5IM7A

Crystal structure of hla-b5801, a protective hla allele for hiv-1 infection
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA-B*58:01 Heavy Chain
publication title Crystal structure of HLA-B*5801, a protective HLA allele for HIV-1 infection.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 277
sequence length 277
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5im7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5im7A01
5IR1B 1ZVSB 1QNZH 5AZEH 3AMLA 4CADB 1EFQA 2FO4A 4U0RC 4P46D 2O5ZL 4LQFL 1I9JH 2EE3A 4JVWA 3P9LB 2PYFA 1MLBA 1S9VA 4I48A 4IDLA 4Y19A 3V0WL 3DPBA 3M8OH 5H94B 5D2NE 2WINB 2NY2D 4MJIA 1LEKB 1S7VB 5KSBF 5HHMA 4LF3A 3QFDB 1TQCC 4POYA 4U6HB 2X2YA 1KJ3H 1S78D 5DT1L 2XTJE 4Y1AB 1F02I 4JFOA 3HCVB 1J0IA 1OCWL 2ZUTA 1D5ZA 3QH3B 3MNZB 5MI0B 2UZYB 2A2QT 1VKXB 1KJVB 3U82B 4A2LA 5EU5B 5T3XE 1OTSD 2DDQH 4W81A 4NBYB 1A7QH 4P2QB 4I18C 4IRJC 4HPOH 4FQ2L 5KVMC 4FMFA 4HWEH 4NQED 5HHOA 5E8DL 1G7MB 5HGAB 4U3CA 3GMRA 5FYLD 5IWLC 4JFFD 3CMOH 5DMGD 3RDTD 2AXGA 1BIHA 1F4WH 3CSPA 1NBVL 3PGCB 4LVHB 2ORBH 5SX4I 5D7IE 5ELIA 1BZ7A 4MLSA 2VC2H 5ADPH 4NDMA 3PWPB 3O2DL 3F7YB 4BZYA 3PDGA 2ESVD 4KHXH 3DROA 1K5NA 4N9OB 1SM3H 4YXKL 5F1IB 3IDXL 1A6UL 1JV5A 4Y5VA 3VXNB 4DJMA 5D96B 2DQJH 2A6KA 4J1UB 3X12B 3MLZL 2NLJA 2VABB 3ZE1F 1KN4H 5EIIA 2C4FT 5M94B 4FZEH 3KPLA 5DJYB 3ZDXE 4QXTA 3UBXA 3BH8B 1W72B 4M7LT 5BMFH 1BJ8A 4UQ2A 3LZFH 3KPOA 3FQXA 3WNMA 3F6IA 1CE1L 1JZ4A 3C5ZB 2Y07L 3MRNB 5JW4M 4GMTH 1QLRA 1JNJA 4H25B 4JO3H 1XFPA 3FQNB 2JB5H 3TPUE 3TH2T 2CDFA 3TBWA 5J9PA 5HHNB 1BD2D 4KH2A 4BQ6A 3T0EC 4LCYA 4QRRD 3AB0B 5DRNA 3ECBB 2Y06H 1JGEB 1S7RA 3LKSB 2DL9A 1BPVA 1X9QA 1CVRA 1HILB 3VRIB 1MLCA 1T1WA 3GMQB 1ADQH 1YMMB 1UM5L 2Y36H 3TZVD 3O11B 5EUOE 3U0TA 1FN4B 2UVFA 4LDOB 4O4YH 4MHHI 4HZAA 1C5BL 1HSBB 4N8CL 1FYHB 4XI5D 3RWJA 3NZHH 3BIBX 2X4NB 4NO5B 4PGEB 3BN3B 2QHRL 2P24A 4IRJA 3VE0A 5HYSB 2NY4C 2Y6SC 4PGDB 4ZTPL 4L1DA 5AWNH 1HWHB 3GSRA 1NJ9B 4G8GB 1GIGL 3I50L 4OD2A 4Z7NF 2HMIC 1IZJA 2EYRB 5IWLA 3QZWA 1OD7A 1A7BA 3MFFA 2X4SB 3BT2H 3RX8A 4QCIA 4QT5A 5EA0H 5FV1L 1NCWH 3GZKA 1AGFA 5JPMB 2X4OA 1JGDA 2BERA 4NZJA 2R1WA 1MQKH 4G3YH 4LKCA 4KJWC 3VXTA 3G5XB 2IEPA 3B9VA 2WUCL 2GK0B 4UOW1 3TBTA 4RQQA 3BZFA 3ULUD 1LO2H 5BRZD 1IEBB 5E08H 2A6DA 2VLKB 1J05A 5E99L 3OJDA 1A4JA 1M7DB 1ZLUK 5JQ6L 4YIQA 2NTSP 1KUMA 3NH7H 4XH2B 4J6RH 4XNQA 5C0AE 5H37G 1UT9A 1TETH 4OZ4B 3HE6C 4NQDB 4WVRA 4HIJB 3SOBL 1UGNA 2H32B 3DX6B 5CAYB 2HRPL 3Q1SH 2SEBA 1CD0A 1YNTB 1Q0YL 1V3KA 1OB1B 1MJUH 2P48B 4KGJA 3ZSTA 1FVCB 3ZDYE 4YXHH 2Z93B 4N5EA 5HVFB 1M05A 2YOCA 4JN2A 1Z5LB 4IIQB 2HP4A 4L4TD 3KLHD 3WUWB 1OP3K 1A8JH 3CCHB 4M1GH 5ISZA 3IDGA 3OXSB 4XXCC 3P73A 1CGYA 1ZLUH 1YMHA 4JFXB 5DUPH 1R6VA 4P99A 3TO2A 5JR1H 5IVXB 3VWKD 2B0SL 4EIZC 2VXVH 3BP6A 4FABL 3W9DB 5DJDA 1MRDH 2DBLH 4O2CB 4S2SB 4X6DB 3UAJC 4AJ0A 3CZJA 5C1MB 5IMOB 5JUEL 4Z9KB 2FJFB 1RV6X 1T5WB 1RFDL 2GJ6D 2E6JA 5DVKA 1PD6A 2DQTL 2Q8AL 4UT6H 4OAWB 4P5TA 3L3GA 1FG2A 5GGVL 1YMME 4U05A 1DVFC 1A6AA 4ZYKA 5BZDA 5I1CL 3AU1A 4Y2DC 3C60C 4LAJH 2XY1A 3OX8A 4YDVB 3MXWL 4WFGD 2JJTC 1OP3H 4KMQA 3P4LA 2NY1C 5C0EA 5F96H 2X40A 3IU4H 4HGWB 2QQNL 2J8UF 5K93A 4AH2A 4JN1L 4LP5A 2DIAA 4YE4L 2V7HB 3KPSA 3QWQB 1KPRA 5FGRA 4NRYA 5GGSY 1XF4B 3LKOA 5KSAB 1CFNA 4NM8H 1JI2A 3EKCA 3NCMA 4RBPK 4HZLB 3P9MB 2D03H 2Q8BH 4JFQB 4K7PH 1DUYA 5K9KA 4EJ1C 5KW9H 3JUZA 1HNGA 5JMRA 5D7JC 5CEZL 3GSNL 1JPTH 3BUYA 2DQEL 2ZCKL 2Y23A 4Z7WF 2DTML 3E6HA 4TNWK 1B0WA 4LSDA 3GB7A 4JFDB 2HFFA 4FRWA 5TDPB 5ESAA 5IQ9B 3ARFD 4N0FB 3QIBB 1CFQA 4D0DB 3K1KC 3GSOB 1AE6L 3G04B 4NQDE 4XNZC 3W39B 3DO7B 1EFXA 3RHWF 4EVNB 5A2JH 4EBQH 4XXCA 3NTCL 2ITDB 4QXGL 5CP7B 5F7EL 4UTAL 1RIVL 3RNQA 1KJ2B 3RWDA 2BK8A 4RBPH 4CVXA 5HHVH 1YN7A 4GUPA 5EU7E 5ABDE 5C70A 3D18A 3MODL 1I7TA 3D69A 3KWWB 2AK1L 2HFTA 5DDHA 4XNMB 3SCMC 3ULUF 5BS0B 3AUVA 4TYUA 4R7DA 3U0PA 2KZWA 1FL3B 4ODHL 1P7QD 3FCTA 5H35A 1XGRB 4LPTA 2WQ8A 5DVNA 4WCYL 1CR9L 1DQMH 4LL9A 3LY6A 3ZE2F 5C6TL 3MRMA 4KTDH 4MAYC 3WS3B 4OIIL 1AO7D 5SWZA 5GRUH 4AEIL 1AJ7L 2XZAL 1ND0A 1HINL 3S37X 5I1DA 5MEOB 4P2RD 1ZVYA 3D39A 4KTEH 3BP5B 3HNVH 3NIFF 2JJTA 4OZGF 5D1XB 5SWSB 4KK6C 5BJTB 3TN0C 1UJ3C 4JLRB 4CMHC 4PRIB 1BFOA 4PJFB 1OF2A 2MKWA 3TM6A 4C4KO 3UX9B 5I9QC 1IGJB 3C8KA 1S7SB 4M3KB 2BSTA 3D9AL 3BAEH 1YA5A 4OI8A 2AJZB 1RUAL 5DK2A 1P2CA 4XP5L 4KV5E 1E4KC 2CLRA 3FOLB 4M62L 4EI5B 3FTGB 3QDMB 3TGXA 1WK0A 2CRYA 4M7JL 2PO6C 3WIFB 3TYFA 4GXVL 3KYAA 5CP3H 2XWTB 4JO1H 1VENA 5F9WC 3MLWL 4GMSH 4ISVA 1HKFA 2ADJB 4LEOA 2J1KA 4RMWA 5KVEL 4HBQA 4PJ5E 4WI5A 4I77H 1KCUL 4YC2B 5LWYL 2EXYD 3LEVH 5GGQL 3LV3A 1LE5B 1PJ9A 1MPAL 2BVQA 5I8EA 2AV1A 2CDGB 1J0JA 1A1OA 5E6ZA 2P5EB 2H3NB 3RVXD 2Q76B 3TIEA 4OM1H 2NY7L 5JTWA 5E8EA 1XAUA 3L1OL 1O7VA 3MUHL 4FTVE 5EDXA 3G6AA 3I85A 4QOKB 2VDOH 3CXHK 5BOZG 5DRWB 4YPJA 2DQIH 4PJBB 4PTUA 3DBXA 4RRPA 5KS9B 4KROC 4HT1H 3QQ4B 4KVNL 2GKIA 3SGEH 2OJEA 1DR9A 1JTOA 3MRKA 1NCCH 4FQXD 3DVGA 1IQDA 4LGPB 2IQAA 3VXMB 3T09A 4GKOA 4DEPC 5GRJH 4XBGA 2VZSA 4U31A 5I2IB 2EEBA 2X1WL 5GSRA 3ZTNH 1D5MB 4MAYA 2R69H 2XN9A 1PG7W 1TJIH 2UZIL 2BNQB 1MWAA 2AQ2A 2R0KL 3V5KB 4G80A 3CFEB 3O2VH 2EDQA 4PV9A 3DRQA 5T1LB 1G9EA 2VLRB 2YD6A 3MLTA 1KIRB 2A74B 1FAIL 4P57A 3TN0A 5BS0E 1OPGL 1U8OA 4LPUA 1FCGA 1UJ3A 4ZD3L 2VN7A 1AFVH 4KDTC 3H0TA 5MERB 3MOAH 3HC4L 2LU7A 4OTXL 1XGTB 3QXTA 1FGNH 1FLTX 1Q1JH 3P9WB 2BHYA 4PS4H 5J3HD 3MYJA 5FUOH 1BVKA 1ACZA 1MI5D 1MRCH 4LHUD 1NEZA 2DKSA 3VXRB 3BHBB 1HCVA 1NFDF 3GMNB 2VH5L 5IP4A 1PYWB 4O2FA 3HI5L 4HIEA 1FJ1A 2P8MA 4ZFGL 2VR5A 4EDWH 2PO6A 1JPSH 1JHKL 1Y0LB 4JY5L 3EJYC 4AMKL 3BEWA 3GM0A 3KJ4C 4JANB 2BMKB 1V3MA 3WHXA 3JZ7A 3O0RH 5D9SB 1T1ZA 4PRIE 4PJFE 5EWIL 4NRZB 1PKQE 3KPNB 1NGPH 3CX2A 1EGJL 1HI6A 3BIKB 2X4UB 1WBYB 4XP4H 4Q9CA 5IMMB 4LVNC 4ETQA 4EUPA 3FQWA 4DVRL 1LD9B 3HLAA 2A9ML 3UTTD 2QQLL 4MDIB 5F7WC 4E0RB 2IAND 1T03H 3PWVA 3DSNA 3MLUH 1KG0A 1KFAH 1VSCA 3IDMA 4HIHA 5J57B 4DFHA 4JCMA 5E03A 4QRQA 2DMBA 4HX1B 5FOJA 4HC1H 1JZ3A 1FNHA 3HZKA 3MA7B 5DURB 4PBWD 3SGDI 2A9NL 3SDCA 4TSBL 2B20A 1BLNB 3BZ4B 3C2AL 4YPGA 4WJ5B 2VLJA 1CK0L 2NNAA 4ONGH 4C4KT 2DLEA 4NGHL 3ZKXB 1P1ZB 5IFAH 3WSQL 3QR2A 1Q9KB 3QHTC 1FAKT 4NOBA 4YHLH 4CL7A 2Z92B 4U1GC 5B21A 1C16A 1IAOB 1LO4H 3SE4C 3JSSA 2HJKB 5HI3D 2BOCB 1QVOB 4XCYB 5I73C 1EGJA 4PJBE 3GSUA 2ZUWA 4ZAKA 2AQ1A 3T3ME 1TJGL 1ZANL 1UXWB 4HLZH 1X5KA 2WBKA 3A6BH 4FQHA 5JORA 4TOYL 5TGBA 3RL2A 2IPKA 4NZRH 4MZ3A 4RNRB 4ELKB 3HNTH 1FZJB 4ONHB 1EHLH 1DL7H 4AT6A 3WN5C 1BQHA 4CNIA 4TPRL 1FIGL 4M7KL 3AREA 5J12C 4MX7A 1I8LC 2KKQA 1UACH 1MHCA 2DM3A 1Q9LB 3D85D 4IMLB 3T65B 4FXKA 1ZLSL 1EHNA 1P7KB 3HE7D 2ZP0T 1ONQA 5CSBA 4L9LB 3MLPA 1F58H 3SJVB 3FFCA 2VLRE 4RWHA 4KDVA 4W70A 3QHFH 3QJFA 4YEFA 2ZG3A 2C7UB 1OAUH 3MCLL 4NUJB 4HPYL 1U58B 4PJXB 4JHWL 4XZUA 2ADFL 3TV3L 4S1QH 1IVLA 3QUXC 3VH8B 3LDBC 5E70A 2I9TB 2A77L 3ARGA 1CQKA 1RZJH 2DL2A 4G6KH 4F7CA 5AAMA 5BXFA 1HHJB 3WIHL 1C1EL 1EO7A 2X1PA 2JJVA 3W0WE 1G7IA 3DO3A 4JM2B 4NKOA 3CLEH 5JHDE 4RGNB 1JN6A 4LHQB 2QHLA 3P4MA 4ZNEA 5T3ZH 2A38A 1BBJB 5D2LE 3OF6D 1WCQA 2UY7A 5C0BB 4XPBL 1G9NC 2QJDA 1WWAX 5MEQB 2GAZB 1F4AA 1LNUB 2CR6A 4PJHA 4HS6A 5CJQL 5F9OL 2FZ3B 2NY3D 1V8HA 2UUDK 2UVEA 1JTTA 2BP3A 2MMXA 4GH7B 4OD3H 4R96A 4TUOA 4W6XB 4Z5RA 4N8VA 5JOEA 3MR9B 3TIDA 4KUCD 3LKRA 3CFBB 3SE4A 4Z7OE 4BZ2L 4KK9D 2Q87A 5GS0C 3HC3L 3B2VL 3CFKB 1Z3GL 5DD6A 3VD3A 1CLYH 3O3AB 3GIVB 4W68A 4V2BA 1INQA 3WHE0 1ZT4A 2BSRB 5F70A 1G0YR 2X4TA 2NQCA 4V2CB 3M17A 2PYED 3MV8B 3WIHA 3I6LE 3CH8A 5JHDD 1OTTC 2VDRL 4FN0A 3WN5A 1RULL 1DDHB 1CGSL 5F1SA 1I8LA 3OR6A 3TFKA 1OSZA 1YPZF 1KPVA 1R3KB 1LK3L 1XZ0B 3EDJA 1ZEAH 4FQQB 2V2TB 4G9FA 3B8YA 2DIBA 1FNGB 1GOFA 2UUDH 1VEMA 2DYPB 1TCRA 4YHNA 2VQ1A 1CWVA 3MJ8A 2JIXB 4YUEH 4IDJH 2COQA 3MBXH 4LHUG 4URTB 6FABL 2IGFH 4L3CB 4WRLA 1OAQL 5GS0L 5MHSD 1QFWH 1T3FB 4GS7B 1ZLWK 3VDCA 1CFVL 3BD4A 2F58L 5I1EL 3PGDB 3WFZA 3QUXA 1S9WA 2DLGA 3GSVA 2CIKA 3DRTB 1ZHKB 3FO1A 4UTBL 3QUZA 4AM0A 1HNFA 4JJ5B 5D7LA 3WIIL 2EH8H 1LEIA 2ADGA 2V2XB 5IJKC 1T0NA 1J9CT 2OI9C 4DZ8A 1MREL 1VFBA 2HVKB 3ALWA 1IJ9A 3B9KD 1I3GL 4YQXH 1RK0B 5HGHA 5J6GB 4N1HB 5L2KB 5GGRB 3RJDA 5B38A 1J1XH 2Z35A 1Z6JT 4AEEA 1RPQA 5C2BH 1OWRM 4LFHD 2DN7A 3VFMA 1HKLL 1ZMYA 3T04D 4G8FB 5FF6A 3VFOA 3DTXA 3QUYB 1VFAB 4HH9A 5EPMA 4OI9A 3ARDA 3FZUD 4YX2H 3S5LA 4S1DD 1CICC 4S10A 1AY1H 5HGDB 1JNHA 4ZFZB 1ZLWH 4OSUL 4OF7A 4RGNE 4ZSOA 5FO9A 5ITFA 2CK0L 4K9EL 4GSDL 5FAAA 1AGDB 3GIZL 5E2JA 2J6EA 1F3RB 1VA9A 1S7QA 2P45B 5D1QD 1YEKL 5JZ7D 1JNNH 3STBA 4ZQKB 1NANH 4HMDA 1GC1L 1N8ZB 1MRFL 3H42L 3SE8H 4MQXC 5DJ0A 5F93C 3ULSB 2QV2A 1UB6B 2C9AA 3WJLA 3VXSE 2CQVA 3HG1B 1M7XA 3WFEL 3WMSA 4XPFH 1G7PB 3MRLA 5DC4B 4CMMB 4PRPE 1NUGA 2CGRH 5ERWA 3N1PC 4JFEB 1IGYB 4NZTH 4DWHA 2OTPA 4BSVB 2ARJQ 3CZFA 4DTGH 1WGOA 2ARWA 4PRDA 3GGWB 2GUOA 3L9RB 2X7LB 1X5JA 1MEXH 3Q5OA 4CJ0A 5AYQA 1ZVHA 3IDUA 4X9GA 2G2RB 4D0CA 1GJIA 4E9LA 2OXHA 4TTDC 2ID5A 1J5OH 2P8LA 4CKVX 4Q2ZB 1A9EA 2ATKA 3EOBA 3V5HA 5I1GL 1MVFA 4MD0A 3STZB 3RNKB 3CX5K 4WUUE 5LCVL 1EJOH 2RCSH 2NW3A 3QUMH 4KUCF 3TO4D 1OARL 3RVWD 3BDBA 5IJKA 3L5HA 2EYTA 2AABL 1ZHNA 3GRWH 1P5VA 3IF1A 3QCTH 3K4AA 4RMQA 3TBVA 4WW2B 3VXSD 4RGOL 5FKPB 3RWHB 1ZLVK 3X14B 4HGMA 3WJJC 4OD1L 3SGKC 1HHGA 3MBED 2D9QB 3BRFA 4OV6F 1V7MH 1A64A 2ERJB 4PJDB 3GBML 4JY4B 4Q6IB 3LMJH 3LKPA 5FXCH 1FYTB 3FRUA 3HZVA 1IGCH 1CICA 1X44A 2JKXA 4Y4KC 2YK1H 4MWFB 2CIIA 3FFDA 4GQPH 4XPTL 3KXFE 4YFLI 3LN5A 3WEXB 2CO7B 2V5SA 4NOFA 2JELL 4X8XA 5DHVA 3TCXA 1QFOA 2ICWA 1OSPH 3WDIA 2IALB 3O4LA 1EXUA 4LRIA 1I4FA 3QBTB 3N1QC 4J23A 4WEBL 4KJQD 4WUUD 1AGCA 1X6NA 4L8DB 5L88H 3T0DA 1KCGC 4JHZA 4XWOD 3FHAA 4OZIE 2EC9U 4K8RH 4KHTL 4OQTA 5I1LA 3ISWA 1ZS8A 2IBBA 1ZLVH 1W72H 4WI9A 4JRYA 5GGSA 1HYRC 3QIUA 1CL7L 5C7XH 4MA3A 1EBAA 3BPOC 1CDBA 2P5WA 4WWKC 3SKOA 1I1AB 2F53E 3G9AB 5SX4H 3REWA 2B4CL 5D71L 1TZGH 5C8JB 5GRXG 1TZIA 1KCVH 2LABA 2V2WB 1CE6A 4P2YA 3FO9B 4M6MH 4TNWF 3O2WL 5T5FL 2DKUA 3THML 4OT1L 5DQ9A 4MXWL 4F2MB 4LIQL 3D0LB 4GJTB 4YHIB 1JF6A 3RUGB 1IMHC 3QEUA 1LP9E 2WANA 4HXBH 4ZS7H 1OAKH 2XKNB 3MLSL 4O2EB 1NC2A 1JHTB 4OGAD 3H9SB 5E8OA 4XCFL 2WBJB 3O3EB 5ETUA 3MRGA 1DBKL 4TRPL 2F19H 1KLGA 3CC5A 2O5XH 4PJ8C 2HLAB 1YY9C 3QHZL 5AAWA 3PQYB 1WIOA 3DUSA 4M02A 1OAXL 1G0XA 5FO7B 3UXFA 1WZMA 2ZCHH 3FN0L 4KXZH 5GGTL 4WI2A 1JYXA 4KRMB 3NFNB 5FHAL 5FYKD 4PTTB 3MNVA 3WJJA 5HYFA 2NY6C 3SGKA 5KVGL 4KMTH 5EOTB 4U1MB 2PXYD 3HR5B 4WO4C 3VI4F 4CVUA 2OMNA 5E1AA 3VXPA 4HUUA 4J4PA 4QTIH 3CU1A 1T22B 4OUUA 5IIEB 1XR9B 3O6FB 4WHDA 4NN7B 3QEQB 5E1HB 4LLDB 3P0YH 1FHGA 1CFTB 3S37L 2PW1A 4Y4KA 1VEOA 1FC1A 3ULVE 5HDQH 4M03A 5I19L 4GAGL 3EDEA 3GNMH 1RZIB 2ADIA 2DRUA 4NNYA 3T2NH 3VW3L 5C0GB 3VFSA 2YUVA 3D3VD 1KOAA 3DSFL 4MVBA 4B7LA 2R2HA 2AK4D 2YA2A 5C0DB 1QSED 1J10A 4S1RH 1OQXA 4NQCE 5C08D 1B90A 2IBZY 1WAAA 3I6KA 4IHOB 4N0YH 4QHUA 3BFOA 4U6VL 3RFZC 1FYTE 2NY5H 2XIDA 1N59B 2B2XH 4I3SL 5HBBA 2VDKH 5IV2B 5MEPB 5GGTA 2E7LC 4K2UL 4KJPD 3IFLL 5ICXB 1BZ9A 2H32H 4HJ0D 4WWKA 1HDMB 5F3HA 1IAKB 5LGJB 4DKFL 4CDGC 3RPIA 1HHIA 4PJAA 3O8XC 1C7TA 5F7MC 5JDJA 4K71C 2HH0H 2ZOLA 4EZMA 2J88L 5DD0L 4YFDB 4OGZA 1IL1A 1MLBB 1KULA 1REIA 1A7PL 4AK1A 1LO5B 5E2VH 5T3ZD 2GTWA 5KN5A 4MJIB 4PJ7A 1IC5H 1GVIA 3A0OA 4LF3B 25C8H 4RAVA 1HZHH 1YUHB 3DXAA 5JW3H 2ICWJ 1TCMA 4YZFF 3TJEL 3SDXB 3DUHA 2XRAH 4OFVA 1G7LA 1U92B 3VGGA 4PUBH 2DMCA 4WFED 4YHKL 3FAWA 2BDNH 2YPKA 4OCYL 4MXQC 3OXRB 3BKYH 3T08A 4IOSD 2MCG1 1J86A 1Z9OA 3REVB 3UBXI 4HV8B 1DFBH 2XNAA 2AXGB 1QSFD 2G9HA 2HFEB 4KZEH 1KTDA 4NSKA 1I1CA 4NQXA 4Y4FA 3DMMC 2YN5A 2X4RB 3G6JA 3K81A 4U2YA 2Z4QA 1BZ7B 4X6CA 5ECJE 4EKXA 1F3JA 4WY7H 2BXZA 4JQIH 2H6PA 2FX8L 3MXVL 5BQ7A 2AVGA 5E9DB 3DROB 5CMAB 1J0HA 1JV5B 4Y5VB 5HGBB 3DX9B 5DI8A 4D0BA 2A6KB 1WZ1L 2EC8A 2OK0H 2BX5A 4QO1A 5EORH 5F7FA 4GRMA 4X80L 4NNPH 3CIQA 1HH6A 1U93A 4H88L 1A2YA 3HUJA 5HYJB 2E7LA 2MCPH 3S36H 1MCOL 3DYOA 3FQXB 3VRJA 1RJZA 1J1PL 1QLRB 1XMWA 3JWOC 2GI7A 3D2UD 3WL9B 4APQB 2CDFB 2YPLE 3TBWB 1EBPA 5IUSA 4PRBA 3HZMA 3RPKA 4WWID 5CINL 4LSSL 3B83A 1WQVT 3QCUH 3KPRE 4GAJL 2EDOA 4YDIL 4FQLL 4PRAA 4NM4H 3SQOH 3VWJD 4KRPD 2FB4L 3AS0A 3QI9C 1MLCB 5L8JB 4GLRH 1E28B 3QWRA 4GRWE 1KJ2H 5CLTA 5B39B 3H8NA 3OKKA 3RGVB 1JP5A 1RZKH 1UYWL 3IXTA 3LKQA 2BHUA 4OCSL 1RJLA 4WNQB 2Y5EA 3L7FB 2P24B 1S7TB 4OGXL 4XNUH 2X4QA 3VE0B 4MJ4A 3VXQA 1FH5L 4LCWD 5FIEA 3LS4H 4Y19E 4IRSD 1U3HB 1PEWA 4GG6A 4OD2B 4ODTL 4X5XA 5HHME 3SE3C 4IMKC 3JWOL 3QDJB 2H8PA 3MLRL 2AXFA 4DN4L 4QCIB 4R8WH 3BN9D 4F9LA 4QT5B 4Q9QL 4MA8L 4P9HC 1QFHA 1AGFB 4LEXH 1H3PH 2X4OB 2VLLA 3GEWB 1LMKA 3HPJB 4OLEA 3ZE0E 1A6TB 4U1KA 3T77A 1QO3A 2R1WB 1CLOL 2JCCA 4LKCB 4LDEB 4ACPA 3VXTB 4QRSA 2VIRB 5AYUH 4JPIA 4ZUVA 4TQEL 3TNNA 3KPRD 1U9KA 4RFNB 1T1YA 4RQQB 3IS0X 2C3GA 1N0LA 2E9JA 5JDSB 3BXNB 2YMXH 5HHOE 4G6JL 3OR7B 5I17B 2YRPA 1J05B 5EO0A 3EOAB 4PRNB 3IETA 1JGLH 3DECA 3WKML 1H0DA 4ONFL 4M6AA 3LQAC 4XNQB 1WTLA 1L6XA 4OLYH 2WWKT 1JPST 4WHYH 3UO1L 1BEYH 4WI8A 4QLRA 5A2KH 4N8PA 3H6JA 4PBXA 1I7UB 4M48H 5KVDH 5ENWA 1LO0H 1F5WA 35C8L 4QF1A 3O9WC 1RUQL 3H7BA 1IE5A 2VXSL 1JE6A 5IHBA 2QL1A 2IH1B 4UT7L 3VMOA 2AEIT 4LLAA 4H20L 4P2QD 3Q6GL 2YC1A 4MD4B 2R9HC 4JN2B 4RGMC 1XIWB 4PD4K 1HQ4A 4Y16C 4XTRC 1LEGA 4KKCC 2J3SA 2R1YA 3JXAA 3E1F1 3MLXH 3BWAA 4Z7QE 1QLEL 2XOTA 2FR4B 4PRHA 4ZPVA 2J5LC 3JWDH 4Q9RH 4N68A 4JM4H 1XGPB 4NJAH 5TE6L 5ISZB 3IDGB 3FB5A 4DN3L 1WIPA 2DQGL 3S8WA 1QKZH 1JRHI 4ZO8A 1FZMB 4HK3N 3TO2B 1OGTA 4FQIH 2VOTA 3ARSA 3PWPD 3CSGA 4JQXA 3BP6B 4PJEA 2ZKHH 2VAAA 5DEZA 2NY4B 4M1DL 1SVZA 2EDHA 5B8CC 1AXSA 1YEJH 1WC7B 4XHJC 1FPTL 2NY2C 2I07B 5EZOL 3GJEB 2VDNL 1ZA6A 3FQRA 4C56A 2OS7A 4LRNH 4HG4J 4IMKA 5TDNB 4KZDL 3NFSH 4JO2L 4UUJA 1S78C 4YXLH 4P5TB 5C0CA 3MRHB 4K8RD 5ALBH 5CIPH 5CKAA 4TUJA 5HPMB 1OTSC 1C5CH 1UG9A 1S3KH 1BF2A 4M4RA 1OL0A 5C0EB 3C5ZD 4WU5A 1WBZA 3F58H 4QXWA 4R4FL 1I3VA 2AI0L 2M26A 1G0DA 4F58H 5DMGC 3TYGH 4M5YH 2ZUUA 3L5XL 5E00A 4NRYB 2C4FU 1FGVL 3KYKH 1CD8A 4PJ9B 3OKEA 4XWGH 2FD6L 3WFDL 2Z31B 1YEHH 2A6JB 1NMAH 3RU8L 1WFOA 1NFKA 3BRGC 4J3VA 43C9A 3T1WA 1DUYB 4PB0H 5K9KB 4D9LL 4QRPA 3LN9A 4LLWA 2HKHL 1G6VK 4V1DB 3U7YH 5CEXA 3PWUA 1VHPA 2R0LH 4JZOB 3O9WA 1SJXA 5ID1A 3ES6A 4JPVL 2OZ4H 3VMNA 3U0WH 4UILL 4U1SA 4D2NA 3E6HB 2UWEA 3IFOB 1R24A 5I1IH 3N85L 3HC0A 4QEGA 3ME0A 3MRPB 4LLUA 2HFFB 5F7HA 3IS1X 8CGTA 3BWUC 5B4MD 1XGQB 3IFNL 4OBSA 4OJFL 5ESAB 3FB7A 4G8GD 1CFQB 5FYLL 1FO0A 2CLZA 4GO6B 1OLLA 3TEUA 3EUUA 2ENYA 4K3EL 1EFXB 3MV01 3W81A 2LTQB 3MRIA 3NOIA 3RNQB 3RWDB 1NGWA 2R39A 5T1MB 1BVZA 3TCLB 3U36A 4CVXB 4KRLB 4P46A 5I18L 3LQMA 3D18B 3BP4B 3VD9A 2V5YA 3C9NA 3HB3C 5H8DA 4K7PX 5D93B 5C9JB 5B8CA 3KNBA 2PW2B 4R7DB 5E2UL 4CRPA 1RIUH 1JK8A 4J8RA 5H35B 4OB5L 1ZA3A 2L7UA 3G6DH 2VLKD 2XPGB 3D0VA 4FFZL 3GSNB 3KPPA 3TZVC 2WY3A 2CKBB 1EIBA 5SWZB 1BJMA 2IH3B 5T3XL 4X7EC 2DM4A 3WLBB 1I1RA 3L3DB 1KYOK 5KSVB 3IXAB 2VTFA 1YEIL 4JDTH 4NQEA 4NWUL 4POZD 1BFOB 1OF2B 4JFFA 2Z8WC 3C8KB 4KAQL 3RDTA 2BSTB 3SQBA 3X3GH 1IBGH 3QQNA 1P2CB 4KU1A 1EPFA 1JZ7A 3K2UH 3L6FA 4ZUUB 3JTSA 3T0ED 4EXPX 3M1BA 3TYFB 2OR9L 4M43H 2HWZL 3FRPG 4XVTL 1R5VA 3OKLA 2DI7A 3PXHA 4N0UA 3ULUC 4ISVB 5FKAB 4YWGL 5DGRA 4LEOB 2CMRL 4D94A 4MA7H 4R26H 4JRXE 3KPSE 1BVLA 3UYRH 2E7HA 1NUFA 4C57C 1MCWM 5GGUB 2DBJA 3SO3B 3LV3B 1TQBC 1IARB 4R0LB 1D9KC 3WUZA 5IB2B 1LO3L 2BVQB 2VJXA 2YSSA 3EO1B 5I8EB 2XWJA 3GK8L 3S34H 1H8NA 3TIEB 3UP1A 4JDZA 3V4UH 1WEJH 2QADD 4XRCA 5TH2A 3R06B 5E8EB 4ORZC 4OGYH 5TDOA 5ACLA 1P4IL 1DE4A 2VE6A 3AC0A 3G6AB 3S88L 1SBSH 2ZG2A 1DLFH 3C09C 1T83A 3J8F7 1AD0A 3SEPA 4NJ9H 3K74B 3MMEA 1ZWIA 1ZSDA 1BD2A 5D7IA 1YJDC 4XNYL 4FP8H 4QRRA 3DVGB 3HZYB 5L0QC 4LPCA 3ABZA 5LXGL 4H26A 3IRPX 4KK5D 4KJWD 4PGBB 4XBGB 2R0WL 4ERSL 1CF8H 2I5YL 4GBXB 5CJXA 1CYGA 1II4E 2C1PA 4G8IB 3JTCA 3TZVA 1MFCH 1ZAGA 2XN9B 1YYML 4JRXD 2R0ZL 4LVEA 5L6YL 5EBWA 1OGAB 1DEEA 2W9LA 1KCRH 3MV7B 5C3TA 4G80B 1KGCD 2IF7A 5D5MA 4PV9B 4V3EB 4X7TA 2DD8L 4MLIA 5EZJB 1LDPH 1MCRA 3MLTB 2G60H 5IK3B 4P57B 1DQTA 4DFIA 1U8OB 3AM8C 3HE6D 2DQUH 1PY4A 1IM3A 3H0TB 2BJML 1T89C 3O6LH 5IW6A 3RBGA 3U4BH 4TSAL 4O58H 4JFDD 4X9FA 1A14L 4NKIL 1XH3A 2GSIA 5HXMA 3MYJB 5JW4N 5I1HH 3G08A 4KI5D 5ACZA 5SWZE 1BQLL 1Q9OA 3QIBD 4NQSA 1I8MA 1A0QH 1VB9A 3D39E 4HIEB 2LAAA 1FJ1B 2P8MB 2PO6B 5I74C 1FFPB 4F7EA 2RB8A 5FM4A 1FE8H 1NUNB 4FQ1H 3D1MC 3TWCL 3BEWB 2YWYA 2GY5A 1U2HA 1QTYT 3S35L 5F9WB 2GFBA 5BRZA 1A1NA 1AQDB 1YEFL 4U6YA 2H1PL 4D9RD 5EUOA 2AEQH 3I02B 4ETQB 2IJ0C 5HJ3B 3A67H 4R97C 4O5LH 3FQWB 4UB0H 3MRQA 5DJ6A 2APFA 2RQ8A 5JIHA 5D6DA 4P3CH 1RK1A 1J0ZA 2DQFB 3I9GL 5DZLA 2X09A 5FHBH 5HYSG 3UAJD 1MF2H 4DGYL 3IDMB 4HIHB 4OZGA 2M1KA 4P49A 2YA0A 4LSQL 4F7MA 3T2OA 3EO9H 4HKBA 4HWZA 4ZOAA 1DVFD 3HZKB 5D1XD 4C54A 4Q74A 4MJ5A 4G42B 1W2KT 3SDCB 4G6ML 3ARFC 1F00I 3VG0L 3RGHA 2NNAB 5EUKB 4HMEA 4L4TA 1QSVA 1PZ5B 4X7SH 5J1AA 4X8JA 1R5WA 2NY1D 5DD1H 3MGTA 4HDIB 3UZEA 1IFHL 3V7AE 1S5HB 1C16B 1P7HL 3CVHA 3QRFM 3SDAB 3BMVA 4MHHG 3QEGH 1IT9H 3GSUB 3QDMD 2FX9L 3IDNA 4ZAKB 3VWKA 3L7EB 2DWEA 3CUPA 2AJUL 1JVKA 5C0AA 2VITA 3TBYA 5IFJA 4PDCE 5TF1H 3QCVL 4FQHB 4WHTA 5BVPL 3AM8A 2IPTH 5TGBB 3KYNB 1VADB 2E6QA 1JYNA 4AEHH 5D7JD 3BE1H 2GJ6A 4AT6B 3BKCL 5DR5H 1VGKB 4OZHE 3PWLB 4X6DF 3AREB 5EU3A 4MX7B 3WFCL 4OQ1A 5FO8A 4PV8B 1TFHA 1NSNL 5JO5B 2P5ED 4DGVH 2BNRB 2ICEA 4XCCH 1CIUA 3LAFA 3QXDA 4BK4A 4L8CA 3FFCB 2UYLB 5C86A 4HWUA 3RTQA 3WE6A 4UOW0 1CGTA 3ET9F 3LRHA 5M95B 3QWOB 4GKNB 3WUWG 5B3NA 3Q6FA 4XZUB 1XGYH 3I2CH 1SEQH 4MQ7A 2MQCA 1HQRB 5CFHA 1GOGA 4M5ZL 5EO1A 2PCPA 3C5SA 3OAYK 1D6EA 3VXMD 3ARGB 3NVQA 4F7CB 2ZUVA 4HBCL 5BXFB 1OOAA 2LVCA 3LRSB 4X7DC 4UU9B 4X4ME 4FQJH 4LSUH 3G5VB 2W1NA 4H5SA 4HWBH 1JN6B 1QBMH 2BNQD 4YBQD 1GZQA 4YHYB 5MP6L 5FOBA 5C09B 1E6OH 3VFVA 4WUKH 5T1LD 2MNUA 2NXYB 4ODWB 4M8QA 1CFSB 1DANU 3ILPA 2I27N 1A3LL 5DEGB 4PJHB 3ARFA 4HS6B 1R3IH 1NAMB 4NWTL 3MUY1 4TUOB 1GGBH 3GI9H 3RVXC 2VNCA 5HTSA 3ALXA 1NFDA 2P42B 4N8VB 3B4NA 3T2PA 1U8MA 4KI5F 3TIDB 2XQYK 1PFCA 2VXQL 3V9FA 4U1IA 5D1ZB 4RISL 2IC2A 1L7TH 3VXRD 2N4IA 3OAYH 4UINH 1N6QL 5DD6B 1MFAH 2EDNA 3H9YA 4RA3A 1INQB 1ZT4B 1MCCA 1BQUA 3BQUB 4FQXC 3VGFA 2MPAL 1HOCA 2X4TB 3LOWA 5F97E 3M17B 3JV6A 5JOFB 3E8UH 2R8SH 2VLJE 4XMPL 5IW3A 5F7DA 4KY1H 2D2OA 4LU5H 1IC7H 2EDJA 3RL1B 4KQ4L 4CU8A 1U8IB 5J12B 3C6LD 1AO7A 1IGTB 4JPKL 3RVUD 1AP2B 4XPGH 3HKFA 4P2RA 2XFXB 4GW4A 1UZ6E 1PX4A 3M07A 4ZG1A 4IRZH 4Q7DA 1TCRB 3B43A 5I15H 4YHNB 2VQ1B 4NCC1 3MJ8B 5DLMH 4HWNA 1MCKA 3P11H 3NN8A 1XCQA 4QY8A 3MUGA 1KIPB 3INUL 5DURD 2E27H 1JHLH 3F7RA 4YR6B 5EZLB 4PJFF 5GS1B 1S9WB 2KQMA 1YDPA 3NCJL 4GRLB 1JYVA 2Q7YA 3QUZB 4AM0B 4LCIH 2PKDA 3DGGA 4LCUA 5D7LB 1LEIB 3GSWA 4YHML 1T0NB 2OJZL 5F7NC 4CBPA 5HGHB 1K85A 2DOCA 3PL6B 1BIIB 5B38B 3QDGB 2Z35B 4S1SH 4YGVB 4N90E 3MV9E 3BPLC 5A3ID 4PJCE 3F5WB 2QQQA 4LGSB 5DA0B 5FF6B 2ICES 3VFOB 3DTXB 5ADOH 4HH9B 5DJCA 4L5FL 3ARDB 3RIFK 1NGZA 4HXAH 4ORGA 3S5LB 4JKWA 1A6WL 2YKLL 2CK2A 4NQVA 5F6IC 2VZ3A 4XVJH 5IHUH 4AZ8A 5HVHC 5FO9B 4ZSOB 5ITFB 2CXKA 1JFQH 3P3YA 4Y4HA 3LH2L 4ZNEE 2BVYA 1CZ8L 4WI3A 4IS6A 5TFSL 4MNHA 1QSZA 4DAGH 2R56L 4NIKB 5CHNA 3SJVD 3F65A 4KJYB 4FQXA 4PJBF 1P4LA 3S9DB 5DJ0B 3P4OB 3T1FA 5KS9F 4K94H 3X13B 5TQ2L 3EJYD 3HRPA 4WHYG 1FZKA 4UOJA 3NA9H 2B1AL 3EDDA 4G43A 4F7TA 4OFKA 4QRUB 1LK2A 4JDVA 4NHCL 2R29L 5HI3C 1I9RL 4IBLT 1DTUA 5E2WH 5ERWB 4OLXH 1GAFH 5HDLA 4UIMB 5TPWL 5FM5M 2DQCL 1NCAH 2V6HA 4LK4A 4NZUL 3RWGA 1YEDA 2V9RA 5IFHL 3VRLF 1U3ZA 1MUJA 1YYLL 1DBML 1I9IL 1NBZA 5A16A 1D5IH 3WFBH 4Q6YA 3WD5L 2P8LB 1UWEL 3W2DL 2J8OA 2X9XA 3RA7H 1ZGLA 1GGUA 1A9EB 2H9GA 1MI5A 3V5HB 5IBLD 1OP5K 3QJHB 1IAII 5SV3A 1B88A 5KZCD 2HKFH 3IDIA 4NC0B 4Y5XC 2NW3B 3HE7C 3O6KH 2PR4L 1M4KA 3N1FC 4G9FE 3ARBC 5HYQA 4Z7VE 2EYTB 4TULL 3AY4C 4X9IA 1ZHNB 4ZMAT 2W0FA 3IF1B 1BWWA 5D6CA 3TBVB 4LCCC 4BH7A 3I3EA 1LE9A 1F42A 3ZL4L 2AXHA 3RKDC 1JNLL 4JFYA 4ZNCD 1HHGB 4FQPA 3ILQD 1DQLL 2OQJA 4TSCH 3VGHA 1W8OA 5DRXA 2DQDL 4U6XA 3UTTA 3MV8D 4OCRL 1YEGL 5TE4L 2NX5B 3KJ6L 3LKPB 2IANA 3O45A 2O5ZH 4LQFH 3V6ZB 3V5DA 1MHEA 5DFWH 5HVGB 2GK2A 3V0WH 5IROA 3GMPB 2DI8A 2GT9A 3GI8L 3LN5B 3QQ9C 4ZUWB 1OP5H 4GG8B 4ENED 3IVKA 3E6FA 2ICWB 1BZQK 2DYPD 1EXUB 1I4FB 1VFUA 4Z7UA 5DT1H 4ZDHA 3IJSB 4NUGL 1AGCB 3K2MC 1OCWH 2AKRA 2FJHB 2YD3A 5I1LB 4Q0XL 1NGYA 2NY3C 1ZS8B 2BC4A 3FOMB 5GGSB 1MSPA 3QIUB 3P77B 1JJUA 4TUKL 2QKIB 4FQ2H 1T2QL 4ZSOE 1CLCA 5E8DH 2WIIA 5FK9A 1FSKB 1CE6B 1IKNC 2RGSA 4BUGA 3W5MA 1IQWL 3MRRA 2FYYA 2Y4SA 3PHOB 1EO5A 1NBVH 1ACYL 3DURA 1U8JA 1WBXA 1KN2L 4M8VA 1Q8MA 5L2KD 4WGVB 4YDLC 4I9WE 1U95B 3QEUB 1NBQA 3EJJX 2CD0A 4KI1A 5CGTA 3O2DH 1MHHB 3EO0A 3PGFL 2MJWA 2VLME 4LQ1A 4ZXBB 5E8OB 2P47B 3LEXB 5ETUB 5I1KL 4H0GA 3D85A 4YXKH 3X11A 3QUYD 3IDXH 5DA4A 1A6UH 3CC5B 1BAFL 4Y5XA 7FABL 1N2RA 1RVFL 3HE7A 3ZHKA 4JCLA 4OCMC 1K3ZA 3MLZH 1MFNA 3AY4A 2VWEC 3HMXL 4ODXA 1C08B 1WFTA 1ED3A 3HA0A 5FGCE 3UDWC 3LSOA 4U3HA 4PYHA 1KSRA 2XICA 3QEHA 4P3DB 1X5IA 5EBGA 4MB3A 4JPWL 1K3IA 5GSVA 5GZND 1CE1H 1S7UB 2Y07H 4HUUB 1FCCA 2C3HA 4PJXF 3SDDD 1U8HA 4F57L 1L9MA 2L0DA 2O93L 5GS2H 3HG1D 3ZT6A 4XC1L 2IWGA 1TMCB 1T66D 2PW1B 3UPAA 4Y4KB 1QFUL 3B9KC 2WWMD 4PP2A 4XP6L 1RUKL 3IAPA 1EEQA 3FO2A 4JFED 1AGEA 4GAYA 3OF6A 4NNYB 4JM2F 4QNPE 3S4SA 1A7OL 1NGXB 1UM5H 3V7MA 1XGUA 2UZXB 4XBEL 1G7JA 3BEVB 1C5BH 4JB9L 4N8CH 4QHUB 4IOIA 5J11C 2OL3L 3KLAA 4S1DC 1ZGLM 2QHRH 3HMXA 1RQ5A 5JNYA 1BZ9B 1UH4A 4ZTPH 1XCTB 5F3HB 5GPRA 2WV3A 3N9GL 5F89B 4PJAB 1GIGH 3I50H 4L3EB 1R5IB 2X44D 5D1QC 4WV1C 5JZ7C 2Z91A 1JWMB 3O4LE 2ZOLB 3KYMA 3RWCA 3VH8G 1LWRA 1V3JA 4XAKD 3CH1A 1Y18B 1IL1B 3UJIL 4HJJL 2GTWB 4PJ7B 5JHDA 4JAMA 5FA4A 4P5MB 5C6PB 4JRYE 3HR6A 5D2LA 1A3QA 3LPGA 1K6QL 3MGOA 4NKMB 2P5WE 1B9ZA 3ELAT 3OL2A 4PJIE 1FNEA 3MSPA 1G7LB 4DOHE 4X9BA 5E99H 3K7UA 1BF8A 4ZOEA 1FNAA 1H15A 4F3FA 5JQ6H 2YPKB 1EZVX 3QAZB 5I6XB 3UDWA 4HKJA 2PF6A 3QIWB 2HJLA 3BGMB 1CLZL 1L0YA 1MOEA 4BZ1L 3NIDE 1GXEA 4BSJA 2XNAB 3SOBH 4LPVA 1MFEL 3EFDL 2FSEA 3RZWA 2HRPH 3ZKMD 1KTDB 4NSKB 4Y4FB 2BFVL 1Q0YH 4HKXA 3G6JB 3TO4C 2Z4QB 4X6CB 2X1OA 3HNSL 1F3JB 3L3KB 3RVWC 1YNLL 5CLWA 1M7IA 1BJ1J 2H6PB 3OAZK 5DSCB 1K4CA 1ZT1B 3B9KA 1A6VL 5BQ7B 1I1AD 3VXOA 4HUXB 1W0YT 5CSZB 4MNGB 4RIRA 2Q86A 4I0KA 3B5TA 4PJGB 3MACL 3MBEC 5D8JL 2NY0B 7CGTA 1K4DA 3WS6C 3STLA 2D7PA 4U1LA 5CD3B 4BA8A 1MJJA 5C0ND 4NT6A 2EZ0D 3DI3B 4YFEA 4AIZB 1A1MA 1ZHLB 3A6OA 2D31B 5I8OL 5MENB 1EZVY 1ES0A 4GRMB 1IEAB 2B0SH 4FABH 1A9BA 4OZIF 3UC0L 1HH6B 3H9SD 4LIQE 3WFHA 3O4OB 1U93B 4MNQD 1T1XA 2WAHA 3KYOA 4MDJA 1UVQB 1MH5B 4ODSL 4R7NA 1JCKA 5JUEH 1U3JA 3FMGL 2ZUXA 2EDEA 3FHQA 2F54B 3PQYD 1RFDH 2GITA 4K23H 5DQJA 5D1QA 2DQTH 2Q8AH 1PG7X 4KJQC 3LKNA 1XF3B 5GGVH 2VN4A 4ZODA 5INDA 4L29A 4XWOC 3JTTB 3OAZH 4PRBB 1CG9A 5I1CH 1BM3L 2VERN 1UZ8B 4FG6D 4MMZC 1WAAE 5IKCA 1I7ZA 1PKOA 3O2VL 4PRAB 4ODBD 3WYRA 3MXWH 3HI1A 4A6YL 3ZO0A 1S7WB 1F97A 1XR8B 4JFHD 4WDIA 3K8LA 4X5WA 2QQNH 4NKQB 3VJ6A 4XCNA 2DJ4A 4JN1H 3IGAA 3QEQD 4YE4H 2ICCA 5GZOC 1Y6MR 1RJLB 3PP3K 3VXQB 1Q72L 1NLDL 1I85C 1Q94B 5GIRB 1YC7A 3LQZA 5DXWA 1KEGL 4EDXB 3RX7A 3S36X 4X5XB 1IEHA 4OGAC 5CEZH 3GSNH 5DRZB 3ETBF 3QDHA 2AXFB 3DXAE 2DQEH 3KLSA 2J4WL 3VGAC 3P30L 2ZCKH 4C83A 4U1NA 2VLLB 2DTMH 1W0VA 2P1YA 1B6DA 4R90L 4U1KB 5IGXL 4PB9L 2JCCB 1MJ8L 3L95A 4L4JA 4RMVA 5DZNA 1ZK9A 2OP4L 3VXSA 1EERB 1T04A 1T1YB 4HUVB 1NCDL 4JQVC 4ZUSA 4Y5YB 5AUMA 4XP9L 3MOBL 1AE6H 4YBHA 5E0QA 3MBEA 4A6YA 3CVIL 4WW2F 3E2HC 5EO0B 3WS6A 3IETB 4R3SA 3MLUL 4UTAH 3NTCH 4QXGH 5F7EH 4X6FB 3EYQD 1RIVH 3PP3H 3O3DA 1RI8A 5D70L 4EN3A 4MJID 3AS2A 4X6CE 1H3UA 3MODH 2W0KA 2WK2A 1X7QA 2AK1H 3FT4B 4PJDF 1QPPA 1YNKL 2AGJL 4RMRA 2GIYA 4HF5L 3SDYL 3U7AA 4MS8D 5E5MB 4ODHH 4U1HA 2EXWD 1NCBL 3VMPA 3GMOA 4WCYH 1FVDA 1CR9H 1FL5A 2V5RA 5C6TH 2DLIA 4WUUA 4BH8A 1CD1A 4OIIH 4AEIH 1MFBL 4GKZA 1AJ7H 2XZAH 1YY9D 3KAAA 1HINH 5TQ0L 1LEGB 1NGQL 3OTTA 4CAGA 5FYKL 2R1YB 2W9EL 4PRHB 4ZPVB 5JPNB 5AD0B 1OTUC 4KJPC 5TF0A 5IQ7H 2E7LE 3HUJE 4HJ0C 4QTHB 1RZJC 4M3JA 5IB5A 1DN0B 5EN2B 4AG4H 1T0MA 4WO4D 3D9AH 4L4VB 5LVEA 2LU3A 1MJ7L 2HG5A 1U8KA 4PJEB 3NA4A 4POUB 1RUAH 4XP5H 5E9DD 5TE7L 2D3VA 5DTFA 1I85A 4M62H 1FLRL 3R0NA 1ZA6B 4HC1A 4M7JH 4CDHA 4GXVH 5CBEB 3RUGF 1QPXA 4UUJB 1MCPL 1KXQE 1U8PB 3MLWH 2XZCL 5KVEH 4P5KA 3T3PF 1UQSA 2R1XA 4NNXA 1KCUH 5LWYH 5GHWL 4JY6A 3L5WA 4CVZA 5HYJD 5GGQH 4RX4D 2FLRT 1RZ7L 3N0PB 2YD1A 1MPAH 1B4JL 4WU5B 4ELMB 4XXDA 1I1FA 2GSGB 2XQBL 3L5IA 4JQVA 3FT3B 1IGIL 5ANMB 4GG6E 2W38A 2AV7B 4APQD 2NY7H 1UM6L 3E2HA 5FYJD 2PXYA 1KF9B 3L1OH 3UJTL 4CVWA 1BGXL 3OKEB 5L2JA 1CI5A 4X6EB 1A3RL 1BECA 1CN4A 4JKKA 3ULVL 1DZBA 4HCRL 4KVNH 2JCCE 3CDGA 1LP9A 1M71B 5DJZB 5C07B 5DZOA 1ORSA 4LLWB 4OBRA 2XQYG 32C2B 2RIKA 2EIZA 3V6BR 5DEFA 2HVJA 3I6GA 5ID1B 3ES6B 4J3SA 3OKMA 3RGVD 4U1SB 3T8XB 1B0RB 1R3LA 2RR3A 4P4KB 2IADA 2UWEB 3OGCA 5ESQA 3OJMB 1KCKA 3I75A 2VDQL 1NH6A 1JI1A 5KSBE 2AK4A 2UZIH 4XVSL 5JHLL 4G9DA 4PGCA 1QSEA 5C08A 2IMNA 1U3HD 4O02L 2R0KH 4XMKL 3G5ZB 1H3XA 1ZKAA 3TJHD 2HFGL 1CDIA 4MXQD 3QDJD 2CLZB 3CFJB 3NACL 1FAIH 1OPGH 4AENA 4ZD3H 3MRIB 2A1WL 1NGWB 3HC4H 4KK8D 4OTXH 3U36B 4P46B 4U0QB 4BQ9A 3L3JA 3NGBB 3TA3B 1G7QA 1RIHL 4OKVA 3VFUA 4ZUTB 1MCEA 2VH5H 3HI5H 4ZFGH 1ZA3B 4HCRA 1JHKH 2RJMA 3CSYA 2FGWL 3D0VB 1P4BL 4JY5H 4KRPC 4PY7A 4AMKH 5J1SC 2I25N 5BO1L 2BVOA 3PDOA 3MNWA 5IB4A 1HIML 5EWIH 1F6AA 2PTVA 1E27A 3MJ7B 1EGJH 1SYVA 5FB8B 3BPNB 3OKDB 4NQCA 1B0GB 4DVRH 2O5YL 4TVPE 2KUTA 3AXLA 3JVGC 3CK0L 2A9MH 4IRSC 2QQLH 4WENB 4KKLC 2W0LA 3FB8A 4C56E 4G7YL 4HEPG 4YDJA 3RDTB 1QSFA 3KPQB 4N5ED 4Z76B 4XB8A 4Z77A 1AI1L 5HY9A 5C0CE 1XIWD 2EDBA 15C8L 4WHCA 2GTZA 1RMFL 4ZO6A 3P0VL 2BOBB 3JTSB 4DUVA 3OJ2C 2H2SD 5D2NB 2A9NH 2NXZB 4TSBH 4MCYA 1WLHA 3C2AH 5EIVA 2UV3A 3WKNA 5I1AA 1CK0H 1NC4B 4E41E 4U49A 3U6RA 1YEEL 4NGHH 4Z78A 4LLMB 3WSQH 2XTJB 1TJHL 4AQ1B 4C58B 3QT2A 2YEZB 5F88B 5IMKB 1JUFA 4MAUL 2C3VA 5J06A 4KKAD 2XWJB 4WTWA 1TJGH 4F15B 4NHUA 1ZANH 5DMKA 1NL0L 4QRPE 5TH2B 3OSKA 2GJZA 4TOYH 5TDOB 4Z7QF 4YAQA 5EO9A 3DETD 1EEYB 3OAUL 2XT1B 1D5XB 3D25A 5MI0C 4PG9A 1KCLA 3D2UA 3DWTA 5GQBA 4TPRH 4BSWB 1AD0B 2UWEE 3VXUD 1FIGH 3NFPB 3MMEB 4M7KH 4NN5B 1ZWIB 4Z7NE 1RZGA 1ZSDB 3NABL 4Z6AT 5D7IB 1A5FL 2WZPD 2VZ1A 3BO8A 1I8KB 1NAMH 3NCYS 1ZLSH 3KDMA 3LHPL 3F8UB 3GHBL 3PIQB 3TESA 4KDWA 4LLVB 2O26U 2I60L 3VWJA 4E41D 2XZQL 3KR3L 2NZIA 4HUWB 3RP1A 4PJ9D 3EYFA 4LVHC 3WO4B 2YR3A 5FYKU 1AKJB 2Z31D 5HHQA 3MCLH 4OV5B 5IEKA 3K8MA 3V0VA 1EVTC 5BV7L 1TNMA 4HPYH 4JHWH 2F5BL 2ADFH 5D5MB 1PZUB 3TV3H 2HLFD 1T6VN 4JEGB 4V1DD 1C5DB 4LCWA 1PX3A 2A77H 3UPCA 4BELD 4G6FB 4IRSA 4NN6B 1DP0A 1B4RA 3WIHH 1C1EH 1IM3B 1J1OL 3UBXG 5D96C 4XP1L 3DARA 1I1YA 1AIFA 1BX2A 1XH3B 2V9TA 4F33B 4KVCL 2GCYA 4K8RC 4OFIA 3JWNC 3TPUB 2WUBL 3OZ9L 4Z95L 2Q6WA 1N5AA 4XPBH 3HFML 1IGML 4Y16D 5DD5L 4F7EB 4Z8FL 1EFXD 5C9KA 3KPRA 1JPFA 2EKSA 4LLQB 3C5ZC 4P2OB 5CJQH 3QXVA 4TTGA 5IR1A 5F9OH 4YBLB 2GFBB 4NQEE 5BRZB 1A1NB 4G8EA 3BVNB 4U6YB 4JFFE 5EUOB 1KJMA 5I76A 4UNVA 3P9LA 3PXJA 1YY8B 3FRPA 4GFTB 4BZ2H 3AB0C 5B39G 2EECA 3MRQB 5DJ6B 3HC3H 3B2VH 1Z3GH 1LEKA 1CDYA 2NCMA 2EE2A 4R4ND 3EZ8A 1T7XA 4U6HA 1UCBL 1KNOA 2ESVE 4XHJD 5HHXL 1YZZA 1T7WA 5HI4D 4JO4L 3QH3A 4N0UE 3MNZA 3GMMB 2VDRH 4H8WC 5EU5A 1RULH 3QZWG 5F1OB 1CGSH 4P2QA 1L9NA 4OLVL 4PP1D 4MJ5B 2X1XR 3QUMB 5B4MC 3ZKND 1LK3H 4K3GA 1G7MA 5HGAA 5E5RB 1HYSC 4WW1A 4L4TB 5IJVA 4M61B 5J1AB 1R5WB 5FDWA 5DJ8B 3MGTB 4NBZB 3PGCA 1QLFB 1C8PA 6FABH 3I3BA 1FDLL 2YBRB 4LVOB 5GS0H 1OAQH 5EU6D 1F4XH 4F80A 3PWPA 2CXGA 1CFVH 1T7ZA 3VWKB 3AVEA 1WZKA 2DWEB 2J8UE 2F58H 3CUPB 3F7YA 3FQUB 1CGWA 3BDYL 5I1EH 5C0AB 1BD2E 1SJEA 2AJVL 2VITB 3TBYB 4K7FA 5K9QI 4NP4L 1DQJB 4QRRE 1WT5C 4UTBH 3VXNA 1CFBA 3WIIH 4XHQA 3V6OC 2GJ6B 1XEDA 4H8WL 4J1UA 3X12A 4XPAL 1MREH 2VABA 4OF3A 1I3GH 4S0TD 4RFOL 4JFPB 5C0IB 4BQ8A 1M6OB 5DJYA 1DBBL 3SE9L 1VFOA 4HJGB 3FKUS 1CXHA 3RIAK 2ICEB 1IAMA 5D5ME 3QXDB 3B8SA 4L8CB 3MJ9L 2AQ3A 4BYHA 3TF7A 1HKLH 2HA1A 3CPLA 4KQ3L 3C5ZA 5TJWK 3RTQB 4D8PA 4POZC 4WI7A 2NPLX 3H9HA 3Q6FB 5DQDL 3QRGL 4ZO7A 4OSUH 5KTEL 5SV4A 1EEZB 2CK0H 3OKNB 4K9EH 4GSDH 2PCPB 4HIIB 1D6EB 3ECBA 5GISL 3LKSA 3GIZH 1FFQA 4GBXD 1QA9A 1YEKH 2DQHL 3EYVB 3HB3D 1HH9A 3VRIA 2H2PD 1M1SA 1GC1H 3T4YA 4BJLA 1MRFH 3H42H 3O11A 1XF2B 1FN4A 1MIEL 1F45A 1OGAD 1HSBA 3ULUE 5BRZE 3MV7D 3T0WA 5FOBB 1DBAL 2X4NA 4PGEA 4GW1A 3NMEA 5CILL 3EOYG 3WFEH 3EYUL 4LSTL 5KANG 5A1AA 4AY0A 2VQTA 4PGDA 5DJ2A 3ILPB 4UIKL 2FEEI 2YD9A 3U4EB 4IJ3B 1NJ9A 1MCJA 4G8GA 2FHBA 4I18A 2EYRA 4PYGA 1P84K 3MJ9A 3ORJA 2OTWA 4L8BB 4BFGA 1U8MB 2QADC 3PP4L 1KIQA 3PJSB 4U1IB 1J8HD 4KUZL 2ZUQB 3NIFE 4NC2B 4OZGE 3IDYB 3UTPD 1EAPA 1HXYA 4U7SA 4X0KA 1BFVL 4X7FC 5DHVH 1QBLL 1JMZA 2D7TL 5FGSA 5I1GH 4DVBB 3CDCA 5LCVH 1WT5A 4KK5C 5HDOA 1MHPL 1IEBA 1CU4L 1OARH 1G7HB 2JK5B 4L4TE 4YHOL 3V6OA 1KPUA 4N0CD 2N7AA 2AABH 2BDNL 5KSAC 3MRJA 2EDTA 1AO7B 5L8KB 4RGOH 3OG6B 3IKCB 3OKOA 4XH2A 1TENA 3SKNA 5IT2L 5JLZB 4OD1H 2E7MA 4UV7L 4OZ4A 3S96A 1S9XB 2FECI 3PV7A 1NFIB 4DUWA 1D9KD 2CLVA 3DX6A 3OPZL 5DMYA 4ODUB 3DNKA 3GBMH 1PG7L 3NN8B 1XCQB 1OB1A 1FVCA 3MUGB 2Z93A 2GJ6E 2Y72A 2DMKA 4Q58C 1BFSA 4KFZC 1Z5LA 1SY6L 4FA8A 4XPTH 4KI5C 2VDPL 4B53A 2JELH 1YDPB 3QPQD 3QIBC 5IW1B 4JGJA 2Q7YB 3T0EA 3DGGB 5DMIL 4LCUB 5DMJB 4WEBH 1TVBA 2V7NB 4WFGE 4KPHL 3OXSA 1JRHL 4HW6A 3SDAD 4KHTH 3OWEA 4JFXA 1PVHA 2I24N 4NRXB 1RZKC 5IVXA 4ZAKD 1F8TL 1JGVL 3Q3GA 1WUNT 3WNPA 3CFDB 3RWIB 3HI6L 1CL7H 12E8L 1KXTB 5JXED 4O2CA 4S2SA 3V6FA 2B4CH 5D71H 2VISA 4X6DA 4M6OL 2BVPA 3O2WH 5T5FH 3THMH 1T5WA 5LJYH 4OT1H 4MXWH 4LIQH 4OAWA 2AJXL 3DV6A 4U4BA 5FM8A 3ARED 3EYSL 5IG7A 2AJSL 1QEWB 2X1QA 2WLYA 4Y4HB 1INDL 3MLSH 4MNHB 2BNRD 2DWDA 5JIIA 4YDVA 3JV0A 5CHNB 5D1XC 5C0RL 3FFCD 4XCFH 1SY6A 2AEWA 5D7KD 1DBKH 2VAJA 3LIZL 4TRPH 1P4LB 2PNDA 3HPLA 1R0AL 2Q20A 1KCSL 3T1FB 5D72L 5CD5D 3QHZH 2EO9A 3GUTB 1OAXH 4O51A 1OAZL 4UT9L 1NFDE 4G43B 3FN0H 3QG7L 5GGTH 1IC1A 1DEDA 4PJ5B 4JRXA 1HHHA 5FHAH 4HZLA 3P9MA 4G5ZL 4JFQA 4EI5C 5KVGH 3BKJL 1F6LL 3GHEL 2G75B 3RWGB 1YEDB 5ITBH 4HFUL 2AJYL 3W9EA 3HE6A 4JGMA 4GQ9L 1TIUA 5A16B 5C09D 3SY0B 3SHSA 2A83B 4YC2C 3S37H 4JFDA 4FTVB 2NXYD 3V7AG 1ZGLB 3O6ML 5KG9A 1EO8L 5AZ2L 2RHEA 2YZ8A 1NUDA 1AO7E 4GAGH 5I19H 5TDPA 5IQ9A 1B2WL 4D0DA 4P2RE 3IDIB 3VW3H 1YQ2A 3TC9A 4RRPG 3JWDC 3GSOA 1VFMA 3G04A 3MUJA 5K9JL 2B5IB 3DSFH 2K7QA 2W60B 4EVNA 5D1ZD 2W0FB 5I75B 1OM3L 4ESKA 4U7MA 4JHAL 4WGWB 4U6VH 4XX1G 1LE9B 1OAYL 1P5UA 4JFYB 4I3SH 2GQHA 3KWWA 4K2UH 3IFLH 4XNMA 1U36A 3BQUD 1P6AB 4P48A 4HG4K 1VESA 4GXUM 1FL3A 4U6XB 4P9ML 3VFPA 2VL5A 2J88H 3IAGC 1MHEB 5CZXD 1BHGA 3V52L 1N26A 2PTTA 2IBGA 4P4RA 1A7PH 3PNWA 3ZTJH 1GGIL 4YBQC 3PABA 3BP5A 3IVKB 3E6FB 5E4EB 1FRGL 1DVFA 3PDDA 2CO6B 4JE4B 3ARRA 4Y2DA 3C60A 3TJEH 5JW4R 1QHOA 2QQKL 3QP3A 2HTKD 4I4WA 2VZOA 3C5JA 4YHKH 4OCYH 2AJZA 2VRAA 2XG4A 5GRZA 1PKQB 3EZJB 3WO3B 5SX5K 3FOLA 4GRLD 5A2LH 5CZKA 1K8DB 4WI6A 2WIIB 3QDMA 5FK9B 2CH8A 4JKPL 2X4PA 1RU9L 3DJ9A 3MRRB 4EUPG 2R2EA 3FB6A 1U8JB 3RWFB 1NAKL 4RAUA 2JJSC 1CT8A 3PL6D 1MFDL 4WTZA 4HAFA 5D7JA 3QDGD 2FX8H 2ZCLL 4RWYL 3EO0B 4NYLB 1JYWA 3MXVH 1FV1B 1G6RL 3WXVL 3C6LC 2EKJA 5E8PA 1SJVA 3RVUC 1MWAL 1Z9MA 3F6LA 4QXUL 3BUTA 2P5EA 4ZO9A 3QG6A 2H3NA 2MWCA 3NPSB 1WZ1H 4M5YL 3BD3A 3ZKSD 4ODXB 1ED3B 4HMCA 3ROLA 4DCQA 4NKDB 5DRWA 2WIMA 5E6IB 1B6UA 1EH9A 5SX5H 4ETYA 5KS9A 1SBBA 3MLYL 3VG9B 4H88H 5K33A 1TVHB 5GSVB 4WI4A 2HT2D 1MCOH 1J7VR 4JZJB 1MI5E 4FXGA 1J1PH 3ZKXC 5I2IA 1U8HB 3TT1L 3SCMA 2A73A 1HN1A 2YN3A 4W4OC 3QQ3A 3KS0J 2B7DT 2BNQA 4PP2B 5CINH 4LSSH 4OZHA 4FQCL 2I9LA 4GAJH 5C6WH 4YDIH 2EIBA 4FQLH 4MCZB 5T1LA 1J18A 1G6RA 2FB4H 1RJYB 4BQBA 1KIRA 2A74A 5CIPB 5A3IC 1I9EA 1DSFL 2QSVA 1JZ8A 1QQDA 1EJ6A 3KHOA 4OF5A 5IBTL 4P23B 2MHAA 3BW9B 3UTTE 1W0WA 2VQUA 1UYWH 1YPZE 4OCSH 5JA9A 1XGTA 2IANE 1CDGA 1A7NL 3B9DA 5GRVL 2F8VA 4OGXH 4PJHF 1FH5H 4F7PA 1MQ8A 1RURL 3VXRA 4JVUA 3GMNA 2CRZA 3MRDA 4ODTH 4S11A 5F71A 4L9LC 3JWOH 3MLRH 4DN4H 1LDSA 1E4KA 4JANA 4Z7UE 3AMKA 2DICA 3RWCB 4MA8H 4Q9QH 2VR4A 1A21A 3CH1B 4QHMB 4X4MA 2JJSA 3W0WB 4YDLB 4NRZA 3KPNA 4TN9A 1CLOH 3EW3B 5JHDB 4OLWL 4JAMB 5FA4B 1H3TA 5IMMA 5EFIB 4R4BA 3MZTA 2YUXA 4TQEH 3RWEA 3C6LA 5D2LB 1LD9A 4MQTB 5I8CB 3MRFA 5DYOB 2OSLA 3IKKA 1JWSA 3EJZC 4OCLC 4MDIA 2NX5D 1DBJH 4G6JH 3V2AR 3SGJC 1HHKA 1CGVA 4PPTA 4UV4L 1CBVL 5DK3A 4JM2C 1KB9J 2H26A 1QYGL 4RGNC 3WKMH 5T1KA 4HKJB 1P6FA 4ONFH 4IOFD 2HJLB 4KWUA 3VU2A 1MY7A 4HX1A 2OL3B 3UO1H 4N8VG 2APXA 3BJLA 2OLDA 5DF0A 1IGFL 1BLNA 3BZ4A 35C8H 5IBLC 1AR1D 4WJ5A 3UTQA 1RUQH 3U4AA 5DS8B 1P1ZA 2VXSH 2IAMB 3TVMD 4H1LA 1Q9KA 4UT7H 1KXVC 2Z92A 4H20H 3Q6GH 4UAOB 3X17A 5EOCL 2HJKA 4XC3L 1SYSA 3VXOB 4XCYA 4FHBD 4HS8L 1D5BB 4LARL 4OLUL 1QLEH 2Q86B 4MA1B 3RRQA 2Z0BA 1T21B 4L8SC 5LGHL 3ILQC 1VACB 4M1CC 5CEYB 1UXWA 5TE6H 3C87A 2AXJA 4NT6B 3C6SA 4DN3H 2XKUA 3DLQR 1E4XL 2DQGH 4RNRA 3S97C 4ELKA 2ZJSL 4ONHA 3RY6C 1ES0B 3UPRB 4PLOB 4X5LA 2OTUB 4ZXBD 1UEMA 4KDTA 1T1XB 3KYOB 4M1DH 1Q9LA 1N6VA 4IMLA 1FPTH 3T65A 3T2QA 1EVUA 4R7NB 5EZOH 2AAVA 5I16B 2VDNH 4JG0L 1GGCL 3P2TA 4ENEC 2GITB 4L9LA 5BVJB 4KZDH 3SJVA 4JO2H 3SGEI 5E94B 4O9HL 4FFVD 5INDB 1T20B 2QSTA 1LVEA 2C7UA 4HIXL 1CG9B 3ARBD 1U58A 4PJXA 5IKCB 1I7ZB 1EMTL 4GS7C 2VZTA 2CRMA 3HI1B 1KACB 1QRND 4OFDA 2I9TA 4JZNA 4WDIB 4J4PD 4X5WB 3RKDD 3MRBA 4R4FH 3VJ6B 2AI0H 4FNLL 5KVFL 3MV9A 1DQDL 5B38G 2FATL 4PJCA 3WNKA 1U41A 3AAZB 5ICZB 3L5XH 2XXMB 4CN4A 1UA6L 1FGVH 3IJYB 1S5IL 2FD6H 3WFDH 3RU8H 1N4XL 2PYEE 1RAMA 1UADC 4I5BA 3DV4B 5EC2B 3S5LG 1T6WA 1R3JB 4PLJD 3G9VA 4D9LH 5JIKA 3WCYA 3MLVL 2HKHH 5IHZB 3QQ9D 2D4FA 3QUYC 2FZ3A 4JPVH 5EC1B 1X5XA 4UILH 3CSBA 3N85H 4F8TA 3L95B 2HN7B 3PF2A 1KV3A 2VWEE 3IFNH 3VXSB 1T04B 4OJFH 3PG2A 5ID0B 3CFKA 5CZVL 4L3ED 4ZUSB 5MHSE 5AUMB 5FYLH 3O3AA 4L8SA 3F7VB 2ARJA 4PRPB 5GZNC 1SEBA 4K3EH 4XPHL 3SDDC 2EC9T 2FBOJ 4EN3B 1ERNA 5D7SL 1AR2A 3RIAF 5I18H 4I0CC 3C8DA 5FUZL 5GRYA 4JREB 1DDHA 1T7VA 1T66C 3I84A 1X7QB 1J11A 2WWMC 4UDTA 5E2UH 1RZ8B 1UWGL 4LSRL 4BKLA 4U1HB 1QUNA 4FQQA 3IT8D 4OB5H 5EU4B 2V2TA 1MVUB 1JWUA 3GMOB 4XAWL 1G9NL 1FNGA 2DLTA 1TTUA 1KELL 4FFZH 5J4MA 4HSQA 4WUUB 4IEFB 1CD1B 4LKXB 3FL7A 5KOVC 1MNUL 4GKZB 3QIWD 5T3XH 3BESR 4Z7VA 4L3CA 4R2GB 3U30B 2D7QA 3TPKA 4PREB 2P44B 1NBYB 1T3FA 3O41B 3OB8A 8FABA 1YEIH 1OLZA 3H3KA 2J6EL 2FRGP 3MA9L 4NWUH 3UTSD 3V8OA 4JJ5A 4KAQH 1T0MB 2V2XA 3TBSA 5GJSL 3JBG7 1UWXK 3PV6A 4NO0B 4EIGB 2HG5B 3WNOA 1U8KB 4HAGA 4BM7A 1G9MC 4WW2C 5J6GA 4CU7A 5L2KA 5I1JL 5DTFB 5GGRA 1KB5L 3VI4E 5I71B 4K07A 3U9PL 1AGBB 2JJUA 1U8NB 4LP4A 1X5FA 2NY0D 4YNYA 4QHKI 2CRIA 3KXFB 2OR9H 2HWZH 3B6SB 2ERJC 4XVTH 1U8QB 1ORQB 4G8FA 4Z18A 3QO0B 3QUYA 1VFAA 4YWGH 3K0WA 4Q6IC 2CMRH 5MEND 3CGTA 2WBWB 3LPFA 2P46B 5B22A 4OZIB 5HGDA 2CUHA 3L5WB 4N1CA 4N5UA 4ZFZA 4CVZB 1OT2A 3BKML 2ZG1A 4NO3B 1OW0C 5EOCJ 1LO3H 1PGRB 1AGDA 1I1FB 4LPXA 4XXDB 2HJFB 3GK8H 2F54D 4KRNA 1F3DJ 3RJQB 2F53B 4LHJB 2H45A 2PXYB 3AROA 1N8ZA 1MCLA 3ZKMC 1P4IH 1UWXH 3ULSA 1YQVL 3D5OF 3S88H 1G9ML 3SDDA 3QSKB 1GZPB 4OCXL 2R4RL 4UNTA 2X6MA 1H5BB 4M93B 3HG1A 4HK0A 3CDGB 1LP9B 4XNYH 5F3BB 3GFUA 1ZHBA 4QHLB 1ORSB 1I1AC 5HD8D 3QWRD 1KB5A 4JFEA 5LXGH 3IYLW 1AHWC 2R0WH 3I6GB 4ERSH 2I5YH 1KBGH 4G7VL 4JRWA 4BK5A 1HXMB 3QO1B 3OGCB 5ESQB 3L9RA 2X7LA 1NEUA 5C0NC 2X70A 2EZ0C 1YYMH 3V4PL 2R0ZH 1QSEB 5L6YH 5DWUL 3ZDZF 2E9BA 5CUSL 4WEMB 4YZFE 1F2QA 3EBAA 2DD8H 3MO1B 4Q2ZA 2WBJC 3N50A 5DJAA 1IAIL 1VPOL 3WLWC 1FQ9C 2AJ3A 2QR0A 2BJMH 4DK3A 3QXAB 1AXTL 3Q2CA 4HK3J 4TSAH 1A14H 4NKIH 5CJBA 1HCFX 2BY2A 4LAQL 3WXWL 1CS6A 4YDKL 4HWBA 4OKVB 3UTZA 3MREA 4PJAF 4OQTL 5C3LD 5ESVB 3ZSSA 5FKPA 1BQLH 2HAZA 4FG6C 3X14A 1U6AL 4MB5A 3H7LA 5F6HI 2F8XC 2OI9A 3OHXB 5CCKH 2J12B 3CSYB 3TWCH 3F12B 3FO0L 1FNFA 4X83A 1UKTA 1FG9C 3PDOB 3BH9B 3MNWB 4PJ7F 1H8OA 4LASL 3S35H 4JJHA 3O6FC 4QKXB 4NN7C 1F6AB 1VGEL 1YEFH 4MJ6A 1E27B 2H1PH 2ATPA 3DX8A 1DCLA 3VFWB 4NQCB 5LBSL 1P53A 4MWFA 1ZTXL 3RZCB 3WEXA 1L6ZA 1OW0A 3TH4T 3QFJD 5E7FA 3I9GH 3BIAX 1JGUL 1QFWI 3ROOB 4TSCL 4YDJB 1DQQA 3ESVF 4L8DA 4DGYH 4Z77B 3U9UA 3V0AC 5HY9B 5DHYA 2VXUL 1QP1A 4MD5B 4K94C 3P4NA 3S98A 4LSQH 2FWOA 1NDMA 3DVNA 1FZOA 4GW5A 3LPWA 5DJXA 5EBLA 2XA8L 3GBNL 3G6JF 1WFUA 4MCYB 4X6CF 4G6MH 4N9GB 3VG0H 4X4YA 1AHWA 5JW5B 5FYKE 2V2WA 1S9YB 3FO9A 4Z78B 4L4VD 2B1HL 5IMLB 1IFHH 2YUZA 4ZTOL 1HSAA 2N1KA 2VB5A 4PJIA 4FS0A 1MAML 3D0LA 3EYQC 4YHIA 3RUGA 4PJGF 5GZOD 4YK4B 1WCBB 5JOPD 3IU3A 1ITBB 2X89D 3GJFA 5IB1B 2FX9H 3MJ6A 3EAKA 4ZFFA 2AJUH 3H9SA 4MNQA 5CBAA 3O3EA 3QCVH 2GJZB 4MS8C 5BVPH 1SHMA 2YD8A 2EXWC 5C92A 1T80A 3U1SL 1N5YL 4KC3B 1J88A 1Q0XL 2HLAA 3T0AA 2F74B 3BKCH 1C12B 3D3VE 5FO7A 1RZGB 1NANI 4LSPL 3WFCH 2AK4E 1JF1A 1QSEE 1RUPL 4PTTA 5C08E 1NSNH 3DOSA 1CGUA 4ODVL 3CLFL 3VWJB 3HR5A 1GHFL 3HAEA 3ZTJG 1S7XB 3EYFB 5F1NA 1T22A 5IIEA 1XR9A 4MXVF 2KDGA 5HHQB 1A6ZB 3QEQA 5IEKB 4LLDA 3UZVB 3V0VB 1ODAA 1R3HB 5INCB 2X41A 3DX7A 3LN4B 5C07D 4M5ZH 1CVSC 3VGEA 5FDYA 1LGVA 4OKDA 5LKNA 5ALCL 5T33L 2N56A 1RZIA 5T3ZE 3O3BB 4HBCH 1FORL 4Y5VC 2EDDA 5C0GA 3DUUA 4P4KD 2YUWA 2FBJL 1I1YB 2VDML 1AIFB 4OLZL 2K1MA 3QNXB 1NDGB 3BDXA 5C0DA 2W59A 1XF5A 2F8OA 1GGYA 5MP6H 2ZNXA 2YPLB 1QFPA 3BSZL 2YHGA 1N7ML 1N59A 3ARWA 3ARVA 4I0PB 4WFEE 3PHQA 4J3XA 5BZWB 2C5DC 1A3LH 1HDMA 3KPRB 3SPVA 5LGJA 3L3HA 1FFNB 2DF3A 4NWTH 4ZFOL 5FA3A 2JCCF 3TT3L 5JXAL 5AG8A 4OFYA 1OTUD 4G8EB 4APQC 1S8DB 2CKNA 2E7BA 4E5XA 1KJMB 4GRWB 3TA3D 5I76B 3FONB 2VXQH 1QSFE 5CJOL 4RISH 1I7RA 4E42A 1LO5A 4GT7A 2FO4B 5IESL 1WWBX 5BV7B 1N6QH 3IB4A 2VKWA 2F5AL 2OCFD 2PYFB 1S9VB 4I48B 4Y19B 5T5NF 1YUHA 1KNOB 2GHWB 2MPAH 1PLGL 4BFBD 1X5AA 2LU4A 3SDXA 4MS8A 4AL8L 1MCSA 5HHMB 4OZFA 1JMXA 4XMPH 2WWKO 3RGVC 1U92A 1L8JA 4I1NB 2EDXA 3CDYA 4KQ4H 5K59E 3VFGL 1XT5A 4QWWD 4M7ZB 5EOQL 4JFOB 3OXRA 1D5ZB 4JPKH 4MQSB 5I66A 4PJ8A 2WSKA 1INEL 1U3HC 3PUCA 1FFOA 3TJHC 3REVA 4WW1B 4HV8A 1IAIM 5F1KC 3EFFA 5IJVB 5FDWB 1GPOL 5GJTL 3LS5L 2ZUYA 2HFEA 1NMCB 5FYJL 4NHUE 2EEAA 5HHOB 4ZFOA 3GMRB 3K1DA 2X4RA 2X10A 2N7BA 4KK8C 1KENL 4M7LL 3OKYA 4WO4A 1WWWX 4HLJA 3INUH 1E4WL 2NXZD 4XCEA 1P84J 5JW4Q 1SJEB 4RFNC 5E9DA 5T5NG 4K7FB 3NCJH 1NC4D 2EYSA 5CMAA 4FFWD 5L9DL 4NDMB 1FVEA 1TPXB 5HGBA 4HQQL 3OG4B 3DX9A 1N0XL 4PJEF 2XTJD 4OIAA 4PR5A 5F8QC 4YHMH 2XTLA 1K5NB 2OJZH 5HHPA 1IC4L 5T3XD 4YHZL 4EQ2A 4OCNC 3KPTA 1RHHA 4M4PA 2NLJB 3SKJL 1KTKE 5EIIB 4K3DL 3HS0A 5HYJA 5J13B 4JFZL 3A6CL 3ARUA 4RX4A 4KXZI 3KPLB 3CPLB 4LCWE 4QXTB 3UBXB 4D8PB 4L5FH 5CGYD 3WL9A 3LEYH 1A6WH 1F6FB 1GGTA 2YKLH 3H9HB 4APQA 4UQ2B 3KPOB 4N5EC 4ELMF 3O8XA 4FFYL 4XGZA 1XIWC 4JG1L 2J2ZA 4U0RB 3LH2H 4CN1A 5TFSH 1CZ8H 5J9PB 2FL5A 2R56H 3O2DA 1QA9B 2PETA 4LCYB 2H2SC 1HH9B 2CJUL 4XMLL 4Y0GA 1SMAA 4W6WB 1D6VL 5DRNB 1FNSL 3RVTC 1E28A 3T4YB 1S7RB 5IB3A 4JR9L 5B39A 1AKJD 1TQCB 5TQ2H 1MIML 4XBPA 3RGVA 5DO2D 1T1WB 3W5NA 4GW1B 1IM9A 4WNQA 1T5XA 2B1AH 4Y7MA 3L7FA 1S7TA 4V3DB 3TLRA 3U0TB 4NHCH 2R29H 1I9RH 5DJ2B 3RWJB 4G6FD 1U3HA 1T4KA 2UWEF 4KKAC 3TJHA 4I18B 1AQKL 4IRJB 3TP4A 2W07A 5TPWH 3X3FL 4MXQA 3QDJA 2DQCH 4J3UA 2DJSA 2OTWB 4NZUH 1NLBL 4P5TC 1J0YA 1KIQB 5IFHH 3GSRB 2EE6A 4KKLD 4Y1AE 3DETC 1YYLH 5LQBL 1DBMH 1I9IH 3UYPA 3HPJA 1A6TA 1RZFL 3QZWB 1EAPB 1HXYB 3MFFB 4X0KB 5FCUL 3WD5H 3T4AA 2BY3A 1UWEH 2CDEA 2EH7L 3W2DH 2VIRA 4P2QE 1CXLA 3DMMA 1JGDB 4P2OD 1FBIL 4I3GA 5JDSA 3HMWL 3BXNA 3OR7A 2PR4H 5I17A 1YECL 1KPUB 1TLKA 3TBTB 3EOAA 4PRNA 4TULH 3SKMA 2YXFA 3BZFB 4PJ9C 3EOTL 3MRJB 2Z31C 3OKOB 5E4IA 2A6DB 3QNZA 3SKNB 3ZL4H 4U33A 1JNLH 5KSBA 3OJDB 1A4JB 1CXIA 4TVPL 3S96B 4YIQB 3PWPE 1DQLH 2HLFC 2NTFA 1A4KA 2CLVB 4RFEA 1I7UA 1CXEA 2V17L 2DQDH 1V7NL 4OCRH 1YEGH 3H3PL 5TE4H 1BJ1H 3P0GB 3KJ6H 1A47A 2IH1A 1I3UA 2YPVL 4Y1AD 3VI3E 4DW2L 2DLFH 2AERT 2OBGA 4MD4A 4P9HL 2SEBB 1XIWA 3GI8H 2FR4A 1M05B 2NR6D 3T0EB 1XGPA 3UROR 1TVBB 4NUGH 4NQUA 2LTQC 2NYYD 4O00A 4Q0XH 1FZMA 1AXIB 4KKBD 2Q3ZA 3QI9A 3Q3GB 2FHFA 3QDAA 3P73B 4TUKH 5C0AD 2ZSWA 5D93C 1YMHB 1T2QH 3LQAL 3V6FB 1WC7A 3MOQA 1GSMA 2VISB 2I07A 3S3PA 3GJEA 2BVPB 4R4NC 1IQWH 5TDNA 3RVVC 5IEHA 4K23L 5DJDB 2R23A 4RMSA 1ACYH 2QADB 3DV6B 1KN2H 5IG7B 5BCAA 3MRHA 5HI4C 3SE3A 3CFCL 4YHPA 43CAA 5FGBC 3IDJA 2VXTL 5HPMA 4M6NL 3L3GB 3VXUA 2DWDB 1FG2B 3PGFH 1A6AB 4ZYKB 5BZDB 4PP1C 3AU1B 4DKDC 3RTQD 3ZKNC 5I1KH 3VD5A 4D3CL 3HPLB 3OX8B 1BAFH 1BOYA 2FDBP 1FO0L 1RVFH 4G8GE 7FABH 2QSCL 5D7IF 5HYIA 4O51B 1X5YA 4E41A 3HMXH 3UJJL 3MCKA 5KJRL 1L7IL 4PJ9A 3GO1L 5F72S 4GLRI 2A0LD 1OVZA 4AH2B 4JRXB 2Z31A 1HHHB 2A6JA 3KPSB 4MYWB 2FX7H 1KPRB 3Q5YA 4OM0L 5FYJU 3LKOB 5CS7A 1CFNB 4JPWH 4V1DA 1UXSA 1V5JA 2CKBL 1VEPA 4JZOA 3W9EB 2LE9A 3HE6B 4F57H 5D5MF 4C59B 2BCKA 1TITA 3ARTA 4M9OA 5DC9B 1F2XK 4M9PA 3IFOA 3L3IA 1YMMD 2VLKE 4XC1H 3KHQA 3ZDXF 2APWA 3V6OE 3DHMA 3BYYA 3BUYB 4NFBA 1QFUH 3MRPA 2IG2L 2IMMA 4NFDA 5KG9B 3SO3C 4XP6H 1RUKH 1XGQA 5DC0A 1PQZA 4R0LC 5HDBE 3GB7B 4PFEA 5K9OA 4I2XA 3VFTA 1A7OH 3VDAA 5DVOA 4Y16A 4MB4A 3CD4A 3C08L 1DLHA 4XBEH 1HYSD 4JB9H 5T1MA 3TCLA 3SN6N 2OL3H 2D7NA 3DYMA 3BP4A 2WMPA 1J87A 4MSWA 5F44A 5C9JA 3NCCB 5IF0A 2PW2A 1MELA 3N9GH 1YN7B 5HPOA 4GUPB 4D9QE 5EUOF 1I7TB 3D69B 4ONOA 4U1JA 3VFPB 4GBXC 2VL5B 2XPGA 3DIFA 5DDHB 5T1DL 3T0EE 4XVUC 3GSNA 2H2PC 3EHBD 3U0PB 3VD4A 2CKBA 3FCTB 2PTTB 3UJIH 4XNXL 4HJJH 4P4RB 4HUNB 4PGZA 1LQVA 2IH3A