3K71A

Structure of integrin alphax beta2 ectodomain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
1081
structure length
880
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
total genus 119
structure length 880
sequence length 1081
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k71A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k71A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k71A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k71A01
4WK0B 4UM9B 4G1MB 2VDPA 2VDPB 1L5GA 1TYEA 1TYEB 3ZDYB 2VC2B 4WK4A 3K72B 3V4PB 4NENA 3NIGA 4O02A 3V4VA 2VDRA 3ZE2B 5E6RB 4Z7QB 3IJEB 4UM8A 4IRZA 2VDOB 3ZE0A 3VI3B 2VDQA 2VDQB 4WJKA 3T3MA 3ZDXA 2VDKA 3FCSA 3FCSB 1L5GB 5FFGA 5ES4B 4WK4B 3K71A 4MMYA 3VI4A 4Z7OA 3NIGB 4NENB 2P26A 4Z7NA 5HDBA 4O02B 2VDRB 3V4VB 5FFOA 4MMZA 4JX0A 4MMXA 4MMXB 4UM8B 4WK2A 4NEHB 4WK2B 2VDLA 2VDLB 3ZE0B 4WJKB 3T3MB 1JV2A 3ZDXB 1JV2B 3NIDA 2VDKB 5E6UA 5E6SA 3K71B 4MMYB 3VI4B 4Z7OB 3ZDZA 3K6SA 3K6SB 4Z7NB 5HDBB 4G1EA 4MMZB 1U8CA 1M1XA 3ZE1A 3ZE1B 4WK0A 3NIFA 3NIFB 4UM9A 4G1MA 3FCUB 3FCUA 3T3PA 3T3PB 3ZDYA 2VC2A 3K72A 3NIDB 3V4PA 5E6UB 5E6SB 3ZE2A 2VDMA 2VDMB 2VDNA 2VDNB 3ZDZB 5E6RA 4Z7QA 3IJEA 4G1EB 2VDOA 1M1XB 1U8CB 4UM9D 3VI3A
chains in the Genus database with same CATH superfamily
4BUGA 1HU8A 3K2UH 1PDKA 4N2CA 2A77L 2Y23A 4NQCA 2IOMA 1W80A 4HAGA 2Z35B 2WXLA 4YK4C 3A6BH 3OMIB 2CLZA 3NBNA 5KVEH 2BNRD 1CDUA 1TZ8A 4KXAA 4ODBD 4PR5B 3WDJA 5ID0B 2DS4A 3M45A 4F2MA 2Q9OA 5DO2D 3CN0A 2ODIA 3QRGH 5E1QA 4M7JH 2D7TH 4EQ3A 2G4GA 4JFYB 3H8NA 1U6AL 2WB1A 4WWOA 3MNMA 2YHGA 3N41F 4KO7A 5HDBE 5HE1B 4PWIA 1WBXB 2P80D 2JQMA 2H2PC 2A4CA 3WLBA 3KPMA 5KVMC 4LNRB 2OMZB 1XQ4A 5T5FL 4J6RL 3GMMA 1WT5C 4KKBC 4LCUB 1XBDA 5AVXB 5GGSY 4OIFA 3AREA 4OUUB 3QDJE 2ZX8A 3F65A 3T1FA 1Q47A 4HCRA 4D3CL 4N2MA 3GSWB 1JWSA 1NIEA 5LAXA 2F15A 4O3TB 1I8LA 4JO2L 4XWGL 5ANMA 3O2WH 3MUUA 5DEZA 1KGXA 3GJFK 1ORSB 1A66A 3LS5H 2DLTA 3ZDXF 2HRGA 2RA1A 2LVCA 5HGBB 5JIPA 5E8EA 3SBRA 3U30C 1G9NC 4M5TA 3SYCA 3TL5A 3BP4A 2QPSA 3LPGA 1W72B 4F8PA 4KDVA 5D2LE 2DIBA 4H8WC 5AMSA 4PY7B 5DFWH 3MJ6A 5T33H 4CVZB 3B5TA 3LNFA 1JIBA 2BHUA 1SEBA 3D30A 3FHAA 3EUUA 3IJ7A 3MV8D 3NJGA 4IMKC 1T03L 1M71B 3P73A 4J81A 4G8GA 5A2LH 5B4MC 5IMOA 4N68A 3QIBA 2KZKA 3B8YA 4UQ9A 2YGNA 5IJ8E 1MFEL 1QFWI 2N59A 4O45A 1UZGA 2GBTA 2PPEA 1U4CA 3KDMA 3RVUD 4W9IC 3S34L 4QYAA 4O2CA 3ZTNH 1GY1A 3NFSH 4A0BB 3VH8B 3W0WD 3SBQA 4X60B 3QNZA 4XC1H 3SGEI 3L6FA 1A7RH 1KENH 3SDAC 4XX5A 1NFAA 2VDMB 1JRHH 5FO7A 3JV5A 5DUMH 1PW3A 1J87A 2EZ0C 1G6RA 2A1WH 2VR5A 1BGXL 4RRPA 3PXSD 1OSZB 5KJRL 3PQYB 2O61B 5HHOE 5DD5L 1AR2A 1OGAE 2R0KL 3L3GB 4JM0A 3RWCA 2X1XR 4GBXC 1AO7D 3CV5A 2QZPA 5I18L 1XR9B 1NCJA 4FI6A 5SX4I 4KK8C 4Y8AA 3UG4A 4FKKA 3ARDD 1BOGB 4YO0A 4FQXA 4LVOC 3CVIH 4HEPA 2WKOA 3K2UL 4YH6A 5F7LB 3RGVA 2WQUA 4FHKA 5A6MA 5CXCA 4KTDL 3ZL4H 4CY5A 4DP0X 4ELME 1F42A 2Z64C 1S3RA 2H6NA 2XTJD 1R3JB 4BE5A 5DZLA 4GIAA 1FIGL 4PJEA 4XMLH 5J1AA 2F74A 3CVHH 1KJ2L 4YDZA 1XWVA 4TSAH 2WXRA 1T5KA 5DJ6B 3BLBA 2D7TL 1KZYA 3QXAB 5FWRA 3G9VA 3VRLE 3FH7A 2F7RA 2R51A 1MAML 3BEWB 2WBJB 1M9WA 3ARZA 4MQXC 1E5TA 2X4UB 3WEMA 4O58L 5A16A 4TSBH 5HVHC 1KGYE 4W6YB 3EYFA 3RVXD 5DS8A 4GW4A 1N4XH 4MA7H 4GG8B 1P7HL 1HNYA 2L3BA 4FP8H 2YQ3A 3QZNA 1T0NA 3BQUC 3PWNA 2IGLA 2OJZH 5F7HA 1G7IB 5L7XL 1KTDB 1ULVA 1FVDB 2OMBA 2VLRA 4N2BA 1QUPA 4NFBA 3BPNC 4LNVA 4XH2A 3G6DH 5LGKA 5IHBA 5K5YA 1YDPA 1SXNA 3NSFA 4XE0A 2NY0D 5DR5L 3UPAA 2WP3T 2QC5A 5CMAB 1YN6B 3LS5L 2CSPA 4R7LA 4XI5C 2FIKB 3QCVH 4KKZA 3ZTJH 2AJXH 4MFHA 2B3IA 2VJ8A 2X41A 2XBTA 2ZKHL 3BPCA 4L3FA 5D96B 43CAA 3BUYB 1N6QL 4E9QA 5F2FA 2MSPA 1XSKA 4AZ8B 5HDWA 3SKUD 3H3PH 2YEVB 1FRGH 3DUUA 3RFZC 2BH0A 4FA9D 5IB3A 4HPOL 4ACPA 2A4ZA 4QCIA 4XP5H 5T33L 2EVIA 1QLEB 3SDXA 1ZHLA 2N7AA 4LSUH 4HOXA 1LDSA 3DX7A 4ZUUA 4PH8A 3U2JA 3U83A 4M7ZC 4G5AA 1LO2L 1KG0A 3BW9A 4TNGA 3H3BC 3LB6C 4JM2A 3MJ8B 3RUGB 2KS0A 3K72A 3JXAA 1KJ2A 3PE9A 3VSUA 2P9LC 4UZSA 1D6VH 1I3GH 3TP4A 4KUCD 3JVFC 1PIFA 5KVDL 3TTYA 3ZTNL 3NFSL 4AC2A 4BK4A 1AKJB 2GI0A 2JJSA 2Z91B 1N0XL 4OGYH 5KANI 2IAND 2IBZY 1CLVA 2Q7YB 5AVZB 2UZIL 1A7RL 4LOUC 3FRXA 3NZ8A 4LQ1A 3HZKB 3THML 5AOJA 4BK5C 4HH8A 5DUML 4YSEA 1BW8A 1FFTB 1WHOA 2YSSA 3HMWL 2A1WL 3QSKB 5GHWH 2UY6A 2NYZA 1MZZA 4F1SA 2QKIA 3LEXA 1U2CA 2XL2A 4XAKD 2OVQB 5CXBA 4L4VA 3PAUA 2PTUA 3C6SB 3ENEA 4AG4H 2C1PB 4Y4FD 1I82A 1NEUA 3ML9A 4GM8A 3IFOA 5AAWA 2X2UA 1OGTA 1P5UC 1E2WA 4RMTA 4GXUM 4WO4C 1UKTA 2I7SA 4LPWA 4AYFB 2VZVA 3ZL4L 2J8UE 4YN3A 3IJSB 4NXSA 1KT2A 1A6VH 1M2OA 2G4EA 3NCEB 3O2DA 5C09A 3CFBA 4U6TA 3CQQA 4I48A 5EU4B 4PJ8B 1A7OH 3KL3A 3Q06A 3EYVA 4UT9L 5SWZB 2KDYA 3D87B 3B3IA 1IARB 3CX2A 2YD5A 1TLMA 1UOLA 3DV4B 2FQGA 1YC7A 4LG8A 4HLZH 5DWUL 5CEXA 1AP2B 2IFFH 4TM9A 3B2DC 3GXIA 1B2YA 4CC4A 4PTTA 3NJJA 2W94A 2R2EA 3DVIA 3U1PA 4UTBA 2V3DA 1FVEA 2DIAA 4K4KA 5CJOH 5MHSD 1JZ4A 5JMOC 5LDUA 1NPNA 5FYKH 4HJ1A 1AMYA 2KKQA 1VACA 3TEXA 2QPEB 5GZOC 3G6JA 4OCYH 2E6PA 2EEBA 5FKPB 3F04A 5KTEL 1C16B 2W18A 1JVOA 2OJZL 2B9AA 3I6LD 5INCA 3WUWG 2UZXB 4IBWA 3UYOD 4RQQA 4MGXA 4S2SB 3I2NA 4R0LB 2KLRA 4K5PA 3IVKB 1S9XA 2YEQA 3U79A 1WO2A 4AX3A 2ENQA 2DMKA 2C9QA 3OSVA 2BNRA 3UMNA 4M1DH 2DWDB 3DK0A 3QCVL 3VFSA 1OM9A 4JO1L 3VWKD 3RVWD 3SB3A 4NHCL 3OKDB 1HH9B 1YY9C 4R5TA 1U8CA 3GREA 3OWEA 5TGBB 2AJSL 2HB0A 1R1CA 3H3PL 3SODB 2ZZUT 2DQCH 2ZONA 3IDXL 3WJJC 3F64A 1DQMH 1UVQB 3FCUB 1HAWA 2Z7ZA 4MNQE 3BLKA 3KYKL 2DIEA 3S2CA 3TO4A 3MC0A 3ROOB 1E27B 3RNQB 2P24B 3CFEA 3V4PA 5JOFA 3KCPA 1A7QL 4I1NB 5IFHL 4UT9A 5KVGE 3VRJA 1VF5C 4PREB 5MEQB 1ZLSL 1V3JA 2A73B 1JOIA 2Y5TA 4KXZI 3V0JA 3TNMB 1MPAL 4NKMB 4DERA 1Z5HA 1GYAA 1GPOH 2AABH 1RZJC 3OC5A 1ZWIB 4JHUA 3C5SA 1WAAE 3HG3A 5MEND 1SF3A 4IRJB 4M7LH 4F93B 4UILL 4IBLT 2WTPA 5FPIA 5D2NE 2IDQA 3WNLA 5CAYB 4ZN4A 2Y1YA 2RHEA 2W59A 4FLSA 3BLPX 2G2RA 5D5MF 1PFCA 2CMRH 1PEZA 3H7LA 4HA1A 4OF0A 4RMRA 5SX5K 3ARQA 2DYRB 3E0CA 4N85A 3PSLA 2CBQA 3V5HA 2XN0A 5JHDA 5BV7H 3SO3B 2F5AL 3PPEA 4UT7H 5FK9A 3FQRB 5HHPB 4RE5A 3KYMB 1TEGA 3PGDA 1IT9H 4C55A 4L1TA 2PYED 4Z7VB 1RJZA 4WEMB 4ERQA 3BVNA 4X6DF 5EARA 1GYUA 1MY5A 3LV3B 4FHBD 1JGUH 4IRSD 1IL1A 1ANUA 3QBTB 2C7UA 3N3EA 3W0WA 4AC4A 2EBSA 3W56A 3V0GA 4L9LA 3VG9B 2RB8A 1MQKL 2KYIA 2HFGL 1RJLB 5SWSD 2XVLA 5C3LD 1T89C 3HC3L 4R7XA 3D18B 3W5NA 1NUGA 2IPTH 4Z5RA 4FNTA 4BFRA 4MCYB 3CSFA 3Q3GB 1BMGA 5D1XB 4PI2A 2YAPA 2VM9A 3RKPA 5CJOL 3VXUE 2NX5E 1CK0H 3ZMNA 3DDFA 2H45A 2QADC 2XJLA 4NIKB 3UZEA 2F19H 2FJHB 2LU3A 3OBAA 5T1KD 4J0WA 3CX5K 3MREA 1LEIB 4BXSV 4OCYL 3O4OC 3V79C 3PV6A 2EDWA 2X28A 3QJHA 2ESVA 3WCYA 1B6DA 4AKQA 2X6VA 5A2Qg 2BOLA 1KFAL 3T65B 2AGXA 2BSSB 5HYIA 1EXHA 2YUXA 1TYQC 1I4FA 5HXMA 4KNTA 4YE4H 2X9ZA 1T4WA 4PQXA 5KAQG 5E7BA 2IH8A 1E4XH 2YLKA 3CZLA 1FHNA 3D8MA 4KBPA 1LLAA 3O81A 4G7SB 3GSNH 3TNNB 1CGSH 3VXSB 1VGEH 4GIPD 3L3JB 4O02H 5EF0A 2W91A 4UNTA 1ZLUH 1JNJA 2H3XA 1OARH 2H9LA 4HBCH 2H2PD 4MB1A 3FU7B 3C5XA 2DQCL 4XN5A 2DQTL 3D0VB 1DQML 1DQJB 3IXTB 3ARPA 2NNAB 1QTSA 4KKBD 5J89A 2WIMA 4R84A 4NPYB 1DJXA 4K94H 5JORA 4W4OC 3ULUF 2ZPKL 4TQHA 4ZX6A 4H5SA 2OPCA 4OFIA 3CIQA 2LU5A 2YA2A 1SM3H 1BQHB 3S48A 3CNKA 4B3EA 3FB6A 3VD9A 2XN9E 1GPOL 3DWLC 1THAA 4DZBB 1H3GA 1DDHB 3UJJL 5I6KA 5DHXB 4ZOXA 4M7LL 2JKWA 2C9PA 4P3WA 1MAJA 3BP7B 4MD5A 4DESA 1U8KA 1OGPA 2BFVH 2MWCA 2CA3A 5GGRA 3S35H 3U1SL 1W6LA 3F3GA 1Q4NX 3HG0A 3LZQA 3E0GA 1W72H 2NUPB 4POUB 2R2HA 3QG7L 4PN6A 3ZKQD 5C92A 4UTCA 1CG9B 2E6QA 4XMWA 1MZYA 4XN7A 3OTTA 4ES8A 1KUMA 3IFPB 5E5MB 1AQMA 4RISL 3H42L 3MCLH 3V6BR 1RPKA 1T0MB 4TNVF 4MDJB 2PWHA 5FYJH 4RZCB 4A11A 3K4AA 4P2AA 4OB5H 4KZCA 4M1CC 3OAZH 3SDAD 3QJFA 4WWKA 1NFDF 1MCDA 5JUEL 1NOFA 4S1SH 4X9FA 4I85A 4E9TA 3JT2A 5F1IA 1QRNA 3PE7A 3QEUB 5T8IA 4XVSL 3A6CL 4XVUC 2EZ0D 1JPGA 4MRBA 4NUJA 2IANA 2WTRB 2K7PA 2Z7UA 3GZOA 1EAPA 1LJMA 3RWGB 5K9KB 3L1GA 5JNYA 2OMXB 3M7OA 3V0EA 4GBXD 1MIEH 2VDMH 1DVFB 1Z5LA 3ESMA 4YHNB 2A6DA 2XNAB 3KH3A 3TZVA 5KN5B 4HLEA 4KK8D 1LWRA 3WELA 4GQ9H 4P5SA 4HPHA 4L37A 5CLZA 1J0YA 4JQIH 2Y7NA 3GLDA 1ZTXL 4AEIH 4NAJA 4WHCA 4KITB 2MOVA 1KB5H 1IFHH 4L29B 2NY4B 2RFXA 3L7FB 3VXTA 4HOMA 1U8MA 3GSRA 3BZ4B 4FMKA 4N2IA 4B9JA 3NZSA 4U6XB 4AYID 1AGFB 4P0DA 2YBRA 3PWVB 1FZOA 2JI2A 3EG9B 5CKAA 2AH0A 3H9SB 4WNJA 5TEFA 1NMAH 1G1YA 4YE4L 5GRYA 1SJHB 3NSJA 4KKCC 1E4XL 4Y5XB 4PI0A 1NDMB 1IGYA 4H0LC 1U3YA 4U0QB 1NANH 1CGSL 1UD4A 1VGEL 3VFUA 4MQXD 2ZCKL 4ZTOL 1GIGH 1AI1L 1BVLB 1FA4A 2XA8H 3BAEL 5HJ3B 3C75A 5FX3A 1NDGB 4E5ZB 4PRHA 3NCMA 3FFCD 1DZBA 2DWTA 1AG0A 3BQUD 2FR4A 1IB5A 4M43H 2TAAA 4A2LA 5KSVB 4MJ6B 3L3OB 4FXKA 4K94L 2B5NA 3K7UA 5IIEA 2F0CA 4U1IB 2W07B 4FQPA 2XPZA 2ZXBA 3BI9X 4A67A 3LEYH 4ELKA 4L0YA 2VYRE 1AXSA 3T0EC 5FEBA 3MROB 5I0DA 5KVFH 4B9PA 1VPOH 4YHYB 5FA4A 4XI5D 4JFDD 4WK4A 4ODXA 3BZFA 3DUSB 2CO3A 4TQPA 3ZT7A 4H8VA 4L5FL 2V5SA 4K7FA 3O6ML 4GSUA 3ECWA 1AS7A 3OXRB 1I9IH 2B4CC 1AHMA 4PGDA 1R3LA 5MI0B 4J5VA 1Y18A 2KERA 4G8IA 4I1PA 1ZJBA 5E6RB 1E8NA 4CSTA 2YMXH 3C8KA 1O7DC 5ADOH 2BP8A 3RY4A 3S35L 1GOGA 1GGYA 2AJ3A 5DZAA 5J6HB 3VB8A 1E6JH 3HKZA 4GO9A 1GHFH 4XP9H 2BWIA 4GKZA 1LO3H 3LB6D 5L8JB 5BPPA 2B1AH 1PDKB 1AZCA 4HSAC 1TG8A 2QPFA 1ZA6A 5ES4B 2PUQT 4NQCB 4JFXB 1KBBA 5E9DE 1GH7A 4J3BA 4BKTC 4P9HL 1NCUA 4DP5X 4F2MB 2I5YL 4LOUD 2CKBB 1K2DB 1ZV5A 3ALWA 4Y9BA 3EI3A 3MBXL 4TLKA 2YWYA 3E3QE 5L2JB 2UZPA 2X4NA 4XNDA 1JMZB 3OX8A 4RGOL 1T5WA 3C5MA 3A23A 5E0FA 1NAMH 3SGJA 4DO4A 1RZKL 3S36X 5IQMA 4X9BA 1MIEL 3WLBB 3IDNA 2V9QA 4FQJH 4NM4H 4XOBA 4Y4KA 4GQ9L 3BE1H 4YHIA 3GMMB 2ZOLA 4WO4D 2DM7A 3QZLA 3QZMA 4PJ7B 5DGRA 4NWUH 3DHUA 3O6LH 1TITA 3EYOA 3AREB 4PCTA 4CKVX 5DSCB 2AK4D 2VMDA 1JWSB 5LAXB 3EFOB 3IULA 5HDRA 1U36A 5D70H 1N7ML 4AY0A 5FM4A 1NMAL 1OAXL 1KTRL 3TVMA 5E8EB 4BV1A 1KCUL 2LLGA 4NM8L 3ZSSA 1ZLVH 4J86A 1WICA 3UC0H 1RZPA 3HN5A 4K8RC 3IEAA 5FHBH 5H1MA 1U8HA 1BAFL 1HQ4A 4F15B 2EYSA 3FU3A 4PJAE 4JS7A 1SEBB 1BF2A 5I5MA 1TSRA 3P73B 5IMOB 4OJCA 3QIBB 5GZOD 1VYHC 4BSVB 1CCZA 5D1QE 1YPZE 2ZUXA 4UOW1 1ZMYA 2VXVL 5FO9B 5DJ8A 4J3OG 4DVRH 3KDMB 1PKQE 4FYQA 5EU3A 3GJEA 1SYVA 4JPQA 4M3KB 2VO8A 5F7YC 4AJVA 4CBPA 3VB9A 5IQ9A 2WQRA 3GXMA 1RURL 3LEYL 2ZAIA 4U6VH 1VPOL 3QNZB 1ZT7A 4M5ZH 4M9PA 1WISA 1QSFD 3NCYP 3L6FB 4CU6A 3MUZ1 4C4KO 2TRYA 3DHPA 2ILLA 1Y07A 2P9NC 1YN7A 1G6RB 2VC2L 2AJZA 1A3QA 1KTLB 4OF7A 1N64H 1N59A 2GTWA 2MMXA 3QXVA 3EJYC 1GZQA 3RWCB 5ADOL 2W1NA 3IU4H 3AG1B 3KRWB 4LSTL 1BFVL 3IPBA 5JPMA 1FAKT 4Z76A 5I0WA 4YO0B 2VABA 4FQXB 4GH7B 1YAIA 4JFFE 2CK0L 3L1EA 3RGVB 5CXCB 2VUYA 1J86A 2R1YA 3KLLA 4CI3A 3EDEA 1HZHH 3DHJA 4U1GB 1R5MA 3CK0H 4TVUA 4ZJ9A 1OAZH 1EERB 3L3IA 3QNYA 1CD1A 5J1AB 4Y9EA 4NJ9H 4PP2A 3DROA 3NABL 4K3JH 4B0MB 3FCTA 2QVMA 1WZKA 3T71A 3RIKA 4M6NH 5JLZA 4H40A 1CFSB 4A2GA 1XF3A 4FFZL 3AMLA 4JG0H 2HRLA 4WHTA 1WEJL 4KNQA 1UA7A 2XQYK 3EYFB 3VTMA 1SVCP 5DS8B 4GW4B 2AAAA 3MMYA 4ZX4A 4NM4L 2BZ7A 3B34A 4IMKA 4XMZA 5I71B 4A7JA 1T0NB 3PWNB 4DQOH 2OYKA 4UNUA 2XSKA 4MQTB 4WGKA 5C0CE 1FFPB 4HZ1A 4XH2B 5AW3B 2VC2A 3REVA 2X2YA 1YDPB 2F54E 4ZMYA 1KN4H 1Q9KA 3T6VA 3IM1A 1YEHH 4JHZA 2WZPD 5F6IB 4MAYC 4PRPD 1FZMA 1E65A 3MRFA 2NY5C 2XN1A 4DEPB 1BVNT 3LMJL 2F8XC 3F7RA 43CAB 2QDVA 3BPCB 3UAJA 4ZUVA 3NPZB 4JPSA 5E00A 3QR2A 3DUUB 1Y7VA 5IB3B 4PJHA 4R96B 4Y1AE 2QADD 3SDXB 1ZHLB 4J3OC 2YOAA 3DX7B 2AHIA 1KYOJ 1HH6A 2G5UA 1FPTH 4GBXA 1RIVL 2NZIA 4K5OA 1DEDA 1KG0B 5M95B 3BW9B 4JKLA 3I50H 4WQOA 4JM2B 4LEBA 2ENJA 4LHJB 3K72B 1KJ2B 3LVEA 2BPBA 3MJWA 2V9TA 3VGZA 1CZ8H 1S4UX 2RD0A 2FH8A 4WEBH 5BZXA 5LWYH 2DQHL 1E7VA 2X6AA 4A66A 1UQSA 3RAJH 2EO9A 5C08E 2ZWNA 4FFZA 3MV01 2NUTA 1FQ9C 3LHPH 4M5ZL 4FAND 2YQBA 3VI3F 3NZ8B 5FYLD 3EQ8A 4I18C 1JWMA 4A6YH 5B3JE 1BLNA 1YR2A 1PZCA 5DS1A 2RJMA 4ONGH 2FATL 2YSSB 3MV9E 4WJKA 3AQXA 2QDWA 3JPXA 5CNHA 1G5GA 1N64L 2NSQA 3BH4A 5C6TL 4LLVA 3LEXB 4UIMB 5CXBB 4L4VB 3RJQB 1AZRA 1LEKB 4FLQA 4G9FE 2D4FA 2EDQA 3LZFL 4JFQB 3KBFA 4AQAA 1N6DA 1WG3A 1TBGA 1OGAA 2V5TA 4LVHC 3IFOB 3TCLA 1OGTB 4CKQA 3AFCA 2XIIA 1HC1A 5DZ9A 3DPBA 2QZQA 4XMKH 5HYNB 3QH3B 3FFCA 3BCDA 3GXFA 1Q1JL 3UR4A 1CBJA 1E9OB 1OKEA 1KT2B 2AQTA 1K4DB 3BQUA 3H4HA 3N1FC 3ZE0F 4Z7IA 4LLUA 1GW0A 5C09B 3CK0L 3CFBB 3IDJB 1WZLA 4I48B 4QRTA 1G7JA 4R97C 4ELMA 1OAZL 2E59A 4U1LA 2VZOA 2GCYA 1VIWA 3EYVB 2R69H 1AMXA 5HE2B 2D7MA 4K3JL 5KVGH 2HLFC 2K70A 3RILA 4LARH 3QUZA 5I30H 2YAQA 5CEXB 2K3TA 1AD9A 4J3XA 2GIYA 3TEZA 2ZXAA 3ZDZA 1SLVA 1NC2A 2ZX5A 4K3EH 1UM5H 4H1LG 4PTTB 3V5DA 4Z3IA 2R2EB 1AHWC 1FVEB 1AO7E 3JT0A 2WNXA 5IJBC 2EDNA 1QHQA 2GQHA 2RCSH 3RFZA 2H4EA 1E28A 2F5BL 1FZJA 2PKDA 1EVTC 1VACB 2JKJA 5K9QI 3G6JB 4FGMA 2EYTA 2NR6C 5I6XB 3K6FA 1A02N 2RGSA 1QHOA 1PG7H 5ANHA 3KBPA 2AKRA 4E9YA 5KWYC 4ZMOA 3LZRA 1YO4A 2O72A 4NQED 4YSUA 1KMGA 3JRPA 2V17L 5IVXE 4TUJA 5INCB 2X1PA 5EMMB 1A65A 2YA1A 4TNWK 4M1CD 3SCYA 4AQEA 1FCGA 2LE9A 9PCYA 2DDQL 4R26H 4XNYH 4AL8C 1S9XB 1A9EA 3MOAL 3Q44A 2VLME 3VWJC 4OR1A 5KG9B 1YEHL 2MKLC 1QLRA 2BNRB 2JIXA 4GW5A 4XVUD 4OFPA 2V2XA 3VFSB 4LBAA 4PJIF 5DU7A 3I2CH 4J1UA 2X1WL 2ZF9A 2EIDA 4FNUA 4RDQF 1U8CB 1BEYH 3S5ZA 4EKXA 4R5VA 1IGML 3VJ6A 5E2WL 5DHVA 4F33B 3SYOA 5IG7A 5FDWB 1IAIM 2Y7QA 3MRJA 3CFNA 4PV9A 5TE6L 1HIML 1ZY9A 4GRWB 4F92B 4S10A 1FPTL 3GPEA 2FZ3A 3QQNA 3TBTA 3V4PB 3KCPB 3VFMB 5JOFB 2A38A 4K7PH 3I50L 3VRJB 3EOAA 1IBHA 2EACA 3OB0H 4J4PC 2J6EL 3TEYA 1MEXH 1S7XA 2IGTA 3VSTA 1DJZA 8FABA 2HXAA 1WP6A 1TVBA 2IBZX 4YBHA 3FBQA 3C5SB 4OLZH 3TM6A 3CGTA 4M5YL 1F4XL 3F7LA 2I9LB 2XIBA 4KKCD 2LT9A 2OYPA 3TBBA 3KZ8A 3U4KA 1OSYA 1OTSC 5CBEB 3PHAA 4WI6A 3AB0C 5F8QC 2BS8A 3H7BA 4JDEA 5CN3A 4A6YL 1I1AC 4RSVA 3VFOA 2J88L 2R7EB 4HS6A 5EOTA 1RZJL 1TNMA 5E95B 5J0BA 4Z7NA 2FT8A 3V5HB 5JHDB 5IHUH 1HWWA 4Z7UE 5B8CA 5JR1H 5EF1A 2HYEA 3MV8B 4XO3A 5B22A 5FK9B 3SN6N 3T4AA 5C0GA 5I6NA 3X14A 5I0VA 4DK6A 4XMKL 3WFCH 5DI8A 4JQVC 1OSEA 4UAHA 5D7KD 3T0ED 4DEWA 1HINH 1DVQA 4NAQA 2XQYG 4AQ1C 1CFVH 3BVNB 4X6CF 5IB2A 1BD2D 2EUVA 2E46A 3GS0A 1LK3L 4WTZA 5EPMA 2Z2NA 2K4AA 3RX9A 3VI4F 2C7UB 2EDKA 5IFJA 4JG9A 3RIFF 1BPLB 3W0WB 2C4FU 4OJFH 2BIIA 4L9LB 1YNKH 3US1A 4YHKH 1IEBA 4TQEH 3Q0HA 5D7JC 3PPSA 1R33A 1WJ3A 3PXLA 3GM0A 3QEGL 1U58A 2YRZA 3MAWA 5GS1A 4PHZA 4Z5RB 5FYKU 4F7PA 4K3EL 1J7VR 1MDTA 2J6EA 2ZP0T 4DGVH 2BOBA 3KLDA 5K93A 4OLXH 3T0VA 4KO6A 3MREB 3V2AR 2FQFA 1SLXA 3D1MC 3NJKA 2F7PA 3Q1SH 1KFGA 1A7NH 3LX9A 3QJHB 4HMEA 4AMKH 1BXAA 2QR5A 4GM3A 4HUWA 4L3ED 2A74A 2CUAA 4Z3FA 4ZW5A 3UPRB 1I4FB 4ZPTA 1UM6H 3FYIB 4LU5L 2FRGP 4MNGE 4B9ZA 1FH2A 1CQKA 3AS2A 4Q2ZA 4ODWA 4W68A 4A0AA 1V3LA 1TYEA 2H9MA 1YEEH 1RJCA 1A3ZA 2WKOF 1EZVY 3N44B 3QUXA 4YFEA 2CKBH 1W16A 5MHSE 2M8XA 5TF2A 5A2AA 4DWHA 3V4UL 5H17A 5CUSL 3QHFH 5FDYA 3NIGA 3WDIA 4U1KA 4HD5A 2H9GA 5HGGS 4BINA 4PSWB 4E9WA 2JELL 4HWBA 3PSCB 4K7PL 4QEGA 3W39A 1AYRA 3FTWA 1BM3L 1R19A 4JL2A 4XXCC 2EDXA 4H5SB 3DIFB 3LPOA 3QDGD 2AGJL 1SXAA 1SY6A 4GMSH 5I2IA 1BHGA 5A7BA 3FCSA 2P5EE 4ADJA 1AQHA 3EFDH 4J3VA 3WIHL 4KQ4H 3GHEH 3LKPA 4ATTA 1EEZA 1ZGLB 1NGXA 1QSEE 3FQNB 3JTBA 2WZPA 4K8RD 4PRPA 1U0QA 3X1NA 4MD5B 3KVDD 4BBWA 4RA3A 1T89A 3HW7A 4QRSA 1A3LH 2VWEE 3VX0A 3AG3B 2IH9A 5A6LA 2CJTA 4YFLF 3AC0A 2UZYA 3WAJA 1FNHA 3MXVH 4S11A 2R2HB 3H55A 3KLSA 5JR1L 1P4LA 3LIZH 1J5HA 2ATAA 3PF2A 3EKCA 3CHXA 4YJZL 3WFCL 3RX5A 2D0GA 5J5EA 3GHPA 5GGUA 4A11B 1HINL 3BN9C 1DUYA 1HHIB 4Z6AT 3LRLA 3MRGB 3PDGA 3QJFB 4WWKB 3JYCA 3STBA 1FNEA 2V9RA 1BPOA 5F1IB 1QRNB 3SQOH 4PJXE 2ROXA 2NNXA 5SWQA 1RZ8A 1JPGB 1QR4A 3SBWA 1RK0A 2IANB 4RFEA 1NIBA 3X2QB 3G08A 1EAPB 1PLCA 3DC0A 3PYCA 4CDHA 3EJYD 3AACA 1QMUA 1Z5LB 3CBRA 4DQAA 2A6DB 3BAWA 1CO1A 4CUCA 3MCKA 1HEZB 3JTSB 4EI5D 4ENZA 1IGCL 2P9IC 4EI0A 2ITEA 1H0DA 3OR6A 4BZ2H 2IMMA 3MLVH 1JBJA 4XB7A 3SBPA 2RFXB 2A9NL 2N1TE 3WIHA 3E8VA 4KRPB 5LGYA 1P9MC 1U8MB 3T1WA 3OKWA 1ZE3C 3MYZA 2PYEE 1OP3H 4HOZA 4AMKL 4YDJA 3DJZA 2A7BA 2K45A 2YBRB 3ZYZA 1FZOB 1E30A 1MFBH 3IJ9A 2F8OA 1BWWA 2BZCA 3TV3H 4QRJA 2GIXA 4NNXA 1UM6L 3OF6D 3E7JA 1JPTH 1IRAY 3A6OA 3U7WL 1N9PA 3LRHA 2PWFA 1IGYB 1RZ7H 1P7KA 1LP9E 5BVPH 5SWSE 4YZFE 3BDYL 2ZUVA 4R7DA 3T6ZA 5FB8A 3VFUB 2J1KA 3VVVA 2XWZA 1PLGH 4XEIC 2NXZC 4QJ4B 5BQ7A 1MXGA 2CN2A 2BNQE 3T3ME 3MI6A 1J5IA 1HHKA 2NMSA 3FUJA 1J05B 2FD6L 3OZKA 2CO7A 3EDJA 4XNZB 1MI5D 4RRPM 5AFAA 3V6OA 1F00I 2FR4B 4X0KB 3BG1A 3AXLA 3KH4A 4FXKB 5I15H 1IGIL 4H20L 1OPGL 2Q5BA 4BCDA 4LP4A 1S46A 4FQQA 4MB3A 2FL5A 2M83A 1A3RL 4N2HA 3VDAA 2G5BA 1JV5A 1AXSB 3ET9F 5IV2B 3BVUA 3MUJA 1NPUA 2WYTA 5FA4B 1F13A 2J1ZA 4GMSL 4WK4B 1MREH 2ZSWA 4ODXB 3BZFB 4J2QA 3FBKA 4K7FB 2OSYA 3UABA 3QS3A 1X5AA 2GPZA 1MCEA 3PV7A 4KQ4L 2I9TA 5D1ZA 3EF7A 4GQRA 4PGDB 1R3LB 1Y18B 4G8IB 1V10A 4UDTA 5TF1H 3VWKB 3UTOA 5BNXD 5EALA 1EO5A 4GP5B 4J3OD 4LDEB 1BWMA 2OTUB 4B0MM 3CSTA 35C8L 1PYWA 5F9AC 5H35A 3BVWA 4ZQKA 4J12A 5EO0A 1ODUA 3WFDH 2B4CL 2WLNA 3MGTA 5FYJU 2WCSA 1ZA6B 3RDJA 5EM2A 2Q87A 4GXFA 4P3DA 5J11C 4UT6H 3ZIMA 5EFIA 2FLBT 3D4ZA 3RIAK 1PF3A 5EIQA 4A37A 3N1GC 4Y2OA 3WY3A 5K39A 3NH7H 4N0YH 2NCMA 5IEHA 3EI3B 5ICXA 4QRPD 3VGEA 5MENB 2Z31A 4QOKD 3AL8B 5I23A 3OX8B 3QP3A 2JTDA 1TZGH 4XCFH 1HVXA 2XT1B 1LQBC 4PJ6A 3IDNB 4U6HA 5T3XH 3BH9A 1OF0A 4LAQL 4YHIB 2ZOLB 5EMLB 2AZAA 4BZ2L 1A4KB 3EYOB 1LE9B 4FA8A 1E4WH 1ICTA 5B39G 1XDTT 2PW1B 1N67A 2ZUUA 1NCBL 2BDNL 1JF5A 4EBQL 5C2VB 3WMSA 5J7CC 4PVBA 4P2OC 5GSRB 5IMLA 1E5YA 4P2QD 4YSPA 3C99A 3IDMA 1R46A 1UA3A 2J1YA 4LB8A 4Y9FA 3T08A 3ZJAA 3BVVA 4AVKA 2EH8H 4ERYA 3B9KC 1SFHA 3K1DA 5DGQA 3TN0C 4F7TA 3O4LA 4W81A 4JY6A 1XL6A 2HLFD 1Z1WA 4A7UA 3QQ9C 3AROA 2P9SC 1JTOA 2ZWSA 4I3SH 5E8PA 1DANU 2WZ6A 4G82A 1RXLA 4NQDD 4B50A 5BVJA 1JDDA 1HQ4B 1U8HB 2R23A 3HG1D 4NN6C 1PLGL 5CO1A 3DYMA 2XRAH 3OM3B 1FNFA 4DSYA 2JJVA 1G0YR 2NR6D 3F6LA 2DN7A 3IGAA 2MTPA 2WLKA 1PZ5A 1QTYT 2P7TB 4KUZL 4EI6A 1SHSA 4R7VA 3OAUH 2OJYA 5DJ8B 5ETUA 3QUHA 5EU3B 1TUPA 3GJEB 4FNLL 1SYVB 3CX5J 4NZ8A 3FUHA 1WA0X 5IQ9B 1MNNA 5E1HB 1YA5A 3ULVC 4RMQA 4CVXA 4GUPA 2CBOA 4LSRL 3VWJD 1OT1A 1ZT7B 4OI7A 3O2VH 4Y7OC 1KPUA 3RVVC 4ISVB 4ZMWA 3KPLB 1MCLA 3KLAA 4L3EA 1BZQK 4OIIL 1B6UA 1HX0A 1S4IA 2JCCE 2P45B 2UY7A 2C34A 2APBA 1YN7B 2NQ3A 5DD0H 1UEYA 4DGIL 2I0RA 4PJCA 4ZO6A 1RK7A 2AJZB 2YLHA 1AQ8A 4FB1D 5IJCC 1TYJA 1GZQB 1SYSA 3VX1A 1ND0A 2FLMA 3CXHK 3U46A 3WFEL 3NAAH 5KBMA 2Q8AH 1QEWB 4Z76B 2VABB 1WPCA 5KUMA 2H26A 3P69A 1SMAA 4IRZL 1JNLH 3WFDL 3L4YA 5KSAA 4CBZA 2NNCA 4C57C 2R1YB 1Z7JA 3ATFA 3UTPD 2WZ0A 1XF4A 1CLYL 4ERSL 2BSDA 4Q89A 3T4YA 2A6JA 2EIJB 4PB9H 4S1RL 4JFDE 3ZE1B 2BWDA 1KXHA 3QDGA 1KDJA 5E9DA 5EU6D 3DROB 3MA9L 4PBDA 3B2MA 1X3DA 2NTFA 3ARFC 1MWAL 4N0YL 1S7UA 4KY1H 3R06A 1RUMH 5JLZB 1I1AD 3FRPG 1QFSA 3C8HA 1AVAA 4YAQB 2GAZB 1YEJH 3U30B 2ATPA 3IE9A 2YQGA 2AW2A 3QQ3A 2AEIT 5M7QA 1XF3B 4WHTB 4PLKC 5LNDA 2IURA 5CFHA 1EX0A 4JO3H 5CP7B 4FI7A 5HI4D 4JY5L 3SMRA 3CIAA 2UUDK 3CMOL 4AUYA 1FE8L 1GTFA 1EXGA 1MVUA 5C1MB 5J57B 3ROLA 2DKUA 2QGDA 3PXJA 3BISA 2VC2B 4F2FA 1NZRA 1R5IB 3REVB 3RWFA 3FT0A 4IYKA 2HP4A 2OL3B 3NCJH 1Q9KB 5DVMA 2PM7B 4GAGH 3BO8A 2QPDB 3GSQA 5D7JD 3EBHA 2XLLA 3TPUB 1H2XA 1TQVA 2R9HC 2H6UA 3FUFA 1I31A 3F7QA 1TTAA 5ILTL 5C07E 4IRZA 2KUTA 3AZUA 3FT4A 1XGQA 3QUYC 4PJHB 4Z3EA 4QXWA 3SY0A 1QO3A 1E4KC 4G6MH 4MZIA 4M3JA 1JL8A 4PV1C 2XWCA 3U9UA 3E1ZA 4FFTA 4GBXB 1G4RA 5TE7H 5I8OH 1NFKA 3SN6B 2BIPA 4TZ4A 5BS0E 2N56A 2HA1A 2YSTA 4LVOB 3RWHB 5D1QA 1YPZA 3O6KH 5I1CH 1MWAA 1QFWL 4FTVD 4WFFD 3BWAA 1UTDA 3VXMD 3HNSH 3SD2A 4N5UA 3P3YA 4OCXL 1JYXA 4RGNE 1UQSB 2XZQH 4X6FB 4MHHG 3FGBA 2NUTB 5DD3H 3FSVA 4P2RA 3O2VL 2Z6FA 5IHZA 1JWMB 1BLNB 1CI3M 3TBWA 2D3LA 2W65A 4WJKB 3CDZA 2EDRA 4PRNA 1F8TH 1P1VA 2H0PA 3CQPA 3J80g 1K72A 3FL7A 3K6IA 4LLVB 2KZBA 3D09A 4YDNA 2X9WA 3MRQB 4KGLA 4NZFA 4XWOC 1OGAB 1XB8A 4AQAB 5HVHB 1CGYA 3V4LA 5LJYH 1I1FA 2VXUH 2P8LB 2XETA 3SKJH 3NK3A 5F7EH 2JCWA 1JNLL 2QSQA 3FFCB 5KYWA 5DJXA 5ITBH 3EADA 3BQUB 3RDTA 2APXA 4JFFA 4LLUB 4PB9L 1CLOH 1G7JB 4GW1A 4JDZA 5DD1H 4U1LB 3BPNB 2GCYB 2Y69B 2IBGA 3L3HA 1QPKA 3VGGA 3WIAA 4PNKB 3HUJF 4LOVA 1T0PB 3NZUA 4JZNA 2DMHA 3PJSB 4DW2L 3RGBA 2OKMA 3FT2A 4MAYA 1A22B 1PLBA 3DSFH 2RQ8A 2X89D 3B7FA 1AD9B 5K1CC 3LQZA 5DZVA 3ZDZB 2AQ1A 1YEJL 3TWCH 1NC2B 3D9AL 2AJVH 3V9EA 4BZ1H 4Z7QA 3V5DB 4OT1H 1XCQB 2IBBA 5AZ2H 4EXPX 3RFZB 5K9QG 2H6KA 1E28B 3JWOH 3QDMD 3BH8A 4JRYD 4EUPG 4JO3L 2EYTB 3EZ8A 5IHLB 2AKRB 3EG6A 2YXVA 3KPNA 4M7ZB 2VISA 4TMPA 2DEYX 3AW5A 5JA8B 4TUJB 5TFSH 4PMEA 1NA8A 2YRPA 3BN9D 4N20A 4P07A 5ABDE 3IJ1A 4NENA 4X5WA 3V9FA 4WWID 4M4RB 1A9EB 2V3FA 3IGFA 5C0CA 3OPUA 1GC1L 1QLRB 2JIXB 4GW5B 3EJUA 5FUCC 2J6WA 2F54A 3P2BA 1P4UA 2PM9B 4RWHA 4GRLC 2OR9H 1WH0A 3FC8A 1TCMA 2HZHA 1IFGA 4QRFA 1KBVA 4KVPA 3VJ6B 1IAII 1RH8A 5DVKA 5IG7B 1SDAB 4LRNL 3MRJB 3QIWC 1AGBA 4PV9B 1HCZA 1X7TA 4G6ML 2X42A 2N3JA 4YHOL 4Y1AA 1W8EA 3TBTB 2EJ1A 4H8HA 5EZOH 2UV3A 2Z8WC 4MJ4A 1A4JA 5CZRA 3S37L 1QASA 1MHCA 1IKFH 4FQ1H 3EDFA 4FKHA 1CFQA 3AY4C 1S7XB 4DETA 8FABB 3MLXH 2P8MB 3MBWB 4MS6A 3HNSL 1XGZA 2G9KA 2G9AA 4PRID 1TVBB 2XZQL 2Z4TA 2PP8A 3GZKA 2AK4B 3WENA 3K2IA 3LN9A 1AKPA 3HBZA 5IK3A 2XG4A 3SDDD 4UQ3A 5EOCJ 5CJBA 2WXKA 3H7BB 2VCOA 3CLEH 4FCAA 4JDEB 1BA9A 2AK1H 1F4AA 4TULL 3P54A 3HE6A 4NCDA 3VFOB 1F8TL 4DP6X 1IGFH 4HS6B 5EOTB 1TMQA 3MV9A 4YVUA 4Z7NB 2AJUH 5CF3A 1AHWA 2W9EH 2DV6A 4PMFA 3TYGL 3W38A 2DWXA 3FMGL 3KGRA 1WDAA 4ZS6C 3T4AB 2VXUL 3UERA 5C0GB 4IMLA 1R17A 3SKJL 1ZHKB 3X14B 2C3VB 4KO5A 1NCCL 5DI8B 5T1DL 2MNUA 3PAYA 1DQIA 1QACA 3MLUL 1J8HE 5K9OA 5IB2B 4WNQA 5EPMB 1CLOL 1JZDC 4HETA 2ADFH 5JQ6L 4N9GA 5DD1L 3W5MA 5IFJB 5AYQA 4L48A 2GK0A 5FYLE 3TIDA 4N2LA 1IEBB 3G5ZA 3VAEA 3VWJA 4Y8DC 2X0WA 4IHOA 3BDXA 4PLJC 1QSFB 1U58B 2HWZH 5GS1B 2V7NB 1LK2B 3IMSA 4JFHD 5CJQH 1IC4L 1DJGA 4UM9D 1WBZA 3KPOA 2AJVL 3QAQA 4F7PB 4UOJA 4HFUH 2FE0A 1MJJA 2BOBB 3IE4A 4H4NA 4LOFA 4PEEA 1CIDA 1XXDC 4JUTA 3SE9L 2J43A 5L8LB 1WZ1H 1IVLA 2ETWA 4XPAL 2PPFA 4K2UL 3SKMA 1M9SA 1OHQA 4NBMA 1WGOA 1A6WH 2EO1A 4PD4K 3DARA 3CPLB 4OF3A 4TV3A 1ACYL 1Z6JT 4UYQA 3NYKA 3JWDL 4J4PA 5DFAA 4TNVK 2WLLB 4ZPTB 5CYKA 4UM8A 4PGZA 1NCTA 3E8UL 4XR8C 1AXIB 3CG8A 4Q2ZB 1JXJA 4JKWA 4WFHD 1X44A 1XXFC 1LM8V 3D08A 2W5PA 1B9XA 4YS4A 4ODWB 2CE8A 15C8H 2OR9L 5EU6A 4A0AB 1KIUA 3QUXB 4GGAA 4QF1A 2MQGA 4PJDF 4QI3A 1UACL 4UINL 5B7MA 4LCVA 3NIGB 2DLIA 4OZ4A 1URIA 5CINH 4LSSH 3T3PE 2IC2A 4O2EA 4U1KB 3EH2A 4FQ2L 2H9GB 1VADB 3QO0A 1U21A 1OAYL 3SHSA 1MCBA 3D4CA 3SO5A 3GEWB 4G3YH 4KK9C 1J1PH 1H5BC 4FQ1L 3PWPD 4WY7L 4P2OD 5IOPA 2DLFH 2N01B 2HX9A 1O9VA 4MZRA 3TCXA 3BSHA 4FQIL 1TQTA 1ZA3A 4F9PA 3B9KD 4UDUA 5I2IB 2HESX 2C3GA 3Q5YA 1JNHB 4NKIL 4AQ1A 1RI8A 3FO2A 5FIEA 4G71B 2HT4C 4NC1C 3QQ9D 5C2WB 3G6AA 3IDYB 3LKPB 1NKGA 3N42B 3DRQA 4JPIA 1NGXB 5HDBF 2VGLM 4PRPB 5HYJD 2YD0A 2HMID 1HK6A 5CM1A 2BVUA 3KXFA 4QRSB 4PHXA 4JPWH 1VFOA 1HWHB 1OE3A 5DMKA 2UZYB 2H0EA 1TTFA 1XF2A 2W9EL 3WKMH 1HSAA 4GSQA 4YZWA 1QOKA 1WIUA 1P4LB 3SYAA 1S7WA 1UM4L 4JE0A 2CG9X 4PUBL 5IFAL 1PI6A 2JJUA 3EH3B 4ODHL 3QHZH 3O4OB 7TAAA 3ULVD 1X9QA 4JXMA 4JG1L 3EDKA 4IKKA 1WQVT 4LSVH 5CHNA 1T1YA 4GLRI 4RLDA 1THCA 1SVBA 3RFGA 4QRBA 3ZE2A 4FTVA 3RVVD 1FNEB 1G7HA 3RTQA 3SGKC 1E5AA 5BUGA 3V0WH 5MERA 5D2LF 5JW3H 5HI5C 2DQGH 4WFEE 1RZ8B 5SWQB 1RK0B 1QKZH 4RFEB 4G7VL 3G08B 4FHJA 2PLTA 1KN2L 3OLIA 4ZOBA 1EHKB 3CFDA 1C12A 5CZVH 1M56B 3WXWH 5J6GA 4P4KC 4KJQC 4OLYL 3P4MA 2B7DT 2LLLA 1J8RA 2B1HH 4HFUL 5I24A 1YMMA 3MCKB 1LVEA 3S5LA 4JHAH 8PAZA 3FUNA 1O6GA 4JMNA 5DLLA 1SQ9A 1H0DB 1WZ1L 3OR6B 1J10A 3OR7B 4AENA 3V4VA 2ZX7A 1ZEAH 3VXPA 5MP6H 1PZSA 4NJAL 4GG6B 4BCCA 1WFUA 3BC9A 4JB9L 2WTOA 3VXNB 1R5VA 2PWDA 4YDJB 2W0FA 1ID2A 4OQTA 4CZVA 3K46A 1XV8A 3NCXA 4D2NA 3P4FA 4LHQB 2YRBA 4NNXB 3R0NA 2D7QA 4MB4A 2DAVA 3BKYL 4N8UA 3VH8G 4JHWH 5HI3C 5I6OA 1SOKA 3P11L 4OM0H 1L6PA 2X6MA 3DJRA 1K3IA 1FNSL 1E3ZA 1MVFA 4QTIH 4ABUA 5FB8B 4IDJL 2Y2TA 2FDBP 4HUKB 4B9GA 2LU7A 3ASNB 4PLKD 2VDOL 1KCBA 4XNXL 2WLMA 4EMZA 5BQ7B 1AD0A 5EMJB 2R56H 1DVYA 2DYPD 3VFTA 3GGWA 2CO7B 3VD5A 2J21A 2XTSA 2Z65C 3HI1A 1V05A 4OGXH 4GKLA 5FCSH 3AXLB 2LVEA 3MKKA 1LL1A 3NCCB 4N5EC 1JGIA 4G3YL 1G9ML 3BIAX 4FQQB 2FL5B 1J1PL 1K5NA 1OW0A 4M48L 3V7MA 2G5BB 1JV5B 2DLFL 3I9PA 1F86A 3RTLA 4NQEB 1ZLWH 2ZSWB 3GLEA 5E2TH 3MNZA 2I9TB 2QQNL 2GHWB 2R9HD 1I9RH 4PSRA 2P5EA 1TQSA 4TN9A 1BYOA 2OL3H 3MUHL 4Z0XA 2ED8A 1WRFA 1QX1A 1OP5H 3WGUB 3QUYD 1HJCA 3H1ZA 1QSEA 5GGVL 3QQ4A 1BV8A 4HJIA 4ES9A 2R4SL 2XHNA 1PYWB 4YXHH 5TE4H 4ZQKB 5JIDA 3I3DA 1FGNH 5EO0B 1IKNC 3FN9A 3WKML 3IGLA 3MGTB 3CSGA 2J4WH 4WFGE 3JZHA 3H2QA 3IRCA 4P3DB 1AFVH 5CP3A 2WSKA 1YEFH 4HJUA 1P9MA 2R0WH 4BHUI 3I9GH 1QZNA 1XFPA 5HYFA 2VDOA 3DXMC 1UT9A 1K8IA 1DBBH 1W15A 3D05A 4X5LA 4Y2OB 4YFLI 5K39B 4J6IA 4PRIA 1NUNB 4JLRB 3EHBC 5IEHB 1KCSH 1KY7A 3NCWA 5ICXB 2EVJA 2VSCA 2Z31B 3C5ZA 2BM3A 2PYFA 4ODVH 1E5BA 4PJXA 2VQTA 2NQDA 4HUUA 1C1EL 3EYSL 3HNVH 4XNUH 5CZVL 1CURA 5AD0A 3X1EA 3EO9H 5AL8A 1T83A 2PCFA 4U6HB 1SUJA 4XWOD 4GMBA 3BH9B 4MMXC 2RTTA 1OLLA 3C6LA 4K9EL 5EAMA 4G5ZH 1TQUA 3MLSL 1IC5L 1BQLH 1OAUL 4XX1E 3OKTA 4QL1A 1R47A 3AUWB 1IILE 1UZ8B 1QSVA 4X50A 3I6KA 2HKMA 2YD2A 2L04A 5IMLB 4GKSA 4X4ME 2ICWI 5D7IE 2OULB 3IDMB 1LWJA 5DJ2A 2Y0SA 1MG3C 1DQVA 5E4EC 3T0EB 3HG4A 2OMVA 4F7TB 3O4LB 1B3IA 4LLQB 1AG6A 1BD2B 3MUGA 4OTXL 3SOTA 1FVCA 3ESVF 3GF8A 3NCFB 5F96L 2CK2A 4IBUA 4QTIL 1TJIH 3DTXB 4M8RA 4QTHA 4XCCL 5BVJB 1A1MA 1UWEH 2ZKMX 4FRWA 3OVUB 5JXAL 1CR9H 2H6PB 2F1BA 3L4UA 4HIXH 1N5AA 1ONQA 3IGAB 4EI6B 1PZ5B 1PIGA 4APQA 2BNQA 4BH6A 2J8UF 5ETUB 3ZY7A 3ZHFA 3OXSA 5AVWB 2E7BA 1DL7L 2X9YA 3E6HA 3MUY1 1MCQA 4FFYH 4OLEA 4LCWE 2OQJB 3QEQE 5FF6B 1G7MA 5G5DA 1P0SE 2ZUQC 4CVXB 5A2CA 5D55A 4ZOEA 2RALA 5DC9B 4BQCA 1DJWA 3OKLA 3M6DA 4ZMQA 4NUGH 2B59A 4N2NA 1KPUB 3EYUH 3TFKC 5TJWK 3ULUC 3KLAB 4L3EB 1BF8A 2B0SH 2XWTA 2UY7B 1F11B 2JF1A 3CDFA 2MHAB 4GRLD 5LG1A 1OY3B 3GBMH 4QWWC 2QV4A 3UTTE 4PJCB 2WBJC 1DSFL 3D48R 3K81A 4AWJC 4L1BA 1KB9K 4ZW6A 3WS3A 1SYSB 3BUPA 3QIWD 1KXVC 5ECJE 1C5CH 2GK2A 4GEIA 4HU2A 3BGAA 3ATBA 1U8OA 4UQDA 5TE4L 4XVTH 5DQ9B 2WQ8A 2H26B 3PDDA 4YL4A 2O5XH 4QKTA 1TJXA 3MO1A 4ODSL 4ZODA 3UBHA 4YFDB 5EORL 2J4WL 1OANA 2DQ6A 2C9SA 1XF4B 4HAFA 1OM3H 3JBG7 1AFVL 3RB7A 1YEFL 3Q8AA 3KLHC 3MHZA 1PEVA 2YOCA 1M7DA 4GO8A 3PWPA 3QDGB 4P2OA 5E9DB 2VDPB 1HQRA 1JRHI 4D0KA 5AB2A 5KYYA 1CI5A 3TN0A 5CU5A 1S7UB 3HHMA 4OD1L 3VMOA 4ODVL 4JKPH 2ATPB 1HFUA 3QS2A 4M00A 3QQ3B 4KQ3H 4GM9A 2CIIB 2Y36H 2YK1L 3MTXA 2BCMA 4PVMA 3HNVL 1J0KA 3ILQC 4S0SD 5CD3A 1QLFA 3ISWA 1INEL 2L7JA 3IETA 4DFHA 4ZS6D 5JHBA 3MXWL 2DLGA 5EBLA 4AV5A 5DRNA 1PZBA 3ZN6A 1EEQA 1FORH 4G5ZL 4XCYB 1MVUB 1LEGA 1NJ9A 1GZPA 1YEDB 2FJSA 1WIOA 3GBNH 4JVWA 4RVBA 3ROLB 4X61B 3DV6A 3D2UA 2MCAA 1WAAF 4AN1A 4D0CA 1RZIA 3RWFB 4HUXA 1PY9A 1GGBH 4R8WH 3O8XC 3VNYA 4Z7OA 3UP1A 1UXLA 2NQCA 1KEMH 4QMEA 4BWUA 3BO8B 5F0PB 3QUMB 2QHRH 5D7LD 3DVGA 2E27H 4XBEL 4OZIF 4PLJD 4TSCH 3NVQA 5HVWA 3OJDA 4QRPE 1T22B 4UOQA 1RMFH 1Z9SA 3GSUA 3ORJA 1QSZA 4OM1L 1TJIL 4D6VA 4QAMB 1TJHH 4JHPC 1XGQB 2O6EA 4GSDL 3SY0B 1QO3B 3BKMH 1AGCA 1T1WA 4JN1L 1F2XK 3ULSA 1M53A 1CR9L 4WW2A 2DM4A 4HIXL 4GRMA 3EAKA 1ASQA 1IBYA 3JV4A 4AMXA 2F8IA 3GK8H 1X5KA 3H53A 3FQUA 4IKNA 2R0ZH 1YPZB 4NO5A 3H3KA 1MWAB 1FN4A 3L4TA 3BWAB 2NY6B 4FFYL 2H14A 4Y4HA 5TK4A 5EG6C 1CLZH 4FAAB 4P2QE 5BJTA 4G1EA 3NVXA 1LHZA 1SLUA 2MEJB 4LPVA 1DBAL 1LQSR 1K8KC 2V8LA 5IF0B 4CN6A 4NUGL 4P2RB 4WK0A 5JWZA 2Q8BH 3GDCA 5IHZB 2RBLA 3VRIA 1IGTA 4NQTA 1RUKH 3KWTA 3TBWB 2AI0H 3ZDYA 2W65B 4NPKA 4G83A 3ARFA 3CDZB 2AH1A 3G5XA 3TT1H 4NQDE 4I0KA 3HG1E 4PWHA 2ADYA 2VL5A 5GGQL 2WOYA 1ZOXA 3FOMA 2HKHH 1JHKH 4D9QE 3VD1A 4PFEA 4DCQA 2OZ4L 3AJ7A 5AW9B 2OK4A 4I5BB 1WE5A 3WIFB 1I1FB 1RUAL 4KK9D 1Q90A 1QBLH 1OT4A 4PWEA 2I27N 4A39A 4CMHB 1SHYB 2VMJA 2XPYA 5DJXB 5EN3A 4MJID 1MI5B 1JGVH 3QYMA 3RDTB 5I1KH 3RY5A 1OM3L 1Q9WB 5L88L 1YYCA 4LL4A 4JDZB 1BF5A 2HT4D 2Z93A 3L3HB 5ESQA 4Q4EA 4LDOB 5IWLC 1DP0A 3ZT6A 5HVFB 3OPZH 2BKLA 4MAYB 4QRQA 5LQBL 4CZYA 3FQWA 3VGFA 2HVKA 1VFBA 3LQZB 3TLRA 4PJFE 4Z7QB 4JKPL 1ZIAA 2Y36L 4OZHE 1JF1A 2CLRA 5F0JB 5AVQB 5CGMA 4R4BA 4YDVA 3QUYA 3S3SA 3QCUH 1E4KA 3VVWA 2NCEA 3GJFH 2PXYC 4WV1C 1M1SA 4BH7A 1JGLL 1XD0A 2C5DC 2X4QA 2ZP9A 3KPNB 4KRLB 1MFVA 2C9AA 2VISB 3A3YB 1FORL 2ZKYA 3GUTB 1XHHA 5DQJB 3FULA 2X40A 4NENB 2A9BA 4QY8B 4X5WB 1YNLH 1KC5L 4UYPA 2QFRA 3AS3A 4KQ0A 1N6FA 2WWOA 3OQRA 4R8WL 2JKLA 2W38A 3G7TA 3ULEC 3RIFK 3IJHA 2QHRL 1NGZA 2E27L 2OZ4A 5I1EH 1EMTL 1CPUA 1SFDA 4DP4X 3MR9A 1FHGA 3ABGA 3VA6A 3M46A 4P4KD 2FQEA 4Q9RH 1S7SA 1U8JA 5HYSA 1TJHL 1A4CA 4QOKB 3U2IA 2OXGA 4KZEH 4X5XA 1HZKA 1G5AA 1AGBB 4JRFA 1KJVA 2XPGB 4FLOA 1B4TA 5FYLH 4Y1AB 4PCYA 3SO3C 3R0MA 1A4JB 2KBGA 4NSKB 1CE1L 1K3ZA 4I3RH 3GK8L 4HKZA 4KU1A 4LVHB 2HVJA 4KMTH 1ADWA 1CFQB 2PTTA 5IBLC 2YPLD 3S3BB 3UYRL 4JPKL 5D4QA 5BS0A 2X2IA 4W93A 5F1NA 1I8IA 4YDIH 2OCCB 5HI3D 4R97B 2O5NA 5IK3B 2XG4B 3VG9C 4N0FA 4UQ3B 2Q8BL 3DBXA 5FUOH 2G75A 1E9PA 1F3JA 3NRPA 4KAQH 4KK6C 1IV8A 2BO0A 3D50A 3HE6B 3RFHA 2Y1ZA 2IH1A 4P3CH 1WWWX 1G94A 3TT1L 1N3NA 1UOVA 3L4WA 1NQBA 5ALCH 3T2NH 2FEJA 4CVWA 3JZ7A 25C8H 4ODUA 1CMOA 1AHWB 3GXUB 3MV7D 4HJJH 5HHXH 3DX3A 3QJSB 1NGQH 1NMCC 5GRWA 1U2YA 3N40P 4N5ED 5T3ZD 1UD3A 2F2HA 4OLVL 4XPBL 1A14H 1QBLL 3RX7A 1S7TA 5JIKA 3TEUA 4LLMA 1TIUA 4DF9A 4WFFE 3WFZA 1A12A 3FB8A 4HEME 1JGVL 3VXME 1T6WA 5CD5C 5K9OB 2CPCA 4WNQB 1GXEA 3QWRD 4WUUE 4HIIB 4N9GB 1SZNA 3FXIC 1JZJA 2Y06L 3D69A 2GK0B 5FOJA 1N5YH 1XHMA 3TIDB 3G5ZB 3OPZL 4X7SL 3VWJB 2JKNA 3BAXA 1HNGA 2DTMH 3OLGA 2EADA 3S4SA 3AU1B 3D3VA 3HLKA 1FDLH 3W1ZA 1WD9A 3ZDXA 3EW3B 1JF6A 3UTSE 4L18A 4ZSOE 4RETB 3D39E 5IM7A 4N8VA 4O3UB 1LO4L 3CXHJ 4V11A 5KSBE 1QEXA 1LXMA 2GW5A 4AM0A 1LO5A 3SKMB 2WUCL 5CJ5A 5HHNA 5KW9L 1FYTD 5EEYA 2TRHA 3I7PA 2VIRA 2XCMC 3JVGA 5AYUH 4Z7WE 3AY4A 1YNLL 4KHTH 3OD3A 5CYKB 1JI2A 4UM8B 4HQQH 3D25A 1QVOA 4U1JA 4N86A 4N0UB 3MNWA 3EXJA 1ZGLP 5JOPD 4Y88A 3EHBD 4MA1C 1X5HA 4MKMA 4N24A 1DEEA 4LSPH 1JCVA 3AB0B 5EU6B 3P9MB 2EAEA 3V6FA 1MFMA 5AKSA 1NINA 1PJ9A 3NZHH 2HX8A 1IM9A 4QF1B 1I1AB 5B4WA 1NGWA 2ZAGA 1K6QH 1ZK5A 5T5NF 4RBPK 5EA0L 4OZ4B 2VLJA 3S96A 4O2EB 2X3BA 3CLFL 3HMXH 3QO0B 1AAJA 3DECA 4QLRA 1WWBX 1R6VA 4ZT1A 2MCPL 4I3RL 4EN2A 1W0YT 1SHMA 2P42B 4HDIB 5IOPB 4D9RE 4FQLL 4RX4D 2VR6A 1JS4A 3FOLB 4LLYA 4NZDA 3IMRA 1M57B 1ZA3B 4RFOH 4UDUB 1GYVA 5ESAB 4YDIL 4AQ1B 2UYLA 1E4XI 1WSST 4IW4C 3G6AB 4CY1A 3PCYA 5D6DA 3DRQB 4JPIB 5ABAA 3GC3A 4U7KA 1SOSA 2CO0C 1X6NA 2DYSB 3KXFB 3NG5A 2UXGA 1SJEA 5DS2A 3MDJA 1S5IH 1HOEA 2BOCA 1S8DA 3I3EA 3QZWA 4EUPA 5TPWH 25C8L 3FQXA 1I8KA 2WAHA 4POZC 2QSCH 5JW5A 1HSAB 2IQ9L 1XF2B 2ZJSH 4P5RA 3FTSA 1ZVSA 3B2VH 1S7WB 3VXRD 3GDBA 5DHDA 3IKOA 4BL0A 3KL0A 3NTCH 1QWUA 2A9AA 5CHNB 1T1YB 4LSQL 3ZE2B 3TFKD 1OT2A 4X9HA 1AZUA 4FTVB 4TRPH 3RWDB 3ULUD 4LIQE 1G7HB 3RTQB 3AM8A 1J8HA 3UZVA 3NRFA 3QFJE 1JZEA 1PTZA 1C7TA 1T5XA 5MERB 1N5YL 1MOEA 4QWWD 3WNNA 3CFVA 2DTSA 4KZ0A 2WBJD 4PJAF 3EMHA 1C12B 1DO6A 1W0VA 2FGZA 2YFOA 2WYZA 2J12B 3B2UD 4F27A 5J6GB 1WCBA 1J5DA 4S1DC 3P4MB 3GXTA 4M7KH 1FDLL 3BIBX 1NWOA 4HHAA 1W6WA 1YMMB 1GA2A 3APFA 3EQ9A 1MRDL 1V8HA 1MRCH 3MUNA 2V3EA 4AENB 3V4VB 3KRXB 1AIZA 4MS8D 3OMZA 1HILA 2DKMA 3RA7H 1R5VB 2ZCHL 1A0QH 2EIEA 2ZOUA 3KLHD 1XCWA 4WI5A 1IAKA 3OV6A 1TOXA 1U42A 1TF4A 2CHNA 4KHTL 3ARWA 1HHHA 2OJEB 4QTFA 3TBVA 1ZHNA 4Q52A 4F3FA 1ACCA 4ORGB 4J3UA 2XG5A 3TJEH 2GYSA 3LH8A 5K9JH 3A47A 2TSBA 2AS5M 4FA4D 4HSCX 2VDPH 1UATA 2FT6A 1FFNA 4I89A 3O3UN 3ILQD 3LD8B 1U3HA 2NOYA 1AD0B 4RRPG 2QQLL 2DJSA 1K6QL 3VFTB 1Z0MA 2DY2A 3GGWB 3VO0A 4WHYG 2JSFA 2YZ8A 2DBLH 1IAMA 3ZX1A 1BAWA 4YHMH 3HI1B 5C3TA 1C5BL 3MRHA 1VRSA 3T3PA 3O3AA 5F6HI 3QDMB 4JRYB 2HSIA 4UZUA 1EHLL 3UGEA 3GUFA 3BPLC 3UXFA 1AKJD 3O0RH 1XF5A 1K5NB 5DZOA 4ZFOA 4MDIA 5DJCB 4LP8A 2XE4A 5DVPA 4BIKA 3O8XD 1B4LA 1AR1C 4RFOL 2P8PB 4YWGH 3OW8A 2LFGA 3FQYA 3MNZB 1GJIA 3GFUA 2BSED 2Q76A 5C0FA 4X2UA 4NZTH 3U7YH 1L3WA 1EAJA 3PHSA 3HAEH 3T0DA 3QG6A 4GQBB 3RYMA 3NJHA 1QSEB 3QUMH 3L2LA 3QQ4B 3FB5A 5FV2A 3L4MD 1GL4B 1E8MA 1QYGL 1S5IL 1I8UA 1NAKH 3P4NA 1MW0A 4N1EA 4P4KA 3ZIYA 4K3GA 2Y24A 2WYIA 1E2ZA 1MDAH 2ZJSL 1RI6A 4ZOCA 1QFHA 3AREC 3BKJL 3QJUB 4M62H 3NTCL 2BNUA 4U3XA 3ECVA 1ET8A 4PJ8D 1FF5A 1I8LC 3L9RA 4DUWA 4JN2B 2VDOB 4FQHA 4XP1L 4AM0Q 2X6UA 1K8IB 2YPLA 3GI8L 3WBDA 1M2VA 2NY3C 4TPRH 4NIYE 4PRIB 5J13C 3B9EA 1N8OE 4ZS7H 2MQCA 3D0LA 3C5ZB 5HYJE 1CVSC 4XP6H 2AEOA 3KW8A 2DKSA 4N90D 3HG2A 5K1NA 3RL1A 1G7LA 5IMMA 1PZ2A 3N1MC 4HUUB 1INDL 2RIKA 3LN5A 4LCCC 1H8OA 1CDHA 5AD0B 3D12B 3EJZC 2PCFB 3H0TA 4OH2A 2NXZB 3CCHA 1XF1A 4M5SA 3FTUA 4GQQA 6PCYA 5I1IL 5DJ0B 4AEHH 4H0IA 3DO7A 3C6LB 3PVUB 4PTUA 4APXA 2ENSA 5SV4A 1Y6NR 1OWRM 2K6ZA 3IMTA 4KI5E 3B7TA 3I6KB 3EXLA 4N87A 4DNWA 4PJBE 4PG9A 1A0QL 4GKSB 3WSQH 1XD1A 1ZHBB 3PP4L 1G43A 3C5JA 1S6NA 5GGTL 4BWTA 3T2QA 2OMVB 3U48A 5B3JF 2OX5A 3SKNB 1DN0A 2GBAA 3QISA 4QGTA 4GXVH 4WRLA 3LXAA 5BZZA 3MUGB 4GJTB 4XAWH 5PAZA 1ROWA 4AXWB 4HWEL 4N3UA 5AW4B 1YYLH 1ERJA 1X7QA 1HE7A 4JK0D 5DJAA 2NT0A 3K4DA 3NK4A 1FC2D 4QTHB 2FLRT 1S9KC 1A8JH 4PRAA 1A1MB 3P3TA 2VQUA 4BFNA 3OKKA 2NY5H 3IBEA 3Q8CA 4QR7A 1U8LA 5DQDH 1N5AB 5TDNA 2PXYD 4DGYH 3EI2A 4LT7A 5AW7B 4FQXC 4APQB 3OXSB 4F9LC 2VH5H 4H7VA 12E8H 1IKNA 2CNYA 3E6HB 1IQDA 5EZIH 1UH3A 5C0DB 4NX0A 1G7MB 4YLCA 2NY2B 2VLKD 4J3OH 4PD4J 4NHUA 2OTWA 3MU3A 3DJTA 3OKLB 3TT3H 1H2WA 5HHVH 2XZCL 2B59B 3BGFC 4IRJD 4MCZB 5J11B 3IWUA 3OG6B 2UWEE 2XWTB 2HCZX 5DRWA 3WHXA 2B16A 5JPNC 2QQKL 1DVUA 3WIIL 2FWLB 3KAAA 4HISA 4WVRA 1FL6A 2CPUA 3CDGA 2E4TA 3U7YL 2EC9U 3JZGA 4PW4A 4FG4A 4D7PA 3WS3B 4BCZA 1EQWA 4JW3A 5K59E 3VW3H 3N40F 2HH0L 4HULB 5F3HA 3IKKA 1U8OB 2L4OA 4XCEA 3APNA 3P0VH 4OLUL 5KVEE 4JKNA 4HUCA 3U82B 2EDMA 4LO9A 3D51A 5GGTA 5IVXF 5IREA 3BDBA 4N22A 3RFRA 3WY1A 3MO1B 3WEXA 3LYRA 2YD9A 5KUKA 4TLUA 5IBLD 3HNTH 3CN1A 1QFWM 1XVSA 3E38A 4YC2C 4JJ5B 3S35X 3ESOA 4LOEA 5JW4R 5ELIA 4WU7A 3TWYA 1JPFA 5BO0D 1EHNA 3EBGA 1XGYL 5AAMC 1M7DB 3TF7C 3PWPB 2P5WE 3KGUA 4P2OB 2R29L 5F6IC 4RX4A 1YC8A 5TQ0L 1HQRB 1U4EA 4ZFQA 5HQGA 3BD5A 5KYYB 3WO4C 2CWRA 3B9KB 3DKHA 3L5XH 4KK6D 3TN0B 4F7KA 2AGLA 2BRRL 3MRLA 3F58H 2QQQA 2WB7A 4XPHL 1R3KB 3MLWL 4OZFA 3IXAA 2VMFA 4NCC1 5CD3B 1QLFB 4NN6B 1QFMA 3FYEB 3DK2A 5EBLB 1A1OA 3B2XA 4JAMA 5DRNB 4AEHL 1UGNA 4JM2C 5E9AA 3V0AC 4UI9R 3RP1A 2X38A 1F0LA 1LEGB 1GZPB 2CU9A 3MUOA 5CD5D 1G7PB 1QPXA 5CCKH 4QO1A 3VXRA 5CBAB 1RZIB 2JJSC 4GMTL 1Z3RA 2IAMA 3QFDB 1TTUA 4GZ8A 4M93C 2XOTA 4Z7OB 3MFGB 3F00A 2JLLA 1TSHA 4G6AC 3CTTA 1XSOA 4KK5C 4QAWA 2VSKB 1NDTA 4X4MA 1OGSA 3DVGB 1A25A 3OJDB 3WXVH 1A5FH 1CWVA 2J2ZA 4XAWL 4Y19E 3WFBL 3GBDA 4MCNA 1Z9SB 3GSUB 4FZEH 3VD3A 2H32H 1Z32X 1OB1A 4AIZA 1WFTA 3RVTC 4Z7UF 2ZXDA 2NYYD 2QKIC 1M7UA 1M42A 1AGCB 1T1WB 1MAKA 5I6PA 4WW2B 3E9UA 2EEDA 1E4HA 2YARA 4FG0A 3PS6A 1AY1H 4GRMB 4HIJA 5DQDL 5H8DA 4KUCF 5A2KH 3SYPA 2VW7A 2R29A 4WJG3 5CEYA 2WGXA 3B2PA 3FQUB 3I3BA 3WJMA 3KWWA 12E8L 3FRUB 4NO5B 5ISZE 2AV7A 2P28B 2WLYA 1FN4B 2Q7AA 3DO3A 4Y16A 1ROCA 1G1KA 4V33A 4M4PA 4Y4HB 5CZXC 2DWYA 5EZIL 4DP2X 5LXVA 5BJTB 4G1EB 2CXKA 4TVPL 3ZTJG 4LCWA 3VD7A 3QEQA 5HPMA 4NP9A 3N43F 5CILH 1EJOL 4QRRE 1ET7A 1D7CA 2GG1A 2WBWB 4WK0B 2EDBA 3HI5H 2X9XA 1F41A 1VGKB 3VRIB 1IGTB 1JK9B 3HR5A 3QPQC 5F97E 4PJ5E 2RMNA 3ZDYB 2A0LC 3ARFB 3LN4A 5LXGL 3G5XB 4CC4C 4E42B 2VL5B 2YB8B 1NGPL 2FUTA 3FOMB 4RWYH 5DHEA 5ESVA 3UTTA 1NFDA 2BCKA 4DCQB 4YSTA 4JFZH 4J73A 1JDCA 4CMMA 5CEZL 5I6XC 2AQRA 3KYNA 4XOEA 2DYPB 2EXYC 2LABA 3L8QA 1KF9B 1TJGH 3UIZA 2R0LL 5C0BE 2QGEA 4PLNC 4R9HA 2DM2A 2WLIA 3IMWA 4XP4H 5GRZA 4M6ML 1B2WL 5ESQB 2YR3A 2C4FT 3R1GH 4F7CA 2XXFA 3MOBL 3NUKA 5AVYB 5HY9B 4HKXB 1COBA 3I6GA 4MCMA 4QRQB 3FQWB 3L5XL 2F58H 4I77H 5C2BH 1VFBB 3NFNB 4KJYB 2ADGB 3NIDE 3F3HA 2WVTA 4PS4H 5TDOA 5I76A 3ODTA 4HJGA 2P9UC 1UZ6E 3GXNA 3F58L 1U3NA 1JF1B 2HKRA 2CLRB 1MHPH 3QULA 3TO4C 4POZD 1BZOA 4R4BB 4BQ8A 4YDVB 3I7OA 1DCLA 1QA9A 3QUYB 5I8EA 4H1LH 2WBXA 4BH7B 2NY4D 1PZUB 1JE6A 5EOCH 4A38A 5D7SH 4U3HA 3B6SA 2JI1A 4NUQA 4DPCX 2KH2B 3FDWA 1AIFA 1KIRA 1DVXA 3Q8FA 4OZGE 4K9JA 2W88A 5EDXA 1IZJA 5KBPA 1ILUA 4X8CA 1U8NB 5E03A 1U92A 3EJQA 1CYGA 3UO1H 3JWNE 3IJHB 4BKLA 1DQQA 4AEEA 1NGZB 4ZQTA 3M1BA 2TRCB 4XOCA 4LE8A 3DVFA 3CFSB 3WXVL 1A5FL 1CXKA 2XBDA 3ILEA 4JRXD 2GUOA 4FZEL 4S1DD 4B7IA 4HF5H 1S7SB 1U8JB 3MN8A 4GUQA 4HCIA 2AXFA 1EJ8A 2OXGB 1I9EA 2I85A 1NLDL 4X5XB 5C0RH 3QNFA 1H6FA 2W0PA 1KJVB 3S88L 3KCWA 2Z1KA 3MNVA 1UC6A 4HKZB 4J79A 1OSPL 2BP5M 2DJMA 1QNZH 2HVJB 4Y5YA 5E6IA 1JI1A 1JTTA 3ATAA 2PTTB 4PWJA 5FFLA 5FUZH 1B4JH 5BS0B 5F1NB 4H0GA 4KXZH 1VEOA 2FYYA 3LNHA 4KFZC 4PJXF 4JANA 2JFCA 5AKRA 1KELL 1PY0A 1NEZG 4DN4L 5J9PB 3KHQA 4N0FB 1A9VA 2FYVA 3DBXB 1AYOA 2G75B 1E9PB 1F3JB 3F7VA 3TFBA 1B0RA 2C9UA 1PMYA 1WWCA 2APWA 2IH1B 3FTGA 4JR9H 3NEXA 4QLWA 5C9JA 1N3NB 5KBKA 1BIIA 4DEUA 4RWYL 4ODUB 1IFRA 3C12A 5EO1A 1P7QA 4NLAA 3GRWL 5GXBB 2E9WA 1WITA 2JK5B 1YECL 1OHZA 4KVCH 4ZMPA 4NQCD 1WA2X 2J8OA 3FU0A 1F1GA 1HT6A 1S7TB 3A5VA 4LLMB 4WV1A 5ACLA 3N41B 2N4IA 3PGCA 3FB8B 4M03A 2E47A 3BKCL 4OLWH 1R0AH 2O93L 1AR1D 1KLFA 4KJPC 1BECA 1YNTA 4XC3H 1IBGL 4UF7C 5I28A 4LPTA 2MFNA 1LP9F 4XVOA 3D69B 1P4BL 2AXGA 2VLKA 1Q0YL 4YZFF 3RZWA 3UCQA 1CGXA 3VGBA 1OMWB 5FYKE 3F7KA 2VR4A 1YYMH 3KM2A 1KJ3H 4K55A 4RFNC 4WI7A 5C2BL 5ID1A 3S4SB 4PS4L 3T3MF 1PNCA 1VCBC 3D3VB 2Y1AA 4GRLB 4NBYB 2CHDA 4U33A 5GJTL 3RPIA 1OK8A 3ZDXB 1QR1A 1EXUB 4IOIA 1D5IH 1ZS8A 3CU1A 1MHPL 4M61A 1KB9J 1TPXC 5IM7B 3ABMB 4N8VB 3FSAA 2XWJA 3GMRA 4CY3A 3QIWB 5KEZA 1F4YH 1SVZA 3N9GL 1LO5B 3ARED 5HHNB 4WI4A 4GY4A 2ERJC 4KPHL 4URTB 2C7FA 2YGVA 1NPJA 1U3JA 2QFPA 4UTAA 2J1WA 1F3RB 5EUOE 2WQSA 5T1LA 4L3CA 5E2JA 4E9VA 3D4YA 1L0YA 4JHVA 2NY3D 1Z66A 3S36H 2KZWA 3MNWB 1LD9B 3OQ3B 1NCHA 5IW1B 1DEEB 2F1AA 3AVEA 1IX2A 3GRWA 3V6FB 2ZG3A 4AVJA 4B96A 1TJMA 4BFEA 1IM9B 2H3KA 4ICWA 3CFTA 3EJZD 3GO1H 4G8GD 5D1ZI 4HF5L 1NGWB 4UOZA 3EGXA 3QIBD 4QXGH 5D71L 3MXXA 2VDLL 2GJPA 2VLJB 5C0RL 4Z8LA 4CAGA 4ZG1A 1MW1A 5H37H 1TU2B 3PVWB 3UDWC 4JFEE 1E3FA 1EK3A 1F6FB 3HHRB 4TOYL 5EH1A 4FABH 3QHYB 1JPSH 4GINA 1D5BA 1QNZL 4RA0C 4ZO7A 3B56A 3RQ3A 2XQBH 4H8PA 4OFDA 5BRZA 3FO1A 5ACZA 4X5PA 2CH8A 2CJUL 4YDLC 2UYLB 4WWKC 5A2BA 1WZAA 2JJTA 3MLZL 4X80L 4BCBA 3K0WA 4KTYA 3ZOAA 5D72L 4HZAA 2B3RA 4HC1A 3LQAL 1YQVL 1I7UA 2ZICA 4HD9A 2A6IA 2X3AA 2X6BA 1REIA 1ZVNA 2GABA 4V2CB 5LHDA 3SDYH 1NR0A 1HSBA 2BSBA 3TZVC 2BOCB 3GNMH 1S8DB 3QZWB 4EUPB 4MTMA 4PRBA 5BO1H 1TETH 3FQXB 1I8KB 3P4LA 4FQXD 5JW5B 4H25A 2VRQA 1ZVSB 3ETTA 4NUPA 1OIOA 4HYTB 4F7MA 3AQYA 2V2WB 4KRPC 2BY2A 2AQ5A 4AQOA 3T6QC 1MHEA 1R0AL 3IUQA 2NDGA 1FLRH 2DMBA 4Z95L 2DI8A 1HKLH 4LASL 2V37A 3UZVB 4NZRH 2UXTA 2WXJA 1T5XB 3VFNB 2VDLA 3EOTL 3CFQA 1ECZA 5ADPH 2Q86A 1BQRA 3PAVA 2BSTA 3DETD 1X5MA 2AQQA 4OU3A 4WUUA 1GGIH 3P2DA 5BV7C 5GMKn 2D2OA 2CUIA 5FHAH 1U93B 5GPRA 4FE9A 2A6KA 2OBGA 4WAFA 4JFVA 1AZZC 3DGCR 5HDQL 2NPLX 3H6JA 1XCTA 1F58L 3ILDA 4JJOA 2BHYA 3K6SB 2CCLA 1W8NA 5I5RA 3UTSA 1NBYA 3EJSA 5SXMA 2CE9A 1KWGA 4FXKC 3FM0A 1F4YL 1Y1DA 5JHLH 4D9SA 3TO2A 2DBJA 2VLRD 2XKUA 3QR0A 1H3PL 1HILB 1BXVA 5KSBA 3HFML 2B5MA 1HESA 1ZDSA 2JNZA 1UJTA 1IAKB 3DI2B 4MA8H 3BZEB 4L1MA 4MJIB 1YEIL 2R8SH 4ALAH 3TBVB 2JCCF 1HHHB 3HN8A 1CICA 4F3FB 1ZHNB 4CL7A 1K5WA 1I2MB 3ILPA 2OMUA 1IM3D 4Q8BA 2W60A 3B5HA 2XG5B 1RUQH 3GSXA 1DANT 3B9DA 2VDKH 4G9DA 3AG2B 1IQWH 1FFNB 3QRFM 1B4RA 3GMLB 2C9RA 3S0PA 2CO0A 1TEFA 2WPGA 1F4HA 1AQKL 2K6WA 4GAJL 4KFMA 4UWQB 3VI3A 4FFWD 4LIQL 4EOWH 3PIQA 3BZ5A 4JM2D 3BAKA 4MRCA 3MRHB 4QNPE 3NRQA 1UOWA 3O3AB 3ELQA 3SYQA 4NI3A 3UAEA 5ICYA 1GRWA 2GTZA 2MCMA 1XIWA 1XF5B 5JW4Q 4ZFOB 5ERWA 4MDIB 2FNBA 4X7DC 3UOAB 3RWIA 2HTKC 3JV6A 3MA7A 1HCVA 4G6AD 4KK5D 4CILA 3WL9A 3JTTB 2WQAA 2Q6WA 1VDGA 4K7PX 4TLTA 2Q76B 4KZDL 1UASA 4I8DA 2Y2YA 4IK6A 1GOFA 4G6JH 4DKAA 1M7IB 1KSRA 3ZE0A 5DEFA 1A6ZB 3QG6B 3ABLB 4K94C 3SGJC 4FN0A 3FB5B 2CO6A 5KYXA 4DN3L 3SDYL 1J11A 3U9PH 2DQDH 3P4NB 2K8QA 3IS0X 4Y4KC 5GRJH 4N2AA 4P4KB 3QWQB 2WVVA 2TSAA 3FSWA 3I74A 4X7TB 2E7DA 1PX3A 2A9DA 4OAWA 2R39A 3BSZH 1TVDA 1D3CA 4C4KT 5CZXD 4YHZH 4D9LH 2BNUB 1GSKA 1KXQA 5FC9A 3K8LA 1F1AA 2PR4H 5GGVY 1M3JA 2ZWZA 3INUL 3OMNB 4B9CA 1AOZA 4ZYKA 2A9CA 4FQHB 3LXUX 3EU7A 2DZEA 2YPLB 3SGDH 3WFHB 1P2CB 3QPQD 3TVMC 4XYIA 3U4EA 1JV2A 4NZRL 2A0LD 3DMMA 1FJ1A 3IURA 4D0DA 1OAQH 3BPOC 4NKQB 5ADPL 2VXTL 3D0LB 1DR9A 3PQYE 1MFUA 4ZMLA 5HGHB 3IPEA 3L7EB 3RL1B 1G9EA 3ZGIA 5IMMB 2HN7A 2OMNA 5A3IC 3LN5B 1L7IH 4O2FB 3H0TB 3CCHB 4JO5A 3SJVE 1X4XA 1S5HA 4P9HC 2ZG1A 3HFQA 3BXNA 4PJIA 1JP5A 3LH2L 1MFDH 2EDTA 4P5TA 5JHMA 2EXYD 3DO7B 4L8SA 1IJNA 4W9EC 2QBWA 4PTUB 2EIZA 5IGXH 3MV7B 2CBTA 4IBSA 2G5RA 5IQ7H 1URLA 4YXKL 1JZFA 1F56A 1EV2E 2BFGA 4PG9B 2YPVH 1MCRA 4HS8L 3OWRA 5AKTA 1G4MA 3FZUD 4XNQA 4XPGL 4GO6B 1RZKC 4JM4L 2OX5B 4UB0L 2X1QA 3SCMA 5TDPA 4ALAL 2CCWA 4CVUA 2GKIA 1RK1A 4RMBA 4IBVA 2XDWA 2Z4QB 3HRZC 5DJAB 5FO8B 2NNFA 4C4UA 2LV4A 1VZGA 1B9KA 1VE7A 1IQWL 4PRAB 1S7QA 1W91A 2XZZA 2BVEA 3TO4D 4D94A 3ZRSA 1YJDH 3OKKB 4IU2A 1KBGL 3MZKA 1U8LB 1VKXA 3L48A 4N6RA 3L9YA 4P9ML 5KVFE 5TDNB 5JPMC 5L6YL 3EI2B 3CU7A 4EOWL 3WEBA 3WGVB 2M2DA 2CCVA 4WENB 2B9BA 4Y9GA 4C56A 1IGJA 2XVBA 5E7FA 5D5MB 4O5LH 1O6FA 1F3DJ 2WLJA 4UV4H 3RWEA 4ZFFA 4XXDA 3CHQA 4JFWA 1S9VA 4NHUB 2OTWB 4BYHA 3A4EA 5E8NA 1FYTB 3V5KB 3KYAA 1PS3A 5MEOA 3J81g 1T1ZA 1XTMA 1P84K 5KSUA 1KV7A 3WHXB 2E8YA 1BQSA 5FLVA 1DZ0A 3CDGB 5CWSA 3F6IA 1KGCD 3EHBB 5KJ4A 2F53D 3BUTA 3POHA 3QXDA 2Z0UA 4X6CA 4X6DB 3IKCA