3S8FB

1.8 a structure of ba3 cytochrome c oxidase from thermus thermophilus in lipid environment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title High resolution structure of the ba3 cytochrome c oxidase from Thermus thermophilus in a lipidic environment.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s8fB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s8fB02
3BQVA 1PY0A 3QJRB 3CVDA 3AY2A 3ABLB 4E9YA 5G2AA 3HAQA 1XIOA 4G7QB 4LDEA 2BHFA 4N6HA 2IH9A 3VVKA 1ET7A 3RYMA 1MGYA 2F95A 3EH5B 2BP0A 4KO9A 4G7RB 1RZQA 3NY8A 2YAEA 5I6OA 1F4ZA 2HPYA 4E9WA 5DHGA 4N4WA 2DWSA 2J55A 1SJMA 8PAZA 1L0MA 3TBBA 2PEDA 5B6VA 1PF3A 3WQJA 4XTOA 4A2DA 4QLWA 4YSPA 3NJGA 4X32A 3OE8A 1NWOA 1IBZA 2WO2B 5C1MA 2VW6A 3EHBB 3HB3B 3NJNA 4K9JA 3AW5A 3NSBA 1NIBA 3CODA 3VGAA 4HCIA 2R7EB 4YSRA 2I7OA 5IY5B 2FQGA 1MG3C 2PP9A 4FBZA 2Y1AA 2KSAA 2NTWA 2VT4A 3MBVA 3QJSB 1E30A 1URIA 2KSBA 4X1HA 2N0MA 2BWDA 2Q5BA 2PPFA 2J57A 1ZIBA 2X72A 1N70A 3L45A 1PZBA 4KO7A 5I6NA 2UX7A 3V9EA 4BXSV 2CALA 2EINB 1AZRA 4GP4B 3SQRA 4YSAA 3V2YA 3V2WA 3X1GA 4YL4A 1PLAA 3RFMA 1FFTB 1VJMA 2KS9A 5KKHA 3FSZA 4J4QA 2DYSB 1N68A 2JKWA 3PBLA 2EIMB 1NWPA 4EF3A 4BUOA 4KOBA 4MBSA 2VSMB 3X3CA 3QBGA 2UXVA 3T6ZA 3OE6A 1GS8A 2FQFA 4W1TA 3C75A 3QDCA 4YSTA 5I6KA 1S8LA 3ODUA 1RZPA 1SHWA 2Y04A 4M3HA 5E9NA 5B7FA 4HYXA 2GC4C 1ILUA 2FJSA 5B0WA 1PXRA 2FTAA 2XXGA 4BWWA 1VGOA 2YCXA 1JVLA 3OM3B 3UZCA 2IWFA 4DP5X 5H2MA 1V55B 1TN5A 3TASA 2GB2A 5I6PA 1QKPA 5A8EA 5ANHA 2PP7A 4NERA 3DQBA 1BYPA 3FPXA 2J56A 3OQRA 1KGBA 5B6XA 2XU9A 4G7SB 3OMNB 2Q9OA 3QPKA 3MX0B 1QHQA 5TK4A 3UAAA 3N55A 1M0KA 4YSEA 1PNDA 2YQBA 2H47C 4ENZA 4EIYA 5ITEA 5B7EA 1RCYA 2XX0A 1BQRA 5A45A 2AANA 3PPSA 4Q89A 4FA7B 1S51A 5H2JA 2XWZA 3UABA 3T6WA 1EHKB 3EF4A 1KG9A 1OE3A 2XXFA 3ABWA 2HX7A 4QI1A 2BP8A 2QT6A 5PAZA 3T9WA 2EILB 4L0PB 1KBVA 3GYRA 1PXSA 2IWEA 2CUAA 1SF3A 3WI9A 5B2NA 1WS7A 2E86A 4WKXA 5A44A 4A68A 3WG7B 1TKWA 3H56A 4A2HA 5JJEA 1ILSA 1ADWA 5JJJA 1W6WA 2MTAA 2VMJA 3DIVA 4PXKA 3FYEB 4RH4A 1KDIA 2AT9A 1AG0A 1XB3A 2XVBA 4E9QA 4EA3A 1NZRA 2J4YA 5G2DA 2NTUA 3FS9A 3FSAA 3NJMA 5I6LA 2HXAA 2UXTA 1BYOA 2BP0B 3AG4B 2AZUA 4BWUA 3HANA 1BQ5A 1MDAA 2PPAA 5FC9A 1J5DA 1E65A 2IDUA 3NP3A 3NJIA 4F2EA 4A4MA 1M56B 2XYBA 2YAOA 2YXVA 3VG9A 3OE0A 1T5KA 1NTDA 2IDFA 5G54A 3UACA 4JQ6A 1OCZB 3ZPQA 3CVBA 2JAGA 7PCYA 2UXFA 2I35A 3CG8A 3PAVA 4BVNA 4N4YB 4YVUA 1SF5A 3PLYA 4WAVA 3WKQA 1AS6A 3UG9A 3NSCA 2B3IA 3NY9A 3CVCA 3P0GA 4DP4X 4KOCA 3SN6R 5JJNA 1XB8A 3OMAB 2OCCB 1W8EA 1BEXA 3C9MA 1GS6X 1JZHA 2I85A 1E12A 2UXGA 4GPOA 4HIPA 4E9SA 1CC3A 3CZUB 4BXVA 4IARA 4GYBA 4BK5C 1U19A 3UAEA 3IE9A 1BM1A 4BEZA 2EI4A 2WJKA 4GP5B 2YXWA 2YAPA 4E9VA 2IDTA 2A3TA 3GXUB 2Z73A 4PXFA 3REYA 1PZCA 3IEAA 1GSKA 3N2JA 1AZNA 1ZV2A 2Z55A 3UGEA 1VLXA 4G71B 1M0LA 1UCQA 1S53A 1OE1A 3PAUA 4BWTA 2X87A 1KCBA 2HX8A 3FQ2A 2M3GA 5G36A 5AKRA 1V54B 2YAHA 1J9TA 5I5JA 2QPDB 2YAMA 4M4RB 1OCCB 2GC7C 4UAHA 3EH4B 2AZAA 4FAAB 3X1EA 3NSYA 1WA2X 1GY1A 5DYSA 4W9ZA 1JFPA 1AQ8A 3VW7A 1CWQA 3EMLA 5H2KA 5G53A 4DKLA 1XB6A 1WA0X 2JFCA 4KNTA 4BDVB 5H2IA 3FU7A 2I1XA 4TXVB 5B1BB 1KG8A 4YSCA 1BXUA 2UX6A 4K5YA 2AVFA 4UANA 1S52A 1XMEB 2IH8A 2BP8B 1MG2C 4FPDA 2KSYA 5AHYA 4NC3A 1EZLA 1BXAA 2FT7A 5AHZA 3G5WA 2W8CA 3WKPA 2P80D 2FWLB 1HAUA 2XUWA 3NJHA 2EIKB 5I5IA 3FT0A 4A66A 3QJTB 5AZUA 2RACA 4F7KA 3T6VA 1A3ZA 2YCYA 4GRVA 4GY4A 1J9RA 1ETJA 3FYIB 2BWIA 4PAZA 3ABMB 4XTLA 2BW4A 5AZDA 1BRDA 2WJLA 5PCYA 6PCYA 4DPBX 2VSKB 1M0MA 2Y02A 4TL3A 3CDZA 3H4FA 3QBLA 3S8GB 2I7SA 3NJFA 3S3CB 4Q8BA 2BZ7A 3QAPA 3X1BA 1AACA 2XV0A 3ASNB 3COCA 1CYXA 3ASOB 3DKHA 3NT0A 4UHRA 4UF7C 4F2FA 9PCYA 1P8UA 3JT2A 1SNRA 4GXFA 1IW6A 3PCYA 1WA1X 1R2NA 1WS8A 5BR2A 2BO0A 1GUEA 4IAQA 4MD2A 2DYRB 3NJJA 2ZFEA 1IBYA 2VM4A 1QHJA 1QLEB 5I26A 2ZXWB 5FJGA 1J9SA 5ETZA 4OV0A 3HAPA 5AWZA 3NS0A 2CJ3A 4XXJA 2VW4A 4AKOA 1GZMA 2DV6A 2FQDA 2X88A 3DDLA 2Y01A 1ZIAA 1FA4A 4XTNA 1JXGA 1ET5A 2HX9A 2EIJB 3JTBA 3UONA 5BR5A 3GDCA 4HWLA 2FT8A 4BWBA 1AAJA 1JXFA 1OE2A 3QJQB 4AKPA 1ASOA 2PPDA 2YDVA 4GBRA 1OOWA 2BW5A 4KO5A 2GSMB 1QNIA 4E9RA 3NYAA 1UATA 3UZAA 1F88A 1E0PA 5EN0A 4A2FA 1L9HA 3QJUB 5H2HA 1ZDSA 3AYMA 4X4KA 3UTWA 1OCRB 2QPEB 4GP8B 1FBBA 1HZXA 4G72B 3TBCA 1CUOA 5LDUA 2PPCA 1BRXA 2FNWA 1AG6A 1ZDQA 2HLEB 4BEYA 1JZFA 3FU7B 1BRRA 1PLCA 4JR8A 4A2EA 4NAJA 2LLNA 1R1CA 2H3XC 2PP8A 2JXMA 1X0K1 1MZYA 1E5ZA 1M9WA 4WTQA 5H2NA 4AMJA 1A8ZA 4KNSA 3NYKA 4X31A 2DY2A 4HCGA 1SDDA 3IN0A 4YSSA 1DZEA 5B35A 4HHGA 1E67A 2ZOOA 1P8IA 1JZGA 3IN2A 2HRGA 5I5MA 3T45A 2Y00A 1S8JA 2ZIYA 3IBOA 1M57B 5H2PA 1KV7A 4GYCA 2R4SA 5B6ZA 1JERA 1F56A 2GIMA 4KLYA 4P5RA 1XJIA 1IKOP 5B34A 4BV0A 1NINA 3CDZB 4HZ1A 4QIDA 4HCFA 1JGJA 2XX1A 5TGZA 1H2SA 5AX0A 2F93A 5J7AA 2BRDA 4IB4A 5DHHA 2JAFA 2GHZA 2YARA 5I28A 3ZIYA 4QKTA 3FU8A 3VI0A 2VN3A 3UTYA 3TU6A 1QKOA 3WNJA 3QBIA 3S8FB 1WAEA 1L9TA 3QQXA 4JHVA 2MRYA 3AYNA 3X3BA 2B08A 1AR1B 2NRDA 1KDJA 2I20A 3X1NA 4DPAX 1W6LA 2AFNA 3T6XA 1PCSA 3ZX1A 1FBKA 1E5YA 1TN0A 1GY2A 1IXFA 1PNCA 1L9QA 2G87A 3HASA 1MZZA 3OMIB 1OV8A 1C8RA 1Q5IA 1OCOB 3HEIB 4KNFA 2DWTA 4NB7A 3QJVB 2OJ1A 4L6RA 2ZZLA 3X2QB 3VHZA 1NIDA 1AZUA 5B1AB 1PAZA 1BAWA 5EHFA 3H4HA 3SBQA 2FT6A 4MQTA 5G2CA 2GBAA 2PLTA 1KYAA 1TEGA 2IAAC 3C9LA 5G28A 3RZEA 4UG2A 1DYZA 1NIAA 4JHUA 4A67A 7PAZA 2PCFA 2QDWA 1LN6A 4XT1A 4MFHA 1A4AA 3FSWA 2ZONA 3KW7A 4XT3A 5D4JA 4G70B 1RKRA 5D4IA 4ZK8A 3S3BB 3TA4D 5AX1A 3S3DB 4DP6X 5I6MA 1B3IA 2CAKA 2J5WA 1O0AA 3OAXA 3AG1B 1X9UA 3HARA 2H5UA 6PAZA 3UTVA 4E9TA 5ITCA 3MBWB 3D12B 3T71A 4DP7X 4DP2X 4YSUA 1HFUA 1PMYA 1JV7A 5TK2A 3UADA 1KCWA 4CSZA 1ID2A 3FQYA 5F8UA 1YLBB 4KO6A 3NSDA 3AG3B 1ZPUA 3OD3A 3PAZA 3ZEVA 1SHXA 1JVOA 2PPEA 4DP1X 1KMEA 1I53A 1X0SA 1JZIA 3OE9A 4E9XA 2YCWA 4DP9X 2TSBA 2GI0A 1AANA 3NP4A 3V9CA 4YSQA 5B6WA 1JV6A 2WSDA 2XV2A 4CSPA 5B1JA 1AZCA 2R4RA 3SBPA 4DPCX 1AZBA 1SFHA 1OF0A 2XV3A 5D4HA 5B3SB 1P8HA 2WO3B 2Y69B 3PXLA 4HHWA 2CCWA 3EH3B 5LWEA 1GS7A 4AX3A 2L6XA 2YCZA 3CAPA 3PWHA 4DAJA 1SDDB 1V10A 2W88A 3UTXA 4JKNA 4YSDA 4HYJA 3FSVA 2IDQA 2CBPA 1DZ0A 3AZUA 3KW8A 5B1JC 2YDOA 1IUZA 2R7EA 3ABGA 3WNIA 1PZAA 1A4BA 1GW0A 2YAQA 4Y9HA 3PDSA 4QRYA 4JKVA 1GYCA 4BDVA 2QDVA 1KBWA 2RH1A 3D4SA 4A2GA 3HAOA 4DP0X 1PLBA 3U25A 3ZDWA 3ABKB 3AM6A 1TU2A 1C3WA 5AFAA 1PY6A 1IC0A 1AP9A 1NIFA 1L9SA 2I21A 2YAFA 2TSAA 2P80A 1JXDA 2VM3A 5B7MA 3DTUB 1S54A 1TEFA 1ET8A 1A65A 2IWKA 4L35A 2OV0A 3ZBMA 4EJ4A 2Y03A 4DJHA 1CYWA 1Q5JA 1AT9A 1C8SA 1NDTA 1NPJA 2IDSA 5H2LA 4WW3A 2FQEA 4YVNA 3NJLA 5F7BA 3A7KA 4LDOA 1AIZA 3BVDB 1KGYE 3PXOA 4HALA 1BXVA 4HAKA 1BQKA 2ZWNA 3FPYA 1JOIA 1L9OA 1AS8A 1AOZA 1AS7A 1L9PA 5A7EA 4MD1A 4AZUA 1HAWA 3PQRA 5B1KA 1GR7A 2LNLA 1H68A 1X9RA 1JZJA 4DP8X 5H2OA 1A4CA 5F7AA 1R84A 1SFDA 1L9RA 2PCYA 1NIEA 3AG2B 1GU8A 2HRHA 1ASQA 4PCYA 2VW7A 2XLLA 5B6YA 3SBRA 4AI7A 4AKQA 2BZCA 3ZPRA 3KJ6A 3X1FA 1IW9A 3QAKA 1FWXA 1QM8A 1UAZA 4AMIA 3NJKA 3QBKA 4KNUA 3WIAA 1F50A 1J5CA 4N8UA 3ERXA 1J9QA 4MQSA 3NSFA 1ASPA 4P5SA 2HZHA 4YSOA 1X0I1 1NPNA 3FQ1A 1CURA 1JZEA 3FU9A 1NICA 4LDLA
chains in the Genus database with same CATH superfamily
2OSYA 4AH2A 3F7PC 3RVTC 3S96A 1B2YA 2OTPA 5K1VA 3VXMB 3VH8B 1YZZA 3CZKA 1ET7A 1U2YA 1FC2D 3MRHB 3TJEH 1ZT4A 3IDNA 4GKSA 1P9MC 3QZLA 5TGBA 3RG1C 4HUVA 1GHFH 3EADA 4U6HA 5KVDH 3EFFA 3K2UL 4XGZB 5E6IA 1LD9A 4QUOA 5JR1L 3NMEA 5DLML 1S4IA 2DQGH 2PXYA 1FGNL 4KZDL 4HKXB 4K9JA 2OJZH 4XO8A 3ZQXA 1DVSA 3N5AA 2YOCA 4IJ3C 1SYVA 1MAKA 4GO8A 5D1ZA 2E4TA 4FBZA 3T0ED 2NTWA 2CRIA 1WH0A 1R5VA 4HJEA 5H2BA 1DVZA 2PPFA 3NFPA 3PWVB 1PZBA 1NSNL 1TU2B 4Z3FA 3UTQB 3X1GA 4XT1C 4PRPB 3QDMD 5KKHA 2KS9A 1RLBA 4J4QA 5F7DA 4R26H 4IIQC 4JY4A 1BBDL 3QG6B 4HUWB 4Y2DD 3FB7B 3K72B 4WFFE 1I3RB 3KNBA 4LVNB 5DO2D 5J13B 1PSKL 1DO6A 1N0LB 2NX5D 4F80A 1GXEA 1JHKL 1ILUA 1PXRA 3CMGA 1RK1B 4PP2A 2M1KA 3EJRA 4LEOB 3KPNB 2WTRB 2KYIA 3IGFA 3MV7A 5E00B 1QFWL 4D9LL 4EOWL 2UWEB 4ZG1A 5GIRB 1OPOA 3PHOA 2NLJA 1U95A 1KBPA 3OAYH 4UT6L 3U2IA 1N26A 1WD8A 4ZO7A 5F3HB 3TZVB 2WBWB 1CGUA 3S0PA 5EO1B 1IBDA 1N4XL 5D7KE 4OM1H 4PVBA 2AI0L 3Q2WA 4PJBB 4OKVA 3NABL 3PPSA 4PJHA 5JHLL 1S51A 4WWKD 5HGDB 1S9XB 5DUMH 4BH7A 4P23D 1FFNB 2QT6A 3EF7A 1JZ4A 1MAML 1WZMA 1I3VA 4L0PB 4XN2A 5CAYB 5FO8A 5J06A 3MFGB 4N1EA 4U1JB 5F9WC 1S9YB 4IBTA 5C0ND 2QVTA 3B3BA 5A44A 5AOIA 4UU9B 4X80H 4MNHB 3VW3L 2R2EB 3KGSA 3N42F 1T5WB 2D03L 2F08A 4GQZA 3A67L 3A4EA 3QUXB 4QF1A 5DJ2A 1XIWC 1KNOB 3NBNA 4QRRE 1XDTT 1LLAA 2OQJB 3H7BA 4Y8DC 2WWMC 1NBZB 5LWYL 3K6SA 2AVGA 4H0LC 4LLMA 5D2LF 4YZFE 3ECQA 4BWUA 4NCC2 1J5DA 3Q8EA 3FN3A 4GXUM 4AGQA 3ECBA 2ZKMX 1CGTA 3A6CL 3O9WC 1KIPA 2P52A 4QJ3B 3SDCD 2ZCHH 3OE0A 1S7RA 1T5KA 3I6LE 4NQXA 3D39B 4PREA 3G6JE 3JVGA 3DX3A 3TVMD 3VXPB 3VWJA 1MSPA 4RX4D 1TO4A 3D85A 5HGAB 1NGZA 1F1GA 2PYED 3RILA 1DQML 1QSFB 4R90H 4G5ZL 2JF1A 5B3JE 1FCCA 1WWAX 3FHAA 3MRNA 1HCFX 3B7YA 5IIEB 4UDUB 5DMKB 2P4AB 2UXGA 1S7QB 1JZHA 2J8UF 4LQFL 4PJ7B 4XVTH 2BSRA 3CQQA 4AL8L 5ISZD 1CC3A 4MBRA 1RZ8B 5FYKE 2DM4A 3DTDA 3DK2A 4GW4A 4NIKB 1U8NB 2WLIB 4N0UA 1CICC 4POZD 2F58L 2NTFA 3H85A 4UDTB 4KPHL 1FE8H 4PGBA 1Z9PA 4WCYH 1UM6H 4PJ8B 5AKTA 2COQA 4L37A 1WF5A 3GXUB 5DVNA 4ANWA 4EI5D 1HKLH 4KXZI 4XCYA 1DJZA 3GRGA 1QSZA 3TT1L 3WTUA 1F18A 1FNGA 2EDDA 2KI6A 3HC0B 4R8WL 4JPSA 2RR3A 4ELKA 4PN6A 3PAUA 3QC6X 5D1QE 2BSCA 3B9AA 4AYFB 2P5WD 4LIQL 5AKRA 5JXAL 1WP6A 4LVEA 4XB8A 1A1MB 1NCNA 5DD6A 5TQ0H 2ZYSA 1GY1A 2DQFB 2FSEA 5IVXE 4F15B 4FMVA 3D18B 5H2KA 1XB6A 1Z9SB 1WC7A 3KPOA 3P3TA 1OPGH 4AJWA 1D6VL 2JTDA 4LCWE 5HD8C 3AC0A 4FJ6A 2EDRA 4K8RD 3EFOB 1UWEL 2APVA 4NO5B 4PRNA 5E4EB 3SIKA 4ZFQA 3T4AB 3BUQA 3CIAA 3PWPB 3DX8B 3WKPA 1TJGH 2EIKB 4GKOA 3OKYA 1QRND 3WIFB 2EO1A 1T2XA 3BE1L 3MLZH 4J4PC 35C8L 4ISVB 1J9RA 3MN8A 1HDMA 2DQGL 4F3FA 3ARDA 4U1SB 2IQAA 4JKLA 1J8RA 1MQ8A 2Z92B 3FBQA 3NG5A 3Q9QA 4BK8A 5L88H 1VACB 4X6DE 3WDHA 1D2PA 5KSVB 2VLJB 3PG2A 5CSZB 3O4OB 1SLVA 3QEQD 4PJFE 1M4KA 1HIMH 1HHIB 2W60B 4Y5XB 4CSTA 3BVWA 4WJ5B 4IHOB 3S37L 2ZICA 3GSRA 4D0BA 3UTPE 4OGYH 4QRUB 3C5JA 4K2UL 4YNYB 3DX0A 5ACMA 1SOSA 1CQYA 3GGWA 5CGMA 2XSKA 1P4UA 4MXWH 5CBAA 1AXTH 3B2UC 3KDMB 3NN8A 4NZRL 3QDJA 4NFDA 2YGVA 3QRGH 2J1XA 1UEYA 4IW4C 3TEUA 4KJQC 3KLDA 2JB6A 3IMVA 3JTBA 2QR0B 2X53A 1VHPA 1NEZA 5E1HB 1RJLA 1G7PA 2FT8A 4PV8B 2VXVH 1JGVH 3AUWB 3QJQB 1KCRL 4DEPC 4M7KL 5BPPA 2JJSC 1IAIL 3D09A 4OM1L 3CFMA 1UATA 1F2XK 4YFEA 2XXMB 1BZOA 4O2CB 2YPKA 5HDBB 2HLFC 3OF6A 3N1MC 1CO1A 2M83A 1I9JL 1YJDL 2AJUH 5DMJB 5EU4A 4GUPB 2FZ3B 2X4TA 5FK9A 2DMBA 1WITA 2GAZA 3KXFD 4KQ3H 2O5YL 3QJFA 4X8JA 2YSSB 2YWZA 2H2PC 1Q4NX 1ZDQA 2EDOA 3FO2A 4X7CC 5B21A 1P7HL 3ZR5A 4LOUC 5LG6A 3U9UA 4Y5YB 2H3XC 3NSXA 1WICA 4M4PA 4NKIH 2DIEA 4KXDA 2WMPB 4YZWA 2CKBH 4X31A 1SDDA 2VL5B 1AGFB 3GMPA 5JW3H 4PJEA 5CLXA 1XGQA 3CFEA 4GW5B 5L4MA 4AQ1C 5ABDE 4HUMB 2UYLB 1JCKA 1PX8A 3B5HA 3KWUA 3OLEA 5J7CC 4KLYA 1HJBC 3TIEB 5BVJA 1GZQA 1KPUA 2EYSA 3ZDYF 1Z3RA 1YMMA 3PP3K 4WWNA 5AYTA 1H2SA 2F93A 5LAXA 1H5BB 2W9EH 2Z7UA 4YMPA 4IM8A 4FKEA 4L8BA 2YBRA 3EYFA 5G4MA 4QRPD 3VRLF 1XHHA 3V79C 3G5VA 3L5WB 3QBIA 3S8FB 1N8OE 2NY6C 2X4UA 3OR7B 3C9NA 3MYJB 2FEDD 4UQ2B 5A16B 1CFSA 3L2LA 4NCDA 4E0RA 3PXHA 5GZNA 3MJ6A 5IMOB 5EBGA 2AFNA 3BH9A 1IC5H 2FDBP 3BKJH 3PREA 4BUQA 1QI5A 4MB5A 1ROWA 2GJ6E 4HT1H 4MS8D 5C0RH 3CBJB 2ZPKL 3FAXA 1FE8L 1VEOA 4AW7A 4WCYL 1UM6L 2W0PA 3X2QB 1G7LB 3I9PA 2GITA 5FO7B 3QVAA 3SGJA 2V9TA 1KT2A 2GBAA 4MJID 2HT4C 3UTOA 4M1DH 4U1GC 1BIIB 4XPTH 3TCTA 1CG9B 5HSFA 4M56A 3D0LA 2HPTA 3W9EB 2ZKHH 2QKIA 3S3BB 5FDWA 3S3DB 1PLGH 2VXUH 1A64A 3ZKMC 1O0AA 1E5UI 1YCSA 1V3LA 2YC1A 4MX7B 1TQTA 2B4CC 1EHLL 5I1LB 5TE7L 2H5UA 2QADC 3V6OC 2HP4A 4EUPH 1YQVH 1PMYA 4AWJC 1OPGL 2R27A 2A74A 3HE6B 2WKLA 5E5RB 5TTRA 4MAZA 2OXGB 3I9AA 3QQ9D 4CVZB 2NY1C 4KMQA 2AQ3A 4KVNH 4AGPA 4TLSA 1NGWA 4HC1A 1U4EA 4YX2H 2AJZB 4KC3B 1TJGL 3GJFB 5D71L 3T3MF 1XGTA 2VRQA 5F96L 4Q97A 3FBKA 4PJ5E 4LBAA 1IQDB 4P3DB 5EU6E 5FM8A 3QIUD 2XWTB 1NCIA 2XVLA 2EJ1A 5CO1A 4DPCX 1F6FB 4FFYH 5JIHA 4FP8H 3ZDZF 3MOAH 4MNQB 3GUFA 4WHYG 2AXJA 4AX3A 3CAPA 1ZLUH 3VB9A 5L88L 2P8PB 1AXSA 3FSVA 4PJ6A 2OYPA 5FUZH 5A7BA 5BRQA 3ATEA 2YZ1A 2X70A 5CHNB 2OI9B 2M26A 5SWSE 3HS0B 1HIML 2UZIL 4MMXB 4QHNB 5EC1A 3MLPA 1LVEA 2PYFA 4Z7QE 3CFNA 5JOPE 3R8BB 5BRPA 1BP3B 1UWXH 2OMZB 1GJWA 3PL6B 1TLMA 3PF2A 1IKFH 1U8KA 5I82A 3MPCA 2BVPB 2YKLH 4Y4KC 4JAMA 1ZGLP 1AIFB 2YD0A 5JLZB 4YXLL 1BREA 3CFDB 5CN2A 5FUOH 2MFNA 2AV1B 5EBLB 5E4OA 1TQVA 3UTZB 4AMKH 1B4TA 1LYQA 2OXHB 1FUNA 3WMSA 2XQYG 4U05A 1DEEB 2DI8A 2Y03A 2DWDA 1C8SA 3U4EB 4JJHA 1WZ1H 1UJ3C 3WLBB 4NO3A 5LBSA 3WTVA 3STZB 1KGYE 5CJXC 1JGVL 4AVHA 3K6IA 4L1LA 4P5TD 2E7HA 3HRZC 4KKPA 1NCUA 2X4SA 1G9EA 1IGMH 2ZCLH 3WEOA 2JK5B 1OTUC 5ENWB 3TA3C 1HT6A 3D0VB 4ODWB 3L4ZA 2WBJA 5L2JA 1QBMH 1MFUA 3Q8BA 5KOMC 5AZEL 1UTDA 4HIIA 5DD1H 1R3HA 4E42A 2AJUL 4WI0A 4PJGF 4OZHE 4AGMA 4QXUL 5T33H 2FO4A 2IJ0C 5I30L 4JVPA 3HFFA 4NPYB 2V3DA 4AMIA 3TBYA 1MWAH 3CHXA 4KNUA 3MBEB 5GGVL 3VJ6A 5D2LB 2C1PA 4J3UA 3U1SL 4NHCL 2BNRA 2N0KA 1BW8A 2VT0A 3QA3B 2NY5L 5I8EA 3SYQA 2R1YB 4HJJL 4Q6IC 5CUSL 2LTQC 2BNQB 4B95C 2IADA 1LILA 3DURB 4UOW1 4N6HA 1L9MA 2EYRA 5A6IA 5JW3L 5B38B 1NC2D 1MUJA 2YUVA 1UM4H 3GBNH 4S2SA 3K46A 2AJXL 2YXMA 1HH6A 3VDBA 2YPLA 2HPYA 1WCQA 4E9WA 2DWSA 1U92A 3DPDA 3ESOA 3TBBA 4ZYKA 4JO3H 5AAMC 2J8UB 3L4YA 4DVBA 4HS6A 3SDDC 1RULH 1J7VR 4L8SA 5C1MA 1OGTA 4G8IB 2X1WL 5AYUL 4UMGA 1BF5A 3JTSB 1XF3A 4KV5E 3IDIB 1NCJA 3IE4A 3FH7A 3K71A 4BDVB 2KSAA 5EU5B 4ZMQA 3BXNB 4OFKA 1U21A 3X3FL 3RNKB 3BKJL 1IC5L 3UTTB 4KFZC 2IDCA 3QEHA 4CU7A 1D7FA 2ENYA 4LCCA 3V2YA 1YN6A 4HT1L 4O4YH 1TSHA 1UUNA 5JIIA 3ZUCA 3BWSA 1OP4A 1VFAB 4MA8H 3JZYA 4JQIA 4Y16D 2PTVA 1ITBB 4X4MA 1P7KB 2EIMB 2EZ0D 4EF3A 1WAPA 3PWUB 2IBZY 5IM7B 4W4OC 3BT2H 5C07E 3A4FA 2YUWA 4JQVC 1LO4H 5T1KA 4Z9KB 4Y2DB 4BGDA 2BOCB 5I1EH 5IW1A 4UQDA 3CNKA 4XPTL 2Y04A 2H1LM 1T7XA 2HYMA 4FXGA 4KFMA 5E9NA 5HHOE 3W5NA 3VXRB 1ACZA 3UPRB 2O61A 2XYCA 2VZ1A 2YCXA 3RTQC 1R3JB 2VR7A 5KYYA 3UZCA 3WGUB 4K23L 4P46C 4RZCA 5K59F 1REIA 4WWOA 3V7MA 1BYPA 3UTSD 4YJZL 3DRQB 5IB5A 3NFSL 4PJ9C 1T7ZA 4FYRA 2YQBA 4FCAA 5DC9B 1FVEA 4PLNC 2G2PA 4JE4B 4PRHD 4R7XA 1ORSB 4YX2L 4B96A 1X7TA 1SJVA 3HG1B 2XWZA 3MGOA 2YIHA 3T0WA 4WWKB 3O8XC 3N3EA 2OULB 4PG9B 5GZOA 1N6QH 4ZZFA 3FZUC 5TJWK 2WLYA 5IW6A 5B2NA 1UKQA 3H56A 3IMRA 4FP8L 5DRNA 5EH1A 1E50A 2ITCA 4HX1B 4NKMB 4PB9L 1X6NA 4GBXD 4MAYA 1FIGL 2AT9A 3OR6B 1XB3A 3MRLA 2R56H 4HJSA 4AG4H 4EA3A 5HPMB 4FQJH 5G2NA 5HHVL 5I1CH 4F5CE 3HMXH 2X4PA 4PJAF 3L5XL 2A9CA 1NAML 2IDUA 1ZPLA 3FJTA 4RMBA 4Z7VE 3W39B 1NTDA 4I0CC 3SKNA 3O6ML 1OB1B 1XZ0B 2WY3B 8CGTA 3TVMB 3PJSB 1U8QB 2W9LA 4LHUB 3AQYA 3QNYA 5FUOL 3EXLA 2GUOB 3BO8B 1TQBC 2PYEB 3ARFA 3ZLQC 5ID1A 4E41D 1MJ8L 3HCVB 1Z7JA 2HFEB 3WN5B 5J11C 1XB8A 2EKSB 3F2LA 1WZ1L 3O45A 1G6RA 1KLGA 4FLQA 4OF0A 5JPNB 1GGUA 4I13B 4X0KB 1EH9A 2GJJA 4N6RB 5ISZB 3C2AH 2QBWA 3O3UN 5CU5A 4Y4HD 4UIKL 4I0PC 1I1YA 2ZCLL 4F58L 4TNWK 1LO0L 2FHFA 4KKQA 3WNOA 1QBML 1ZE3C 4LPVA 5TDPB 4ORGA 3W82A 4EI5B 1ZV2A 4IDLA 4OM0H 2YD1A 2ZXAA 3EYQC 4N25A 1H3WM 3FQRB 4OLWH 3D8MA 4IBLT 2J2ZB 4QRRA 5T33L 1CR9L 2KQMA 3NCYP 4QHKI 1HHJB 4H20H 2M3GA 1T20A 3BUPA 2P5WB 1OB0A 2LQRA 3IGUA 5EO0B 2EIZB 3MUGA 1R3LB 4Z8FL 3LB6C 1MVYA 2IAMA 4XVSL 3MNWA 4EO5A 2E9IA 1MPAH 4MLIA 2V5MA 4OH2A 2ICWJ 5E6IC 2CGRH 4JN1L 1BXUA 3ZDYB 2AVFA 1IC7L 4B3VA 1KXQE 5AD0A 1S5IH 1UA7A 3GBNL 3OWEA 5D1ZC 5K39A 4B9YA 4UINH 3IJ9A 5FGSA 4A66A 5C6TL 2V9RA 4JO3L 1KBKA 3RI5K 1JPFA 2DM3A 2Z35B 2ESVD 4ZUVA 1KULA 3OMZA 4NNXA 5I15H 1IGIH 3UFIA 2VXQA 4HXBL 5C09E 2FWSA 2DJMA 3EOBB 2Y02A 1VFBA 2I7SA 5EU3A 1RK0B 4OZIE 2HJKB 5FGCB 1RZJH 2YGPA 3F6IA 1P84K 4K4KA 4XC1H 5I75B 1PYWB 2OZ4L 3H2PA 2QLYA 3V0VA 1IILE 3DLQR 1IW6A 4MQ7A 4TMPA 5BJTA 1TVHB 5D1QA 3SQBA 1UUSA 3DSNA 2R1WB 4ZOAA 5FM5O 4V33A 4NRXA 5BO1L 4A1RA 1YEHL 3BT2L 5IVXA 5AB2A 1ZGLA 5IOPB 4Q56A 1PD6A 5CBEB 1QFUL 3MRCB 4NT6B 1BVNP 4ZXBD 2GFBA 5IFAL 4LCWA 1P84J 3D30A 2HG5A 3FRUB 1ADQL 3P02A 1LEGB 4RSVA 5IBTL 3F5WB 5IV2B 5TH2A 3EOTL 4U0RC 2H7WA 4FA8A 5CMAB 1OE2A 1LE5A 3T3MB 1KIRB 3I74A 1OOWA 3MUHL 3P0VH 1IQWH 2JCCF 1QNIA 3ZYOA 4XP5H 1F90H 3U48A 5IB4A 1KXVA 2F7QA 4JPKH 4X6DA 1MCFA 5FGBA 43C9B 5CGBA 4WTZA 3EO9L 1D9KA 2F19L 4HPOH 3NCXA 4IJTA 4PJFA 3ET9F 2VIRA 3T3PE 1HOEA 2F5BL 2HLEB 12E8H 2G60H 1PZ5B 3HHSB 4JANB 4MMZB 1YEJH 1U9KA 4AG4L 1PCXA 1R1CA 1WBYB 3NCYS 4KI5C 4M8VA 5HJGA 4FQJL 2ZWZA 3RKDD 4RGMC 2J1WA 5I1CL 3P4NA 4NDMB 1BG9A 3SGKA 1XH1A 1YEGL 2ZOTA 3OPZL 2AEIT 1QZ1A 2F8XC 4PGCA 1TQCC 1RFDL 2O6EA 1XCWA 4JM0A 5EG6C 3S2AA 4AQZA 4LLDB 4JZOA 4JFYA 4X98A 5HYQA 4LVOC 4ZDHB 1F56A 4RFNC 3UP6A 1MCIA 1IKOP 1KGWA 3J8F7 3NJVA 5MEOB 3CN2A 1FDLL 3BGAA 1KJ2L 3ZE0B 3EGSB 3GT6A 4WW2F 2CDGA 3GD1C 5KZCD 1HXMA 3P9MB 4L5FL 3JUYA 3UBFA 3SJVE 4PG2A 3F8UB 5AW6B 2APSA 2DKSA 4NAQA 3FUFA 1U8JB 1GKOA 4LLYA 4OD3H 4CL7A 3VFOA 5I1DB 1FVCA 4J3OD 4MS6A 2I20A 3X1NA 2MQGA 4QWWD 3HNSH 4G9DB 3X11A 5BV7B 4HU2A 1L6ZA 3ULVC 3TWYA 2FX8H 3C12A 4K7PY 4ODXA 1MRDH 3FU6A 5DO8A 2DI9A 4LNRA 2MCMA 2Y4SA 3QQ3B 1VENA 1UZ8A 4JY6A 5BS0D 3UBHA 4OT1L 5CWSA 2GPZA 1XGUB 4OM0L 3VU1A 3JWDL 4MQTA 4IRZA 4RDQF 4NYLA 1RUQL 1TEGA 5DZVA 3VXSD 2RALA 5EZIL 4MJIB 2W07B 4FZEL 2G3NA 2PCFA 4B0MM 4EZJA 1XCTA 4H20L 1Q9LB 2ZONA 3JWNH 4XT3A 1UD2A 1UXMA 5I1KH 1QEXA 3MXWH 4UQIM 1HESA 3KPPB 4GAYA 4LEXH 2XV6B 5HYIA 2BS71 1I7UB 2R23B 1MPAL 2XPGB 2XT1B 4HIJA 4YBHA 1IBGL 1M3IA 5INDA 5B39A 1HFUA 2CGRL 5EFIA 2G0KA 3ZL4H 2F5AH 3NSDA 1IARB 3SY0A 3ARDC 2NNRA 4HFUH 4Y4FD 1G1YA 2VDPL 3BLPX 3GJFH 3O3DB 3INOA 4E9XA 5E8NA 3ILPA 2EQDA 1XGYL 2AITA 2UY7B 2R4RA 3NZHL 2GJ6A 4V1DD 3MRDB 2V6HA 1TMCB 2VR5A 1LM8V 4YWGL 3OV6A 1NAKH 4DAJA 3NCJH 1MCCA 1QACA 4F1ZA 4K3DL 5AWNH 3APCA 1ACYL 2ZXEB 1RZJL 3NRQA 4WFGE 3NRPA 4XC1L 2OMXA 3VNYA 2GSIA 2Y7LA 2R7EA 1TFPA 3CH1A 5GSVB 1QYGH 4PWKA 5J6HA 1WGOA 3KJ4C 2B5IC 4PWFA 1MI5E 3FTUA 2AXGA 4XNXH 2J4WH 3KBHE 2MSPA 2OSWA 2D0FA 3MJGX 1C3WA 1NUDA 4QXGH 3HZMB 1ECYA 3CN1A 4FTVD 4WI7A 5H8DA 1JNLH 2NYYD 3QPXH 3LPFA 1FIEA 1HXKA 4G8FB 4KTYA 2K45A 1JXDA 2BMKB 2YQ2A 4S1SH 5IFJB 3OJ2C 2YD5A 3WNNA 2B8OT 2F6AA 1RAMA 5AUMB 1CD1A 2WN2A 4URTB 5I24A 1SXAA 4K3HA 2A4ZA 3ARUA 3LQAC 3BW9A 4G6AC 4KGJA 3B3IB 4LDOA 2KLSA 4KKLD 3DGCR 4HCRH 4JO1L 1ZEAH 4RAVB 3LEXB 1DBBH 2R0ZL 4JJ5A 4IJ3B 4PIBA 4L4VB 5E9AA 2QHRL 4U1IA 1OP3K 5EU6A 3P0VL 1IQWL 1U8HB 3QPQD 1OAQH 5F7NC 4MD1A 5IG7B 2XTJC 1JZJA 4B9PA 3ZYIA 4J3OF 1A6VL 4Z77A 1BGXH 1UB6A 1IIIA 1W72B 4JPKL 1HVXA 1X5LA 4UZSA 4H25A 5AAPA 3FFDA 1VCAA 2XLLA 2WXJA 4PWJA 4WO4A 4IIQB 4F93B 5M7QA 3KJ6A 1F86A 1JDDA 5AVUB 5SWSA 1RZIA 1IW9A 5HHXH 1G9NL 2BP5M 4X7FC 1V7NH 4AQ8A 2RQEA 1BMGA 3CDGB 5HHQA 5D1XC 4KXCA 2Z8RA 3HS8A 1WD9A 3KPSD 5AG8A 4RNRB 3BEVB 4N2DA 3LVTA 1LO2H 1YMHB 3BQVA 3HC2A 4FG4A 4N2GA 2ZX7A 4HWEL 3S4SB 2MHAB 3AY2A 3UYPA 3U30C 3IXTB 4ZPVA 2Z7WA 4HSQA 4HK0B 5IR1A 2IH9A 1BCIA 4Q6YA 3IF1B 3VTTA 3O2DL 5KG9A 1NC2B 1EAPA 1WZAA 4JEGB 2EYTB 4X6BA 4KO9A 1AGBA 3CGTA 5JW5A 2OW6A 4LLUA 5GZNC 3D6GA 2G4EA 2X9ZA 3GHPA 3PE9A 4I5BB 1KEMH 1S5HA 3KPLB 3K2KA 4AQAA 3EJTA 3BZFB 4NN6B 2BSDA 3BSGA 4FABL 1BMZA 5IMKA 3VRJA 3VGAA 4HAFA 3REWB 5KYWB 2G5BA 3SGJC 1QO3B 4QDGA 1NFIA 5EEXA 3GKZA 3HNSL 2X72A 3PGFL 2EDQA 2IH3A 4OZHA 1MW2A 4RLDA 3CHQA 4ACPA 3IPEA 4UNTA 1CWVA 2ZUTA 5CEXB 4LPYA 3BCFA 3Q6FB 2HG0A 5TE4H 3T0BA 4L2YA 5E51A 4XX1G 4IBZA 3VXNB 1WAAF 4L3AA 4ZFOL 1A6WL 3QBGA 2NXYD 4MDRA 1L3NA 1T89A 4W1TA 4A2LA 3IYLW 1XSJA 5I17B 2X6VA 2A74C 3EOAB 3I02B 1JSYA 2BVYA 3RX5A 2VERA 4H8QA 5I1KL 4P2QB 2QGCA 2H1PL 1Q9KB 3FQNA 3B9VA 1WRFA 2BCKB 1MVFA 2WHVA 1ZGLM 5JNYB 3QHZH 2LR4A 5EOQH 4ES8A 1KLUA 3BWZA 3ISRA 4AV4A 4JGNA 2F53E 5B6XA 1BLNB 3OMNB 2F5AL 1M0KA 2P5PA 4PSRA 4FQCH 4U1KA 4F57L 5A45A 4QGTA 4ENED 4ZOEA 5KSAD 1ML0A 2G2RA 4FXKA 2VM9A 2VDRL 3VI3E 3FO0H 4NI3A 4ICXA 2HCZX 2E86A 4FMKA 4O02B 4X9YA 4UQEA 4ZQKB 1A5FH 3IVKB 4BKSC 1XXFC 4KROC 3RU8H 4N5EC 4PJIF 1EEZB 1TPXB 2WINA 4GBXB 3P40A 1U93A 4M6ML 5G4NA 2X2YA 2VLKB 4GRLD 2JIXB 4QAWA 3TH3T 3WEAA 1TO5A 1T83C 2UXTA 2BP0B 3MNZB 1QYGL 5KYNA 4P5KB 2G75A 2EC9T 4PBVC 4HF5H 4OD2A 5HHOA 1BF2A 1XAKA 3DMMA 5ANMA 1NFDE 4KK6C 4F7PA 1DN2A 2PXYD 3X17A 1YPZF 4XXWA 3LEVL 3I75A 2HFFA 2JAGA 3HUJF 5HYSG 3WEXB 1HSAB 3BD5A 1C08A 1T21B 4S1SL 5AVTB 2E46A 1PJ9A 3NSCA 2B3IA 4E41B 4DERA 3P0GA 5HI4C 4EIUA 2VRKA 4L3EE 4JFPB 2EH8H 1NH6A 4F2ME 1U42A 2RCSH 2WBJC 2A4CA 2I60L 5CZXC 1BEXA 3C9MA 1GS6X 4O9HH 4Z1PA 3QNXA 1DBBL 2SEBB 4HZLB 4YXHH 1JHTA 1R19A 1M53A 1DUYA 1HEZA 3BGMA 4Y4HB 3UAJA 1OAQL 2ZXBA 3DO4A 2P8LA 2FEEI 2YXWA 1N5AA 5DC0A 4XI5D 3ATAA 1M7XA 3ZL2A 4OZFA 2LABA 3NDYE 3FHEA 5DURD 1AZNA 5ICXA 2Z55A 4YEFA 4V2BA 4XVJH 1QR1A 4UAOC 3WTTA 2I9TB 1IV8A 3BVXA 1X5JA 4HWBA 5L0QC 5HHXL 3ILEA 1JIBA 5D70H 5IWLC 3G6AA 4AIEA 4Z7VA 5JXED 1SOXA 4FQ1H 4OJDH 4YK4B 3HOGA 4RWYH 3GO1L 2ETWA 1WA2X 1SBSL 4MYPA 1LO2L 1R5IB 2W65A 2X6CA 2OMVB 4OFIA 3A3YB 4X5LA 5G53A 1OEZW 4EI6B 2EP6A 4A55A 1JTPA 3MXVH 4XN1A 5MEQA 3ESVF 2VZUA 4U1NB 3VD5A 3C5ZC 5E8PB 3SB3A 4K8RH 2KSYA 3RHWF 3OAWA 4DEPB 2GW5A 1I85A 2IBZX 4UOJA 4ABQA 1DE4A 4KJPD 4AUUA 2PETA 3BKML 4KRPC 1BD2B 3MLTB 4LSUH 1DSYA 4XMPL 3VFTA 1PX4A 5AB0A 1G9ML 2ESVB 4FKHA 2V2WA 3EYOA 3S34L 3HZ3A 4QHUA 1DBML 2VDLL 2VSKB 5D9SA 2V5TA 3KPMA 4OGAC 1RJYB 2VLLB 3ZRSA 1TEYA 5IVNA 2GQHA 2H26B 2BZ7A 3QAPA 1QVOA 3HZYB 2XV0A 4AT6B 2EE2A 1CYXA 3FQXB 3FOMB 2OR7A 3CN3A 4GXVH 4QTIH 3P30H 2XC8A 4FA6A 4BUGA 4FXGC 2E6QA 1Q9OA 4IRJD 2KZKA 3MVSA 4X9GA 1UQSB 3GSWA 4X6CB 4XCEB 3NCCB 4Q2ZB 1CDBA 1J9SA 4ZMYA 4Z0BH 5BMFH 3VD9A 3QZNA 1H8NA 4Y19E 4X50A 4AQ1B 3TO2A 3ZZ1A 1RZFH 3UJIL 4ETQB 1KXTA 2NY7H 3CE1A 2CUHA 3HG3A 2K4AA 2P7TB 3DXAA 4ZXBB 1KXQA 5F7LB 1ZSDA 2HX9A 3DX9A 1ZHLA 2WBXA 1FJ1B 3UONA 5BR5A 3NCWA 3KMDA 4JHBA 5E7BA 1QLRB 2EDMA 4PY8I 1T66D 3QHZL 5EOQL 5GZOC 2R59A 3RWGA 3RTLA 4JFQB 3FB6B 3H1ZA 4LFHD 4H44C 4YDJB 1IL1B 4FQIH 5LN4A 5DEGB 1HWGB 1A14H 4UQBA 3FCGA 2X12A 2M2DA 2XWRA 5IF0B 1EHAA 3DJSA 3GI9H 1PZDA 3VO0A 4GKNB 4MYWB 3VCLB 2D4DA 5LVEA 4OZIA 5JO5B 4MSWA 1AH1A 3BUDA 1YUHB 3U2SA 5JPMA 2XRAH 1A5FL 3JWOH 1GPOH 2YO3A 4YH6A 1JZFA 4F7EA 1BRRA 2QFPA 4QHMB 3A4DA 2JXMA 5GSRB 1LQSR 5H2NA 1X5KA 4J1UB 4DVRH 1JMZA 3GIVA 5D6CB 3SOBL 1TF4A 4MHHG 2AERT 3N9GL 3AJ7A 5I5MA 2QADB 1S9VA 3EJCA 3IMBA 1ACCA 1G7MB 1FORH 2GCYA 2NY1B 4PJHF 4N1CA 2KZ1B 1EMTH 1QPKA 4W9EC 1MCLA 5DJAA 5C0FA 4YXKL 3DX2A 4DW2H 5I28A 2LE9A 5CEZH 5TDNA 3WNJA 4U1LB 5HGBA 1QNZH 1O5DT 4OV5B 1DJXA 1MCHA 2WJ7A 1KGJA 2F54B 4H8UA 2XVKA 4L9LB 2C7UB 4U7MA 1GJIA 1UOLA 4HJ0D 5D7LD 4RGNE 3RIFK 3BN3B 1NMAL 3Q1EA 4OAWA 5BV7H 4KK5C 4RMQA 5AG9A 1F3RB 4BQ8A 1IXFA 1NBYB 3CFJB 3MACH 3OSVA 4JRYE 4HQQH 1OV8A 4P3CL 3DO7A 2IPUK 2C34A 2GEQA 1T7WA 4KNFA 4YE4H 2DWTA 1VGKA 4NB7A 4NKDB 2DMGA 2ICWA 3FQUB 4TOYH 1Z6JT 4PS8A 1NIDA 4H8VA 3ZVVA 5KS9A 4YHYB 5A3ID 3QUKA 2X9YA 2IAMC 1UH3A 4XVJL 4P4KC 2NNAB 3NA4A 2J44A 2ZJSH 2GI7A 4NQSB 4G8GD 3CHPA 3UBXG 3G9VA 5I6MA 4K94C 3LXUX 2NZ9D 1FP5A 2DWEB 3CFIC 3NDZE 4BRJA 1KYUA 1KUMA 3B6SB 2IQ9L 3BGFC 3OF6D 1MCPH 4I18C 4PP1D 1X5HA 5DJ0B 3UADA 1KCWA 1CXHA 4FTDA 2XJLA 1J1OL 1J0ZA 3IMUA 5F3BA 3D52A 2C3VA 4LGRB 4NUGL 3KLAB 4LSTL 1UKTA 1DN0B 3L3IA 3KWWA 5ALBH 3SJVA 3TBVA 4X4XA 4TL5A 4XAWH 3C6LC 3BP6A 2K3TA 4ZW7A 3E6FA 3CTTA 5KYXA 4OFYA 2E9BA 1FO0B 3QO0B 3FRPB 3WJMB 5IQ7H 4X5XA 1UXWA 2H0JA 2QQNH 4LSUL 5ESAB 3TJHD 3VFGH 2A6JA 3CWGA 3KPRD 2Q6WB 2WQRA 3N1QC 4YHPA 2WQSA 5DZOA 5FUCC 3WO3B 4OQTA 2UUDK 4BZ1H 4ZO8A 4KDWA 3D9AH 3REVA 5FYJD 2Z9TA 1UH4A 4GXVL 4KKBC 2C9XA 3ABGA 3WNIA 4I2XE 3BUYB 3QXVA 2H0EA 4JKVA 1JF1A 4Q6IB 2DQUH 3DOSB 2LTQB 3MTXA 4YUEL 3ESNA 4DTGH 4Q52A 5F93C 1OCWH 4PRIE 2ZKWA 3MUY1 1PKQB 4IOSD 2ZG2A 4M03A 5H94A 5BMFL 2L0DA 4IRSD 1NIFA 2A9DA 4FTVB 3LS4L 2ZE0A 2I21A 3FQWB 1NOAA 3T2QA 1IU1A 3MR9B 3SDAB 3UGUA 2PO6C 5B7MA 4HWUA 1T80A 3IAPA 5I1IH 4HS8L 3OKKB 1IAOA 1KXVC 2IANB 3BIKA 5GXBB 2UY6A 3AREA 2Z34A 4POUB 4DKAA 4CU8A 2OMTA 2ADFH 2ADGA 2NSQA 2R4SL 3LZFH 5C0CD 1BQKA 5FGBC 4NC2B 3K4AA 3MNVA 4FS0A 2VE6A 3FN0L 3BN9C 4WUUB 5B1KA 3PQRA 3POHA 3PPEA 1CF8H 1H68A 1ONQB 3OHXC 3G5ZA 1CFNB 1ORQB 4FQIL 4HKJB 1AQDB 2CQVA 2WYTA 3KLKA 2V7HB 1W72H 1AGCA 2R9HD 1K8DA 3UC0L 4A6YA 4A7GF 1I8MB 1L9RA 4PJIB 4C83A 2C9SA 2VW7A 4LMQE 3SBRA 3APNA 4FMFA 4H8HA 2BZCA 3N50A 3IBEA 3ZZSA 4EXPX 2HT3C 3SGKC 3H3KA 1RV6X 2J7LA 3C6SA 3BVTA 3I2CH 3QAKA 1AY1L 4QTFA 1QM8A 3WL9B 4ZSOE 4M7JL 1MLBA 1MI5A 2XRAL 4R4BA 3JWOL 4BCXA 2W91A 4UMSA 2VZVA 5JHDD 2XDHA 1KENH 3KPSB 2P48B 4L4TB 2MQ0A 3FF8A 2FNBA 2OBGA 3RTQB 3TTYA 2Z1KA 2CLVB 1YPZB 1ZT1A 1EZUA 4K7PX 2WQAA 1ZLDA 3HUJB 3A4AA 4H4NA 4FQHA 2YOAA 3MLUH 3SGDI 4KRLB 3ZXAC 2J6WA 3BQUC 1K3ZA 4R97C 4X83A 3VFUA 3DUSB 5D7JC 4YN3A 1EMTL 3NRFA 5KYUB 2FLMA 2IPKA 2E0PA 1JHLH 3DUUB 3GDBA 4DKTA 5ECJE 5HYJD 3HB3D 2DDQL 3NJGA 3K8KA 4NGHL 5HY9A 1CGYA 5CEZL 3AW5A 5IGXL 1G94A 3ZDXE 1QNZL 4FJZA 3EBHA 4XE5B 4JFHD 1XXDC 1U8OB 3WAKA 2I9LA 1M71B 3T0AA 2VT4A 3QJSB 4F37K 4F2FA 5BV7L 5GS0C 5IHZA 3Q43A 5KVFH 1ECZA 1GC1H 2J57A 4LDCA 4OFQA 1CBVL 2FJFB 3Q5YA 3QK0A 1F4AA 3VRIA 1BZ7A 1WLHA 2EINB 3OJDB 3SQRA 4K9EC 5SWZD 3F6LA 4ZFFA 2CKBA 4YE4L 2R2CA 4P06A 4QHPA 4P5MA 2Y07L 3FCSB 3NOIA 2YS4A 3BKYL 3LVEA 1OGAD 3MC0A 4PRAB 5GRJL 5LQBH 3MRIA 4GW1B 1Q0YH 2FQFA 5A2KH 2WKOA 3N41B 2NXYB 3QZMA 4RRPA 1RZPA 4YDZA 2ZJSL 5LCVA 4RFEA 5MENE 5D55A 5FM4A 4TNVK 2E27L 5E2VL 5HGGS 2IC2A 4IMKC 1RUPH 3EO0A 1DVXA 1EBAA 3HZVA 5J11B 4L23A 5EA0L 5BUPA 2YN3A 5A2FA 2FHBA 1B2WL 4R5XA 2ZXGA 3LZQA 4U2YA 4XTRD 1JYWA 1PTZA 3D08A 4CMHB 5TK4A 3RURA 3T1FA 5IB1B 2P44B 3DGGA 4FLSA 2X3AA 4A7UA 3P2TA 3I6SA 1QA9A 5D5MB 4BIKA 4F1SA 5IQNA 1EHKB 3D69B 2GSGB 1C5BL 3QDGE 5PAZA 1A8JH 1RY7B 4N2IA 3BDXA 2ICES 5IQ7L 2QQNL 3RGHA 3QJHA 3H7LA 3GMOB 1WS7A 2XG5A 3FCUB 4GAGL 4O02H 3APFA 4LDLB 3TO4C 5JW4M 2EXWC 3N1GC 1FGVH 4PGDA 3S96B 4OF7A 5FO2A 1PFCA 2FGWH 5GRUL 4BZ1L 3L54A 3HHMA 1H3PH 4GRLB 2AABH 1ZT4B 3IDNB 3V52H 3MREA 2YPLD 4GKSB 4K7PL 5ITFA 4M43L 3BLBA 5TGBB 3ABZA 4HUVB 4B9CA 3FT3B 3MJ9L 4U6HB 1NOLA 3EFFB 5DS8A 4OSUH 4RZKA 5E6IB 1LD9B 3FU0A 3LKSA 1OVZA 1G6VK 4PLOB 3UACA 1V7MH 1KSRA 2PXYB 3GTVA 3EDJA 3K7UA 3WIHH 2UXFA 1SYVB 5D1ZB 2X2UA 4WFHE 1EFXD 4FYSA 3UG9A 2F53A 2DKMA 1R5VB 3CVCA 3LDBC 5IJCC 4PWEA 2PF6A 3L9RA 3NFPB 4E36A 2AXWA 3LN5A 3GPSA 2MCPH 3Q06A 3RGVD 2OCCB 1J8SA 1YC7A 3QI9D 4GPOA 1U8LA 3LZFL 2ARJQ 3F04A 3BD4A 1VGEL 4WO4C 4JY4B 3VI3A 3VI4A 3UAEA 3D4GA 4JDVA 3W38A 4OJYA 2FSDA 4FHKA 4XPGH 4N22A 3UL4A 2V2TA 3KNBB 2VDNB 3LN4A 1GSKA 3IJ7A 4PP2B 2E6JA 4KVCH 1AHMA 2XZQL 3MV7B 2HTKC 3I2CL 2DLIA 2DL9A 2X87A 1NGXA 3PHOB 2NLJB 1U95B 1HL9A 3C60C 3CJJA 3MV9E 3K74B 1NPUA 1TZIA 4MZ2A 2AZAA 4JRFA 5HI3C 4GT0A 1JFPA 1NL0H 5F1OB 4Q4EA 2Q7YA 5DMYA 3MROA 4OKVB 3TFBA 4EN2A 3MMEA 4YSCA 4PJHB 3IKKA 1I1AC 4S11A 4PVMA 4BH7B 5ABZA 4E68A 1XCXA 4Y2OA 2IG2L 4U0RB 1MG2C 1WHOA 2IMNA 5FO8B 2VZTA 3VGAC 4HZAA 4L3EA 4QYOA 3WTSA 1IAII 1EZLA 2LFGA 3W56A 4F2MA 2F7RA 2AV7A 3KH3A 5CJ5A 1KCUH 2O5NA 4MAYD 4ZFZA 2WO4A 2EDFA 5L6YH 5BS0E 3T0EE 4GRVA 4NQVA 5DZ9A 5GS3A 4QF1B 5DJ2B 3S88H 3H7BB 4WFFD 3CDZA 5T5NG 3K6SB 1J18A 4KTEH 1UYWL 2VXSH 3QBLA 2N01B 4LLMB 1VSCA 2VR9A 1OTTD 1MWAA 3LMJH 4M7LT 4G5AA 1GAFH 2EEFA 3ASOB 1KIPB 5DJXA 1IIKA 1S7RB 2SODB 4GXFA 4NQXB 4PREB 4NJAH 5HJDA 4E5XG 1OZUA 3VWJB 3A22A 1U33A 1R2NA 3D85B 2EXTA 4P59L 5AYQA 1NGZB 3UDWA 3QQDA 4G8AC 4WDIA 5DD0H 1H8OA 2NX5E 4FZ8L 1VCBC 1PIFA 2ZOWA 3MRNB 5D7KD 4WU7A 3VFPA 2BHYA 1Q0YL 2J88L 3ILQC 2C26A 3MHZA 3UJJH 5F1IA 1AMYA 2D0HA 1CXEA 2XKNA 3WFBH 2BDNL 4LVOB 4JVUA 1F6LL 2A4EA 1XGZA 2BSRB 4XNDA 2Y01A 4P4RA 1P6AB 2HTLD 2PTUA 3GMLB 3EDDA 4AV5A 1HE8A 3LRSA 4HETA 4UQAA 3ARYA 4GW4B 3L4WA 3GDCA 4N0UB 3C5SA 3GNMH 3WO4B 2NTFB 3SE3C 5AW8B 4PGBB 1IT9L 1FH2A 4JFDA 4L37B 1W9XA 4GBRA 4XCYB 2RA1A 3FTXA 4XWOC 2BW5A 3NH7H 2D7NA 4WGVB 1FNGB 2NY4C 2NY3C 4QRRD 3K91A 2O93L 4Z78A 4ELKB 1RVFH 4NO0A 4DQAA 5F7EH 1UM5H 5HTSA 5KBPA 2ICEA 3K6NA 5CKGA 3CC5B 4FL4B 1G0DA 3IDYB 5DD6B 4DN3L 4O02L 3GTNA 1I3RA 2QPEB 3T0DA 1YY9D 2FSEB 4AMXA 3DGDA 1FGVL 1OW0C 3DMMC 5CZVH 2CO1A 1J1PH 2BCMA 1WC7B 3KPOB 5DHVH 2B2XH 4A2EA 1PIGA 1UD8A 2LLNA 1HL5A 1CLYH 2AABL 4PRNB 4YSSA 3B9EA 4KXAA 4TSAL 1QG3A 3PABA 2B7DT 2JMRA 2DOCA 4KQ4H 2Y00A 4OSUL 5FYKD 1A1NA 3HPLA 2HWZH 3UZVA 4JRXE 1V7ML 1HDMB 2C3XA 2ROYA 4P9HC 2MWCA 1XJIA 2E4FA 1B3JA 2OTUA 3ARDB 5DT1H 2IQAB 5FXCH 3QIWA 3RWEA 3WIHL 2ITEA 5FO9A 1FNFA 2GHZA 4U7KA 2JAFA 3APMA 4QKTA 4F8TA 2H41A 4ABUA 3LZNA 2VN3A 2WW8A 3L1EA 5EIQA 3LHAA 4C4KO 2MCPL 4APXA 1K72A 5D1QD 1VADB 3GLZA 1WUZA 4TSBL 3T6XA 1GYVA 1U0QA 3GSRB 5IK3B 4D0BB 3ELQA 1JTOA 3C5JB 2OCFD 2H6PA 1MZZA 4AENA 1A7RH 3ZTJG 3GGWB 2JJTC 2LV4A 1NBZA 2MKLC 5CBAB 2QQQA 2KMWA 3TYFA 3ARGD 4HXAH 3NN8B 1WGVA 1JPEA 3QDJB 1JJUA 2EO7A 2WWMD 3HI6H 3WN6A 5IT2H 4KVCL 2X09A 3DOHA 5CF3A 3L9EA 2JB6B 1DYZA 1NIAA 2F9BT 3E38A 1NEZB 1RJLB 4N2AA 1G7PB 3IJSA 5J12B 1Y18A 2FK9A 5D4JA 3TA4D 5T1MA 2ZX8A 4JDTL 1Y6NR 5IBLC 1X9UA 3K1DA 5E8EA 1KG0A 4HSAC 1E6OL 1AHWC 3UROR 4JN2A 4EIGB 1F11A 3WXWH 2YPKB 2JVUA 4M00A 1JGUH 1FZKA 2VDQB 1E4XL 5EU4B 1M05A 1D9KD 2X4TB 5FK9B 3LS5L 4XNUL 3MOQA 4W9IC 2GAZB 4NSKA 4HKBA 1T6BX 3QJFB 4X8JB 4UTAH 1FO0H 1M3JA 3F6JA 3L16A 1DBKH 2DD8H 1CICD 3FO2B 3ORJA 3U9UB 3U6RA 4JRYA 5KOVC 3CZEA 2W5PA 3PXLA 3KPRB 4NWTH 4P48A 1IM3A 2CCWA 4YZFF 1SDDB 4KTEL 3NACH 1TZ8A 2VXSL 3O6LH 2CHDA 3GMPB 4PJEB 2C9UA 4AW4A 1GAFL 2WLLA 3DYMA 1XGQB 3CFEB 3G6JF 5B1JC 3MO1A 4YFDB 4FFZH 5HVGB 4M3JA 2WANA 1BPLB 3D33A 1E4WH 1GZQB 5BVJB 3KLHC 1KPUB 1DSWA 1PVHA 2EYSB 3ZZQA 5B3JF 4XNYL 3WCYA 5LAXB 3ABKB 4L8BB 2YBRB 3EYFB 4LCUA 1AP9A 2RFXB 3T4YA 3K6FA 5T5FH 4B9JA 3G5VB 5FF6A 2R29L 3UJJL 1HEHC 5G5DA 3C9NB 3AGVA 4N2MA 4E0RB 1CFSB 4LKCA 4FNLL 3QJZA 4TRPL 5F7KC 1SJXA 1A65A 1P7QA 4MCZB 4Z3TA 3BH9B 1ZTXL 1ZJBA 2Y6SC 1Q5JA 5B7EA 4P2OA 5D72H 5IJVA 4NZ8A 3ZDZE 4TUOA 3VDAA 1L9OA 3B9KA 3ZT7A 2GITB 5LGHL 4GFXA 5TE6L 1L9PA 4JJOA 3EDEA 1KT2B 1V05A 3GS7A 4KKAD 3ZO0A 5J1TC 4EVNA 3TV8A 1NGPH 4ZS7H 3DRTA 3PIQA 3KXFE 2Z7ZA 2DBLH 3MBXH 3WY4A 3EDKA 3QUMA 3D0LB 2XHNA 2XICA 4M48L 2QKIB 5FDWB 3ILDA 3NVQA 4LIQE 2YC1B 4IU3A 4MNGE 5IVXF 4I2XA 4XMZA 1TETL 4GSDL 5BZDA 1FNSL 4JFFE 4U6VH 1NC4D 3U7YH 2QVMA 1A7QH 3FTGA 5F9OH 2A74B 3F58L 1ASPA 3GSOA 2HZHA 1CURA 3B2UD 1QASA 5D2NE 4PRIA 2J1YA 1CLYL 1JI1A 2OTWA 3QJRB 1CQKA 1KJMA 1QQDB 1NGWB 1SXSA 3OKLA 2L7JA 1WSST 2B4CL 3QWRA 1ZOXA 1XIOA 3V0WH 1XGTB 3MJ7A 4K5PA 4KQ4L 1DR9A 3PWNA 2H0FA 4G7RB 2HWZL 4J28A 3VDCA 4QRPE 1KBBA 1ED3A 3EDFA 4ZAKD 1E7UA 1T1XB 4CKQA 5DT1L 1ULVA 4XMKH 3M17A 4IOFC 4X6DF 5MI0C 3E7JA 4HWNA 3RBSA 1AXSB 1CL7H 3OTTA 3HB3B 4PJFF 4N8VA 1NIBA 1TVBA 2X70B 5GHWH 4AIOA 4TN9A 5FA3A 5EC1B 3LQMA 1J0IA 4OZGE 2PYFB 1CDUA 2CJTA 2KSBA 4GO6B 3CU1A 3ECVA 2FLRT 1PZ2A 4HFWA 3SOTA 3V6BR 1U8KB 1MCNA 4XPAL 4JAMB 4IKLA 2H2PD 2XFXA 1BQUA 4PV9A 3RFMA 4ICWA 4LOUD 5FLUA 3SPGA 1JG9A 1HZKA 1FZJA 4R83A 4OLYH 4WHYH 4PPTA 2BIHA 4DOHB 4XB3A 1OGAB 3HKZA 4LQ1A 1YEEL 2UYLA 1IJNA 4LSDA 1BA9A 3C75A 2DWDB 2YGQA 1HHHA 2W92A 1S8LA 1SHWA 1OP5H 4NO3B 4M3HA 2GYSA 1DDHA 3SYOA 1OKEA 4HYXA 1XTLA 4PJ5D 5GJSH 5B0WA 3VB8A 2HRPL 3FT4A 1G4RA 4PH8A 4DP5X 2X4SB 4AM0A 1Z3GH 3D0AA 1LMKA 2YJQA 5I18H 4WI9A 3ZL1A 5L2JB 2WBJB 2A99A 3BPCA 1JGUL 4HIIB 1R3HB 3LKPA 2Q9OA 3QPKA 4B9FA 4WI0B 4Y9FA 2H47C 4ENZA 5ITEA 5SWSD 1RCYA 1F3JA 4EUPG 2AJVH 4BFFA 3BSZL 3UYRH 5JOPD 3TBYB 3VJ6B 4UTAL 2C1PB 2EILB 2X10A 2DD8L 2IFGA 2BNRB 4Y88A 1IM9D 2CUAA 3MKKA 5I8EB 3TT3H 2D3LA 1S3KH 2A1WH 4NWTL 4JNXA 1PQZA 4YC2C 2IADB 3NACL 4GMTH 2R1XA 3SPVA 4ZMAT 1EJ8A 2EYRB 1UVQA 2G5RA 4JFUA 5DC4B 5F44A 1MUJB 3FSAA 3MNMA 1GIGL 4S2SB 1BYOA 1E43A 2EABA 5E8OA 1HH6B 2YPLB 2RHEA 2F74A 4F2EA 1E65A 1U92B 4TQ8A 3NJIA 3T2LA 5MENA 2JQZA 3EYSL 4ZYKB 2OK0H 3HE6A 1JNNL 1AFVH 4DVBB 2OXGA 1QWHA 4HS6B 1BX2A 1BDYA 4L8SB 3OC5A 5C1MB 1OGTB 2Z6FA 4HIQA 1XF3B 1RP8A 3O6FA 4IQHA 2V37A 1ZKAA 2A6DA 3WJLC 1LDPL 3H3PL 1I82A 3K71B 3C08L 1AS6A 1E2WA 2W0LA 4JFZH 4W9GC 2HKFH 3TBSA 4JRWA 5JJNA 3KVQA 4LCCB 2V0AA 3VFWA 1YN6B 1QSEE 3MOBH 5ITBL 3D05A 1A6UL 4HIPA 2Y36H 4JFXA 4W9KC 3QI9B 3ZHKA 5I66A 2GK2A 3QDGA 4F8PA 4APQD 3FUEA 5CHNA 1PGRB 3HS0A 4MMXA 5T1KB 5IW1B 3LRHA 1Q1PA 1JUFA 3P3RA 2VDNH 3MV8E 3IEAA 3O0LA 8FABA 1MREL 4AVKA 2O61B 4UV7H 5J8OA 2ADJA 3IMSA 1E4KA 3R19A 2X0VA 2JNZA 1N7ML 4WNQA 5KYYB 2PTTA 1MIEH 1GH7A 3DVGA 3FT9A 4JO2H 4OJFH 3B56A 1COBA 4DGUA 4EBQL 1YN7A 4RZCB 4IOIA 3RY6A 3BAJA 1AD0A 1H3TA 3U7YL 4PJXE 3OJMB 5IB5B 3MLYH 5LUMA 2E76C 1UOWA 3EH4B 1SXBA 2FO1A 4FAAB 1BEYH 3EJZD 4EZMA 5DYSA 4DHLA 1EPFA 1FVEB 2OMWA 3U4BH 2ORBL 4MAUH 4Y0GA 4TXVB 5B1BB 4HCRA 5LGJB 5EF3A 3MGOB 3F62A 5F8QC 5L9DL 4UANA 1E6JH 3GHBH 4WI5A 1PY9A 3P9LB 5FKPA 3WDJA 5DFWH 3X13A 3BMVA 1UD4A 5IW6B 3WGVB 2W8CA 4GQRA 4LRIA 4EZLA 4GRWE 4LBEB 3RE0A 5I5IA 5ID0A 2PWFA 5DRNB 3FT0A 3VH8G 2VN4A 5T3XH 2ITCB 1A25A 2Y5QA 4XMXA 4E2OA 5ESVA 1PW3A 4MAYB 3T6VA 1A3ZA 4YHNB 2Y9RT 3MRLB 2BWIA 2P5ED 1X5FA 1CL7L 3BPNC 4TSCH 1HEJC 5C07D 3B4NA 3P73A 4EKXA 3UIZA 6PCYA 2XN0A 3AXHA 2BRRL 1HKFA 2O6CA 2XA8L 5I1GH 3COCA 2WAQA 4AK1A 1LEKA 2H6UA 1P8UA 1RIUH 1TITA 1OARH 1FC1A 1A6AA 3B43A 3CMOL 3SKNB 4AIXA 1ZXQA 1IGYA 4GIAA 4ZX6A 3QNYB 1ESOA 3ARFB 2IH1A 3WFDH 5ID1B 5AZ2H 5FJGA 4YBLB 4PJCE 1ZRUA 5KVGH 2YD6A 5AW1B 3O45B 1EK3A 1G6RB 1KLGB 2VW4A 1YDPA 3NK4A 4HJIA 4YHOL 2DB8A 2X88A 3JV5A 4DK3A 4ZMWA 3TF7C 4BSJA 3W0WE 2APXA 4BYHA 4KY1L 4NM4L 3UTSE 4EMZA 1Z5YD 4TNEA 2JKTM 2VDOL 1I1YB 5D93C 2Y2YA 1YNKL 4PRHE 5E2UH 4OLXH 1NCBL 3VFVA 2P42B 5CN3A 1I9IH 4RMTA 2NY2C 1FBIH 3E9TA 4J8QA 4ORGB 3T0EA 2R51A 1JRHH 4HUXA 4OZHF 2BVTA 4ABWA 1FCGA 4J2QA 2EDLA 2E9WA 4NC1E 4QRRB 4UOQA 1ZLUK 2IPTH 3GRWH 5EDSA 3BI9X 5I23A 4NQCE 2CD0A 4XNZC 3QDMA 1T20B 3I9GH 5HDQL 5I0XA 3RWIA 3LD8C 5E94A 1CN4A 5INCA 4ODHH 5LO7A 3MUGB 4DPRA 1IGTA 1MXGA 3IMTA 4C54A 3TT3L 5C2BL 3MNWB 1F3DJ 1S3KL 1UWXK 2A1WL 4XOBA 4OD1H 3CX5K 5DLLA 1BSIA 3H0TB 4Z7UE 2VSCA 3UPRA 2NX5A 1F02I 1KN4L 2PP8A 4XP6L 1R3JA 1E5ZA 5AD0B 2X2JA 4D2NA 5K39B 5AQ0A 1J5IA 2YBGA 1C5CL 2ZOOA 1P8IA 3KL0A 4H0IA 2DQCH 3P4OA 1EWHA 3ALPA 2AJ3A 2AK1L 1JPFB 2GG1A 4ZUVB 1KV7A 3PNRB 1HNFA 1TCMA 4NNXB 4ODUB 3VVWA 2Q8BH 2JCCE 2AK4E 3HFMH 4KV5F 7TAAA 3CX5J 5LNDA 4QIDA 5DQDL 1ZK9A 1VFBB 3QS3A 1IZKA 4IU2A 5EU3B 1JGDA 4JFZL 4P23A 3FNKA 3ZIYA 3SE6A 3CX2A 2HKFL 1QKOA 1EXUA 4I9WE 3TWCH 4ZJ9A 1MHEB 3V0VB 1U8CB 4JHVA 4QOKE 3VSUA 3QUYA 4MQ7B 3MOBL 5D1QB 5DZAA 3SQBB 3RL1A 1TENA 2ARWA 4Q6KA 5DHMC 2Y36L 5EUOF 3B2VL 1UACH 2HKHH 3DSNB 1GY2A 3WS6A 2C8NA 3HASA 2Y22A 1RUKH 2XQBH 1OCOB 2R83A 5K93A 4QJ4B 5IVXB 1ZGLB 1Z5HA 4YQXL 5JYLA 2VDNL 5B1AB 3HVNA 1T3FA 5IJKA 2FECI 2GFBB 4FNTA 4LCWB 4UV7L 1NBQA 3SDCA 4N26A 1OB1A 2HG5B 2VO5A 1MIEL 4JO2L 1IO4C 4XN9A 4OJFL 1CDIA 3DARA 3L1GA 4KY2A 4RX4A 5TH2B 1RKRA 1F13A 2PYEA 3DETC 4NCC1 3LNFA 5AX1A 4XC3H 5DS1A 4CNIA 3RZCD 2IFFH 3ALXA 3BFWA 3WUZA 3MLYL 3KS0H 1BEYL 3W3BA 4JRXA 3UEQA 2BVUA 1XR8A 5C09D 2IGTA 4BUHA 5IB4B 4MAUL 2CBTA 2VWEE 2VDQH 3PDDA 5ADOH 1E6JL 4P8QA 4LP4A 4X6DB 4CU6A 1K4DB 3ARPA 3AWEA 3MRBA 3NA9H 1D9KB 4PJFB 2PPEA 2AEQL 3QULA 4EJ1C 2VIRB 3HE7C 3FFOA 5T3XL 2J5LB 2BY3A 4KK8D 4EI5A 4TULL 2ZKXA 3QIBA 4OF6A 3HMWL 2E7LC 2AP2A 1KTCA 2G0LA 1RU9H 3OL2A 4BJLA 3TESA 3P4NB 5CGYC 1V10A 1OALA 1KIUA 5FCUL 4HYJA 3BISA 2IDQA 4PGCB 2QZ5A 5FYJH 1IUZA 5DS2A 2F61A 4PLKC 1CD0A 4JZOB 4JFYB 3CDCA 4X98B 2VQ1A 4J2XA 1CDJA 5CFHA 4XPHH 5GRYA 3AXIA 1A7NL 1LHZA 3F7QA 3E3QC 4O00A 2YGOA 2CDGB 4UT6A 1LEIA 1URZA 4BGLA 4U3SA 4NKQB 3T0VA 2X4QB 5KVGL 5E2TH 5EEZA 4LLYB 4R97B 2CIKA 3VFOB 1QRNA 1FVCB 4QT5A 3X11B 2IWKA 1PDKA 4L35A 1CU4L 1WE5A 1C1EH 1NPJA 4BSWA 1XSKA 4ODXB 2HKAA 2J20A 1AIZA 2BERA 2EVIA 3EOBA 2ICEC 4HAKA 4RVBA 2BSTA 3DPBB 2WUBL 3X3GL 4OV6F 3BVNA 4LNRB 4OY9A 4CW1A 1FBIL 1AS8A 1S7SA 3BAYA 4JY6B 2HJKA 3PJNA 5IQLA 5CWSB 4K15A 2DH3A 1GYWA 5SX5H 3ULVL 4MQTB 3HTLX 2LNLA 3VMNA 3QEQA 1UFUA 1L7TH 2NR6D 4LVNC 4NYLB 3R1GL 5T1LA 5J13C 1BVNT 3GZPA 3RRQA 2PCFB 2V9QA 1ZLVK 1LWJA 1XCTB 5T3ZH 4MKMA 3MX0A 5FHAH 1EEYA 4WK2B 4BK5A 2E75C 4DGYL 4GAYB 5DRZA 2BP3A 1XF4A 5E5UB 4W68A 3IDJA 5B39B 5INDB 3TZVC 4HIJB 1MHCB 4OD1L 5KWYC 1GGBH 3HZKA 3H9SD 4MQSA 4LSPH 3L7FA 5EFIB 2X6MA 3IFLL 4P5SA 4Y1AE 3SY0B 1NICA 2NW3B 4FG0A 5F6HI 5TFSL 1DVUA 2E6PA 2FGZA 2O5ZL 3OAZH 1B4JL 1IGCH 1SGKA 2BHFA 3BP5A 4PWHA 4UOW0 5CMAA 5E8NB 2Q10A 1T03L 2YZ8A 1MCRA 3V5HA 3ILPB 4UT7H 4JCLA 1DQLH 4NQUA 3KE0A 5GS1B 2GJ6B 8PAZA 1OSZA 1L0MA 1G7JA 1PBYA 2IO5A 3AABA 3QUXC 1DQDL 5FYLH 3WQJA 2Y2WA 5GRZA 4OZIF 4NFBA 4ZTOH 3EHBD 4QLWA 4L3CA 1KGIA 1HZHL 3A47A 4ZMNA 5AW9B 2OMXB 2GSIB 2OLDA 3RIAK 2R7EB 3CH1B 3TWCL 5F3FA 3KXFA 3FONA 5J6HB 2HT2D 3LEYH 2AXGB 4KUZL 5C0DA 4A7QA 2Z31D 4KO7A 4IBSA 1N0XH 3WKML 3BVUA 3FUNA 3VXSE 2WCPA 4WEMB 1KC5H 2GTWA 2IEPA 3PUUA 3WKYA 2JKWA 1JNHA 5CINH 4FEIA 2WOYA 1EO8H 1QUPA 1NFKA 5F88A 5D2NA 2UXVA 1CD1B 1WT5A 4OJAA 2X6AA 5LBSH 3BW9B 4HUUB 4LDOB 1I7TA 2O30A 2W81C 4AEFA 2FJSA 4XAKE 4JJ5B 4PJ5B 4DKFL 4U1IB 2IFFL 2WVUA 5EU6B 1S46A 5FV2A 1W16A 3LDBB 4QRPA 3RZWA 4ZUUA 4OVVA 5KUKA 4JFTA 1ZV9A 3AS2A 3LQAL 3JWNG 2NXZD 1GJUA 2EAEA 4Z77B 2VDQL 1UB6B 1JRHI 4KUCD 5ADOL 3P54A 3GINA 4WEBL 4H25B 1QHQA 4YGVA 3TN0A 3QHTC 5ABAA 2GY7B 4TNWF 2OJEA 2B39A 4GAJH 4PJGA 5SWSB 3K81A 3T3PF 2G4GA 3HJEA 4OZGA 4LLAA 1OAUL 4Z7QB 4FG6C 1TT6A 1A4KA 5HHQB 1SF3A 2J72A 4GEIA 5DMIH 2EDKA 1HI6A 4F15C 3US0A 2Y1ZA 4L1BA 1NFAA 5JJEA 2DPKA 1D5BA 5IESH 3UYPB 4LNVA 5ALCH 4ZPVB 4IMLA 3HPJA 1O0VA 2J4YA 5E4EC 1J05A 3LRLA 5KG9B 3LOWA 4ACTA 1EAPB 2DMCA 4IK6A 4LHQB 5DR5H 4X6BB 1IFRA 2VZSA 1I1FA 3JTTA 4M7LL 4IBYA 2D7TH 3HANA 5FFLA 5JW5B 2XPGA 3VVVA 4LLUB 1UFGA 2FH6A 4XVUD 2ZF9A 1S5HB 4AQAB 2IV8A 5IVOA 2IDFA 1BF8A 5JIDA 1FAIL 2WCGA 3DIFA 4AE0A 1TLKA 1B90A 3VQLA 4OF3A 3VRJB 5IMKB 4L5FE 3VGAB 2P49B 2VABB 2D73A 4N24A 5E2TL 3UZEC 1WK0A 3RI5F 5IFHL 5DRWA 2G5BB 2ODIA 1NFIB 5BNXD 2FX9L 3O4OC 4PJ7E 2PMZA 2Y1YA 3UOAB 1F58L 3QIUA 4Y2NA 2IH3B 1IBHA 4OZHB 4PW4A 5E9DE 4IDJH 4JLRA 1HU8A 1CF1A 4JQIH 1BVZA 1UURA 5JHMA 5JMOC 3TCLA 2AJYH 4TVPH 3PWLA 4ODSL 5CP7A 3TH4T 2Q7NA 2I26N 1OSPH 5GISH 3VD4A 3ZT5A 1L7TL 4XN8A 1YNLH 1P1ZA 5T3ZL 2EO9A 2WJ5A 3UP1A 4O5LH 6TAAA 4OIIL 2G2NA 1S53A 4P2RE 5CJQL 3FQNB 3MLXH 4JHAH 5AKVA 1VKXA 2VQTA 5I74B 5G36A 4UTBL 4G8FA 3UO1H 2CO7A 3WY3A 1KLUB 4JPWH 3HLKA 4OGZA 5TD4A 1YSOA 4I3RH 4WO0A 3EZJB 4HC1L 4U1KB 3MAWA 4YHZH 3UC2A 1NCHA 4M1CC 5D7IE 4DK5A 4Z5RA 4K5YA 4OCSL 4MD0A 2G2RB 3EYUL 4JG0H 5SWQA 4FXKB 4X2UA 1ZCRA 4YHKL 4P5TA 5DFVD 1DQLL 3QCVH 3SYCA 1WIOA 2VMFA 4H2CA 2JKXA 2NY3B 1QSEA 1FVDA 1X5IA 5B38G 2LT9A 2ZWYA 3TH2T 4KUCF 5FYLL 2WINB 1U93B 3FYIB 2XTJD 5AW0B 3ABMB 4P9ML 1BAGA 3MLVL 1H6FA 3EYVA 3S8GB 1NDMA 4WRLA 2G75B 3ZTNL 3MV8A 4LPWA 2DQEL 5FCSH 3SYPA 4PJAA 5HHOB 4MLSA 4OD2B 3QEUA 4KNQA 5ANMB 1NUGA 3MGAA 1SNRA 4RNRA 3IRCA 2CO4A 2XN9D 4F7PB 2R69L 1BJ1H 1N0XL 2QVKA 3DDGA 3PQYE 3I75B 2HFFB 5D1XD 5HVWA 1IKNC 1WS8A 2WLMA 2F1BA 1OAJA 1KC5L 1H5BC 4DO4A 1GUEA 3QO1A 3EUDA 1C08B 1FYTD 2F53D 1TSRA 3N04A 4PJXA 3PS6A 5IHUL 3KG5A 4HLEA 4I3SL 1JMXA 2GEEA 4OLZL 4GIOA 3NS0A 2WLZA 1G6RH 3FAWA 5LBSL 5LXGL 1R75A 5L4IA 1A7PH 1R5WA 3QNXB 3NQIA 4JHWH 1JHTB 5K9JH 4PGEA 3HG2A 2NNFA 2O6PA 3ES6B 5DDHA 4DS7E 3GJFK 1DUYB 1HEZB 3BGMB 4ETYA 4WI3A 3MCLH 3RWHA 2P8LB 2DQJL 4ODVL 1JXFA 1N5AB 1B0WA 5F6HJ 1N19A 3QH3A 3VQMA 2PW1B 4WY7L 4EPSA 4WQOA 4OZFB 3LZLA 2Q86A 3TFKD 2FBRA 4KJWD 4PHXA 5ICXB 4BD4A 4AXWA 3QORA 1QR1B 2X40A 1YEWA 5A40E 3JWNC 3EJYD 5GGTH 4Y16A 4TS6A 3G6AB 4Z7VB 4FF9A 5DVPA 3WD5H 4BH8A 1OCRB 3GIZL 2WKOF 1R24A 2YD7A 1EJOH 2W65B 4B97A 1J5OH 2NQCA 3HE6C 4TM9A 5IESL 1J5HA 4K07A 4XH2A 5MEQB 1NQBA 5IREA 2D8KA 4AYDC 1X0K1 1ES0A 2ADIB 3U1QA 4XMLH 4GQPH 4B9IA 3O6FC 1WJ3A 4F8LA 3GBMH 1VESA 3DJ9A 1DE4B 2D7TL 4MXQC 4NZJA 2PR4H 1W0WA 4ORZC 1LK3L 4G6JL 4MVBC 4D0DA 1S8JA 5FYKH 3UTSA 3VFRA 4OLUH 3VFTB 3DX4A 2GIMA 1C16A 1DSFL 1IB5A 2N3JA 2V2WB 1MCKA 2FWUA 2VXQH 3EYOB 5B34A 2JLPA 4PRHA 4QHUB 4XCFH 4DT2A 5D9SB 7CGTA 3KPMB 4HCFA 5C86A 2MOVA 3UH8A 1QVOB 5F9DC 3VI0A 1NGYA 3EFDL 3UTYA 3HS0C 3IU3A 4JDZA 4MMXC 4LHUG 4XN5A 1MCWW 1AR1D 3RB5A 3IKCA 4KQ0A 1Q9OB 2K6YA 1T0OA 3PL6C 4NQCA 4RFOL 4DPAX 4BFNA 1E4KC 2WQWA 3AS3A 3ARZA 1E5YA 2X1XR 3GSWB 3OLGA 4GBXA 3W2DH 4TVPL 1YYMH 5GISL 1E9QA 5ELIA 1YYLL 4B27A 4ZD3H 1CE6A 3TO2B 4JM4H 3OXSA 2B16A 3PDGA 3KYKL 1YNLL 4Z7UA 2WXPA 3DXAB 1OHQA 1PZUB 1BIHA 3DX9B 1ZHLB 3T8MA 1B9ZA 7PAZA 4NN7B 2QDWA 4JHAL 3KW7A 5FOBA 1HSAA 4K3EH 3UO1L 3ZKNC 4G6FD 3RWGB 4JPWL 2HJFA 1ZV5A 3GZOA 4E41A 5C3IA 2Q2LA 4LRIC 1JZ7A 5DMGD 4Z7WF 3SHSA 1KN2L 1JFHA 2JCCA 2AK4A 5GRWA 4OIFA 2N7SA 4S0SD 5KW9H 2Z91A 2BC4A 5C09B 4ANKA 3KEHA 2Y25A 4ZW8A 1R0AH 4DFIA 1HILA 4WSJA 3VI3F 4XCCL 3VG0H 4OZIB 2YMXH 3R06A 1WFUA 4MSWB 3NIGE 2YGNA 3QCVL 4N8PA 4N0CC 3THML 1KMEA 5MHSD 5JPMB 3U2SB 4QOKA 1BVKA 4UBDC 2TRYA 4GLRH 3S9DB 1CDYA 1DFBL 3W81A 4M8RA 1CXFA 3V9CA 4CADA 1JV6A 4MNQE 2WSDA 4F7EB 5BO0D 1WIUA 5DHEA 3UG5A 3MRRA 3MFFA 3NEEA 1AZBA 1SFHA 3VMOA 1MQKH 3VWKD 4JY5L 4Y19D 2CK2A 1QTSA 2YCZA 3PWHA 4G7YH 3GIVB 4DKEH 1NFDF 1FL5A 3KW8A 1S9VB 2YDOA 4QI3A 3SBWA 1KACB 5AOJA 2GCYB 4Y9HA 3HS9A 2KLTA 4JGJA 3QIWD 2D0GA 4EI6A 3V0AC 1PAMA 3Q3GA 2XY1A 4A2GA 2FLBT 1VJSA 2A73A 5DJAB 5C0FB 4WW2A 2QPSA 4UQ3A 2WZ0A 4FADA 1UCBH 4NNYA 5KUMA 5TDNB 5HGBB 1L9SA 5IVZA 3ULUD 4HISA 5KJRL