5J6HA

Recognition of the mhc class ib molecule h2-q10 by the natural killer cell receptor ly49c
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
276
structure length
275
Chain Sequence
GSHSMRYFETSVSRPGLGEPRFIIVGYVDDTQFVRFDSDAETPRMEPRAPWMEQEGPEYWERETQRAKGNEQSFHVSLRTLLGYYNQSESGSHTIQWMYGCKVGSDGRFLRGYLQYAYDGRDYIALNEDLKTWTAADVAAIITRRKWEQAGAAEYYRAYLEAECVEWLLRYLELGKETLLRTDPPKTHVTHHPGEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, Q10 alpha chain
publication title Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
pubmed doi rcsb
source organism Mus musculus
total genus 70
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2016-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j6hA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5j6hA01
1P6FA 4IOIB 5FHBH 4R96A 3AS1A 5D72L 4KPHH 3T0WA 4POUB 3BP4A 3G6DL 4Y5XB 1N5YH 2X41A 4NZDA 4LSVL 5HGHB 2DMBA 1FO0H 4NQDA 2JTDA 4KROB 4JB9H 2CDFA 3BP7A 3K74B 4J12A 1NAKL 3EOBA 5T3XD 1V7NL 1MEXH 1RFDL 3S7GA 3UYRH 2F53E 2E3VA 5I15L 4QHLB 1MFBH 4MNHA 4M62H 4XP1H 1Z9LA 5JDSB 1KOAA 4NO0D 1L8JA 3WO3B 4HULB 1SJEA 4HKXA 2R8SL 5H35A 2AEQH 3ZDZE 4XHJC 4WJ5A 3W9EA 4FZEL 4DEPB 5HDQH 1OB1A 3V6FB 4MHHI 3U2SA 1YN7B 1G6RA 4O9HL 4S0TD 4S1RL 2DQUL 4EN3C 3HRPA 4OLYL 1OTTC 4FFZL 3GMLA 2QKIB 3NAAL 1JMZA 2W9EH 3UXFA 1UFUA 1KJMB 4M1CC 1DQTA 5DI8B 2MQ0A 1XMWA 3ARDC 3CXDH 4XPGL 4AL8H 3L3OB 4OD2A 2XT1B 3QUMA 4ZSOB 3VGEA 2EO1A 3LN9A 3TYFA 1T03L 4DWHA 1F6LL 4NQED 5ICZA 1JL8A 2FO4B 1KJ2L 3VD3A 4KK5D 2DQGH 3QWOA 1RJZB 4AEEA 4F15B 5TDNA 4BM7A 1MAJA 2AXFA 1JHKL 2B1AH 3RWJB 1D5IL 5FGCB 4BQ9A 1HOCB 2OMNA 4DW2L 3MMEA 1BVZA 1X5JA 1UJ3B 2Y7QA 3ZKXB 1OCWL 2F53D 3DXAE 3FT2B 5ALBH 4R97C 3VWKB 1SQ2N 2VLJA 5I1KL 1CS6A 2DBJA 5I19L 1JZ8A 4JFEB 3AXLA 2BP3A 5C6WH 8FABA 1SM3L 2VOTA 3TNMB 1G7IB 3I50L 5DD6A 4KK6D 5FUOL 3NZHH 4ETQB 4QTIL 4GAJL 1MNUH 5GJSH 1UT9A 1XH3B 5DK0B 3DSNA 3RUGE 3QUXD 1RQ5A 2BNRE 2IMNA 3QQ9D 4S1SH 5ECJE 1A7PL 1A7OL 4KJQC 5GGSB 2XQYK 5H2BA 5DJYA 2VZ3A 3MGTA 3VXRE 3BQUC 4NC0B 4QRTB 5C71A 5JPNA 3PWVA 5I73B 4OGYH 5L2JA 4NO0A 4GT7A 1MJUH 5MERB 4PLKC 1X7QB 4ZUWB 2H9GA 4Z7VA 4MB5A 4OCXL 3CU1A 3U9UB 3UO1H 2ENSA 2FO1A 4U6HA 4NT6A 1W72B 3FO0L 2UYLA 4C83A 4WFGD 1BZ9B 1D7FA 1F90L 3CK0L 3ZKND 3ZLQC 4UNVA 4Z7OF 3KPOA 4P9HL 2DMKA 2FBJH 2E6JA 2DN7A 4JR9H 3RVVC 5BV7C 4GRLD 4OGXH 4OLUL 4JFOB 1DUYA 5EU6E 4V1DB 3WO4C 2NY5L 1A6ZB 4TSCL 3T0VA 2R4RL 5ITBH 3SDYH 5GSVB 1GVIA 1DBKL 5FUZH 1DBJH 1DBMH 3BXNA 1YEJH 3VGDA 5JR1L 4RAUB 4R6UA 1JIBA 4NRZB 3H42L 5EU3B 1NCWL 4NQEA 2HN7B 1UH2A 3G6JB 5TF1L 3TZVD 2Y5EA 2W65A 1UM5H 1IVLA 5E5RB 3VGAB 4MD4A 5C09E 2ICWI 5EZIL 3KJ4C 5CKAA 3EJZD 2V2XA 1RUPH 2F53A 5GS1B 3QR2A 4TTDD 4WY7L 2ATKA 5E2WL 1NSNH 3QNZA 4DTGL 5FOBB 3BD3A 2VAAB 1JPST 4NKDB 1UM6H 1OGAE 4Z7VF 4Z0XB 5TQ2L 3VFWB 4C56E 1RIHL 1E4WL 3EUUA 7FABH 3IU3A 3QUXA 1JGEA 3GSWA 3H7BB 1PYWB 4I13B 2ARJA 5KZCD 1KJ2A 2VERN 4E0RB 1J1OH 3GSNL 1S7SA 3O3UN 2DIJA 2H32B 3BHBA 1L9MA 3L7EB 4F9LA 2VDLL 4HCRH 4M7LT 4HGWA 3RVUC 4HQQL 4KHXH 4H0IA 1QLRB 5DSCA 4JY5H 4HK0A 2YD4A 4OZIB 3TN0B 3UTSB 5A2KH 3W9DA 5A40E 5T33H 2FEDC 5E94B 1K4CA 4Z78B 3B4NA 1XF5A 1KJVA 3BWAB 2FSEA 1A4KA 1WWCA 4I0PB 4Q74A 3GMPA 3NA9L 1U3HA 1IMHC 4I9WD 5CIPA 5I1HL 1CU4L 1H3PH 3QFJD 4GRLA 2DJ4A 3U1SL 2R4SH 3A67H 1NUDA 2J8UE 4PJ8D 5K9OB 1JI1A 2RCSH 4ZS7H 4IDJH 1BEYH 1H8OA 1TNMA 5DJXB 3RFZC 4D0CB 4HWUA 4J3XA 1TQBC 2DJSA 3BESR 1A8JH 1P6AB 4HX1A 5LGJB 3ZDZF 1OGAD 2WINA 4MWFB 4C4KT 5CJXA 4LSQL 3TZVA 2BY3A 3TVMD 4QXTA 3ARFB 5C0FA 4AT6A 5FB8B 4XRCA 1JTPA 1DUZB 3DRQB 3EOAB 4X4ME 4XP9L 2QSCH 1K9TA 5JHDE 1FVCB 1FC2D 1WWWX 4PIRF 1FZOA 2CPCA 3QIBB 4GKSB 4QHUB 1DN0A 1FZKB 3BAEH 2QBWA 4HJJH 5I16B 4XAKD 2JB6A 2XZZA 5EB9A 4ZAKB 1MWAH 2EIBA 5EN2B 4HUXB 3MOAH 4YHZL 4PJAB 5FA4B 1IC4H 1QLEH 1S7QA 1FH5L 1U8KA 4X8JB 3IVKA 3ALWA 1TVHB 1W0VB 2R15A 4DVRL 4H1LB 3F8UB 2DL9A 2NTSP 3BKYL 5IR1B 3HG1D 2F54E 3C9NB 2Y4SA 1T7YA 4JG1H 4EI5C 2ADGB 2VUOA 5E9DE 4G6AC 1IFHH 4L8BB 4PBWD 1G6VK 3AREB 2CUHA 2LV4A 4U1LA 5F3HB 1OAXL 3P4LA 4UB0L 4WI9A 4A6YB 1JCKA 3EYOB 4YZFE 1U8HB 1F3RB 5C0BE 2PO6C 3I6LE 1KC5H 3LAFA 4Y5YC 5IVZA 2Z8RA 5DMYA 4OF8A 3VRIB 3C5SB 2XTJE 1A7RL 4X8XA 2P5ED 4Y89A 5C9JB 4P2OD 3O3BA 3QO1B 4FQQB 4ZFFB 1U8OB 2B1HH 3MLXH 5L88H 5IEKA 5C0ND 3LOWA 4YR6B 3NGBB 4NNXB 2PXYC 1HHHA 4WFEE 1KIUA 3BYTA 1I8KB 1T2XA 1N0XH 3A6CH 5C09A 2P8PB 3QFJA 3K8LA 1RZFH 1RUAH 3MRLA 1G7LB 4HJ0C 5IKCB 2VISB 4PJ8A 5FA3A 2BSTA 4PY8J 3KLDA 2UWEB 1I85A 3JV4A 3GSNA 4CVZB 4DAGL 1EAJA 3QUZD 3SE4C 4G42A 4AMKL 5JMOC 2X4QB 3PNWA 1F2XK 4GXVL 2CJUL 2VLKE 2X4NA 4YIQB 4L8CA 4N8PA 3QIWC 5EZLA 3KPPB 3D6GA 1OGAA 1AIFA 5CINL 3VI3E 1NAML 4NWTL 1J1XH 3MRBB 3OMZA 3TVMA 2DD8H 4GFTB 3VG0H 4AEIH 5DZOA 3O8XD 2DI8A 3VXNA 4XGZB 2HG5B 2XRAL 2ZUTA 4MXVF 3ROOB 4OZFH 2IH3B 3BE1H 1RI8A 1DL7L 3QDAA 3GSOA 4YNYA 5LKNA 1RUML 4XI5C 1OAQL 4JQXC 2W07A 4YBQD 3TFKC 5F7UA 3QCUL 1R3HA 1T3FA 4R9HA 5C0BD 1S5HB 1CLZL 1TTUA 1FL6B 5TH2B 2NX5D 5JW5A 4IJ3C 1GC1C 1BQLL 1EK3A 3RI5K 1MQKL 2XTJD 4NKMB 1AXSA 1Q0XL 1ZT1A 3T3PF 5EA0L 4QEGA 3EHBD 1UYWL 4K3DL 4U7MA 1M71B 3HG1A 3O0RL 1KN2H 5F8QC 4Z7UA 4LIQH 4WFED 3EOYG 3WJJA 3WUWB 3WXWH 2UY7A 2H26B 3P11H 4A6YH 3S4SB 1JF6A 1J10A 4HMEA 5IGXL 3LH2L 4A2LA 3ARGD 2VLKD 4DKFL 2QHRH 2JJUA 2P5EA 3VFUB 4F9PC 1Q9OB 4M61A 4P2OA 1LD9B 5D1ZC 1NH6A 4AENA 3BEVA 1C12A 3IETB 4MNGE 5SX5K 4KXZH 1MI5E 4PJ9B 4NM8L 4G9FE 2VLLB 1HHGA 2ZPKL 4GW5B 1QPXA 3KDMA 3CSPA 3Q48A 3LD8B 3NABH 3MV7B 1QYGH 3HPLB 4JVWA 4X4MA 2NZ9C 2AJ3B 4PLNC 1JPSL 4LKXA 1NPUA 3RWFA 4JDZB 2QADD 4JPWL 5DUBA 4LRIC 1RVFH 2YZ8A 1T22A 4LSPL 4I4WA 4D8PB 3SPVB 3QUZA 4BA8A 3RBGA 1CICD 1WBXA 4DZ8A 1EEYB 2R56H 2BDNL 5D93B 4NNYA 1U36A 2HJLB 1A5FL 1URLA 4PJ7A 2IGFH 5KSBE 4MHHG 4HUUB 4OGZA 4MJIB 4FFVD 3MV01 4DN3L 4M7LL 3S88H 1HYRC 1GRWA 1DQJB 1OSPL 4KK8C 3O8XA 1OAKH 4RMQA 3L6FB 4Z7UF 5I66A 3PP3H 2J88H 1LDPH 3MFGB 3KS0J 3M17A 2JF1A 3TO4C 2DWDA 4LEOB 5C0BA 1NGQL 4PR5A 2NX5A 2ZKHH 4J3UA 3CFCL 3O9WC 1ZT4B 4M6AA 1CTNA 2A6KB 4WENB 4DQOL 3GZKA 2CRMA 3FQUA 4NOFA 4EVNA 1MI5D 1T0NA 1NAMA 4G9FD 1S7UB 3S36L 3O45B 3HI5H 1NL0L 5IEHB 1ZVSA 1GH7A 2X44D 4JHAL 3PWNB 2UUDK 4NUGL 1JZ4A 3CMGA 4CMMA 1KLUB 3MRFA 1E4KC 4JFZH 4YPGA 1ZHKA 2A9NL 1ORSB 2B2XL 5ADOL 4R4ND 1WZ1L 4X5WB 3IF1A 5EC2A 1BVLA 2SEBA 1MHEA 4HT1H 4Q6IB 4KH2A 1I8LA 1QA9A 2OXHA 3ARGA 2VLKA 3GNML 2X42A 1X5KA 3GMRB 5B3JF 4AK1A 1N0LA 1PZ5A 4PRHE 5INCA 3ZDYE 2V9RA 3EFFA 1A2YA 1MIMH 4PJ7F 4ESKA 3DSFL 3LEVL 3RWHB 1IAKA 2A0LC 4LCWD 3A6BL 3WDJA 5EOCL 4HDIA 4XHQA 3SDAD 4LCUA 2D31A 4TUOB 4NPYA 1BWWA 2FLBT 1JRHH 4EDXB 4U1HA 1UB5A 2XYCA 4HZLB 5FKPA 2EO9A 3QNXA 3H6JA 3ILQD 4NQSB 3ES6B 3MBEB 2O61B 2A73A 2N7BA 3MO1A 4HH9A 4MJ5A 2XZAH 1TCRB 3UC0H 2C1PA 3EYUL 5I1JH 2DQDL 5H37H 2HYMA 2E9BA 4X7CC 4MA3A 1CFQB 5LGHH 1Z3GL 2IAMB 1MREH 1G7JA 4U6XB 4LRNH 3DHJA 4EDWH 3K1KC 1CGUA 4Y2DB 5T1KB 5BQ7B 3FHQA 3L3JA 4U0QB 1C1EL 3RWEA 1ONQA 1XCQB 1B6DA 4XNZC 4FFYH 2RIKA 2XG5A 4P3WA 3I6GB 2X4SA 1OQXA 4ZNEA 2J8OA 2VR9A 3RWDB 5CSZA 4XCYB 1LP9E 3VGFA 1YEDA 3QISA 5JORB 3CX5J 3QYCA 4UQ3B 4P3CL 1NCTA 3AS3A 3D85D 3BH8A 1CVRA 3VI3F 2BSED 2PYFB 1B2WL 2GFBB 1JI2A 2DDQL 4FTVD 4BK4A 5EO9B 4W6XB 4MNGA 1MI5A 5CGMA 4G9FA 3UTTE 2AQ2A 2ZSWA 4URTB 5ISZE 2ADIA 3HMXH 4OJFH 1YQVH 3RP1A 4JPKL 2JCCB 4RAHA 3V7AG 1CQYA 5JPMB 2YS4A 3QPXL 4XHJD 5D2NC 3CFJA 2ITCA 3FKUS 4WI3A 5F89A 2X1OA 1BECA 3S35L 1CFSB 4EN3D 4QT5A 4F57H 1OTTD 4QHMA 5HYSA 2XY1A 2XKNB 1INDH 3VFVA 2LAGB 5FGRA 5KS9B 4EBQH 4M1CD 5C0RH 4NHUB 4R0LC 3I85A 1UA6L 3T77B 2XV6B 3ARDD 2V7NB 3GB7B 1NCDH 3GBNL 3BPCA 4LCWA 3QO0A 1KG0B 4RIRB 2DICA 5CP7A 3SDAA 3CH1B 3OKLA 4L4VB 2XN9B 2CKBH 3ILPB 2YD8A 2OR9L 4YEFA 2WUCL 3ZDXF 3QRFM 1NFIB 4XP4H 4LU5L 2YEZB 2BNQD 3BOVA 5E08L 3K2UH 3N1GC 1EGJH 1R24A 4QRRD 4P5KA 1CBVH 4PJIB 1A1MB 5CP3H 1HKFA 5T3ZE 3BP5A 2Y72A 1NDGA 1CXKA 3PHSA 2YOCA 4TUJA 5HYFA 3TT1H 1MLBB 3W2DL 2F5BH 2P24B 2CIIB 2C7UB 1VFBA 5GS2D 5IG7A 3M07A 4XPHL 4KKLC 2A6IB 1EHAA 2ENYA 4YHLH 3K0WA 5IVXE 5IBUB 5CEYA 3UP1A 3DUSB 1DR9A 1CE6A 4R7DB 3RAJH 4N5EC 1TJHL 1XFPA 3DGGA 3LKQA 4HUWA 2R2BA 2YK1H 4XCFL 2YBRA 1LQSR 5BV7L 5BZDB 2DYPD 4X9HA 2ORBH 4KJQD 1EEZB 3AM8C 3DYMA 3WHE1 3VXTB 3ZL4L 4XMKH 1P2CA 1MFDL 1MCEA 3D18A 4O2CA 4GBXB 3IAQA 3BQUD 1BD2B 1LEIB 5D7IA 4KHTH 4PRHA 3D85A 3B9KC 4FTVA 4YFDB 1G1CA 4UDTB 4DN4L 2APXA 3MSPA 1Y18A 4G9DB 5IMOB 4PLKD 1AD9A 2CQVA 3RDTC 1W8OA 3L3HA 4K23H 4N90E 2K1MA 5E8OA 3MLUH 1DLFH 5CKGA 1IEAB 3HNVH 2Q86B 4NNPL 1KCUL 2K9UA 1BBDH 4K3HA 5D1XC 5LWYH 3SDXB 4EN3A 3O41B 3VGGA 43C9A 4B53A 3RVVD 1XGYH 1R3JA 3DYOA 3KYMA 4M1DL 3OG4B 5SWZD 5DD1L 4OKDA 5FM8A 3UBXB 3AFLA 4MCZA 2OTUB 4ZD3H 5D7JC 2L7UA 3ULVH 5IESL 3ARDA 4Y4KB 1RIVL 1SBSH 3MACL 3S6CA 1I7ZA 1I8MB 1JGLL 3T0BA 1FGNH 1CFBA 3B6SB 3EFDL 4RDQF 4PGZA 3M1BB 4NQXB 5D4QA 1J1PL 4M6NH 4MQTB 1RMFH 5AYUH 1KF9B 4G8GE 4FZ8L 3PHOA 4PUBH 4WI8A 2OX5A 3GJFA 4JGJA 4QRRA 4G8IA 4NN5C 5CJOL 1OF2A 1RZJH 3X13A 1DQML 3MCLL 1RU9L 2HT3C 2APTA 1S9KC 5TFSH 1F8TH 1A6TA 1BP3B 2WBJB 1CL7I 1OM3L 1FRGH 5D7IF 3G5ZA 4WCYH 5FYJE 4O51A 5I8OL 2GY5A 3HUJA 4QHNA 5ESAA 1DQQA 4LBEB 5DQ9A 5D8JL 5GGTA 5DR5L 1PDKA 3SE3C 3FO1B 5DEGA 3BP4B 4R2GB 1L7TH 3PGDA 4WRLA 2NMSA 4HUMB 4CRPA 3HR5B 2W0LA 4W4OC 4UT9H 2CDFB 2DYPA 2VQTA 1NGXA 4OTXH 3UMTA 1MHHB 1NCAL 4P2QB 4PRAA 5EBMB 3C08L 1N3NA 4PP1C 3H8NA 1U92A 3DARA 3OKKB 2X9XA 3BQUA 1KEGL 2DAVA 2PUQT 4MA7H 4I3RL 3IDJB 3MRGA 3RVUD 1FG2B 1G7MA 12E8L 3MA9L 5DGQA 3R1GH 4LCCC 2FEDD 1UZ6F 4FXKA 3H3PL 1MHPL 1YMME 1OB1B 2Z31B 3QUYA 1WCQA 1F3DH 4IRSB 4XTRC 4MNQD 2J6EL 3T09A 3W39A 1OQOA 1TZIB 3LRSA 2JB5L 3LEYL 4XCNB 3F12B 4XT1C 3LRGA 4LGPB 5FIEA 3FJTA 4M3KB 3HNSL 1NBVH 5SWZA 2AEIT 4MJ6A 1X5XA 3X11A 3MLYL 3BUYB 4HF5H 3BKCL 3J7HA 4YLQT 1JP5A 3HE7C 3SDDB 4B7IA 5DHXB 4OD2B 1ZA3A 4KRNA 2VZUA 4NCC1 4NUJA 1WBYA 4DGIL 4U1KB 3GBML 3HUJF 2ZZUT 3ALXA 4NQVA 4P57B 1ZMYA 3IJYA 3VFRB 4UNTA 4WNQA 5GISL 5J8OA 1XGUA 3F5WB 2C4XA 3QWOB 5DJ0A 1YPZA 2QR0B 4KDTC 4QKXB 3U9PH 3SGEI 3G5XA 4MLIA 2C3VB 5TE7L 2OJEB 4MMZC 1U6AL 3VCLA 4G6ML 1NCUA 2QQNL 3TBYB 1LO5A 3TM6A 3KPRB 3D9AH 1FJ1A 5SX4I 3IDMB 1TZGH 5E7BA 1HILB 4NRXA 3BVNB 1FFNA 5T5FH 5I74B 1NDMB 2HA1A 4XZUA 1NC4B 3V4VH 1BX2A 4HFUH 3W0WE 1H5BC 2Q6WB 1XF2A 4OF6A 3QUKA 3WIFA 4XNXH 1BGXL 5F1IB 4EI5D 1N4XL 3PWVB 2ERJB 4G6AD 3WS3A 3L9RA 4KK9C 4ODSH 4G6KL 2CRIA 4X80H 2FX9L 4AM0A 4PY7A 3STLA 4TNWF 5HJ3B 5L7XL 3PGCA 1XT5A 2H9GB 2PO6D 2W9DL 3HZMB 5JXAH 3MX0A 4M43L 1WFNA 2O5ZL 3V0VA 1S7WB 1QHPA 4G8FB 1TIUA 2BK8A 3KLAB 4YDJB 4C83B 5JQHC 4KGLA 1HZHH 2R9HC 4G8GA 1NFDE 7CGTA 1FLTX 4PS4H 4PJEE 1ZHNA 4MNQA 1YPZF 5HHME 2NLJB 5TDOA 3E0GA 3ZMRA 5IOPB 2PXYD 2I24N 3L5XH 4Z6AT 2EE6A 4JPIA 5HHOE 4R26L 4HJ0D 2BSSA 4X98A 5D7LD 4NO3A 2NCMA 2YRLA 5CZXC 4RZCB 3VD7A 1SEBA 1BQHB 3FT4B 1GC1L 4HUVB 4Z8FL 2W59A 5DRXA 4OKVA 3IKCB 3MXWL 4BUHA 4F7PB 1RHFA 3WFBH 3BI9X 5BRZE 4WI2A 4FMFA 4PTTB 4F80A 3MBXL 4UIKL 3RJQB 3QIWD 5EIVA 2W65B 3ECBA 2OM5A 3WHXA 4U0RB 5I1LB 4YHIA 1MCRA 2MCPL 3W0WD 4KROC 1E27B 1MFCL 4UTBL 3TIDA 4X4ZA 2YUZA 4HIHA 2FATH 1A7QL 3ZT5A 5CEZE 1CZ8L 3DO3A 4XVTL 2J6EA 1QO3B 1KTRL 3QHFH 1KPRA 1QFWI 2XZCH 3RGHA 5FO7A 4RFOL 1R3KA 3AU1A 5E1AB 3QNZB 3C2AL 5CBAB 1OHQA 4XI5D 1JTTA 3FCTA 3ZZ1A 3TFKD 1XGTB 1F2QA 2V6HA 1ZSDB 1FYTB 5DWUH 1H3TA 3VA6A 4DEPC 3BP6A 5EUOA 2GIYA 3HI6L 2VDMH 1DLHB 5I0DA 5FYKL 1GHFH 4X6CE 2IH1A 2X4OB 3CLEH 4R90H 4Y5VB 3WD5L 1DSFH 4CADB 2DBLL 5CEZL 1OP3K 2E9WA 3AY4C 5HHMD 3BHBB 4KVCH 2HWZH 2EDEA 4EI5A 5GRUL 1VGKB 1JV5A 1WBZA 1Y6NR 4F7TA 1EV2E 3RL2A 2WY3A 5LBSL 4LSTH 5ANME 4K2UL 4HEPG 3BD4A 4M5YL 4M6MH 4MXWL 3FQNB 15C8L 1JGUL 2AJUH 3IYLW 3NIFF 2PO6A 3UPAA 3MRQA 3DX6B 4X6BB 4Y5YA 4LVOB 3GMMB 2D03L 3CX2A 4JO2H 1C5DB 5CWSB 4OQTL 4F15C 6CGTA 3GMPB 5KVEL 3BPLC 4M8QA 5D1ZD 1Y0LB 5JMRA 1EZVY 2AK1H 1IARB 4F3FB 3BX7C 5FYKD 4GRLB 4AH2A 4YDVA 4PJBE 3UAJC 2PXYA 5D9SB 1UJ3C 4OUUA 1TZHB 3VWKC 5CEZD 3N06B 2NZ9D 1OD9A 5D7LA 1AGBA 3CMOH 3O3DB 2VDOH 5GXBB 2KZWA 3KG5A 3HC4L 5IB5A 5FYKU 3FMGH 4RGOL 4M9PA 2AKRB 5MI0B 5IJVA 5JXEC 1QSFE 2G2RB 4QXGL 3SE4A 2MHAB 5JQ6H 3NH7L 4TNVF 3NFPB 1PGRB 1BOGA 1J18A 1BAFH 5F88B 2YPVL 1WVZA 1J8HB 3QIWA 2CK2A 3TZVB 1JMXA 3D1MC 5EUOF 5EIIA 3EBAA 4QXTB 2F8XC 3W0WA 2OZ4A 1JNLH 5IBLC 3U7WH 5DVKA 4KK8D 5K9JL 4RQQB 1FZOB 2HMIC 2VDQL 5FUCE 3X12B 1KTDA 3WFCL 1NLDL 3VU2A 1S8DB 3TO4D 1HXMA 1A6AA 1KIQA 5C07D 1K8IA 4JRXB 2K7PA 4IRJA 4JQXA 2FHBA 4TRPH 3TFKA 4KKCC 2GK0B 3DGCR 4V2CB 1P4LB 5EBWB 1S7QB 4POYA 4DCQA 2EXYC 3Q3GB 3GSUA 5IVNA 1F00I 4NGHH 3O9WD 2WM0A 1A6WL 1HQRA 1IGCH 1ZXQA 4HKBA 3O6KH 3FFCD 4JFYB 4WEUD 1IE5A 1QBBA 1N26A 2J8HA 2AABH 4XP5L 4LASH 4MQ7B 1NFDA 4RGMB 4YDIH 4X99B 2G75A 5HHMA 2YRZA 1P7KA 3VXSE 1JWMA 4HHAA 5L2KE 1F4AA 4OCNC 5HHOA 4OIAA 1IKFL 3OSKA 1I4FB 2E6PA 4ZPTA 1JZ2A 4P59L 1KCVL 1X4ZA 5EWIL 4M5ZH 3DV6A 2NYYC 3T8XB 4E42B 1QSFD 1AI1L 1YYLH 2VDNL 3MLZL 4UIMB 3OJDA 5M7QA 3X17A 3SJVE 5IFHH 6FABL 5IEKB 4OZGB 4F9PA 2Y1VA 3VGAC 5D1ZA 2BVOB 2VITB 1A3RL 1KJ3H 2HKHL 4X6DA 5I75C 5KW9L 1E28B 2A0LD 3WBDA 4HKJA 3TBTA 2OL3L 2V7HB 1PKQE 4NKIL 4PJ8B 5KSUA 3FB5B 5C8JB 2BSTB 5GS1C 5IHUL 3HR6A 3RBSA 1ZVHA 2PTTA 2PKDA 4WU5B 3S37H 1RK0A 1UVQA 3I2CL 3AVEA 3O6MH 5IB3A 1HWGB 2ED7A 4FQ2L 4DVBB 1J0KA 4LRIA 1DJSA 3PNWB 3QEGL 2M8XA 3TIEB 4DZBB 4BUGA 3H9SD 3DRTA 5ITFA 4KTDH 1JNHB 2CDGB 3SGDH 4X6CA 3TVMB 3BZEA 4K94H 5DVNA 5JHLH 1FZMB 4PBXA 4OQTA 1UWEL 1NFDF 3N9GL 3Q1SL 4AEHH 1YY9C 4MDIA 3SY0B 5A16A 3VXSD 3ROLA 2NW3A 4KRPB 3V52H 2BSRA 1JVKA 1KIRA 1C16B 1NMAH 5EOTB 3OR7B 1K2DB 2HH0H 3TN0C 4EKXA 5ANMA 3TO4A 5C07A 5AWNL 4TOYL 2VXQH 3QIUB 1HDMA 2VLRD 4BH8B 5C7XL 1FVEA 4PGDA 4YWGH 4OCRH 5IV2A 3DROA 4I0PC 3SJVD 5EORH 3U0WL 4L5FL 2VUYA 1F4XL 4ONHA 2BHUA 3HG1B 3O2DH 2Q8AL 5C3LD 2JE8A 4P4RA 3TWCL 2C1OA 4X6DF 3SKNA 1C08B 4K9EH 5C0DB 3LY6A 4PREB 1JPTL 3G5YB 3ZTJH 3QG7L 4TVPL 2AK4B 2P45B 5DMIH 5GGRY 4LOUC 1QSFA 3PL6B 2Y25A 2P5EB 4M61B 3DVGA 2HKFH 4ODUA 1WEJL 4PB0L 3VFMA 4NQCD 3MRCB 1G9MH 2CLVB 4P2RD 4TSBL 2DTMH 1HHGB 4X6CF 4GRMB 3RY4A 1U58B 2ZOKB 1MHCA 3D69B 4UV7L 4XP6H 1YC7A 4H88H 2W0FB 4M1GL 3O6LH 3KYOA 5CUSL 3BIBX 1E6OL 2PR4H 5DUBB 3SBWC 4BSVB 2I27N 3FO9B 4C58B 4ZAKC 1PVHA 5J13B 1OT1A 4Q2ZA 1LK3H 2R0ZH 4LHUD 2Y07L 2R1YA 4NNYB 2XWJA 3H9SA 1FL5A 4Y16B 3RVTC 1RK1A 4Y19E 4TVPD 2X9YA 3INUH 1PG7X 2X1QA 1KTLB 2YXMA 3VH8G 1CDUA 4WFHE 3VD9A 3VFOB 4LKCA 4KKLD 3V4UH 3MNWA 3HC3L 5FDYA 4OM0L 3AREC 4CJ0A 3VXSA 3LN5B 2BC4A 4RWYL 2HFFA 1QSEE 1T1XA 1PY9A 2OL3A 1ETZA 4RWHA 1JYNA 2VL5A 3H9ZA 2PYEB 3ZT6A 2VRAA 4N5ED 4QF1A 1LHZA 2MPAH 2NX5B 4I3SH 2ESVB 5EZOL 3D25A 2Y36H 1GOFA 3TNNA 2VLRA 2ZJSL 3ARBB 5CJQH 4NBZB 5DEZA 4KJYB 4IRZH 3SJVA 4OI8A 2BHZA 3SGJC 1N8ZB 5E8EA 4NFCA 5HDLA 4XNUL 4Q9QH 3NGBC 1GPOL 4MAUL 4FFWC 3B9KD 2W0PA 2AJZB 1HSBB 5DD0H 5IIEA 1MVUB 4CMMB 2DLEA 4RRPA 4YPGB 3RDTD 1P4IL 2EC9T 3L95A 5D2NA 4MSWB 5I9QC 1NGYA 1UEYA 4G8EB 4TPRL 4AG4H 5T1LD 5D1XD 2APWA 2GUOA 3OXSB 1QBMH 4Y19D 1AFVH 3QFDA 5I1CL 5INCB 4GW1B 1JF1A 5EBGA 3L5HA 1T21B 3I75A 4NQCA 1CT8B 4YO0A 5KSAC 1IAKB 4P2RA 1MCSA 5E8DL 4R0LA 5D7JD 4JKLA 4FQPA 4DOHE 4R8WL 4XVJL 3QEQE 1BJ1J 4PV9B 4RA3A 1U95A 2ZP0T 4U1HB 4KZDH 3W82A 3QNXB 4H0HB 3C09B 3KWWA 4O5LH 4LLMA 3G6AB 4X9GA 4LHJB 1WAAE 4U6VH 2R0KL 2GTZA 2EE2A 1E0OB 3DOSA 4JO4L 1CICB 3GMQB 1RUKL 4LHUA 5D1QB 2W60B 5IJKC 2LQRA 4F7CA 4L4TE 4Z7QE 2P47B 1OD7A 4MD0A 2Q76B 4BFIA 1IT9H 4P2YA 3MV11 3IDNB 2HT3D 4N0CC 4UOJA 5MEPA 1K3IA 3N1FC 3GFUA 3ABZA 4CNIA 4M6OH 5EPMA 4YK4B 4Z0BH 3KPSE 4WI6A 4C4KO 5GGSY 4FFEX 1F02I 1VSCA 1K4DA 4JFPB 5F93C 5F21B 5DD3H 1ONQB 3OHXA 2PN5A 5C0IB 4NO5B 3UJIH 1RURH 4NZRL 3J8F7 3SE8L 3ULUH 4N5EA 4O2FB 3IXTA 4M7JL 4JY4B 1JNNL 3BH9B 2FD6H 5KSVA 2P8MB 4XMLH 1X5AA 3AM8A 1NMCB 2X2YA 1MLCB 2X4TA 4PP1D 3L5WB 3FT3A 2WMPA 1I3GL 1BF2A 4N0FB 4Q9RH 3LKRB 5I1EL 2IG2H 2H3NB 3B9KA 3LD8C 4BSWB 2ZSWB 5IB2B 1WTLA 3P9WB 1LO2H 4U1SA 4X6FB 3DV4A 5FHBL 4Z77B 4KPHL 3RDTA 1N5YL 3FB8B 4M00A 1HNGA 3RTQB 1FO0L 4JB9L 2NXZB 3X3GH 3IDGA 2OSLA 4JKWA 5I30H 4XTRD 5IT2H 4QHMB 1MEXL 5D93C 2I60H 4HUKB 2OBGA 5T1LA 5HYSB 2BVQA 3PF2A 5KN5A 5D1XA 3UYRL 1IBGH 3U6RA 4M62L 2F8OA 4PP2A 4Y19A 3QRGH 3VDBA 1ERNA 5EOCJ 4QRSB 3X3FL 3CIQA 5B21A 1NCNA 3BPCB 3QJFB 2GJZB 5TDPB 2EDFA 5D7JA 4F7EA 3HE7D 4OZ4A 1G7HA 3SDAB 3H7LA 1FFOA 3OKLB 2YD5A 5H94B 3UDWC 4GKNA 3O6FB 4ETYA 5KG9A 1HYSC 4IS6B 5KTEH 2EIZA 4IHOA 5HPOA 2Z35A 5J1TC 3IDUA 1QRNB 5DYOB 1AQKH 5K9KB 3V6BR 2Y23A 3B8YA 2ZNXA 4G80A 4QY8A 3FQWB 2HTKC 3DI2B 4PJDB 5JA9A 1INQA 3TCXA 3ZKSD 3CXDL 3LPGA 3RIFK 4QHKJ 4D9LH 1VFBB 1FV1B 1UXSA 4DKEH 5GRXG 2GITB 3CSYB 4AL8L 1BBJB 1IGFL 3CFBA 4JFFD 1F58L 4NHCL 3K8KA 4YX2H 1UCBH 5ID0B 3T0EB 2XA8H 1QLFA 5IF0A 2EDHA 1CXHA 3NFNA 1BFTA 1B0GB 4LARL 5HD8C 1IQWL 1CE6B 3SE3A 2DQGL 2VIRB 2QEJA 3SEPA 3VWJC 4CW1A 1B0RB 4V3EB 3DGGB 2R2BB 4JFXA 3P9LB 1QHOA 5D2LB 3CDFA 4HJGB 4GSDL 4OCLC 5E2UH 1CXEA 1PQZA 2B1AL 4Q6IC 2MTPA 5JUEH 4W4OA 3BISA 2P7TB 2FYYA 4JFDD 4XBPB 5D70L 1P2CB 4XBGB 1FORH 3GSXB 1R5VB 2XNAA 3GMNA 5F1NA 4KY1H 4UQ2A 5ALBL 2AEWA 4KKBC 4MAYB 5E6YA 3HAEB 5B39G 2BFVH 4UAOB 1IGTA 4OGAC 5DHYA 5TQ0H 1RZGA 4FTVB 4XMPH 4NFBA 4GG6F 43CAB 4KK9D 4OF7A 5DTFB 1YEHL 3ARXA 3HMWL 3NZHL 1XGQA 4ELMB 3VFNA 1MNUL 5GJSL 4M48H 1M4KA 4LCCA 4GUPB 4ONGL 1OSZA 3NCJH 1LK2B 3PABA 2YA0A 1FNGA 3STZB 3MBEC 4S1SL 3QA3A 5J6GA 2PW1A 2BZDA 2R9HD 5A43C 4HS6A 3QXDA 2CR3A 2Q20A 1FGVH 4X7EC 5SX5H 4ZFGL 5M95B 1RZKH 4OGYL 3P3YA 1I9JH 3B2VH 1XR8A 2IAMC 1MJUL 1TITA 2CR6A 4KZEH 5CZXD 5CEXA 5LJYH 2AV1A 2CO6B 3HE7A 4OLVH 4Y2DC 1R0AH 2LABA 2Z93A 3UO1L 2BOCB 1SMOA 4ZSOE 3P73B 2XXMB 3R4DA 3VFTA 3GRWA 3FB6A 3WE6B 2CUIA 2BNQB 1DE4B 4X4YB 3GJFB 5IFJB 5IW1B 5ACMA 1DBBL 3UROR 3S34H 5FGCE 4KROD 2R2HB 1AR1C 4KDTA 3QULA 1FO0A 5ESVA 5ITBL 3RL1B 3M45A 4RFEB 5EG6C 1VFAB 5I1DA 5FUZL 4R97B 4HIEB 25C8H 4LLWB 1D5ZA 1DBML 3BMVA 4LPUA 1YEJL 4NO2B 1PZUB 4JFFA 1DQQB 5DQ9B 4I2XA 5I8CA 3JWDC 4KVNL 2CRYA 1CGVA 4LQFL 5B4MC 2JK5A 3DO7B 4JO1L 2P49B 4MZ2A 5ICXA 4PJXB 2XQBH 1OY3B 1ITBB 3P0VH 4LSSH 1LO0H 3DMMB 4ERSH 5INDA 4YHKH 5CCKL 4JFDA 3BGMB 3HAEH 5DJZB 1U8IB 1RUPL 3BQUB 4Z7QF 4HWZA 4KJPC 4XPAH 3VXOA 2KZ1B 4H8WH 3LN4B 5I1IH 1NSNL 2UUDH 2RFXB 4H26B 2IALA 3DVNA 1CDBA 3G5VB 1XIWB 5SV3A 4MJ2A 2FR4B 1DBAH 4PGBB 4OLZL 1UM6L 1VGEH 3PDOB 4TNWK 4WI7A 1DZBA 4XH2A 5D6DC 4KKNA 1QFWM 1BWMA 3N1MC 7FABL 3T4YA 2BHYA 2FWOB 4NYLA 1Q72L 2A2QT 2VYRE 2DI7A 1FL3A 4UUJB 1Q94B 4L3CA 3W39B 3CCHA 5I8EA 4TULH 4XWGH 1J1OL 1W8NA 2ARJQ 1ACZA 5AUMB 5BV7B 3VRJA 4V1DE 1MCPH 4YDLC 1RZJC 4HCRL 4ODXB 2X6MA 5SWZB 3UAJD 4MJ6B 3WO4B 1A4JA 1S7XB 4KHXL 1EA9C 4HK3N 3VWKD 3HFML 4F8TA 1YMHA 3OAUH 4YE4H 3U83A 1FNLA 5T33L 2DQFB 1KCKA 1QBLL 3S8WA 4JFED 1YA5A 5FAAA 5JXED 3IJYB 4QTHB 1E6JH 3G6JE 1P5UA 5I2IB 4IOIA 3ETBF 5C0GB 4JM4H 5HVHC 2FEEL 4Y5XA 1HWHB 4WVRA 5HGHA 2XXCB 1H3PL 3BKMH 5DK3A 1YN6A 2R4SL 1NMBH 5IBLD 4B50A 3RQ3A 4DGVH 4GBXC 2RCSL 5D7KD 4ZS7L 4UTAH 4WTZA 1JHTB 2W9LA 4IDJL 4QHLA 3JUZA 2HMID 1BEYL 1A9BB 1TXKA 4JPVL 5E2TL 5JDSA 1FJ1B 4CKVX 1I7UB 4NRXB 1OTSC 4JG0H 3MOBH 5JW3H 1FFNB 3HB3C 4KKCD 2I26N 4F58H 1EUTA 2EXYD 3TV3H 5E4IA 3V6FA 3HC0B 3ZT7A 1P84J 4LLDB 2EDNA 5HHQB 1ED3B 1YN7A 1N59B 3NZ8B 2QKIA 3AC0A 4H20L 3AY4A 4V1DD 2FDBP 1KJMA 4J3WA 3BAEL 4HGMA 5DI8A 2QLVB 4NWUL 3IDYC 4Y4KC 4OZIE 5EO0B 4ZMAT 4ZOCA 4XNQA 3UTSE 2YA2A 4Z95H 3LQMA 3L3OA 5JIPA 1GGIH 1O0VA 2QQKH 3T2PA 1T89C 1QLEL 4NZTL 4U1MA 4ZSOA 1NANI 2NYYD 2B5IB 3IGAB 2D2OA 3KLHC 5FECA 3P30H 1RJZA 4MNQB 3RU8H 3Q0HA 5TDOB 4JG1L 5K33A 3Q2CA 3EO1A 2X05A 9CGTA 1QUNA 2EEBA 2ICWJ 1UJTA 3MNVB 4JY6A 5E2VH 1HOCA 1IFHL 3SKOB 2WBJC 4X98B 5I71B 1UJ3A 32C2A 4RBPK 2D9CA 3FQRB 3FT2A 3VWKA 1FIEA 5C6PB 4YPJA 5GZOC 5DJDA 3OPZH 5IMLB 1KC5L 4WHDA 4KI1A 1A47A 4JFEA 3ARWA 3DIFB 3TNMA 1TQBB 5DJ6B 1G7IA 2EXWC 2DIAA 5EZJA 1KB5B 2FIRT 5JXEA 3N85L 4ETQA 3TCLA 1EMTL 4R2GC 4HMDA 2AJXL 1XH3A 1SYSB 5DK0A 5L88L 1WF5A 1V7MH 3PWPB 1S7RB 2H1PL 1GOHA 2NXYB 1N0XL 3A6CL 3KPQB 5GGSA 3TIDB 4V3DB 1RZFL 5HVFB 4P2CG 1YY9D 2JIXB 4LNRA 4OCWL 4LF3B 4XVUC 4QRTA 1T5WB 3OXRA 3MLTB 5FO7B 4P5MB 5HYQB 3AU1B 2BJMH 1UCTA 4HCRA 4ZO8A 3BRDA 4YAQB 4OV5A 2ICWB 3TN0D 3UTSD 4PJAE 3W11C 5MERA 4ZUWA 1J87A 2R69H 3NPSB 3BP6B 5EUOB 3U9UA 1N2RB 2Z31C 1IJ9A 1MIEH 1J1XL 3DUHA 1AH1A 1W72A 2CSPA 4MLSA 2DD8L 4IRSC 1Q9LB 1I1YB 4AEIL 5DRNB 4I0PD 4ZQKB 4GLRI 1L9NA 4KJWC 3H3KA 4JFOA 3OJVC 3BE1L 1VFOA 1KYOK 3HRZB 3LZFH 4V1DA 4GRWH 2NY3B 5C0EB 5F8RC 3RL2B 3QHZH 1IL1B 2GTWB 5GSVA 4XC1H 1CK0H 5KJRL 2VDRH 1RY7B 1T7WA 4RAUA 2MSPA 3CFKB 3AMKA 3L1OL 4JLRB 2Z4QB 4LOUD 4NRZA 5EU3A 5DURB 1KCRH 2HN7A 2DKUA 2VSDA 2HVJB 3OGOE 2VAJA 3V0WH 2YUVA 3QT2A 4WV1C 4IIQC 3WS6C 1X6LA 4NKQB 3MFFB 4LIQL 1JNJA 4ZTPH 1ZEAH 3P11L 4U1GC 4A6YL 4Y88A 1VADB 4XNMB 1W0WA 3STBA 2UWEE 2V17H 4YHMH 5GS1A 2D9QB 1AHWB 3ZE1E 2OJZH 3QI9C 4ZDHB 1LMKA 4ZAKD 5FOBA 2VAAA 1CFVL 5I74C 2QHRL 4N8VB 1LEGB 2P5WB 1LEKA 4Z0XA 3QIWB 1NKOA 1NGWB 3RVTD 5HI5C 3IFLL 1UG9A 3WDHA 4HXBH 3BZDA 4GW4A 5DUPH 2M26A 5BXFA 1IKNC 1J5OH 1PYWA 1MJ8H 4FA8A 1RZ8B 3NABL 2W92A 3CGTA 4E0RA 4ELKB 2H32A 4XCEB 4JN1H 4QGYA 5FHAL 2LFGA 2UVEA 5A2FA 3ARED 3L7EA 1D5XB 3U36B 4HWEH 4O2EB 1QLRA 1HXMB 1KELH 2IPUG 3NCEB 4JANB 2BNUA 4OZIA 5I8KL 3L3IB 3TN0A 1QD0A 3T1FB 3UTSA 1EBPA 2R56L 5IB4B 5E94A 1YY8B 4Z78A 1TCMA 2YPLB 2IGFL 1QKZH 1HQRB 3HPJB 4BQ8A 3FO2B 4JEGB 4J8RB 4HKBB 3S88L 1SJHB 2Z92B 5DJ2B 3BWAA 4LCIH 2IQAB 1S7VB 2VWEE 4I0PA 2VLME 4RGNC 1OAKL 4Q9BA 3V2AR 1YNLH 3KXFB 3T1WA 2EH7L 2FECL 2HT2C 2J88L 1LDPL 4KGJA 3IFNH 2EECA 3R0NA 4JKPH 4QRPB 4RRPG 5K9OA 4PP8C 2NW2B 3QUMH 5DJXA 4Y8DC 3BD5A 4D0CA 1JTOA 2ZKHL 3ET9F 1U93B 3OJDB 2C3HA 1P7QB 1A6PA 5LGJA 3QEUB 1PD6A 1J0YA 5E99L 4N0YH 4MWFA 1FDLL 4U0RC 2D7QA 4HG4J 4RMWA 3F6LA 4ZOAA 3TBTB 5FB8A 1DUZA 3DRQA 3MV7E 3EOAA 5KSUB 3WMSA 4Z18A 1JFQL 3FOLB 1BVKB 2R0WL 3BZ4B 4JFZL 1A7NL 1RPQA 1IRAY 2PTTB 3LQAC 5DFVC 1FG9C 4QHUA 2BRRL 1FZKA 2GYSA 5IB3B 1AXTH 3WNOA 5F9AC 1CGTA 4Y7MA 3SBWA 3ZE0E 1T1WA 5I16A 4NZUH 5DJAB 4ZAKA 4QO1A 4HUXA 2IC2A 2CRZA 4PJAA 1U8LA 4LHUG 5FA4A 3OX8B 4HXAH 3DVIA 1MIML 4X8JA 1Q1JL 1EEUA 4MJIE 1TVHA 4XC3L 1W0VA 4Y5VC 1VDGA 2ICEB 4YFLI 4N0CD 3VI4E 4H1LA 3OQ3B 5BS0B 2VLMD 4YGVB 3C9NA 1INEH 1N5AB 4GQPH 3ROLB 1JRHL 2ADGA 3MGOB 2ADJB 4L8BA 1CGYA 3AREA 2I5YH 1M05B 4A6YA 3EYOA 1U8HA 1L6ZA 5C07B 1UH3A 5I1JL 3AS0A 4LVOC 3MUZ1 3VRIA 3C5SA 1U8PB 2XA3A 5F72S 2BXYA 3O9WB 3FFCB 5C9JA 3QH3A 1MREL 3F65A 5D72H 3QO1A 4ZFFA 1U8OA 5DMKA 1XEDA 4P4RB 3SGJA 2C1OB 4J4PC 2M2DA 4X5LA 4MS8C 4NNXA 1I8KA 3MV7D 2P8PA 3F7RA 1NAKH 4PGEB 1G7LA 1EERB 3C60C 2VISA 3LKNA 1NUGA 1RFDH 3DXAB 4ENEC 2M1KA 2UWEA 4OSUL 3ZE2E 4FFYL 1KSRA 3KHQA 5MI0C 3WFEL 5LAXB 5HHPB 4W6WB 2X4QA 3U0PB 1I7TB 3N50A 4PJAF 2P1YA 4YIQA 4U6TA 3KPPA 4OFPA 4L3EB 2DLHA 3VFPB 1F11B 3MRBA 3RUGB 4MJID 2BNRB 2C9AA 3MYJB 2FGZA 3JUYA 4K94C 1AO7E 4S1RH 2RHEA 1WFTA 2A6JB 4MZ3A 4ZOBA 3HMXL 3T3MF 1YQVL 4XGZA 2OK0H 2HG5A 3EZJB 3ROOA 1T5XB 3RX8A 3RX7A 1HYSD 2IH3A 4BSJA 5JOFB 5IVOA 2FB4L 4U49A 3WEXB 1PAMA 4F57L 1S5HA 1BLNB 1FL5B 1FL6A 5TH2A 3ZYZA 5IJKA 1INDL 2HTKD 2A77L 4EBQL 5I6XB 5C0RL 4NFDA 4NKMA 2B8OT 4DUWA 4N0CA 1NCDL 4LKCB 4B41A 4RGMC 1NGZB 1JYVA 4QNPE 2A83B 1YC8A 3R8BB 3MNWB 3NMEA 1JHKH 2F5AH 1HXYA 2CKBL 4LLVA 1U8JB 1N64H 5EU6B 1TTFA 5DEFB 4N8CH 4K9EC 3WUWA 2HLAB 2E7MA 2H26A 4DW2H 5HD8D 2DQJH 3VFGH 3VWJD 3MCG1 5EUKB 3NCFB 1EGJL 2JJWA 4JFHE 1CBVL 1CWVA 4EJ1C 3ZE1F 3IT8D 2VLRB 5MP6L 5D7SL 5FUOH 1OP3H 4QTIH 2F5BL 3QDJB 4KKBD 3VFUA 1Q9OA 5E8EB 4D9RD 2J12B 1LD9A 4OGAD 3IETA 4PRNB 4YHLL 5CMAA 1OAYH 2KUTA 1A7OH 4GW5A 1TETH 3MV7A 3HPLA 2D4DA 2AJ3A 1OGTB 3RAJL 2H8PB 2YK1L 2LTQC 4JDZA 3L95B 5D2NB 3MBED 4FS0A 1P7HL 3K1DA 1U91B 1BOYA 3LV3B 1KPUB 1WK0A 4D8PA 3SPVA 2QQLL 1WISA 4XMKL 3GSQB 3LEXB 3B9VA 1EEYA 4MDJA 1OL0A 4KFZC 4OCXH 5KS9E 1S7TB 1EVUA 1JF1B 2HFGH 2AEPH 4KHTL 2IPKA 2IEPA 3DUUA 4NHUE 5J1SC 5CGYC 2UZXB 4HUUA 3FO0H 4P2RB 2ZUUA 4MJIA 3JWDL 3JSSA 2IAMD 1F90H 2IMMA 3CK0H 3BIKA 5EIQA 3I9GL 2CUMA 5BO1L 3L6FA 3IU4H 1U8MB 2MKLC 2NTFB 4Y2DD 4K23L 1U95B 4X6EB 1HKLH 2XN9E 3RWIB 4KRPC 3UDWA 3FQXB 1DLFL 1UACH 2EKJA 1CFTB 2R4RH 2CKNA 3HNVL 3QZWB 1BBDL 1J8KA 4PJIE 4MD0B 1XGYL 3QIUC 4BFIB 1Q9WB 2AAVA 4KQ3L 1ZHLB 1HN1A 4AIZB 1AR1D 4GG8B 4FG6C 1GGCH 2VZSA 4ZD3L 3ULVL 5TF1H 1SBSL 2YWYA 1Y6MR 5LCVH 1FGNL 1P5VA 1S7UA 4N9GB 3O45A 5IEHA 5EZIH 5B4MD 4Z5RB 4M6NL 1UXWB 5AYUL 2J8UB 1J0HA 4B7LA 1ZS8B 1KLUA 1HQ4A 3HMXA 4PUBL 4HLJA 1ORSA 1QBAA 4X5WA 1OAZL 4AIOA 1RZJL 2YN5A 4Q6IA 3PL6C 4DTGH 5JIIA 3QNYA 5TFSL 1MQ8A 1F8TL 3Q6GH 3Q5TA 1BD2E 3FOMB 1QACA 4KJPD 1E4WH 2FECI 3B9EA 3JV6B 3RWHA 3DJ9A 1P9MC 1QEWB 3WLBB 4N1CA 3DETC 2G5RA 4S1DC 4L4VD 3RPIB 4TUOA 3REWA 1HHIB 1L7TL 4PY8I 4EDXA 2ZG3A 2EEDA 4HZLA 2VDLH 2CKBA 2XFXB 4NQSA 3MBEA 2O61A 4OTXL 4PYGA 1U8QA 2WWKT 3OKNB 5KN5B 4Y16C 1TCRA 1FNFA 3B5TA 1EGJA 1VERA 4PP2B 4MA7L 1YEKH 5CP3A 4GG6B 3QQ3B 3IAPA 2WK2A 1CFQA 1Y6KR 2IAMA 1R5IB 4D3CH 5F3BB 3R1GL 4U6XA 5CAYB 3NA9H 3P77B 5DD5L 1H0DB 1IEHA 4Y2DA 5T1KA 4GO6B 2OXGA 5BQ7A 4UZGA 5E9DB 1AE6H 2EIZB 1NJ9B 3QXUA 2Z35B 3V8OA 3C8KB 1ORQB 1CDGA 3T0DA 1J05A 1CG9A 1D9KB 1EFXB 1N6VA 3I6GA 1JZ6A 1MFEH 4WHCA 3ARBC 1QVOB 1NBVL 4XCYA 4GBXD 3IRPX 1T0MB 4UMGA 4WTZG 3P4OA 4UQ3A 5FO9B 2D0HA 4FNLL 3GK8H 2PYFA 2GFBA 4KQ4L 1IAII 3MRKB 5EO9A 3RKDC 4YDKH 4KTYA 4G43A 1OTSD 2GK2A 3K46A 4XP9H 3HB3D 5JPMA 2JCCA 2ITDB 1BJ8A 2ZOLB 5ILTH 1MCQA 1FFPB 5TE6H 3AGVA 3S96A 4M3JA 1LO3H 1M7DB 4N0UB 4MXQA 1CFSA 4YHZH 3OB8A 3OGCB 3MNZB 1XF3B 2XKNA 5KS9A 1PG7W 1J0JA 4CUCA 4NHUA 2VH5H 2X4PB 5E7FA 3WJLC 2X7LB 3T77A 4DVRH 1A0QH 2V7NA 4Y4KD 3V7AE 3UPCA 3JTSB 5T5FL 4RIRA 3CH1A 4L4VA 3MOQA 3U4EB 5CILH 4L8SC 5D6DA 3V4VL 1FNGB 3ILPA 3R06B 3MODH 4HFUL 4LFHD 1NFIA 3FB7B 2YEZA 4LMQE 4UB0H 3KLHD 4AYFA 5D1QC 1CVSC 2NY1B 4XNXL 5F9JA 2EDLA 4PJIA 1A1MA 3DX7A 5EC1B 3B83A 1ZGLA 4NSKB 2WBJD 4W6YB 1S9YA 3PXHA 1MLBA 4ODSL 4X80L 2P24A 2CIIA 5IQ9B 2C7UA 1HIML 5GZOD 5JXAL 3RWCB 3C8HA 5I17B 5GGUB 2BOBA 5CLTA 5E8NA 4E41D 4FP8H 3RNKB 1U3ZA 2EXWD 4RX4D 4PJCB 1Z9OA 3FB6B 5HGBB 1HSAB 4WWKB 3DUSA 1T6VN 4R2GD 2JCCF 1YEIL 4HK3J 4R7DA 1CDIA 1FCCA 4FXGB 4IMKC 2CIKB 1CXIA 5BZDA 3N0PB 1GZPB 3QULB 3L5XL 1EEZA 4WU7B 4P2QD 1NMCC 3VXTA 4AMKH 4CVXA 3NTCH 4GXVH 2VLJE 4GBXA 4XVUD 1BD2A 1LEIA 5CINH 5KS9F 2X09A 3KPRE 4I2XB 4I77H 4LLUB 1HCFX 3UYOD 4UDTA 4OFYD 3UZEA 3W11D 3WFBL 2V2TB 4G9DA 5IMOA 1QZ1A 3TP4A 2ZUYA 35C8L 1X3DA 1I1FB 5FKAB 2Z31D 3RTQC 1ZLUK 1DL7H 2NXZC 5F6HJ 1IEAA 1RUMH 4IRSD 1H5BB 4F2MB 5T3XE 1GZQB 2FATL 3QCUH 4AZ8A 3SDXA 4C57C 3BT2H 5C0JB 1XF1A 2OQJB 2DQHH 2YXFA 4KJWD 4PJFA 4PJIF 1BQLH 2GI7A 2WLZA 4HWZB 4R7NB 2XZCL 1MQKH 4NDMB 4G7VH 3RX5A 1AP2B 5KSBB 3UBXA 2IALB 2OTUA 4HS3B 5C2UB 4TSAH 3RHWF 4WHTB 4Y4KA 3WLWC 5GGRB 1K8DB 3EAKA 4Z7VE 3Q5OA 1RSFA 3O6FC 3SN6N 3LKSB 1I8MA 1R5WB 3B6SA 2VDML 4A2MA 1CN4A 4NYLB 1T89A 5F7DB 3M1BA 4NQXA 3CLEL 4R90L 3GM8A 1DSFL 1JYWA 2VO5A 5HYIA 4OLXL 1PFCA 4KVCL 5F96H 1T4KB 2HWZL 2F19H 4FQ1L 3SQBA 5IGXH 3LH2H 3VDAA 5F9WC 4L9LB 3MRDB 3DWTA 2WBJA 2DWEB 4LSTL 3K2MC 1B6UA 1PSKH 3PXJA 2DLGA 3T0EC 2KBGA 2AJUL 1QG3A 2C3WA 3KPRD 3QI9D 4NM8H 3GIVB 4LBEA 4NQEE 3T65B 5J89A 1ES0B 4E41A 1AGCB 3MLVH 4RX4A 3QHTC 3FO1A 1NC4D 3MJ7B 5HI5D 2HFTA 1YNTA 4FQLH 3IJSB 3CUPB 2AK1L 3HR5A 4JPWH 2FHFA 4KI5C 1YN6B 2BCKB 1S3KL 3WL9B 1MHHA 4P2QA 4MAYC 3SDXF 5EBMA 4ZYKB 2BDNH 4NBXB 4PJFF 4UAOC 1GAFH 1A5FH 3CMOL 3HN3A 2VDOL 3OKKA 4H8WC 3IDJA 4YEEA 2WUBH 4JHWH 2DKMA 2MJWA 1FG2A 2Q7YB 5JQ6L 4AEFA 1FYTE 2WLYA 1CL7H 4OFYA 1BAFL 2MWCA 3UX9B 4YXHL 2Z31A 5LGKA 4LDEB 5FGBC 4GXUM 3WN5C 3AAZB 1JNLL 5M94B 4IRSA 3U7WL 4CU7A 4RGND 4HGKC 1TZIA 4L1DA 4XCNA 3F12A 1VFUA 1NGQH 3LQAL 4NKOB 2HT2D 2DTSA 3IFPB 4LLQB 3F7QA 3TT3H 3BUYA 5FCSH 4XNQB 4U1NB 4HMCA 4M93B 3SDDA 4DQOH 5SWQB 4TRPL 3MV8B 4S0UC 4U1MB 3REVA 5C08D 4U1KA 1GGUA 1IGCL 4P57A 4WFGE 3VFRA 3O6KL 5L9DH 5FECB 5GS0H 4AQ1B 4M9OA 2D4FA 3F5WA 3PQYD 5IB1B 1FN4B 4YDIL 3BPLB 4XXDB 2QR0A 2B2XH 3EO1B 4WV1A 4IIQA 3WS6A 4JY6B 2C3VA 2OJEA 4CBPA 5F9OL 1AR2A 32C2B 1OW0C 2OR8A 3VXUD 5JW4N 1LP9B 4W4NA 4HW6A 5CD3B 1R3LB 4I18B 3MJ8A 1A9EB 3TBYA 5DJDB 1VESA 4IOFC 1JF5A 5DFVD 1KEMH 1BPVA 4M5ZL 3ZO0A 4OLEA 4R4FL 3KPRA 3DSFH 4WO4B 2XZQL 3LEVH 3QI9A 5EZJB 3IDMA 5GRWA 2Z91B 3KPLB 3NN8B 1FYTD 1HILA 3TCLB 3SDCB 5ISZB 3BVNA 4RAVB 1J8HE 2PCPA 5F6IB 1NDMA 5GJTH 1NC4A 5CSBA 2Z8WC 3LQZA 3DMMC 3UBXI 5KOVC 1KJ3L 4JM2C 2JELL 4H1LG 2C26A 2COQA 2Q6WA 1IKNA 5D5MB 1ZAGA 3MUHL 1GGYA 4LLYB 4LNRB 4U2ZA 1KENH 2NY6C 3KVQA 5F1IA 3OXRB 2DQDH 2GCYB 5ID1B 2BY2A 5AD0B 3SGEH 2HP4A 4OV5B 1XIWC 5JLZB 3GI8L 4JRXE 2OLDA 3FL7A 5SWSD 1W0YT 1MFAL 5HJ3A 3HZMA 3E3QC 2CGRL 3AB0B 1OAUH 4W81A 1E4XL 3DBXA 1T80A 1KLGB 1S7WA 3GJEB 4KTDL 4G8FA 1C1EH 2NY2C 3KLAA 4YDJA 5SX4H 3G04B 1GCFA 3MJ9L 5F7LB 3HZYB 4K94L 4X7TB 4LPVA 4X7SH 5F7KC 4UV4L 1CIUA 4MXVE 4LAQH 4YXLL 5FF6B 4G5ZH 4OFKA 2NLJA 1SMAA 4J4PD 1XGPA 4MS8D 5IOPA 1WIUA 1TQCB 3GSRA 3KPNB 2C5DC 1U8NB 3MRNB 2FX8H 3C60D 1NMAL 2I25N 3SKJH 3T4AA 2HH0L 4ENED 4RZCA 1BQHA 3FT4A 4HUVA 1BZ7B 3THMH 3QDMB 5C08A 3IKCA 3T3PE 3U4BL 4F7PA 2QHLA 4OCRL 4PTTA 1TMCB 1J8HD 5EORL 1I7RA 2DOCA 4OV6F 4HSQA 4G7YH 4OZGE 3O2DL 3MUGB 5DRZB 3QPXH 4OAWA 1EO5A 1F97A 4I9WE 5I1LA 3BZFA 4WEBH 1E27A 3QFJE 5I75B 1ZA6A 2VQUA 2E8YA 2GT9B 4K9EL 4OF0A 3S35H 1V3LA 1OPGL 4YH6A 3PDGA 1W0WB 3VXUA 1IAOB 1MELA 3CVHB 1QO3A 4XBEH 1CLYL 1VKXB 5GGTH 5E1AA 4OLWL 3OTTA 5CBAA 4PV8A 1WITA 4JRXD 4LMQI 4UT7H 1XGTA 3BW9B 1MWAB 1ZSDA 1FYTA 1LEKB 1H3GA 2HKFL 4GW4B 1DLHA 1FAKT 1G9ML 5BXFB 2DTML 4EUPB 2J7LA 2DJUA 1KXTB 2X4OA 4JQIL 4Y5VA 3RWGB 3QXAB 3U0TB 4CADA 3CFDB 3UZVB 5F9DC 4XP6L 5I1GH 3EW3B 2ZCHH 1H8NA 3KYNB 3O6LL 1M6OA 1VGKA 3WUWG 1CLCA 1BIIA 4L29B 4XAKE 3S4SG 2BNUB 1A6VH 4F33B 1LK3L 2R0ZL 3CH8A 1QFOA 1MUJB 5SWSA 3FQNA 3LIZH 3UYPA 1QFWH 3LKPA 2B5IC 3INUL 3DX6A 4X6BA 4HWBH 5CJ5A 3GMMA 2B0SL 4HFWB 5GGQH 1C5DA 5CWSA 5HYJD 3B2UC 3HG1E 3QPQC 4Z7UE 1Y0LA 4XCFH 3TC9A 4F3FA 2FX7H 5T3ZH 4J4PA 1R6VA 4MS8A 5D9SA 5I71C 1SVCP 2HJFA 5L0QB 1TZHA 4FABL 1LWRA 3BDYH 1NBYB 5IMMB 5C0AB 2R29L 3C60A 1ADQH 3S98A 2MPAL 3O3DA 3PJSB 4HH8A 1A14H 4G3YH 4I3SL 4U1IB 2Y36L 2AKRA 5EU5B 2G2RA 2C4FT 2MHAA 5CJQL 4DN4H 2P5EE 3NFPA 5CFHA 4IRZL 3V9FA 2DQEL 5F88A 5JZ7C 5HY9B 4Z7NE 1J8HA 2IBGA 4Q9QL 3QQ4B 2FZ3B 5H37G 2NXYC 5CGYD 2Q8BH 5DD0L 1ZHBB 3MJ9A 3VXQA 4EOWH 3CVHH 4RQQA 3IB4A 4KRPD 1BF8A 1IZJA 3X12A 4OZFB 4BKLA 1T1WB 5ADPL 3T2QA 1S8DA 4AG4L 5IESH 1U8LB 2Y9RT 4JRXA 3NPSC 4PJHB 1A22B 4ZTOH 3MACH 5B3JE 1KYOJ 2GK0A 1P4LA 1QBML 5EBWA 3QIUD 1AFVL 4K7FA 4PJ7E 5ETUB 3EFDH 1YMMB 2GHWB 3Q3GA 4EUPH 4U7SA 4FG6D 4JKKA 4JFYA 4LL9A 2XTLA 4FZ8H 3FRUA 4MQ7A 4F37K 1FIGL 4X99A 4JFQB 3S37X 1H3UA 1MPAH 4KZDL 2NY3C 1JGVH 1UB6A 5DLML 3VE0B 5E6IC 4ACPA 2BXZA 1I4FA 3B5GA 4X5XB 1PEZA 1ROWA 2NX5E 2AK4D 3SE9H 3UTPD 3L3GB 1VPOL 5I8OH 5TF0A 4G6JH 3T8XA 3GM0A 4E42A 1IT9L 5BOZG 5D8JH 4U3XA 3PL6D 5MEOB 1DQDH 2VXTH 4UIMA 4BQ6A 1I1CA 4PRDB 2BMKB 3QH3B 4HPYH 4M6OL 5DMKB 5HYJA 5HPMB 4OZGA 1K5NB 4KAQH 2D0GA 2BVOA 4HV8B 1N7MH 2VITA 1E28A 5DD3L 1MSPA 2V7HA 3WCYA 1NCAH 3DETD 3LKNB 5JDJA 2VR5A 4S1DD 1JYXA 3FB5A 5EU7E 5C8JA 3S3JA 4OCMC 1AHWC 1HH6B 2YD3A 4WU5A 5FYJH 2BVPB 4EQ3A 5DF0A 4RMVA 4X7FC 4DVBA 5T5NF 1ACYL 4XMLL 5I9QB 3C5ZB 12E8H 3MA9H 4OZHB 3TIEA 4DZBA 3HI1B 4Y16D 4OM1L 3H3PH 2R1XA 3LS4H 2R0LL 3IS1X 1XR9B 2VZOA 4Q9RL 1JNHA 2CDGA 4NJ9L 1KCGC 5DZLA 3DX8A 4RBPH 4JRWA 5KSAB 3WNLA 1YECL 1FZMA 5CHNB 5HGAB 1LO2L 4OCSH 1CLOH 2VB5A 3VJ6B 3SY0A 1RJCA 4OB5H 4OQ1A 1JHLH 1O7SA 1DTUA 3MLYH 3X3GL 5DXWA 1C16A 3BKCH 3OR7A 1K2DA 2PYED 3CXHJ 3LPWA 5EOTA 5I30L 5IT2L 5L6YL 4YHOH 2I60L 2NY4C 2OMBA 1MCHA 1X5HA 1TFHA 4FQJH 1IBGL 2ESVD 5A1AA 4E5XB 3QIUA 3VA2C 4BH8A 2VC2H 5DO2C 3ARBD 4KWUA 3BGFC 1JPFB 5E5UB 3N1QC 4P23C 3LVEA 1UKSA 4JVPA 4OZGF 2XKSA 4D0DB 4PJEB 4DKAA 1HXYB 4LLVB 5GRJL 3RKDD 1C08A 5HGDB 3ZDXE 1U6AH 5C0DA 4PREA 3G5YA 5KTEL 4KUZH 3UCRA 1DFBL 3EJYC 1WSST 2QQNH 3EYFB 4ZXBB 1AQKL 2IANB 2ED8A 1WWBX 1E4XI 4ZNEE 2AK4A 4LGSB 1T20B 1IGJB 2I9TB 3OKEB 3PL6A 5B8CB 4HIXH 4D9LL 3TBVB 4DKEL 4KV5E 2DLFH 1JWSB 1VHPA 4YX2L 4JAMB 1DEEB 3MRCA 2CLVA 5CMAB 3BKJH 5JNYB 4I0KA 4S2SA 3T08A 4JO3H 4GRMA 2ED9A 1U58A 1P9MA 2ZOKA 3D69A 1CD1A 2W0FA 1IAIM 1K6QH 4BSVA 3OKOB 3FO9A 5I0ZA 2WBKA 3BYYA 1TENA 4G6KH 4UDUB 5D1QD 1FORL 4MDJB 2B39A 4KY1L 1PJ9A 3ZYOA 2VXVL 3BUTA 4Y16A 2R2EB 1CGWA 2IPKB 3DUUB 3OG6B 4HIJB 4XMPL 3GO1H 2OZ4H 1T2QL 1KTLA 4M7KH 4UOW0 4LCWE 1NBZB 3BIKB 3VFOA 1X5ZA 4L9DA 3V5HB 4M48L 5TGBA 3NCJL 3WV0A 3QCTH 3LN5A 5IBUG 2ZCKL 1C5BL 2PYEA 4HBCH 1FGVL 1ZLSL 4JKMA 1GC1H 4WFFE 1NC2B 2HVKB 4Z8FH 1HNFA 2ESVA 4PJDE 2X4UB 3MXWH 3B2VL 3ARBA 2F74B 4KJYA 3MBXH 3MUJA 1S5IL 1U3HC 1Z6JT 2FH6A 1V3KA 4XNYH 1N8ZA 4Z7NF 3TBSB 4OLVL 4POZC 2C3GA 3T0EE 4MA8H 4HIIA 3MRHA 3P0YL 4IM8A 1MFCH 2AJZA 1HSBA 3PGFL 4DUVA 1MVUA 3PP4L 1HQ4B 4XVTH 2RAMA 2YSSB 3VWJB 3BPOB 3RTQD 1KFAL 2NXZD 4EEEA 4MSWA 3C2AH 2AXGB 5KAQF 4KC3B 4G8EA 3QNYB 5EDXA 2WANA 3WUZA 3CAFA 2A6DB 1MCFA 3OXSA 5D7IE 2BY1A 4PRIB 25C8L 2Y06L 3HI6H 4GW1A 3NACH 3EO9H 4FTVE 1ZTXH 2LVEA 1T21A 1H3VA 5FO8B 1CT8A 3UBXG 1WZKA 3M8OL 4DK3A 3WJLA 3WD5H 4PTUA 4O4YH 3WLWD 2DBLH 5CEZH 3O6FD 1NEZB 4PV9A 1J0IA 3REWB 1GYAA 1FNSH 1P69B 2CLRB 3C5JB 2XQBL 4JE4B 2CKBB 2ADFH 5GRUH 3P0VL 2DQCH 1LO0L 3IFOB 4ERSL 3G6AA 3ARVA 5IROC 1U8QB 3NPZB 1QRND 4LFHG 4YHKL 1FNEB 2G9HB 1CICA 3GMQA 2GJ6B 4M5YH 4GKZA 5DS8B 5D1QA 2W60A 3C6LB 3MR9A 4WFFD 3WDIA 5I6XC 2XPGB 1UZ8B 2Q76A 1SJVA 4XPAL 1FCGA 4H8WL 3IDNA 5F7NC 5E5MA 2C4FU 2J1KA 1UZ6E 3T0ED 1VGEL 1SBBA 5D71L 1RIUH 4JFPA 5ABDE 2X1PA 3QEHB 5A2JH 1WTGT 2LAAA 4U7KA 2GSIB 2BNQE 5C0IA 4NO5A 4P9MH 4TULL 4QRRE 1J05B 4XWGL 1LE5B 1CG9B 1YYMH 4O2FA 3HC4H 4IMKA 4JY4A 4KI5D 3HS0B 3BH9A 3UTQB 1MVFA 2Y5TB 2P8MA 4XPBH 1MLCA 4MAYD 1LVEA 4Y4HC 3P4OB 3L5WA 2YPVH 3EYQC 3CZFB 4YHPB 2WV3A 1HI6B 1D6EB 3WNPA 3HUJE 4N0FA 1CD8A 2E7CA 3LKRA 4IEFB 4WUKH 2EDQA 2YR3A 1SYVB 1UQSB 2H3NA 1XF4B 1FLRH 4BSWA 4G43B 5IB2A 2ZG2A 4Z7WF 4RISL 1PKQB 2DF3A 4X6FA 4S0SD 4Z77A 4JM4L 4OD3L 4PJXE 2VDQH 3FB8A 3CX5K 3RTQA 3CVIH 3WFCH 3S96B 1NLDH 1KACB 3BKML 4ODVH 4P49A 4I8DA 4ORZC 4DGVL 1VCAA 4BH7B 2HTLC 2RBLA 4MB4A 4XVSL 5J0BA 1PW3A 4D0BB 1O5DT 1IC1A 4ORGB 4QRSA 2IQ9H 3QJFA 4JG0L 2GJZA 4XP5H 5TDPA 5JW3L 2AXHA 1IAMA 4F58L 4NN7B 5H94A 3O6FA 4J2XA 3BJLA 3HNTH 3B3IB 5J57B 4IS6A 2YMXL 1UWXK 1IKFH 3FFDB 4HC1H 1QRNA 5HI3C 5DYOA 4QXUL 5F9JB 5K9KA 3RI5F 3IS0X 3FQWA 4XXCC 3DX7B 5SWZE 2AERT 4YDLB 4PJDA 1ZGLB 3MLZH 1S9YB 2X4RB 2LU7A 4GQ9H 5HBBA 2EDBA 1FV1A 4Z95L 2GITA 2VN7A 1NGPH 1BBJA 3CSYA 4KV5F 4CN4A 4IOFD 6FABH 5ID0A 3GSVB 1AC0A 2QQKL 2BOBB 5E8NB 2YC1B 3T0EA 3WJJC 2HKHH 1JGDB 5KW9H 1J9CT 3MRJA 1A6UH 1F3DJ 2UZYB 5MHSE 1B0GA 2VIRA 4YBLB 1B0RA 3P30L 1YPZE 3K3QA 5HXMA 1FPTH 3RZWA 3RU8L 3P9LA 5HVHB 5D2LA 3VRLF 3DMMD 4HJGA 1MCWW 4F7MB 1LGVA 4JM2D 5E2VL 3W81A 4R4BA 4CVXB 2P7TA 4XBPA 5AZEH 2P48B 4XBGA 3GSXA 1R5VA 4UILH 4MAYA 3HAEA 4H5SB 3OPZL 5I76A 4P46B 2FJGB 3D0LA 43CAA 4EI6B 5DTFA 5F7HA 1XIWD 1XCTB 2B4CH 3KYKH 4ELMA 1U2CA 3NIGF 1UWEH 3CLFH 3N9GH 2AW2A 2PNDA 1T66C 2YWZA 3JV0A 4GUPA 4GAGH 1LK2A 2FJFB 1V7ML 3LHPH 1EO8L 3STZA 2NY2D 3PV6B 5MEQA 5FGBA 3WN5A 3GHBH 3LS5H 5F7FA 2VE6B 2MFNA 4PG9B 2VXSH 1OT2A 4PJFB 2Z8VC 4TOYH 2JKXA 5ACZB 3PWUB 4PJDF 3MCKB 4MD5B 1JJUA 2BJML 3RA7H 1D5BA 1P4BH 3IDYB 3O4OB 5KVDH 2Q8AH 1BQHG 1DQLH 2R69L 3L7FB 3T2NH 2EYSB 2BOCA 3P73A 1MIEL 3GKZA 5JIKA 2H45A 3LMJL 4KDVA 5MHSD 3E2HB 1JPTH 5DMJB 1QSEB 3WE6A 2BNQA 1DE4A 4X4YA 4MNQE 5TPWH 1D9KC 3DTXB 3OKDB 5IFJA 5IW1A 5D2LF 3ZHDA 4Q7DA 2R2HA 1KLFA 4J6RH 3VXPB 4KI5F 4JDTH 3RVXC 3QHZL 4JDVA 3RL1A 4RFEA 5FCUL 1VFAA 2ZUVA 3V4PH 1OW0A 1JBJA 2AGJH 3NIFE 1CK0L 4EQ2A 3NIDE 4HIEA 4LLWA 5DJCA 4NO2A 4TSBH 1KPVB 1IGIL 1IILE 2WAHA 2XKUA 2WIMA 3MRPB 4E41B 1ND0A 1AKJB 3SGKC 1X5IA 1KCRL 1RULH 2DIBA 4JJ5A 4ELMF 4UV7H 3DO7A 1XZ0B 5A2LH 1BFOB 1YNTB 1KIPB 3ESUF 4PJXA 5CUSH 1WJ3A 3DMMA 4PJGB 5J56B 4JM2A 1ZEAL 3LRHA 2Y07H 3P2TA 3BGMA 3CFEB 5DJZA 1U8IA 4X9BA 1KULA 2V17L 4YHML 4IBLT 2H2PC 2OJZL 3LN4A 3FONB 1KB5L 2RFXA 4H26A 4N1HB 5BW7C 3G5VA 1XIWA 2FR4A 3HHRB 4HZAA 1ZWIA 4PGBA 3VMPA 3EDEA 3PDOA 4ISVA 5EUOE 3IDXH 4DJMA 3QEQB 3QDGD 5DDHB 3HC3H 3E3QA 4HXBL 1SEQH 4OM0H 2FWOA 4RWYH 5BVJB 5FYLE 3TO2B 1J5OL 4UUJA 1Q94A 3IXAB 2NY1C 3B2UD 4YFEA 3QPQD 5GIRB 5AUMA 1KTKE 4L4TB 3NBNA 4HWEL 5EZOH 4ODXA 3TJEL 3WKML 3DHMA 1S7XA 1MCBA 1TJIH 3WKNA 1X6NA 3UJTL 2ZJSH 2IBBA 5E4EC 2DQFA 3REVB 1MRFH 3WXVH 1QKZL 5FYLL 4WWKC 4QTHA 5BZWB 1EAPB 5I2IA 5J1AB 4Y1AB 2OI9B 4LCIL 5C0GA 2EYTB 5JZ7D 1CGXA 4OIIL 4PJXF 3PWPD 4WV1B 3ZTNL 4IIQB 1YNLL 1HINH 2NXYD 4HS8L 4LPTA 4JM2F 1KB9J 5IP4A 5D6CA 3TA3C 4U1GB 4P5TC 2JIXD 4JKPL 1FE8H 5D7LE 5K9QG 2WWKO 3A6OA 3MJ8B 4IMLB 4JREB 4QHKI 1JHTA 3QUML 1A9BA 3QCVH 4K3EL 1T1ZB 1MCLA 1EHLH 3QI9B 4O02H 1I7UA 3D39B 2DLTA 4K55A 1I3RB 1T1YB 5F44A 2PCPB 1ZT7B 4NJAH 4N0YL 4K71C 1MJ7H 4LP5A 4PJ5B 3LQZB 3HC0A 5FYLD 4LLDA 5HHQA 4XPTH 1ED3A 1N59A 3MPCA 1ZLWK 5K59F 3NZ8A 3WIHL 3V6ZB 4LNVA 1I9RH 3MJGX 2EYRA 2DKSA 2NY3D 3JBG7 3S3SA 1AXTL 4NZUL 5E6ID 3V5KB 1EUUA 5EO0A 3ZTJG 5HHXL 2AJYH 3K4DA 2Q7NA 1ZOXA 4HXAL 3DBXB 4W70A 1IM3B 2YPLE 4QYOB 2WP3T 3QDGA 5DURD 4LVNC 1J86A 4TQEH 4ALAH 1QNZL 3IGAA 3MREA 2V5YA 1OWRM 5GS0C 2G60H 3MLWH 1INEL 4RGNB 4WUUB 3PV7A 1IGYB 1XGPB 4FQCH 1HH9A 4FMKA 4WW2B 5C2BH 1MAKA 3BRGC 4L9LC 3GSRB 3MNVA 3JZ7A 3SKOA 5GHWH 3T4AB 3TH2T 3FQRA 3CSBA 2ZUXA 1T7XA 1R3IL 1YEEL 1VA9A 2AQ3A 5FDWB 3IKKA 3Q6FB 1I3GH 5IMLA 3H0TB 3MTRA 4LCYB 3DIFA 1A21A 5C08B 5DJ6A 3GRWH 1KB5A 5JA8B 2P5WD 4EXPX 2EICA 5IW6B 1I7RB 5L8KB 3VGBA 1A3LH 4U1JB 1CDJA 3PQYB 1SYSA 4OAWB 4X6DE 3BZFB 1NANH 5FYKE 4TUKH 3PWPA 1S7RA 1ZA6B 2X70B 3V6OC 3KPQA 1MAML 2ATPB 1GOGA 4GJTB 3VXUB 3WNKA 2JIXA 4LF3A 1T5WA 3HCVA 1TVDA 4I1NB 3MLTA 4P5MA 5HYQA 5KVGH 2QV2A 4PV8B 4GRWF 4YAQA 3X3FH 2ICWA 3MV9B 2PTVA 4YHNA 2NY4D 3E6FB 3RGVB 3SHSA 2YPLD 1N2RA 1OARL 4MA1B 4KMLB 4ZG1A 2EC8A 1SJXA 5DO2D 1TPXB 3TPUB 1M7IB 4EIZC 5BS0E 1Q9LA 1I1YA 5DRNA 1JPGA 4OT1H 4ZQKA 1B4JH 1RJYB 3WSQH 4P23D 5E03A 2OK0L 4K7PX 3KXFD 1UWGH 2E6QA 3ZYJA 1PY4A 5ICYB 1M6OB 5C0EA 3HRZA 4PRBA 1BIIB 1MCIA 4QRPD 4M93C 5DHVB 4XWOC 4CVUA 1IL1A 2GTWA 4QCIA 5C07E 5E6IA 3EJYD 5SWSB 5ERWA 1IGFH 3SO3B 3NIDF 1F58H 4NHCH 4PGCB 1ZLUH 3LKPB 4P3DB 1UH4A 2IADB 2N1KA 1QR1B 4XAWH 3CFKA 4JLRA 2Z4QA 1P7QD 1PBYA 2NPLX 3BGAA 4U3CA 2AV7B 3FFCE 4LARH 4K3GA 1IQWH 2YPKB 3SOBH 1RAMA 2HVJA 3D3VB 4Q0XL 4MCYB 2BRQA 2NY0B 5LQBH 4K3JL 4HD9A 4BFGA 3MFFA 4GSDH 2F5AL 1NLBH 1N64L 4N8CL 2HJFB 4ZUUB 5D70H 2DQJL 3VFGL 4I18C 1VADA 1U0QA 3C60B 4GLRH 4XNMA 3U7YH 3WIHA 1AHWA 4WO4C 3N1PC 4YXKH 4ONFL 4ZDHA 2JJVA 1QQDB 4ODWB 5KAQG 4U31A 2BX5A 1YEHH 3SDCC 5CZVL 3MRRB 3HMWH 3S5LB 4AIXA 1YNKL 5F6IC 4N8VA 1LEGA 2P5WA 2VNCA 2J4WH 1NGWA 4ONGH 4Q9CA 4L3EE 2GKIA 3KPTA 1JN6B 1PG7L 2HRLA 1JK8B 1OAYL 2FNBA 3O11B 5BS0D 3NCMA 3VXQB 5DK2A 1TETL 1RZ8A 2DQIH 1AGEB 4OD1L 2XWBB 4ELKA 2X89D 4XCEA 4ZFGH 3TGXA 3BPNB 5AEAA 1QPPA 2IBZX 5BCAA 1D5XA 2ZSVB 3U36A 1EJ6A 4BKLB 2YA1A 4O2EA 3VXMB 5MENB 4YUEH 3ALPA 4JANA 4JZNA 5IW3A 3L3IA 3T04D 3T1FA 3H9SE 3FQTB 3AB0C 2QSTA 5IB4A 3QB7C 1YY8A 4J23A 4K7FB 4LEXH 2HFGL 2AEPL 3NCBB 3QUYC 2YPLA 3HPJA 3FO2A 3PWLB 4J8RA 2UVFA 1TJGL 1SJHA 2Z92A 4OIBA 5DJ2A 3FRUB 2IQAA 1S7VA 1N6QH 1U3HD 1RZIB 3IU4L 4POZD 5F1KC 1DBBH 4P23A 3U4AA 1HKLL 3U48A 1TQCC 3KXFA 2IPTH 1EIBA 3SQOH 1BFSA 1UB6B 4O58H 1UACL 5DHVH 1FAIH 4MMXC 2NNAB 2D0FA 4KRLB 3DXAD 4QRPA 1FZJB 2V2WB 4K8RH 4D2NA 1LDSA 2NW2A 4QOKB 2ZNWA 4Y4FC 3KYAA 2VLRE 3NFSH 2O5YL 4KVNH 3UJJL 1U93A 4LQFH 1GGCL 1P7QA 1CGSH 3QDJE 4JO1H 3QEUA 5HYJB 4L3ED 1GL4B 3OB0K 2BNRD 5LCVL 2W1NA 1FHGA 5DJ8B 1HHJA 2J3SA 4Z9KB 3O4LB 4XX1E 2HJKB 5CCKH 1Q0YL 3EYSL 1A1NB 3FRPA 2VDKH 3VXRD 3FOLA 1BVKA 3BZ4A 5B38B 3CJJA 1FSKC 1SY6H 2G5BB 5D2NE 1YZZA 4OFDA 2LTQB 1NKRA 3F58H 3EOTH 2P8LA 5DJAA 3B9AA 5BJTB 4OLZH 3Q6GL 3OX8A 2R1XB 4J1UA 2ZCLH 1PLGL 4GAYB 4NQCE 2GY7B 4P2RE 2R23B 2DM3A 3DX8B 2ICEA 2DQTH 1Q72H 1PX3A 2UZIH 4C59B 5BS0A 4NC1C 4OUOA 1MRCH 1YDPB 4YGVA 1N5AA 5E00A 4DFHA 2X89A 1AQDB 5EU6D 3V5DA 3MGOA 4JRYB 3VG9B 2ADJA 3CDCA 1M05A 2VQ1A 1U9KA 3MJ6A 3HFMH 4BJLA 2AJSH 1YJDH 3QG6B 3JTTA 3VW3H 2FL5B 1QBLH 3F62A 4DFIA 3O2VL 3WFDH 4TVPE 1W72H 1AGFB 4PB9L 1U8PA 1YEKL 1CQKA 3O9WA 4FQHB 3QDJD 3FFCA 4Y4HD 2HT4C 3EYQD 5DC0A 4D3CL 3O2WL 5C09D 4ZFZB 2ID5A 5L0QC 1D6VH 1ZLVK 1AE6L 3BO8A 3PIQB 5T1DL 4PGEA 1B9ZA 1L4IA 4WGVB 4WHYG 5ALCL 3GEWB 4IOSD 3DXAA 3JTCA 1E4KA 4JPVH 5E2TH 1IM9B 4M4PA 2WBWB 1MCCA 1MFEL 5LAXA 3KLSA 2D7TH 5HHPA 2WIIB 3U0PA 1I7TA 2PW2B 3KPMB 4K07A 4P0DA 5HYSG 2YUXA 4C56D 1EVTC 3C8DA 1LNUB 3GK8L 2Z9TA 3JWNC 2HTLD 2RJMA 4L3EA 3VFPA 1F11A 4NP4H 3RUGA 2BNRA 3X14B 3GGWA 3MYJA 4S2SB 1G0DA 3CDGB 4YDKL 3PWJA 4NIKB 2Q3AA 2AI0H 2A6JA 1CD1B 1MJJA 4GKOA 3HTLX 1YQ2A 4H20H 4RMRA 3VXRA 1T5XA 3UTZB 2CK0H 4LVHB 5ILTL 5TE6L 5GRVL 4JN2A 4NWUH 3OL2A 1LO3L 5JOFA 3WEXA 5IROA 3HE6B 3OZ9H 5FGSA 5HI3D 4ODTH 1BLNA 1KN4H 2W38A 4NZTH 4HBQA 4GG6E 2VH5L 3CZJA 5IK3B 2EDKA 1A0QL 5IMKA 1B0WA 4H25A 1NGZA 2H32H 5F97E 2A83A 5TGBB 3QJHB 2ZUQB 4RDQG 5CILL 1X5FA 1U8JA 5EU6A 3MODL 5DEFA 2HLAA 5C0CB 3GUTA 1F45A 1BM3H 2W91A 1GJIA 5EUKA 4NM4L 4BYHA 3OKMB 2EIDA 1T0PB 4ZO9A 3C6SB 1NCBH 1FVDB 2NZIA 3N85H 2WZPD 1EMTH 3QDJA 3D0VB 1NQBA 4Y4HA 3HAEG 5KANI 5E24E 2EE3A 2AJXH 4NRYB 5C6TH 1MH5B 1Q8MA 4HIIB 5HVGB 3MRHB 3RUGF 1G7QB 4PRNA 2XI9A 5AAMA 2H1PH 4FP8L 4PFEA 5T1MB 4KDWA 1IGMH 5JHDD 1A1OA 2J5LB 2MQCA 2XICA 4AY0A 5DQJA 3L3KB 4M7ZC 1OGTA 4OCWH 3OF6D 1T66D 4WW1A 3RZCB 2H8PA 5J9PB 1M1SA 2Y6SC 3HZKB 5JIHA 2FGWL 1MFNA 2AQ1A 1U91A 4N0UE 3LV3A 3C5ZC 1KPUA