5IEKA

Structure of hla-b*40:02 in complex with the endogenous peptide refskepel
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-40 alpha chain
publication title Structure of HLA-B*40:02 in complex with the endogenous peptide REFSKEPEL
rcsb
source organism Homo sapiens
total genus 75
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iekA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5iekA01
4J12A 4UUJB 1V7ML 3MRBB 5HHMA 1NCAH 4JAMB 4XPTH 4E41A 4BZ2H 4JJ5B 1ZTXH 3L9RB 1I1FA 2ZCLH 4PJIA 2E6JA 2X4RB 1NMBL 4F7TB 5IBLD 2B1AL 2IBBA 1MIEH 2DWEA 2OZ4A 3CVHA 1NCNA 4M9OA 5DEGB 4DKDC 2EXWD 5AZ2L 1AIFB 4V3EB 3G6AA 2MNUA 2ZUVA 4U6TA 4X6EA 1FJ1B 4UZGA 5D7SH 2VDKH 5FYJU 3GMMB 3OAYH 3T77A 3MREA 1MAJA 1FN4A 5KSUA 2CXKA 2ILLA 3T0WA 2H9GA 1BZQK 1B0RB 1HQRB 2HT3C 4G6AC 1BVLB 5FXCH 4OLXL 2CLZA 4BYHA 5E1AA 1YC8A 4L4VE 4KHXL 5DJZA 3SDXF 1ROWA 1G9NC 2Y9RT 4MNHA 5DJ6A 5IW3A 5I75B 3JWNC 3VXPA 2AEPL 2F54A 3FQXB 1EFXB 4Y2DD 1A1OB 4JKWA 4YEEA 5D1XB 4F33A 2E9BA 2M26A 3U79A 1FPTL 5EG6C 2OI9B 5D5ME 1AFVL 4PRBA 3P2TA 1I1YB 3VH8A 1MHPH 4KJPC 3WUZA 5EU6A 3E2HA 4QRRA 4R26H 5E9DD 1FAIH 4AEHH 1NLBH 2VZ1A 5J06A 1OGAA 4U1SB 3RL1B 5CD3A 3QCTL 1KB5H 5DRXB 3WIHH 1ZT7B 4LLMA 4GAJH 3CAFA 3ZYJA 35C8L 4MDJA 3ZYZA 1FLRL 2J88L 1ZHNA 1XZ0A 5IJVA 3RKDD 5KVDH 2BHYA 3LOWA 1F4YL 1Q0XL 3O4OB 2VDPH 4NHCL 4XNYH 3T0BA 3WDJA 2YS4A 4KKAD 2FGZA 3QO0B 5IBUB 3PIQB 5KG9B 4LCCC 3O4LE 5A2KH 4P2QD 4NCDA 1T6WA 3HLAB 25C8H 2ADIB 4WI2A 3WJLC 4L9LC 2P5ED 4AYFA 4ZPTB 3L5JA 3TVMA 2R0ZH 3ECBA 3DHMA 3U0WL 1MEXH 4XMPL 4M4PA 4CN1A 2VLLB 5CFHA 2EE9A 3QBTB 4JEGB 5ICXA 4KHTL 3UZEA 3CFCL 4FXKA 3CMOL 3D85B 1NC2B 2DYPA 4P2OC 3VFNB 4YHIA 4MNQE 3O81A 1ZA6A 3V0AC 2FR4B 2BSRA 5E8DH 2JK5B 1NEZA 4P2YA 4KROB 2P8LB 3HAEA 3RVXD 2HLFD 3WS3B 4J3WA 4GSDL 5ISZD 1FNSL 3BAEL 1KXTB 1BZ7B 2APFA 2APXA 4PRHB 4U6YB 5C6TL 5JDJA 5MP6L 1S9YA 1WC7A 5FYLL 3MRJB 2ZCHH 4H20L 2V6HA 1FRGL 5EPMB 2WBJB 4ZFZA 3I3EA 2R29H 4PJ5B 3MFGB 4MCYB 2Y5TA 4MQ7B 4EVNA 1FDLH 5C2BH 3VFUB 4UIKL 3RVWD 3F7YA 1U8OA 4LLAA 1CR9L 2DQCL 5A3ID 3QI9C 5C08A 3SGJC 4PP8C 1EUTA 4XWGL 1ZHBA 3AMKA 2OYPA 4RMRA 1A4JB 4HQQH 1ED3A 4L4TB 4KRMB 1DBBH 5IKCA 4HUVA 4N0CC 4I1NB 2I5YL 4NQEE 1DQJA 1CLYL 2XA3A 5IHZB 3VXQA 5B4MC 3ELAT 3RIFK 2P45B 1CFVH 5F89B 2HWZH 1UJ3A 5DZLA 4ISVB 2GTWA 3KPSD 2AJYL 2JKXA 3NA4A 4JN1L 3TN0A 4MA3B 4B41A 1INQB 4PJAE 3QP3A 1QACA 1A7OH 4Z7UF 3RA7H 4HIEA 8CGTA 2WAHA 3QUXD 4DZBB 1SVCP 3PHQB 3RWFB 2GK0A 3IKCA 4OZGF 5D6CA 1WAAA 4MXQD 4X4YB 3WYRA 4LIQH 1T1YA 1RIUH 2VL4A 4U2YA 3GMNA 2E8YA 4JQVA 2EIZA 3QIBB 2CD0A 1IGTB 4PP1C 5HGHA 4E0RA 2HVKA 1A1NB 4ZS6D 3UMTA 2OP4L 5DUPH 2PYEA 2PW1A 4NO0B 4KWUA 5IFHH 1A7PL 1X4XA 2EKSA 4I0PA 3UP1A 5GGRY 4NO3B 1YJDL 3GJFH 2GUOB 3BQUB 1PG7H 3DX6A 3VI4E 4XCYB 4Q6IB 4HIIB 4WVRA 2DQEL 2DM7A 3HE6D 4QRPA 3SDCB 1C5DB 1MRDH 4RCAA 3RDTC 2E27H 4HWUA 1PY9A 2F8OA 4S1DD 4P23B 2M2DA 4HUMB 1MJJB 5F6HI 3IRZA 1Q9LB 3QRGL 2WBKA 5E0QA 3VFVA 1WBZB 3EO0A 4XNUL 3QNXB 2P48B 3HR5A 2IH3B 1VCAA 4PUBH 1RULH 2I25N 2W07A 1G1YA 1WSST 5IEHB 1ZV5A 3LIZH 2A9MH 1RAMA 4FABH 4U1IA 4RBPH 4U6HA 3Q6GH 1H15B 4Y7MA 3ARBB 3BN9C 3K2UL 4LRNL 2H6PA 5DQJB 4L3EA 1MCOL 4QNPE 1K4CA 2BOCA 1ZT1B 1KYOK 5E5MB 4Z7WB 2AERT 3ZYIA 5JO5A 3NPSC 1U3HA 4X8XA 3RZWA 2I60L 3MNWB 2QQNH 5TH2B 1T7XA 5GGQH 4Z8FH 2ZSWB 1RFDH 1E4XH 3QNZA 4WTXA 3MV9E 4WHDA 5C0ND 1A3LL 2XY2A 3QDMD 4PJFF 2VMFA 3HE7C 2Q8BH 4C58B 3MBXH 5IUSA 4JO4H 4M7KL 1B4JH 3U83A 5IV2A 1XF1A 3FZUC 1XF2A 2YXFA 1D6EB 5BZWA 4R96A 3L5XL 1JZ5A 3JUZA 3MRCA 3F62A 4NJAH 1U8JA 3SCMC 4R4ND 1VGEH 1HXMA 5I18L 2YD1A 2J5LB 3DBXB 1QA9B 2AK4A 4YHMH 4P9ML 5FA4A 4PB9H 2XV6B 1F11A 4ONFH 1WT5A 3OX8A 2F5BH 1SY6H 1Q94A 3LKOA 4KJQC 3SDDC 2VSDA 2GJZA 2DQFA 2R69H 3PWPE 2I24N 5CSGA 2ATKA 5C0RH 3RVVD 1IARB 4WNQA 2CGRH 5FKAB 2VKXA 5GRZA 1YDPA 3OV6A 2EXYD 1X6NA 2DTML 1OW0A 4J3UA 1A6ZA 3I6GA 4NO2B 5KZCB 2YPLA 5A2FA 4F9PC 2JJTA 3L5IA 4JDTL 3SY0B 3ARFB 1AI1H 5JR1H 3FQUB 4IDLA 5DT1L 5F44A 5H94A 3SO3B 3G08B 3GB7B 3GSXA 3GSQA 3VFPB 5KW9L 3DMMC 5KN5B 1J5OL 2GSIB 1I8IA 3OXRB 1J8HE 5BRZE 5JNYA 1RY7B 5ITFA 2X4UA 2R23A 3S36L 4JCMA 1JPSH 4IRSB 3ILQC 1UZ8B 3BOVA 4ZUWB 4MHHG 4A6YB 3O6KH 4XXCA 5DC0A 1B6UA 1BFOA 3T3PF 4WV1A 2VLRE 4BH7B 1KIRB 1G7PA 4K71B 5I30H 1T0PB 4YO0A 3T1WA 3K8KA 3DO3A 3LQMA 4PJEB 4RNRA 1IM9B 5ERWA 1NGWB 4Y8AA 5ADPH 4J8RA 4ZQKA 3B2UC 4JR9L 1KTLB 4L8DB 1ES0A 2FCBA 4WDIB 5C0FA 3SE4A 2P46B 4JO1H 2ZOLB 1FVDB 3RWEA 3DSFL 4M03A 3UDWA 1A9BA 3AROA 4A2MA 2XZCL 3MROB 2EDJA 1FH5L 1ACZA 4JRXB 3ULSA 1K8DB 2H3NA 5J11C 1FL3B 4QHNA 1G0YR 4RQQA 4OZHF 5JQ6H 4G8IA 1F4WH 5DD1H 1QQDA 4Y4KA 4PJ9B 5JLZA 5DLML 3CLEH 4UB0L 3TO4D 1DBML 1I7ZA 3B9EA 5L88H 1JJUA 4RA3A 3AM8C 4DGYH 4M6NL 3GO1L 1VSCA 2YK1H 5DHVH 3IXAB 4XHJC 1XIWC 1EXUB 1Q9KA 3ES6A 1SHMA 4PJ7B 3WEXB 1NCDH 3SOBH 5HDOA 3C8DA 1JGLL 3MV01 1CLZL 2DTSA 3QUMH 4JDVA 2XG4A 4XVJH 5F7LB 3SQOH 1S78C 3FB7B 3MV8B 4DN3L 4KI5C 1FV1B 2NW3B 5ESVA 2MQ3A 1T7VA 3SPVA 1NUDA 3AC0A 3W11D 4I3GA 5D93C 4YPJA 4G9FD 2C3HA 2MMXA 1CVSC 4HJ0D 4PGCB 4H26A 3BHBB 1WISA 4ZFOA 5DYOB 4UDTA 2KPNA 1FGNH 1PZ5A 3G6JB 1LEIA 5KS9A 1TQBC 1T80A 4Q2ZB 2R2CA 3KPLA 3HRPA 1JGVH 4XNQB 5E6YA 5TFSL 1RU9H 4GG6A 4JO2H 2R1WA 3IDMB 2R2EA 4Z7VE 1HH9A 1FC1A 4DGIL 5C09D 4P4KA 5E5UB 3B9AA 3IF1B 2V5RA 3MRPA 2Y06H 3UYRL 1NC4D 4S2SB 4OZ4A 1HXYA 4WUUE 4MAYB 3QUYB 1U0QA 5IB1A 3TBYB 1I3RB 5GRUH 2AV7B 4ZTPL 3DROB 2R8SH 4TUKL 2Q20A 1MH5B 4R2GB 3MOAL 4CU6A 1CGXA 1ETZB 2BNQB 3P77B 1MCNA 4I8DA 3V2AR 2Y5EA 2NY2C 3MRGA 4HUXB 4LVNB 4XPBL 1U8QA 1OPGH 2EE2A 3ARGD 1GAFH 3DVNB 3FT3B 1J10A 1A7QL 3UO1L 3H9YA 1F42A 2VH5L 2YA2A 3MLXH 1WWCA 1FZKB 4UV7L 4BFGA 3S34L 3M8OH 4YIQB 4XBPB 4UQ3A 3QJHB 5K9OB 2HMIC 4IRJD 1E6JL 3B9KA 4S1QL 4WI7A 3T2OA 1Q9WA 4LHUB 5LQBL 4IHOA 3H9SB 4U4BA 4N5EA 3TBSA 1T2JA 4TYUA 1YEKH 1FZMA 5BS0D 4EOWL 4OSUH 3MA9L 3Q5OA 4PRHE 3UZQA 5F3HB 3B83A 2OZ4L 3CVHL 3TO2B 3K8LA 2EIEA 1MI5D 2ESVE 4BSJA 2Y6SD 1ZWIA 2CIIB 4QXTA 5ICZA 4XAKD 4Q9BA 4XGZA 4FNLH 5B3JF 4PJ5E 3L95A 2CLRA 4UQ2B 4EN3B 4U3XA 2EC9T 1LK2B 5IB3A 4O58H 4MJID 4FP8H 1NDGB 3WE6A 1N8ZB 2M1KA 3P4NA 4MB3A 1T6VN 1BMGA 3EYQC 1R3IH 2FNBA 3QPXH 3RGHA 4FFWC 2GJ6A 4QTIL 3RY4A 2GCYB 3QWRD 3VXUD 3HUJF 4NDMB 4KZDL 3NFPA 4L4TE 3KLSA 3ISWA 4NRZA 4BUHA 3OAYK 2Z8VC 3QIWD 5E2JA 5JMOC 1K2DA 2IG2H 1OP5K 2YOCA 1IGYB 1XAUA 2G60L 2C7UA 3PNWB 4XBGA 2CRYA 4YBQC 4OI7A 4PJHA 3N1GC 4R4BB 3ZKND 3VFTB 1MCPH 3EZJB 5F9AC 1BBDH 4XVTL 4XRCB 3MNZA 2VOTA 1BD2B 4DOHB 4HT1L 2Q7NA 3ZSTA 5F9JA 3ZKXB 2DRUA 1AGCA 1N5AB 2ZSVB 1GRWA 2GI7A 1U8HA 4UV4H 3SKOA 4Z7QE 1G7LB 1J7VR 5E00A 5GRXG 5C0AD 1EDQA 5L0QB 5GRYA 5GIRB 2IPKB 2ZUQC 1ZLUH 3M1BB 3TJHC 4AEFA 1L4IA 5FDYA 7CGTA 1F4AA 3F8UB 3RU8L 4UDUA 5J56B 4OLUH 1OAQL 2Y36L 3FN9A 4OB5L 3AU1B 3DRQB 5J3HC 3WUWA 4R0LC 3QRFM 5HYQB 4JLRB 2A6IA 5JDSA 4OZFB 1Y6MR 4HX1B 3VGBA 1Q38A 3PV6A 2F58H 4PJGB 4ZOBA 4L5FH 4LCCA 1AO7B 3HZYA 2JB5L 4NZUL 1IKNC 1FFOB 3WJLA 3LN4B 4L9LA 3NBNA 5F71A 1FFRA 1RZ8A 2NY7L 3NCJL 5FF6B 4TRPH 4HD9A 5L2JB 3QUZD 4KKBC 4Z7WE 2VYRE 1HEZA 43CAA 3GBNH 3D5OF 2Z93A 1MHEB 3ESUF 3MRRA 1CFQB 3PWLA 1X5AA 4P2OA 1BEYH 4YDKH 1YN6B 4WY7L 2QSVA 1I1AD 1TFHA 4HZLB 4JHAH 3UTPD 4P0DA 2BJML 1IAMA 1M7IB 4ODSH 4PRNA 1RHHA 1QSEE 1FZJB 3RVUC 3UTTA 1CXKA 5FHAH 1R3JB 1T0MB 2NZ9D 1C08B 2Z31B 1JZ2A 5IBTL 1OARH 2WV3A 4L8BA 1V3LA 3KR3L 1QBLL 2BDNH 2PXYC 5C3LD 4HFWA 3HB3C 4OD2B 4LQ1A 5DMKB 3TT1H 5KSBA 4UU9B 5EUKB 4LBEA 5GS3A 4APQD 4GAYB 4AJ0A 2HT4C 3CPLB 1BQUA 1U2HA 2DQDL 3QI9A 4M02A 1EZVX 1J0JA 4Q58C 3SGJA 2EE6A 4PJCF 2BOBB 4W6WB 5DJYA 3EGSA 5IB5A 4Z0BL 1KC5H 5KAQF 3HC3L 3NIGE 1RVFL 1Z0MA 4MCZB 4WU7A 4N0CA 5IBUG 2XI9A 2DDQH 1UWGH 3HI6H 5DS8A 3SO5A 3KJ4B 2CJUL 1DN0A 1F6AA 4EI6B 1D9KB 3I02A 3PL6D 3T2NL 2XKNA 3OG6B 1Q9OB 1YEGL 1L0YA 1VADA 4G7YH 3DYOA 5JHLH 2YZ8A 3NABL 3FB5B 4K8RL 1AQKH 3RIAK 3FO0L 3QXWA 4X4XA 4PV9B 4HEME 4UAOC 5T3ZD 4NNYB 5I1HL 4FZEL 1SJHB 5E8NB 3P9LB 5KVGH 2VN4A 2VXSH 5SWQA 4K23H 4JGUA 4U1GC 2FJHA 3KPRD 3P0YH 1EEYB 4OCWL 5CSZB 3Q5YA 3REVA 3BE1H 4QHKJ 4U1HB 5D6DC 3QDAA 4L4JA 1X6LA 5MI0C 2DQHL 4D9QD 1N6QH 3ULUD 1M7DB 3GJFK 5J6GA 4JDZB 4DVRH 2IGFH 4PJEE 3QEGH 1YMHB 5F7EL 4HIXH 3A6CL 1CL7L 1IGCH 4QRSB 4CKVX 1WQVT 1A0QL 3FO9B 3U6RA 1AR1C 5IR1A 2NY5H 1HN1A 4PGJA 4Y5YC 5TQ2H 4BZ1H 1LQVA 1MJUL 4KGLA 4X83A 3RDTA 2A1WL 4ZO8A 4P5KB 1IAIM 5IW6A 4NQSB 1EEUA 1OLZA 1P5VA 3HMXH 1JWSA 2COQA 2XTJC 4JRXE 3TJEL 5DDHA 1DL7H 4X6BA 3WIHA 4P2RD 1R3KA 1MRFL 3C2AH 5EUOE 3LDBB 5F1NB 1J1OH 2CSPA 2IH1A 3OMZA 3KYKL 5HYEA 3SKMA 3DUSA 2H2PC 1FNGA 4Y2OA 4LAJH 1MCWW 3TYGH 4BSWB 1NMAL 4PJFB 5A2IH 4XI5D 2EEDA 1OTTC 5IGXL 5B39A 4PRID 1S7TA 2OXHA 2OR9L 2Q6WB 1JN6A 2CQVA 2QSCH 3MUHL 4LCIH 3IETA 2YD7A 4U31A 3X11B 3WD5H 4QXGH 1ADQH 4MD4A 4LSUL 4JZJC 3T0AA 4XPGH 3WSQL 1YYML 1UWEL 3HE7A 4Q97A 2HT2C 2VDNL 3INUL 5C7XH 2FGWL 1G7MB 2HG5A 1GJIA 5HHPB 1UACH 4YQXH 1G6RB 3SCMA 1ITCA 3G6JE 3QQNA 4I18B 1RZFH 2HFEB 5B38A 1LEGA 3H42L 5EC2B 4KKLD 3FCTA 3HZMB 4NM4L 2IADA 2CDGB 2F53D 2Q8AL 1RUQH 1CXLA 4BA8A 3GI9H 3NFNB 1IAOA 5F6HJ 3SDDA 2FHCA 2MKWA 3UEZA 4X7DC 5LBSL 4AK1A 4U1NB 3CSPA 1IJ9A 4NKIH 1LP9A 4QRUB 1KT2A 4JFOA 5DFTA 4FFZL 4WRLA 1UVQB 4HKXB 1U8IA 4G6MH 5FA3B 4OGAC 5GSVB 3T0XA 1A3QA 1QG3A 5FO9A 3DRTB 4F9PA 5FDWA 1I4FB 5HGDA 4ENED 5CBAA 1T5XA 1AXTL 2BNQE 3KVQA 4JKPL 4X5XA 5DZOA 5EZLA 4HHAB 3DMMA 4KKCC 1FORL 4Y5XC 4HIHA 1FYTA 1P53A 3WN5B 1IAII 1TJGH 2H41A 2MOVA 5D2NB 4DK3A 1NUFA 3C5ZD 3KPQB 3G5YA 3MUJA 3TIEB 3ZE2E 4Y19A 5ALBH 3EYVA 5GGTH 3O3EB 5AUMB 3PWVA 3IFPB 4M6MH 3VXSA 4X7CC 1ORQB 1IQDA 4N0UA 4J3SA 4NN7B 1F3RB 4NZRH 4M1DL 5EIVA 3PQYB 5GGSY 1J1PL 2HH0H 3V6ZB 3DETC 5J7CC 4WW2F 2YEZA 3H9SE 1PJ9A 4K3DH 1OM3L 3KPPA 3OZ9L 1IGJB 3IDXL 3EYUH 2BC4A 1T3FA 2DOCA 4WU5A 5EO0A 1MVUA 1E4JA 4YBHA 1YQ2A 4P59H 4WFHE 5K9QG 5EA0L 3MTRA 3BPNB 3JTTB 3MLWH 5AAWA 3R8QA 9CGTA 5T1MA 3RWCA 3GJFA 4X0KB 2NY5C 2Y72A 5SWZA 2W0KA 2AJ3A 3SDYL 2GFBB 1CQYA 2AQ3A 1T5WA 3OKOB 5T3XE 1JWMA 1IL1A 1KJMA 4MMZC 3TP4A 4OIAA 1FVCB 2CDFA 5I75C 1ZHLB 2BY3A 5KJRH 2X4OB 5FYKL 2OL3H 4ZODA 4ZFOL 4OF8A 1EHLH 3D2UB 2MPAL 3EYFB 3VXTB 2OI9C 4GRLD 1HZHL 1JCKA 2AXGB 1H8OA 1XIWA 4QY8B 3LEVL 4PYHA 4TSAH 5LXGL 1ZE3C 4ERSL 1X4ZA 3RY6C 1JYNA 2M8XA 1PSKH 4WHCA 2BSSA 2QQLL 2WY3A 1MFEH 1JL8A 2ZUYA 5C9JA 3GGWB 1QPXA 4K7PL 2AQ2A 2NLJA 3L3JB 1HDMB 3RZCD 4HK0A 4MWFA 3LY6A 4HMCA 2I26N 5L7XL 2APVA 2YSSA 3K7UA 2P8PA 5L6YH 5AYUH 1BD2E 1P1ZA 4DOHE 5JOFB 4D8PA 3NCYP 4C54A 1D5XA 4Z7OF 4S10A 1NAKH 2FX7H 1T83C 2HN7B 4AIZB 3VD5A 2BRRH 3JV4A 4G9DA 1YMMA 1S7RA 4OAWA 7FABH 4P3DB 1CF8L 4MA8H 4Y2DB 3MJGX 3MBED 4M61A 4PRPA 5MEND 3VXRD 1S9XA 4AG4H 2VZUA 3JTCA 2X1XR 1DQTA 3MXWH 3PP4H 4MDIA 2X7LB 3ZE0F 1MFAL 1J0IA 4FQHB 4F8QA 4QHLB 1HHKA 1VFBB 3LSOA 5E9DB 3V6OE 4CU8A 3OSKA 3BEVA 5E4IA 1YPZF 5TDNB 5FK9A 3I6KA 1LO3H 1TVBB 4M7JL 3MLSH 4NBYB 4AEEA 3GHBH 1RSFA 3WIFB 1OAYL 4YXLL 1D5IH 5TGBB 3VRLE 4H25A 4ZUVA 2WBJC 1KFAL 1EJOH 4PJGE 3H3BC 1TZHA 3D3VD 2AKRA 4U33A 1D5ZB 1LO0H 5CGTA 5I1EL 1S7UA 4LCUB 1KB9K 3EYOB 1JGEA 2P5EB 1J0ZA 1JPTL 3CFKA 1UZ6E 3MJ7B 4QYOA 3BPCB 1Z9LA 5T1DL 3AUVA 5CHNB 4YNYB 4CNIA 1XGPA 2EDLA 1B6DA 3ZL4H 2ICWA 1OB1A 3WKML 5J89A 4I48B 4ZTOL 5CINL 2FHFA 4N1HB 5EN2A 4XXDA 1ZANL 1BECA 1FNEB 3QDHA 3V7AE 2ADJB 1O7SA 3V4UL 3IU4H 4PLKC 5HGGS 5FM5O 3WJJC 1MFCL 3OGCB 5ISZB 1H3VA 1V3MA 1XH3B 1DEEB 2NY3D 4O2EA 3DECA 3U2SA 4W68A 4KK8D 4JY4B 3MLRH 1KGCD 3X3GH 1NBVL 2FO4B 4KRPD 1P7KA 3RUGB 3BKYL 3BUYB 3I9GL 3HUJB 3BP7A 3W39A 5EIQA 2AI0L 4YJZL 4HV8A 4R7NA 5GGUB 1G7JB 5I1GL 5IFJB 3J8F7 4NRYA 3HNSL 4L4VA 3CZJA 1KTDA 1KG0B 3QDGA 4ELMA 5GQBA 3V5KA 1FNFA 1WBXB 3QIBC 4NN5B 4AM0B 3SGDI 1BVKB 1AGDA 3TV3H 3HRZA 2YXMA 4XVUC 1BAFH 3ETBF 5D5MA 3DV4B 5DUML 3VFGL 5IF0B 1XCTA 1KCVH 1G9NL 4Q0XH 4OJFH 4L29B 3BQUC 4LLVB 4Y1AD 2R0WH 4YGAB 2D7MA 5SV4A 3SDCC 4GUPB 2VR5A 1CDUA 3LKSA 4P23C 3MACL 1GYAA 2VITA 4HC1H 1QZ1A 3QEQD 1J86A 3WLWC 1WZ1H 4YGVA 3KPSB 4HGWA 3EYSH 4R4FH 2CK0H 2BNUA 5GHWL 3S3SA 3PXJA 1HYRC 3QXTA 4LHUG 5MHSE 1AGEA 4FQCH 5ITBL 3QUXB 5F7DB 1IKFL 4GKNB 1ZVYA 4R3SA 1TCRB 5F96L 5HI4C 4CMMA 5IHUL 3ARBC 1QBML 2CR6A 1W2KT 1AXSA 2Z91A 4YR6B 5E1HB 5DR5H 1JF1B 2V2WA 4YHKH 1JRHL 4OIIL 5EOCL 1ZLUK 1MLCB 1NQBA 1TENA 2LAAA 3QPQC 4L1DA 2HJKB 3RGVD 1I8MB 2ZUWA 3G6DH 5CEYA 1CDIA 4OQTH 3EO1B 4YE4H 5BO1H 3TJHA 3TPUA 2BHZA 5FV1L 1P84J 3WXWH 3HZKB 3VFMB 3BKJL 1LDPH 5KTEH 3HE6B 3ZDXF 1MREH 4KVCL 1N2RA 4ZAKA 3OJDB 2W91A 3GMQB 3VGGA 2XN9E 2DD8L 3ULUF 3FONA 1U8PB 5DURD 5BQ7B 1IEHA 2AJXH 3S5LB 4R0LA 2NZIA 5CP7B 5DMIH 4D0CA 4NFCA 4V2BA 1IE5A 2J5LC 5IESH 4LVHB 2OSLB 5DRZB 2A83B 5TF0A 1IKNA 4KK6D 1HI6B 4HUUA 4LOUC 2OK0L 2X2YA 4D2NA 1LK3L 3KXFB 1NL0H 4IS6A 5ESAA 1N59B 5FO8B 1OWRM 5C0CD 5GS1B 4TVPL 4WCYH 2AXHA 5IB4A 3JXAA 1KBGH 5MERB 1N3NA 4G8GA 1QFOA 3MRKA 4Y8DC 4GRMB 5GJSL 1GIGH 2BVPA 1H3GA 2FBJH 5ALCL 3C60D 3MRHA 2H2SD 1ITBB 3ARFC 2BVEA 3QDMB 1CDHA 5CS7A 5FGSA 4WW1A 1GGTA 4PJCB 2E9JA 1JUFA 5CMAB 1IM3B 4RWYH 5DRNA 2PXYA 1J05A 1ZTXL 4YHLH 1N6UA 4RMWA 2VIRA 1H0DA 5JXAL 2Q7YA 4IRSC 3HCVA 1MIEL 4P46A 3EO9L 3G5ZA 4HAGA 1OSZB 4ODVL 3TYFB 3KPMB 1T1XB 5D7SL 1OP3H 1T1ZA 1F3JA 4K71C 5EO9A 1MWAB 1U3ZA 3PV7A 1E28B 4X5LA 4Z0XB 2CO6B 1KENL 4OZFG 5CZXC 4TPRH 3OHXA 4YHOH 3FN0H 3QFDB 4LP4A 2ERJB 1MHHB 3VFWB 3BI9X 4E42A 1IMHC 2BCKB 3MV7A 4NCC1 5D2LB 1T1WA 4OLWL 4GQPH 3K81A 4MB5A 1O0VA 4K7FB 5T3XH 3T3PE 5LGHL 2DLGA 2PCPB 4NQVA 4XCCH 2VLKE 5EOTA 3SDAB 1KN4L 5IT2H 4BM7A 4F57L 4XT1C 1RURH 3PHOA 4XBEL 4YFLF 1XMWA 2DQIL 3TC9A 4LSPL 5JUEL 3F7QA 2QEJA 3QQ3B 4ODXB 2J8UF 3V7AG 3LKPA 1FVEB 4LARH 3WIHL 3QG7H 2EE3A 4XPFL 4D9RE 4GAJL 1YEIH 4YDLB 3TBWA 2AEIT 1INDL 3FQWA 3PQYE 4M62H 1CD8A 3BWAB 4UTBH 2VXVL 3BISA 2I07A 3CH8A 2X6MA 2UYLB 3IFOB 5C0JB 4F7CA 4MQSB 1OVZA 5IW1A 2UVFA 25C8L 3RWIA 4IJ3B 4R97B 5I1JH 3CU1A 3G9VA 4KDWA 4NJ9H 1TVHA 4NYLB 4LPVA 4MX7A 3FFCD 5I17A 4IRZL 4Y5YA 5CLTA 5DFVC 1ZT4B 2V2XA 1XGTA 3BYYA 1MCJA 3BKCL 3FOLB 1HYSC 1VFMA 1GZQB 4O51B 2SEBA 2HTKC 1W0VA 3U0TA 4MNQD 1AY1H 1YEEL 4QHMA 3O9WB 1F58L 3IJSA 3TO4B 3NFSL 1RZKH 1QYGH 3FOMB 3EKCA 4YHZL 4IOIA 1FE8H 5DVNA 5GGRB 4HKBB 1C12B 4XP6L 5EO1A 1RZJH 4XMLH 1NFIA 4K9EH 3HMWH 4QO1A 2Z8SA 1Q1JL 4MAYC 4HMDA 3IU3A 3QUYC 5FYKU 3V0WL 1EJ6A 3EJYC 2FX8H 4K94H 4TQEH 3DGGB 1LEKB 5TDPB 3REWB 3QEHA 2ICEA 1YNLL 4JZJA 2VQUA 1F3DJ 4I3RH 1QO3A 4MYWB 2WWMD 3EDKA 1RIHH 1OTSC 5LVEA 3VCLA 3PWNA 3O41A 2BVQA 3QA3B 4GT7A 3OXSA 4LVNC 3EHBC 2P7TA 4JPIA 4DUXA 2PW2A 2VC2H 2F9BT 2DKUA 1HSAA 2RCSH 5GS2D 5BZDB 4AQ1B 5KVEH 4Z76B 1DEDA 1TZIA 4TUJA 3D87B 3MGTA 4OM1H 3OAZH 5EIIA 4HGMA 4FFVD 4G80A 2YR3A 3ORJA 1GC1C 4NQED 3NCCB 3LN5B 2HFFA 2PO6B 5I2IB 3IJHB 2VLRA 5CWSA 2E7BA 3FQRB 4PTTA 5E5RB 2ATPA 4CUCA 4YX2H 5I1LB 1A2YA 1IZKA 3MNVB 3VRIB 1KCRL 1NC4B 1OT1A 1KCUH 4B7IA 2C26A 1EX0A 1A7OL 3OKNB 5DTFB 5FKPA 3C6LA 3ALWA 3MZTA 5IOPA 3AXLA 2ICCA 2ARJB 2HKHH 5IVZA 3LZFL 2JCCB 4XCFL 1RIUL 1CICD 3NN8B 4QRTA 3PG2A 4C83B 5DJ0B 2EDHA 3KPTA 3ERYA 4GAFB 4Y5XA 4MQXC 4EN3C 3PWUA 4W6YB 5JPNB 3O8XB 2EH8L 5E8OB 2H32A 2BSTA 5DF0A 2H45A 1QKZL 2FEDC 2JJUA 4HCRH 3ARGB 3RPKA 2ARJQ 2YPVH 1WTGT 1UT9A 1P7QD 4QWWC 5CIPB 5GSRB 1MRDL 3MRBA 1XGRB 1T7WA 4WWKA 4JAMA 5I6XB 5A16B 1FBIH 2W60B 4KGJA 2B2XH 5AZEH 2PN5A 2B20A 3DX8A 2X4RA 2Y1VA 4IRJB 1DSFH 3V4PL 5HYJD 5DEGA 4WFFE 5DD0L 4U6XB 2FEEL 1AIFA 1RULL 2C4FT 1ZLWH 3TBVB 4ZUSB 2NY6B 1FJ1A 5I1KH 1A6WH 1C5CH 5BS0B 3ZDZE 5AWNH 3MRFA 4HKZB 3Q6GL 1CGUA 3X14A 1HKLH 1Y18B 3RUGE 1XF4B 4LEOB 1MI5B 1HQRA 1SM3H 3T4AA 1W72A 1BVLA 1JPGB 3QQ9D 4I9WE 3GMRB 5J4MA 2O93L 1Y0LB 4UNVA 3GSVA 2QQNL 2AK4D 4MJIB 1RFDL 1E4XL 3HMXA 2RB8A 1UKSA 4ETQB 2CUMA 1EFXA 4KZEH 3HKFA 1A1OA 4OCYL 5L0QC 2R9HC 3MV9D 3D18B 4UINH 3VXUB 2OI9A 1I1YA 4JO4L 1FG2B 2D31B 4YXKH 1I75A 2EYSB 1RUMH 1RZKC 4URTB 3RIAF 4POYA 3RY6A 4U7SA 1NJ9A 5DRXA 1A9EB 2YPLD 4PY8I 2H26A 4NP4H 4ONFL 3KPSE 4JPVH 2F5BL 4K94C 2WUBH 2FSEB 4M1CD 3QO0A 1IGIH 2QL1A 4L3CB 2DIAA 1YYLL 3HLAA 4PLJC 2CGRL 4LFHG 5DJXA 3PWPD 4PG9A 4DW2L 2YUZA 4UT7H 1T83A 3VGHA 1YPZB 4NWUL 2VLLA 3MX0A 2R15A 2NY0D 3MRDA 1CE6B 3D85A 4XNXL 1NC2A 5JR1L 5DJ2B 5C0AB 3VFNA 4RRPA 4X7FC 2BVUA 1T20B 1ZLSH 2FR4A 4OV5A 4DKAA 1K8IB 2JK5A 2P8LA 2W0PA 1J8HD 3WS3A 2RJMA 1G6RH 4Y16D 1S3KL 3DVGB 3VW3H 5CILL 2Z31C 1MAMH 4PRHA 4U6YA 4HPYL 5GJTL 1KEGH 1LILA 3MRJA 5C07B 3KLAB 2D0GA 5JW4N 1K4DB 1JGDB 4MS8C 5EPMA 3EOBB 1P6FA 2WBJA 1KJ3L 1HSBB 1ZK9A 5DMJB 3UJJL 2AJSH 4NQDD 5IFAH 5ACMA 3VWKB 3VFUA 5ADPL 1MCEA 4HF5H 1K9TA 3TLRA 2XZAH 3KXFE 4OCRH 2YMXH 3QUZB 2CK2A 1J1XH 1XEDA 4PDCE 4JFFA 1A4JA 4MQTB 2F8XC 3LPWA 1FZOB 2A6JB 5GGTA 1I1AB 4F7EB 3KJ4C 2NW2B 4P3WA 3FT2B 3NIFF 3MXVL 5IHZA 2VABB 1D9KC 4WFEE 3GIVB 5ID1A 3W5MA 5F89A 3UPAA 2YPKB 3WJJA 4FTVE 3RVTC 3CLEL 2VXTL 2AP2A 4PJCE 3NZ8A 1UM4H 2Y07H 1CXEA 4GW5B 1INQA 4DGYL 3UC0H 2XWBB 4TOYH 4DZBA 3PHQA 3RWFA 4RMTA 1WITA 5LCVH 2YD6A 2J1KA 1F4XH 4AENB 4GMSH 4APQB 3QIBA 4U2ZA 1XGYH 2Q76A 5T1KB 1QPPA 4CVWA 3H0TB 1IGTA 3TEUA 1A1NA 3UX9B 2WP3T 1G9MH 5D96B 4NO0A 2Y23A 4IOFD 4NO3A 4JVUA 2GUOA 3BQUA 4HIIA 3B6SB 5E7FA 4EXPX 1Y6NR 3FJTA 5D2LE 3E1F1 1KPRB 1VKXA 3QCVH 3BGAA 1IGML 1YUHA 3V95A 4LSVH 2XWTA 4P23A 4GKZB 3G9AB 1RU9L 2DN7A 4JO2L 1Q9LA 2DLIA 3IAQA 1WBZA 4KH2A 3QNXA 5D1XD 2IH3A 3BZEB 3FHQA 4JANB 2ZG2A 2BY2A 5CKAA 4DVBA 1UWXK 3LDBC 4JZNB 4Q9QL 4NKDB 3WCYA 5KVFH 1NFDA 1H15A 5ECJE 3RI5F 3ARBA 3KPRB 5HI3C 4WUUD 4QF1B 4HJJL 5DQJA 5LWYH 1ZT1A 3S9DB 1C1EH 3IDGA 5E5MA 4MXWL 3MLZH 2P43B 4PY7B 1JYVA 2HJLB 4MA7H 3MNWA 5I19H 1JVKA 5TH2A 1CFTA 3FQTA 6FABL 1PEWA 1QTYT 1QFWL 2ZSWA 2DAVA 5IHBA 1OAUH 1D6VH 1U8LB 1HKFA 2G75B 3GRWA 5JORB 1OHQA 3OAUL 1H3PH 1GAFL 4PJXE 3TZVD 2FIKA 1HILB 2ZPKH 1LE9B 3LRHA 2FWOB 4YUEL 5D7JD 5I8OH 3BZ4A 2H1PL 4EI5C 2FATH 3N50A 2J8HA 5JXED 4JFQB 5JHDB 1D6EA 4M93B 4I18C 3U4EB 3EAKA 4KTDH 3HG1E 2E9WA 3VJ6B 1I9RH 2OS7A 5IMLA 4P2RB 1QA9A 5IMMB 2ZCKH 2V7HB 3OPZH 5H37H 4KROD 5IEKB 3RAJH 4MSWA 3BP6A 4I4WB 2RGSA 4OSUL 5E6ZA 3HPLA 4M8QB 3VA6A 1ZA3B 4S1SL 3KYAA 4NUGH 4PRIB 4GAGH 1MFDH 4X6CE 4H1LH 1NCWH 4ZO6A 5HYSB 1AGBA 2J8OA 1A22B 4OM0L 5FKAA 5JIIA 5C2UB 1GOHA 2DIJA 2ESVD 2OBGA 4FNLL 1B4RA 3LEYH 4DKFL 2XFXB 2IAMC 4KPHH 4NO2A 4O58L 3SY0A 3ARFA 2HVJB 3LD8B 1N26A 3FQUA 3D6GA 3G08A 3GB7A 2FL5B 4OLZL 1N7MH 3VFPA 1AE6H 5KN5A 2GSIA 2ORBL 1I9IH 1B9ZA 3OXRA 5D2NC 2O5YL 3U7YL 3BGMB 3DXAA 2IF7A 5TE6L 2GSGA 1DZBA 1DQML 4L4TD 1KACB 3D69B 3P73B 3CDCA 5I8KL 1RZ7H 1UZ8A 4TUOB 2FYYA 4ZUWA 5DJAB 3F5WB 4CN4A 4A6YA 4OF7A 4O2CB 1F3DH 5D7IE 5IQ9B 1DJSA 4HXBL 4NN7C 1ZVHA 2F53B 1VB9A 4KMTH 4BH7A 4RGNC 4J4PD 2D4FA 1UCBL 1FO0A 1QSZA 1MCPL 3S5LG 4PJEA 2MHAB 1IM9A 1NSNL 4X9HA 4LPYA 8FABB 4GMTH 3MQIA 1KTLA 4L8DA 5D9SA 4WDIA 2R2BB 2ZOLA 1R0AL 1XGUA 2JCCE 1FVDA 2J8UB 2WQ8A 3BPNC 2F19H 4UV4L 1KCSH 4NZDA 4L8CB 3EDJA 3L3IB 1RUPH 5IM7B 1CXHA 3MROA 5GZOC 1GGBH 1FL3A 2Z4QB 1R5IB 5ETUB 1CCZA 3C5ZB 1YEHH 2D7TL 3RWDB 4DQOL 1S7QB 1SBSL 4Y4FD 4HC1A 1EVUA 4PJAF 3UTZB 2C9AA 1KUMA 1IEAA 3NOIA 1A4KB 1G7HA 1A02N 1BGXH 1AD9A 1XR9B 2NYYD 3RWJB 1PEZA 1T66D 1EXUA 2B0SH 4PJ7A 5IBLC 3WEXA 3WS6C 3ZHKA 3UTQB 1YY9D 2A74B 2VLJB 5KAQG 1PX3A 2A6DA 4XNMB 5BVJA 2EXWC 4XP5L 2LQRA 2RQ8A 4EKXA 1PGRB 2F58L 3AFLA 3DURB 3MV8A 2HJFB 4M43L 3KWWA 4NZJA 3F7VB 2VL5B 4LF3B 2NW3A 3VI4F 1DVFD 2UWEB 4H8WH 1A3RH 3BSZL 4OLVL 4E9LA 5DD5L 3SEPA 4CJ0A 5C0BE 1OAXH 4H88L 5B22A 1MI5E 2JTDA 3QH3B 3R1GH 1F13A 4PGCA 4M3KB 1PDKA 4UOW1 3BHBA 3EOYG 1DBJH 4WUKL 3M17B 5DYOA 1AKJD 2Q3AA 3IFLL 4NHUE 4IDJL 3G6JA 4O02L 3L5WB 3KYNB 4Q2ZA 1BQLL 2CPCA 3GNMH 3PP3K 2UZYB 5I71B 1ZGLP 2K9UA 4XNQA 1ZGLA 2MCPH 4Y2DC 1RJZA 4G43B 2XG5A 1BIIB 1QSED 2BMKA 4GRLB 3IF1A 3H3PH 4OF5A 3LN9A 1P4LA 2OXGA 3OQ3B 4KQ4H 4QNPF 3ARYA 4S2SA 2BDNL 1IC5L 4MAYA 1MFBL 1VESA 1V7NH 4FA8A 1Z3GH 4NM8L 1KB5B 3TBYA 1I3RA 3RPIA 2AV7A 3E8UH 3DROA 3ARWA 4QCIB 2FJGB 1FFNB 5DD3L 4AMKL 1MH5A 4HWBH 4JHZA 5HHNB 3RKDC 1U42A 3ARED 3RZCB 1ETZA 2BNQA 4KKAC 2IMMA 1WIUA 2AABL 3K4ZA 1ZS8A 4HUXA 2R1YB 2FB4H 3K8MA 1HQ4B 3GBML 4M48H 1IBGH 3DVNA 1KIQA 3FT3A 1KTKE 4F7PB 5BV7H 1JZ4A 1U9KA 3FMGH 4KI1A 3OKLB 1DBKL 3HNVL 3BZFB 3IDUA 1FZKA 2WWKT 3EFDL 1NAMA 4YIQA 1CG9A 4XBPA 5C0AE 1B2WL 4MNGB 3MBEB 1MCSA 4PGEA 5K9OA 5MENB 1I8LC 5DA0B 3VXRB 5JHLL 3U1SH 5KSAD 1AQKL 4FMFA 2YA0A 3AGVA 3H9SA 4U1KA 3U0PA 4WI9A 1QRNB 3RVXC 2HLFC 1MPAL 1T89C 3NTCH 3TNMB 5B8CB 2VXSL 2QSTA 4XPAH 5F3HA 2WLZA 3P0YL 1FNHA 5C07E 12E8H 3TO2A 1YNKL 1W0WB 4U1LB 1I85C 3W0WE 2X41A 1IC4H 4JY5L 4PD4K 4ZUTA 3S37H 4JHWH 1NMCB 4UQ2A 4EN3A 3MGAA 1MWAH 1S5HA 3D3VB 1LK2A 4HIXL 5I1AA 5EORH 2ZOKB 1IGCL 2X4PB 1N8ZA 4NN5C 3RVWC 1W72L 2IPUK 5A3IC 3OKEB 2HRPH 5EZJB 4KAQH 4Z18A 4BZ1L 1C7SA 3QUKB 4KXZI 4D0BA 1CI5A 1YA5A 1Q0YH 1OSPH 2QKIA 3HMXL 4NQCA 3P40A 2BXZA 1EAPA 1DUYB 4WHTB 3V5HB 1EEZA 1R5VA 4XMKL 5SWSE 5ADOL 1DL7L 4JRXD 3V6BR 2GK2A 4X80L 5DJDA 3SDXA 3HFMH 3PNWA 1C5BL 2MFNA 2CMRL 4PJ9D 5DK2A 4OGYL 3WFHB 1LVEA 2NY3B 4R4BA 5AD0A 3VFTA 1B3JA 2DLFH 5D7LB 5EZIH 4CJ1A 1VGKB 4KRPB 4XRCA 4NKOB 4BQ8A 4MD5B 1LO4L 1BD2A 1PD6A 1G0XA 4FQXB 4KC3B 3QUXC 2NNAB 2DI8A 2K7PA 3FHAA 1U92B 5F3BB 3GSWB 1N5AA 1IAKA 3MLVH 5I1DB 2ZSVA 4MXQC 1V3KA 1OAKH 4PTUA 5GGSB 5IVXB 1T2QH 4K3JL 5FGRA 1G7LA 5F1IA 4OCNC 2CKBB 2I27N 4J1UA 1ZVSB 4EIZC 5GIRA 2G9HB 1RK0B 2C3VB 3MO1B 3M1BA 4XAWH 2VDMH 4DTGH 4RX4D 4YHYB 5IIEB 1NBYB 1UACL 4Y1AB 3PE9A 4JRWA 1RUKH 3HE6C 5DSCB 4FOMA 1A14L 3VG9B 3AU1A 3DRQA 4S1DC 5F7HA 2V17L 1R5WA 3QEQB 4NC1C 4G8EA 5HYQA 3MZGB 2V9RA 3EW3B 1FFQA 1DBAH 4OZFA 5DWUH 4HX1A 1GL4B 3W9DB 1FYTD 4ALAH 2V7NA 1DE4B 4LVHC 1AO7A 2BVTA 3Q6FB 4Q7DA 1FFOA 4JY6A 5HHOE 4PS4H 5ILTH 3KPRE 1AP2A 3T8XB 3Q1SH 5FF6A 1KF9B 3ZDXE 5L2JA 2BERA 4X7EC 3MLYH 1RZGB 5GS1C 1BIHA 4NT6A 2D0HA 3B5GA 2EECA 2UUDK 2D9CA 3RGVB 1F2QA 2CIKB 1QRKA 1DQDH 3P11H 2PETA 3SE9L 4GBXD 4R2GD 4YXHH 4P3CH 4Z7VF 4HZLA 3RL2A 1TJGL 4RMUA 3KJ6L 3KS0J 1PAMA 5DUBB 1JNNH 1M7IA 4YC2B 3LH2H 3WO4B 5C0NC 4Y4HD 1MCBA 4P49A 1R3JA 5BJTB 5ALBL 5T1LB 1C08A 2Z31A 5GGTL 3TT3H 4NPYB 4MVBA 4M6ML 2UY6A 5JHDE 5J0BA 2X70B 4LEXL 3BH9B 5DURB 2OQJB 4MS8A 3CZFA 4R4NC 5DMKA 1K3IA 1NPUA 4ODUB 2BNRB 4NNPL 2F74B 5E8PA 4UU9A 1M6OB 1WFTA 5EUKA 1UYWH 2R4RH 4OGZA 4KVNL 3RNKB 3SGDH 2RFXB 1R3LB 4GAYA 4P9HH 4PY8J 4X7TB 3CPLA 1FQ9C 2VAAB 1RMFL 3PABB 1U58B 3BP5B 5MEPB 3JTSB 3L6FB 5HHMB 2BOBA 4PRIE 3ZE1E 4P59L 3P9MB 1F8TL 4KMLB 5C0CB 1XR8A 5D70H 4NWTH 4WFHD 3RVVC 4PR5A 1E6OH 1HINH 2ERJC 4JZOB 2AK1H 2EXYC 5TE7H 2R0KL 4FHBD 5HI5D 4EI6A 3G6AB 1D9KA 3C60B 4OZGA 4ZDHB 4X6EB 4PB0H 4KQ3H 1CXIA 1HOCB 3T77B 5T3XD 4CDHA 3QXDA 5KSUB 2EYRB 5CIPH 3U36A 1G1CA 4F58H 4PJDE 4PJBF 5ANMA 1MQKL 4NNYA 1SJHA 5E8NA 3P9LA 1D3CA 4NCC2 5CCKH 1P5UA 1ZSDA 3QCUH 1PSKL 1EEYA 5DJZB 4K3GA 5CSZA 3KYOB 4MNHB 4U1HA 4YDLC 1S5IH 3KPOA 1TTUA 1M7DA 5JOPD 4JDZA 5A2JH 4PRAA 5DFWH 1JTOA 4JB9L 5CSBA 3VG0H 1A6VL 4ETYA 4LCWA 3E2HB 2Z92A 5L6YL 5AYUL 3FO9A 4IJ3C 4R97C 1FG9C 1JFQH 1OGAB 4PP2B 3WFDL 4G42B 2BRRL 3KGRA 5J57B 1NGXA 4XCNA 1WV7T 1NLDH 4MDJB 3TFKD 3O6LL 1ZHNB 1XZ0B 3N9GL 4KV5F 3L7EB 3GRWL 4JG1H 4AG4L 3MXWL 4K7PX 5F1NA 1D7FA 1OWWA 4LSDA 3TO4C 3ECBB 5ICYA 2J4WL 3ARSA 5DC4B 4PJFA 2FRGP 1L7IH 3EOTL 3PWJA 3H3KA 4FXKB 2XIDA 3V7MA 2NMSA 3MLSL 4XP1L 2Q6WA 4O2FB 5DHVB 4TSCL 1INEH 1D5IL 4Z7QF 2VLJE 2A9NL 3X11A 5L9DH 3KHOA 2PR4L 1CGWA 5HGAA 1P9MC 3S88H 5F7UA 4U49A 2UWEE 1JPFB 3FFCB 5JIKA 2BXYA 1KELL 5J1TC 4G5ZL 2C1OA 3W11C 4EI5A 4V1DA 4HS8H 3VDCA 2YD8A 4HJ0C 5HHPA 3MLUH 3EFFB 2OJEA 3FB6B 3PGFL 3MA7B 3B2VH 3HI5H 4ZFZB 3VDAA 5EOQL 5EC2A 3BKMH 2Y5TB 3K74B 1YECL 2VDLH 5C71A 3H7BB 3IU4L 1U8OB 3N1QC 2CDGA 1B88A 2XPGA 4PREA 1ZHBB 2IANE 3NFNA 3L3DA 4Z78A 1I1RA 3MLRL 2DIBA 4U1NA 3X3GL 3CDGA 3IJYB 4P9HC 4A6YL 4FQ2H 1CGYA 3MLTB 4Z7WF 5IKCB 1UVQA 4LLDB 4HKXA 3HC0A 5D1QD 1FO0L 5FA3A 1BVZA 3MFFB 2IAMA 5GSVA 1DQQB 3DRTA 3JV6B 1JWUA 1I4FA 3MRNA 5JPMB 1CK0H 5F21B 1H3UA 4RDQF 3V6FA 5K9JL 2GTWB 2V5SA 1RHFA 5INDB 4TSBL 1UEMA 5D2NA 4JGMA 4WW2C 3KPQA 2N7BA 5HHXH 3TA3C 3TIEA 4HIEB 3ARGC 4YDVB 4GRWE 4Z7NF 5D6CB 1NCCH 3IFPA 3H7LA 1T1YB 3ROOB 3GMNB 1ORQA 3SHSA 2EIZB 3G5XA 4NQEB 3CCHA 4HC1L 3VXRE 4TN9A 3ZTNH 3O6ML 3CD4A 4E0RB 2HVKB 1AGFB 4IRJC 4R4FL 2PNDA 1QRNE 1TJIH 1IGJA 4OZHA 5JW4R 3NIGF 4LDLB 3CK0H 3OF6D 4P5TD 1LO2L 1V7MH 4ZAKD 4X4ME 2LVCA 2Y6SC 1CICB 4XB8A 5J3HD 3L3OB 4UMGA 4X0KA 1U8KB 2B1AH 3U46A 5FGBC 2GFBA 3G6DL 5FCUH 4X6DE 4GXUN 5AZ2H 5HYSG 3OKOA 1EV2E 1MJ8H 3L3KA 1FVCA 1JYWA 3B5TA 4U6HB 2JJVA 1P7QB 4AEIL 4DGVH 1LDPL 3D2UA 5I1IH 1BQSA 2ADFH 3EYFA 3VXTA 4KKBD 2AXGA 2E7LA 3N1FC 2H8PB 4NSKB 5FO7A 4ZS7H 2X89D 4OLXH 1EIBA 4DCQA 2AJXL 4J3OC 4QY8A 5DMYA 1ZLVK 2XN9D 3WS6A 1KJ2A 4BQ6A 1MHCB 5HYJB 1KJVB 3QIWC 1KXVC 2BY0A 3NCMA 3DI2B 3L3JA 1HDMA 4OTXL 1UH2A 4WO4D 3T0ED 1FPTH 5D7LE 3ZKNC 1G9EA 1KGCE 1BF2A 1MOEA 2VXQH 4GXVL 5IV2B 4LVEA 1NL0L 2IBGA 3RNQA 4FQLL 5JIHA 5JOFA 3O3DB 1P6AB 3GMLB 5C3TA 1HXMB 1NKOA 4P46D 2HN7A 3A67L 1IFHL 5GS0D 2AK4B 1QR1B 5IVXE 35C8H 5EUOF 1FLRH 2J88H 2OCFD 2ZWLT 4P3DA 1HNFA 3U7AA 1Q94B 3LKOB 4NHCH 3MV9B 1L7TL 2GJZB 1DFBH 2X7LA 3DWTA 4IEFB 4FQHA 5KOMC 4QHLA 1VFBA 4Z5RA 4Y1AE 1CLCA 5E9DA 1GC1L 1NAML 1YDPB 4PG2C 5TDNA 3U0WH 4XMPH 5FUOL 3MV7D 2X1WL 1A6ZB 1TVBA 2YPLB 1OQXA 3CMOH 1IVLA 1JPST 3QEQE 5H94B 3WIFA 2VSCA 5TGBA 2N4IA 3VXOB 3QJFA 2P4AB 1G7IB 5EU3B 1D5ZA 5F7MC 4BKLA 4P2QA 1K5NB 4LCUA 4GSDH 2YZ1A 5GPRA 2P5EA 3PWPB 1FNSH 2C4XA 3BAEH 4F3FB 1A1MB 3SGEI 5C6TH 5DRWA 5IMOB 3BPCA 3QUZC 4YDIL 1MIMH 4NKQB 2NY0B 2IFFL 5CHNA 4TNWF 4H20H 1MFNA 1S7SA 1RUAL 4WV1B 1FRGH 4P57A 1I8LA 2XWJB 4I48A 4WGWB 4XVSL 4WTWA 4FG6C 1I1AC 1UXSB 4RNRB 2VWEE 1FP5A 1FNEA 2VLKD 2X1OA 3FO1A 4NC0B 2ADJA 3WHE1 3F58L 4JFYB 3DIFB 5I66B 5MEOB 2DQCH 3OB0H 4EDXB 1BLNA 5ISZA 1T89A 1ES0B 3GI8L 4XWGH 2NZ9C 4Y16B 1JHKH 1JMXA 4KTYA 1FL6B 4HG4K 4LARL 4JY4A 1CD1A 2MJWA 2MQ0A 3QG7L 4PGDA 4LQFL 3HUJA 4HFUL 1A9BB 1I85A 2Q3ZA 1UM5L 3TH2T 4D9RD 4UTBL 5GGUA 3ULSB 1G7JA 4DKEL 3KS0H 2H3NB 2BNRE 3AS0A 5IFJA 3PQYD 1F02I 1TJHL 4NQDB 2RAMA 4RQQB 1CZ8L 1A6UL 1I3UA 3HI1A 4Q74A 5F7KC 1QQDB 3LB6C 1KG0A 4APQC 4AM0A 2XA8L 1BVKA 5ACZB 5I1JL 4NJ9L 5HHME 1I7ZB 1EUUA 5L2KA 2L0DA 5BOZG 3ZE2F 3FFDB 3QYCA 4E41E 4JN1H 3IXTA 5C0CE 2DMBA 3VXNB 3S96A 2A73B 5D96C 3RP1A 1ORSB 3LMJL 4PJIE 5IF0A 1PX4A 1Q9KB 4M1GL 4L29A 4NZTL 4UILL 4LLVA 1OY3B 5CEZL 2RR3A 3LQAC 1I8KB 3D9AL 4ZMAT 4HIJB 5F70A 3GFUA 4J3XA 1QEWB 3PL6C 5FUZL 5EBWB 4ODHL 1QBAA 3GK8L 5EZOH 3UYOD 1RZKL 2OP4H 4HUKB 1ZEAL 2UZIL 1A7BA 3QDJD 4HWEL 1A7PH 2FJFA 3NIDE 1AJ7L 1YJDH 4DK6A 3QUXA 4WI8A 2DQEH 5F7DA 4GKNA 1TCRA 3W2DL 2CUHA 4J3VA 4MXQA 3VFSB 4K94L 3KNBA 4XZUB 1JF1A 4G6FD 1IC7L 2F54E 2IFGA 1MLCA 1RIVL 2R1WB 3QRGH 3Q5TA 1BQHG 3ULUC 4GH7B 4XNUH 2R2EB 1HH9B 2EDNA 4P4KB 3EO1A 5DMGD 4YWGL 3VRJA 2OR7A 1CE1L 4LSSL 4QRRE 3MRQB 3EJZD 2LAGB 3KPNB 1HXYB 2VC2L 1OGAE 3C6LD 3HZKA 3VFMA 3DUUB 2AEWA 3K2UH 3HE6A 4LRNH 1MAKA 4AT6B 5KVEL 3N1PC 1MCOH 5HJ3A 2E5EA 4LHQB 3GMQA 3NCEB 1U8PA 5BQ7A 3TBTB 3S5LA 4IOSD 4QKXB 4R8WL 3U4AA 4M93C 5CP7A 4YBLB 2I60H 2X4SB 3H2WA 2EC9U 1F4HA 2P44B 4Z7VB 4KUCD 5DRZA 5JMRA 2A83A 1A3LH 1HI6A 4HWBA 4CVXA 3SKJH 4M7KH 4WUUB 4XI5C 2WQRA 2RIKA 4WWKD 1F00I 5FOJA 5GS1A 1T7ZA 5F9WB 5E6ID 3BMWA 5KANI 1KIPB 3SKUD 3WXVL 1FIGL 4N1EA 5I18H 5EU4B 4GRMA 3DETD 3SQBA 1Q9WB 1LMKA 2AS5M 4P9MH 2VRAA 1FNLA 3TBSB 3LD8C 3C87A 3FFCE 1GHFL 3BO8B 3QDMA 3TZVB 2YPVL 4GRWH 5D7JB 1IGFL 2PKDA 4C4KT 4OUUB 4HLJA 4PJCA 4HULB 1OAZL 1IM3A 5F9DC 1FBIL 4CMHB 5ICZB 3LEXA 4QXUL 5C6WH 3VRLF 1GVIA 2CLRB 2DTMH 5I16B 4FFEX 3ARZA 1OSZA 2BY1A 4KKLC 4PGBB 4PJGF 4JDTH 3RFZC 3KPMA 4NC2B 5DT1H 4WFFD 5I1KL 1IEBA 5C08E 3WDIA 3KLDA 5AWNL 4FQJL 1J5OH 4ZNCD 1P4BL 1UZ6F 5TF1L 5I1CL 4Z0XA 4S0UC 4X7SL 4QHKI 3S36H 4PJBB 3A6BL 4U0QB 1MHHA 2ESVB 1O7VA 2APWA 1J18A 2AJVL 2BCKA 4I9WD 1FGVL 2F15A 5EB9A 3MYJB 3C8KB 1RK1B 4POZD 4ENEC 3KLHD 2YA1A 4PJHB 3DVIA 2DWDB 4FXGB 3QULB 1Q72H 1BOGB 3C5ZC 4TVSa 1HNGA 3B8YA 4JR9H 3MJ6A 2BP3A 1GPOH 4X98B 5F9JB 1T7YA 1RUML 1KPUA 1JZ8A 2HP4A 2XXCB 1X7QB 1MY7A 1WAAE 3QQ3A 1SEBB 4ODXA 1U8MB 1TETL 2WUCL 4NKMA 1FVEA 1NCBL 3BJ91 5BCAA 3DSFH 4JRYD 1YN7A 4Z95L 3O2VL 3QIUD 1YJDC 3SKOB 4CVUA 1FH5H 1C16B 4JFZL 3BWAA 4EUPA 3OKDB 3CJJA 5FCSH 5T5FL 4EZMA 2UYLA 5CGYD 2WUBL 1QSFA 3IFOA 5DLMH 5GRVK 4UB0H 1RI8A 3FRUA 5C1MB 1DBMH 4QRPE 5CBEB 4NYLA 4MD0B 4UT7L 4V3DB 5D1ZD 3GO1H 2X42A 1ZT4A 3C6SB 4RSVA 5ENWB 4LLYB 4I13B 2BVOB 5I9QB 4BK4A 1JGLH 2JB6B 5LAXB 1RZIB 2CKBH 3HHRB 3FOLA 1GZQA 3ULVD 4O51A 2FEEI 4K55A 4DN3H 1A5FH 1FLTX 4Y4FB 2PTTA 1T0NB 3TO4A 3QZWB 1R24B 4F37K 2OL3B 3FOMA 3VW3L 2JELL 4GRLC 3RBGA 4HKBA 1C12A 43CAB 1KEGL 5GRJL 2GY5A 4MAUL 2AXFB 4P2OB 5HYJE 2QR0A 2AJSL 3DGGA 4O5LH 3BD5A 5IFAL 5TDPA 3REWA 1P9MA 5TFSH 1RHHB 5E56A 5BVPL 5C0IA 2C1PB 3L5HA 2B39A 3HC4H 1DVFB 2I9LB 4N9OB 3RZCC 1VERA 3IB4A 3UYRH 1MVFA 4W70A 5I0ZA 4G9FA 3FO2A 2DQUH 3KXFD 2EEBA 2P5WA 4HFWB 2YN3A 1AKJB 2FZ3A 5BZDA 2AK4E 2KKQA 4Z76A 2DI7A 4ZTPH 1NGZB 4LRIC 4TUKH 3GMOA 3LV3B 2DQGL 3MOAH 1AQDA 4WFED 3GSNA 3IJHA 3MBEC 3FQRA 1QSEB 1CDYA 5C09A 3WV0A 4FTVD 5I1LA 3MNVA 3ME0A 4WU7B 5DTFA 4TOYL 5B8CC 1A7QH 1CT8B 3UO1H 2ARJA 2ZUTA 2VH5H 2YPLE 1F6AB 3RWGB 4P4RB 4UV7H 3EDEA 3K3QA 1K6QL 5HBBA 4M5ZL 5FYJD 3A6OA 1F4XL 4RISL 4GMSL 3NN8A 4Q9RL 4LLQA 4C83A 1NGPH 5DJ0A 3AREB 4S1QH 5LQBH 4N8CH 2BRQA 5FECA 3WNLA 4WW2A 5E8OA 1L9MA 1TMCA 4PPTA 5BOPA 4HZAA 1EK3A 3TA3A 3ARGA 1KYOJ 4EOWH 5L8KB 3MA9H 5J13C 2FJHB 2VISB 4G3YL 2ICWI 5JW3H 2NY4D 2LVEA 4GW4A 3REVB 3TWCL 2F8VA 2O5ZL 4S0TD 5A16A 1KIUA 3E6FB 4XNZB 2QV2A 1S8DB 4YPGA 1MCLA 2EYTB 3P9WB 4IRJA 3E3QE 4GOSA 2EEAA 5KSAB 1N4XL 3SDAD 1PY4A 4C56D 3VD4A 4YDJA 1FHGA 2J6EA 5D8JL 3TBVA 4ZUSA 1DLFH 4WENB 3RX7A 4HXAL 5IR1B 3O45B 5BS0A 3NAAL 1CQKA 4HKZA 2X9YA 2NY3C 3MRLA 1EO7A 1KJ2L 3RDTB 4LSQH 2AV1B 1Y18A 4KK8C 4CDGC 4KZDH 1XF4A 4KRPC 4KJWD 4LEOA 3VWJD 1X5FA 2XOTA 3I50L 1C1EL 3MLZL 1JPGA 3KYMB 1QFUL 4QGTA 5FGBA 3VA2C 4NQDE 3O3BA 1Y0LA 4FS0A 3ZO0A 1VHPA 5F1SA 4F9LC 4MJIA 2G60H 4TULL 32C2A 4ETQA 3SKMB 2XYCA 3GM0A 1FNGB 1H3PL 4WI3A 5T33H 1VPOL 3D18A 3HPJB 3PHSA 3QWRA 4XVTH 3VXUA 4BFIA 3CH1B 4LL9A 2QLVB 2VLMD 1EO8H 4JM2D 2D31A 4HT1H 3ZLQC 4YHYC 3CX5J 2EYSA 3CXDL 3BIBX 3T1FB 3NPSB 5CGMA 2EO1A 5DHYA 4ODTL 5TE4L 1M7XA 3QIWA 3LKQB 4HEPG 1HHHB 3VG9C 1X44A 1B0WA 2W0LA 3HG1D 4UT9L 1BFVH 2ZCKL 3OPZL 3X17A 5EUOB 3ZT7A 1GH7A 5DEFB 4PIRF 2DM2A 3O9WD 1HWGB 1MY5A 1Z9SA 1NKRA 3MOBL 5K9KB 3IYLW 2IALB 1NCTA 2FSEA 4L3CA 4GQ9H 3O2DH 3SCMB 1V8HA 3CFEB 3RU8H 5B38B 1LEGB 1OAQH 1YPZA 3SJVD 5HSFA 4ZO7A 4N9GB 4K3EL 4PBWD 2IADB 5E70A 4PV8B 4FZ8H 3RGVC 1FNAA 5D72L 4S1RL 4MHHI 1T20A 2JB5H 3O6FD 1LP9B 4YC2C 3M45A 5ELIA 4BQBA 1ONQA 3WO4C 4PG2A 3CFBA 2NY7H 3NCJH 1GXEA 3DVGA 4GG8B 3MRMA 4W6XB 2EO9A 2VUOA 5SX5K 3OR7A 3I6LD 2FECL 3KLAA 1UA6H 4LSTL 1O5DT 1K4DA 1JV5B 1JGDA 5HGDB 1T5XB 2NXYD 5CLWA 4HMEA 5EZLB 3DMMB 3EOBA 1CBVL 3C09C 2G5BA 2PO6D 4HIHB 1FYTB 5DGQA 3CSGA 2BJMH 1QFWI 5AEAA 4KK6C 3BRDA 4GMTL 3AAZB 4JFDD 2MKLC 4JVWA 4KXZH 5IBTH 1XF5B 3CFDB 3QUZA 5DJCB 3KR3H 1UH4A 3AS1A 1QBLH 2O5XL 4N0UB 2F19L 2PF6A 5E2TL 3LRSB 1FZOA 3EBAA 2A6JA 1RUPL 1RJCA 4GBXB 5BMFL 1I1AA 1TVDA 4KUCF 4F7EA 2ADGA 3V4VL 2NW2A 1A6AB 4DUWA 2ZP0T 3FT2A 4LDOB 1YEHL 1KNOA 2VABA 3C60C 4M6OL 5CP3A 3GIVA 2BC4B 3ROLB 2H2SC 3NMEA 3O8XD 1L9NA 4Y4HB 4MGXA 1MVUB 1PQZA 5GS2H 1U6AL 1QLRA 4GW1A 3WHXA 4Z0BH 2CLVB 3HC3H 4GW5A 1RVFH 3RWCB 5EBLB 1KLUA 1GGYA 2AJ3B 4JPKL 2CJUH 1XT5A 1UB5B 3D39D 1T22A 2HFGL 4JFPB 3VFRB 3TNNA 4AENA 2CDFB 4APQA 1YEGH 4FQQB 3LS5L 4S11A 3H9HB 2GJ6E 3ZSSA 4TNVF 5EOCJ 2NY6D 3NABH 3F6LA 5C0GB 4K8RH 4O4YL 3H0TA 2CUIA 1E4WH 3FO0H 3BMVA 5AYQA 5I1HH 4PJBE 5E99H 2EDKA 2IPTL 5C0BD 1XIWB 3UTOA 3JV5A 4TTDD 2B1HH 3D0VA 3B6SA 4NRXB 3O3AB 1OD7A 2QADD 1MCRA 4I2XB 4OCWH 2BSSB 1KPRA 5M7QA 3WFEL 2B4CH 1L0QA 1JMZA 4DAGH 3PL6A 2DQHH 3UJTL 4ZOEA 4GKZA 1QP1A 5EU7E 4OKDA 5H35A 4PJHE 2E6QA 2AVGA 4HK0B 3ZDZF 2A0LD 2VAJA 3BUTA 3V5DB 5KSVA 1U8NB 5F7EH 3BZEA 2DKMA 4JANA 2YSSB 3STBA 5BW7C 3RUGF 3MJ9H 4JZNA 4AL8L 4NKDA 3BDYH 3VE0B 1WVZA 1MJUH 1TQBB 2A1WH 3KPRA 4QF1A 4RFOL 4N0YH 4B0MM 1GCFA 3MRIB 1FAKT 4KV5E 4HWBL 4M61B 1S9XB 2HJLA 1IAIL 4GS7B 2FD6L 1H9VA 4X4ZA 4OBRA 2PTUA 2YUVA 1EGJH 3BEVB 1QLFB 4HS6A 5JTWA 4M48L 1NMAH 3BPOC 1HILA 3CMGA 1LE9A 2FWOA 3FMGL 5IGXH 4LDEB 3FL7A 5FAAA 3JBG7 2OR9H 3FQNB 2R2HA 2APBA 4JFQA 1I7UB 5EC1B 2DMCA 1FL5A 4H25B 4JO3L 3U4EA 1TIUA 3VJ6A 2EZ0D 4P2RA 3U1SL 2NTFB 2NY2B 2AKRB 15C8L 4GLRI 2ARWA 1NGQL 2V7HA 4LSUH 3QO1B 4ZO9A 5IEKA 1YYMH 3T2PA 2YKLL 3CFKB 1UWEH 2Q86A 4I4WA 2D4DA 3SGKC 4M8QA 2VDNH 3FTGB 4UBDD 3INUH 4XPAL 4CNIB 4O9HL 3GM8A 2F5AL 4QOKD 4R7DA 4TTGA 2ICWB 1PKQB 1II4E 5DXWA 5I76A 5C07D 1IC4L 4JGJA 5J1AB 1GGCH 3H42H 3V52L 1KCGC 3W0WD 1MQ8A 2XFXA 1Z5LA 1PFCA 4NM4H 5IK3A 1A8JH 3UTTE 1MCFA 2HVJA 3VWKD 2Q8AH 1QNZH 4HDIA 5EBMB 4XP9L 2FL5A 2WWMC 3QQ4B 5LBSH 2GAZB 3QXVA 3BGMA 2VR4A 5GGVL 1IC1A 1E27A 4FFZH 2VTFA 4IBLT 4R7NB 5ESQB 1CD9B 5KSBE 5LGJA 4X9FA 3D69A 4RIRB 5DK0B 3P73A 5J8OA 1OF2B 3GMPB 1PG7W 4TUOA 5HD8D 4JG0L 3PGDA 5CZVL 3F5WA 4FFVC 6CGTA 4O2CA 4ELMB 2IEPA 5SWSD 5IQ9A 4RFEB 5CEZD 3OKKB 2F53A 4JKPH 2B8OT 1FORH 4CW1B 1E4KC 2DLFL 4PRDB 3IDIA 4NGHL 4U0RB 3UPRB 2R1XA 8FABA 4OZIB 3OB8A 3HS0B 5C9KA 4NUJB 3WKNA 5F7FA 2PUQT 5D1QB 2R2BA 4Z7NE 3MLVL 4BFBD 3LKSB 2J8UA 4M7ZC 1FC2D 4KK5D 1SJEB 4L8CA 1CICC 1DDHB 4M1DH 4OQ1A 2AJZB 3IFNL 5AG9A 1BWWA 1I7RB 4OT1L 2V9QA 5T1KD 2VDRL 3RJDA 1OM3H 2Z4QA 1R5IA 5ETUA 2B4CC 3C5ZA 3OZ9H 3RWDA 3B9DA 3IDXH 1S7QA 5I73B 2VDML 3UTZA 2D03H 2BVYA 1KV3A 3B3IB 2XY1A 4CMMB 1G7QA 4X6FA 2Z91B 2VXUL 5EA0H 4JREB 4PFEA 2V2WB 4G7VL 2FHBA 1H3XA 1XR9A 2X4QB 2KQNA 2WWKO 1OTUD 3SDYH 2YBRB 3UTQA 1DBAL 2A74A 4D3CL 3C8HA 4XNMA 3QHFL 5E24E 2ZUQB 5JA8B 4RWHA 3DURA 2CO7B 3TPUB 2HJFA 1JZ7A 5DI8A 1KEML 2VL5A 4LF3A 4YK4B 4P5TB 2MPAH 4LK4A 3Q1SL 2P24B 3D0LA 4ZAKB 5HHOD 5IWLC 1JNLH 5D2LF 4MVBD 3MLYL 3QH3A 1SYSB 3UBXI 1SEQL 5DZNA 3LEVH 1V05A 3QQ9C 4ERSH 1U93B 3E6HA 2EDXA 2QQLH 3L5WA 1PZUB 3KYNA 4P3CL 3GUTB 2W65B 4XCEB 1BZ9B 4QTHB 4UT6H 4JPWH 1JNNL 4FQ1H 2YUXA 5DJ8B 4XC3L 3LH2L 3R06B 2ITCB 1BIIA 2VZOA 3OG4B 5L7XH 4HH9A 3TT3L 4GRLA 5ESAB 3HN3A 4OFIA 4C57C 5IB4B 5FB8A 1L6ZA 1N3NB 1F90L 5JHDD 2XN9B 5ABDE 5CJQL 3GSNL 3WMSA 4RBPK 2DM4A 3I2CL 3VGEA 3VD3A 1KB5A 4JFED 2R4RL 1E0OB 4QCIA 1CF8H 3NCFB 4P9HL 2FJGA 1FFNA 3U30B 5HHNA 3CLFL 4KY1L 4G6JL 3T0EB 4WO4B 5K93A 3RZCA 4XPHH 4PJXF 1S9WB 2L4OA 5ID0B 5JW5B 1IQWL 2A77L 4OCSL 1JUFB 4JM2F 3QWOB 4JKLA 4M1CC 1G0DA 4QRQB 3S35H 1HH6B 2VIRB 3B4NA 1HINL 2X10A 4P46B 4F7PA 3OKLA 2E6PA 3BZFA 1YNTB 1DQLL 2NY0C 4LRIA 5FYLD 1OAYH 4YXLH 2X9XA 5CKGA 1NFKA 2P49B 3BT2H 4MNGA 3MBEA 3CVIH 1KFAH 5MENA 5EO9B 3VXRA 4D0DB 2KL6A 1KPVA 1AH1A 4P99A 3E3QC 4F58L 1LP9E 1I3GH 1I7TA 1PYWB 4LPTA 5DD6B 3OHXB 1F2XK 2L7UA 4X6CF 5FV2A 1MF2L 1JPTH 5FUCE 5SX4I 4Y16C 5CCKL 5T1DH 3MV7B 3QZWG 1HHGB 4X4MA 5K59E 2VDQL 1SQ2N 3HNTH 3RJQB 1W0WA 2J6EL 4U1LA 1S5IL 3IGAB 4ZTOH 1W0YT 1FYTE 3W9EA 4LP5A 5K33A 2VQ1A 1ZANH 1NUGA 3D3VA 3PHOB 4OFYD 3V4UH 4YAQA 2X4PA 3ILPB 3MPCA 4ZSOB 4Y19E 2IQAB 3MUZ1 1JFQL 4W81A 3OKEA 5EZJA 3VXSE 3TH4T 1NBVH 4N0UE 3JSSA 3BKYH 3U9UB 3I9GH 1UC6A 1NLDL 1BM3H 5GRVL 1F6LL 1A7NL 3FQWB 5D7IF 2ZKHL 4LSRL 1J0KA 4NQUA 1I9JL 5I1GH 4J7RA 3V5HA 1DCLA 4L8SB 3U9PL 1CFNA 4X9GA 2VLKB 4F7CB 5IW1B 4RFNB 1T03L 4CADA 3WFHA 5I17B 4YZFE 2IJ0C 1QR4A 5DUMH 2EDDA 3VFGH 1VGKA 2V2XB 1ZXQA 1XGTB 2JCCF 4NKOA 3UZVB 1G9NH 4WEBH 4MD5A 1LGVA 1CLOL 4RDQG 2W92A 3B9VA 2HLAB 2NNAA 4R90H 1U92A 4ONOA 4LPUA 3PJSB 5C92A 3GSWA 5I1DA 4GKSA 4HUNB 4ZNEE 1W0VB 4F9LA 2VLJD 1MJ7L 3X12B 1DUZB 3U7WH 3RI5K 1NBQA 3MACH 4IIQB 1YEDB 2ZJSL 5IVXA 1SVZA 2AXJA 1S7WB 4RMSA 4E5XB 2CKBA 4JHBA 4ZFFB 1TQCB 3GBLA 1EERB 4IOIB 1ZVSA 2IQ9L 2G9HA 1RK0A 2C3VA 3MO1A 5EO1B 2X5PA 4EIGB 1GGUA 5IIEA 4IOFC 5ITBH 4S0SD 1NBYA 3SKNB 2YC1B 4Y1AA 1JHTB 1CYGA 4HK3N 4UTAH 2W0FA 1QBMH 3B2VL 4I2XE 3HI5L 5DSCA 1X5LA 5F9OL 2EDWA 4ACPA 2VZVA 2ICWJ 3V9FA 1JRHH 5EOCH 1FYHB 4LLWB 2DICA 4KI5E 4EDWL 4JZJB 2EKJA 5H2BA 3U4BL 4YBLC 2AGJL 3P30L 3W9DA 3PWNB 2FDBP 5D1XC 3QDJB 1N5YL 3O41B 5L8JB 3F6IA 2BVQB 1CS6A 3G5VA 1BFTA 1TITA 2IAND 3AM8A 1KTRL 4GJTB 3VMNA 3NACL 2PW2B 2JF1A 2YWYA 4OCXL 3STZB 3BKJH 3QNYB 3S3PA 4FMKA 3SGEH 3GKWL 1AC0A 3T8XA 4MJ2A 2OTUB 1JP5A 1TZIB 4TUJB 4I5BA 3MGTB 3T3ME 4G6FB 1RZGA 3GSOB 5HPOA 5JOPE 5A40E 1HHIB 3RGVA 5F7NC 5IJKC 4RGND 3HTLX 4PTTB 2ATPB 1PKOA 4Y89A 1A2YB 2C4FU 3O4OC 3LS4L 3PDDA 4H5SB 1A21A 2ZNXA 5HY9B 2ITDB 5HDQL 2OK0H 1WFOA 3C6LB 3RBSA 3TZVC 4BQCA 3WNKA 1LK3H 5BJTA 3ARUA 1PLGL 3AB0B 5D7JC 1S7XB 3VGDA 2QQKL 2X70A 5JXEC 4F37F 4CMHC 1HIMH 5B39G 1HHJA 3ZKMD 3NH7H 3HR6A 5GJSH 5EWIL 4Y5XB 1JK8A 3GHEL 4OLYH 2F74A 5ALCH 1M6OA 2H32B 3T09A 4NBZB 2RFXA 1R3LA 2W9EL 3UTSD 4KROC 1UEYA 4LAQH 2VAAA 1QRND 1AD0A 1TTFA 5MEPA 3F12B 3JTSA 3L6FA 3MCKA 1SY6A 2VB5A 1HWHB 2GJJA 4WWKB 3P9MA 2QTEA 5C0CA 5E6IB 1PKQE 2XQBL 4H1LB 5JXAH 3DX8B 2LU4A 4JZOA 1GGIH 1VENA 3EO9H 5FCUL 3IVKA 1YEJH 4ODVH 4AIXA 1MJ8L 5B38G 3C60A 4DJMA 4ZDHA 2WZPD 4XP4L 2WK2A 1HOCA 3MRFB 5EU7C 3V8OA 3IAGC 3X14B 1ZGLM 4DGVL 2EYRA 5I1IL 3C5JA 2ADFL 3LQAL 4PJ8D 1OP5H 1KENH 4J6RL 1M05B 3L1OL 1BP3B 1IZJA 4HUWB 3T4AB 1W72B 5EFIB 4ZS7L 4MJ5A 4A2LA 2O26U 1TXKA 3GSVB 4GFTB 3UBXB 5CD5D 1WEJL 3WFBL 4ONGL 1CU4L 4OLWH 3QDGE 4QGYA 4ELME 3QFJD 3KYOA 4XTRD 3WL9B 3N85L 2JIXD 2G2RB 2DJ4A 4W4NA 5LGHH 5T3ZL 4RGOL 5E4EB 4J4PC 1KN4H 4UOJA 2LABA 2XQYG 4F57H 5JQHC 2AEQL 2IWGA 2VXQL 4XBEH 1GZPB 4XH2B 1EHNA 3GJEB 4PYGA 2DQIH 5D7LD 3VXMD 4LSPH 3WFCL 3CXHJ 4OZIE 1C8PA 5JUEH 3RTQD 1MCCA 3ULUL 4FQXD 4PP2A 4G42A 2XZQH 1NJ9B 4XPFH 2H26B 2LU3A 1INDH 3ARXA 1X5ZA 1RJLA 2VXVH 3L7EA 1UADC 5I9QC 1KB9J 2OTWB 3K46A 4CBPA 3NA9L 3ARDD 4Q9CA 5GZND 4LU5L 5BW7A 4B53A 1DFBL 1TDQA 2GYSA 3QXAB 4H0GA 4Y4FC 3RHWK 3RY5A 4M5YL 5DJXB 4P5MB 4IRZH 4PG9B 1CGSH 4Q6IC 3THML 2ID5A 4ZXBD 5TPWL 4JRYB 3MRDB 3BVNA 3QIUB 3O2DA 2NYYC 4O2FA 5DHVA 1T66C 1BREA 2FX9L 5CUSL 3BKCH 5CJOL 3SE8L 1YY9C 1BJMA 3O0RH 4NO5B 4OV5B 2HTLD 3QUMA 4FQIL 1P4IL 3TPUE 5AAMA 1YEEH 3C08L 1UXWA 1WZLA 2BSED 1F58H 3NFSH 3BD4A 1JPFA 3O4LA 3WIIL 1DVFC 3FFCA 5FFLA 4YHZH 1KXQE 1T21B 1QLEL 4YEFA 5D1ZB 1MIML 4Z77B 4XP6H 3RKPA 3TH3T 4D94A 2W59A 5GGVY 1Q1JH 2NXZD 3EFFA 3FB6A 3K1KC 5HVFB 3MA7A 3V0WH 2EDQA 1WZKA 4OKVA 3NZHH 5J12B 1CTOA 1YNLH 4MNQA 3DUHA 3UJIL 3H7BA 2GITB 1JHLH 2BK8A 5L2KD 3SGKA 1CGTA 1JHKL 1EEQA 4EBQL 5T1LD 5I8CB 1M71A 3TM6A 1CGVA 1CDBA 1JGUL 4JFFB 5HVHB 2EICA 3IJYA 4G8GE 4CVZA 3MLTA 3C5SB 2BZDA 5E8EB 3PGCB 2W9DL 2V5MA 2CXGA 4LLDA 4M8VA 3ZDYE 1RJYB 3MFFA 4B5EA 4QXWA 3EJJX 1EFQA 1DQQA 2BNRD 3JV6A 5ID1B 2NX5D 4U1MB 5DHXB 2A38A 1WIPA 3OL2A 4KRLB 5JPMA 3T0EE 5DEZA 1J88A 1VACB 3AREC 2KQMA 4HGKC 3NZ8B 5E2VL 5INDA 4JKMA 4RMQA 4D9LL 1KCRH 3OR6A 5HHMD 3DGCR 4MJ6B 4E41D 2LU7A 2XRAH 3QEUB 4YDVA 1F6FB 5TJWK 4ZD3H 5BV7B 1D5BA 1REIA 1OD9A 3LZFH 2X09A 1VA9A 4XCFH 3QG6B 3ROOA 2R4SL 3GSUB 4YHNA 2B5IB 4NQEA 1TZGH 2Q76B 4KMQA 4XNZC 1EHXA 5EZOL 3GIZH 3S8WA 1AGFA 1E4KA 4FTVB 3RWHA 3SO3C 5KSAC 3KDMB 2EH8H 1JNHA 3ZE1F 1QKZH 3IRPX 1NCAL 4XPTL 1XCQB 4ZUUB 1IILE 4K3HA 4BZ2L 5MEQB 4PJAA 2ZCLL 2FBOJ 3MV7E 4FN0A 4RAVB 1VFUA 1VKXB 1OT2A 1YUHB 1C7TA 1LO5B 2EIBA 2XZZA 1J11A 2XWTB 4HKJB 4OGXH 4RGMB 5HVWA 1CICA 3DX7A 3L3OA 4V2CB 1WF5A 1U8KA 5HHQA 2F54D 1TNMA 2VDKL 3FT4B 3V4PH 4CL7A 1ND0B 5DD0H 1KN2H 2DBJA 3SN6N 3CSYB 2OX5A 1P2CA 1YY8A 4DVBB 1SJXA 4PJDF 4ZSOE 5FGCB 2BFVH 43C9A 5IVOA 5EU6D 1NFDB 4QRRD 3KHQA 1P7QA 3PF2A 4F80A 1OGAD 2NY4B 1WTLA 2XNAA 2H8PA 1JI2A 3MJ9A 3IDGB 4NSKA 2QSQA 1ZOXA 4WTZG 2XACC 1PVHA 1UQSA 1MHCA 5HYJA 1CFTB 1MLBB 3FQTB 3TCLA 1KJVA 1NBZB 4C56B 1UCTA 3OWEA 4WEMB 1MHPL 4OCYH 1QUNA 4PJ9C 1A6TB 2FIKB 1WCBA 1U41A 4DFHA 4R26L 4AEHL 1FAIL 1NLBL 3SKJL 3MLPA 2QJDA 3TVMD 4UOW0 3BZ4B 5IWLA 4HS3A 3AY4C 3VWJB 3I75B 2DLHA 4ZPVB 2XTJE 1KB5L 1EGJA 2J2ZA 1BF8A 5D6DA 5C0EA 3O3DA 3GMLA 5IMLB 2DYPD 5KVDL 3IKKA 3Q2CA 2VDPL 4XNYL 3D1MC 1QR1A 4P2CG 3HZVB 1LNUB 3CFJA 3LKRB 4MSWB 3BP6B 1ZMYA 3GDBA 3HPLB 3G04A 3MV9A 4QEGA 3W0WA 3BEWB 4PJXB 2R0ZL 1MEXL 1YYLH 3QISA 3PDGA 4R9HA 4JM2B 1AGBB 1U95B 3P4MB 4DW2H 4NWUH 3P4OA 2IBZX 4RAHA 5FUCC 2Y7QB 1U91B 1TTGA 3DSNA 1CDCA 3CX5K 3R8BB 3HG1B 4XNXH 2KZWA 4GO6B 3L3HB 5E8DL 2Z35B 2UWEF 3QDJE 2CH8A 5C08D 5DO2D 3VXOA 4RAUA 1WGOA 1A7RH 1G7IA 3DXAB 1UB6A 5EU3A 1T04B 3BPLB 1K5NA 2GSGB 3SBWC 3PWPA 2ZCHL 1S3KH 4X6CB 5CILH 4F3FA 1A1MA 3IS1X 3JVGC 4ZYKA 3SJVB 4KRNA 3UAJD 2FYYB 5IMOA 4HPYH 3ZZ1A 5GJTH 1VFAB 2R29L 5LGKA 3IDJB 2OMNA 1FDLL 5IB2B 5C2BL 1FO0B 1KJ3H 2XWJA 3UJJH 4GBXC 3W82A 4R2GC 1UXSA 3E3QA 1Q72L 1QSFD 1XGQA 3O6FB 3TN0D 4JFYA 3DIFA 5I66A 5MEOA 1J8HA 5BRZA 4EDXA 4Y4HC 1GPOL 4HQQL 5D9SB 3I84A 1BWMA 3BX7C 4Y16A 1DBBL 5C8JB 1XGUB 1FL6A 2DQTH 3BIKB 2DBLH 1W8NA 4OF6A 2P8MB 3T4YB 3OKMB 2NXYB 2NY1D 1CFVL 4KJYA 3BRGC 3OTTA 5D7IB 3FB8A 2HWZL 4NQDA 5IMKB 3MXVH 5E94A 4BSVB 4PLOB 4QHUB 5FOBB 1S7VB 2PYED 3CC5B 1WBYB 4I0PD 4JFDB 5ACZA 2VXTH 1IEAB 4GRWF 3FFDA 3RA7L 4K8RD 5JOEA 4QRPD 1G7HB 3VXNA 1BX2B 1OCWH 2A73A 3VMOA 1AD9B 1ORSA 1MUJB 3S4SB 4LIQL 2D7OA 1I8KA 3STLA 2A6DB 5BVJB 2CKBL 5HI5C 4HIJA 3CX2A 3TIDB 4LLUA 5HPMB 5DUPL 2KDGA 1ODAA 1A5FL 1QEWA 3KWWB 1DANU 5IFHL 5EBWA 1YEFH 3BJLA 2ZG1A 3LVEA 3GKZA 1PG7L 1J0HA 1F5WA 4BFEA 2DMKA 4UUJA 4C4KO 4ELKB 4L3ED 1EMTH