5J6GA

Recognition of the mhc class ib molecule h2-q10 by the natural killer cell receptor ly49c
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
275
structure length
272
Chain Sequence
GSHSMRYFETSVSRPGLGEPRFIIVGYVDDTQFVRFDSDAETPRMEPRAPWMEQEGPEYWERETQRAKGNEQSFHVSLRTLLGYYNQSESGSHTIQWMYGCKVGSDGRFLRGYLQYAYDGRDYIALNEDLKTWTAADVAAIITRRKWEQAGAAEYYRAYLEAECVEWLLRYLELGKETLLRTDPPKTHVTHHPGSEGDVTLRCWALGFYPADITLTWQLNGTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, Q10 alpha chain
publication title Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
pubmed doi rcsb
source organism Mus musculus
total genus 59
structure length 272
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j6gA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5j6gA01
1RZJL 1AD0A 3JVGC 5F44A 4XWGH 1T22B 2KPNA 2MCPH 1CYGA 3BPLB 3WIHH 5IF0A 4HKBB 3FAWA 5C3TA 4QYOA 2IBBA 1VDGA 3F12B 1QQDA 4MNQB 4FP8L 3JWNC 1V3MA 1ZSDA 1BD2A 4TNWK 2PO6C 1OAQL 4YWGH 1PZ5B 3D3VB 3TFKA 1ACYH 5SV3A 2EH8H 2AV7B 2H1PH 3RGVD 1S7SA 1RJLB 1FIEA 2HFTA 1GGYA 5BV7H 1MCWW 2DKUA 3MLZH 4MXVE 5TQ2L 4BZ2L 5DC9B 2D7MA 1PQZA 2VZUA 2AJVH 2P46B 1OSZB 4NQDE 2D0GA 2C3HA 3H42H 2ED8A 3S4SB 2DTML 3HS0B 1T0PB 3N50A 2KDGA 3VE0A 1G6RA 3QPQC 3MCLL 3VCLA 3PIQA 3C60D 4M1CD 4YHZL 2GTZB 1ES0B 1NCUA 1S3KL 4HV8B 4H8WC 4U1SB 4K2UL 2FGZA 4QNPE 2ZUWA 1NGZB 1A6TA 3VXSA 5EZJA 1LDSA 2VDRH 1KIRB 4BQ6A 4Z7WE 4JFFB 5KN5B 3ARSA 1NH6A 3V7AE 4RAUA 5DO2C 1BQLH 3QA3A 3EGSB 1F4AA 1AXSA 1Z5LA 2PTTB 4IJ3C 2E5EA 5IJKA 1FV1B 4RCAA 3FO2A 3NCEB 4HUVB 2ILLA 5DMJB 2L7JA 4Z7VF 1X9QA 4P99A 1MAJA 4U1KA 2M26A 4PB0H 2QQKH 4L4TD 4N8PA 2JJWA 1WGOA 1OARL 1SYSA 3QR2A 4I48B 1FSKC 4HWEH 2ZCKH 3U7YH 3P4OA 3V5KA 4AYFA 1MAMH 1QPPA 1VACB 5IB2B 4XBGA 3UAJC 5DUPL 4U7SA 5I6XB 1A1OB 5DJ6A 4XCFH 3VGEA 1AD9A 5IVNA 3HN3A 5KVDL 4NC1C 5D7IB 1NUDA 3D0VA 4OTXH 2OI9C 3QUKA 5GXBB 3RUGE 4RA3A 4S10A 3VFVB 1NC4B 4E41D 4YC2B 4EI5D 2AAVA 1HWHB 1E4KA 3BIKB 4RIRB 4APQC 2NY7H 5TF1L 1CFTB 4YX2L 3QYCA 4RGMC 2O5XL 3NCBB 1I1RA 5KVFL 5DA0B 4NOBA 4NZTL 2WAHA 4L8BA 5D5MB 4W6XB 2X4UB 1NBZA 1NMCC 2VIRA 3RI5K 1LE9A 1AH1A 3T0EB 3WJJC 2QSQA 4GW4B 5FYLL 5F89B 3FOMB 3ZE0E 2AXHA 5KS9A 1CT8B 1ETZA 2C7UA 3QIUB 2F53A 2E9WA 4PRNA 1VGEL 4MS8A 4RMWA 1TJHH 2XZAL 5JHLL 1BF8A 4OBRA 1FFQA 5BS0E 3U82B 4NO0D 4YXLL 4M7LH 1FVCA 1V8HA 2F74B 2YPKA 4F57H 3S35L 1RIVH 4OLXL 4AEFA 2PKDA 5FF6B 1FO0B 1AQKL 3WD5L 3D18A 3T4YB 4GLRI 2EDOA 3L3DB 1FH5H 4N0UA 4QF1B 1Q9KA 4YDJA 4OIAA 4F37F 2VLKE 1CG9B 3D2UA 4OF0A 5T3XH 2Z31B 2R56H 3IDXL 1L0YA 4NYLA 5IKCB 1FG9C 1OAKH 2DQHL 3PWNB 2CIKA 5HHOA 1ZT4B 1QNZH 2DI7A 4NHCL 4OUOA 1XGPB 5IMKA 1PYWA 5CP3A 5EOCJ 1WUNT 4I3RL 4JGUA 1KEGL 5JXAL 4H26A 3H3KA 4LCWE 2C26A 3RKDD 1UYWH 3STLA 1JHTA 1IQDB 5EU7E 3AXLA 4GBXC 5CJ8A 2DLEA 3QJHB 5J4MA 5AZEL 2LTQB 3HZKB 1J0YA 4KY1L 1GIGH 2FX8L 2WUBL 1S7RA 3LHPL 5JUEL 3U6RB 2JCCA 4OZHA 7FABH 4QXGH 1AP2B 3SHSA 1KJVB 5HPMB 3OV6A 1HK6A 4JRXB 1BFVH 3CLFH 2NY0D 4M5ZL 5ACZB 3GSNL 3K1KC 5T1KD 1WCQA 3QEQE 4I5BB 4NJ9L 3GJFB 4MDIB 1TNNA 4OFKA 1Q8MA 1F4XH 4FZ8L 4R26L 4GKZB 4HUWA 2AW2A 3MRFA 5ID1B 4UQ3B 2XXCB 4NP4L 4LSTL 4KPHH 2DQUL 1E6JL 3BKYH 5K9KB 3F65A 5B39G 2L4OA 4ZFGH 4TOYL 5DEFB 2DKMA 4ESKA 1UXSB 4GG8B 4OLWL 3ARGD 1IAOA 5CWSB 5MENA 4MQTB 4PGCA 2VLJD 3GRWL 3UC0L 2CXKA 2D0FA 5C09A 4AH2B 4EDXA 2ERJC 1ZA6A 1MCPL 1R24A 4O2CA 2CUIA 3KXFE 3WFCL 1IARB 3MA7A 3MV01 3ECBB 4MD4A 1EEYA 4P9ML 3VXME 2R2EA 4DKFL 2P5ED 3GNMH 1N7ML 3GMOB 1JGEB 4QXUH 4RFNC 4TUOB 1EO8H 1LEIB 5BJTA 5I9QB 1TVHA 2BVTA 4G9FE 3VGDA 2P8LB 3EOAA 3LSOA 1ZTXH 4Z0XA 4MWFB 5C9JB 4JFYA 5HHQA 3QUYD 3MRGA 4OZFG 3NH7L 5CIPH 3E6FA 1MRCH 4OZGF 2WY3A 3GMNA 5EIIA 1D9KD 1P7QD 4GRWB 2ZPKL 3NFNB 3CZFB 4PJ7B 4DAGH 3AY4A 4HS8H 1ORSB 4HK3J 2IH1A 4FNLL 1AXIB 2NY4D 4HW6A 2PXYB 3BEVB 1INDL 4ALAL 2MHAB 1U3YA 1T80A 3QXWA 2QTEA 1NUFA 1Y18A 1IM3A 1XGQA 4NKDB 3FT2A 4PJFF 1NCBL 3FQTA 1YMHB 3O6FA 3I6KA 4OF6A 4PG2C 4HC1L 4LEOA 2IAND 3KPOB 4AMKL 3LQMA 1HOCA 1WBXB 1L8JA 1NDGA 2F58L 3EHBC 2DF3A 4GAJH 3MGOA 2OBGA 3AREC 5SX4H 1TQCB 4RFOH 3U4BL 1JNLL 1DQMH 1KIPA 5KBNC 1DVFA 1K4CA 4MAYD 3O3DA 2PYFA 3OKMA 5C0AB 3RAJL 2AK1L 3O8XC 1H3UA 2AJUL 2X9WA 5HD8C 4QOKA 2W38A 3LKQA 5F7HA 2HMIC 4O2EB 4QXTB 4AG4L 4D9LH 4WU7A 2HTKC 3UO1L 1M7IB 4OD2A 1A02N 1Z6JT 2CLZB 2C4FT 3OKOB 3H0TA 5LVEA 3SEPA 1I1CA 1PG7L 1UKSA 4POUB 2DQJH 1H5BA 1MCEA 3CFEA 4UT9L 2GSGA 3FZUC 4XCCL 2VOTA 2WZPD 3BRDA 1DN0B 4M6OL 4GG6F 3OR7B 1G7HB 1YY8A 5DHVB 4FABH 4GRLD 1AFVH 2QSCL 4K23H 2F53E 4GT7A 3FOLB 4KAQL 4LRNH 4QRUB 2QQLL 2ZOKA 4DKEL 4OFPA 5I1AA 1SMAA 5F1IB 3SKOA 3FB5A 1BEYL 1CLOH 1KEML 3T1WA 1ZHNA 3HB3C 4AEEA 1TPXC 4JG0H 1FAKT 1MRFH 2MMXA 1EGJA 4WO4C 1AO7A 3BQUD 4PJHE 1DQDH 3OAZH 3BKJL 4MJIB 3IFNL 2PO6B 5C07A 4Q6IA 2AEWA 5C0FA 3BP5B 4LLVA 1A2YB 3W9DA 1CTOA 4HPYH 1HINH 4OLVL 2HJLA 4XRCB 3N1FC 4YEEA 4I77L 2Z91A 3FN9A 3ZTNL 4LAQL 4NHUA 3IXAA 3BZEB 4WNQA 3HHRB 2DQIH 3ARXA 3PHOA 2QR0A 4PJ8D 2R2HA 3MLYL 4HIEA 2BVOB 2BSRB 5MI0C 2R0LH 1DQLL 4XPTH 4TVSa 4WI8A 2G9HB 3TWCL 2NLJA 5I8CA 1N26A 4DN3H 2FHCA 1MWAB 4FQCH 1CXEA 2Z92A 4H5SA 4PRPE 5C6PB 1XZ0A 4KHXL 5GS1A 4KZEL 2CDGB 4YDIL 1ADQA 4QO1A 4X98B 2HA1A 4NUGL 4FQIH 2PTUA 3NPSB 4LVOC 3ULSB 1PLGL 4U1LA 1X5IA 1ZHBB 3DVGA 4IJ3B 4ZS7L 4I18B 3NTCH 1XCTB 5J89A 3RVUD 3KPLB 3PL6C 3FQWA 3T0BA 2B4CL 3UJTL 4HG4J 4P2YA 3QG6B 3V6OC 2OR7A 3BP4A 4YJZL 5CEZE 1EFXB 1FSKB 4JM2C 5D7JD 2ZJSH 2O26U 4K3EL 1HYSC 3D0LB 1GGIH 4XTRC 3JV6B 1UC6A 1JGLH 5MEQA 1KJ2L 3LKOB 4JQIL 5AEAA 3UDWA 3O4OB 1UM4L 2AGJH 4B7IA 5HI4C 4NZUH 5DUML 5C09E 4PJ9A 5C0RL 3ALXA 3CPLB 4Q9RL 2HVKB 4UV7L 2OL3B 4F9LC 1OF2A 4MCZA 3C5JB 4WEBL 2JK5A 2VXVH 4Y0GA 3LZFL 4XMLL 5A2IH 1CDGA 1F6AA 5HGGS 1FNAA 5I1JH 3QDHA 4RGMB 1WZKA 3OAUL 2A6KB 1FN4B 3TPUA 5E1HB 5E2UH 4JFDE 4QRPA 4RRPA 1S7XB 4NCDA 4KRPD 4LIQH 1U91B 2XZZA 3DIFA 4OGAC 1DEDA 4X4YB 4NWTL 5JNYA 2NQCA 2AJSH 2YSSA 5TFSH 5ANME 1S78D 3IJYA 3GJEA 3LKPB 5D7LA 5C0JB 3MV7E 2UZXB 1GGBL 3NZ8B 2AJYL 2J12B 3VGBA 2XA8L 2ZG1A 3VWKD 1NUNB 5LCVH 4ZDHA 5M95B 3WJLA 2VDKL 4EN3A 3KPPA 4J8RB 3BUTA 3HPJB 1NGYA 4L9DA 3HG1A 4NN5C 4YNYB 1U8PB 2AXFB 3GMMA 3LRSB 4GO6B 1G6RL 2VDOH 1ZMYA 3SDAB 3CFKB 2J1KA 4JVUA 5C92A 4D9RD 4Z7VA 1L6ZA 3G5YA 2E8YA 1BBDL 2XZCL 3CFIC 1S7UB 4B5EA 3HI1A 2IBGA 3U7AA 1M7DB 4UIMB 3IU3B 1RJYB 2FEDC 4Y19E 1T83A 3MRRB 4KZDH 1RK1A 1RUAL 1INQA 4HUXA 4JFEA 4P9HL 5FOBB 1NFIB 4ODHL 1WFTA 3LEVH 1NCAL 4NRZA 1IGJB 3I50H 4JFPA 1MCQA 1J8HB 4R7DA 1MJ8L 4WTZG 4FFWC 5HGHA 2MFNA 2ZKHH 1MCOH 3B3IA 3S37X 3SQOL 3EFFB 3FQXB 1DBMH 3BP7B 4L5FL 4HJJH 3SY0A 1AQDB 5D72L 3WHE1 4HUUA 4QWWD 3P30H 5CS7A 1E27B 1ZGLP 4HIJA 5A1AA 4JFQB 4RMVA 4J3SA 5FUCC 3S5LB 5I0ZA 2X70B 5ENWA 3DX8A 2GFBB 1IM9A 1KYOJ 1L7IL 1D5MA 2I25N 1KOAA 4XB7A 4P48A 5K59F 3RGVC 3P4LA 1QSFB 2ZUSA 3CFDB 3QDME 1KTDB 1MQKL 2JJSC 1MJJB 1G7JA 2WINA 2E9IA 2BNQA 3ARBD 4EBQH 4M7KL 4ZFOA 1GPOH 1RFDL 1RZ7H 1FZJA 1JGDB 3LIZL 1XF1A 2BC4A 4HWUA 2GSIB 1SBSH 2BRRL 3QJFA 3W11D 4LEXL 3AS3A 4F58H 1A3QA 4HBCH 5ILTH 4HJ0D 2EDEA 1MCDA 4DVRL 5CJQH 5IB5A 4PP1C 4V3EB 1OSPL 1QFOA 2DIJA 2YPVL 4OLYL 3TVMA 1PKQA 3WFEH 4JDTH 1N0XL 2DQCL 4Q74A 3ARTA 5KSUA 1OCWH 1Z3GL 3N1MC 2FJHB 1WT5A 4WEMB 1DSFH 5GHWL 1H15A 1I8LA 1OD7A 3CSGA 4JKWA 5DQ9A 5BMFH 5L7XH 4HFWA 2CLRA 1T04A 1PX4A 2VABA 4PR5A 4HIHA 3IKKA 1KIQA 3BKMH 1CXLA 2GCYB 4OZFH 1CVSC 1HEZA 1JZ2A 2JF1A 1FNGA 5ITFB 1EJOL 4WWKA 5EC1A 1FNSH 5ALCH 2ITDA 3LQAH 3BD3A 2I5YL 3SO3B 5I76B 1UXWB 5KG9B 4FXKB 5F7YC 4V1DE 3OXRB 2EDFA 1LEGB 5EU4B 3B43A 1ND0B 1DBAL 4TNVF 1U6AH 4K94C 3FFCA 1LO3L 3OKLB 2GTWB 2RB8A 1MI5A 3NABH 5D1ZD 4FOMA 4S1QH 1P7KA 5DQDL 3V8OA 1XFPA 3PGFH 2X4QA 3EZ8A 5ALBH 4DZBA 1Z9OA 4ZFFB 2ZNXA 5DUBB 2SEBA 3B8YA 4OJFH 1CDUA 4IMLB 4IEFB 4TUKL 4NRXA 3ME0A 4OZIB 2DQDL 3O8XB 4KI5C 5T1DH 3T2NL 5CJ5A 3T1FB 1FG2B 3FMGH 5JOPE 4OM0L 2K3TA 4NSKB 3WXVH 2BMKB 4NM4L 5AWNL 3TZVB 3KLAA 2VL4A 5GS0C 4U6YB 2NX5B 3MNVB 1N6QH 4JQXA 4P2RA 3HNSH 3KPRD 1XF4B 1QLRB 2NTFA 2RQ8A 4L8SB 1QOKA 1EDQA 1NFDB 2R69H 3LS5H 1HH6A 4X4XB 1WFNA 5HYJD 3D69A 3TH2T 3ARDC 4P57A 4X0KA 3KPQB 4RZCA 3P4MB 1NBYA 3CX2A 2QL1A 1YNTB 3K2MC 4LLMA 5KTEH 5C8JB 5IFHH 3C5SB 4NQSB 1I3RA 3HE6A 2YPLD 5F96H 3BP6B 5GRWA 4UMGA 3AMKA 2IADB 4UILL 2APXA 5ECJE 1J86A 3BH8B 4OZGA 4XH2B 5EU6A 4P4KA 2CJUL 5BV7B 3MYJA 3MODH 4JZJA 2NW3A 1P84J 4W6YB 1HCFX 1KN2L 5CD3A 3QWOA 4PJBB 4FQQA 3U4AA 3IDNA 3BDBA 3VWJD 3E8UH 1CFQB 1TPXB 5E2WH 1DQJA 2V7NA 4WO4B 5C0CE 4ZO7A 4OT1L 4Q58C 4C56A 3AAZA 4NWUL 2P24A 3QB7C 1Y0LA 2W9EH 2YHGA 2BVQA 1A47A 4UI2A 4XAWL 3OZ9L 1Z9MA 5J0BA 4OCYH 3H9HA 4KJQD 4M9OA 5IB3B 3TP4A 3RKDC 4MSWB 4I0PA 5DZOA 1I9RL 1KCRL 4YBHA 3DUUB 2VE6B 3BWAA 4B53A 3CIQA 3PQYE 1H3GA 2HAZA 2Q76B 3TN0B 1KLGA 5K9OA 4NNPH 4LPTA 1C7SA 4YHPA 5IVXB 1WC7B 3LKRA 3MCKB 5ISZA 3ELAT 4JFZH 4R4FH 1CTNA 2DLFL 1JPFA 3AROA 2FEEI 4N5UA 2FR4A 1D5XB 5F1KC 1IBGL 3MRPB 1ZVSA 3O0RL 3QDGA 3AC0A 2ZSVA 4ZTPH 1U42A 4F8QA 4L4VD 2VJXA 4OCWH 1BBJA 3O45A 4PJCF 2P5WA 1WCBB 5D7IF 1KN4L 4YO0B 3UBXB 3KPMA 4NN7C 1CK0H 4ZS6D 3HI5H 1X5KA 3UX9B 3V6FA 4JY5L 5IB1B 1K2DB 5I73C 2X44D 1JNNL 2FD6H 1R5VB 5DJ2A 5CEYA 4LVOB 5GIRA 4L8DB 1KC5L 4JY4A 3DURA 2LABA 4PP2B 1ZLVH 5D5MF 1HI6B 3BEWB 1M71A 3GO1H 2DYPB 4M93C 4LVHB 4WUUB 3MXWL 3QWQB 4G6KL 1OGAA 4Z9KB 3SGEH 5KVGH 1AGBA 3RWGB 4KDVA 5TQ0L 1KFAL 4KKAD 3KS0J 4N0FA 1OP9A 4O2FB 5FM5O 5FOJA 1Q94A 3HE7C 3FO9A 5CP7A 1A7OH 2K7QA 1QBMH 5EH1A 3VXNA 2Q7YB 4KC3B 1Q9LB 1PVHA 3T4AB 1D9KC 4OCRH 3GHBL 2DWEB 2EE3A 2CDEB 4NNXB 3Q6GL 3QNXA 4XP5H 1MJUL 1HZHH 1FYTA 4MQSB 4HULB 3HPLB 4L3EB 1BQSA 3QIWD 4LKCB 3WL9B 1Y6MR 1JGUH 5E4EC 2J6EA 1FGNH 1T4KA 2CRZA 2VLRB 1F3JA 3QQ9D 4KV5F 4N0CD 1D6VH 5I8OH 4OLUH 4ZUSA 1OPGH 1NAMA 1MH5A 4PTTB 5EU7C 4RWYL 2OJZH 2DQEH 1E28B 3PNWB 4M5YH 5D71H 1QEWA 4V2CB 3TBTB 5ESAA 3TO2A 2HKFH 3QUZD 1QFWH 4LPCA 1EGJL 3MRKB 3WIIL 3ZYZA 5IBLC 2A6DB 3V4VL 1RZKL 3JV5A 5F88A 1N64H 4Z7OE 1Q0YL 4GH7B 2OX5A 2VB5A 3MOAL 3ILQD 1V7ML 4MAYC 4NN5B 5KAQG 3WIFA 4LARL 2E7MA 2EDKA 1AGDB 1F4YH 5I1KL 4PJXB 5BZWB 2XWTA 1CL7I 2ICWJ 2GJ6D 5INDA 3MNZA 4Z7UE 3MZTA 4TPRL 3T3PF 1TZHA 4Y4FC 1FORH 2DM7A 4Y2OA 5JHDB 2F5AH 1QSEB 4U05A 3QZWB 1DQQB 1RK0A 3DGCR 4XCYA 5DYOA 1NLBL 4BH8B 1BZ9A 4P23C 1U8NB 2CIIA 1XF2A 5DFVC 1AI1L 1FVEA 5HI3D 3QRFM 1KG0B 2XQBL 5FYLD 1QD0A 1JHKL 3SDXE 2Y7QB 1FFNA 4OCSH 2DDQL 3ES6B 2J3SA 4JN2A 2IMNA 5SWSE 4LSPL 4N5EA 1CLYH 1F4WH 2VDNL 2BVUA 4P4RB 5GRJL 1BMGA 1OAZL 2NY5L 5TH2B 2QHRH 4JJ5A 3R0NA 3ZE1E 5HGDB 3O9WD 4DK6A 4JO3H 1BIIA 3QFJB 3RWHB 1RVFH 1JPSH 1XMWA 3PWJA 3KHOA 4I1NB 4PJAB 4S2SA 2DWDA 1T0NB 3MRJB 4R3SA 3QPXH 2HRLA 1XGRA 2UV3A 2C1OB 4PJDE 3PV6B 1BQUA 5GGRA 2OSLB 2AK4D 3WKML 4O4YH 1TJGH 4PY7B 3C9NA 3GSWB 3FT3B 1JCKA 3OB8A 4JZOB 1WBYB 3GBNL 4P2QA 3BQUC 4MX7A 1MIEL 4GRWF 3QCTL 4CMHC 3KG5A 2E6JA 4PJ7F 1GH7A 1T66D 1IAMA 4X83A 2COQA 4HWBL 4ZUUA 4GW1B 4G80B 3RGVB 2IPUK 2DBLL 2B39A 1NC2A 2F19H 1BGXH 3HR6A 4F7MB 3CVHA 2NNAB 4QRSB 1P1ZA 2ZG2A 4P3CL 5DD1L 3UYRL 3MRNB 3QG7L 5E6IA 3EYFB 1QZ1A 1VFAB 4HPOH 5CIPB 1NGPH 1OW0C 5F7EL 1YMME 5IROA 3VFSB 3MACL 3IXTB 4M6NH 3TT1H 4PRHA 4XPFH 3FTGB 3C6SA 2GUOB 3P0YL 3FN0L 1KBGH 3BGMB 2FIKA 3MRHA 4IBLT 3C60B 2JIXD 4PJFE 3LQZB 5IT2L 4Z7QF 3DRTB 4HKXA 2BRQA 4QTIH 5BRZE 3T8XB 2YK1H 4R8WH 1TZIA 5D7KD 5LXGH 3LQAC 3Q6FB 2NXZC 1HNGA 4L9LC 3MOBL 5L2KD 4JZNB 2BNUA 2XG4A 1J1XH 4WI5A 3FT4A 3WLBB 5FDYA 1QHOA 1DLHB 4WW1B 5EULV 5F3BA 3F6LA 4CAGA 4D9QD 1K8DA 4OI8A 4NQCD 4BFIB 3TT3H 4AIOA 5D7JC 4XPHL 3VI4F 5DMGC 3HZMA 2DL2A 3LKNB 1W72A 2IAMD 4NZDA 3SKJL 5DEGB 5J6HA 2A73B 3MGTB 4OGYL 5E5MB 3I84A 2NY2D 4FP8H 4CDHA 4JPIA 3CDGA 5IG7B 1CD0A 3SDYL 5MERB 2WUCL 1CU4L 1UJ3C 1OAQH 2UVEA 4KFZC 1WVZA 4YFLI 1P4BH 4ODXB 1NUGA 5J1TC 4GG6E 3C6LD 3OAYK 4EI5B 3TA3C 4JKMA 2D4FA 4BZ2H 4RGND 2VR5A 3CX5J 5TE7L 2NZ9C 3BT2H 4HCRA 4Y5VC 3QIBD 2XTJD 1T7XA 1QFPA 4X6CA 5DDHA 1DBBL 1IC4L 2W60B 1J5OL 5DR5L 3MCLH 3A6BL 4OM1L 2CDFB 2AJ3A 3QXDA 4OCLC 1EUTA 4CDGC 4U3XA 2FJFA 2HVJB 4K2UH 1RMFL 4P49A 1FZKB 3FRUB 4XVSL 3NAAL 3QBTB 2VH5L 1F4HA 2XZQL 5JW5A 5EU3A 2FSEB 1UCTA 5GGVL 4D0DB 3ARDB 3WSQL 4NO0B 3T2QA 1JWSA 3MRQB 4KQ4L 3WNPA 1A14L 5I71C 4FFEX 3KPSA 4U1MB 1QSVA 3N9GL 1B6DA 3NACH 1SEQH 3X12B 2EDNA 5DK3A 5J8OA 3IGAA 3TNNB 2JJTA 5IWLC 1OLZA 4Y4KD 4ZFOL 1KCUL 3ZO0A 4I2XA 1OARH 3NIDE 1X7QB 1LO5A 3GGWB 3H6JA 1S7TB 3BGFC 1DTUA 4F9PA 4LF3B 1XIWD 4KKCC 5D6CB 2MPAL 2HT4D 4PRIE 2DLGA 1CICA 1GOHA 3NCMA 4M48H 3B9KA 3O4LE 3MCG1 3NFPA 5DUPH 3GSVB 5GZOD 1WTGT 2P1YA 4NN6B 2XY1A 1SJEA 4FQXD 4G6JL 5FO9A 4QGTA 5HXMA 4MNGA 4JY6A 1I7RA 4FQLL 5DJDB 1OP3K 4XBEH 3FONB 3SGDH 4OSUL 3C5ZC 3WCYA 3U0TA 3IDMB 1VKXB 5IFJB 2VQ1B 4K7FA 4X7SL 3SE8H 1T1XA 2XKNA 4PIRF 2P42B 4EUPB 3S6CA 5TF1H 4YX2H 1CLZL 3MRIA 4P3DA 2ZCHL 4NZTH 2VDQL 5D1XD 2EC9T 5HVHC 4EVNB 1QRKA 3X13B 2A83B 4CVXB 1TJIL 1U95B 4LLQA 1T20B 4ZO6A 2YZ8A 3RUGB 1NAKH 5FYLH 4G3YL 3P77A 4XP9L 1A6WL 2CR6A 5T1KB 3LEXA 3DRQA 2N56A 3MFGB 3MUZ1 3KHQA 4HT1H 4WFFD 3MOQA 4L3CB 1VGEH 1T22A 4P5KA 3KWWB 1YNLL 1MHEA 2XZAH 3QUMH 4RMTA 3MLSH 5JHLH 1JZ8A 2WWMD 5I15L 2XG5A 4Y1AD 3SDCD 2A6JA 4YXLH 5E9DE 2Y4SA 4JANA 5T3ZE 3S35H 3GMQB 1PZ5A 4IIQA 3VXUA 2AV7A 1AQKH 4Z0BL 3WD5H 3ARGB 5IMMB 2JJVA 3WEXB 3WE6A 4Q7DA 4M93B 3W0WE 3ULVF 4TVPE 5B3NA 1A7QL 1OSZA 1MVUA 4YBQC 4HJ0C 4PJ5D 4YXHL 3S4SA 4M9PA 2YRZA 3G04B 2VLLA 1EUUA 4PRDA 1MCJA 1JF6A 3P2TA 5E6YA 3IETB 3O3UN 1F45A 3FKUS 4LHUA 3VDCA 1CDIA 4KTEH 1QYGL 4NZRH 4G8IB 3QAZB 4MDJB 2NY6D 2GTZA 1ES0A 3S36H 3A0OA 1QP1A 1T0MB 3ARFC 3U9UA 3HE7B 4HV8A 3VFUB 4PGBB 5JR1L 1Z0MA 2VLKB 3CSYB 3QUYB 1KEGH 3UTTA 3N06B 4WI6A 3QUXC 3PP3K 2EDBA 1TLKA 2D03L 1D9KB 2B7DT 1XGTA 4JFFA 3EOBB 3MRCA 3VFGH 3EGSA 4IDJL 2K7PA 5ICZA 2EDDA 3BVNB 5CSZA 3UTZA 1K4DB 2FX8H 2NY4B 3GBMH 3LHPH 1FRGL 3WFHA 1H0DA 4WCYH 3RWFA 4XVTL 2H2PC 2WWKO 1FE8L 4WGVB 5E4EB 3I2CL 2W0PA 3I02B 4QRRD 3L3IB 1VCAA 5T1MA 3F5WB 4BJLA 4V2BA 5DHXB 4LCWB 3LRHA 3L6FA 1X3DA 4N1CA 2OS7A 3GSNH 3Q48A 4P46D 3H3PL 3UEZA 3H7LA 1CWVA 5ITBL 3P0VH 3V9FA 2KKQA 1UWGL 3GMLA 4L8CB 2XFXA 2Y5EA 1DBJL 2IANB 4DWHA 4FZEH 4KI1A 5IB2A 4KJWD 1AJ7L 1URLA 1ZLSL 4M1DH 5KZCB 2FIRT 2DQUH 1E6JH 4QHNB 1NMAL 3HZYA 4PJCA 5HYQB 1KF9B 1HILB 1QG3A 4OLWH 4NGHH 1SJXA 2G75B 1RJCA 4X5WA 2CMRH 4MAYB 3GRWH 1AHWC 5J06A 3VFVA 1G7LB 1LO4H 1NC4A 1PJ9A 1U92B 3FRPA 1T1ZA 3BPNC 3VXRA 3KJ6L 2AS5M 1MCPH 2P43B 1CDJA 3BIKA 3QEQD 4RIRA 3O41A 1CFTA 1F8TL 4HUMB 3PGCB 3OGCB 5DD0L 3S96B 3QI9C 5JOEA 4NOFA 2VL5A 5C0DB 2ADJB 5D5MA 3KLHC 4YIQB 3T0EA 1NQBA 3REVB 2KQNA 4GW4A 4QY8B 1T6VN 5C08E 4X9BA 3QIUA 1S9YB 2Y1VA 5F7DB 4ODWB 5GGQH 3KAAA 4G8GA 4S1DD 1P69B 2X4PB 3HI6H 1CD1B 1JVKA 3ZZ1A 4CJ0A 4DW2L 4DGVL 3VFTB 1GL4B 1RHHB 3FO1A 3B9DA 4JAMB 4LVEA 4F7EB 4M4PA 4WFGD 3F58L 2F74A 2J4WL 3VXOA 5I8EB 1BD2D 1U8OB 1N2RA 3IT8D 3U0PB 4D2NA 4ALAH 3TFKD 2WQRA 3T4YA 2UUDH 4KMTH 3L3DA 5DVNA 1U8LB 2YA2A 3F7VB 3X14B 3DJ9A 1P5VA 1S9VB 4P5MA 4TSCL 2X9XA 1TVBB 2UYLA 1JRHI 4LKXA 1NCBH 4P5TA 1GAFL 1CG9A 4HC1H 4JO1L 2FX7L 4PB9L 1C08B 5DJXA 5IKCA 2HT2D 4AMKH 3BQUB 4S0SD 3PWNA 1J05A 1XAUA 4CMHB 3HRZB 1ZT4A 3TBSB 3BPOC 1TQBB 4NQTA 2F58H 3CLEH 4ZYKA 1XGPA 4ODSH 2FCBA 4HWNA 4U2ZA 4LSSL 3U4BH 1JNLH 4LNRA 2JE8A 4G8EA 4ETQA 1OOAA 3VXSD 3M45A 2R0ZH 4TNVK 1FVDB 3BW9A 1FDLH 5E8NB 2WBWB 3RAJH 1JYXA 2NXYD 3MX0A 1XF3B 2AJUH 1V3JA 3HZKA 4GS7C 1G0YR 4AG4H 5EU5B 1I9IL 4OZFB 3L3OA 3RPIA 3ZLQC 1NAML 1II4E 1OL0A 4JRXA 3MFFA 5ACZA 1JRHH 3VGAC 4D0CA 3IFLH 3KYOA 1IC7L 1NFKA 2NXZB 1PG7H 3JV4B 4GMSL 2PYEE 3SE9L 3MBEA 4FFYL 3RY6A 5CKGA 3ZDZF 1JN6B 4UT9H 4WY7L 3QRGL 4HAGA 4HJGB 4XX1G 4UQ2A 4YPJA 4D8PB 2ENYA 4M6OH 5ID1A 4J3VA 4UQ3A 3P11L 4OZIF 2R15A 3IAPA 3BXNB 3RL2B 3ROLA 4G5ZL 5K9KA 1F02I 1KV3A 2NY1D 4DUXA 3OKYA 4ZUWB 5FUZL 3LN5A 1I85A 4KAQH 1C5CH 1VEOA 2QQLH 2ZOLA 4XGZB 1ZT1B 1VERA 4AH2A 4J3UA 2BNRA 2GY5A 1ZXQA 5D7JB 4MNQE 4OCXH 1BEYH 5CJXC 1KLUB 3BO8B 1I8KB 3DROA 4Q0XH 3JWDH 1SEBB 2HT3D 3D3VE 3QQ3B 1J87A 1XGYH 1T21B 1JGEA 1T6WA 1IEBA 3IFNH 3W5NA 1UJ3B 3SCMC 5DURB 2F53D 1WEJL 5F71A 4MWFA 4CVZB 2JKXA 5C9JA 3ZTNH 1WQVT 2C1PB 4I77H 3FQNB 4LAQH 4JN1L 4MS8D 1YUHA 4R2GD 3ULUE 2PCPB 3NFNA 2EZ0D 3QIWC 1ORSA 3MLYH 4PJBF 1G9NL 1A3RL 4N0CC 4XNQB 2PXYA 1RPQA 3WUWB 2V2WB 1UJTA 2YD4A 2WBJC 4J6RL 5CZXD 1CR9L 1MFDL 4Z77A 4XPGL 1EBAA 2OZ4A 3BMVA 1K5NB 4IOIA 1HHHB 3CFCL 1F6FB 4KHXH 4TVPL 2PW2B 4KZEH 5FB8B 2P7TA 2VXSH 4YDIH 1S7WB 1MLCA 4Y2DC 4OLEA 5EOTB 3VWKB 1JFQL 1IGCL 2IWGA 5I1HL 5HHOD 5IB4B 5EO0B 5I71B 3TJHA 3OF6A 4ZS7H 3P4NB 4LDOB 4PBWD 4IRJC 4I4WB 1U36A 2B4CH 3UJTH 5GGSY 5JOFA 1GZPB 4RNRA 3CVIL 3M1BB 3OJDB 3OKKB 1NJ9B 4LLAA 5IV2B 1C5BL 3GI8L 5D4QA 1XF5B 1CD9B 3BGFB 2EDWA 5IGXH 1VFBA 4PGJA 3S3PA 2PN5A 4K3EH 8FABB 1DBKL 5HHNB 2R0WL 1JMZA 3G6JB 4YDVB 4XI5C 5I1CL 5D7IE 1KJ2H 4LCUB 1VPOL 5A16B 5D1QC 5B8CB 4JQIH 4IMKA 3U46B 1M7IA 1UM4H 1MCIA 2YRLA 2O5ZL 3IFOB 4OB5L 5CHNA 5C0RH 2JB5H 2CLZA 2FO4A 4X7FC 5DI8A 3ZT5A 4Q9RH 3C5ZB 1S7QB 3NCJL 4U7MA 4O51B 4FQJL 4KDTA 2W07A 3E3QA 4P59H 1I7TB 5SWZA 5JZ7D 4LSUL 2HG5B 3LZFH 5CMAB 4XMLH 1DN0A 4AEHL 1T2QL 3KLSA 3OAUH 4JM2F 4G59A 3UTSA 5DHVA 5L0QC 1OB1A 3PWLB 2RR3A 3FB7B 2VAAB 1EHLH 1UKQA 1TTFA 3MC0A 2FWOA 5DRNA 4QRUA 5MEND 1IKFL 4NWTH 1BX2B 4MD5A 5C09D 4K3JL 2G2RA 4KTDL 3JVGA 5JMOC 1W72L 3DV4B 2LE9A 2AJYH 2H2SD 4PLJD 2CUMA 2WQ8A 1A0QL 4BSWB 4WJ5A 4YHLL 2XA8H 4LHQB 1RZFL 4MJIA 1JPTL 3FB6B 2PO6A 3KVQA 2O93L 1KTLA 4G6MH 3ESVF 5CILL 3D39A 1A2YA 5ANMB 1KCVH 4XXDA 4U1JB 3IJSB 4XNZC 5I8KH 3K81A 3BZEA 3QWRA 4HCRL 1P7HL 2CGRL 4BFEA 4UTAH 1ZS8B 2XWBB 3DVIA 3I75A 4NCC2 3RZCC 1G6RH 3NN8B 1YJDC 3VFRB 3V5HA 2P48B 3BZ4B 1WIPA 1BBDH 2XZCH 5AUMB 3K0WA 4IS6B 3ARFB 4JHWL 1YYML 4X5LA 3GJFK 1KB9K 2ZWLT 4ORGA 3QUXB 3O6FD 2IGFH 3QO0A 2GITB 3H9SA 4P9HH 2X1QA 4CVUA 3CCHB 3R06A 4P0DA 35C8H 3LD8B 4PJXF 5IBUB 3NFSL 1NCAH 3AMLA 1JWUA 3VD3A 1MJ8H 3NIFE 4TRPL 1XCTA 4QCIA 2YD3A 2DQGL 5IQ9A 1WIUA 4L5FH 1ITCA 1TETL 1DVFD 3CZJA 5D72H 1Z9LA 1PSKH 3NA4A 3VXPB 3BIBX 2PR4L 1EFXA 5E8DL 5C0GB 4NDMA 5C0BA 1VEPA 2G60L 2I60L 4MD0B 2IAMC 4F2MB 4HS3B 2BJMH 4QOKD 5IESL 2X4NA 5DVKA 5E4IA 2NY2C 1BFOB 1Q9WB 1UADC 1FL6B 5H94B 5B4MC 3GDBA 3HNTL 1DDHA 1YEDB 1A4JB 3LY6A 1L7IH 3I6LD 3KNBB 1VADB 1TTUA 1F97A 3HR5B 3SPVA 3UXFA 5CJOH 1UB5B 2CLVA 1IQWH 1MQKH 2ITCB 2OJEA 3C6LC 3CPLA 4F3FA 4RRPG 2OI9A 1WZMA 2I9LA 1RFDH 3PE9A 3FFDB 2J8UE 4M62L 4G6AD 3BPNB 5KSBB 3LIZH 3DSNA 3AFLA 4APQA 1U8KB 3DUHA 3UROR 1G7QB 4LEXH 1U8MB 4TN9A 2UVFA 2QQQA 3QDMB 1FN4A 4WWID 1OD9A 4ZO8A 1BZQK 2FX9H 2NY3C 1NCNA 3ZDXE 3JTCA 3KPRB 3WJJA 4MJ2A 1HQRB 1OSPH 5HDBF 3HTLX 2R4SH 4GRWE 1JNHB 1YYLH 3RVVC 4PJ7E 2DQCH 4KXZI 4AEIL 5HYJB 4Y4HA 2FBOJ 3LEYL 3LN4B 1W8OA 1FYHB 3LKPA 5EOQL 1Z3GH 2I26N 5F1NB 3E1F1 5GHWH 5KSAA 4HMDA 1LE5B 4PREB 1D6EB 1AO7D 5EB9A 4ODTL 3T2OA 2YPLB 1H3PH 5JPNA 5C07D 4ZTOH 1QA9A 1YQVL 1FLRL 4MA8L 1EJOH 3HPJA 5DGQA 1A7PH 2BSSB 3MUY1 4YNYA 1U8PA 4RBPH 4U6TA 4X6BA 5I0DA 2CD0A 3LV3B 2I5YH 5C0NC 2YD7A 1A9BB 2FECL 3BDYL 3LRSA 5A40E 1A6VL 2YR3A 3VWJB 5JA8B 5JIHA 4NKIH 1CZ8H 1LDPL 2P44B 5BZDB 3UTQB 3WHXB 1LO3H 3BPOB 5GJSL 1MFBL 1NDMB 4M7ZC 5CP3H 4RSVA 1H8NA 2Q20A 3OPZL 4KXZH 4YR6B 3NCFB 5F8RC 5C0AE 2L7UA 4OKVA 5DQDH 3PV7A 1U58B 1BOGA 4OF7A 3I85A 1HXYA 3MRRA 4FQ1L 5HY9A 4PBVC 1Y6NR 5F6HI 4PS4L 4QHUA 5LQBL 3MLUH 4TUKH 5EUOB 1BIHA 4GBXA 1MFEL 3T2NH 3UJIL 4JGJA 5FXCH 1IGJA 4LLUB 2W9DL 1NGQL 4OM0H 1W2KT 4NM4H 1KPUB 4PYGA 3T09A 4HHAB 3EFFA 2WIMA 4XVJL 4BK4A 4D0BB 1B0RB 3W9EA 4L4VB 3VGAB 1ZHLB 5L2JA 4J3OC 3T3MF 3O2WL 4MYWB 5HVFB 4KWUA 3U30C 2W59A 5CZVH 1INEL 1E27A 2VAJA 4JFQA 4CADB 1CDHA 3CNKA 4EI6A 5F7LB 5A2JH 2X70A 5CUSL 3JWDC 4J4PC 1U93A 1MPAL 2ZSWB 3THML 3MNWB 5FGBC 1AGEB 1T1WB 3EKCA 4I9WE 1N59B 4KI5F 1FIGL 4POZD 4G9DA 5E94B 2WV3A 3CFDA 4JDZA 4MA3A 4PJ9D 4C4KT 2A6IA 5JIKA 3QULB 3FCTB 4IDLA 4GKSB 4MXVF 4XPBL 2CJUH 3GSQA 2HJFB 1KPVB 3EJJX 3PWUB 1JGDA 5FYJE 5J13C 2VXUL 3GSXA 4UT6L 5TDPA 3OHXB 1RSFA 4Y88A 4ISVB 5D9SA 1A6UL 1BQHB 2NYYC 5FYKE 5DMIL 3M07A 5D70H 2NY6C 4OT1H 4O58L 4QRPD 3U83A 4NWUH 3LPFA 1MLBB 5LGKA 1ZLUK 1WFOA 4XAWH 1S9WB 3SCMB 4QNPF 1WIOA 3WXWL 5TPWL 3LVEA 1AR2A 3T0AA 1DZBA 2JB6A 1I9RH 2VLME 4Z7WF 5AD0A 5D7LD 2GJJA 2FJHA 3NZHL 2DAVA 2IMMA 5J1AA 4U1HA 3QIWB 3SJVA 1FO0L 4J2XA 3RDTC 5IVZB 5ITFA 1XCQB 4EN3D 3C09C 2D9QB 5JPMB 3HG1D 2X7LB 1KNOB 4P46C 3WMSA 3U9PL 3E2HC 5I76A 1R6VA 1UXWA 4KK5D 5IQ7L 2D31B 5KG9A 4FXKA 1U8JB 2HFEA 2RCSL 1S9XB 5FDWA 3VA2C 1WAAA 2BVPA 4JY5H 4HS6B 5D2NE 4KJWC 5EU4A 1JNNH 4EQ2A 4U6XB 3QO1B 4Y2DB 5TDNA 3EYQC 3PQYD 3AU1B 4JRYB 5HYSG 1LVEA 5H35B 1RZGA 43CAB 4XC3H 2X1WL 3U1SL 4ONGL 2VC2L 2MQCA 3AREA 4IRJB 1KIUA 3O6KH 3T0WA 4KROC 3RUGF 3S3SA 3MXWH 1LO0H 5D7SL 2YKLL 2V9TA 3BKCL 3S8WA 5E8OB 3QXUA 2GJ6B 3BJ91 4JFED 4XNYH 5A2KH 1BZ7A 4OZIA 3O8XA 1MCLA 5J6GA 2ADFL 5F9OL 5TQ0H 1KFAH 4QHKI 2RFXB 5HI5D 2DLTA 1B2WL 3CH1B 2NX5A 5F3HB 1GHFL 4GXUN 5D1QB 5T33H 4YGVB 3HC3L 1XF4A 3ZE0F 3ZHDA 1QLRA 5DT1L 4OCNC 5BQ7B 4MJ6B 3BDXA 3DYMA 2ZCLL 4S1DC 4WEUD 4ERSH 4YEFA 3JWOL 1CE1L 1EEZB 4X4XA 3F7YB 1NCTA 2EKSB 1QFUL 3QUMB 5E08L 5F9JB 3P4MA 4YE4L 1IM9D 1YNTA 3DXAB 1MF2L 5DD3L 4PGDA 1OTTC 5C8JA 4NQSA 4YGAB 1S8DB 3RI5F 4TUJA 3V8CA 3REWB 5L0QB 4KK9C 2MKLC 3G5ZA 3BP6A 4HWZA 2IADA 3PWVB 4E5XA 1A64A 5F7UA 2BNQD 1T1YB 3RTQC 2F8XC 3R8BB 4FQ2L 1AGFA 5DLML 4Q9QL 2AK4B 4HLZG 3BH9B 4X5XB 1D5IL 3L95A 1S5HA 4H0GA 1EGJH 2H45A 5A2LH 3MV8A 5HHMA 4G8FB 3JUYA 5IHZB 1RZKH 3C87A 1EXUA 2MCG1 1Q0YH 3MOAH 3TVMD 2P8MA 5IB3A 4JR9L 4XNZB 4YHML 2VQUA 4LARH 3EO9L 1L0QA 4CNIA 4YHKL 3MLVL 1U2CA 4TPRH 1WJ3A 1UQSA 4LCCA 2DBJA 2JIXB 5FAAA 2DL9A 3VFMB 1FNEB 1A21A 2A9NL 3BHBB 2V9QA 3ZMRA 4WWKD 1HWGB 1D5XA 3MRPA 4Z18A 1RQ5A 2OZ4L 2ED9A 1R5IB 2XQBH 5IK3A 3GSNB 3SN6N 1WCBA 4YO0A 1PX3A 1FC2D 2DN7A 1JHKH 3O6LL 4FTVA 1ADQH 5IB1A 3V0VA 1UWXH 2W65B 3RWCB 4IOFD 2DDQH 1J8HE 1QKZH 4ONHB 1KTRL 1W8NA 1K8IB 3ZE2E 4GQ9L 2UY7A 2VKWA 2VDNH 3PP4L 4PLKC 5GRJH 3FFCD 5JO5B 2C3GA 2V17L 5T5FL 2LU7A 1FL5B 1U3HA 1YECL 1I1YB 2V7HB 1MI5D 3KPTA 3PL6A 4NQCB 3GSUA 1PEZA 3OG6B 4PP2A 2VN7A 4LCIL 3BEWA 5MHSD 5F72S 3SDXB 4XHQA 3PXHA 1G7MB 2EH7L 4DVBB 5SWSB 3CFBB 4U49A 2Z4QB 4AM0A 4XHJC 1A7RL 4UTBL 3VD4A 4JM2A 2IAMB 3IVKA 3RWGA 4MQ7B 4LU5L 1NCDL 2VZOA 3Q1SL 1D7FA 1HQ4B 2NY2B 1QSFE 4YHIB 2XV6B 1G0XA 3QCTH 4CL7A 1KACB 2BOCB 2X4TB 4S1SL 1R5WA 1HIML 4P2RD 3QNYA 3FHAA 3O2VH 4X4MA 1JZ4A 4JPKL 2DBLH 3UZQA 1I1AC 3VGFA 3C6LB 4WFHE 1KPRB 2Q7YA 4KKLD 4P3CH 5DD1H 5EFIB 3QG7H 4NJAL 4RGNB 3K8MA 4F9LA 2AEQL 1HYRC 2EZ0C 4LLYB 1ZLWH 2CDEA 3QIBB 2XTJB 2ORBL 3GI9H 3MACH 3RL1B 1FFPB 3HC4L 4L3EA 3WL9A 4FMFA 3P0YH 1IKNC 4G7VH 3WN5C 1RUQL 1CE6A 3HE6D 1FL3A 2ARWA 3QEGL 1SJHB 2R1YA 4ZUTB 5HHXL 5D2LE 1LQSR 3BE1H 5HYFA 4AENA 5EU6D 1LK2A 4P4KD 4KVNL 5I16A 1ZEAL 32C2B 3SO5A 5HDQL 3QCVL 4OUUB 1E28A 3PNWA 5ETUB 5IJVB 3MOBH 5FYJL 5FCUL 3IDGB 3GIZL 3MRKA 3Q3GB 3RVTD 5EBGA 4OZ4B 2E8ZA 2Q86B 4C56D 3S37L 5FYKL 2R1XB 2LV4A 1U8HA 4X8JB 5FA3A 3PHQA 5L8JB 4E42B 2CK0L 1ZK9A 1NCWL 5IBTH 4Y4KB 1CXIA 3S34H 1MNUL 4I0PD 2EXYC 5I17B 5EO1A 2GAZB 1N5AB 4PJEE 4XPHH 3J7HA 5DS8B 2QJDA 4Z95L 5KOVC 3PGDA 4OQTA 3SKJH 5JA9A 4G42B 5C2BL 3PDOB 1YDPA 5E00B 2VZSA 5ISZD 4MHHG 3L3HA 5DK2A 2D7OA 3DVNB 1KJMB 3L5JA 1GGUA 2HFFA 1I8MA 3SDYH 2WUCH 3BPLC 4H8WL 2AXGB 2XPGB 3QDGD 4GW5B 1QRNA 4LSRL 3I9GL 5JW3L 1Q1JH 4XCEB 5DTFA 2P5WD 4Y16C 1O0VA 3GSRB 5E0QA 5JZ7C 2JLLA 2Y7QA 3K7UA 1IGML 3BRGC 1J10A 4JRWA 2W1NA 1CLCA 1RI8A 3CC5A 1F3DH 1L7TL 1FGVL 5ACMA 1IVLA 1V3LA 2IH3B 3BFOA 1DBBH 5HGDA 1IC4H 1J5OH 2I07B 3A6BH 4OM1H 4RGOH 3RWHA 3S36X 4DKDC 25C8L 1NFDE 2VDPL 2Z8SA 3Q5OA 3ULUC 2VRAA 2LVEA 2RBLA 1MCRA 4RQQA 3MA9H 4M1GL 3QEUB 3ET9F 2AERT 4JFHD 1OGAD 3PWPB 4RX4A 4HH9A 2C1OA 4JFXA 4XVSH 3NAAH 5KOMC 2XZQH 5GGSB 3X17A 2H2SC 3A6OA 1RZIB 4Y1AB 1X5AA 3T77A 1M05A 1IT9H 2C4XA 2OXGA 3RVXC 4KQ4H 4J3TA 4ZFZB 2EIZB 3V0WH 1A14H 5DJYA 1JJUA 1BVLB 2XY2A 3G5VB 3WBDA 4K9EC 2QQNL 2QADD 3CDFA 1FBIL 3STBA 4F7MA 4K8RC 3VXTB 1KCUH 2WW8A 1H3VA 4PJBE 1DE4B 5GZND 1I7ZB 1VFAA 1N6UA 1EMTL 5AZ2L 4JFOB 2EDXA 3K4AA 2Q3AA 3AY4C 2MPAH 4PJ5B 1FYTD 5E8EB 1EPFA 3FTGA 3VJ6B 1IGTB 5EPMA 3L3JA 5FKAB 5GRVK 3KGRA 1H3WM 2NY6B 3LQZA 3ULVL 1OAUH 2FB4L 3DRTA 4FQLH 3T65A 4B41A 4HX1B 3T8XA 5I6XC 4OSUH 2IG2H 3NA9H 1KJ3L 3RY4A 4PRIB 4HG4K 3O6FC 4HAFA 3ZKND 1IAII 3VXQA 4C59B 1KULA 1IGFL 1BM3H 1QVOA 3O4LB 5IVXE 1A1MB 2GJZA 4X7SH 5IMOA 4JZNA 3P9MA 4AZ8A 2F54A 4EXKA 2YUXA 3UPRA 2YN3A 3MREA 2VDQH 5J3HD 1G7PB 2FH8A 2WIIB 3WLBA 4QRRB 1DLHA 1IGIL 3K4DA 4BFIA 2DIAA 4G3YH 2HN7A 1PBYA 3L7EB 4P46B 4XP9H 1A6WH 4U4BA 1IGYB 4ZODA 2HLFD 3MLWL 2VDMH 4GRMB 1BWMA 3MRBA 1A6ZB 3IU4H 1MOEA 3BOVA 4PG9A 4LQ1A 3LKNA 2VXTL 3CDYA 5I15H 4NT6B 3MGTA 5EUKB 4D94A 1HXMA 1SVZA 3NOIA 4WGWB 5FGCB 5I30H 1MHHB 5IG7A 2Z8WC 4N8CL 4C57C 3V6OE 3X3FL 4WUUE 1HHKB 3BPCB 4NO5B 1LQVA 4Z0BH 1T5XB 1IAIH 4ONFL 3MR9B 2EYRA 4N0YL 3HZVA 4PRAA 4G6AC 5DJ8A 2Y6SD 3R8QA 4MXQC 5ADPL 3C8HA 1PG7W 2D2OA 4N5ED 5GSVA 3VRIB 4LASH 5I74C 3PF2A 4XBPA 1C16B 1MY5A 4ODVL 3MJ7A 2W60A 1MFCH 1HHIA 2CDFA 5DHYA 1JHLL 2FDBP 5DVLA 3W0WB 4KRMB 3ILPA 5TE6L 3M17B 5IW6B 2HVJA 2DS4A 4NQDA 3G6DL 1AD0B 2XKUA 3G6AB 5HPOA 3K4ZA 4WHCA 3GSOA 2D03H 4XWOC 3VD5A 2FSEA 4L3EE 3DV6A 1QUNA 5IF0B 5HGAB 1MIML 3ARDA 4P2QD 3HKFA 4HK3N 2VLRE 4IDJH 2EYSA 3MRQA 3OJMB 3AM8C 3IS0X 1ZSDB 1BD2B 5GGTH 1LILA 2RJMA 4NQEB 1RZKC 3EDKA 4BELD 1FE8H 5IEHA 3DYPA 5EOCH 1J12A 1S7SB 1NC2D 5CFHA 3L5WB 5DJAB 4Z7WA 5E6ID 3RTQB 5LGHL 4MZ3A 5T3XE 5DRXA 1X7QA 3GGWA 1UWGH 2AI0L 1UM5L 5D6CA 3RPKA 4N90E 2BX5A 4PRHD 4MVBC 1G6RB 3GSVA 3W39A 1D3CA 3HMXL 5DF0A 1ZLSH 2D0HA 1FZOB 3VCLB 4M3KB 2APBA 5EORH 1NMAH 5DJDA 5ERWA 4PJXE 1A6TB 3VXSB 2ATPB 3IDMA 5EZJB 1MELA 5IFJA 2VQ1A 1IJ9A 5KW9L 3QQ4B 4RAUB 5JHDE 1QSEE 5FHAL 5I18L 4EUPA 3IFPA 3VFOA 1ZT7A 1Z5LB 1FPTL 4G7YL 1MHPL 5DD0H 4PV9A 4QT5B 1RUMH 2EDYA 2Y5TA 2X4OB 5C7XL 5DJ0A 2DTSA 3RUGA 4U1KB 2B5IB 4KK8C 5BOZG 1N6VA 3RX8A 1SYSB 1LD9B 1EHXA 1LHZA 2DB8A 2Z35A 3P4OB 3V5KB 3KWWA 4AQOA 5IFAH 4U31A 2ICES 2Q8AH 3HAEA 4DW2H 4DGVH 4XBGB 1D5BA 1IILE 4FQHB 4MQXD 3F58H 5DJ6B 5AAMA 3QFJE 1BJ8A 2J4WH 5DD6B 3GMQA 3CSBA 4PJAE 1EVTC 4PD4K 2NY1B 3S4SG 3AB0C 1WISA 3DUSA 3D0VB 1DL7H 4LHUG 3QUKB 4DGYL 1VENA 1FFOB 3D1MC 1JTPA 4TSCH 1QPXA 5BS0A 1GGCL 1EO5A 4HEME 1IRAY 2FX7H 4PB9H 3G04A 4L8BB 5CD5D 1NBZB 2OR8A 2VIRB 2XKSA 1LE9B 3V52L 2YA0A 4MDJA 1BFSA 1UCBL 5IHLB 2A77L 5KS9B 1T0MA 1JGVL 1ETZB 1L4IA 3V4PH 3HE7A 2C7UB 4GXVH 3L5HA 4PGBA 4R96B 3VFUA 5IMLA 1XGUA 1I1AB 3EYUL 2VLKA 4LPVA 3CSYA 3GMRA 4HXBH 4NKOB 4R2GB 4H88L 4H0HB 2V2XB 3TM6A 5LGJA 1AE6L 1DEEA 1DN2A 5EZOL 1NL0H 3T08A 2CR3A 4DZ8A 1FVCB 2YPKB 2J6EH 5GQBA 1C5DA 3WJLC 3KPSD 4YWGL 1C12A 1ACYL 1X6NA 2EH8L 3NVQA 3I02A 3H9YA 1ACZA 3F5WA 1I1FA 4LCWA 4N0UB 1R3LA 3BD5A 1T89A 5I75B 3MLZL 3K8LA 1HSBA 4YDJB 4KK5C 1TNMA 1IC7H 1NEZA 3SE9H 3D2UB 3KLDA 4NYLB 4WY7H 3WLWC 4U0RC 1CICD 4MHHI 5I1LA 3B9KD 3FRPG 2CIKB 5HHOB 1AR1D 3P11H 5IP4A 4L4TE 5IMKB 2EO1A 1PYWB 1HILA 2PYEB 1X4YA 3RA7L 3RBSA 5JW4Q 2I24N 4R4ND 4H26B 1G7LA 4EEEA 1U92A 1RIHL 5CINL 3DGGA 1BQLL 3DX6B 3PXJA 4LP5A 5H2BB 3R1GH 1UACL 3OSKA 3VFNA 3EJZD 2WNGA 4JDVA 1G0DA 2J88H 3OGCA 2JCCB 4Y4FA 3S96A 4OZHB 5GRVL 2FATH 4M3JA 4PB0L 2HYMA 3DSFL 4P23A 4E41E 3OXSA 2DQFA 1WEJH 4HWEL 4ODWA 3KXFA 4RMUA 2GKIA 1F3DJ 4Y16B 4S0UC 4KI5E 2HFGL 2ESVB 1V7NL 3VXMA 3VFTA 3ZTJG 5F7FA 1RHHA 4HUWB 2P4AB 1S7VB 4JJHA 5IM7A 2Y9RT 3OAZK 2ATKA 4XCFL 1G9NH 1A3RH 4G9FA 5I8EA 5IEKB 2GEEA 1BF2A 4UT7H 3VXUD 1I8IA 5DA4A 4YDKL 1EX0A 5MP6H 3UBXI 3RZWA 1S5IL 1G9MC 4NQVA 2DM2A 3F7VA 1CR9H 1MFDH 1DUZB 1TVBA 2YOCA 4WV1C 1R24B 2NY7L 3MA7B 2R2BA 1C08A 1EEYB 1K6QH 2F5BL 3LB6D 1JFQH 1IGCH 2FO1A 4CRPA 4LHUD 1G84A 4NRYA 5SWQB 2EDRA 4ZPTA 5BJTB 1TVHB 3OKDA 3QNZA 4YFLF 3MTRA 3EOAB 3CVHH 4S11A 2OXHA 3NPSC 3D9AL 3CVIH 4JFYB 1Q38A 3HRPA 3MRGB 5D2NC 3UTTD 3E6FB 4I18C 1TJHL 1C5BH 2E3VA 4N68A 5E8NA 5EIIB 1WT5C 1I8LC 4JFFD 3JZ7A 1OW0A 3L1OL 4KKBD 2IH1B 1HKFA 4F57L 1GJIA 4RFEA 2WP3O 4HFUL 3EOTL 2R0WH 3GK8H 5EU5A 4MCYB 5I1CH 4WWKC 1HHJA 1FH5L 3WNKA 1KXQE 4OB5H 4PUBL 1E6OL 1Y18B 2B0SH 1IM3B 1XGQB 4X9GA 3FT2B 1NBQA 3QQNA 4M6MH 3FQTB 1OTSC 3IB4A 1B6UA 4FQJH 5JORA 3O6FB 1UH3A 5T3XL 3O4OC 4L9LA 4LEOB 4Z76A 5CBAA 2BOBA 1OAKL 3SKUD 1DUYA 5BVJB 5M94B 5EZLA 1X6LA 1N4XL 1QNZL 2LFGA 1NDGB 3ZSSA 3BXNA 3MGOB 5K9QG 2IJ0C 2VSDA 5C0EA 4ZUWA 1KIPB 1HDMA 2CKNA 3VRJA 1ONQB 1DVFB 4MGXA 1K4CB 4XGZA 4OFIA 5CCKH 4UIKH 3OKMB 1OVZA 4KJPD 5CGYC 1NC4D 3VXRD 1XR9B 4WFED 2BFVL 4OQTL 1W72H 3BO8A 5AYUH 1CGVA 4QOKB 3LKQB 1GIGL 2XACC 3TF7C 1PY4A 4ZXBA 1ZHKB 4WU7B 4LHJB 5CAYB 1RV6X 4YHLH 3P0GB 4JQXC 4UV4L 2D7NA 1RZFH 4OD2B 3PHSA 3ARWA 3T0ED 1W0VB 2BXZA 1JBJA 5CILH 2I9TA 4NO2B 4OBSA 3QIUD 1JE6A 5DC4B 4UOW0 3IJHB 4LMQI 1H5BB 2C1PA 4XPAL 1I75A 4G8GD 1F4XL 3CFEB 4JLRA 3TA3A 5FO8A 2GSGB 4HCRH 4KJYB 5IW1B 4PJHA 2YBRA 5FECA 3DWTA 3OX8B 5L88L 4Y5VA 3V4UH 1YY8B 5I74B 4LIQE 1UWEH 3RNQB 3WUWA 4ZFGL 1R0AL 1YN6A 2ZOKB 4JHWH 3SDAC 4J1UA 5I1AB 3B4NA 1LEKB 5GRUL 1K5NA 3FB5B 4QLRA 4P5TD 2AJXL 2PW2A 4CMMA 5FB8A 5MEOB 4BK5A 1AO7B 2ICCA 5EOTA 2P47B 3GNML 1TMCB 2BP3A 3NFSH 3QXTA 4R9HA 4Q6IB 3P4NA 4TRPH 4Z7OF 5IIEB 4HKJB 4LLVB 4I4WA 5CBEA 2DQGH 3EO1A 4K3DL 4K7PH 4PRPA 3W9DB 2W0FB 5GSRB 5IWLA 5TDOB 1TETH 4NHUB 3IXAB 1NJ9A 1TVDA 2IANE 2C3VB 4WNQB 2PR4H 2WP3T 3KJ4C 1XF5A 5E8DH 3EFDL 2QR0B 4XVUD 2G60H 4F15C 4Z7UF 3SKMA 5C0IA 4AIZB 3NBNA 5IESH 1IC1A 3LDBC 3HNTH 5A16A 1AC6A 2NLJB 5I8CB 4JRXD 3IAQA 3IFOA 2Z92B 1M7XA 3C5ZA 1R3KB 1Q9OB 3MRLA 4HZLA 3VRLF 1CI5A 2OMBA 3SDXF 3MBED 1SY6A 4TQEH 1I7TA 4KK6C 4M62H 3MRMA 5FYJU 5T1LA 5CMAA 1E4XI 4MMXC 4YUEL 1HN1A 4U1LB 12E8H 1T5WA 3DVGB 5FYKU 4WHYG 3ZE1F 1X5LA 3FB7A 3FQWB 3GB7A 4M8QB 1VEMA 2VSCA 1DQML 5F9DC 2J8UB 2HKHH 3RJQB 4NO3B 1BX2A 1TZGL 2NPLX 4IRSC 2BNRD 4PJDF 2IQ9H 3RKPA 4AEIH 1I7UB 4MJ5A 2X1XR 2R29H 4JFDA 3MO1B 2HJKB 3ARPA 4K7PY 4BSWA 4K94L 5MEQB 5SX4I 4ELKA 3QDJB 1V5JA 3FB6A 3G5XA 5B38B 1PY9A 3AB0B 4MA8H 2IC2A 2GYSA 5ANMA 3RWIA 2QV2A 2EIEA 2EE9A 3IJSA 2DQJL 3MV7A 1E4XH 4DGIH 3BDYH 3VH8A 1X4XA 5DZLA 3RIFK 1ZS8A 4HMCA 1VB9A 4X6FA 1LDPH 2CKBH 3SO3C 3TPUB 5GISL 2B1AL 5GS0L 1AFVL 4QRPB 5DJZA 2ED7A 2PXYD 3BZ4A 2J7LA 5AUMA 4LCYA 1MFBH 4WDIA 1M6OA 3QFDA 5CJBA 3DIFB 1P6AB 4IS6A 1HCVA 3ARFA 1T3FB 3OPZH 4JB9L 4O5LH 4DFIA 2C5DC 5KANG 2O61A 4RDQF 3UZVB 3NPZB 2YSSB 1CIDA 4YPGA 3PABA 2CO7B 1CLOL 3B83A 3IJYB 1JZ3A 3QUXA 4GMTH 4PS4H 3SGKC 5LQBH 2GITA 1JMXA 4S1RH 1A6AA 1G7IA 4N1EA 1TENA 1MFEH 2W9DH 1A7NL 4ZDHB 3TJHD 3OF6D 4LRIA 4M7LT 1MJ7L 3KPPB 4X9FA 43C9A 1NGYB 4XVJH 4Y19A 3HG1B 5ICYA 1EFQA 1FAIL 4LSQL 4ZAKA 3TZVC 4JREC 3BJLA 3GMMB 4WI9A 2FL5A 1LMKA 3O2WH 4HXAL 2GK0B 3H8NA 4JM4H 1NBVL 2H9GB 2ZUUA 4X6DB 5GRYA 4L8SC 4U0RB 4O00A 3RWEB 2R0LL 1MPAH 1BFOA 4KUCF 5H94A 3O3EA 3DPBA 3G5YB 1Z0NA 3CX5K 4FFVC 1YEDA 4Z7VB 1A4JA 4WU5B 3HCVB 5C9KA 3DX7A 3KNBA 1VADA 3O3BA 3HI1B 3HR5A 1FIGH 2VXQL 3ZT7A 3UTPD 2Q8BL 5ICXB 5ACLA 3MQIA 1RK1B 3TIEA 1AHWA 4XPBH 4G6FB 5ID0A 2XA3A 3FFDA 1J11A 4UBDD 5SWZD 2VXUH 4UT6H 5JLZA 2BSTA 4QKXB 3GEWB 4JFPB 4HGWB 4IM8A 4PLOB 3DX9A 5BV7C 1A6UH 3M8OH 3QDMA 4R7DB 3MUHL 3UTSD 3QI9A 5HGHB 2ADGA 3JTTA 3QEHA 2FYYA 3L3KA 3SY0B 3HUJE 4I9WD 5E1AA 5JMRA 5TF0A 1YNKL 1JK8B 4EKXA 4HUUB 3CXHK 5TPWH 3V5DB 3WXWH 4X9HA 4OLZH 2ZJSL 2BDNH 4WTZA 2H3NA 3DX8B 1BJ1J 3NZHH 5I66A 1IM9B 1LE5A 4MLIA 4PREA 1JGLL 2BY2A 1D5MB 2H32H 4BSVB 4F7CB 1I4FA 5KSVA 4R97C 4BA8A 4MJID 1LO2H 4RISL 2AGJL 2KL6A 2PO6D 1DANT 4KRLB 5FYKD 4MA7L 3TN0C 3JBG7 1G7JB 2H8PA 3D39D 4HK0A 2WINB 3ZTJH 1KSRA 5E6IC 2BNQB 1OTUC 5E5RB 4XMPL 3LV3A 3NIDF 3D85B 5EO9B 5FGRA 1FZJB 3QWRD 1A9BA 3EOYG 1UVQA 2VXVL 4WV1B 5IQ7H 2BC4B 2FGWL 3UP1A 3EYSH 5KVEH 2RCSH 3JTSB 5DMKA 5BZDA 5E2UL 3DMMA 2ICEB 2EDTA 5F9AC 3UTQA 3BN3B 2YD5A 4LIQL 2UZIH 4WI4A 2DICA 1YEJH 3RP1A 5DRWA 3U1SH 5HYIA 3C8DA 3QP3A 2AJSL 4V1DA 5TFSL 1VA9A 5D2NB 1CCZA 4LGSB 2EKJA 2YKLH 5D7SH 4W6WB 2R1WA 4Z5RA 3H9SD 3U36B 4D9RE 1H15B 5HHVL 3G6JE 5DQ9B 1B3JA 5DO2D 4HFWB 2CLRB 4LVHC 4W4OC 1RIUH 2VABB 4IHOB 3ALWA 3I3DA 4HIHB 1I9JH 1KIQB 1OWRM 1KPUA 3EJYC 1HEZB 3RGHA 1B2WH 4GQPH 1FNGB 4XNUH 4RMSA 1ZLVK 4WWKB 5EC1B 1GHFH 2E7BA 4D0BA 1V05A 4B50A 2ZCLH 1Z9SA 5HHPB 4G43A 4MAUH 5ESQA 1ZWIA 1EFXD 3JWOH 5FIEA 1CE1H 1OM3H 5C0BD 1PD6A 1Y6KR 4AT6A 4LQFL 3MV9B 1EZVY 1QFUH 1C1EH 2M2DA 3BSZH 4HWBA 5E08H 2VISA 3MNWA 1E4JA 3KS0H 3UAJD 3MRDA 5FM8A 1MF2H 1WZ1L 3FFCB 2VWEE 2WK2A 2NR6D 4BKLB 2VITB 4OF5A 4TTGA 1AGCB 4M7JL 3SE4A 1GXEA 5GRZA 5B22A 4DZBB 4GKSA 1TXKA 4H25B 4KZDL 2D4DA 1HH9A 2SEBB 4FQ2H 1P4IH 3TYGL 5HYSB 5DLMH 3TBVA 3RWDA 2OP4L 4APQD 3LEVL 1QHPA 3I50L 2ICWI 2HP4A 5CD5C 4WRLA 2X4SA 1BQHA 4CVWA 1MCOL 2UWEB 5F8QC 4YFEA 1AC0A 4HJJL 1SM3L 1A9EA 2NTFB 4WHTB 4OFYA 3IDJA 3ULVD 1QBLH 1BFTA 4N8VA 3SCMA 3BX7C 2IQAA 3S9DB 2EDLA 1OP5H 1HH6B 4H0IA 3RWJB 4YHMH 2CO6B 4Y4HD 3D69B 2G5BB 4YHKH 5C0CA 3MLVH 4RZCB 1NBYB 5KSAD 3S97C 4LLMB 3ESUF 3VG0L 6FABL 4R0LA 3RX7A 4L1HA 5ESVA 1DQTA 1I3RB 4LVNB 1ROWA 1NCCL 2A9NH 4A6YA 1Q72H 4CGTA 1ZA3A 3DECA 4L3AA 2WBJA 4OZGB 2X7LA 1KNOA 2OZ4H 5EU6B 4P4KB 4U3HA 1CGTA 4JZJB 2NW3B 1ODAA 3PQYA 4F9PC 1IFHH 4KUZH 4FQQB 3IDNB 3MROB 3V6ZA 1U8JA 3O6LH 5E2TH 3O2DH 4F58L 1JWMB 4YHNA 1DQJB 5FM4A 2V7NB 2ZNWA 1HKLL 4LPXA 1E0OB 3QO1A 4Y2DA 4C56B 3AU1A 4JRYA 2P24B 1T03L 1Y0LB 5CJQL 43CAA 3CXDL 2BVQB 5T5FH 3CFJA 1YECH 1A1NB 4IRJA 1UFUA 3HA0A 3VI3E 4JDTL 4I0PB 3U2SA 4CU6A 1OCWL 3EYVA 4QHLB 5E8OA 3BWAB 3KJ4B 3BZFA 4UTBH 5BMFL 4F15B 2AQ2A 4L1DA 4GBXD 4LU5H 1MHCA 3LKRB 5BO1L 4XNXH 3LDBB 3TNMA 4LLDA 1CFNB 2IPKB 4S1SH 4DCQA 2FR4B 3MJ8A 5ALCL 5KJRH 5JQ6H 5D1QA 3BN9D 1ZVSB 3QDGB 3T0DA 4OD1L 2ZSVB 4YZFF 3LQAL 5BQ7A 1RHFA 1BBJB 3O45B 1BLNA 5KSBE 1YPZE 4PLNC 3AGVA 3WFZA 2XRAH 3V6FB 2AEQH 2GT9A 2EKSA 1P2CA 1U6AL 1F2QA 2ORBH 3DI2B 3OB0H 5DJ2B 3DXAA 4QRQA 5CEYB 5DHVH 5GIRB 5I1DB 3KPRE 3HC4H 4NFCA 2DQTH 5J1SC 1S8DA 4JY4B 4PJGB 3REWA 1RUQH 3DURB 5ADOL 4MJ4A 3WO3B 1NSNL 4S1QL 3DBXA 3PWVA 3TBWA 9CGTA 4XCNB 4PV8B 5C6TL 5HHXH 5ALBL 3WFDL 5HYJE 1T1YA 1OGAB 3B5GA 5SX5H 4TSAL 3C60C 4M1CC 4IRSB 5JIIA 4LBEB 3BYTA 4WHYH 3QCVH 4X5XA 5HDQH 5EA0L 1AGBB 5MEPB 3MMEB 4LPWA 5FCUH 3FMGL 3FAXA 3GIZH 3LB6C 2YPLE 4G8FA 5IHZA 5FEBA 3VW3H 3QXAB 4R90L 1OGTA 1J0HA 4N0FB 2ZUQB 5D2LB 3MJ6A 3S37H 3HNSL 1Q94B 2R2CA 1P4LA 3FO9B 3TEUA 5CP7B 2QADB 2B1HH 1NCWH 5HVGB 2W92A 4ZPVA 4P2CG 5H8DA 1MNUH 2R69L 2APVA 2EIDA 2PF6A 5FHBL 5K93A 4L29B 4DQOL 1AIFA 1FQ9C 4H1LA 4C83A 4KKBC 3DETD 3QNXB 2BHUA 2IBZY 1A7BA 5DJCA 1EV2E 3RZCA 3SJVD 5E24E 1T4KB 4XC1H 1F3JB 5F96L 3KDMA 1L0XA 2FBJL 5AAWA 1AXTH 4ZUSB 1N3NA 4UUJA 2Y07L 4PJEB 4LSRH 1GZQA 4Z7UA 5EUOE 1QEWB 5ESAB 4OGZA 4CBPA 2W65A 2HTLD 3RWCA 4GUPA 5E2WL 5J57B 1K8IA 5GJTL 4X99A 4EI5C 1L7TH 4GXUM 5CEXA 2F9BT 4D3CL 4OCYL 2JCCF 4L4VE 4OZHF 3ARED 3BUYA 25C8H 2QKIB 3SDXA 2JJUA 1PEWA 2R0KH 1G7MA 4OIIH 4DVBA 4JREB 5SWSA 5CGTA 2XI9A 5INDB 3MNZB 4NNPL 3H2WA 3O8XD 4MQ7A 1IZKA 2HLAA 5HD8D 4E0RA 2HMID 1IEAA 1CGSL 4YHIA 1CFSB 3DARA 4XCYB 2YS4A 2NX5D 2HTKD 3S3JA 5CEZL 3D5OF 5DK0A 2E7LE 3MBXH 1OAXL 4ZTPL 2QQNH 5GS2D 1FBIH 4PJDA 1KPRA 1SY6L 3QHTC 3MZGB 1JUFA 1CK0L 2E27L 3HI5L 2C4FU 4J7RA 1FFNB 3ULUF 1MCBA 3N1PC 4ZQKA 5AZ2H 2FD6L 4OAWA 5E2VL 1MUJB 4GFTB 1SHMA 4F7PA 3RL1A 3CJJA 6CGTA 4U6VH 4NUJA 2OR9H 1BIIB 5IR1B 5HJ3A 5L8KB 3FO0L 3ULVH 3EYOB 3EZJB 3GO1L 4S2SB 2DWDB 3QDAA 2UZYB 1B88A 1XGRB 4NN6C 3V95A 1KJ3H 1YMMA 1JYWA 5GGRB 4PRBB 4FXGA 4OUUA 5ETUA 1IGFH 3IKCA 2DLIA 4J12A 5IJVA 1EAPB 2XN9B 3MV8D 2FEEL 3HB3D 3Q3GA 5HHMD 4PJFA 2Q86A 2R1XA 4R97B 4ZUUB 3O3AA 5BRZA 5DZNA 1NC2B 4W68A 1A7OL 3K74B 1QBML 3CVHB 1P1ZB 4JHAL 5E6IB 3SGEI 4HF5H 3RJDA 2GAZA 2F8OA 5E7FA 1MCHA 3E6HA 1KCGC 3SGJC 3PJSA 2NY0C 2ADIB 2YMXL 4JRYE 3NCCB 3GKZA 5DS8A 3TCLB 4PRHB 3C6SB 1DANU 1JGUL 5E00A 1FGNL 3TYFB 1CXHA 2FIKB 4O9HL 1MCFA 3DVNA 1KJMA 1D6VL 4N8CH 1HHGA 3X3FH 4HKXB 4B7LA 3A6CL 1IMHC 2Q3ZA 1TZIB 4ONFH 1J88A 2GJ6E 3CU7A 4JG1L 3MBEC 2HKFL 3GSRA 4FTVD 2F8VA 3ARGC 5ADPH 3FB8A 3HC0A 4DEPC 1YC8A 5FV1L 1A3LL 4ETYA 3AUVA 4XP6L 2R8SL 1N64L 1U3HD 5FYLE 1GC1H 1KB9J 5F3BB 3VMNA 3S88L 4OGXL 4GG6A 3PL6D 4YQXL 2YD6A 1QO3A 1F13A 2EYTA 4YFDB 2XIDA 1F4YL 1QFWI 3PWPA 3G6DH 2VUOA 5GRXG 3QAZC 3DXAE 3HZMB 4JM2D 4LSVH 1W72B 5GGSA 1FORL 1QSZA 2QBWA 5J6HB 1RZIA 4JGMA 1MIMH 4OKDA 5DC0A 2F5AL 4J4PA 2V2TB 1HYSD 3QUYC 4XTRD 5FGBA 2EIZA 1VFUA 1AY1L 5INCA 3MLTA 5HI4D 4AL8L 4Y5YA 2AK4E 2NY4C 3A67H 1I7ZA 3TBYB 2JELL 4OCSL 5EG6C 1LP9B 1CLYL 4N9OB 4XMKH 3CU1A 2RAMA 5E8EA 4X6CB 4L3ED 5FKAA 3WHE0 5DDHB 3I3BA 4ELME 5HSFA 4YAQA 2DMKA 4WHDA 2XQYG 3IF1A 4OGAD 1CL7L 3U79A 4PRIA 5EBWB 4GAYB 3J8F7 1A5FL 3O4LA 5KW9H 2IPTL 1G6VK 1CDCA 2DD8H 3HLAA 5FHAH 3VG9C 1JWSB 3HNVL 1CDYA 1FPTH 3TJHC 4G7YH 2YUVA 3KPSB 3RDTA 3NIFF 4NKMA 1IAKB 5D7KE 3IGAB 2F19L 3B6SB 1KT2A 4TSBL 1JZ5A 4LNVA 4EDWL 1WWBX 1YN7B 3HMWH 5BXFA 4YHYC 3DTXA 3L7EA 4HPOL 3DO3A 3MJGX 3EBAA 3E2HA 4HDIA 5L8LB 4U1IA 4M6NL 1CICB 4XPFL 3VGGA 4ENED 5SV4A 5EUKA 1L9NA 4D9QE 4NQCE 1UZ8A 3VRLE 4IMKC 5FO9B 4MNGB 4JY6B 5F70A 1UA6H 3BPCA 4NO5A 1IAIM 1UZ6F 5EC2A 1T5XA 5LXGL 1QRND 3IDIA 3MR9A 5B3JE 4Q2ZB 4GRLC 4M4RA 4NIKB 2Y06L 4K7FB 2DI8A 4UBDC 2HRPH 1F11B 2J8UF 1T1XB 1GGCH 3WNNA 4NNYA 5E9DA 1J1XL 4KGLA 4MXWH 4R4BA 3MRIB 3SKNA 5CKAA 3P73B 3I6GA 1D5ZA 4CJ1A 4EOWH 4HIIB 4LLQB 5DWUH 2UUDK 3ZDXF 5GS2H 3W0WA 2E9BA 1DJSA 2GK2A 3P77B 1JGVH 1N8ZB 4RGNE 4ZD3H 5HVWA 3LEXB 1QR1A 3EYUH 1XH3A 2Y36H 1JF1B 3G6AA 4RX4D 1TQBC 2XTJE 4P5KB 4R7NA 1MHEB 4H88H 1AE6H 5HGAA 2YD9A 1T7WA 5LG1A 3V7AG 5EZOH 2A6JB 4JANB 5D6DC 2YUZA 3SDDA 1J1OL 1P53A 4IIQB 4NQEA 3B2VH 3VXUB 1P4BL 4PJ8C 1JV5A 3GM8A 3H7BA 4PGEA 3L5WA 3WE6B 3JXAA 5DJAA 3RTQA 3ZL4L 2YC1B 1KCSL 1KB5A 3BT2L 1IC5H 1MVUB 3LKSB 1WICA 3U4EA 2AABL 2VLLB 4PRDB 2OK0H 4Z78B 2CKBB 1GOFA 4LHUB 1FZOA 3W5MA 3G08A 4EUPG 4WUKH 5EN2A 4J3WA 3U9UB 4PP1D 4JPWH 3RA7H 3UTTB 4UDTA 2ATPA 2AJZA 4WW2C 3RVUC 4TULH 1XGTB 2XT1B 1RIHH 3QQ4A 5CINH 2DJUA 3N0PB 2F54D 3MRCB 1UACH 4L4TB 5ICZB 4JKPH 5CSZB 3UTZB 4YHOH 1AKJA 5J12B 3WFHB 1H0DB 3RWFB 5TGBA 4P2OA 4QT5A 4X6DF 3HAEG 3NACL 1SEQL 4F33B 1RZJH 4A6YL 4NPYA 2BHZA 2X4OA 5T1MB 4N9GA 4NFDA 5HDLA 3L6FB 1FZMA 3DSFH 2LQRA 4RWHA 1LD9A 3F62A 3GMLB 2VZTA 3P40A 2XFXB 2HFGH 4Z6AT 1RAMA 1V7NH 4M48L 2YWYA 3K2UL 3V6BR 4FQHA 2X6MA 4Y5XC 2NR6C 5DD6A 5DSCA 5C08A 5TQ2H 4E41B 3L9RB 4NKQB 4W4NA 4XBEL 3ARRA 5LBSL 3HZYB 4PJCB 4YDKH 4HSQA 3PWPE 4WFFE 1YEFL 3MLPA 2AEIT 1CFBA 4X5WB 1S5IH 2BCKA 4QTHA 5D8JL 2AV1A 2DTMH 1MCNA 1FFOA 2IEPA 3VXRB 1T1ZB 3SE8L 4Y1AE 1IL1A 4KRPC 1UEYA 3O41B 4YHZH 1ZKAA 4KI5D 1S3KH 2A38A 1HSAA 2VL5B 2F5BH 3L7FA 1S78C 3UJJL 4RMQA 4PY8J 3SGDI 5GS0D 1NAKL 2J5LC 3ULVC 4K07A 4K7PX 4LL9A 4X6EB 1B0GB 4R96A 1ZVYA 2HH0L 1ULVA 3VWKC 1I1AA 4NQDD 1CQYA 3D9AH 2EEBA 4HT1L 3TJEL 2CRIA 4G8GB 4Y4HC 4NKOA 4PJ5E 2LU3A 3QUML 3MLSL 2V2XA 3FO1B 5KSAC 1FJ1B 1PGRB 3L1OH 2FLRT 3ARDD 2OTUB 3T0XA 3CMOL 3TO4A 3ZKSD 2CSPA 1NEZG 1BOYA 3VXOB 4HFUH 2H32B 3EOTH 3MXVL 1N2RB 2D7TL 1IKNA 3WN5A 5K33A 2VZ3A 4Y8AA 4MNHA 4XZUA 4P5MB 1JPST 4PUBH 1E6OH 2UYLB 5DVMA 1TFHA 4LKXB 4P5TB 5T5NG 5B8CC 4ZUVA 2Z93B 1R3HB 5KVDH 5DJXB 2AXJA 4QRRE 4CU8A 1J05B 4KMLB 3EO0B 1N4XH 4KTEL 3FQRA 4NZRL 4ZYKB 2C3WA 3S36L 4LLWB 1F42A 4ZSOE 2B2XL 2DI9A 2X5PA 2KZWA 2PYEA 4LNRB 4G8EB 4ETQB 4OI7A 2O5XH 5KVFH 3BW9B 4Z8FL 4UU9B 5LAXA 3DX6A 2VWEC 5H2BA 4HKZA 2BFVH 4OQTH 3VFGL 2NY0B 5FGCE 1YJDL 3GBML 4WCYL 1J0ZA 2EO9A 3LCYA 3OR6A 4QWWC 4GLRH 5JDSB 1NGXB 1GC1C 3L3OB 3BN9C 4UV4H 3RPIB 1HE7A 2YXMA 3MFFB 4D0CB 4HKBA 4PJIB 3F12A 3KYOB 4MNQA 3P0VL 4XPAH 2QEJA 3MBEB 5IHUL 4OLXH 1KLFA 4Y16A 5ABDE 3GIVB 2ESVA 3D3VA 4FZEL 3Q2CA 4UQ2B 1RJLA 1S7VA 4S0TD 2VLJB 3ARBC 1DFBL 4DEPB 4M1DL 5L88H 4EXPX 3ROLB 5IEKA 3UPAA 3W11C 3U48A 1R0AH 2X4RB 3LN5B 2AKRB 4NGHL 2CMRL 3IDXH 2UWEF 2ZOLB 3HS0A 2P5EB 1LO4L 1DUZA 2DQHH 2BNRB 5GRUH 4WFGE 5BS0D 1VSCA 4NHCH 2AJXH 3DROB 2BY1A 1BD2E 2DM4A 4U1SA 4NQEE 4I3RH 5E56A 1NGZA 4XXCC 5JXAH 4E9LA 1IEBB 5SWQA 1KIRA 1P7QB 1O5DT 3SOBL 2CXGA 5KN5A 1K3IA 1A8JH 5F1OB 1VHPA 3HE7D 3LD8C 4K3DH 4FA8A 4DTGL 4C55A 5GGQL 5AZEH 2VLKD 4KY1H 2PTTA 4JHBA 2WUBH 3HI6L 5JUEH 1YUHB 3WDJA 4DOHB 1FV1A 3DETC 4GKNB 1UB6B 2OQJB 3EFDH 4HUVA 3EAKA 4M5ZH 2O5YL 2ARJB 4I48A 4MCYA 2AQ1A 3BWUC 4NJ9H 3VXSE 4KMTL 2F15A 3R4DA 4X7EC 4LCWD 4FZ8H 4R26H 3AS0A 1VACA 1GCFA 4Z77B 4CUCA 3BESR 1A1OA 4IOIB 3MSPA 4NP4H 4LSTH 2HTLC 1YEGL 2ICWB 1CVRA 3QHFL 2P7TB 4X7TB 4DKAA 5D1ZC 3BISA 4U1NB 1MLCB 1FP5A 5BVJA 5D7IA 4TOYH 3ZE2F 4YUEH 3VG9B 1YZZA 5IBLD 4X80L 4RAVB 5KZCD 3UC0H 3CLEL 4ODSL 1ZV5A 5JOFB 5FO7B 5J56B 4RNRB 3WFCH 1ONQA 2R0ZL 4YHYB 1FDLL 4P9MH 3TC9A 4DKFH 1NKRA 1TZGH 4DN4L 4DUWA 2XXMB 1XR9A 1N7MH 2DLHA 2X4UA 1VFBB 3SBWC 4BSJA 3RVWD 5F89A 3FOMA 1CT8A 5J11B 4IOSD 4YZFE 3LH2L 1ZHKA 4Y4FD 4K94H 4FQPA 3NH7H 1EIBA 1EZVX 4EJ1C 1H9VA 1W0VA 5CHNB 1JRHL 2ZPKH 4P23D 2FO4B 4PJGF 5DI8B 3IFLL 4NO2A 5DFVD 3MJ9A 3WUWG 5JDJA 3IJHA 3KXFD 4FNLH 4GRLB 1KELL 5FF6A 5SWZB 1FO0A 2YEZB 5C71A 1BWWA 2X41A 1ZOXA 1INDH 4X8XA 3VXMD 4OV5B 4MXQA 4KJYA 5IW1A 1MAKA 3IAGC 4GAGL 3OX8A 3ZDYF 4FG6D 3UTSB 4QF1A 5GISH 1OB1B 2B1AH 5KS9E 4G9FD 1RJZB 2ZUYA 5GS0H 1J9CT 3RNQA 3VWJC 2YZ1A 4FMKA 1JF5A 2FWOB 4PTUB 5DRNB 2AP2A 1C5CL 2Z31A 2CH8A 5B39B 5D2LF 4RBPK 4JB9H 1BP3B 4MD5B 1LEKA 5JXEA 2G2RB 2R23B 4OCXL 4U3CA 4Q0XL 3JWDL 1F5WA 5MEOA 4KJQC 1B4JL 4WJ5B 4JQVC 5JIPA 1XGYL 1TMCA 3AM8A 4N0UE 1A7NH 5LWYL 4XAKE 2P8PB 3KYKL 5IIEA 1KTLB 1A4KB 4KHTL 1MJ7H 4HKJA 1CFVL 3D39B 1IQDA 4PJ8B 2AK1H 2Q1EA 3CK0L 4XXDB 2W0FA 3QJHA 5GSRA 5TDOA 5EZIL 3U6RA 1FAIH 2ENSA 2DRUA 4LSQH 2C3VA 4HXAH 1AP2A 4PJEF 2MJWA 3I75B 3UO1H 5HHOE 1KJVA 5HPMA 1NBVH