3S8GB

1.8 a structure of ba3 cytochrome c oxidase mutant (a120f) from thermus thermophilus in lipid environment
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title High resolution structure of the ba3 cytochrome c oxidase from Thermus thermophilus in a lipidic environment.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 49
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s8gB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s8gB02
3NSYA 1O0AA 3N2JA 3COCA 1FFTB 2JAFA 3HAQA 1PXRA 1LN6A 1A4CA 5A8EA 1W8EA 1S51A 3ERXA 4E9SA 1AANA 4XTNA 1ASQA 1IBYA 1L9PA 4UHRA 3QJVB 1CC3A 2FJSA 5B1AB 1JGJA 5AX0A 2YCZA 1PZCA 3S3CB 1OCRB 4M4RB 1VGOA 1X0I1 1L9RA 3QJTB 5FJGA 3ZEVA 1ZIAA 1BRRA 3WNIA 4AI7A 3PDSA 2Z73A 2XYBA 2NRDA 3NJIA 1ZV2A 2DYSB 1JZEA 1OCOB 1GU8A 1BQ5A 1XB8A 2FT8A 2UXFA 2FQGA 4G7SB 4LDEA 2AFNA 4HHWA 1KG9A 2FQDA 4NERA 4DP7X 3QBIA 2IDTA 2AT9A 5JJJA 6PCYA 2R7EB 1QHJA 1HAWA 4N6HA 2WSDA 4PAZA 1WA1X 3V2WA 3ABKB 2TSAA 4GPOA 1L9HA 4HCFA 4JKNA 1PNDA 1NDTA 1JZJA 5PAZA 1F4ZA 2F93A 3S3DB 1WA2X 2VM4A 1SFHA 3HB3B 1E5YA 7PAZA 4XT3A 2YARA 2IWKA 1XIOA 1XJIA 1TEFA 1SF3A 2XXGA 1OE2A 2IDUA 3PPSA 3X1EA 3GXUB 4A2GA 4GYBA 1Q5IA 3HANA 1ILUA 3FSAA 2WO2B 2ZWNA 2YQBA 3D4SA 5G2CA 2KSBA 3PAVA 1PZAA 3FQ1A 4BWWA 1E67A 1PMYA 4AZUA 1BQRA 2BZ7A 4YSPA 2BP8B 4PCYA 1R84A 4GRVA 2EILB 3NJHA 3QJQB 5DHHA 4BV0A 3X1NA 4DP8X 2W88A 4A68A 3T6WA 4UF7C 2FQFA 4MD1A 1JXGA 3CDZA 4W1TA 3SBPA 1CWQA 2WJKA 1P8UA 1J9SA 1J9QA 4JHVA 1A4AA 2WO3B 5I5MA 4G72B 3H4FA 4E9XA 2BP8A 4G7QB 2AANA 3SBRA 3DKHA 3V9EA 1HFUA 1BXUA 2KS9A 5B6VA 6PAZA 1NIDA 4YSCA 1DZEA 1C8SA 3PQRA 4J4QA 4BXSV 1V55B 4YSTA 5B0WA 3VHZA 1ET5A 1AS7A 4X31A 4AMIA 3HAOA 1YLBB 2Y1AA 1BRXA 4LDOA 3QBGA 4FA7B 2GI0A 1F56A 1N68A 1GS8A 4AKQA 3G5WA 3UADA 4N8UA 3AG3B 4A67A 3QBLA 2YAEA 3ZBMA 1TEGA 3ZX1A 5E9NA 1BEXA 3GDCA 1FBKA 2VN3A 2YCYA 2VSMB 1ZIBA 2EIKB 1NIEA 5A45A 3AY2A 4YSDA 4AKPA 3QJSB 1KCBA 3CG8A 3GYRA 5H2PA 1M56B 5G2AA 2CUAA 2IDSA 5H2OA 3PXOA 5B2NA 5AKRA 4GP5B 3ASOB 4HYJA 3UACA 3UZAA 3AG2B 1HZXA 1TN5A 5H2LA 3TASA 1CYWA 1RZQA 2PPFA 2Y03A 1KGBA 3NJGA 4UAHA 1NINA 4DP2X 1PF3A 3FSVA 5B3SB 2YCXA 1H68A 2J5WA 4MQTA 2IWFA 2I21A 4YSAA 4G70B 1AIZA 1ASPA 5AX1A 3EMLA 1S8JA 5BR5A 3FT0A 4BK5C 3NY9A 2FTAA 2XV3A 4A2DA 4Q8BA 4QLWA 4ENZA 1FA4A 4KLYA 4HYXA 1GZMA 2PP8A 5FC9A 2HPYA 2IWEA 1BXVA 5I5JA 3OMNB 2CBPA 2DYRB 4E9VA 1AZBA 2M3GA 4E9YA 4GXFA 2ZONA 1M0LA 2YAMA 4P5SA 8PAZA 1S52A 3QAKA 5B6YA 2VMJA 4G71B 5B1JC 5JJEA 1AAJA 2FQEA 4WTQA 3TBBA 5H2JA 5PCYA 3BVDB 4AMJA 2FT6A 2BP0B 2ZXWB 1CUOA 5TK2A 3HARA 4NAJA 3WI9A 4L35A 2EIMB 4KO6A 3UTVA 1E5ZA 1A3ZA 4N4YB 3IN2A 5D4HA 3VG9A 5I6NA 4TL3A 1SDDA 5H2IA 4FBZA 3HASA 3NJKA 2OV0A 4EA3A 2H5UA 2AZAA 2Y02A 3CODA 1OCZB 2GC7C 1QHQA 2BP0A 4AX3A 1ZPUA 1BQKA 2IAAC 2YAPA 3NYAA 2XLLA 1V10A 1MZYA 2QDWA 3A7KA 3V9CA 1OF0A 5H2NA 1AG0A 1BYPA 2DV6A 4HWLA 1M57B 1IXFA 2QT6A 4E9QA 3C9LA 3OMAB 2VW7A 4HCIA 1BXAA 5B1KA 1VJMA 3PBLA 3X3CA 1NIBA 1L9SA 3BQVA 5I28A 1M0KA 1ILSA 2TSBA 3FSWA 3FU9A 3MBWB 1AT9A 1AZNA 2BO0A 5AZUA 3OE0A 1GW0A 3T71A 5I6MA 1JFPA 4WAVA 2IH9A 2XV2A 4HZ1A 3X1FA 3X1GA 3PWHA 2JXMA 3UAAA 1FWXA 4EIYA 3UONA 1SHWA 2DWSA 4L6RA 1DZ0A 3CDZB 1NIAA 2I7OA 2XX1A 3IE9A 4HALA 4FAAB 4GP8B 3AM6A 1OE3A 3ZPQA 3VI0A 5TK4A 2JKWA 3KW7A 4E9WA 2Z55A 1DYZA 3DIVA 1JOIA 3ASNB 1QKOA 4NC3A 5B34A 2VW4A 2GIMA 4E9RA 5LDUA 2KSAA 4QIDA 1ET7A 1ETJA 2VSKB 1EZLA 4M3HA 5AFAA 2HRHA 3AG4B 4PXKA 2H3XC 1WS7A 3AW5A 1AZUA 1KGYE 3ZPRA 3ZDWA 2KSYA 5A7EA 5I6LA 1A8ZA 3C75A 1QNIA 3PCYA 1QM8A 3WKQA 4K5YA 1A65A 2PPAA 4JKVA 4MBSA 3OD3A 3ODUA 1IUZA 1W6LA 2Q9OA 1L9QA 3NSCA 4DP0X 3FPXA 2PCFA 2UX7A 2YDOA 3AG1B 1S54A 3PAZA 1BYOA 1AACA 3EH4B 4X4KA 5I5IA 1XB3A 2QDVA 1PZBA 2JFCA 1J9RA 1A4BA 1F88A 1N70A 4YL4A 1U19A 3TBCA 4F7KA 2HX9A 1PCSA 4GP4B 5DHGA 3FYEB 3NT0A 1S53A 2BW5A 2I7SA 1C8RA 3AZUA 3JTBA 2CAKA 1JV7A 4JQ6A 1MDAA 5ITCA 1OV8A 1RKRA 2MTAA 5AHZA 2X87A 2PP7A 3NS0A 3ABGA 1PXSA 2E86A 3PAUA 4YSOA 3SQRA 1C3WA 2B08A 4G7RB 5F8UA 2X72A 4L0PB 4PXFA 3KJ6A 4OV0A 3UTWA 2BWIA 2XXFA 3QDCA 3NP3A 4F2EA 2ZIYA 5B35A 2R4RA 5G28A 1UATA 1VLXA 3FSZA 1RZPA 1OE1A 1BRDA 1UAZA 4TXVB 1RCYA 2PPCA 3VVKA 2QPDB 5AHYA 1QKPA 3OE9A 1ZDSA 3S8FB 1S8LA 1AG6A 2AVFA 2BWDA 5B6XA 1JVOA 4DJHA 1MG2C 1TU2A 2LNLA 2ZFEA 5I6PA 3RZEA 4YSEA 2ZOOA 1TN0A 2OJ1A 1T5KA 3QQXA 2YAFA 4BEZA 3RYMA 4XTOA 2XU9A 2I85A 1PLCA 3ZIYA 4KNTA 1GYCA 3SBQA 1L9OA 4MQSA 2R4SA 4LDLA 4BUOA 1PLAA 3FQ2A 5F7AA 4Y9HA 1XB6A 2W8CA 3EF4A 4KO5A 2I1XA 3HEIB 5D4IA 4GY4A 4JR8A 3JT2A 3PLYA 1SFDA 2I35A 3VGAA 1URIA 3OMIB 2N0MA 1JV6A 1NZRA 1SDDB 2ZZLA 1AZCA 4KOCA 1IKOP 4DP9X 2XX0A 5B7EA 2GBAA 1IC0A 3NJJA 2HX7A 3TU6A 9PCYA 2YDVA 1P8IA 4UANA 2Y04A 3EH3B 1AS8A 2J4YA 1HAUA 1IW9A 2DY2A 2CJ3A 2BW4A 2RACA 3HAPA 1J5CA 2GHZA 3UG9A 2FWLB 2VW6A 3CZUB 1KBWA 1L9TA 2PP9A 2UX6A 4DP5X 3MX0B 5AWZA 5I6OA 3KW8A 2PPDA 4YSSA 5H2HA 1XMEB 1BM1A 4QRYA 2BRDA 1AZRA 2UXTA 5G53A 5B7MA 2OCCB 4IAQA 4A2FA 2LLNA 1KG8A 5H2KA 2UXGA 4BDVA 5DYSA 3WKPA 2WJLA 3VW7A 3T9WA 2H47C 4DAJA 1PLBA 4XTLA 3REYA 2GB2A 2JAGA 2Y01A 3H4HA 2EIJB 4KNUA 1ASOA 4HAKA 2PLTA 3T6VA 3CAPA 4BWBA 1GY1A 3FU7B 1WA0X 4WKXA 2L6XA 1ADWA 3ABWA 3ABMB 2Q5BA 1WAEA 5B6WA 3N55A 3NP4A 3QBKA 1H2SA 2A3TA 2BZCA 2AZUA 1X0SA 1L0MA 2FT7A 3CVDA 3WQJA 1MGYA 5ANHA 3AYNA 4GYCA 2XUWA 4MFHA 1SF5A 1KBVA 1TKWA 2XV0A 3UTXA 4CSZA 1NWPA 3UAEA 4QI1A 2IDQA 3FS9A 1PNCA 1MG3C 1GY2A 2Y69B 3FU7A 3T6ZA 2CALA 1KDIA 1R1CA 4DPCX 2G87A 4F2FA 3FPYA 1E65A 1FBBA 2VM3A 4DP1X 3FU8A 2F95A 2YXWA 3NJNA 2HXAA 1JZHA 3OAXA 2HRGA 5B7FA 3IBOA 2GSMB 3UTYA 1SJMA 5H2MA 4KO7A 1KCWA 1PY0A 1NWOA 4AKOA 4ZK8A 3QPKA 3X2QB 4HCGA 3AYMA 4CSPA 4YSUA 4X1HA 4KNSA 3NSFA 3RFMA 4DPAX 3QJRB 3V2YA 2R7EA 1AQ8A 3P0GA 5F7BA 5KKHA 2CCWA 4N4WA 1NPJA 1IBZA 3NYKA 1AOZA 3TA4D 3T6XA 5B1BB 3L45A 3ABLB 4EF3A 5I6KA 4FPDA 2HLEB 5JJNA 2UXVA 3WNJA 1NTDA 3NSBA 2X88A 1X9UA 1F50A 2QPEB 2PPEA 5G54A 1CURA 4BWUA 3DTUB 5D4JA 4HIPA 5TGZA 5I26A 1CYXA 2PCYA 5G2DA 4QKTA 1JXFA 1P8HA 3CVBA 4NB7A 4A2HA 2IDFA 1W6WA 3IN0A 3C9MA 4BEYA 2XWZA 1UCQA 1JZIA 3NJFA 4A66A 2YAOA 4KO9A 4BXVA 3T45A 1R2NA 4YVNA 7PCYA 4BWTA 2NTUA 2J55A 5EHFA 2P80A 5B1JA 1OCCB 5AZDA 1KDJA 1PAZA 1J5DA 3X3BA 3NSDA 1GS7A 3FQYA 5B6ZA 1B3IA 1AS6A 1JZFA 4EJ4A 1PY6A 3NY8A 3QJUB 1NICA 2DWTA 2YAQA 4KOBA 1I53A 4P5RA 3UGEA 2HX8A 4XT1A 1JERA 3WG7B 4WW3A 3H56A 1E0PA 2EINB 3PXLA 4YSRA 4A2EA 1M0MA 1Q5JA 1KMEA 1ZDQA 3IEAA 2YAHA 1JZGA 4MD2A 1KYAA 5ETZA 2GC4C 1E30A 5A44A 2YCWA 1EHKB 4GBRA 3S3BB 1J9TA 1SHXA 4DP6X 3WIAA 2VT4A 4YSQA 3UABA 3NJMA 1AR1B 4XXJA 5ITEA 4KNFA 1E12A 3OM3B 2I20A 4DKLA 3DDLA 3QAPA 1NPNA 2XVBA 2IH8A 5IY5B 1GSKA 4HHGA 4BVNA 4X32A 1JVLA 2FNWA 4JHUA 4W9ZA 2J56A 1QLEB 3SN6R 1M9WA 1NIFA 5EN0A 3EH5B 3UZCA 2P80D 2J57A 4YVUA 3U25A 1WS8A 3X1BA 2B3IA 5G36A 3FYIB 4IB4A 1GS6X 1X9RA 2HZHA 4DP4X 5BR2A 1GR7A 5LWEA 4A4MA 4Q89A 1V54B 2BHFA 5C1MA 1GUEA 2Y00A 2NTWA 3DQBA 1BAWA 1JXDA 4UG2A 4K9JA 3NJLA 2MRYA 3OE6A 1MZZA 4BDVB 3EHBB 1IW6A 2EI4A 3OQRA 2RH1A 2PEDA 1AP9A 3S8GB 2YXVA 3D12B 4RH4A 1SNRA 5J7AA 1X0K1 1ID2A 3MBVA 1ET8A 4DPBX 4IARA 3CVCA 4E9TA 3OE8A 1OOWA 1KV7A
chains in the Genus database with same CATH superfamily
4XAKD 5EOCH 5KYXA 5CLYA 3BXNB 1OP3H 4W4NA 5DVNA 2C1OA 3CFKA 1KLFB 3OB0K 5H94A 1RSYA 1U8QA 3CHPA 3ZHLA 4BH8B 4FG0A 3NMEA 4FLOA 4F27A 4FA8A 2EO9A 3K71A 2FJSA 3TBVA 3BKMH 2MKLC 4KAQH 4KKNA 2B1AL 4GUPB 4GAYA 3X13B 4Z7IA 3FZUC 1HI6B 4EXKA 3MV9D 4NC0B 4B50A 2AJUH 2BC4A 2ZYRA 3IAQA 1BM3H 1GW6A 3JWDH 3IDJB 2JCCF 4RCAA 4PRIB 5EZOL 4FHJA 5C08D 2ICEB 3S96A 3WYRA 3IJHA 4NPYB 1DUYB 2WWNA 1R3IL 3KJ4C 4PVBA 4DP7X 4G8FB 3T0EA 1H19A 4AIZA 1F2QA 2FWSA 3ARGB 4Z0BL 5FYJU 1RD6A 4JKNA 4UT9A 4L48A 5ISZD 1YYML 5JLZA 4BCXA 2LAGB 1OP9A 1EGJH 4QDGA 4JHWH 3MLUH 3LZOA 4KKCC 3VH8B 1PQZB 3PNWB 4QOKD 3DETC 3O6FD 3MRGA 2MKWA 3AB0C 4NKOB 2CA3A 4YGAB 4JRYB 4G6FD 1Q5IA 1P5UB 3KE0A 4JM2D 2IOMA 3IXAB 4TN9A 5H35A 2A73A 2Y7OA 4OLYL 3FQ1A 5HBBA 2WXFA 2AV7B 2GEQA 4KFZC 3DI3B 2Z8VC 4LK4A 5DZAA 3ZXAC 5A2KH 2F5BH 1VZIA 5L4FA 1V7MH 1FLRH 4X6DE 3CXDH 4EQ2A 3TBTB 1A8JH 4XNXL 5A6MA 1SDAB 3A4AA 4BM7A 4MD1A 2YPLD 4L18A 3H9SE 3AREA 4NHUB 3PDGA 4DGYH 3PHSA 4I0PC 5I15L 1J9SA 4GQ9H 1G6RH 1YEWA 3S5LA 4Y5VA 2WXMA 3S36X 1JUFB 4IBQA 1YN6A 1HIML 3KPRE 4OD1L 2HFTA 2GVYA 3SEPA 1NIDA 5KBDA 1C8QA 2F5AL 4J4QA 1HU8A 4BKLA 2EVGA 3MXVH 3BRDA 1U91B 1F11A 4NKMA 4LDOA 1B4LA 1JPEA 3V5KA 4ZQKB 4NO0A 2QL1A 2XZZA 4AYFB 3IMRA 4N6RA 4WUUE 1TJIH 3OKDB 4KXDA 5T3ZL 4M1GH 5TGBB 1VEMA 4CSSA 4BFJA 4NZRL 3ULVH 4Y7MA 2J7LA 4J3OD 5GZND 3MV9B 2UY7B 4DCQB 1SYSB 3EFDL 3OGCA 3T0DA 3GSWA 5G2AA 1BZ7A 1XXFC 5D1XA 4K2UL 5AKRA 2PKDA 5C08B 4ZMNA 4X9IA 1FVDA 2WQUA 1P7KA 4QXVA 3HFFA 5ALBH 1KUMA 1CVRA 1QZ1A 2YPVH 4KKAD 5JZ7D 3M8OL 4G1EB 1IL1A 2A4EA 3PE9A 2J5WA 2LVCA 5KN5B 1OARL 3PL6A 4FFWC 4ZX3A 4HOXA 3IFOB 3ZJAA 3LHAA 4ENZA 5ISZB 1OPGH 2I9TA 4W4OC 1T21B 1GZMA 4B60A 2PP8A 4OGQC 4Y5YB 5E0QA 1VGKB 5ANMA 2BVOB 3CN1A 2RFXB 2CBPA 4JRXA 1IC5H 3F8UB 4QOKB 3O6FB 5BRZE 3RUGE 5FOBA 2QLVB 5E99L 1RZJC 4G6FB 4GEJA 4JM2B 5J57B 3K3QA 3SGKC 4OW6A 1ZT1A 3KCWA 4N2EA 1A4KA 5I1LB 4X99B 3T0VA 3CFJB 3MBEA 4ILDA 3LZRA 4S2SA 4TUKH 5IFJB 2YEZA 3ZHDA 2D7OA 2WMPB 3OLEA 4LL4A 4F2ME 3QEGL 5HYJD 5ESVB 4OU3A 1NGXA 3PWUA 1AKPA 1CLOL 3NCJL 1FRGL 3UTVA 4GG8B 1ORQA 3TP4A 2BHYA 5JIPA 1UQSB 2UY6B 2G9HB 5I17B 2QSVA 4KUZL 4IIZA 4NKQB 2R69L 3D69A 2B9BA 3CUPA 2LT9A 2H2PD 2XIIA 1T7ZA 2AZAA 4X5LA 3BPOC 4JAMB 3CZEA 4K7PL 5HVGB 5EIIB 4YXHL 4FFZL 4PW3A 3DIFB 2ZF8A 3BZ4B 4GUCA 3VW3H 2G0LA 4NHCH 4ZUTB 3ZO0A 1AGEB 2ZOWA 2GPZA 1I1AD 3MV7D 4GXUM 1VFOA 1NIBA 5C0DB 4J3BA 3KPNB 4HCRH 4FFTA 5M94B 4HUUB 2XFXA 1I7ZB 1KJ2A 2WO4A 4FQHB 4UTBH 3VO0A 5DJZB 4WHTA 1CXHA 1OP3K 3VU1A 1NAMA 2OLDA 4FAAB 2EXYD 5I1GL 2A9CA 1COBA 2BVTA 4MQXC 4XZUA 5TK4A 4MD0A 3QUKA 5I9QC 3C08H 2VDPB 4IU2A 3ULVD 4KNQA 2DMHA 5DC0A 3RGVD 1FZKA 3MV11 1NC2D 2X3AA 1M1XA 1JOIA 1MJJB 1IBGL 1NPUA 4MA3B 4WU7B 4B95C 4NC3A 1T2QH 4UOZA 3SDYH 4L5FH 1CLZH 4WSJA 3WY3A 4IEFB 4QIDA 4PH8A 1FNHA 4HJEA 3AG4B 4EMZA 4XX5A 1XH3B 2D03H 1BZOA 4LNRB 1O0VA 2D3LA 5A7EA 5DQDH 3VAEA 1QNIA 2O5YL 3MLZL 2O6EA 1XF4A 2VKWA 1IGJB 2APFA 4G9DB 3NTCL 3NSCA 3VFSA 1MCDA 1LO3H 4K71C 5DJYA 4XPTH 5T1KA 2EE3A 2W9EH 4XMZA 1EZSA 1TMCB 3BEVA 5IVXE 3BSGA 1MNUL 2YLKA 2BNRA 2DTMH 3U9UA 5I1DB 4J7RA 5I6XC 1S5IL 1TZIB 1A6VL 3DVGA 1ZJBA 2VN4A 1WTLA 5HYJB 4GAGH 1JV7A 1RKRA 2C9RA 5E9DA 4J3UA 5AD0B 2N7SA 4YHPB 2HVKA 1PXSA 2F7IA 1RY7B 1LNUB 4GT7A 4YR6B 2DYPB 3QNYA 3KJ6A 2VLKE 4TSCH 3QZOA 4F3FB 3O3EA 2WTOA 3QJOA 2N7BA 3NP3A 2BIQA 2R4RA 4NOBA 5DWPA 3CZSA 1D6EB 4LPXA 4ODHH 3SOBL 5DEFB 4NN5C 2FBJH 4X6FB 4XTRC 5D7IF 2BCKA 3JTTB 4G8GD 1Q72H 4DKTA 4AM0B 1NGPH 3LKNA 4ACTA 5EOCL 3HIZA 3OKLB 3P0YL 3RZEA 3BX7C 4LIQE 5F1IA 3C6LD 4Z7OB 2IBZX 1I1AB 3MV7B 1YY9D 1IT9L 4IOSA 4OF5A 1YMME 4JO5A 5CLXA 3FQ2A 2YBRA 4KAQL 1P2CA 1OT2A 3STLB 2VDPL 3CPLB 3MJ9L 4FFYA 2IBGA 3ML9A 2V2WB 5SWZA 3NABH 2AJUL 4JY6A 1QUNA 2R29H 4Z7UB 3JWDL 2Y1VA 4AW7A 1O6VA 3B1TA 2GBAA 3AQZA 1XH1A 5BV7C 1F02I 1PYWA 1FH2A 3E1ZA 3RGVB 3GZOA 1CE6B 1NC2B 5BZWA 4UQ2B 5LGKA 3CZUB 1JZ2A 1S6NA 5DFVC 4PV8A 2Y22A 3F3HA 4M6NH 1GVIA 3S7GA 3KW8A 1EDYA 1XMEB 1JIBA 1I7RB 4WI3A 2DDQH 3LN5B 1UA6H 3L3HA 5H2KA 1NOAA 4F8OA 4JG5A 1C08A 4R6UA 3PU7A 4JHWL 3RVWC 1N2RA 2GB2A 2JAGA 2Y01A 3H4HA 1PS3A 5TJWK 1UZGA 3QIUA 2X28A 3I6SA 1S5HA 4R0LB 2NTSP 4WKXA 4B27A 2A7BA 2ZP9A 5GS0D 4U6XB 5B6WA 2A3TA 2BZCA 4NM8H 4PRAA 4K5NA 1EXUB 2J1YA 1YMHA 4PJ9C 4IBVA 5EOCJ 2YGVA 3I50H 2VMEA 4Y5XA 1T04A 1TKWA 2F5BL 1QQDB 3MOAL 1KB5B 4C47A 1MLBB 3FS9A 3OX8A 1KJ3L 3MLXH 4N68A 3ZY7A 4X7DC 4UQBA 1KDIA 2YEQA 4NN7C 2G87A 3QC6X 5MEQB 3GB7A 3E3QC 2OZ4L 1NKGA 3CLFH 4GKZB 2Y7SA 1G6RL 2FX7H 4KRMB 3UP6A 4JRFA 2CXGA 3IBOA 4G7VH 4LLWB 3U1SL 3NFNA 1PY0A 1HH9B 1KCUH 1XGUB 2EDQA 2HVJA 5EU6E 3MRFA 1QHOA 4IS6B 2FGWL 2PO6A 2Y7NA 2LABA 3MLYH 4J8QA 3OR6B 4WJKB 5I0WA 3QXWA 2A74B 2WKOF 3NSFA 1WP6A 4G8GB 1UXLA 5BMFL 2WD0A 4KK5C 4ODXB 1N3NB 1RZIA 4XBGA 4H20H 4QRSA 2X4PA 3MRIB 1J87A 3L9YA 1YCSA 4NNXA 3L5IA 5DGRA 4A7TA 3C6LB 1IBZA 4J39A 4MRBA 3TA4D 3SDXB 5CM1A 3BPLC 1QEWB 4YHIA 4RMTA 2LAAA 4LFHD 2WVVB 5CXPA 1AHMA 1AZZC 2YD3A 3H3KA 4M1GL 3ULVL 4BWUA 3ZTDC 3B5HA 2WXLA 3NIGB 1JGIA 1AXSA 2V5SA 4YE0A 4EI6A 1Q9KA 4HPYH 1RURL 3G5XB 3HG1A 4G9FA 4OLUL 43C9A 1XF3A 4JHAH 1I7UB 2E7HA 1UCQA 2OCFD 2YAOA 1OAKH 2ZUVA 3T8XA 3CDFA 1S7VB 5IQOA 1I1YB 4TNFA 3D2UD 3PWPD 2YPVL 4RRPM 5ABZA 3FRUB 1YRKA 4PRHD 1FCCA 4OBRA 3DXAE 4F7PB 5F6IC 4FG6D 2IH1A 2KERA 1VCBC 3PJNA 4BQ9A 5JO5A 1KTLA 3SBWA 1NICA 1PLGL 5JORA 2HX8A 2BIMA 1NMBH 1OPGL 3S37X 4KZDL 4MBOA 1OXYA 2V7HB 4FULA 1BFOB 4MD2A 2Z8WC 5HVHB 4LLVB 2A0LC 4HJIA 3JQOB 3GSOA 1IC5L 2AJZA 1FO0B 1HZHL 3PREA 32C2A 4OTXH 2QHRL 1WGVA 3OM3B 3KWWA 1R3LA 4G1MA 5HI5D 3RVXD 3VD7A 4W9ZA 1OP5H 1SLVA 3SN6R 1FG9C 1T1XA 2C3VA 2N56A 4R96B 4TUKL 4Y4KC 4X4ME 3RA7H 4BHUI 1H15A 2QR0B 5L4IA 1WPCA 2O6PA 4D8PB 4ZPVA 2EYRB 4WO4A 2V7NA 4XMVA 3B2XA 4K9JA 3HR5B 4F57H 3WSQL 5B38G 2XWJA 4H1LG 2ZKYA 1GXEA 5IVNA 1PZUB 4I3SH 2HUHA 4NC1C 2Z1KA 4UOW1 3CBKB 3SE4A 4QT5B 3BCFA 3ZLQC 4EKJA 4EOWH 4LSRH 3L1EA 3VW3L 4BBWA 4UT7H 4NHCL 3HAQA 2VLMD 1LN6A 3FFCE 2ADYA 4M48H 1J0KA 4KK9D 5KVFH 1T89C 3ERXA 3ARFC 4CA4A 4HCRL 4UHRA 4OGZA 3KWUA 2FWUA 1B0IA 1UD8A 2D31A 1CK0L 4M4RB 4Z7WA 4UTBL 1GGBL 5E95B 2EUXA 4NC1E 4FXLA 5KYNA 3BSHA 3EYQD 4YZWA 5J4MA 5KG9A 1CDGA 3DX7B 5FB8A 1KY7A 2C9AA 2JKLA 1E40A 2FQGA 1UFUA 3SGJA 3NQIA 2X44D 4U0RC 3V4VH 4OCMC 1KCSL 2VSCA 4QRRE 3D2UB 4P5TA 3PWPB 1LO0H 5DUMH 1F8TH 1CLZL 1WCBB 4KVNL 4L5FL 4MD4A 4PJFF 3ZSSA 4PRHB 1GTNA 3CH8A 2BIOA 1IGIH 1X4ZA 2FHFA 3U48A 4AG4L 4YFEA 4XE0A 1W0WB 2WZPD 1P4BH 4PJEB 2ZUQB 5D7KD 1M71B 4N2FA 5FUCC 4PP1C 2VITB 2YARA 4QJ5B 4Q4EA 1DJZA 1S7XB 2VN7A 2XXGA 3MNVA 1KGXA 4JDVA 3DV4A 3VNYA 3BP6A 4LEOB 3HANA 3CAFA 3FSAA 4TQ8A 1BLNB 3P40A 2WCGA 2V37A 4YQXH 5AVTB 3KMDA 5JMOC 1S7SB 2ZSVB 2ZPKH 3SZKC 2ALWA 1HK6A 1QG3A 2GUOB 4Z76B 2DTML 5J1AB 3DRTB 1X9QA 1UT9A 1F90H 5FUCE 3P69A 2WVUA 3CDZA 3ETBJ 4FLRA 1H3TA 2RMNA 4FXGA 1J7VR 3NUKA 4QJ4B 4GW4A 4ZXBC 4NQSA 4G7QB 3EW3B 4XP5H 3HNTH 4PJHA 4GQZA 3CBRA 4ODHL 5E6ZA 5B6VA 5IV2A 2PR4L 3QBTB 4OFYD 4JGMA 1Q72L 2NNAB 1T83A 3UROR 4NRXB 3LXAA 2R0WL 3EXLA 4DUXA 4ZO7A 1NGZA 5KVGE 3FW6A 3ETTA 4PY7A 5IW6A 5LGYA 5E2TH 3HI5H 1OM9A 1TQBB 3L4CA 4ZFGH 1YUHA 4WQOA 1RZGB 2P8PA 2NQDA 3LN4A 5FO7B 2DI7A 5HHQB 4TSAH 4A04A 4Y7OC 1NAKH 3CWGA 1L3NA 3UYPA 3OGOE 1ZIBA 3GK8H 4WW2B 1IQDA 5JQ6L 4M7LL 5BW7C 2R29L 2XBDA 1WBXA 2ROXA 4ZBJA 2WB1A 4PJBB 4R7NB 4X83A 2X4QA 3IXTB 1JXJA 2W92A 5EZIH 2DL9A 4NUGH 2JQMA 3INOA 1RZQA 2EIZB 1A1MB 2VMFA 3NJGA 3ZDYE 2MCPH 5K9QG 4D2NA 1X5ZA 4KUCF 2G30A 2XIBA 5B3SB 1W2KT 3WTVA 3WEXB 1TFPA 1UD5A 5DZPA 5BR5A 2SEBB 2DDQL 1UA6L 4BGDA 3FH5A 2VUYA 3N0PB 2EDHA 2YLHA 4FHBD 4QHUA 4L8BA 4X98A 3EO0B 5MI0C 2X4RA 3MTXA 4WI7A 2O30A 2Y0SA 1OT4A 4GLRI 5GGUA 4OZGB 4R90L 4H0IA 5JIDA 1KXVC 1YEGL 2VXQH 4MSWA 5E2VH 1DDHB 1AAJA 4X6CF 4AMJA 4AITA 4KKQA 3S4SG 4B97A 4GG6A 3PQYD 1OHZA 2XRAL 1G87A 3EH2A 4NO2B 3UBGA 4FTVD 3QP3A 5GJTH 1CFTB 4YBQC 1OHQA 2AQTA 4APXB 1KEMH 2AQSA 4N4YB 2CHWA 3MLXL 5JUEL 1P7QA 3VFOA 3V4PH 4NM4H 2TRHA 1RJCA 1OP5K 1QFUH 3C8DA 4W9EC 4FQXD 4AIOA 2O5XH 1KCUL 2C26A 2ENYA 3RU8L 3WFHA 3KWTA 1V10A 1RUAH 1N64H 1R9FA 4J4PC 5CD3B 5DJ2B 1DVYA 3SDCC 4DKAA 1N26A 4ZO9A 1L5GB 2EYSA 4ZOAA 2H1PH 4H20L 5B1KA 2DH3A 1VJMA 4WK2B 3E9TA 2CE6A 4L8DB 3BQVA 5F1NB 3RFRA 5AW3B 4WWPA 2KI6A 3T71A 3DOSB 4I48B 1J8HD 5EH1A 1I3GH 1NFDF 3O11B 3V0DA 4ALAC 4LCIH 1HWWA 4DO6A 2V8LA 2Q7NA 3RNKA 1A6WH 1J0ZA 1EJ8A 4PGJA 1XCWA 3VI0A 1MLCA 4HPYL 2R1YA 4NENA 3QG7L 3RVUD 3UBHA 1AFVH 4F8LA 1HJBC 1XF5A 3RX5A 4LKXB 3D7PA 1NOLA 4DZ8A 1QLFA 3L95B 5EDSA 4I87A 2Q0ZX 5DS8A 1PZ3A 2FAUA 4WEUD 2HRHA 2XSKA 2EICA 5IHUL 3T1FB 2DIJA 3AW5A 1S3RA 1MREL 3L3OA 3V4VB 1QM8A 3PXJA 4R5TA 1LTXA 1L0XA 1RK1A 4Z78A 4GOSA 3D0LA 3L4ZA 4BRJA 1LGVA 2ZCLH 4JREC 4E41A 3DO7B 3UAJC 1ETZB 1OD7A 2XG4A 4PJDF 4BZ2L 4OTXL 3ILDA 4JPWH 5IW1A 1EZVX 3MR9A 4LB8A 1MDTA 3H9HB 2HRLA 3U0TA 1FL3A 3FBKA 3ZTEA 2HX9A 1H3VA 2MOQA 5BUAA 4OZFG 1S53A 1ZV9A 3RA7L 1SN5A 3FUKA 3PQYB 4ZD3H 3OKNB 1OV8A 2EDEA 2MTAA 2GUYA 1RU9L 4HLZH 3NS0A 1HC1A 4AH2B 1A7RH 1KNOB 3A67H 4L3ED 4PR5A 4QF1A 4XB8A 5I66A 5F8UA 2GFBB 1A1OA 1M05A 5KSUA 1BZ9B 2AJXL 1YNLH 4F2EA 1ZHLB 5DRZB 4FQPA 1TMQA 4MQSB 3JWOL 4WFGD 4FQXB 1OE1A 4I3SL 1BIIB 2FH8A 3LSOB 4QHMA 2PPCA 3RDTD 2E9IA 5AHYA 3K5RA 2E4FA 1KJVB 2ZZUT 4EOWL 2OJZH 2I32A 2WXKA 4HIXH 4QY8B 5CKGA 3T3MB 2ZFEA 1I8KB 4B3VA 4UT7L 4ZX4A 3X14A 2FUTA 3C87A 2FO4A 4PRIE 4XTOA 3GBNL 5KVFL 1PLCA 2IJ0C 1CL7I 2DRUA 1SBSL 3LNHA 4MMZC 4Y9HA 4ADIA 1J8HB 1OAXH 3U7WH 2Z7WA 3DRQA 4X6DA 2EEFA 4C4UA 1A6UH 4U6HB 5FO9B 3ARVA 3JZ7A 5J1SC 3LRMA 4ODUA 3H9SA 5FFOA 2MCG1 3X11B 2VJ0A 5ICUA 4BSJA 1AS8A 4BFBD 5DQ9A 5KW9L 1X5XA 3FT2A 2MQ3A 3V4VL 5IKCA 1LO0L 5DUML 1F8TL 2HN7B 5FYJH 1G0XA 4TNVK 1F4XH 4CBPA 3C12A 2DIAA 2OMNA 1IGIL 2UXTA 4JVWA 4PWEA 3CFQA 4FZEL 1CT8B 4WI5A 2XXMB 1J0YA 1P4BL 4JFEE 3GMPB 2R2HA 4OCNC 3LD8C 4QXUL 4I0PA 3SE3C 4WUUA 5DD3H 1FJ1A 5C0RL 4IHOA 1S7UA 1AGCB 3DMMD 4BZYA 3MOQA 1GY1A 5MP6H 3C8KB 4YQXL 1WAEA 2YIHA 4XO5A 1KYOK 5E00A 1HCZA 1S7RB 4ICWA 3B83A 3MQIA 4Y4FD 2R2CA 1OF2A 2VGLM 3QRGH 3SYCA 2VDMB 1F90L 1P4UA 5GGSA 4XPHH 3A5VA 4XAKE 1JRHI 4XMKH 3QQNA 3BEWB 4L3EB 4A2LA 1KB9K 1CXKA 3P11H 4DERA 4XP5L 4ZK8A 1DVXA 2JCWA 3RDTB 4C4KO 3SCMD 1Y18B 1T5XA 5BRZA 3RUGA 1OIOA 1ORSB 1JTOA 4GO8A 1JGDA 4U33A 2M2DA 2Y3AA 3LEVH 3UTQA 1MWOA 3O6FC 1Q0EA 5B1BB 2R27A 4ZFGL 1FCGA 5GGRA 4YZFF 1I3VA 4F2MA 1PZ5A 1XH0A 4F15B 2IFFH 2PPEA 4BFRA 4E0RA 1NAKL 4XN9A 4W4OA 3TFKC 1HHKB 3SE9H 3GK8L 2R39A 4HS8H 3LQZB 3AUVA 1E90A 4OV5B 4NQCD 4R4ND 1MVFA 4IU3A 4NB7A 3VI4E 3QR2A 3FCBA 4XBEH 4UAOB 5EZIL 3FU3A 3SGKA 4NUGL 3BISA 3FAWA 2QQQA 2J55A 2CMRH 4QOKE 1OGAD 1L7TH 2WXJA 4GJTB 3UZVA 4JFHD 5CS7A 1JZ7A 3IDUA 5C8JA 1GKOA 3VFMB 4YXKH 5FYKE 4R7XA 1K3ZA 4LCYB 4LO9A 4YHMH 4OVVA 1BFVH 4JGNA 3O41B 2C7FA 4A2EA 2WWKO 2OKMA 2A2QT 3EYOA 4DEUA 4AVJA 5L2JB 2UWEB 3CLEH 4R8WL 2EEAA 1Y6MR 3C6SA 3DMMB 3IJ8A 3ZUNC 2UYLB 3EJCA 3EG9A 5IY5B 4OFIA 5IJVB 2VXQL 3KBPA 3TNNB 4BVNA 4S1SL 5E2VL 1KC5H 5DZNA 3S5LG 3VRIB 3E38A 4YVUA 4J3OC 3D0VA 3U25A 4Y4FB 1T0MB 4BINA 1S7TA 2ZXGA 1N59A 3CZKA 1INDH 2YFOA 4J5VA 3ELQA 4A7UA 1ZS8A 1HYSC 4OGXH 4NRYA 4Q89A 5CFAA 1AMXA 3CV5A 4Z7VE 3V4PL 1JGVH 3OE6A 3ZL4H 9CGTA 4GLRH 2EI4A 2G2RA 1MCCA 1QFUL 3AADB 2UZIH 4RIRA 4JQIH 1TO4A 3DX3A 3MUHL 3KPSD 1CFNB 1SNRA 3MBVA 1YEHH 3IKCA 3T8MA 1RUAL 4E9TA 1N64L 2XYBA 5D4QA 2I7SA 3SCMB 3HZMA 4IRZA 4I7ZC 1N19A 1KYFA 2F8XC 5EU3B 1AIFA 4LP4A 1I7TA 4QRPE 2H1PL 5EUKA 43CAA 2YFNA 3F7VA 5C07D 5EU4B 5AX0A 4N20A 4L3FA 1HOCB 3F5WA 2DLIA 3GHEH 1I3GL 1X0I1 2CHNA 4WHYH 4P2QD 3CGTA 4AI7A 3PDSA 3WIHL 5CZVH 4X5XB 1A6WL 3BUQA 5HGHA 2V33A 1UZ6E 1YA5A 2QPSA 4I0CC 1AFVL 3ILPA 2AFNA 3CSBA 3GC3A 4JFFD 4BKSC 2AK1L 4K9EC 3UPRB 1PKQE 4OGAC 1KB9J 3MJWA 2OYLA 1AYRA 1OGAB 4QHNA 4PJ8C 2D0FA 3TZVB 4N6HA 1MQ8A 3VFRA 5D9SA 1IC1A 4GPOA 1L9HA 4HCFA 3RX7A 3VGBA 2IEPA 3U0PA 1WICA 4CL7A 3HAEA 3WNMA 2GSIA 5CEZD 3DBXA 1SFHA 5C0GB 1T1ZB 2BVQB 1XJIA 1TEFA 1YMMA 4NYLA 5HYJE 1E27B 2ZCLL 4A2GA 1DQJB 3A4EA 1I1AC 1G7MA 1TJMA 4HKBA 2BH0A 3IYLW 4XO3A 2YQBA 4HVBA 5IROC 4ZYKA 3AU0A 4AQOA 3PAVA 1VACA 4JPWL 1E67A 3INUH 1OSYA 5I8EA 4ALAH 4B53A 4DN3H 4WWKC 4GRVA 3ARSA 1PGRB 1BVOA 3JV6B 1BZEA 1XR9A 3DTXB 4UYQA 5EEUA 4FE9A 3VE0A 4S0SD 2FWOB 2VYRE 5D5MB 1XGZA 1A7RL 4W1TA 2GI7A 3RGVC 1FAIH 3QK0A 3DA0A 4PBVC 2OTUA 4Z7OE 2B7DT 3MACH 4HXBH 1BEYL 3ARUA 4N0YH 4W9JC 4PJXF 2E9WA 1K5NA 5KSVB 1H8SA 1TENA 3KPSB 5DRWB 5AKTA 4N9OB 3TH3T 2QQLH 4PHXA 3D3VA 3BH9A 3US9A 3VGGA 3AU1A 4A6YA 1BVKB 1V3MA 1IC4L 1M2OA 3D50A 1BECA 2ORBH 5C07B 4M93C 1DSYA 4OD2B 5DZJA 4R0LC 4OF3A 1IGFH 1KN4L 2ZOLB 3ROOA 1OAXL 3LX9A 4DFHA 4PJCF 3PP4H 5A16B 4P2QB 1WC7A 1BZ8A 1A6UL 1XZ0B 5HHOB 1LEGA 1EVTC 5IFHL 3I3BA 1JPGA 1TITA 5I24A 3TA3A 3KDMA 4AENA 3F6LA 3OVUB 1XTMA 1DLHA 3MFGB 1QSFD 2Y03A 4LPTA 1IC7H 5EU6A 5FKAA 4YDIL 1PF3A 3EKCA 4YPJA 4JFFB 5A2JH 4PJ9A 2FBOJ 2XPZA 1FF5A 1EVUA 4IQHA 3B5GA 5E9AA 4QLWA 1MCWM 1YSOA 3V7AG 3STZB 1N0LB 3VFUB 2JSFA 3ES6A 2OL3A 3KHQA 4NIKB 1ZANH 3TWCL 4Y2OB 2OMVB 4HKJB 2CR3A 2WV3A 3KCPA 3C6LC 3K2MC 3MC0A 2ZONA 1HHHA 1CF8L 3VG9B 1SOQA 1WHPA 1NANI 5T1LD 1CXIA 3LKQB 5C86A 1ONQB 1I3RA 2QSTA 2WN2A 3BCDA 3Q5YA 4GKNB 3BVDB 5D1ZI 5H2BB 3TBBA 3TVMC 3KPTA 1NEZA 4WEEA 4BELD 1ZAGA 1G7PB 5AVVB 3B6SA 4RFEA 2YBGA 5EORH 3VXMD 3DXAA 4MJ5A 1RERA 2NY7L 3MGOA 4HU2A 3RX8A 5H2IA 1TEYA 2APSA 2Z7UA 2WSPA 1MJ8H 1PY4A 3SDXE 2V3FA 2W60B 3ARDD 2R59A 2DW5A 4QCIB 1ZT7A 3STBA 3VFPA 1OAZL 1DLFH 3ILEA 3CSTA 5LB1A 4Q9RH 2CDEA 3HN8A 5HD8C 3NIGE 1IEBA 3KBEA 4GT0A 2KPWA 2I25N 4K8RD 3CH1B 3IJ9A 3X12B 3FT9A 1E0OB 2D9CA 2VLJA 3HZKB 4R4BA 5HVHC 2YOAA 3LIZA 3LEVL 4U6VH 2V2TB 4JO4L 3QH3B 4B9GA 4O2FA 4FG4A 4HBCH 4X8JA 2NY0C 1GW0A 3JV4A 4KGJA 1SOKA 1JFPA 3MRMA 1J1PL 1UFGA 2Z3FA 4DFIA 4X4MA 4JCMA 5GS0C 4UQ3A 5DWUH 2X10A 4YNYA 2DWSA 1H6EA 4I77H 1E9PA 3SE9L 1SLWA 4HS8L 5JHLH 3AWEA 4U1IB 3H7BA 4PEEA 3T4AB 4D9LH 4XBEL 4JDZB 2HRPH 3HKFA 2JB6A 3OZ9L 1QSFB 2GTWB 2MOGA 4KZEH 4O4YH 2X5PA 3ZE1F 5KJRL 1KXTA 3RVTC 3RILA 4S1DC 2VXVH 5TH2B 1NDGB 3QEUB 3UL4A 4YXKL 3Q2LA 1NLDL 2IDCA 3FFCA 4YHML 2J6EL 4K7PX 1BBJA 3CMOH 1BFVL 3PCYA 4MDIB 4X6EB 1EAJA 1RK0B 3C09C 3MUZ1 3PV6A 5FIEA 2XZCH 4MCZA 1WFMA 3CLEL 1WD8A 2RB8A 1EXGA 1HXMA 3ZN6A 2MCMA 2DEYX 2PCFA 3WFBH 2PXYD 2H9GA 3ISWA 4BRVA 3K8MA 1R33A 4X5QA 2CIIA 3Q43A 5CBAA 3CJJA 3LPGA 1JZ4A 3W39B 4XO4A 3GUFA 4AGNA 1AKJA 1KTJA 3UP1A 4U1LB 4GP4B 5DHGA 1HWGB 1T4KA 3IGFA 3MRQA 1B4RA 3ARFA 4QRRA 1INDL 5CO1A 3V10A 1I9JH 1EEYA 2ATPB 4OGXL 5ID0B 5KBNC 3VXMB 1CFSA 2RQ8A 3J8F7 3Q48A 4PSRA 4IBYA 1UB6B 1AP2B 1JGVL 3BYYA 1CICB 4I3RH 2BINA 4H8QA 5G28A 5FS5A 2UZIL 1FNFA 1SJEB 4JQIL 5D1QD 3ARDB 3QAZB 4MA8H 4XBPA 4ZMQA 4G6AD 4W9IC 2CHDA 2GBUA 3JVGC 4PJ7B 5D70H 1YEHL 2FIKB 3BSZA 2ZP8A 2DTSA 1CLVA 3IJSB 5DVKA 4JFYB 1UCBL 1FVEA 5H37H 2OJ1A 3QQXA 4H25A 2W81C 3RYMA 2CBOA 1T5WA 5F44A 1P0SE 4N8VA 4MJ6A 3TXAA 4DT2A 4BUOA 4J2XA 2CO6B 2W8CA 4XCCH 4Z3IA 1BAFH 1G7HB 4PRNA 4WI9A 5HI5C 2CLVB 3EO9H 4PJHF 4P4KD 2CGRH 4KOCA 1TSHA 4DP9X 1JD7A 2VKXA 2IAND 1A6AA 4NUPA 1A5FH 1T03H 3N44F 2DWYA 4JKLA 4KI5D 12E8H 2Y04A 4RFNC 5FA4A 5FKPA 5DD1H 3LNGA 1IW9A 3GI8L 3GBMH 3QE5A 4B3EA 1NFIB 4TYUA 5CN3A 3IJYA 3EDEA 1J5OL 1L9TA 2ZCKH 2HFGH 1QRNA 3TESA 3OAYH 4HUVA 4LHUB 4FCAA 2OCCB 5B7MA 4HSAC 4CDGC 1AD9B 1CN4A 2PCPB 1XGQA 5DD0H 3BWSA 2OSLA 3REWB 4Z77A 5MEPA 3O2VH 3OV6A 1DTUA 3LNDA 2BOLA 1EO8H 1HH6A 4PJAB 4KK9C 4ZS6D 3T6VA 4ZXBA 1TQBC 4RX4D 2Q2LA 2MQCA 4F8PA 2BP3A 3U2SA 3VFTA 5KSAD 2PXYB 3ABMB 3DHUA 4OCWH 1FH5L 3GSUB 5E5RB 5I5RA 3W9DA 3W38A 2EIDA 1MJ7H 1U8CA 3QUMB 2Q6WB 4HOMA 4XXCC 1JYXA 1I1FB 4HDIA 3BZ5A 2XQ0A 2X6UA 2WWOA 2XUWA 1AGDA 3CDCA 1CB4A 1FORH 3EYQC 4P23C 2P48B 5KAQF 2ICWI 2YKLH 3KGSA 1M7XA 3P2BA 3DECA 4DUVA 1DFBH 1R1CA 3SY0A 4DPCX 2NUTB 2VLME 2YRPA 1FAIL 3F85A 3BFWA 3FQNB 2D2CC 4N0YL 2BHZA 3GTNA 5EO1B 1EV2E 2RIKA 4K8RL 2AAVA 4PLKD 1OZUA 5D1QB 3FAXA 1UHVA 1WAAE 5BW7A 1LMKA 3PWLA 4ICXA 4L37B 1NCJA 2WJ5A 3QJRB 5HDBE 4AT6B 2XWTB 2QQLL 3EO1A 1OB0A 5F1OB 4GG6F 1AQDA 1E4JA 2KPNA 1RSFA 2VXTH 2XHNA 3FXIC 2A4CA 2APTA 3CPUA 5DVOA 5BJTB 5MERA 2CKNA 1AC6A 2ZUUA 2DQHH 4BFNA 3WFDH 2W95A 1IGFL 4KHTH 3PABB 4G3YH 1X9UA 4TNEA 2VXSH 3PHOA 4KX9A 3VI3E 1C1EL 3GMNA 3UTTE 3IVKA 4OZ4A 5IHZA 4XODA 1TQTA 3FTGA 5LGJB 4P4KB 4AQ1B 1XV8A 1UWFA 3IGAB 3OSKA 5DJCB 4ZUVB 3ZRSA 3LV3B 1ND0A 2IANB 3HHSB 1RMFL 4M7JH 5BXFB 2YSTA 1KXVA 3TO4D 3GXMA 1CL7L 1IC7L 1WFOA 4CMMA 4OZGE 2VXUL 2LQRA 2ED7A 5JXED 3FCUB 4J3TA 3NY8A 35C8H 3G6DL 4G6JH 5EEVA 1C5BH 2ZKHL 4D9QD 2XOTA 3M1BB 3FO9B 1TSRA 1MFCH 4NKDA 3V0EA 2DICA 3G9VA 3QUML 2WLMA 3MO1B 2X2IA 2HJFB 1MFEH 2MHAA 4YSQA 3J27A 5F93C 5FW7A 2EP6A 3B2PA 4KROC 1GGUA 2ALAA 2R2BB 4HH9A 2YGOA 2EDWA 3DDLA 2H6PB 3QAPA 5KSAB 3IT8D 3E8UL 3HBPA 3QEQD 4J4PA 2F15A 2FCBA 1VGEH 2L7EA 2X70A 3ECUA 3FMGH 3G5ZB 2P80D 3SDCA 2MCAA 5JHDB 2DQEH 3SE6A 5DS1A 3PWNA 4RZKA 1A3LL 3QQ4B 2DQJH 3TEXA 2AQRA 3TBSB 1JFQL 2X3BA 4A4MA 3FFDA 1IVLA 4JPIA 5EORL 4M62L 4K15A 1V3LA 4WFHD 2JKNA 2X4NA 4OLZL 3RGBA 4RAVA 3P9WB 4BDVB 1YJDH 2Z92B 1NDMA 3HZ3A 1TQVA 1FP5A 4ORGA 5E1AA 3F12A 2ZX6A 1QEXA 5T1JA 2W80C 3CVCA 5MHSD 4Q9RL 1VLXA 4Q14A 4ISVA 3GPEA 5I1CL 1AXTH 5T5FL 2NY2D 3N2JA 4JFXB 3BE1L 2OMXB 3B3IA 3L6FA 5I1HL 4XTNA 5JNYA 4OR1A 1A9VA 5CBEA 2IPKA 1PZCA 1RPQA 1OW0C 2BVPA 5GRWA 2ESVE 1HE8A 3CVHH 4XOEA 5ENWA 2P47B 1BF5A 3BAXA 4LGSB 3SKUD 4C59B 5INCA 1TVHA 5G4NA 4U1JA 5I8CA 1CTMA 4I77L 4QWWD 5TE4L 2JK5B 2Z73A 3BXNA 1UXWA 5JHLL 1KLFA 1T2XA 3QJZA 4TRPL 4XP6L 1OP4A 1Z3GH 1XB8A 5CCGE 4RBPH 4D9LL 2ZD0A 2FQDA 2HRPL 4GUPA 4JLRA 1NBVL 3FQRB 4M9PA 4NERA 2Z7YA 1HI6A 1HINH 2ILLA 3IMBA 4KZEL 4O4YL 4U6YB 3TO4B 3VWJB 3CX5K 5HYSB 3BAKA 4EZKA 2VXVL 5GJSL 4TLSA 4CVZB 1GPOH 3MZGB 1IJNA 2ERJB 2BSTB 4QAWA 3FCTB 4NGHL 4UT6A 3IDJA 2X12A 2BDNH 1JZJA 4GH7B 4PRIA 2X2YA 2R9HD 4AQEB 4LEXH 4A55A 1AJ7H 1WV7T 2I5YH 4XT3A 4NPYA 2XKUA 1MSPA 3GMQB 3PQYE 1TZHA 1A21A 1KPVB 4QXTA 2E6JA 4WLCA 5L9DH 2X4TB 3OTTA 4OZIE 3OAYK 1KCLA 3RY4A 1W0YT 3ARGA 3TJEH 2E7DA 5FUOH 2IBBA 4XPFH 4WZ9A 3ZGHA 1UVQA 1NMCB 7TAAA 3QEQB 4JFPA 1BFTA 1G0DA 1BQHB 1NUFA 1PQZA 3PNWA 4MVBD 3VH8A 3HG5A 1JWSB 4NKOA 4JRYA 1K85A 3EHBC 3CHRA 2GJ6E 3MRCA 4UF7C 3T3ME 4DETA 3DX9B 5HPMB 3RVUC 3QI9C 4HS3B 3WJJC 4MMZA 3HZYA 3LHPL 5GRUL 3ZKMD 3HNVH 5ADOH 2Y2WA 3QO0B 4QJ3B 1QFWI 2AV7A 2D8KA 4JFEA 3T1WA 1KCRH 1OAQH 2EIBA 1LDPH 1J8HE 4MA8L 6PAZA 1AGFB 3DSFH 1MW1A 5D70L 5GGVY 3TBTA 3BIKB 2WYZA 1D5MB 3U82B 5JDSB 4QXGH 2NY2B 4KBPA 2LLLA 3CZFB 1SMAA 4MCYA 3IF1A 5D1ZD 4GIAA 1JUFA 2Z35B 3TIEB 4AQ8C 2VJ8A 4ATTA 3KPMB 3VFWB 4XCCL 4Z3EA 1NBZA 2R69A 2OBGA 4MQTB 5F7FA 4G82A 4X7TB 4K23H 1U91A 4QIRA 2CGRL 4FABL 1V5JA 2D7MA 4LBEB 1U92B 3SE3A 4PGEA 1S9VB 4GP5B 1KJMB 4ZQKA 1A5FL 1T03L 3AG2B 1UOKA 2E3VA 1R47A 4PJFB 4JDTH 5AB0A 5TGBA 3OKDA 3TYGL 5L4MA 2GAZB 2A9ML 2DLFH 4Y9CA 4ADJA 5C6WH 2ARJQ 1H8OA 2ZCKL 4MCNA 1S8DB 1WF5A 1SYSA 4ZOEA 3NIDE 3L9RB 5L4JA 4Q8BA 3TJHD 5MENE 1QSED 2ICES 4YAQB 3KZ8A 3E6FB 1KTBA 5DD0L 1UOVA 1AZBA 3O2VL 3CFBB 3O0RH 2M3GA 4G1EA 1EO8L 3REVB 4YXLH 2NCMA 5F0LB 2F18A 1CCZA 5KN5A 5DLMH 2YRBA 1RJYA 4ONFH 1S78D 5CLTA 2Q3ZA 4OCWL 1AO7E 1IGCH 2VMJA 4G71B 4KTEL 5LKNA 5ISZA 3IS1X 4XP1H 1MJ7L 4U31A 3QDAA 1G7LB 3TTSA 2OI9C 4YE4L 1VGKA 2BVOA 4WFGE 1A7OH 2RFXA 5JIIA 1R3HA 5EO0B 1FORL 4NAJA 3O6FA 4QOKA 1JTTA 1E5ZA 1GHFH 3RFZB 4UAOC 3UJIH 4JM2A 5D4HA 1U8LA 4JB9H 2R0ZH 4P9MH 4QHLB 5I1LA 4J6IA 4X99A 3CODA 4IJTA 3BIAX 1QHQA 1HKLL 2DQCH 2WMPA 2W07B 2XLLA 5ESVA 1IB5A 3QFJD 2QDWA 5AVSB 3V9CA 2WBXA 4M1DL 1BYPA 4ELMF 2DV6A 3QUXC 4GG8A 2A6DB 1UQSA 3OMAB 2NR6C 2UY6A 5AAPA 5I17A 2CLRB 3BWUC 2XY2A 3CN2A 3BVUA 3PGDA 1XCQB 1K5WA 4RVBA 5D1ZB 1AZNA 1ES0B 3BVTA 4OM1H 5F6HJ 4D7BA 3PWHA 5EIIA 4KHTL 5C7XH 4G3YL 3DIFA 4X6BB 3IE9A 3QDGD 4ELKB 4UNUA 3DHMA 1SXBA 3JUYA 4ZUTA 1T66C 5AZEH 1HL8A 4QKXB 3AVEA 4UM9D 4OJDH 4ZW5A 4WI8A 5DVPA 4EUPH 4Z7VA 1JZ6A 4QXWA 3LVEA 3ZT6A 2JKWA 2OXHB 2XPYA 5HHPA 3L3DA 4M7JL 3QO1B 1I7ZA 3SYPA 2UWEE 4FQHA 2DAVA 5DJZA 2V5MA 2JKXA 5CGMA 4PXKA 3QSKB 4OQTL 2H26B 2X3CA 4UZSA 3VFNB 1E9QB 1JZDC 3DVFA 3FTSA 5JW5A 1FFRA 35C8L 1ZE3C 4MYWB 1C5BL 1PY9A 1QP1A 4MASA 4L4VE 3SCMC 1MFCL 3UTPD 3KBHE 1MJJA 4C4KT 4Q56A 4HAGA 2YD4A 1VESA 2OMYA 1KXQE 4HWNA 4HPHA 4IEFA 5C0IB 1QFHA 2WNWA 3UC0L 4DO4A 4X6CB 3QIBD 4OQ1A 2AQ2A 3DLQR 4LNRA 2B1OA 4FF9A 3BI9X 1LQSR 3FMGL 2EKSB 4ZMXA 3FYEB 2NSQA 3Q01A 4KPHL 4N6QA 1IGJA 3JTBA 3BDYH 4G9DA 5IVOA 1VSCA 3S8WA 3MA7B 4R4NC 1PKQA 4WI2A 1LE9B 4BUGA 5HI3C 4G7RB 3WTXA 5DMGC 4AYBA 2XXFA 3PGCB 4YO0A 2HAZA 1YJDL 1VERA 4LL1A 1CBVH 3QEHA 1BP3B 1DVFD 1UATA 3ETSA 2KT6A 3FB5A 3FSZA 3TZVC 1ZY9A 3LKPB 3VVKA 2O5ZH 1HHGB 1DP0A 1AG6A 5B8CB 5HYJA 1KGJA 3QFJB 4MQ7B 5AD0A 2AEIT 1AXTL 3DYOA 5A43C 1LNUA 1EO7A 3VB8A 4YR6A 1BWWA 2DYPA 3ZYOA 4DESA 1WFJA 5EU7E 3UTOA 2WWKT 4PJ8A 1EMTL 1MOEA 4S1RH 1RPUA 5IW3A 1J10A 4KJWC 4KJYA 2Q8BH 5DEFA 3CVHL 4X6FA 3JTTA 1KOAA 3TT1H 4XNAA 3OWEA 4AM0A 1TO5A 1JN6B 5E8DL 3QDGB 3OKLA 2F0CA 2NNXA 3KVQA 2A1WH 2V9RA 3DTDA 4UM9B 1A0QH 1FZOB 1I1AA 2AI0L 1P8IA 4NS0A 4UTAH 2VERN 3R8BB 5IROA 2CJ3A 3R7QA 4MJID 3CPLA 3STLA 2OM5A 3UG9A 4FLHA 4UIMA 5TF0A 1ZJAA 1H6TA 2UX6A 4FL4B 1USQA 1DQQB 2PPDA 3HZVB 3CE1A 3LH9A 5FX3A 1JNNH 3ET9F 4ABVA 1NKOA 4JFZL 1WFNA 4WNJA 4X2UA 5ERWB 1JYVA 4PMFA 1Z9PA 4LRNH 3I9GH 4KKPA 3V6ZB 4DAJA 2VDKH 4PJDB 4HUXB 5FWRA 3RGVA 4LSPL 1CE6A 1NC2A 4M3JA 4RA0C 1RUMH 4NLAA 3RPKA 3NN8B 3QZWB 5F0PB 3S3PA 5L9DL 4HV8B 4WTZA 2KLRA 4HC1A 2GK0A 5EBWB 2AKRA 4B7IA 5EBMB 2X6AA 2QZQA 1U33A 1ADWA 4NDMB 1I7RA 3VA6A 3QIBB 1BQUA 4G6ML 4HT1H 3PV7A 1IKNC 5EZLB 5FUOL 3SODB 3V5HA 3CVDA 4RDBA 4K5MA 5CJXC 4NKIH 2FJGA 2AJYL 3B7RL 3K80A 4JG9A 5BZXA 3KXFE 3OJDA 1FNGB 4S0HA 4XNQB 1SUJA 3KWXA 4R0LA 3FPYA 1IARB 2VM3A 4U6XA 2EKJA 1LK3L 1PEZA 1EANA 1JMZA 1JZHA 1UENA 3OG6B 4UQIM 1FYTD 5ADOL 2VDRH 3KLDA 4KO7A 3ULSA 5H2MA 1ZK5A 1DVFB 1OAQL 4HKZB 2RJMA 1QQDA 2YN5A 4KNSA 1KB5A 1MLBA 1N67A 3WO4B 4RAHA 4EEEA 3AQDA 5HHOE 3QCVH 4QXGL 5MEQA 1NPJA 8FABB 2X4SA 1YNKH 3FQXB 4PFEA 2VIRA 3KVPA 1MN4A 3VG9C 5GRVK 1HH9A 4QO1B 3V0HA 4P46B 4IS6A 3ZQ9A 2FE0A 3APNA 1CIUA 1QFWH 3VGEA 5F71A 2FK9A 3KLAA 1YY8B 1TVBB 4U7KA 2ICWB 4GMTH 3I3DA 4ODXA 1N3NA 1HHJB 1LK2A 2LFGA 3VXTB 2APXA 5CIPB 4AYEC 5I76B 2G75B 3C6LA 3IN0A 4FKEA 3HAEG 3L81A 3SDXA 4HG4K 5CEZE 3GGWA 2WVVA 3WKML 1JHTB 4I4WA 1ZLUH 2WIIB 2HG5B 3KPLB 4JDTL 3DROB 4MJIB 2DLFL 2EQDA 3N1MC 3TVMA 4ZFFB 3WEAA 2G60L 4OH2A 1MCNA 4MXVF 3G5XA 3P2DA 1QPKA 3H56A 1I7UA 1SJVA 2EINB 1UWGL 5EOQL 5FR3A 1Q5JA 2D2OA 1P84K 5BOZG 3RPBA 1DQML 3N06B 3O0RL 3WIAA 4F7PA 4YXLL 1MFAH 5DLML 3F7QA 4L1LA 2MNJB 5KYYA 4ONFL 5MEOA 3BWAB 5GS1C 5ICZB 2JKJA 1JVLA 5EN2B 1RJZB 2KUTA 4NQDD 4EIBA 2V7HA 3QXAB 5DMIH 2AXFB 1A7OL 4LLVA 5HYQB 2HT3D 4IB4A 2HZHA 4MMXB 3T4AC 1PFCA 1FO0A 1G5GA 1GHFL 3DQBA 3UJIL 5FCUL 1D9KC 1R4XA 1CDBA 1IX2A 1G9NL 4JB9L 2R0ZL 4P9ML 4MAYD 3K6NA 3LKRB 4Q97A 3DUSB 5BUGA 1FYTB 1TJGL 4H5SA 4R96A 3NCYS 1WK0A 5J12B 5HDRA 1QLRA 1NUGA 2CLZB 4GXVL 2QR0A 5GRVL 4KX7A 3EAKA 1OOWA 4AGPA 2DQTH 2XVKA 1NL0H 3BZFB 2EYRA 5LJYH 2NZ1A 4XCEB 5I16B 3HR5A 2NT1A 4TPRH 4XN1A 5EN3A 3QWOB 4K3DL 4Z8FL 5I0XA 4OKDA 3OXRA 2WNGA 5AYUL 1OY3B 4HUKB 2QZ5A 3KLHD 1MQKH 3WJLA 1ZIAA 4PJIB 4YFLF 5IQ7L 5L2KE 3II2A 4H8HA 4NWUL 2V8MA 5LGHL 4K5LA 1GU8A 3C8HA 3PDOA 2FT8A 2ZJSH 2P8MB 2ADJB 3MJGX 4GQPH 5I8KL 4XP4H 4M4RA 1CICC 2XQBH 3T77B 3N42F 2H0PA 2CDFA 4HGMA 5JIKA 2IO5A 4LSSL 1Q9LB 3KNBB 3QAZC 5D7LE 4HXAH 4BQCA 1D7CA 3R4DA 1A1NB 4JY5H 1X5LA 3HC0B 2K6YA 3C2SA 2VM4A 1NEZG 3IDIB 4HFWB 4XB7A 4OIAA 4GEIA 1JPSH 4EBQH 5CCKH 3PWPA 3FOLB 3U7YH 1K4CB 4BFIB 1ILUA 4XAWH 4BQ6A 3VXME 2ZWNA 3FDWA 1WIUA 5D71H 1PZAA 4Z3TA 1W0WA 4AZUA 3JVGA 4NI3A 2DQDL 3W0WD 1E4XI 5EUOB 5I1JH 1U8PA 5L88L 2WINB 1KELH 1VB9A 2VITA 3HUJB 4ZO6A 3VSUA 3QJQB 1S7XA 4LARL 1QR1B 1EHLH 2E8YA 3VM5A 3IWUA 4M00A 1ZHBB 2ICWJ 4Y9BA 4LEOA 4HLZG 3ZSTA 1PD6A 3MA9H 4FI7A 4YDJB 5ILTH 1BLNA 2BOCB 5FDWB 1NFKA 3FUDA 4RAUA 1YPZF 1S7SA 2ZSVA 2OW7A 1A4AA 4MAYB 1E28B 4E9XA 2P5ED 4XRCB 5BS0D 1IM9A 3LQAH 2RR3A 2PR9A 2O5ZL 1R19A 4HEPG 1LJMA 2X89D 1MNNA 4OCYH 5B0WA 1N0XL 1ET5A 5B3JF 4M1CC 3DV6B 4LVOB 2WC7A 2VH5L 2E6PA 3CN4A 4X5WB 1T6BX 3H6JA 2Q86B 2HVBA 1T4WA 1T0NA 4U1NA 2WLKA 3MODL 1HE7A 2Q8BL 3NOIA 3Q9PA 1QBBA 2ZX8A 1WLHA 1P4LB 3GPSA 4HIHB 4NRXA 4K7FB 4UV7H 3TT1L 5A45A 1XH2A 3OLGA 2CA4A 3A4FA 3CG8A 1M56B 2CUAA 1MRCH 3R4RA 1FFPB 1A0QL 1O5PA 3UZAA 4JN1H 4XN4A 3MI6A 2OPCA 3PWJB 5H2LA 1HKFA 4UTAL 1RZGA 5FO7A 5HSFA 4N5ED 5HHQA 3GXDA 1JTPA 1WAAA 5E5MB 1J8KA 2YCXA 1E9OA 4I9XA 4D0BA 2P5PA 2IWFA 4XXCA 2DBLH 1J0JA 1AIZA 1IFHH 3CK0H 1BXXA 4H8WC 4YSAA 1ACZA 2HB0A 4S11A 3FT0A 1ZSDB 1JNNL 4HUWB 4P23A 3N3EA 4G6AC 3RL2B 3ATBA 4PJBA 2F58L 3BKCH 4R7NA 1ZLUK 2JIXD 3IXTA 3WNNA 4LRNL 2IWEA 1R3KB 3KL5A 3NG5A 2EIZA 4GQRA 4NBXB 4OUOA 3NRPA 1IKFH 4KHXH 5GS2H 1RUML 1L0YA 2Z9TA 1LEKB 5CJ5A 2WZ5A 1LO4L 3VI3A 3WEXA 3UTTA 2WXHA 3EFFB 4G5ZH 5CP7A 4M6MH 2SEBA 4CU6A 2CKBH 4FP8H 4JFWA 2N1KA 4HT1L 2WZPA 3W0WB 1U8OB 1CR9H 2WXPA 2W0FA 1T2JA 2VISB 4XN7A 1J8SA 1SEQH 3W9EB 5AL0A 5KANG 1X4YA 1PJWA 2M8XA 2A83A 2XT1B 1HXKA 3RGHA 1DFXA 1UEYA 4OZGA 4X4XB 3VG0H 4KI5C 2F61A 5EO9B 1CDCA 1DDHA 1Y07A 1YN7B 3DSNB 4N8VG 4PRPE 4XNZC 2X6CA 5JW3H 4JUSA 2P5EB 4BGLA 1IZJA 4AEEA 5BS0B 4NO2A 3VXQB 2ZOTA 1F5WA 1FUNA 4TVPH 1CFTA 3WMSA 4RA3A 4OIFA 5KVEE 4APXA 3MGAA 2QT6A 2WOYA 3OZLA 4M7ZB 3BZDA 3EXJA 3EBAA 3QCVL 3RNQB 2YZ8A 1L9SA 3WN5B 1YNKL 3NCFB 2WZ0A 4MJ4A 1LE5A 5EU5B 4ZS6C 1CD1A 4KI5E 3BDXA 4FS0A 5KSAC 4Z6AT 1SHWA 1QFWL 2WUCH 2RAMA 4N5UA 5LHDA 4GSQA 1G7JB 2RHEA 2Y72A 1L5GA 3CHXA 1J1XH 2VERA 5JW4M 1Z32X 4LLYB 2H7WA 4L8DA 1NM9A 5F1NA 5E08L 3WUWA 4DOHB 2DQGH 3EUUA 3DOSA 4I48A 1DQLL 4M02A 4YDLB 3O11A 1DBBH 3G6AB 2B2XH 2ZWZA 3B9KB 1EZLA 1JD9A 5I82A 4WI0A 4NRZB 1KGYE 1OO2A 3CBJB 2KSYA 3MV01 3QUYC 2E9GA 4ANVA 3Q2WA 1N5YH 1M6OB 4HMDA 1A4JA 3GD1C 3CHSA 3N1QC 4LKXA 5JHDE 2JIXB 3AAZB 3ODUA 3FCSB 4ZSOE 4I1NB 3L95A 4BUQA 1ZHKB 5IR1A 1KB3A 2WOBA 4GPVA 2NLJB 4JQVC 4TNWF 2YDOA 2A4ZA 3FQWB 4KTDH 4ODTL 1BYOA 5FV2A 1BD2E 1XSKA 3IMWA 4DKFH 5K59F 3WFEH 5DUJA 2JFCA 4PB9H 2PCXA 5HYFA 4CBZA 1CFVH 1XD1A 4XO9A 2AGJL 3WDJA 5DMIL 3U4EB 3HFML 2J8UB 4G59C 2KZWA 5C0CE 1SMDA 4OIIL 3BVNA 2X87A 1ETZA 3ABGA 3GSNH 1OW0A 4KI1A 1ACXA 2K6WA 2Q76A 5JMRA 3UTWA 1E42A 1D7FA 1XVSA 3VWJC 5CJOL 4AJVA 1SOXA 2ZXEB 3L17A 2NY3B 2ERJC 2WYIA 2R56L 4IKIA 2RCSL 3PQYA 1F1AA 1B90A 1HQ4B 4DJHA 3FSOA 3RJQB 2CRYA 2E9BA 4HJ0C 3SO3B 1NL0L 4OZIA 2DJMA 2D73A 1F1DA 3H85A 4YSEA 3BT0A 1DQDH 4FMKA 3WY4A 1U8MA 2GFBA 4ZW6A 5GGVH 2I85A 1BZ9A 3OKOA 4TVPD 2VE6B 1SLUA 1ZHLA 4MQSA 2CIKB 2QSCL 2FYYA 1BIIA 3LSOA 2CR0A 2I1XA 3JT2A 4I85A 1UXMA 2WLIB 4WHYG 1QR4A 2EXWD 1MFDL 4FQ2L 1KJVA 1MQKL 3BQUD 2ZAGA 2GJ6A 4NIYE 4X7CC 2Y5QA 3HNSH 3GKWL 4L9DA 2VT0A 3DURB 2E76C 3ZE1B 2ZJSL 4A7SA 5I19L 2KLSA 3T2NL 1XAKA 4OI8A 2V17H 2ZYSA 4NZUL 4XP4L 4Y89A 1J8HA 1YEFH 5DRXA 4RDQG 4NJAH 4OT1H 2FD6H 2XQBL 3V0GA 5AWZA 5I6OA 3RI5K 1IBDA 1ZLDA 2WLNA 5AVZB 2DKSA 3WKNA 2A6KA 2G4GA 4HXAL 4EZMA 1BPVA 1G1OA 3WJMA 4W9FC 4EN3D 5K9QI 4YH6A 4YHLH 1R5VB 3WJJA 4YHOH 3PWVB 5I1EH 2PWDA 2RQEA 3MYJA 2B4CH 4WJG3 1JPSL 5T1DL 3C5JB 3EJYD 4RWHA 4EBQL 2OXGB 2VQ1B 2H3KA 5HHNA 5KVDL 4XNYL 1A14H 3K2UH 4NQXB 3ZKND 1F3JB 5T1MA 1U3ZA 5HJ3A 4ZI8A 3LYRA 4HIIA 4WFHE 5D71L 1ZT4B 1UA3A 1HOEA 3O3DB 3VNZA 4N2AA 5I1JL 4K94H 2FT7A 3ZDZB 3GMPA 3Q2CA 3L3IA 5HYEA 1KELL 3M1OA 3V52H 1WO2A 1E7UA 1CXEA 4X8XA 1AGCA 5HHXH 3MA9L 5ILTL 4GRLD 4PGDB 3O8XC 5HGBB 4AQ8A 1KTRL 3C8KA 1GJUA 3FU8A 1OSEA 5E6ID 3OAXA 5MENA 3L5XH 1KIPB 3S6CA 2XTJC 2FJFB 4ODSL 4HWBH 2UVFA 3X2QB 2BRQA 5J1TC 4X1HA 1E50A 3N0AA 5SX5H 3MTRA 1U8IA 2V0AA 4HIJA 1JGEA 2F54D 3MBXH 3P0GA 5AUMB 3BEWA 4L3EA 1HWHB 3BKJL 3QIWD 4D9RE 4XC3H 4O02H 1AOZA 4JM2F 4FQQB 4PJFE 1BX2B 4FYSA 1V3JA 5JJNA 1Q38A 2WLLB 2YR3A 1EPFA 4TLKA 4TVUA 1F50A 2XTJE 1GKEA 1Y18A 1ZA6A 2HFFB 5D4JA 2IAMD 4UV7L 4UZUA 1ORSA 5HY9B 3BQUB 3ZO9A 5CD5C 3AT9A 1C12A 1MEXH 4MVBC 5IUCA 3EJZC 4BEYA 5IG7B 4JN1L 3W37A 3RFZC 1ZKAA 3EJTA 4YHYC 1R2NA 1A3QA 4XMPH 1TQCB 2ZWSA 3RHWF 2K8MA 5AZDA 3ZKMC 2IH3B 1E3FA 4W6YB 1HHKA 1C5CL 2DBLL 5I73C 3CK0L 1B3IA 2EC9U 3LQZA 4G8EA 4EJ4A 1XF1A 3BPCA 1JERA 3SGEI 3WG7B 4PCTA 3BKCL 5ECJE 4EN3B 3KHOA 1KGWA 2VLRE 1KIUB 1I1RA 2EDNA 3GSRB 3UOAB 3WLBB 3LVTA 4HETA 3DX8B 2YJLA 1BWMA 3GUTA 4JZNB 1AC0A 4XXJA 1AYOA 1DBAH 3VFMA 3VFVB 1SY6A 3QHFH 3UO8B 4M6ML 1IGYB 2DLTA 3OPZH 4X32A 1ITCA 2V3DA 3ZL1A 3QUXA 4N24A 3N5AA 3FO2A 4FNSA 4CJ1A 2NR6A 1CR9L 4AE0A 5ICYA 4J27A 3U9PH 4XZ4A 4QGYA 2W1NA 5ICXB 5KYUB 3ZKXB 2UWEA 2YGQA 5A2FA 5BR2A 2BHFA 4AGMA 1HEHC 3E2HB 4PJ6A 2UYLA 4GRLB 3NJLA 1CXLA 2BFVH 2EZ0C 1AP9A 1MW2A 5E6IB 2MTPA 3VRIA 1U30A 3M88A 4H8WH 4L4VA 3GMRA 1T0MA 4IARA 4TVPL 1BF8A 2ADIA 2ARJA 4B6ZA 4H13C 2OMTB 3COCA 1MHHA 2JAFA 3NJVA 3K81A 2F54B 4MX7B 3RX9A 5A8EA 5A1AA 2X0VA 1UJ3B 3QIWB 5TPWL 4IBLT 1JP5A 4J8RB 2VUOA 3EDJA 3WBDA 4EI5B 1TLMA 2QGDA 2WUCL 4HUMB 3SCMA 2F74B 1N5AB 3NZHH 5IFAH 1MWAA 1P1VA 5KVEH 5I30H 2IAMB 3OLDA 1J1XL 4BE6A 2DIBA 2ID5A 4ZPTA 4UDUB 3QQ3B 1MCPL 3NGBB 4NQVB 2WXRA 3GMLB 3CSYB 1ADQH 1HOCA 4BHUA 3GMMB 2XZQH 4K3EH 3NFSH 1IIIA 4N0CD 3P4MB 5DRNB 6PCYA 4CADB 2B2XL 1E3XA 4X6CE 3CFEA 4FDWA 4YDZA 1WA1X 4X5XA 5DYOB 3ZVVA 3QJHB 4GW1B 2PETA 5DS2A 2H8PB 1N5YL 3LJ3A 1WA2X 4Z9KB 3EOTL 3RVVD 4MA1B 5IBUG 4EVNB 4V2CB 1SF3A 3UPRA 1DANT 4XGZA 5DHVB 4LLMB 3TZVA 1GIGH 5J6SA 3RWGB 2CO3A 4N86A 1JFHA 3WEOA 3Q13A 5TDPB 2FR4A 2D7TH 3DJSA 4U4IA 4PG9B 3WFEL 2R15A 2E27H 4PB9L 4HJJH 4OVUA 3VVVA 5C0GA 2ZX5A 3M07A 2BVQA 4KJPC 4Z7UF 2A6IB 3EYUL 3NFPB 4QPEA 4RGND 3QFJE 1DQJA 3H2PA 4A68A 5DXWA 3ULVF 2I9LA 2VAJA 5DJAB 1WITA 4HISA 2C9QA 2CKBA 4FNRA 5HJDA 1CGYA 1NFDE 3KS0H 5ID1B 2C3HA 4FL4C 2VDOB 4JPQA 1PSKH 1P53A 1EEQA 3LXCA 5EIIG 1K8IB 5C3IA 3DTXA 5BZZA 2R2EA 3WUZA 1JF5A 5H37G 3UCRA 5D5MA 4X31A 4HD9A 3GSQB 2AQ3A 3MGTA 5GGVL 3PG2A 1NCWH 2X6VA 3AY4C 1IGTB 1X9LA 5IK3B 5SX5K 1CBJA 2HKHH 4FLSA 3KXFA 5C1MB 3O45A 2XN9D 3OAWA 4HWEL 2O93L 3AY2A 4J3OG 1BVKA 3IDNB 3QS3A 3U36B 2J25A 1FV1B 3QQ9C 3HNSL 4HYJA 2DN7A 4RRPA 5C07A 3HRZB 4OD2A 4PJDE 4IKNA 2WQSA 3QDMD 2ZOLA 3OC8A 1WWCA 2FD6L 2AQQA 4GI9A 5CJXA 1DBJH 2ADFL 4M61B 3SDDD 4UTCA 3HB3C 4Y16C 1XZ0A 5HHOA 5C6TL 2BNQD 3Q2VA 5ESQB 4FQJL 5E2JA 4PLOB 2LU4A 5HDOA 2JJSC 2Y2YA 2HPYA 5GIRB 2FX9L 3GQFA 4N22A 4GW5B 5I1EL 1KWGA 1D6VL 1AHWC 1LQBC 3SDXF 2B4CL 4JFFA 3U83A 4N0FB 2PF6A 3HJ0A 4ENED 3ZGIA 1AQKH 1A14L 2PUQT 3K2UL 3QFDB 1WEJL 1S52A 4KXZH 2OZNA 4P46C 3VMPA 3HRPA 1FN4B 4WTQA 2BIPA 3WEMA 3VFUA 5IB2B 4K94L 4Y8DC 3HC4L 4Y2OA 2ZXCA 3ETBF 1Z0MA 1LO5B 3V52L 1RP8A 3LKOA 4LEBA 2NUPB 4L35A 4RGNB 2VDOL 2VABB 3T5WA 3VG9A 1NSNL 1SDDA 5E24E 1M7UA 2CHZA 4WUKH 5LBSH 2OV0A 3LKQA 1ONQA 4I2XE 5IT2L 2Y02A 3L5XL 1X7QB 4MNGB 4I89A 4NP4L 1ZPUA 1FBIH 5AZ2H 2XXCB 4HWBL 1LL1A 1E4XL 3BFOA 3S48A 3GSNA 1RZKC 4E9LA 5D8JH 3MJ8B 3VDBA 2VW7A 3DPBB 5F89B 4WENB 1KN2H 4XC3L 4V1DE 3H3PH 4KVCH 5DI8B 1ILSA 1CU4H 2W60A 4GI6A 1KSRA 3QPXL 4X4ZA 4ZFZB 5I8OL 5G5DA 3IE4A 4FERA 4MJIE 3H55A 2DQMA 4I18C 1DO5A 1DZ0A 1D5XB 2J73A 2VAAB 2XN9B 3OQ3B 1QMUA 3X12A 3HZKA 4YLQT 3L3KA 5EF3A 5BO0D 3AXHA 1JHLL 1YYCA 3QH3A 3D5OF 3FU0A 3DIVA 3ASWA 4XMPL 5GS1A 4E9RA 2GIMA 3QDMB 3ZZLA 4XMLL 4ZFOA 5AFAA 4U1GC 2I26N 3MBEC 1IAMA 5B38B 5J12C 2YMXL 4H1LB 4J6RH 3SDDB 1XCTA 4U1IA 3T4AA 2BNQB 1YVLA 4U3SB 3WKQA 1DR9A 3ZKQD 1AZVA 3OD3A 1D9KA 2XBTA 4JDZA 3MREA 1NGQH 1QSFA 4JRXE 4IBZA 2FECI 2BM3A 1NDGA 3QEUA 4QRQB 2BOBB 4P2RD 3IBEA 3VM7A 5L2KA 1GJWA 2I69A 3QHFL 3QFGA 3ULUH 1J9RA 2EDYA 2QVFB 1PKOA 3OPZL 1CI5A 1N70A 4F7KA 1U19A 5DK0B 3LRLA 4FOMA 4MDIA 4X6EA 1FHNA 1E6JH 3NT0A 4WV1C 3U9PL 3MLRL 4H8PA 4IIQB 2PP7A 2KDYA 4K73A 2ZNXA 4LSUH 4J28A 4LNVA 3QYMA 1KIQB 3HMWL 5GGTA 4JK0D 1P7BA 4YZFE 1G94A 5D7LA 5ESAA 2GJZB 5FYLD 2BFVL 1AXIB 4BKTC 2GIYA 4TXVB 4PS4L 2QPDB 3LY6A 1X3DA 3GIZH 4FD0A 4PJEF 1I8MB 4OFDA 5DT1L 5IJKA 4PJIE 2AEPH 3U46A 5ID0A 1TU2A 1WUNT 3VXMA 1T5KA 3WO3B 4BEZA 2C8NA 1UB6A 3UTZB 1CICA 3CQPA 2R4SA 4KQ4H 1OAUL 1SJEA 4LDLA 1PLAA 1BPLB 3ARDA 5F7AA 3UIYA 1HNYA 4FYTA 4IM8A 3VRLE 4PJ7A 3E0GA 2FIKA 3LDBB 2VL5B 3IJSA 5DQJB 4ZTPH 2QQNL 3ZDXB 5IFAL 1O75A 4HLEA 4LLQB 4GRMB 5EMYA 3GSVB 3Q6GL 1KGCE 3HPJB 4O02A 5I0ZA 2B1HL 4CAGA 2ZWLT 5DTFA 5CILH 1ADQL 5ACZB 4WEMB 1RIUH 2KZBA 2XZQL 1KBWA 3NFSL 4K3EL 3APFA 2X9XA 2YJQA 1QBLH 3AACA 4MAYC 2CLVA 3MX0B 4MMYA 4B0MM 4JMNA 2XA8H 4W9KC 1E3ZA 5DK2B 3OF6A 3TV8A 5JOPE 2AK4D 4XOBA 1EDQA 5IQ9B 3LTVA 4PCKA 1KEGL 3TPUB 4LSQH 3D2TA 5J56B 3IGKA 4OZHF 5F21B 1PLBA 4HP5A 3WFCH 4HOZA 3REYA 2HT2C 1NFIA 2YC1B 1EJOH 1NH6A 3U4KA 5FA3A 1CLYH 1GIGL 3B2MA 2VR5A 1CDUA 2P7TA 1NEUA 3BO8B 4YBLB 2R0KL 4LHUA 3T04D 4P2RB 3V2AR 1AD9A 1FFNB 1V7NH 1XGTA 4W68A 1L0MA 2E27L 2PCPA 3DGGB 3FQ4A 4WW2F 5E8OB 5INDA 3REWA 2NY5C 4XNMB 3BUDA 2JQAA 4YN3A 1TUPA 3WS3B 1GGCL 5F9JB 1JS4A 4PJBF 3CFDB 3RY5A 3ZOAA 4QI1A 1E43A 2UZYB 5D96B 1MHCB 4Z5RB 5SWQB 5A2CA 5IQLA 5IHHA 5LCVL 1SQMA 1F3DH 2W94A 3LCYA 3QRLA 4HGWB 1GC1H 1KTDB 2BRRL 1VENA 3IMSA 4MTMA 3BH4A 3UTYA 1SJMA 1ZTXL 2DJSA 4DK6A 3QCTH 3P54A 4AKOA 2WYHA 2HTLD 3EGDB 1HEJC 1U8KB 4JJOA 3FK3A 5BRPA 3HN3A 3BP4A 2FSDA 2GCYB 2X9WA 3FQNA 1S4IA 1NCWL 4OZGF 4J3SA 5D2LB 4FPDA 4XWOD 3QG6B 4OM0H 4Y9EA 2OMBA 4XPAL 2XWTA 3WTUA 2L4OA 4LGPB 3FT4B 1JXFA 1NCIA 4G8IA 3IGLA 3S4SB 3S35H 3X17A 3FRPB 2WTRB 4M6OH 4PRPA 5SV3A 1U58B 3EFOA 3OPUA 3I6KA 3PABA 4PJ5D 4QAMB 3ARPA 1FNAA 1AD0B 1AS6A 1DBJL 4GI8A 4P4KA 5DA0B 3ESMA 4ZUVA 5B4MD 3W0WE 3LV3A 2IANA 2AK4B 3EDFA 3HHSA 4M7ZC 2QGBA 3HPLB 2AV1B 4HF5H 5BXFA 5E94B 5A44A 1R17A 1EHKB 3AM8A 3WN5C 3KS0J 4PJXE 3TJEL 4FQ1L 4KNFA 4LAQH 1L7IH 3F2LA 3GTTA 1PX4A 1YEEH 3B3BA 5F3BB 1IBHA 1KCVL 1J05B 3V0WH 4BA8A 4UT9H 3FO9A 4LU5H 2KH2B 1M9WA 1NJ9B 2WBJD 5EN0A 3DNKA 3BRGC 5G36A 2UVEA 1BZDA 1I8IB 3MO1A 4QGTA 5E1QA 2HJFA 2OSYA 5FYLL 3FUIA 3HI6H 4OAWA 2X4UB 4GKLA 2R2BA 4P5MB 2WM0A 1NGYB 2Z31D 4YDKL 4CNIA 4A7QA 1QW9A 5CHNA 5KSAA 4Z0XB 4WUKL 5DC2A 3CFIC 4BH7B 3OQRA 5LBSL 3VD5A 1L0QA 4C56D 3B9KC 4DZBA 4PJCE 3IDYB 3RURA 3G5ZA 1QNZH 3AJ7A 5JHDA 5AZ2L 2GJPA 4WFED 1N10A 5K39B 4ZSOA 3C9NB<