5IEHA

Structure of hla-b*40:02 in complex with the phosphorylated endogenous peptide ref(p)skepel
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPAKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-40 alpha chain
publication title Structure of HLA-B*40:02 in complex with the phosphorilated endogenous peptide REFpSKEPEL
rcsb
source organism Homo sapiens
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iehA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5iehA01
1YNLH 4YHPA 2VR9A 4EI5C 3Q0HA 2WUBL 2BXYA 4AIZA 5E7FA 5IB1A 1FNGA 1HDMB 1CQYA 5DSCA 1QSFB 2DF3A 5HJ3A 1L9NA 2EEAA 4F3FA 2AJ3A 2KUTA 2M2DA 3QPQD 2EYSB 2Z91A 4YE4L 4DAGH 3I84A 3V0WH 3BFOA 1IAIH 1JTPA 3B8YA 4PRNB 2VXTH 4P2RE 3MRHB 5DRZB 1FIGH 3S8WA 5GS0L 2VDOL 5D2LE 2BHUA 2VWEE 5KG9A 1P6AB 3FFCB 4DKEL 1EO5A 1JP5A 4FQLL 4G6AC 3WFCH 3L7FB 1JVKA 1BLNA 4FQJH 1R3HA 5T5NF 1W0VA 4Z78A 5GRYA 2FGWH 1ZXQA 3ARWA 1S7WB 3CFEB 5I6XB 4LLMB 4W6XB 2G60H 4NNXA 4YAQB 5DHXB 2OMNA 4OGYH 4KPHL 5H2BA 4WFEE 2F54B 5LGHH 3GK8L 4P2OA 4EZMA 1WJ3A 1U3HD 2DIJA 4NKOB 1UJ3B 5HGHB 1UYWL 4HXAH 4U1JA 1AQKL 4OQTL 1KIQB 3B6SA 3CUPB 3L3OB 4OLVH 1U8NB 3Q2CA 5I8OH 4LBEB 2HJKA 3P9LB 2ZJSH 3NN8A 4Y4HD 5I1IL 4HC1A 2UVEA 4WI5A 2YPLA 3RTQD 5DQDH 3BUYB 2JJSA 4M62H 3RRQA 3NZ8B 4WFHE 1KCSH 1HKFA 2FB4H 1X4XA 1J11A 1RULL 3UZEA 5E8EB 4JKMA 2I60L 3VWKB 2JJVA 1FFOB 3QDJB 5IHLB 5I76A 1NC4A 3IJSA 3FN0L 3TZVA 3UTTE 2QHRH 1AIFB 5EUOF 5ISZD 1BF2A 3LKSA 4XPBL 5D1QA 3BXNA 3IXTA 5IT2L 2AK1L 4N1CA 1J8HD 3HZYB 4LKXA 4PJDA 4M61A 3OJMB 1DUYA 4CGTA 5D2NB 3TBYB 4ZXBA 5EIVA 2FJFA 3RZWA 4X4YB 4CNIB 4MVBC 1OAYL 3RGVD 1B0GA 1MAJA 4KHXL 2X2YA 4KK8C 3K7UA 1J1PL 2EYTA 4IJ3B 1MCOL 2X89D 4JFHE 4W6WB 4WY7L 4XCYA 2VLMD 5DTFB 4JRYE 2NY1B 4XXCC 3TFKA 1GGIH 1Z5LA 1KLGB 1BFVL 1G6RB 1VEMA 1H5BB 2DM7A 3TNNA 4NHUA 5I17A 3WFBH 1FHGA 4L4VB 1T2QL 1MFAH 5FKPB 2R23B 3Q6GL 3CZFB 1PKQB 3KNBA 3HG1A 2UZYB 3X14B 3S97C 2HTKC 1U8QB 2E5EA 3QCTL 4JM2F 3VRIB 4KKLC 3BUTA 5A16B 4HUWA 3L9RA 1F6LL 2ERJC 2AABL 1ITBB 4L4TB 5KVEL 3RDTD 4QGTA 4L8BA 2HT2D 4M1GH 5SWSA 3VJ6A 5IBLC 1A14L 3W0WD 5LVEA 3V8OA 3KPSB 1E4WH 8CGTA 4TYUA 4Q9CA 3LHPH 2YK1L 1V3KA 4PUBH 2LU7A 1S9VB 3O2DH 5FYJL 2Y07L 2XFXA 5CSZB 4DW2H 5HGAA 1CFVH 4OZGE 4ZODA 4F7CA 2NY6B 2QQKH 2GTWA 3SQOL 3BHBA 5E70A 1MCJA 4FTVA 1A6PA 1YY8B 3ES6A 2XPGA 3A67H 3VXOB 1HHGA 1NBVH 4GKZA 2YN5A 1CXHA 3VFRA 4HK0B 4B0MM 3L5WB 4P5KA 4DZ8A 1B3JA 3WD5L 4B50A 3UTPE 1A5FL 4P4KC 5IMKB 5E6ZA 4TSBH 1ORQB 5EO9B 4PBVC 5I73B 2J2ZA 2FZ3B 1U8KB 5FOBA 4MZ3A 1LILA 1NUDA 4DK3A 2X4SA 1IGTB 1C1EH 3MMEB 5TE6L 5TE4H 5FEBA 1MLBA 2GUOB 3B9KD 4F80A 5J1TC 1B4JH 3HC0A 4Y4KA 4M6ML 3QNYB 4KGJA 1AR1C 3E2HB 3F7RA 2B1HL 1QFHA 3LKRB 1XCQA 5IQ7L 4FQ2L 2A1WL 3C5JA 1CGTA 4KKAD 1FV1A 5ILTH 4OLZH 3QIUD 3MV8B 2PYFA 2FR4B 5DRXB 3STLB 2E7LE 5ADOH 3RWDB 1I85A 5GRUL 4KJWD 1YQVH 2YWYA 3EO9H 2D7PA 4FFYH 4ZAKD 3ARUA 2A6KB 2AKRA 2FEDD 4O5LH 5DR5H 4X7FC 4N0CD 2UZIL 3UTQB 2ZUQC 1VFUA 5IR1B 1FVCA 1FH5H 4DGIH 3O9WA 1KGCE 4N8VB 5I30H 3TT3H 4ERSH 4LASH 5EO1A 1UH4A 3GUTB 4I3RL 2JJTA 3BPNC 3SE3C 3D39E 5A2FA 3NPSB 1RUPL 2XKSA 3U9UA 2XICA 3OKDA 4JY4B 4Q9QH 1E28A 3ZL4L 3UJJH 1MHPL 2X4UB 2YRZA 3PL6C 43C9A 1FL3B 4JFPB 4XVJL 1SVCP 2DLEA 3S37H 3NFPB 1AHWA 4URTB 1OAZL 4WV1B 1CXFA 1J87A 3SDXE 3FO2A 4U0QB 4H26A 5I2IA 4PJ5B 3DX9B 4GW5B 4N8CH 4Y5XB 4KAQL 5DO2D 4TVPD 2V5SA 2O5ZH 5FCUH 4OD3L 4FXKB 2DB8A 2ZCLH 3O45A 4APQB 2WWMC 1IQWL 2W38A 5ALBH 5DJDB 4CVXB 1W0WB 1WBYB 3M17A 1CT8B 4QHMB 4BZ1H 1JTTA 3EDKA 3RU8H 3V5KB 2ZWLT 1JPFA 4OZFH 3KS0H 1MCQA 5HDQL 5HYJD 5D7JC 2FBOJ 1JUFB 4LSSH 3GIZH 4QHLB 2OK0H 2FH6A 5F7LB 3SDAD 3HRZB 1UZ8B 2XN9B 5IW6B 5GGVL 4JHAH 4P57B 4ZSOA 4KRPD 1M7DA 1H3GA 3VA6A 1UVQB 1FYTE 1N5AB 4PRDB 2X5PA 2DQGL 3BH9A 1S3KL 4NJAH 3N06B 1D6VH 2YXFA 3IFLH 1OTTC 5EUOA 4G43B 2LE9A 1YUHA 3WNLA 3GSUA 1DEEA 3NVQA 4G7YL 4JDVB 5F44A 3NABH 5EU7E 3HE7B 3LKQB 3ABZA 3ARYA 4HQQH 1A21A 4TPRH 5L88H 2EXWD 3V7MA 1OVZA 1Q1JH 4R0LA 3D18A 3BO8B 3Q1SL 3F6IA 4PRHA 2ZCHL 4XNYH 1DFBL 2A0LC 3IYLW 4S1SH 3DECA 2W59A 3DHMA 3IDJB 2DI7A 5EU6A 4ZTPH 1P4LA 1YEKL 3MNVA 1KN4L 4WW2F 1LK2A 2Z8RA 5E2UL 3M1BB 2YBRB 5IVZA 2VLKA 4YWGH 5DHVH 1HIML 2C4XA 4M43H 1BFOB 5KJRH 1UEMA 5TDNA 1KCGC 5BZWA 2VYRE 1JN6A 4NN6C 1CCZA 1F2QA 4XNXL 2BK8A 1SEBB 2IADA 2E7BA 2YA2A 4FN0A 1U0QA 2DWEA 4WWID 3RPKA 3MLZL 3O3UN 2ICWJ 4QRQB 2VDQH 2ZOKB 2F19H 1H0DB 3Q3GA 5MEQB 2F74A 2B1AH 1BHGA 4JM2A 2H6PA 3ULVH 4OF0A 3ULUD 1BQHG 2I9TA 3QUKB 1D5BA 2NXYB 2R9HD 1O0VA 2WLZA 5HVFB 2FEEL 4U1MB 2UUDK 3QEQA 2F53B 5E24E 5DUBB 1FORH 2G5BA 3FB7A 4X5LA 2KZWA 1I9EA 3CFJB 4JHWL 1S5HA 5DVOA 4Z95L 1A6UL 4K71B 3V0VA 4NDMA 4JN1L 1JPGB 1IEBB 4LLQA 3RZCB 2ITDA 3PWNB 3BYTA 1CK0H 5HHNB 5LCVL 4EI6B 2PR4H 5DC0A 3W39B 5ECJE 2GITA 3JBG7 3PABA 2OJZL 1PSKL 3CIQA 1KTKE 2GJ6A 1YN7A 5HYSG 3LKNA 4HIHA 5J06A 3MRPA 4QRPE 5INDB 5IB5A 1T22A 2C9AA 3HUJE 5D7LB 5FUCE 3K46A 1AKJD 2VAJA 1S9XA 4IRJA 3O4LB 1HOCA 4S10A 4R4FL 2IG2H 2XZZA 3TN0D 4Y89A 3HAEH 4LGPB 5LQBL 4NO2A 3UBXI 1T5XB 1R5VA 3QDMD 3WUWA 2D3VA 4L3ED 5IFHL 5I74C 3SDCA 1DBKL 3UTZB 2J5LB 3VXRE 3VXQA 4ZUUB 1EX0A 1TNNA 3P4MA 4K7PH 3P9MA 4M00A 3D5OF 3KPRE 3QI9B 2A73B 1AE6H 4HIXL 3P0YL 5FA3A 4NSKA 4P2RD 4ZFFA 3V0AC 1W72L 1HXMB 2Q6WB 4HWBA 1IL1B 5TDOB 5D7IE 4MDIB 5GRJL 3O6FD 4WU7A 1R5IB 4PJ9D 4O51A 3BKCH 1I7ZB 2W0KA 1MFNA 3RL1B 4P48A 4KVNL 4F7TB 4GW1B 4AYFA 2CQVA 1FFPA 2Q8BL 3VXSD 3MRKA 2PUQT 3PXHA 1AO7E 3H9SE 1EO8L 1WIOA 5LJYH 4WEUD 4ZUVB 1RZGA 1VESA 1QSEA 3C6LB 1MUJB 2F5AH 3OMZA 5D6DC 2GFBB 2WIIB 3S7GA 5I1HH 2NYYD 1H15B 1LMKA 4NT6A 5DK0B 4YXKL 4JKPL 5I6XC 4K3EL 3IB4A 4FRWA 1TJIL 1K8IA 3EYSL 1XIWD 2AVGA 4WUKH 3H6JA 5CINH 2AQ3A 3QUMA 3F58H 5DHYA 2NTFA 2VLJB 1A7OH 3TJHC 1B6UA 5SX4I 2CRMA 2WWKT 1VFAB 1UJ3C 5HDOA 2JELL 4M6NH 3QFDA 5KANG 3EZJB 3GM8A 2I9LA 1K85A 1BZQK 2PYED 4XB7A 5I1KL 2VUYA 4P3CL 2PN5A 2Y6SD 4U1IA 1C12A 5IBUB 5JLZA 1PEZA 5GZNC 1MRFH 4BSVA 3TF7C 1KCLA 2W0FA 3GFUA 3MLTB 4IOIB 5FYJE 1IGMH 3WFEL 1ZT7B 1G7IB 4NQSB 1BREA 4P5MA 1QBML 3SE4A 4N5EA 1D3CA 1VDGA 2YKLH 3ISWA 3S34H 4MA3B 1ZV5A 4PGCA 2CK0H 5HGDB 2IJ0C 4K8RH 1VEOA 5BS0B 2FJHB 3WHE0 4IS6B 5CKGA 3GMMA 3VWKC 1JHLH 3GMQA 4JR9H 4FXLA 2BNRB 4TVSa 4RDQF 2W9DL 2IANA 3UTTB 4OM0H 4O9HH 3JWDL 2JIXB 4JB9L 2X70B 2QSCL 4AG4H 1R5WB 2BRQA 4G6AD 4UTBL 1IMHC 4M1CC 2EH7H 1WUNT 2ESVE 1S7SB 1OT1A 3IDMA 4JREB 1PLGH 3RX8A 5D2NC 1UB5A 3U4EB 5E0QA 4C54A 3FB5B 5IFJB 2Q8AL 1CICB 2XKNA 3V6FB 1FNFA 1UKTA 3K8LA 4G6JH 1CXLA 4IJ3C 5ETUA 5FGBA 1RHFA 4XCFH 5MP6L 2NY1C 1EGJL 4HKZA 2KQNA 3BZFA 3QDGA 5LAXA 3X17A 4G5ZH 1H5BC 5C0IA 2R4SL 2EDEA 2FEEI 1TJHH 2ZUTA 1SEQH 3L3KB 1H9VA 5GRXG 1TITA 3QP3A 1CXKA 2Z92B 5GIRA 1JV5A 1BQUA 4YHIB 3UAJD 4FQXD 4N0UA 4A2MA 3JUYA 1DSFH 2OBGA 5T3ZL 2DLTA 2R4RL 1NGZB 3D0LA 5JXEA 2ZSWB 4NFCA 4ELME 1ACYL 4I0PB 3H9ZA 5I1JL 4CMHB 5C07B 1Q0XL 4YUEH 3EYUH 3NH7L 4GAJL 1CGSL 1G0XA 3CLFH 5FDWB 2QEJA 5F8RC 1MIMH 5DD6A 5BOPA 3HE6B 3KYMA 1V3LA 4MSWA 4G59A 4UILH 1WZ1L 3AAZA 4C4KT 4HS6B 1I9RH 5KSBA 3OPZL 3AU1B 4FXGA 1RUKH 4ZYKB 3T08A 4D9RD 4TNVF 3NIDF 4OZGB 3R06B 4HDIA 3ARVA 3QEUB 2NY6C 3MRCA 4FFWC 4GRMB 1I75A 4H0GA 4KK8D 4OSUL 5E95B 1IGJA 2ARJB 1EZVY 5F89B 3MUZ1 4RFOH 5BW7C 5SWQB 1T0NB 3G6DL 1X7QA 3CMGA 1RZ8B 4RGOH 3RVUC 3MLWL 3BH8B 3S35H 4ESKA 5C0NC 5HGBB 4F9PA 4UZGA 5I73C 3MLSH 4JJHA 5CCKH 1P7QD 4X4ME 3S37X 3THMH 2VL5B 2Q76B 3KLSA 3DETC 1DBBL 1UADC 3E3QA 5C09B 1RVFH 4P2QE 5IHUH 4KKLD 5CHNA 3VFNB 3ECBB 3H7BA 3L3GA 5JQ6H 1A4KB 3CCHA 2APVA 3E2HC 4HT1H 1FAKT 1D5ZB 1YEJH 3V4VH 4Y4HA 5FV1L 1G7JB 1YNTB 3ROLB 2H32B 2AEWA 3QEGL 4WJ5B 1FZJB 4RAVB 2PCPB 5CIPH 2A83B 5C08D 3RTQA 1TTFA 3ALXA 4JRXE 4POUB 4DKFH 2K9UA 3T8XB 1MRDL 1ZHKA 3LDBB 1AC6A 3FQXB 5GGTL 5MERA 1UWGH 1YMHB 5ANME 2WMPA 2B7DT 3T0DA 1P84J 4F7MB 2RGSA 2RB8A 3U0TA 1J86A 4G8GD 5C0DA 4Z77A 5IV2B 4QHNB 1FNSL 2FX8L 1JPST 1JJUA 1KELH 2EDHA 5DUPH 3CU1A 1JPTH 2C3GA 4E0RB 4HUXB 5ISZA 1ZT4B 1IFHL 1C08B 1IC7L 5I1LA 1FGNL 2AJUH 3D9AH 4KUZH 2DQJH 1LP9E 3NPSC 3ZKND 5DT1H 1CXIA 1WWWX 1J8HA 4NC1C 1TTUA 2EC8A 2CDFA 1DANT 3PWJB 4RFEA 3L3JB 2E6QA 3TWCH 2XY2A 3U0WH 3O3DA 1J12A 1MCPL 1YDPB 2BVPA 4UQ3A 5ITBH 1GZPA 4UV4L 3RGVA 3MCLH 4O02L 4WV1C 3SDXB 3TP4A 5I1CH 1FAIL 2X89A 4Y5XC 4RIRA 1S78D 1WISA 4XBGB 5D1ZD 5F96H 1NAMB 1AR1D 4ALAH 4APQC 1V8HA 4RISL 4MMZC 2MWCA 2XRAH 3GJEB 3H3KA 5D72H 2H2PD 5H37G 1YMMB 5ADPH 3TO4D 1CL7L 1G0DA 4NQEB 3QNXB 5HHME 5HI5C 5EORH 4AT6B 1J0YA 2Z31C 1DDHA 4MJID 4H25A 3MTRA 3V4PL 1EPFA 4L9LB 2XI9A 1AH1A 2VXVH 5C0EA 5D7SH 5J9PA 3LS5H 3RDTA 3WIHA 1NCUA 2CR3A 4PJCF 4XP5H 3VA2C 4MCZB 5EZJB 5EBMA 3PUCA 4K3HA 2ATPB 7FABH 1RFDL 2IFGA 4OUUA 3W0WA 3EOYG 2CKBH 1IEHA 2J8UF 3BP7B 1V05A 4MQ7B 3VFSB 4IOSD 3HE7C 4RMRA 3TNMB 2P7TA 3DI2B 4UQ2A 1FN4A 3CLEL 4PJAA 4EBQL 3PL6D 5I1GL 5E99L 2ADIB 3B8SA 1X5GA 4ZFZB 4AL8L 4G9DA 1BX2A 5IB3B 4GBXB 1T1ZB 4LK4A 2FHBA 5B38G 4BZ2L 2ZG2A 1BVLB 3IJHA 1KG0B 3MXVL 5GJSL 4PJ8B 2FIKB 1K3IA 3ERYA 5IOPB 1NGWA 2WWMD 4ZMAT 3P4OA 3ARZA 5I16A 4JQVC 1IGIH 3ZTJG 3SO3C 4HIEA 4FP8H 4KH2A 2VR4A 1MCEA 3QUXD 5D7JD 3WNPA 1SYSB 5GGRY 4LQFH 3SHSA 4XNQB 2GK0A 5I1EL 4N5UA 5E08H 1DLHB 1CLOL 2XG5A 3B9KA 4AENA 5JW4N 3OJ2C 3ZYIA 1Z9MA 3WFHB 1CFBA 1N3NB 1JMZA 1MQKL 4MJ2A 1HH6A 2NXYC 5DJ6A 4K7PX 4PV9B 5FB8B 3BJ91 2VZUA 2DS4A 4LU5H 2A74A 5F7FA 3QIUA 4IEFB 3BRFA 4LDEB 1F8TH 2CXKA 3JVGA 4ODHH 4RQQA 1I9JL 3WDHA 2C26A 2VXSL 3RZCC 5CSGA 1JWUB 2Q7YB 3ZDYE 1VKXB 3TBWB 5TDPA 3O41B 2A0LD 5K59E 1LO5A 5HHXH 2AGJL 3TIDA 3HFML 2XKUA 5JHLH 5DEGB 4P23C 1ZEAL 4OV5B 4QRPB 4GG6F 3HUJB 5C7XH 5HI3D 3A6OA 5MEND 1MLCA 1TZHB 1RZ7H 4Y2DB 5KSVA 3VFWB 5L6YH 4X9HA 3KGRA 4U6VL 1YA5A 1DVFD 4JPIB 3RIFK 2PXYB 5FUZH 1Q38A 3EO1B 3RNKA 3RX5A 3TH2T 1F58H 1AP2A 2J5LC 1L8JA 2X44D 2NY2D 1DUZA 2I26N 2EDJA 2IH3A 4OLXL 2Q87A 3KPRB 5JOFA 4NM8H 5F88A 2EIEA 3T4YB 4LLVA 5HYJA 3FTGA 4Q58C 3MCKB 3PGCA 5D7IB 1YYLH 3QHZH 4EN3B 2NXZB 5I75C 2FX9H 1MY7A 3O11A 5CEYB 3SDAA 3VMPA 1YPZE 5I66A 4X8JA 1XF2A 4POZD 4Y1AD 2XWJA 5BVJB 1E4XH 4D9QD 4W4NA 2VWEC 1VENA 1FE8L 1NJ9A 1AO7B 4PGDA 1NCBH 4HG4K 4QRSB 2E27H 1HCVA 4G6ML 1S7RA 2HG5B 3MRIA 5C0CA 3C6LC 5DMIL 2B2XH 5DURB 4M7LL 2WBWB 1JWMA 4OCNC 4YX2H 3A6BL 1LO4L 4A6YA 4PRPD 1YNLL 4JGMA 3Q6FB 4ODSH 4Q6IB 5K33A 2HKHL 3QIBB 4JE4B 4OLWL 4RA3A 2ZUSA 1CL7I 4D8PA 4PJEE 3V6OE 2X4QA 2NCMA 5FYJD 3BQUB 1FPTL 4KJPC 3HMWH 4R3SA 3GIVB 3EJJX 5CMAA 1IAIL 5F1IA 4PLNC 1LEGB 2H1PL 3GSWA 1BFSA 3AVEA 3S36H 4JZNA 2IQ9H 2Y1VA 5DJ0B 2DIAA 3SKMB 2CLVA 3D25B 4DKAA 5SV3A 1JGLH 1KULA 3TEUA 2NX5D 1MREH 5CZXD 2MFNA 3ZDZE 1AI1L 2ZNXA 2Y25A 1XGYH 1QRNB 1NMAH 4MXVE 1BIIB 2EYRB 3KR3L 4OZIF 5HHOE 2BCKB 5EO0B 4Z7OE 3BP6A 5T33H 2M26A 4YDKH 1FVDB 3I75A 1WC7B 1BQLH 4PY8J 4RNRA 1K5NB 1I8MB 4I48A 4ZPVB 3ILPB 5KBNC 3OG4B 4YHYC 5EZOH 5ICYB 4OBSA 2P8PB 3V9FA 1A7BA 1U9KA 1OARH 3U79A 4KZDH 1ZHNA 3KAAA 2PW1B 4K94H 4PJCA 4H5SB 3ZE2E 4ZFOL 1A1NA 2IBBA 4HMEA 4QTIL 1MWAL 5I8OL 4NKQB 4EEEA 1E27A 2VJXA 3ZTNL 3OKNB 1KNOA 1EJ6A 5EG6C 4JREC 1ZGLA 3VH8A 4LDOB 4TSAL 2WINA 4KKCD 5HYIA 1CICC 1I1AB 4LVHB 1NBZB 4G80B 1FO0H 4OAWA 5DJYA 4WO4C 1EH9A 3TJHD 2R0ZH 3LEXB 1UWEL 5FO9B 4ZOBA 2KL6A 3TPUA 3HZVA 4YPGB 3EDDA 3RIAF 4XH2B 5CSBA 1DBJH 3VFUA 3QO0B 4DCQB 3ZT6A 2GW5A 4YHNB 1AKJA 3S35X 1JHKH 1QTYT 2IAMD 4EQ2A 1XCTA 5C1MB 5H37H 2DL9A 5L8KB 1PJ9A 3ESUF 3SGEH 4M1DH 1U8IB 3MJ9A 3TN0A 1NCDL 2F5BL 1CFTA 4RSVA 2DWDB 2AV1B 3QDMA 1QKZL 3BAEH 4L3EA 2SEBA 2LV4A 2XZCH 2O61B 1Q9OB 3LPGA 4I0PC 1T4KB 4RAHA 1WITA 4WHTA 4XNMB 3GMNB 4Q0XL 4LKCB 1IJ9A 4E42A 3ZHDA 1NDGB 4CMHC 4NN5B 1CFSB 1I8KB 1K8DB 3GGWB 5LG1A 1D9KB 3RWGA 1NBYA 3CSYB 2FJGA 2A77L 4HWZB 3DMMB 1F6AA 5BJTA 3FOLB 3BT2H 3RVVD 1U3JA 4P2RA 4MXQA 3D1MC 2DM2A 1AGEB 5D2LA 3HE6C 4Y5VB 1XR9A 2IH1A 4MNGE 4M1CD 4CL7A 3L5HA 3O6FA 2GSIA 4O2EB 1IM3B 1OP3K 3KYKL 2AP2A 3ZE0F 4PJ9A 4JFDD 3CFCL 2YOCA 2ZUVA 4G9FB 4LLYB 4QHUA 4XMPH 5DMKB 1LE5B 3NA9H 1ADQA 3EYVB 1YNKH 4CN4A 3WDIA 4RFNB 5ESQB 5DA4A 1DBMH 4FZEL 1N7ML 2CIKA 3GMOA 4WIQA 3D6GA 4NFBA 1Q9KB 2ZOLB 3TYFA 1KFAL 4X6DF 2NY1D 1JGUL 1KN2L 3WKNA 5DVLA 4ETQB 4WFFD 5F1KC 4GG6A 1IEAB 2GT9B 4XPFH 5JW4Q 5DHVB 4DN3H 4LLWB 1GH7A 2O93L 1XIWA 2DOCA 3HNVH 3ZTJH 3HC3H 4ONHA 4TTDD 1RI8A 4LSUH 3VWJD 1B0RB 4H88L 3IFOA 2QTEA 4DVBA 4GAYA 4LRNH 2OR7A 4M5YL 3OKKA 1ZLSH 4PUBL 5KVDL 2ZKHL 3SKJH 5E56A 4ODUA 4C57C 4M6OH 1OL0A 2PYEA 5T5NG 2BY3A 2QQKL 3BZ4B 3V4UL 4L4TD 2P5WD 3DJ9A 2VLLB 3A67L 5JIHA 1NBVL 3R1GL 3IXAA 5AD0A 2E7LC 1KJ2A 1CDBA 3MLXH 3KPSD 3LDBC 5ANMB 2W92A 1BBJB 4KVCH 4OLYH 2BJMH 3HMXH 4WUUB 5DA0B 4L8CB 2IPKB 1LK3H 2BVUA 4LLUA 2V7HB 3KPMA 4LCWE 3EOBA 3F7QA 4XTRC 4OIIH 3QQ4A 1A7QH 2NY6D 5T1KD 2EIZA 2O5XL 5F7YC 4LCIH 5E2VL 4FFWD 5CP7B 32C2B 4FA8A 1LP9B 1IAII 3ZKMC 2WIMA 1L7IL 4GJTB 1CIUA 4JLRA 4LCCC 4KI5C 1I7UA 1IAKA 3MRDB 3OHXA 3QULA 1G7HA 2CKNA 1RK0A 2PO6D 3O4OB 5TH2B 3RVUD 2DTSA 2RCSL 5FUOH 3N9GL 4JRYA 1I1FB 4EOWH 1XH3A 5C0ND 4OT1H 4NUGL 5F7MC 5C3TA 3TH3T 3QH3B 4D94A 1YQVL 4KUCF 4PJGE 4U1HB 3VGDA 2VQ1B 2YC1A 3DETD 2YWZA 4XC1H 3PIQA 5DQJA 5B39A 1KB9K 4R4BA 3LS4H 4JPKL 3TESA 1YEDA 3NIGF 4J8RA 5FHAL 1NLDH 2XZQL 5FF6A 3IU3A 1F4YL 1I7RB 5C0BE 2J8HA 2GJZA 4PTTB 3ARBB 1DQJB 4C56E 1EEUA 4M03A 4FQXA 2CO7B 2B4CH 2VXQH 3GMLB 4MD5B 4XP9L 4L9LC 5KN5B 5DEFB 1KSRA 5E5UB 1D5XA 1F13A 4HV8A 3UZQA 1U8LA 4HC1H 1P6FA 4UIKL 2VERN 1HHJB 1SYVB 1UXWA 4X6FA 1OGTA 3I85A 2QBWA 1QBBA 4N9OB 4D0BA 3SGKA 4IDJL 5EU7C 4KK6C 1R3LA 2R2BA 5J6GA 2DQFB 4NUJA 3MA9L 1WAAE 4HWEL 4NBXB 4GLRI 1R3KA 1T7YA 5C70A 1WT5C 1X5JA 4KRNA 4U3HA 1WBXB 5EOTA 2DKSA 4GRLB 3GSXB 3SOBL 3LKOB 1P2CA 4GBXC 3BGMA 2DBLH 4HLZG 5SX5H 1MHHA 3UTOA 3BWAB 4JFFE 1LO3H 3MJGX 2GTZA 1OAUH 1BM3H 3MLUH 3LPWA 3RY6C 4PJ8C 3EIFA 1MJ7H 4Q2ZA 4U31A 3RPIB 3STBA 5CJQH 2NLJB 3DUSA 1C5BH 4QTHB 3IFLL 4U2ZA 5KZCB 3EO0A 5I19L 4UIMB 2AXFB 3JV4A 1P7QA 3NABL 3QCVH 1I3GH 4OCXH 3IKKA 1TCRA 3MGTB 5HI5D 4TPRL 5L88L 4R8WH 2GEEA 2Z31D 4UT6H 3GHEL 1MI5B 4GAGL 1QBLL 2DLFH 2ZG1A 3BP5A 4JG0H 4XNYL 3P73B 1R3JA 3UXFA 3MREA 1OGAE 3G6JE 3WSQH 4HJJH 1T6VN 3WBDA 3CXHJ 4P59L 1CGUA 1QHOA 2IGFL 3K1DA 1INQA 5C08A 2PW2A 4HK3J 3JUZA 3PWPB 2P43B 1ORSA 1A6TA 4YWGL 3WUZA 3HLAB 3WUWG 2HKFH 1W8NA 1HQ4B 2OL3B 4PP8C 1KJVA 1EHAA 5K9QI 3HE7D 1TQBB 1WCQA 1ZA6B 5FYLD 3CFKA 2BVQA 4NZTL 3RNQA 3KPTA 3D39A 5CBEA 4G8GA 3GMPB 4NWUH 3QXAA 5GS2H 4NCDA 3CJJA 4R26L 2F19L 4DGYL 4Z7WF 2X9WA 1LEIB 2CLRB 1FBIL 4Y4FC 5IB2A 4G6KL 5TGBA 3OR7B 5L0QB 3KPQB 5GISH 3KG5A 3REVB 1HHKA 4PJBF 2QR0B 4X6DA 5DRWA 3FCTA 3IU4H 1IZJA 2R0KH 4Y2DC 4TUOB 5D1XD 3OKEB 1KB5A 4NQDE 3KPNA 2R69H 3F7VA 1AGFB 2MCPH 4WI3A 3MOQA 4Z7VE 4XCEA 3MODL 2PXYC 1SJEB 4P2CG 1DQQA 1MFEL 5I1AB 5LGJA 3OF6D 1JNLH 3MRMA 3IAGC 5J6HB 1GYAA 4HZAA 1TJGL 1OTSD 3D69A 5D1ZA 3FT2A 3CC5B 2L4OA 1N5YH 3E6HB 5L2KB 1I8LA 4OFPA 4IBLT 1NL0L 5CZKA 3ARPA 3FHAA 1JGEB 2Q20A 3BYYA 3TO4A 3WHXA 3L95B 3FO1B 3HCVA 4EN3C 1I1YA 2NXZC 3RAJL 4JFOA 2MPAH 5IB4A 4IRSB 1RAMA 2ORBL 5JZ7C 2IG2L 5ICZB 3QZWA 3PGFL 3DV4B 3FQWB 5T3ZD 4LVEA 1GOGA 4PJ7F 3MV9E 1HHHA 4NZUL 4V2BA 3CFIC 5C9JB 3G04B 5IVXE 4YO0B 43CAA 5IMMB 1PYWA 5CUSL 1CVSC 1G6VK 4O58H 1I9IL 4P23D 5CJOL 5EOCL 1KPUA 5EUKB 4HKBA 5AUMA 3UYRL 1ZHLB 2WUCH 3DIFB 3QCUH 4Q6IC 3PL6A 3QIBC 3UPRA 2O26U 1AFVH 2EKJA 3PJSA 4PJEB 3K80A 1MJ8L 3BQUC 2BNUA 1T7WA 4X6EA 5E8PB 3ARDD 1YN6B 4HFUH 1EAPB 4R90L 1S7XB 5ESAB 3HHRB 4KTEH 1LO0H 3S3SA 4XCNB 5JPNA 2R2EB 1BQHB 3NAAH 4KROB 2UYLA 2F5AL 1ZVSA 3VCLA 3VGEA 1D5MB 1UM6H 5DJAA 3MNZB 3QUXA 4G42B 5D7JA 4EIGB 4PLJD 5HHOB 3WE6A 1BJMA 3QXWA 4TOYH 5GGSB 4GG8B 1CDCA 1JI2A 3HA0A 4GAFB 4IMLA 1NCCH 3F58L 2CR6A 1KCUL 3BX7C 4MD4B 2FD6H 4NQCB 4BFGA 1A7OL 1KBGH 4S1QH 1NGXA 3MLPA 2JCCE 3OX8A 1CN4A 4E5XB 3ARFB 3U6RB 1SVZA 2JB5L 4OQTA 1CG9B 3OB0H 4GRWE 3MRFB 2VABA 2QSTA 1F3RB 2WNGA 3C6LD 5K9KA 2OXGA 1MRFL 5J89A 4HH9B 2AJXH 4HEPG 3F5WA 1X4YA 5HYSB 4JFZH 4K3JH 5CJXC 4JN2A 4XVUD 1WIPA 4WNQB 1KLUA 4LVHC 1JK8B 3IKCA 3T65B 5EU3A 2YKLL 1TZGH 3WIFB 2EDDA 2NQCA 3JWNC 2VLJD 4BFIA 4K8RL 4NO3A 1MF2H 4KJPD 5J1SC 1I3RA 5HHQA 1CU4L 5LXGH 4MWFA 5IW3A 4JDTH 1NPUA 4Z7UF 5TFSH 1C7TA 1DQDL 4AM0A 3VXRA 5MENA 4OZ4B 1KCKA 4K3DH 2Y7QB 1FVEB 3ZKSD 4BSJA 4ZOAA 1DVFA 2VZTA 25C8H 4H0HB 1ZHBA 3DROB 5D5MB 3P11H 1GGBL 3OAUH 1Q72L 2VDKH 5HD8D 1PLGL 5BS0D 2QADB 2C1OA 5DK2A 2IPTH 3LN5A 3PDOA 2R1WA 5F6HI 3EOTH 3CGTA 4NN5C 4RX4D 3BEWA 2BNRD 1WIUA 3F62A 5MEOB 1QFOA 4HS8L 3DMMC 3MA7A 3OAYH 3G5ZB 3BP4A 3FHQA 2ZSVB 1EFXB 4KK9D 1FC1A 1WCBB 1MHCA 4MNGB 4RRPA 3O0RH 1A9EB 2YPLE 4Y5VC 5JHDD 3H9SA 4O2FA 2CKBB 5E2WL 2CLZA 1QLFA 1E6JL 1L0YA 5CP3A 1F02I 1GL4B 4E41E 5T3XL 1BPVA 3BN9C 1WEJH 5C3LD 4ZDHA 3RHWK 4Y1AA 1CLZH 5F71A 1BOGA 1FZMB 2FBJH 1DSFL 5A43C 4I4WB 5L9DL 3T3PE 4OTXH 4RFNC 4WO4D 4LSPH 1YEFH 4JFQA 4CADB 4P4RA 4Z7WA 3MXWH 2CIIA 2LFGA 2V5TA 4G8IB 3AGVA 2RJMA 2R0LH 3EYUL 4HXBH 3W81A 3SE8H 4PD4K 4XWGH 4PJBA 4PRPA 1HYSC 3BGFB 3WKML 4PJDE 2WBJA 1S7TA 4IM8A 2J6EH 3MO1A 4NFDA 5EC2A 2G2RB 4WHYG 3MUHL 1FFNA 5CEXA 4UTAH 3ROOB 2YN3A 5TPWH 1IM9B 4HWBL 1WFUA 2APFA 5DI8A 1NGPL 4NNYB 5F7DB 3CVHH 4PFEA 3DVNB 3ULVC 5C07D 3FO0L 4Q6YA 4YXHH 1TZIA 4P46A 1LD9A 5I8KL 4EVNA 1AR2A 4NKDA 2NX5A 4MJ6B 1N6QL 1UCBH 3BPOB 4OFKA 1YC8A 2N56A 1KC5H 4IIQB 4NHUE 3AS0A 1OSZA 3VFMB 1CFNA 2CDEB 4M02A 5EZLB 2VQTA 3IFPA 3FQRA 3GI8H 1XF4A 4JDZB 4MQTB 2VSCA 5CCKL 1LNUB 2XWTB 1EDQA 4AEIH 3A0OA 4DKDC 2VZVA 4PJ7A 3QUML 5C0AD 2HRPL 1RZKH 1MCRA 4XVTH 4WTZA 1ACZA 3L7FA 1T5WA 1T83C 5AYQA 5EN2A 5SWSE 1G7QB 4CDHA 3KPPA 15C8H 3O4OC 1Z6JT 5MI0B 3C5ZD 3MFFA 3GJFK 1BZ9A 3UBXA 1IC1A 3H42H 3MBXH 3D0VB 4PGJA 4PJGB 2VAAA 4JFED 4IRZL 4QF1A 5CFHA 4WGWB 5ENWB 3FQTB 3KLAB 2ENSA 5EBLB 1EA9C 3GKWL 1HEZA 2VQUA 4Z0BH 4ZS7H 5L2JB 4TUJA 4L3AA 1G1YA 1T3FB 3SGDH 2IALB 1OP5K 1JCKA 4OB5H 2KQMA 1KELL 1MVFA 4F33B 1JPTL 1M6OB 1S5IH 5FYKL 1DTUA 1NSNH 4ELMA 2IAMA 3TF7A 5C0BB 3JTCA 1NKOA 4NM4L 1QEWB 3GSRA 1N8ZA 4C56B 3ARBC 3NZ8A 3I6KB 2A6IB 2OTPA 4MDJB 1UXSB 1HSBB 4UT7L 4U1KA 2GKIA 1C5CH 3TH4T 3FKUS 5TQ2H 4NPYB 3E6FA 4HULB 3MCLL 4I9WD 1OLLA 1JNHA 2B0SH 1QNZL 4K07A 3RWJB 1QFPA 1KPRB 3CSPA 3HI6L 3CH1B 3MACH 1AIFA 4GUPB 3K3QA 4PJFA 2BNQD 3VE0A 2Y06L 2I07B 3UO1H 4KI5D 5HDBE 1DN0B 2BY2A 2X1QA 3B4NA 3NCEB 2X4OA 4JFDA 5ADPL 4L8SA 3TBYA 3QXUA 1TVDA 1A3LL 3CFBA 5HY9B 4GRLC 1Y6NR 2YD9A 3L1OH 3H0TB 4QRTA 2X42A 2V2TB 3PF2A 1IGFH 2XXMB 4X4MA 3W2DH 1WBZB 4R4NC 1AY1H 5E2TH 4QOKB 3U1SL 2BSSB 2E3VA 5T1MB 2EDWA 1NDMB 1H5BA 4Z7UA 7FABL 2PTTA 4ZD3L 2XA8L 4LLDA 1YMMD 2O5YH 4Z76B 3VWJA 5CZVL 2CRZA 1I3VA 3HS0B 5J7CC 4JO1H 4FFEX 1KXVC 1PKQA 4NQED 4L8DA 4WI8A 3SQBA 4JRXA 2X4PA 2ZCKH 1WWCA 4D2NA 1KEML 1OGAB 3OXRA 2W9EL 2YPVH 4L4TA 2H41A 2P5WA 2F58H 2X4RB 4N0YL 4OFYD 4KGLA 1WV7T 4OCLC 3HTLX 1K9TA 2FATH 3BIKB 2ITCB 2JK5A 4LARH 4U6XB 4I77H 5JW4M 2JF1A 3QUYB 1D7FA 3CSBA 4KK6D 2APBA 3LEVH 4OGXH 1RURH 1NGQL 1AXSB 2CGRH 2ZG3A 3MLRH 5SV4A 4ZUWB 4NRZB 4ZSOE 1QR4A 4HIIB 5T1KA 4D0CA 3WFZA 3LMJL 4GBXD 4DOHE 1KT2B 4N1HB 4ODVH 3VXOA 4NQDD 2DYPB 4DFHA 1FO0B 2Z35B 2F8VA 4S0TD 4POYA 5L0QC 1MFDH 1ZS8B 5IMOA 3WLBB 1AJ7H 3KPLB 3HNSH 3MRQB 1J8KA 3CFDB 3L3DA 4PJ8D 3PWUB 5EUOE 1RMFL 2PO6A 4TN9A 3RY5A 1HE7A 3RI5K 3SBWA 4JAMB 2APXA 4WCYL 5MEPB 1AGDB 4Z7VB 2FZ3A 4X5XA 2C3WA 1X5KA 1FC2D 1C5DA 2R15A 5FM8A 5CD3A 4PRHE 4ZFOB 1DBAH 5AG8A 2R8SH 5BOZG 2OQJA 1YEHL 4IOFD 5EU6E 5F3HA 5EU4A 3V5HB 3GMRA 4YHZH 4XAWH 2GSGB 5HHMA 1S9WB 3QNYA 4YH6A 3ZKXB 3RJDA 1GVIA 2AXGB 4KFZC 1QZ1A 2VLKE 3DVFA 4I3SH 1A6AA 1A02N 2G9HB 1VACB 1RV6X 2HTLD 3NTCL 3MRGB 1FNLA 1OP9A 3WL9A 1K4DB 1EEQA 3F12B 5JORA 3DOSA 3Q5TA 4IHOA 1JNJA 4AEHL 4IRSC 2A6JB 1CDYA 2QKIA 3L6FA 5E00B 4MA8L 3MV9B 3FJTA 4CVZB 3OXSB 4FQ1H 5IVXB 4L5FH 2HFEB 2VUOA 5F3BB 4PP1C 5DMYA 4Y4FD 1A2YB 1XR8B 4C59B 2DBJA 3TVMB 5B38B 4WDIB 4LFHD 1OAKH 2EKSB 1T1WB 3AREB 2WW8A 2ATKB 1H3VA 2XQBL 1W72A 4QRUA 2KH2B 5IIEA 1ITCA 3OJDB 5GGUB 3X13A 4CMMB 3V6OC 3BW9A 5D8JL 5E6IB 4OFDA 3QEHB 5IJVA 5EFIB 2DAVA 2BXZA 3NFPA 2PXYD 4WHYH 5E5MB 3B2VH 4HIJA 4ONGH 2XNAA 2W1NA 2FIRT 2M8XA 1E4XL 1U8JA 3D85B 3VH8G 2COQA 2XA3A 3NCYS 2GJ6E 1J10A 3W82A 3UPCA 4JQXA 4AQOA 1YEEL 3K74B 5T3XE 5C0FA 4KROC 2BZDA 2NY0C 3V5KA 3BPLC 2V7NA 3RWEA 5IK3A 3TLRA 2XY1A 4P5TB 1QFWH 4YX2L 8FABB 1G84A 4YDJB 4EN3D 2OSLA 5IWLC 3H9HB 3TCLA 2VC2H 2V9RA 4YHKL 2Z31A 2NPLX 4X4XB 1UZ8A 5KAQF 4HPOH 2JCCB 4UB0H 3NA4A 5FM5O 1N59A 3ARFC 5CGMA 1W8OA 5JR1L 2YD7A 3CXDH 4N68A 4UBDC 2J4WH 1INEL 4YHPB 3S36L 3DYOA 1X44A 4QWWC 5DURD 1A6ZA 4AIZB 1MFCH 3JWOL 5IB1B 1FNGB 2HN7A 1TETH 5DSCB 1MREL 5HJ3B 1KYOJ 1EHNA 2Q3ZA 4F3FB 2AJ3B 4QY8A 3WIHH 4FQIL 1WLHA 1A1MB 4DGVL 1TQCB 3TYGL 1YJDL 5KTEL 4ODTL 4NN7B 5T33L 4JANA 4KQ4L 5CEZL 5KG9B 4MQXD 1CDUA 4F57H 5DEZA 2CD0A 1U42A 1BLNB 1TVBA 1R3HB 2IF7A 1W0VB 2DMCA 3P0VH 3DVIA 1OARL 2VLRE 7CGTA 1QSEE 3NFNA 4K94L 1ZLWK 4LPYA 2Z0BA 4J4PC 1F2XK 1GGTA 5D1XA 4M5ZH 1Y6KR 2N1KA 4NNXB 2XTJD 4OM1L 4XGZA 1SBBA 4M48H 1EXUA 1U6AL 4ISVA 3FONA 3PV6A 5FIEA 5H2BB 1RIUL 3OF6A 4KKNA 2V17H 3ARRA 1I8IA 4R97C 2ZOKA 2QADC 1FQ9C 4P2OB 4EKXA 4RMUA 1GC1H 5MEQA 4U1JB 4KJYA 3CDFA 4W4OC 3B6SB 5I1DA 2P49B 1NGYA 3LZFL 2HJKB 2R0ZL 5A1AA 3NN8B 3VD7A 5ELIA 5D93B 1EGJA 2IEPA 3U46B 1DLFH 1XGPA 2YPLB 2EDYA 1CLYH 1VFOA 1MCIA 1JHKL 4OV6F 1F97A 2AJYL 4QCIA 3QR2A 1A7NH 3WYRA 3BAEL 3OJVC 1JF1A 5I76B 1NC4B 3IJSB 3TT1H 2NY7L 4OCRH 4HZLA 4PBXA 3TZVB 1GHFL 2IANE 4OGAC 3LKSB 1CF8L 4WTXA 1QA9A 4JJ5B 4P23A 1YECL 2D4DA 5D1QB 4CVUA 3BXNB 3IXTB 5KVGH 3UMTA 4MJ4A 1UC6A 3BT2L 3BGFC 4LKXB 4PJDB 4M61B 1DUYB 4ZXBB 5IUSA 2FJFB 3OGCA 3I9GL 4K2UL 4KKBC 1EEZA 1N2RA 4DTGL 4DUXA 3FFDA 4ODXA 1B0GB 4NQUA 3GHBH 2R2CA 2G5RA 5F9AC 4WW1A 2EYTB 3BDYL 4GW4A 2HFTA 4LSRH 3UTZA 3ARDA 5K9OA 4XMPL 3QG7L 4XCYB 3UTSB 4U3XA 2ADFH 1Z5LB 5DLML 4TUKH 3BPOC 3QDGE 4JO2H 3TNNB 3NBNA 4NHUB 5I17B 1QG3A 4IIQC 5DD0H 5B39G 1HXMA 1DL7H 3DBXA 2OP4H 3KNBB 3HG1B 4KWUA 3HR5A 1ZT1A 4CU6A 1WWBX 1X9QA 4N0UE 4TVPH 4LSUL 1WZKA 2RQ8A 3L9RB 4HUWB 4A6YL 4XP6L 1RJCA 4G9FD 5TF0A 5DZNA 2YD2A 1UA6H 3GNMH 5A40E 5JQHC 3BD4A 5I9QB 3HI5L 5GS3A 1P9MA 4L8BB 1CQKA 3QO1A 4ZUVA 5SWSB 2Z93A 4L3CA 4RMTA 3VJ6B 4KI5F 3C6LA 1E4XI 1ZOXA 1F90H 3DNKA 2WIIA 4LMQE 4XBEH 4FFVD 5GJTH 3T0EE 3TA3D 5MI0C 1CZ8H 4XP1L 4PGZA 1WGOA 1TCMA 1J0JA 2HFGH 4HMDA 5DMGC 3UC0L 1HYSD 4Z7QF 1VHPA 3BKMH 5GGTA 5KSBE 2F8OA 2XFXB 3AROA 1HINL 4CN6A 2VLJA 5HGAB 4OLYL 2BJML 4F7CB 1TFHA 3KJ6H 5D70H 2GTWB 3BHBB 3OKMA 1G9NL 1EMTH 4FTVB 3QPXL 3ES6B 4J6RH 3L3HB 2XPGB 2DQUH 2H3NA 4OIIL 4GKZB 2H8PA 1U93A 3T2PA 3VFRB 5FXCH 2BY1A 2CRYA 3HC4L 4P5KB 4DZ8B 1M71A 4XP4L 3ULVD 3N1GC 4P9HH 1WQVT 2DQTH 3MLTA 2F8XC 1CD0A 4XC3H 4AZ8A 4X80L 5CGYC 2X6MA 5L7XH 1MIEL 3G5VA 2X4SB 4MZ2A 4WUUD 5BS0A 3MFGB 4MJ5A 5EB9A 1MLBB 3E3QE 1XGRA 4RX4A 3HC0B 4XPGH 4Y4KB 4GKOA 1AD0A 3L5XH 2PNDA 1B2WH 2DI8A 2VMFA 3P2TA 1ZANH 2VDRH 1XCQB 3DURA 3C5JB 1UT9A 4LPWA 1FV1B 3L3IA 2PYFB 3MOAL 5JHDA 4ORZC 3B83A 4LRIA 2C7UA 2UWEA 3ULUH 3CX5K 4K9EH 2AS5M 1GGCH 4TSCH 5IEHB 4H1LA 3GBNH 4FQHA 4M4RA 5IHZA 3ARGD 4WO4A 1DQMH 3GBMH 1FVCB 4FNLH 3O9WB 4LIQH 5EO1B 1JPSL 4RGNE 5ISZE 3CX5J 1NFDF 4G3YH 4MLSA 3U9UB 3PHQA 2GK2A 2IFFH 3OKDB 1J8HE 1E28B 5AYUL 5FO7A 3K4DA 4PJXA 43C9B 1SY6H 3O3EA 5J13B 5F1NA 5JXAH 3MV7D 1AHWB 5EOCJ 3FO2B 5IGXH 4H26B 3SGEI 5C6WH 5BZDA 5I2IB 2LTQC 3HN3A 4EDWL 3REWA 5DUMH 2MCG1 5HPMA 4YQXL 1OB1A 3KLDA 5C07A 5DGRA 2VLME 3OKOA 4EDXA 3O45B 4F8QA 4LCWA 1IGCH 4FG6C 4YZFE 3MJ9H 3K4AA 3M17B 4JQIH 5C8JA 4J3SA 1JPFB 4OCWL 1MJ7L 3QUYC 3QAZB 1YEGH 5J8OA 1A7RL 1CR9H 3O6MH 4P9ML 4FQQA 3FQUA 3ALPA 3Q5YA 1BEYH 1C5BL 4HS6A 4JHBA 2R29L 1XGQA 3FN3A 3AU1A 1VGEL 2GIYA 2GYSA 3C6SB 2HWZH 3R06A 4OCXL 4XT1C 4ZSOB 1M7DB 1MFBH 1FZOB 1F4AA 4DOHB 1DQTA 4R8WL 2DQHL 4UT6L 4XVSH 5C0AA 3UJIL 3BH9B 35C8L 4J3UA 3RQ3A 2BOBA 1YY9D 1JF5A 2UVFA 1YEIH 3QBTB 3CVIL 4R4ND 1CGVA 3W0WE 1XGUA 1YUHB 1DEEB 3MCG1 4OF6A 4BQ8A 3VW3L 5L8LB 3QZWG 3C5ZA 3KPOA 2EE3A 5T5FH 3SY0A 4JY5H 1ADQH 3D18B 4R0LB 5HSFA 2DI9A 1OTUC 2AEQL 4JFEA 4NO0B 4PRHB 3SCMD 1MRCH 3GJFA 3SN6N 3WO4B 1X5FA 5EU6B 4ZUTA 3MNVB 1LK2B 3FO9A 4U6HB 3WEXA 5DF0A 5IVZB 2Y5TA 1MAKA 3C2AH 3MRBA 4ZFGH 5LWYH 1FDLL 1MJUH 3ZKXC 4K8RD 2VLKB 4JPWL 2WWKO 4N0FA 5TDNB 1KCRH 2H32A 4Z6AT 5BZWB 3RUGA 4RAVA 1JN6B 4PTUA 1J1XL 2I27N 1WWAX 2NY4D 3E0GA 1NC2D 4NRXA 2IADB 1TMCA 1A64A 2DWEB 3PGDA 5B3NA 2Z8VC 3MSPA 4XPHH 1HZHH 4RAUA 1FLRL 3Q3GB 2F74B 3MBEB 4JM2B 2H6PB 1EUTA 3GDBA 5D71H 5KSAD 3WNOA 1WAAA 2I9TB 3N85L 1D5BB 2BVTA 1KJ2H 2QQLL 5IM7B 5HVGB 2JE8A 4HUXA 1DR9A 3QEQB 3RWHB 1MCDA 2OR9H 2G5BB 1F4WL 2BNQA 1CDGA 3FB7B 4MNQE 1U41A 2B8OT 3HZKA 4LCCA 4KTDL 1S5HB 5CS7A 4MXWL 1CDHA 2APTA 2EDQA 1BVKA 3AREC 3VG0L 1KCVL 5TF1L 4NDMB 4LLQB 2ITDB 3WXVH 5INCA 2X1PA 2DLGA 5E6IC 2Q86A 4BK5A 4UT9H 4FFZH 3C8KA 1HH9A 2GITB 3O6LH 1Z3GL 1BWWA 1OD9A 3PABB 4LNRA 2GJ6B 1K2DA 1YN7B 3LKNB 4HIHB 4UV7L 3RBGA 5L2KD 1EFQA 2D0FA 3MRPB 5IB5B 1T22B 1IT9H 3U4BH 1S9XB 4IRJB 3G6JA 3U7YH 2R56H 4P5TC 1HOCB 3LRSA 1SBSL 4HUMB 2X4TB 5T1LD 1IILE 5F7UA 4NO2B 4XCCH 2EH8L 4BFEA 3WUWB 2QSQA 5B4MD 2A9ML 2DQDL 1B4RA 3SDCB 2H26A 3VXQB 4X0KA 4GQ9L 5EWIL 1J0IA 2ARWA 5GGRA 4ONFL 4TVPE 4HBCH 5JNYA 3P4MB 1BJ1J 3P9MB 3NCJL 4PP1D 4YDVA 3IDIA 1LDPL 5FA3B 3X12B 4ZFFB 4KHTL 4MQ7A 4KTEL 2FO1A 5AZ2L 1JYNA 5HYJE 4OLUH 3TNMA 4KY1H 4TULL 2BRRL 2VDLL 4WU7B 4O51B 2VLRD 3NCCB 1FFPB 4C4KO 4GBXA 1FGVH 2RIKA 3MRKB 2HT4C 4NQDA 4OKDA 4RRPG 4HAGA 1BBDH 1N0XH 2FRGP 1RZGB 5LBSL 3UYPA 1QSEB 3O2VH 1OCWL 4U2YA 4PJ8A 3RA7L 4GMTL 1OM3H 4Z8FH 1Q0YL 4HPYH 1NFDA 1BGXH 3IFNL 4NT6B 1MWAA 4U4BA 1L7TH 1ZVYA 4KV5E 5IW1A 4XPTL 1K8IB 2VITA 4KROD 2NY0D 1ZVHA 5EULV 4D9LH 3I3BA 4I18A 5DHYB 4GS7B 2NTFB 4KMTL 4P2OC 4RBPK 3KXFD 3WIIH 4F9LA 4LEOA 2B4CC 2MTPA 3BMVA 3QFDB 4Q97A 4YDIH 1F3JA 2I9LB 4L9DA 3O3BA 3EYOA 4NQCD 1UCTA 1Y18B 5KSUA 3H2WA 4U1IB 1C12B 3ARFD 5JLZB 3SDYL 5D93C 5F9OH 1MF2L 2EDRA 4BSVB 5DRNA 2W0FB 5I71B 2DMBA 2JJSC 4PLKD 4UBDD 1IE5A 3LD8C 4PR5A 5FYKD 3HNTH 1KTLA 1YYMH 5IQ9A 4P5MB 2CJUH 5H94A 1NEUA 4PGCB 2ILLA 2VTFA 4D0DA 4X6CF 2C5DC 4XMLH 5I18L 3GMMB 3Q48A 2XZAH 3GMQB 1RU9H 4KDVA 3OAUL 5DD3H 2IANB 5HGGS 4KQ3H 1DQLH 3ULUE 1PBYA 4ZTOH 3LVEA 4CUCA 3VGAB 3BKYH 1ZTXL 1R3IH 4Y4FA 2OMBA 6FABH 2W65A 3EOTL 2XACC 3TO2A 2NZIA 4MS8A 4PJCE 5D1QC 1CD1A 1HNFA 1V7MH 1GZQA 4L4JA 4LHUG 2J8UE 1UKQA 3IDMB 1TZHA 4S2SB 1UB5B 4ZXBC 4JPIA 3GSOA 2XKNB 4WTZG 2FX7L 2E9IA 1OOAA 5ETUB 4OCYL 4X5WA 4DQOH 1OAXH 2FBJL 1Q9WA 2LQRA 5FA4A 3OAZH 4J3TA 4KC3B 3ULVF 4NZDA 3FZUC 3TFKC 3X3GH 4OD1L 3JXAA 3KYNB 4HKZB 3BZFB 3QDGB 5LAXB 1NBQA 4WEBL 5ITFA 4BZYA 3UBXG 4H20L 5C0IB 3VFOA 1HI6A 1NAMH 3NOIA 2CK2A 2R0LL 4U05A 2NY3B 4Z18A 1BZ7A 5CGTA 4JO4H 5GIRB 5DFVC 3SE8L 1D5IL 1JV5B 4EN3A 5CLWA 12E8H 2BMKA 2EEDA 3O3AA 4N0UB 2DD8L 5LGKA 1PG7W 4X98A 5F7EL 4UMGA 1K3ZA 4XRCB 5AZEH 5F9JA 3DYMA 3D0LB 3QIWD 3QDME 4CAGA 4L3EE 2J6EL 2WQRA 1MVUA 3ULSA 2AJSL 2P44B 3T0ED 1PD6A 1FNAA 3IAQA 5I9QC 3SE9H 1ZSDA 1ONQA 5TPWL 5CAYB 5DJCA 2YUVA 1Y0LA 4WU5B 1M1SA 2OI9A 1AXIB 5HHVH 5BV7H 5DD6B 3KYMB 4MSWB 3SKOA 3DGCR 4ENEC 3AAZB 5KSBB 1KC5L 1PG7H 3PE9A 4FXGB 3TM6A 4YJZL 1QVOA 3V79C 3JTTA 1PDKA 4EIZC 4HDIB 4M7JH 1MNUL 5FKAA 1TPXC 3MRCB 4LCYA 4OIAA 3P9WB 3VXSE 1R24A 1NUFA 1A9BA 1IGJB 1X3DA 3AM8C 2LAGB 3QHFL 3RVWC 2AV7A 1K6QL 1X7QB 4P99A 2R39A 2VSDA 4U1LA 2BDNL 4GG6E 3GSNL 1N64L 4YE4H 15C8L 1QQDA 4BH7A 2W91A 4NNPH 3DARA 5GS1A 5EIIA 1FVDA 4XI5C 2BHZA 3HPJA 5GS0H 5CHNB 3H7BB 4DKEH 3L3GB 2EDFA 5C2BH 1A8JH 3U0PA 3CCHB 3I6LD 1I8MA 3VXUD 4JFXA 4MLIA 4RGMB 5ID1A 1A6WL 2AEPL 2C1PA 2PYEE 5DD1L 4Y4HB 4E41A 5EBGA 2IMNA 1MOEA 2BFVL 3RTQB 3WFDL 1TENA 3IDXL 1EHXA 1ODAA 3IETA 1KTRL 1S5IL 1ZHKB 4PRBB 4KPHH 5KS9B 4V1DD 3H3PL 1R0AH 3GK8H 3PDGA 1H3TA 4RGND 3EHBD 5GHWL 5IESL 3BMWA 1BF8A 1CE1L 2EICA 3U0TB 4DUVA 1AQKH 3TCXA 4Z77B 5C0DB 4OQTH 2CO6B 2CPCA 3GB7A 5DZLA 5FV2A 2H9GA 1U92A 4G8FA 5ISZB 5I1IH 4XH2A 2GQHA 5I1LB 1J8HB 1I3UA 1P7KA 3QQNA 1M7XA 4MB4A 2CDFB 3MACL 3QYCA 4QXUH 4RFEB 4KTYA 4KDTC 1T03L 5HBBA 1RULH 4Y5YA 4EXKA 5J13C 1F4HA 1P4IL 2BVPB 2I60H 4UDUA 4UQ3B 1GZPB 4HUUA 5CGYD 3RGVB 2X41A 4OQ1A 4OZFA 3EOAA 4XNUL 3FN0H 3TBVA 3WLWD 4RIRB 4CRPA 2YD4A 5IT2H 2AK1H 4OCSL 1IGFL 4UINL 3W2DL 4IMKA 1F4XL 1B0WA 3GSQA 5JOPD 5IG7A 1I1CA 3QAZC 5A3ID 3HZMB 3JV6A 1FZKA 1NLBH 4XXDA 4MAUL 4Y16C 4KHXH 3I2CH 1EEYA 1DDHB 4H25B 5K59F 1J1PH 1U8PB 4OZIE 1MCOH 3P77A 4X6CA 3M45A 4WY7H 5DMKA 4C55A 5KVFL 4M3JA 5J9PB 5DD5L 4BA8A 1BFVH 4R7DA 5EBMB 5GGVY 2EDOA 4NZRL 4OUUB 1VPOL 2F58L 4OCMC 1NCNA 4QOKD 3VGBA 5F70A 1T2QH 3TA3A 3Q6GH 4YEFA 1FL5B 2FATL 2P7TB 3WS3A 1X5LA 4UQ2B 4R0LC 4PJAB 2W9LA 3OTTA 4D9RE 3WN5A 3GSVA 3WO4C 4G9DB 1BX2B 1RURL 1VFMA 5A2JH 5KVEH 1T0MB 2CGRL 3MLRL 2BSTA 1KXQE 3DLQR 1F11A 3IJHB 5H8DA 2R1YA 1A14H 2YUWA 1IAIM 4YC2B 3T0VA 4F2MA 2OTWA 5CEZD 4ODVL 3FT3A 1NGWB 4R2GD 2YK1H 3P4OB 1MFDL 4FG6D 1P4BL 5I16B 1AJ7L 3BJLA 5FYJH 1J0KA 4YBHA 4LAQL 5CWSA 5E8NB 3NZHL 4JG1L 4WUUA 3SQOH 3T0BA 1MCFA 4MNQD 5HYFA 1KTDA 3B9KB 3MBEC 4AENB 3B5HA 1RJLA 4GSDL 1HH6B 1MY5A 3WD5H 1BD2D 5DJ6B 1A5FH 3VI3E 1EVUA 4TNVK 1J05B 1J1OL 2IBZY 2A74B 3BDBA 1Z9OA 3QIUB 5DC4B 3M8OL 1YZZA 5C08E 4J3XA 3MRDA 4CU7A 1CDIA 3V52H 4AH2A 4BQ9A 2VZSA 3H8NA 3C60B 3DX8A 2MOVA 2KDGA 4M6MH 1OTUD 2HLAA 3ARGA 5TDPB 5HYQA 4ODWA 1T66C 1HKLH 2MQCA 4G8GE 2B1HH 1LO5B 2D9CA 3HAEA 2BVOA 5IQ7H 3TIDB 3TJEL 4FQ2H 2A1WH 5EPMA 2MNUA 3IDNA 4Q9RH 1HILA 3HI1B 3V6BR 4YBLB 4FQ1L 3NGBC 1PY4A 4M4PA 1ZWIA 3WHE1 3UZVB 3EUUA 5GRUH 4N9GA 3MLVL 1MLCB 3F6LA 4IRJC 4X6DE 5HPOA 3A6CH 1QFUL 5KSVB 1U91A 3SGDI 1XGTA 3S88L 3QUZB 4Z7OF 3D48R 1UACH 4FZ8L 3W9EB 3MV7A 3GMLA 2OS7A 2FL5A 2UZIH 1DANU 1ROWA 3RNKB 3SDCC 1AP2B 3K2UL 4O2CA 4PRAA 1DUZB 4HWUA 1FG2A 2IH3B 1FL6A 1JGVH 4HUKB 4ONGL 3FRUA 3IVKA 5JOFB 4U7SA 3AS3A 3I50H 5F88B 3ZL4H 5IBTL 1MHPH 3QA3A 1RZKC 4LLVB 1NH6A 3DTXA 3FTGB 4XVJH 3FAWA 5D9SA 3PGCB 1T04A 3B3IA 3O11B 3SDAB 1G6RL 1EAJA 4MJIE 5I66B 5IKCA 4KRPB 4X8JB 3VI4E 1XF2B 1NCWL 1P1ZA 5E6ID 1NKRA 3TV3L 4KAQH 1NJ9B 1XFPA 4PB0L 4PGDB 4OD3H 2DLHA 2V2WA 1IQWH 1RIVL 1S7RB 1VADA 4ZOCA 3MRIB 5C0CB 3HPLA 2W0PA 1QUNA 3VFTA 4EUPA 1J5OL 3RKDD 5HDQH 1JWMB 3VDAA 2XXCB 1JWSA 2R0WL 3R0MA 3TBSB 2NLJA 3RL2B 2UY6A 3ZT7A 4YGVA 1P5VA 5DJXA 3SCMA 5D5MF 5DWUL 5IVNA 4GS7C 4D8PB 1EK3A 2X4QB 1D6EA 1UWXH 1KIUA 2DQGH 4GO6B 1T7ZA 3WNMA 1S3KH 4R3SB 1OAQH 2BOCA 1U8OA 3K81A 5CMAB 5FHBL 5F1IB 3GSWB 4UU9A 4JZNB 2CLVB 4G7YH 3INUL 3EAKA 2ICWB 5I71C 1QHPA 5C6TL 3VMNA 2YUZA 2MQ3A 2DKUA 2VIRA 1NC2A 4QHKI 2VOTA 3NIGE 1I4FA 3Q1SH 4N5EC 1DFBH 3VD3A 1MELA 3BP6B 2EXYC 1YEKH 4ZO7A 4OJFL 1KN4H 2JKXA 2KKQA 3I75B 5E2UH 4YFLI 4RNRB 1RD6A 4I48B 1JRHL 1BECA 1MCNA 4G8EB 5KSAA 1JYXA 1HCFX 5GGQL 3BVNA 2QSVA 3VGAC 1ZHNB 1LEIA 1A1NB 1RJZA 4MNHA 3CPLA 5MHSD 1EJOH 2Y4SA 3EFDH 1MCWW 4XNXH 2DDQL 4D3CL 1QO3A 3DX6B 1E27B 1CBVL 4F15B 1KNOB 4K7FA 2R2HA 4Y0GA 3MLZH 3K4ZA 5KOVC 1PG7X 3VH8B 1ZGLB 3QG6B 3T2NL 3OKEA 3OKLA 2HT3C 3AXLA 2WINB 3HRPA 4RMQA 3UDWA 2V2XA 4OAWB 4Y19D 3HB3C 5DJYB 2LU4A 4X8XA 1MCKA 4R9HA 3DO7A 3IRZA 3O2WH 2HVJB 3VXNA 3TPUB 3HZVB 4XPAL 4I0CC 4GKNA 1RUMH 4EJ1C 3VFUB 4JHWH 3TT1L 3G08A 3KLHC 2YPKA 3PP4L 3SDDC 3GO1L 4HGMA 1O7VA 1UM5L 5MENE 1XCTB 1KIRA 4JN1H 4OF7A 4DEPB 5IFAH 4XNZB 1CS6A 3TN0B 5T1LA 4YHML 1CFTB 4JVPA 4PP2A 4N1EA 2SEBB 5JXEC 5A2KH 4JPVL 1IQDA 4WHTB 3OB8A 2OJZH 4E42B 1PSKH 4QRRE 3RWGB 1NBYB 3EJZD 2FJGB 2P8LA 4ZUSA 1V7NL 4LSRL 2EDTA 5BJTB 3KVQA 5GSRA 1EBPA 4P2RB 2D9QB 3NCFB 2AJZA 2P48B 4R4FH 4LNVA 4TUKL 5D2LB 4NQTA 1XR9B 2IH1B 1T89C 1QLEL 5LQBH 2GSIB 2WBKA 3MOBL 3O6FB 4PJ9B 4ZS6D 4PY7B 1NAKL 4ZPTA 5IFHH 2EE2A 1DBKH 2VLRA 2MJWA 3EFFA 4ZXBD 3U36A 4QHUB 4F37F 3MGOA 4Y1AE 4D9QE 4M93B 3QQ9D 2E7HA 1VB9A 4O4YH 5CD5C 4PJIF 2CIKB 3GMOB 3GNML 4Z7WE 3TYFB 3UTSD 3RVXD 4OI7A 5E9DD 4HS3A 1W72H 3ZKQD 1A3RH 2HFFA 2FYYA 2AW2A 4GG6B 5BQ7A 4H1LG 4B7IA 4F9PC 5GRJH 4PJBE 1XIWB 4PRPE 2J88L 1F90L 3B9VA 1D5MA 5CIPA 4G42A 3IFOB 5DFVD 4DVBB 4GAYB 3HG1D 3DXAE 3OKKB 3WJLC 3KXFA 3E3QC 2Q8BH 2D7QA 4I2XA 2W60B 3BKML 4BSWA 4ODUB 2FSEA 1EO8H 5FYLL 2WLYA 2PYEB 4RMWA 1QFWI 4RGMC 5JW3L 3KWWA 5D70L 4EI5D 4Y4HC 4G7VL 3ARFA 1EMTL 3PP3H 5GS2D 4JKPH 4U6YA 3RTQC 5AD0B 4K3EH 1TJIH 1KJ2B 2NX5E 3EYSH 1H3UA 2DQTL 3QWRD 1GAFL 1CD8A 1IKFL 3DGGA 5DJ8A 4ENED 4LLUB 2OL3H 5C0JB 2JELH 2Q1EA 3KPMB 3EOBB 3QQ4B 4WWKA 3T65A 3P4NA 4R96B 4QT5B 3LQAC 5I1KH 4P3CH 4HF5L 4S1RL 3FOMA 3I6GA 3CU7A 2EIZB 2AI0L 1G9MH 1L9MA 1RZJC 4PJ7E 2ED9A 5DXWA 3CX2A 5JDSA 3ZHKA 3WFEH 3TIEA 5IF0A 2A38A 3VFPA 4JLRB 1ZANL 3RVWD 1I7UB 4CVWA 1IAKB 1T6WA 2OTUA 2VDRL 2ADGA 2YSSA 3ELAT 3FN9A 1G7HB 3OHXB 3QULB 1QBMH 5ALCL 5E8DL 5J56B 3W5MA 3GRWL 1RK0B 2GAZA 2Y7QA 1KJMA 4JRYB 4WW2A 1G7PA 4BKLA 3D87B 3RGVC 3WNNA 1GIGL 2W9DH 2YC1B 3CH8A 5DQJB 5B39B 3JWDH 3L5JA 1EHLH 4JB9H 2EO1A 3DI3B 4XI5D 4R4BB 3VXTA 3GBNL 2NW2A 1JRHI 4UTBH 3EYFA 1JTOA 2Y36H 1YEDB 4J8RB 5KW9L 2IPUK 5FF6B 5DJ2A 3IU3B 1DEDA 3DRTA 5E03A 5I15H 3LN9A 1MHEA 2GJZB 1OPGL 4FQXB 2Q8AH 5SWZD 3MUJA 3OBAA 4HCRL 4MD0B 3SJVD 3QIWA 3T0EA 1D5XB 5JXAL 2YMXL 4HV8B 3T77A 2MKLC 1U8LB 1EGJH 2HT2C 2Q7NA 1XZ0A 2R4SH 4CJ0A 3BZEA 4X6FB 1OGTB 3BI9X 4D0BB 1UEYA 2YUXA 2N7AA 4PJFE 1S9KC 4F58L 4NHCL 4MVBD 1E4KA 1QACA 1R3LB 2R2BB 2VE6A 4DN4L 5J6GB 4NUJB 4Z7VF 4JQIL 3U30B 3RIAK 3QQ3A 4M7ZB 1R3KB 3LOWA 3MGAA 3BPCA 4JFDE 1ACYH 4BK4A 5EOTB 5D2NE 2QQNL 2X1OA 1BEYL 5I1JH 3DPBA 4U33A 4GH7B 1P2CB 2JTDA 1Q0XH 3BGMB 1CVRA 3ZE1F 4QYOA 3NH7H 4GAJH 1CGSH 1GC1C 1MFBL 2GTZB 4YC2C 1MQ8A 1NCTA 1P5UA 4DZBA 4PB9H 5FECB 2N7BA 3UYOD 4Q2ZB 4HD9A 2HTKD 1U3HA 4WFFE 3OB0K 4OFIA 1WZ1H 3DUSB 1MJJA 4Z7UE 3EO0B 3OPZH 5JO5A 4IIQA 3JV4B 1P7QB 3OL2A 1QPPA 2HJLA 1TCRB 1PKQE 4L1HA 1IKNC 4Y16D 3VFVA 4CW1A 1JBJA 3B9KC 3IDGA 4OSUH 1T1XA 3VXUA 5IBLD 1A7PH 1A0QL 5IVXF 1R3JB 3MREB 4LP5A 2GCYA 4JO3L 5AWNL 4L4TE 2F15A 3V2AR 4EQ3A 2P5WE 1UKSA 2MKWA 3MLWH 4KKAC 1INQB 5C08B 1H3PH 2PW2B 3QIUC 3RWCA 5LWYL 3MJ8A 1ORSB 1A6TB 1A22B 4KJQC 1HYRC 3OR6A 3JVGC 1S7UB 4KJWC 3KPSE 1KJVB 2V5YA 4V1DA 1FSKB 3OG6B 4F7EA 4JY6A 3CFKB 1QBAA 2BVQB 2WY3A 3RNQB 5HHPB 1U3YA 3C60C 3D39B 5CBEB 5DYOA 2P4AB 4G8GB 1ZE3C 4NO0D 3QXAB 5M95B 5EBLA 1C8PA 3AFLA 4P4KD 3P30L 4HKXA 1RQ5A 1JHTA 3QEGH 2IQAA 5IB2B 5TGBB 1FNEA 5E8OA 4YBLC 1A6VL 4PJIA 4RMVA 2DMKA 1MRDH 1HHKB 5ESVA 4X6DB 5GGTH 5DRWB 3C08L 3FCTB 2OR9L 4MA1B 1JYVA 4GXUN 3WJJC 1Q9LA 5B22A 4KMQA 3QUZC 1KB5B 3KPNB 3F7VB 4CU8A 1JFQL 2R1XA 4XCEB 4MDJA 1DQQB 5IMLA 5LGJB 3VDBA 1FNSH 1IC5L 1WFNA 3MRMB 3MNWA 2C3HA 3PQYD 1KJ3H 2JCCF 1DE4A 5IEKB 3VXMD 4LGRB 3MBED 5J4MA 1FFRA 3D69B 5BRZD 5D1ZB 1FJ1A 1FGNH 3ZZ1A 1EUUA 2X7LA 5IROC 1PEWA 4RZCA 3QEQD 3TO4B 1NCAL 3WHXB 1FYTB 2ICWI 3HCVB 1MCPH 1I1YB 2C3XA 1NMBH 4UV4H 4JFOB 1HHIA 1IT9L 1DN0A 4O02H 1CIDA 4HHAA 1UM4L 3SDAC 5IB4B 1LE9A 5BV7B 2R56L 1FAIH 3PNWA 4KRPC 5HY9A 4U1GB 3QZWB 3CK0L 3FQNA 4XCCL 1NANH 1T21A 1HHHB 2V2TA 1XF5A 3MC0A 3MYJA 4RISH 3O8XB 5D7KD 43CAB 1CE6A 1PYWB 1A4JA 4X7CC 4GMSL 5FYJU 1CL7H 1KPUB 4NWTL 4HKBB 5AUMB 4FOMA 1INDL 2ICES 1IBGL 2EXWC 4KUCD 4NC1E 3WNKA 4H1LH 4P9HC 1GXEA 3V4PH 3PL6B 3UPRB 2P45B 4G6FD 3D3VD 2OJEA 5EA0H 1T80A 2BNUB 5FK9A 4X6EB 4LFHG 5D4QA 3ET9F 2YXMA 4PJ5E 2I5YL 3LKPB 2VDPL 4GXVL 4AEFA 3DSFH 4NKMA 2NNAA 5DZOA 2BSRA 3RWIA 5JPNB 1OSPL 1FG9C 1Q94A 4NGHL 2UYLB 3O2VL 1ZVSB 4LSVL 3VCLB 4U6XA 3CLEH 1JGDA 4KZEL 2VXUL 3RFZC 4EBQH 3SPVA 5DJAB 3BIBX 3QUXB 4HPYL 4U1SB 5I1GH 5E99H 3WE6B 3MROA 3T04D 4MNQA 4NIKB 3MRNA 1TIUA 3T3PF 4IMLB 4BZ2H 1JNNL 2AK4D 1UB6A 3MXVH 1OTTD 3ULUC 4K9EC 1BD2A 1NGXB 5FM5M 2WANA 4K71C 1F3DJ 3OX8B 1AD9A 5K9QG 4OD2A 4YDIL 4BH8A 5T1DL 4ZAKA 5EZIL 4QLRA 1AQDA 2VABB 5K9KB 2HH0H 4N0CA 3PWUA 4PRID 3B9DA 4PJDF 1FRGL 3F5WB 2DM4A 4LSTL 4HFWA 5I1EH 1CLOH 3U7WH 5FYLE 4X6BA 4JN2B 4QXTA 4GKSA 1ZA3A 2V6HA 2H2SC 4FABL 1KLUB 4KRLB 3IKCB 4LEXH 2DQCL 5EU3B 1MQKH 2AQ1A 4BFIB 1SJXA 5CLTA 4NO3B 3MUGB 4K23L 4X7DC 2XZAL 1I3RB 1RU9L 3RX7A 5HHQB 5I0DA 4XWOC 4U1NA 4MWFB 1MH5A 4AM0B 1PX4A 1FCCA 3VXRB 5MENB 3QFJD 4NN6B 3C9NA 1ZAGA 4DEPC 3GJFH 3CMOL 3BE1L 4I5BA 4XNZC 5FDYA 3MRGA 4QRRD 1DVFB 3TN0C 4B53A 1ZHBB 3ORJA 5JA9A 3IJYA 1OW0C 3LN4A 3QI9C 2C1OB 5DK2B 2NY2B 2AGJH 3LN5B 3PDOB 1BVZA 2R1WB 1PQZA 1OP5H 3RJQB 5BMFL 2HJFB 3BEWB 1ZEAH 2P5ED 1KENL 2HFEA 4RWYL 3MA7B 3BP4B 3STZA 4TNWK 5TE7L 3X3GL 4MXQC 1A2YA 4CDGC 3BSZL 1MHCB 4MB3A 5FCSH 5B38A 1R6VA 4U6VH 4N90D 3H9SB 4O2FB 2CLZB 1QLFB 1TVHA 3O6FC 1ND0A 4ODBD 1RUQL 2OZ4L 3P4LA 3C8DA 4PJ9C 1IAOA 3D2UB 4JO4L 5GGUA 4ZDHB 4Y1AB 1U95A 1BOGB 4HKJA 2YD1A 4Z0XA 5T3ZE 5FOJA 4M93C 3T3ME 4OLXH 1T20B 3HB3D 2UY7A 4UOW1 5FO8A 3E8UL 4JFQB 3TBTA 4HG4J 3PWVA 2CIIB 4OI9A 3DXAD 1IGYA 3SE9L 2NYYC 3RVTC 3KLHD 3JTSA 4P3DA 4PRPB 4MAYB 4DAGL 3SDDD 5JA8B 4WRLA 3V0WL 1XIWC 4UOJA 3QJFA 2VXTL 2WBJB 1FIGL 3MO1B 5EBWA 3MUY1 2HYMA 1FE8H 1FFNB 1QSVA 5CEXB 3SKNA 3WFCL 4QNPF 1KIPB 4G6MH 5GRWA 4FQJL 1VEPA 5DI8B 4PV8A 2FGWL 5DMIH 3O6KH 4LF3A 1TZIB 3QJHA 1LD9B 3QNZA 4M7LH 4P46B 1QSFD 4EVNB 4F7PA 4NKDB 2NX5B 2E6JA 3A6BH 2G60L 1LO4H 4PJHF 4FQPA 1AGCA 2NW3A 2FWOA 4OGYL 5EIQA 4OZFG 2HKHH 4OLWH 5LGHL 1OSZB 1X5XA 2X9YA 3H9YA 5HXMA 5IJKA 1KPVA 1CFNB 4HXAL 4DWHA 3FFCD 1BOYA 3IFPB 1FPTH 3FQRB 1XF4B 3AB0B 4OLVL 4LHUB 1A1MA 2ESVB 1XF3A 2ZJSL 2J8UA 2H1PH 4Y8DC 4NNPL 1FIEA 3PWLA 4PJ7B 2RR3A 5DQDL 1VGKA 5C2BL 4M62L 5CD5D 1AI1H 1KCSL 1T5WB 3LV3A 5EN2B 4MMXC 4LOUC 4PG9A 5DFTA 1RZFH 2FB4L 3KPPB 4NCC2 2CDGA 2F54D 3KR3H 1HWHB 3LIZH 4NO5A 2X4NA 3MFFB 1UQSA 1BZ9B 3UBXB 2QLVB 3S96A 2VAAB 4Y19A 3SGJA 4QF1B 2QHRL 1R0AL 4NYLB 2VLJE 5GZND 5D6CA 1HEZB 4UNTA 4TUJB 4QTIH 1MWAH 2DKMA 3O81A 4WENB 5F7WC 3ZTNH 4ELMB 2IAMB 1ZLUK 3U46A 4YIQA 3GSRB 4TSAH 1N8ZB 3VWKD 3UAJC 4FQXC 5H35A 2K3TA 3QDJD 1W2KT 4QXUL 2E7MA 2CH8A 3QWOA 3MRJA 4XAKD 2ED7A 1F5WA 4U1KB 4ORGA 1UWEH 2EC9T 5BS0E 4NBYB 1GGIL 3E6FB 4RWHA 3EJYC 1JNHB 3F7YB 2BNRE 1ZGLP 1VFBA 2V9QA 1S8DA 4WI7A 5ACLA 3WFBL 1HN1A 3AC0A 4GLRH 3PHOA 4JJ5A 1MFAL 1CTOA 4JZJA 4PJFB 4YK4B 3SGKC 3VE0B 1CFQA 1NCDH 2F5BH 3VXSA 5JHDE 4X99A 3U30C 5ACZA 1QKZH 5BXFA 4NJ9H 2X4OB 5J1AB 4JFDB 4M7ZC 3VGGA 4XZUA 4L8SB 4LAJH 4PGBA 2UWEE 3CFBB 4Q0XH 3U2SA 1NLBL 4NQVA 3RBSA 4QRTB 3I2CL 4YFEA 4M1GL 2P1YA 2ZUXA 1ZK9A 2A77H 2QQQA 1E4WL 1OY3B 2VZOA 4L4VD 1E4JA 1SQ2N 3UTSA 3LHPL 5E9DA 3S4SA 3DRQA 3JZ7A 5FAAA 5AAWA 3OV6A 4WFGD 4P2QB 2DRUA 3O2DL 4Z7UB 2PTTB 3MRLA 2D7TH 5BCAA 3KYKH 3QHTC 4LLDB 4DW2L 3VWJB 3CFCH 1CFVL 5I8CA 3DO3A 4LLAA 4HX1A 3JSSA 3HAEG 4H0IA 4PJXE 4L8DB 3BD3A 3IDYB 3P0GB 3QXVA 3NFSH 4JRXB 2X4PB 3S3JA 2X10A 4H8WH 2FO4A 1N7MH 4FZEH 3OXRB 4EI5A 3NCMA 5F1SA 2P5WB 1KFAH 3IDUA 4TSBL 3G6AA 1JGUH 1ETZA 5C07E 1KN2H 4U7KA 1RK1A 3WV0A 3W11C 5E1AA 4GRWH 2JK5B 1M05A 1BFTA 3BRDA 1C1EL 3QWRA 4H88H 4CJ1A 1FSKC 2VKWA 5TE4L 1O5DT 3BISA 1ED3A 4M5YH 3WS6C 1RHHA 1XAUA 2PTUA 4PIRF 1OF2A 2ZKHH 1B4JL 5KVDH 5GRZA 2UZXB 4XHJC 3V6ZA 2MHAA 3VMOA 4OZHF 1VERA 5T1KB 4D0CB 3V4UH 5DS8A 2IBGA 5ILTL 2D03H 4OLZL 3L3HA 4JKLA 1S7VA 3R1GH 5C0AE 5ADOL 4PGEA 3AM8A 5IMOB 3ZKNC 2Z4QA 3L3DB 2PO6B 3EO9L 5B8CB 1U58A 2QHLA 4DK6A 4HJ0C 2IMMA 4FFYL 2YEZA 4MA1C 3K1KC 4O5LL 2WK2A 5DR5L 4X5XB 3S5LA 4BQ6A 1U2CA 3V52L 1C5DB 4X7TA 1OQOA 2X1XR 1FH5L 5CD3B 4X9BA 4DGIL 4JFEE 4BYHA 5I30L 3MR9A 3TT3L 4ERSL 2O5XH 2OQJB 4LASL 5E2VH 4EUPG 1MEXH 5F3HB 5EU4B 3GMRB 5C09E 3MV8D 5JPMA 1KB9J 2NY5C 1S78C 1WK0A 5HHMB 5D1ZC 1HKLL 3W9DA 1L7IH 1EZVX 1I8LC 2Y72A 3N1PC 4Q9QL 1ZLWH 3UJJL 4OZIA 2ZNWA 1NFIA 2H2PC 1DP0A 1A6AB 2RCSH 4Q9RL 3RUGE 3TO4C 3N9GH 4PJHA 3S37L 3MJ6A 1T7VA 1SMAA 4NUGH 3WL9B 5SWZA 4KJQD 5JORB 3SJVA 3A6CL 2VL4A 3EDFA 4IHOB 5BV7C 2VNCA 4N8CL 2QKIB 3BEVA 3L6FB 2EDNA 1UACL 3C60D 3L7EA 4U1GC 5IEHA 4UUJA 2O5ZL 5FCUL 4MA7H 1HWGB 1ES0A 4HUNB 2ZCLL 4I9WE 5ALBL 4JPKH 3O8XC 4BZ1L 3RU8L 5AEAA 5FHAH 2XZQH 3NIFE 4HMCA 1F4YH 1A1OA 1S9YA 3SO5A 1JGVL 2E9BA 2BNQE 4LSSL 4MVBA 3IRPX 3GIZL 2ICEA 2OK0L 4KI5E 3I50L 4YHLH 4JHAL 4KDTA 4XP9H 4QRUB 1W72B 5IIEB 5DFWH 1G7LA 4PJ5D 2ZP0T 4K7PY 3X13B 5HVHB 3QUZD 3BW9B 2D7NA 4XXCA 4Z7NF 2VZ1A 5IJVB 4Z7QE 3T09A 1PGRB 4NJAL 4APQD 5GSVA 5F72S 3ZSSA 1D6VL 4HIJB 4UIKH 2XNAB 3TC9A 3MYZA 3GI9H 5GS0C 3T1FA 1U8JB 2MSPA 4IDJH 4HQQL 3QDAA 1Q1JL 1UG9A 3DV6A 5C0FB 3MA9H 2D31A 2XN9D 4HWEH 2V7NB 3FT4A 3RWEB 4S1SL 5IK3B 1P69B 1YMME 3QUXC 4ZTPL 1WFOA 2OSLB 4NQXA 3SOBH 2DIBA 3NPZB 4NQEE 3TCLB 4Y16A 2Z31B 2OLDA 3CDGA 3C6SA 2XWBA 3KDMA 4JZOA 4M43L 5KJRL 5DQ9A 1FZOA 3IF1A 1N59B 3EGSA 3TGXA 2P46B 3RWFA 1OAQL 3DUUB 5C0CD 4TNWF 5C9KA 5I19H 3BDXA 4JFYA 1A6ZB 2VDQL 2LU3A 2HN7B 2B1AL 4MX7A 3ULVL 4NKIH 4QY8B 3GHEH 4GAGH 1QBLH 4NO0A 5FUCC 3G5XA 2YA0A 2ZUWA 5B3JE 4LPXA 4QO1A 1JZ8A 4P4KA 1FORL 4JANB 4U6HA 2X9XA 4P59H 2IGFH 3ZDXF 1LO2H 2ADJA 3C5SB 1CLCA 1TVBB 4LP4A 5HI3C 3NFNB 4MCYA 3PG2A 2VISA 1EJOL 1CK0L 5D1XB 1NFDE 3EFDL 4NZTH 1HSAB 3I02A 1PZ5A 1DVFC 4XGZB 4PREA 3SO3B 3JV5A 3R8QA 1A3QA 1EXUB 3V8CA 4YFLF 1M7IA 4ISVB 4MHHI 3FONB 3PV6B 2PR4L 2NXYD 1I8IB 4R26H 5HDLA 1NUGA 3PQYA 4DGYH 2F53D 3VXMA 2NY2C 3MBEA 1FBIH 4G6KH 4KJYB 5BRZA 2HMIC 5I1DB 1NGYB 5IM7A 1YPZB 1X6NA 4MJIA 1S7QA 3LQZA 3O2WL 1G7MA 3VRJA 3RWHA 1EV2E 3WCYA 3ZO0A 3RZCD 1XGPB 1RUML 2WP3T 3C09B 3MJ7A 3MODH 5KSBF 1MFEH 3EDEA 4KI1A 4PY8I 5DDHA 4QCIB 5FM4A 4W70A 5IFAL 3BKJH 4POZC 4P49A 4PYGA 1TJGH 2H2SD 2EE6A 3CDCA 3SE3A 4K7PL 1XMWA 1B6DA 1JF1B 2J6EA 5D7LD 4OZHA 3LRHA 4HZLB 1AE6L 1H8OA 1NL0H 3B9AA 2DTMH 3O4LD 1QA9B 4P23B 1RJYA 1VSCA 4XWOD 3T4AA 3EYQC 4JM4H 3RAJH 3CVHA 3E1F1 4MAYC 2VH5H