1A1SA

Ornithine carbamoyltransferase from pyrococcus furiosus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
313
structure length
313
Chain Sequence
VVSLAGRDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORNITHINE CARBAMOYLTRANSFERASE
publication title The crystal structure of Pyrococcus furiosus ornithine carbamoyltransferase reveals a key role for oligomerization in enzyme stability at extremely high temperatures.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transcarbamylase
total genus 116
structure length 313
sequence length 313
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 1997-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 1a1sA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 1a1sA01
9ATCA 1PG5A 1C9YA 4FYVA 3TXXA 3M4NA 4KH1A 1EP9A 3M5CA 1VLVA 2AIRA 1ZA2A 3M4JA 4A8TA 1RABA 4BJHB 2YFKA 4E2FA 1DXHA 3KZOA 3GRFA 3KZCA 2AT1A 5G1NA 3L04A 4KGXA 1PVVA 1RAEA 2FZKA 1RAFA 3MPUA 2HSEA 4F2GA 2OTCA 3L05A 1RADA 3R7FA 1ACMA 2IPOA 3L06A 3LXMA 4ANFA 1RAGA 3E2PA 2FG6C 1TTHA 1SKUA 1Q95A 4IV5A 3R7DA 2ATCA 8AT1A 2G7MC 3D7SA 1AT1A 1I5OA 1ORTA 1RAHA 5G1PA 4EKNB 3UPDA 1RAAA 4H31A 1R0BA 3R7LA 3NPMA 2P2GA 1D09A 3D6NB 2FZGA 4KGZA 1NBEA 4JFRA 1RAIA 1JS1X 4FYXA 6AT1A 1AKMA 2W37A 4NF2A 2EF0A 5AT1A 3TPFA 1R0CA 1TU0A 1XJWA 2FG7C 7AT1A 4KGVA 4KH0A 4JQOA 2FZCA 1A1SA 3KZMA 3AT1A 4FYWA 3KZKA 1ML4A 1FVOA 2BE7A 1TUGA 1ZA1A 3Q98A 1RACA 4AM8A 4A8PA 4AT1A 1DUVG 4A8HA 2RGWA 3L02A 4AMUA 2H3EA 4WTOA 1OTHA 2I6UA 2A0FA 3SDSA 4FYYA 1EKXA 4EP1A 3CSUA 4JHXA 3M5DA 1EZZA 5G1OA 3GD5A 1FB5A 2QG9A 3KZNA 8ATCA 4F04A 4OH7A 2BE9A 1F1BA 5ILQA 2QGFA 4KWTA
chains in the Genus database with same CATH superfamily
5CBKA 2YMPA 5EKDA 5CB4B 1DC5A 2XNSA 4ZVMA 3BHIA 1K6IA 1GTSA 3CPSA 3E81A 2HY7A 3TUIC 3R77A 1D2AA 4E33A 1EGAA 1OX5A 1UDCA 5J2UA 3BCRA 4HDRB 1ONBA 3ENNA 1JKMA 2XDQB 5B5SA 1QO7A 2I3GA 1JQEA 3HPQA 5JW6A 5LQCA 4INAA 4HD8A 3LXUX 5BSUA 4I8XA 4WK4B 1DNPA 3ET4A 3MOIA 4Y6PA 1QBKC 2JJ1A 3UK1A 4DXDA 5BRJA 2KLHA 5EL0A 1UM9B 4BX8A 4Z4EA 1Y3CE 3NHWA 3BK2A 2H9IA 2ZZMA 2G9UA 3EGOA 1P7ZA 1KRHA 3ZOZA 1G38A 2Y67A 2YFYA 3JTEA 3NJ8A 4H3KB 1GEGA 1TZ2A 3OT1B 5G3YA 4HFRA 2QPTA 3CISA 4XQCA 4D6XA 4QTTB 3UMGA 3QWAA 1UPFA 2EP7A 1L5HB 2B9EA 1XKLA 1DB3A 2J6CA 4Q16A 3QE2A 5K8LA 4HPWA 5TMEA 3L06A 2G04A 3PD7A 2A35A 5L3QA 2NUBA 3EEBA 5T3UA 4B5KA 3OEHA 2Q3HA 2ZE6A 4JVOA 4XLZA 1YUMA 4RA9B 2B1IA 1JPUA 4OKIA 4XYMA 5DBHX 3DFUA 2HR1A 1EVEA 1L7QA 1AQLA 4RCVA 1DPGA 3EXIB 1MXHA 2Q29A 3ELBA 4DHEA 2AR7A 3OOJA 1M34B 1EU1A 1ONNA 4OQFA 1V4BA 2B8WA 1QH1B 4X1KA 3TR0A 2O2EA 4AX4A 3Q8LA 2IH4A 3DDOA 2QUZA 4ZYTA 2ZRPA 1D4FA 3WFIA 1SRRA 1NUUA 1A72A 1JSZA 1HT3A 3L92A 5KNDH 3KLPX 2UXCB 1N57A 2E4XA 2BJWA 2FE1A 4GBMA 2C5AA 2BKXA 4GSKA 4CBVA 4RSMA 4CTOA 4YRBA 4RKQA 1MIHA 4C0KA 2E89A 4N9WA 2RB5A 3KNZA 3C5EA 1UK6A 1Z74A 3EB9A 3N74A 5E3IA 2WIAA 3C8MA 2ZJ3A 1NOJA 2RHMA 3MLAA 2ZJZA 4Q4LA 5FWXA 3X43A 1SVSA 4CLRB 1ANKA 3EEIA 5SZKB 4Z2AA 2VG8A 3ROEA 2CYAA 1AQIA 3ZE0B 5SZJA 5F52A 4B76A 2G5TA 4CMHA 1XVLA 2ZT6A 2R751 5EFOA 5K05A 1XMSA 2TMGA 2HA4A 3D7LA 2OBXA 1WE2A 4P0PB 2HXSA 5LBTA 4Z4HA 1IB0A 1OBVA 2AXNA 3OTOB 1E59A 2HHCA 3VSCA 4RPKA 4OVKA 2XDWA 4BMSA 3F9IA 4IZ6A 3OT4A 4Z1OA 3RNOA 4JI6B 1N7HA 2DTDA 2OGSA 4DCPA 4JLJA 1IHDA 1T0UA 1IOWA 2R97A 1IWOA 2RIPA 1H4VB 3O94A 4BQPA 4D02A 3BS4A 5AVWA 5ADWA 3U6BA 4UBKA 1L4MA 5EEGA 3F4BA 1UCFA 3M6WA 4FPXA 5LD2B 5C34B 3DFZA 2E87A 4K8RB 4INOA 1JMYA 2RGEA 5AM5A 3KTAA 3L1HA 1ZN2A 4DCCA 3OVMA 4WOKA 4QM7A 1T25A 4LDZA 3A1WA 3FOFC 2QD4A 1V5EA 2YOHA 4LZZA 1O54A 2PKCA 4M9XA 3UPTA 1SURA 3RRYA 8ATCA 1UMBA 1Z56C 1WHSB 2I8AA 2FN7A 3ROXA 4F96A 4WXMA 1FX0B 2L69A 3MT7A 3RB8A 2WAXA 1U0SY 1FTYA 1HE2A 3W8FA 1GG5A 4H59A 1I4EB 5BQFA 4GGOA 1NRJB 1PIWA 3V6MA 4BO7A 1B4DA 2B5OA 4R8KA 2J45A 4UW9A 2ZRBA 1SWWA 2IFTA 3Q2KA 5DMHA 2G17A 2IITA 3BRCA 1OXUA 3B8HA 1NBMD 4DR3B 3M8KA 1V48A 3AB8A 3P0IA 5AKHA 4TYYA 4OREX 2YZGA 1TLLA 1ZL2A 4KXUA 2ZVPX 4Z49A 3L5OA 5F77A 5LQDA 4M98A 4ZQBA 2P27A 4KFRA 2PEYA 2J3MA 1YHNA 4FE4A 3L1VA 1X1SA 1Z4QA 2EKDA 3QG5A 1Z0FA 5IDQA 1KDRA 3S2UA 3MG9A 1P1CA 3UHJA 3TGWA 5JOQA 5DNAA 1SOVA 3Q0IA 1OVGA 3LW8A 5TE9A 3TECE 1V8OA 2GRAA 3IIKA 3W2FA 5AK3A 4UCQA 4CE6A 2CXTA 1VL1A 1QG6A 3RUAA 3WL8A 2AFRA 3E2PA 3PC4A 4YWJA 2YWXA 1QVZA 1FSZA 1XAIA 4FI3C 5AW8A 3ZWPA 2O7SA 1HH4A 2QJRA 3T7TA 4MVJD 2FJUA 3HGQA 4AMVA 3MAJA 4YXWD 2BR5A 5F5XA 2ENUA 3CA8A 3EIFA 4EG4A 2J9FB 3F6SA 4M7OA 2R85A 1J09A 2NXNA 3HKBB 3ETDA 3NRCA 1UR5A 4X8LA 3HMKA 4M1EA 3UG7A 3ZQKA 5EHXA 1W1UA 1L4YA 2ECOA 4ZEVA 4CF3A 1JAXA 3QBEA 1K63A 1CETA 5IH7A 4YCDA 4X45A 5DN6A 4OEHA 2A7QA 2P2CA 1RXUA 4Q3BA 2AFVA 2CXRA 3U7JA 1YJXA 1MN6A 1Z2OX 4JR1A 1EXWA 1W44A 1XR3A 3BL5A 3FYHA 3KJZA 2RH4A 4GBJA 4NCIA 3DL7A 5TC4A 1RSZA 3KLMX 3DHYA 1I8TA 4R5MA 1Q92A 3QFRA 5EZYB 4DLTA 5JJ5A 2P2ZA 2EF0A 1N7GA 3V42A 3ZCQA 4C7JA 1JDSA 3M3HA 4UAGA 3BCHA 1Z5GA 3BPSA 1GPH1 1G21E 2QHXA 3MSXA 2H7XA 3UENA 2OBBA 2O8CB 5AJHA 3B85A 4D74A 5J58A 3KSRA 5IDVA 1G64A 3U0VA 3TX2A 3TTVA 1EVKA 1G63A 1R2QA 5GOTA 4EJSC 1HZZA 4JL8A 4OHPA 5ADHA 2YHIA 3PUVA 3P71T 3U13A 2C8LA 4II2A 1ZVMA 3V8MA 1JU3A 2CUTA 1ZA1A 2G6TA 2B98A 4YA6A 4G97A 1VI2A 3V3KA 3VPBA 2OG1A 2P5YA 4PYMA 2PDAA 3QVGB 4K03A 4XB1A 1SXJD 5CJJA 5C31A 4EHLA 1L8LA 3SOPA 4PZDA 1LWNA 4FOOA 4R9RA 4F9EA 2Z2XA 3PQCA 3BHJA 4TS4A 3GD5A 4F38A 1GCUA 1MEEA 3TOXA 1O6ZA 4DR1B 4U6SA 1UKBA 1AB5A 1ABFA 3S4YA 1OBCA 4PQFA 5EKXA 3U4GA 1TA9A 2GOYA 3LWNA 4P38A 3N8IA 4P4GA 4WVLA 3ED1A 3W06A 4EA7A 1D4AA 4L8GA 2AOWA 3HC7A 1XELA 4W1QA 2C8JA 1YRAA 2O7RA 1EP9A 1TYBE 2IEDA 5LXTB 1GKKA 1W34A 3A9VA 4QRDA 1VLVA 3E3MA 3K5HA 4I1UA 3BHNA 2IYZA 2OQIA 1YR8A 2WIBA 4TL7A 4DARA 4JKOA 1JB1A 4JDPA 2BGTA 3VYRB 3IAFA 2PT5A 2AI1A 4PRLA 4RJJA 1J00A 4Y9SA 3TRKA 4AUMA 5KOJA 3FGPA 2J07A 1Q12A 1NP3A 4QG3A 2QR5A 5K3OA 2OV1A 4KU4A 1OX4B 1BS1A 3I5MA 5JNSA 2H52A 1RM5A 3OY2A 3ZDDA 1E7SA 1U98A 1ECPA 2QGNA 4AJJA 4D3YA 1HFEL 3WY9A 5F5LA 3AJAA 1IY2A 1GRQA 3E7XA 3BSYA 5DTJA 1U90A 2PEZA 2VUUA 3HWRA 1TUEA 3NYIA 2ZTSA 5ALEA 4OJYA 1N2CB 3N8NA 3S28A 5TSDA 3ILHA 2H7CA 4MAFA 2XQKA 1FLVA 1PT6A 2FQXA 1IPFA 4G86A 4JLPA 3FI9A 4R54A 5ALYA 3B2NA 3D7NA 5IHXA 4UVEA 1ZPDA 4KUEA 3SQDA 3W34A 1XZMA 3K05A 2OBYA 4MGIR 1XTSA 2XXAB 5EP4A 4KUGA 5FHRA 3TM5A 1BXKA 3W78A 1NLUA 3WMRA 1KH3A 3FFTA 3WKAA 4MA5A 2C5BA 1JW9B 2VYVD 3ZDCA 2V97A 3E4DA 3OCJA 3GZNA 3FCSB 4MIKA 4QO8A 1L4UA 5FWYA 3EOZA 1T3ZA 3FKJA 1FXUA 3BTUA 1D9ZA 4B7UA 1SR8A 3IUBA 2F43B 4MV8A 5BV0A 3PV0A 1DFGA 4C21A 3W6UA 3A6GA 3OEEA 2CDCA 2XKKA 3HZHA 1E58A 1GU7A 1E1MA 4YV1A 4HN2A 2H0QA 3T4EA 2RGGA 5B3JA 5DNWA 4E5MA 2ZR0A 4DB4A 2Z3VA 1AD2A 2PX4A 3GQVA 3WHIA 4BBJA 3LAWA 3B1ZA 1E9CA 2WMOB 4ZN6A 4AXXA 3QELB 3VPAA 2HREA 3MMNA 4FFNA 3B1XA 1NQ5A 1F9EA 1KO4A 1UQTA 5TF4A 3TOSA 1XMQB 2QF7A 4HQRA 2Q3JA 3TVDA 4E3ZA 4QDJA 5J4YA 3P2IA 5BOSA 5KJCA 3R3UA 2QGZA 1UOPA 3HY4A 1ZGBA 4RX1A 1Y3IA 1DCTA 4UCXA 3UGKA 1S7CA 1WXWA 1MZVA 4ZVOA 1R9GA 4LXXA 1Y4DE 3GLUA 2VJQA 5CDFA 1OH8A 2PUTA 2H18A 2VYCA 3TAXA 1JDJA 5IYZA 1CKEA 1CUIA 2VH2A 3CH4B 5K01A 4PYRA 4RXUA 2DPYA 3KVVA 1RWNA 4WWHA 3NVKI 3T0FA 1U0OC 2EYUA 1T9HA 2ID8A 1EGVB 3JVUA 4LWQA 1VA5A 3H1GA 1U2TA 4O2LA 4F0JA 5EWLB 2O1SA 5EXSA 1NBWB 4RNCA 3VX4A 5CFNA 3H11B 3LLUA 4UDNA 3BDIA 2J87A 3PDCA 2ZWPA 1V7CA 5DHSA 3ZK8A 1N7IA 3QPBA 1E32A 4Q4HB 3TI7A 1KQFA 4AF6A 2ZI7A 5K03A 4F5EA 3WLNA 2B4KA 1XL0A 2DUUA 2JGMA 1FFHA 1OXMA 2OG2A 1B73A 1GZ7A 1KI8A 2BHNA 3LX4A 4I14A 4CW7A 4Y1EA 1YBMA 2QY6A 3NBXX 3NHSA 3DOUA 1D8TA 2QSJA 2O59A 3GPDG 3ORHA 3ZU3A 3H6KA 1FP6A 4MULA 4OQQA 4TWRA 1DDGA 4MW1A 3IIEA 1HLGA 1NSYA 5F1PA 3PUXA 3RVSA 3HS3A 2JHGA 4HNHA 4WOPA 4QHTA 3MBKA 1NQXA 2X0DA 4GPIB 5ALIA 5BQXA 4G1VA 4MGHA 3K9FC 2HJSA 2YDYA 4YP6A 4KP7A 3LFHA 4OU4A 4RGBA 2DUMA 3T35A 3TFWA 4X93A 4YI5A 4BN0A 5L4SA 1CRQA 1U3DA 1P39A 4CKWB 4HPJB 1X87A 5K4HA 1OQAA 3H8JA 3SS7X 5IWCA 3DEZA 1QC5B 4RF2A 4RTOA 1VMEA 2JFYA 2ZSUA 4GPBA 4UU8A 3ORQA 3ZQ6A 5IULC 3DGFC 1GL3A 3E0XA 3DTTA 4BO6A 3IIJA 3GOHA 3P4XA 3QUAA 4XD7D 5AHWA 1RYDA 1NXWA 3IP7A 2H1IA 2IQIA 4E5VA 1CIVA 1VE6A 4V3CA 4N5MA 1EEXB 1WCIA 4CHGA 3THYA 1YF3A 4UAVA 1KI7A 3ZZ1A 2BTQA 3IE0A 3DO8A 4DZZA 5ITZA 1HFJA 3LKBA 4JUBA 1Y5MA 1GQRA 2GWRA 3EXG2 2QV7A 4N3GA 5BW6B 3WB0A 2O8DB 3OA2A 3DV0A 3QE0A 4CQNA 2I0FA 1XZAA 4IZIA 3G7NA 1XZFA 4IIGA 5CDTA 3ZJ4A 2FQWA 2GEDA 2IEIA 1KRXA 2VZ0A 3DHEA 5K3SA 4NS4A 4E2ZA 2LDBA 2GFQA 1ZZGA 4DDHA 5JI2E 2COUA 5IKXA 4MR9A 1LU9A 1PJBA 3AF1A 3WB1A 3D43A 4GC9A 4AZVA 5AK5A 4D9MA 2XT6A 5EJIA 2AX3A 4HC4A 4JFRA 4XX0B 1NYLA 1U6JA 1F0NA 2O3JA 2DT8A 3H1AA 3HWWA 5IH3A 1MX5A 5DGHA 4KC0A 3GT7A 4XJVA 5EAIA 1AE1A 1P4JA 1A9PA 5KMGA 2XADA 3CEAA 2RHBA 3IMEA 3JZAA 4HMPA 1XVIA 4BNTA 7REQA 4CXMA 2W83A 1NFFA 5C1PA 3LDAA 3L8HA 1ENZA 2CWWA 4FLEA 3NGLA 1FC0A 3A6EA 2VBIA 4JWTA 4YRGA 2BM8A 5CFZA 3BJEA 3ZWKA 3QXXA 4G41A 1J5EB 1HL7A 5IT5A 2ZTMA 2LGJA 4FJ0A 2WJZB 2Q2OA 2ZWIA 4KQFA 3EIHA 4X41A 5SY4A 4FOTA 4HLUA 3BGWA 1MO6A 2W93A 1F3LA 4URHA 3C1OA 1CF2O 1C50A 5FKJA 1CRWG 4OOEA 3UT5B 3ZIDA 1FP4B 3GLIE 2QTNA 4FOLA 3WAJA 3K6SA 1RTTA 2QQFA 4LX0A 1JTVA 1CS0B 4U2FA 2Q4BA 3HKDA 4FYYA 4RMHA 1RYMA 3K4HA 3Q15C 1GZHB 3TUJC 1X80A 4YJ3F 4CMIA 4HKTA 5JFOA 2P91A 4YUXA 4QATA 1M2EA 1YU6A 4DZTA 2OHVA 3VV3A 5BWLA 5CBPA 3ZGNA 2Q3CA 3LP8A 1XI2A 1MG5A 3TG2A 4MPRA 1JECA 3MUFA 4OQEA 1BMDA 9GPBA 3EQ7A 4Y2XA 5JG7A 2Q8PA 1MO3A 1BMTA 4EO4A 1ZWLA 4A26A 2WZCA 4B6RA 1AHPA 2HDWA 3W4KA 2Z2KA 2I55A 3UOWA 2H07A 4HF7A 3VGPA 4BB6A 5A06A 1RE1A 5T6BA 5IM4F 1U0BB 3K9CA 2YYSA 5A6SA 2W0MA 3FE2A 1OTXA 2Y2UA 3MILA 4HZGA 3RFTA 1BFDA 2IHZA 3PYMA 2PJUA 2H31A 4PPFA 4ER0A 1LNZA 4KGXA 4LNUA 2DFPA 1J24A 4TKMA 2ZSIA 3MVEA 5HCUA 3V8RA 3I73A 4F45A 1GG2A 2UU9B 2REQB 2YVUA 3DE4X 3L9XA 3CNQS 4IH9A 4NOKA 4OQMA 3AVQA 2RI6A 4BMXA 2QX9A 2VUIB 5B1HA 2ZB2A 1T13A 1C0LA 1J1IA 1TM3E 2WHQA 4HH1A 3ZW7A 2BJVA 4JYMA 5FOUA 4EGFA 3ZDBA 4MWDA 2CT8A 1DCMA 4DDTA 4O4IF 3DOHA 1W2HA 4V0MA 2CFCA 3FUWA 2QMZA 3DXYA 4EDHA 3USES 2RE8A 2G0TA 2QW1A 2R00A 3NIGB 1NXQA 2FKNA 2WJ6A 2IVZA 1S9HA 2WV7A 1XKTA 4P3KA 3GH3A 4W1PA 5ER6A 3WHPA 1NG1A 1XU9A 4FR5A 2P6PA 3L4EA 5ICFA 4DA9A 1SBNE 5AI9A 5I9LA 2EQBA 3MT0A 1MJGA 3JQAA 2WSBA 3LNCA 5B2FA 1RWOA 2CNWA 4GF5A 2QTVB 1XKQA 2BFMA 1A2OA 3JYLA 1FFDA 1PR2A 2GILA 2J7PA 1NUHA 2PBFA 3DWGA 4G1BA 3G0GA 4YAKA 3NVAA 5CIQA 4ZZ1A 2AYXA 4YACA 3IJRA 3RPEA 4GVLA 1I3CA 4EUFA 5M34A 1KWGA 1P7YA 2LE0A 2V1XA 4H31A 3TEFA 2K7FA 1E2BA 4PXSA 2Q9UA 1GQFA 1U04A 2P2GA 2V4MA 3HH8A 4BNYA 4BMYA 4XEUA 1B41A 1KQNA 5DRTA 2QRJA 1OW3B 1SJ9A 1V9CA 2BHTA 1JXOA 2PSHA 4JXKA 5IUJC 4XAQA 3R0IA 2P9FA 1T43A 1VI6A 1ZMTA 3R1IA 4IWXA 4N9QA 1NUPA 3A31A 2QE7D 3GLKA 3ZX5A 5CG2A 3MMZA 3HVRA 1I7LA 1Z75A 3RBZA 4J0HA 2FG7C 1H93A 2H2DA 2H1VA 3GJXC 4L28A 5DN9A 5A71A 1D2HA 4XRRA 4HXGA 3E7WA 3V7NA 3RYHA 4BMZA 4F3YA 1BW9B 1P5HA 2P9TA 1WP4A 2ZATA 1MO5A 5AHRA 3GG9A 1XTIA 2OB1A 2PIAA 2R6HA 1E2FA 4LECA 2B4QA 4Z8YA 4ZQFA 5L4NA 1HC7A 4QTZA 5I9BA 3NW9A 4H0CA 4DZRA 2VQEB 2JLAA 1FBNA 3Q6MA 5CM2Z 1EM8A 1ZVVA 2I5PO 1T8RA 2GM9A 5BSEA 4S04A 4NK5A 1ODKA 3WLHA 4HDQB 4EKEA 2CMKA 5IN4A 3DEFA 3E7DA 1PS0A 3EVCA 4GQAA 2XNDD 3DR3A 4A6PA 1E5VA 4QECA 4URWR 3V1TC 3WLIA 5BRAA 5HKLA 3D5EA 4EA8A 5AOAA 5KYTA 2QXTA 2K2QB 1GZ3A 4BX0A 4LOLA 4QOEA 1KBZA 1AKRA 3WWDA 1NZJA 2CFSA 2YQZA 4N41A 4EW3A 2QD1A 3KSAC 2JFQA 4YECA 3R5KA 1QHNA 2ODTX 4CF6A 2YASA 1H1DA 5LOVB 4F4IA 2FZEA 5GONA 3RHFA 3HYRA 3O8QB 3LH5A 4OX9Y 1OILA 2JGAA 5L95A 3ASVA 3AM5A 3PQ8A 4ZOAA 1KFKB 1W5EA 4URZR 5HQ3A 3LGSA 1Q0TA 3G5UA 3G89A 2WIGA 2WF5A 2HX1A 3MSCA 4I4CA 3AOGA 1WULS 2AQKA 1NX6A 4R7GA 3FR8A 5DGCA 2CHUA 2V9ZA 5THQA 1WHTB 1PFGA 1T9GR 5JSZA 3MTBA 1P0QA 2PFGA 3VZQA 4EG1A 2GPNA 3GELA 4QFDA 4Q4AA 4EL0A 2XGSA 2IXTA 1HDXA 4H4CA 1OPXA 5EQJB 1YBAA 4TSKA 2VRCD 1QHSA 1XLVA 3INGA 4KW7A 1Y8AA 1SD2A 2Q3EA 2Q5FA 3MTJA 5HZHA 5FLYA 5T6MA 4ZYZA 3F5SA 1OPRA 4MMYB 4BFUA 3IHLA 4EGAA 5B3JC 3PTAA 4C4SA 2RKWA 4B35A 2I7XA 2CB0A 4BU1A 4J1SA 4XIGS 1M1XB 3LM8A 2DR3A 1XPJA 3MYRA 4Q1DA 4NU5A 1XEFA 3DL0A 4BGDA 5H8WA 2ZZNA 3KWMA 2P4HX 3WIEA 1AA9A 4QXMA 3HK2A 3AR2A 2H17A 2Z5FA 3JQ8A 4HNSA 4DMFA 5JCPA 3AHHA 3TLAA 4EUSA 4OMDA 2R86A 2YMQA 1LBTA 1RLOA 1DEKA 1UC5B 1LFDB 2WIDA 3DTNA 3G17A 3EZYA 3I2KA 3ILSA 4PAQA 2P7IA 1GEEA 2R6AA 4HEQA 1GYPA 5ICCA 3PSHA 1Y37A 5K4GA 2M6LA 4DDVA 3WISA 4RENA 3L9WA 3BFXA 5FTNA 2ZUUA 3KD3A 3NQ41 3WNZA 1C9JA 4ZK6A 1T9CA 2ZTLA 4C7BA 5A5EA 5EE9A 1SY7A 5K20A 2QUKA 4M7PA 3U3JA 3VZDA 3RH0A 3UJDA 4NULA 4U9HS 1ZHOA 1NN5A 2GTIA 1N1MA 1RAIA 2MYNA 1UXJA 3L0YA 4KFSA 2PH3A 3BXGA 2EX1A 4GNRA 4JK3A 4NL4H 4QQNA 4RQAA 1IHOA 5CNKA 3O1HB 3RYIA 3QXJA 5J2TA 5AVJA 2XVAA 4I0WB 1XTZA 5KWVA 4OHCA 4EVQA 1XXLA 5A0VA 2IUSA 4S1VA 1T4CB 1L1EA 1KY5A 3NRBA 1TUIA 3IULA 4IDGA 4QYIB 3SQMA 3SYTA 4DR4B 2IP1A 2AD1A 4RADA 4JXJA 4N8SA 5ERGB 5HMMA 4JIGA 1K27A 2F7SA 5LUAA 4UVHA 3BWDD 4OX9B 2JLCA 1B16A 2CJPA 3LU1A 1LLCA 4G36A 5JEEA 3NUQA 4MQFB 3SVZA 1TPZA 1BEUB 4RFLA 4HPXB 3U9TA 4R8SA 2C4WA 4TV8A 1XA0A 5C8YF 3L0CA 2XDYA 1TEZA 4PC6A 721PA 2OKGA 3HCAA 3PJFA 5HIMA 1UH5A 4U5XA 1MC8A 1Q19A 2XEDA 3VR3D 4LZOA 1HMPA 1YZVA 3GNSA 1RLTA 1A9QA 1UBFA 1WXXA 1JG3A 1ZNXA 3WKEA 1ZVKA 2R5WA 4FBMA 1RPAA 2D7DA 4R0MA 3KQNA 3H2GA 3NKFA 4X00A 3V2IA 4WACA 2C83A 4TKVA 2ECQA 3P0RA 3I64A 5AXAA 1O77A 1FUYB 2B2NA 2BISA 1XLUA 2CFOA 2GN9A 3NX4A 2FB9A 5DBFA 2Q4RA 5YASA 2CZGA 3AL2A 5D86A 4GMDA 1E1RD 1YDFA 2I71A 4G81A 4UHDA 3CONA 4JBGA 5FPHA 2YR0A 1R16A 2Y77A 2J3LA 3R0QA 1KK2A 1IEXA 1U2QA 2QVGA 3CBQA 3ETHA 4J1NA 4L8FA 2Y93A 3L41A 2O54A 2WJWA 4C0AC 2WMYA 3FWYA 1VE7A 4D4KA 2Y71A 2IXGA 5JATA 5AUOB 2OHIA 1FXWF 2WB2A 2NG1A 1CP2A 2R1VB 1L4NA 1VGVA 1SKYE 2AH5A 3GLSA 3IOMA 4TXLA 1BHQ1 3K09A 3ZE1B 2XB8A 1CLUA 2VR1A 1C7JA 3EFEA 4JELA 1KOFA 1QV7A 2VT2A 3WMWA 4BIMA 3TGPA 5DCLA 4WXPA 1K8QA 3AY7A 1XQXA 2PXCA 4MH0R 3C39A 1TU3A 3UHAA 4OK5A 1DOHA 1QIKA 3DDWA 3HXMA 3KYDA 4YCSA 1L3IA 4YASA 1NT4A 2D7JA 2FPWA 3LQRA 3L7AA 4QIHA 3IO5A 1YE3A 4REMA 2BWJA 2NPOA 1ESCA 4NQRA 1YR2A 2WI8A 3BTOA 3KTDA 4NCXA 2B7BA 4CL0A 2C9YA 4FFWA 4P53A 1DSSG 2ZCVA 1FFXA 3TSAA 1N2JA 2VJMB 3M6MD 4HQFA 1AZSC 2REBA 3X1KA 2FR0A 3EBLA 3OQVA 1U2GA 3JW8A 3OZTA 4CIXA 2O23A 1DAFA 5B4UA 1O0CA 5I7HA 3CZ9A 3VU0A 1ONPA 1X77A 4JJFA 3NBYC 3VNUA 2I8LA 4LXHA 1SVMA 1JLHA 3N0TA 3I8OA 4KRFA 4L5JA 3AIKA 4IFIA 3K1TA 5AVYA 1SA0A 3FJYA 4MQMA 1RM4A 4K87A 1VJ0A 4JLMA 1IUKA 3OZ7A 2CJWB 3ZY3A 1ZEJA 2VN8A 5ALPA 1YQDA 4B33A 2BHRA 1JEEA 3BWEA 3GNQA 2WFZA 1YB5A 1RKBA 3HEMA 3L8DA 4LXIA 1QMPA 4QGBA 2PNJA 3T7DA 1S2NA 3UBMA 1IBCA 3PT9A 4IVQA 2PN1A 1S2GA 1V0JA 4JKIA 1T2FA 3ZGOA 2J6IA 4LNAA 3SICE 2PZLA 3NV9A 4GOLD 4BNKA 2AD5A 4KGDA 2BGGA 3GLQA 3V7FA 5G40A 3KQMA 3B1WA 1B76A 1K75A 3IT0A 4PLYA 3AINA 1OWPA 1R0LA 3SC2A 4V1CA 5J4HA 2JZOA 3I76A 4YCAA 3C5WP 2GUWA 2CHFA 4IGFA 3SYKA 2GERA 1G8PA 4KXMA 2MINB 4F8JA 4RNDB 1RWKA 4TLMB 4EW2A 5C9ZA 1RXWA 1T9AA 2A88A 3OPXA 4Q9IA 4IF4A 2WKWA 3ICWA 5REQA 2PL5A 4BC1A 2B6HA 1M1UA 3ET5A 3NDJA 3WWZA 2TMYA 5FNVF 4GP6A 4EUNA 4CKZA 3W5HA 2A8YA 3DTVA 1MABA 3DEJA 3E3NA 1YFLA 1PEYA 5IJAA 2VEDA 2O0LA 3HLYA 1OYVA 3KR2A 2I4RA 5KJ6A 3CCCA 1C30A 5CVVA 4JJKA 4F5ZA 3MTIA 2PKXA 2DOKA 2JVJA 4X24A 3Q12A 3H19A 1CEEA 1Q1BA 2IP2A 4X7PA 5AJUA 2UYHA 2W00A 3OLVA 4OXXA 4CKEB 2GPAA 4YWHA 1L5OA 2DPHA 5J1TB 2HEIA 2NADA 3UW3A 2Z08A 1TL7C 2R00C 3BIJA 2CYCA 3HCRA 4B17A 2V98A 4HSGA 2IXFA 5EE5B 5F2KA 3H65A 1E1DA 2YYYA 3AG5A 4QUIA 421PA 5BMVF 2AYZA 3G3EA 4HLCA 1D2RA 3EZXA 1SZCA 4Y9RA 5E0KB 3SNHA 4CG3A 1TZKA 1HDCA 3R6WA 1H1LB 3WLAA 1P33A 4HO1X 1L9XA 3CG0A 2ZUDA 3FPKA 4LOHA 1MV8A 1RZVA 4G9BA 3G2QA 1BCRB 1FS4A 3KOUA 3N5KA 1IIRA 1M8FA 3B6KA 3C3WA 4JCCA 1D6SA 1GM5A 2ADFA 3HBJA 3LT1A 3KO8A 4GYWA 4M8SA 3FPAA 4RPLA 1W85A 5FBLB 1TK3A 3NXKA 4GSYA 2WHRA 3JALB 3SIRA 5IVPA 2DHDA 4OK6A 3CB4A 3UMYA 1LDNA 3IMCA 3ZWDA 1E3QA 1W9MA 3C3CA 5DP1A 1IG0A 3ZE8A 3D3JA 4O4HA 2Q7DA 4BOYA 4O4LB 3NDPA 4RTRA 1LCIA 5CB8A 2VEOA 3VTZA 4UHKA 2COKA 4E88A 2B4TO 4LJSA 3A1EA 4Y6OA 4IMJB 3M4XA 4F71A 4CKBB 4ZXPA 1K7CA 1H65A 3OF2A 1T3TA 2AJLI 2KMLA 3F5QA 4GIBA 1E4YA 1OXSC 2HADA 4G4IA 3M6LA 1TKBA 3Q72A 3QVWA 1AKNA 1I32A 1L5YA 3KXIA 4RFSA 2IEGA 2F3UA 5EXEA 5C18A 1ZONA 3LWZA 2YJGA 4WBXC 3K16A 1L4EA 3JWIA 1YCHA 5DOVA 3LTNC 3G2KA 1JVNA 3JD1A 3O8DA 1IPHA 2JA1A 3F3SA 1Y9ZA 5EHZA 5JAMA 1PZFA 4QBFA 4D9NA 3N9IA 1DJLA 3RTBA 4CEJA 4OSEA 3REQB 4MUMA 3Q5EA 2KWIA 5AH0A 3WBJA 1KP9A 2QXYA 1DS6A 3C5HA 3HLKA 1UFQA 1PL0A 4OI2A 4M1WA 4YAJA 2PUVA 3CMMA 4YJFA 1RMQA 4MVJA 3DEYX 3ABRB 4PX2A 2V74B 5HM6A 3OZUA 4J43A 4K6GA 5BR4A 4D5EA 1F2UB 3B82A 4IHJB 4IM7A 3LO8A 3AOEA 3ZGVA 3RLFA 5BWOA 4BYGA 5JZMA 5J4LA 1DEOA 3JARB 3MJDA 3NATA 3OQMA 2I3BA 2PKQO 2QRGA 5JZ9A 1XD8A 4Q03A 1E7QA 1P6XA 1IOVA 1DC3A 1AM4D 1ZD4A 2QJFA 3DMGA 3GJSA 4NABA 4MIOA 5K3FA 3VC2A 4EMSA 3RGWS 3EGVA 1A9XA 4IILA 1MC1A 2QD5A 3CSUA 3WGNA 3E58A 4ZAWA 2Y3IA 5EXPA 4QEKA 4HGYA 4CLXA 3IHWA 1MR3F 4DG8A 4IOKA 1W1IA 3H1TA 4WADA 3ZDZB 4I4LA 3E05A 1LSJA 1NUTA 4LA4A 4C0WA 1Q7RA 1DAOA 3R7SA 3WOVA 3H5IA 4M1QA 4AP6A 4HYEA 2QLBA 2UV8A 4TTPA 2OEPA 3OQHA 3VYVA 2GHTA 2I2WA 2JGIA 3AERA 5E2BA 2GR9A 1DJNA 1RHKA 1SRQA 2HMYB 3VNRA 2JW5A 4IOJA 2AC2A 3F6RA 4UU7A 5C1BA 4B83A 1G7SA 4A8TA 1P8AA 1JWBB 1PTKA 1D7OA 3RIXA 3MS4A 2YJNA 4LJ4A 4LMBA 2ZJ5A 1KJIA 3OWXA 4F11A 4FHCA 1BRTA 3UWKA 3JQBC 3EFOB 3VHQA 4Z1MD 1V6SA 3X1MA 1XXHE 1Z88A 3JQEA 1JLLB 3G5MA 4ZRMA 4ZD6A 4L9AA 3ZHQA 5JD4A 1NYTA 5DWDA 5EP3A 2QN6A 3KTFA 4CFYA 4D26A 2Y1OA 3MGCA 5EJEA 1RP1A 1Z22A 4J6EA 4JUDX 3ZDQA 2UUPA 2LNDA 4Q1EA 5T4FA 4EA6A 4HS9A 1TGYA 2YWJA 4QPDA 4ZHQA 4GOJA 5JBQA 1F48A 2GTHA 4F6CA 5A5VA 4ZCMA 3DOCA 1ATZA 2F3QA 4FUQA 4ZT2A 5HE8A 1GQQA 1MNQA 2P4EA 4HUTA 5JROA 5IAEA 3MRVA 5TQJA 2NO5A 2PRJA 3ZXUB 3GPIA 3NO4A 4OAQA 4XUGB 4CTJA 4C1NA 1P7WA 3GRUA 5DBIA 2PU7A 3P4YA 3H5WA 3W8EA 4CWAA 1MCZA 2QU8A 2OPHA 3OIYA 1HKHA 1WB9A 2AW5A 1ORTA 2W8BB 3IQHX 1R1DA 3LL7A 3EMDA 4WX2B 4Z86A 2JGRA 1B2LA 1F0PA 3MJRA 3EZ7A 4M0DA 5FBQB 3SK0A 1L5FA 1OXXK 4C87A 1I2DA 2GBIA 3R0XA 4KQJA 1QPBA 4DBVO 1KJ9A 4II3A 2AQ8A 3LBFA 5CH5A 3ZY2A 1D9XA 1DX9A 2C9CA 4PCLA 3ICCA 4RCZA 5HIKA 1T3LA 1XWIA 3C4QA 3EARA 4FZ5A 4GRAA 2J3DA 3L8CA 1UJBA 4BQOA 3BIFA 2R8ZA 4AN0A 2QZZA 2XUIA 2J0QA 3H5NA 1OJ7A 3RRXA 3STVA 4K9OA 3E9EA 1KC3A 3GC6A 1AVTA 2GN8A 2I4NA 1IK4A 3AYZB 4A0QA 3SQWA 5JDCC 1CY7A 4LI3X 5B1SA 3SS9X 3V6LA 3N0VA 1WVGA 3REFA 3TE6A 3ITKA 4WUTA 2QTZA 2YZNA 4ALIA 1VLZA 1ULBA 4RZSA 4WA7A 1VC2A 5KEIA 2PZEA 3UJPA 3H0CA 1AB6A 3ZXSA 3HFSA 3TE7A 3I0ZA 3KT8A 3ZGLA 3D02A 3NVDA 2YVAA 3PNSA 5J5CA 3HBNA 5TQVA 1KEEB 1VMDA 3KZKA 1QGZA 4LXQA 3OX2A 4UDYX 1T34A 5E7MA 4IIDA 3N39C 4NZOA 3X1XA 1RACA 2K87A 2CNKA 2H2AA 4N39A 3GUVA 4UVDA 3WGKA 1WEKA 3LRXA 1E0DA 2AZMA 3NNNA 1B00A 3SHVA 2EL7A 3E5MA 1IWPB 2A0FA 2HI0A 4QYXA 1NVEA 3ER9A 1TKRA 4R7ZA 3BE5A 3TCNA 2QX4A 4EG7A 5FOQA 2GM5A 1QCYA 1TTTA 5CLGA 3K09C 1UQUA 4XB6B 5BVHB 3I09A 2ZFUA 2VAXA 4DCNA 3IUNA 3L6OO 1KYWA 4I9NA 1GUZA 3O3NB 1G2QA 1WRBA 2HT6A 4LIPD 4D9KA 1E5TA 3RQSA 5EHQA 4ZU1X 4NC9A 4EELA 1XEWX 5EUBA 4AAYA 1A98A 2FPMA 3C6MA 3KELA 3KX2A 2QP9X 2VA8A 1NUQA 4LOAA 4ARBA 1P4AA 4CPDA 5A0FA 3O83A 3AWIA 1ECBA 2OHJA 1LI4A 2YC2C 3QXGA 5EINA 1NLFA 4O1HA 1DU4A 3CMCO 1RFLA 4MUHA 5E1DA 3E9CA 2PKRA 3W9UA 3Q7IA 2OKCA 2VBFA 4OIFA 2GN2A 4YP0A 1OA1A 2AT1A 3A1UA 2XUOA 4ZFNA 4L0MA 3DBLB 5M2QA 2QTFA 1IBRA 4BVAA 2PKQP 3F4KA 4RPGA 3BZUA 2HQOA 3USCS 1H94A 4AY4A 4K1XA 1HNWB 3OT1A 1JIKA 1G4HA 3TIIA 3PEUA 4OLHA 1YMUA 4HQ6A 1OB5A 3OCVA 2FV8A 3KPWA 5FBZA 1KF0A 1R8SA 3K0AB 5IW8A 4HNUA 1C9KA 1GFSA 1VBMA 2IS4A 3JQCA 2HU7A 2D2IA 1GFWA 3ZHRA 2XSZA 4H77A 3AEUB 4LRSB 1JKXA 1FNBA 1ITZA 3ZHCA 2NUTB 1QF7A 3HB7A 4XVUA 2JLQA 2V9PA 3EXIA 3NCHA 1O95D 3G23A 1M34A 3WLFA 3W7AA 3UWDA 1EDEA 2ZI6A 1W9HA 2P9BA 1KSGA 3O93A 1C3OB 2ZIGA 5A4JA 3J7TA 4FONA 3OSUA 4ESEA 2JJ2D 1M8KA 5KYXB 2B7LA 3OEWA 5K8TA 2ZJ1A 4B7XA 3VNSA 1XFDA 5KNDA 1T36A 2ET6A 5LMUB 1RQRA 3QBTA 4DUZB 1XTQA 1LDGA 3AU8A 3BH6A 3GV0A 4XD7A 2FAXA 4JU9A 3WV5A 4XXHA 1K66A 1VHJA 2QM3A 2ZIUB 2HPZA 3KT0A 2QAGB 1JIXA 1YGPA 4RF3A 4YALA 4JLNA 1T9KA 3ZWXA 4JBHA 4BAZA 4ZWNA 5KSYA 1GGMA 1Z16A 2CL7X 3AUXA 3QH4A 4LFCB 1XJWA 1U2ZA 4Y6GB 1S9DA 3ZY5A 2RAFA 5FT9A 3OFVA 2XLCA 5HIJA 2J48A 3T7IA 2W6NA 2P0YA 3BMNB 4CFSA 5JS1A 4TMVA 4DDMA 3OPVA 2WYWA 1CJTC 2I03A 1BGVA 2BMDA 2OCXA 2YWRA 4JSTA 3ZCUA 4CM1A 4GLLA 4FP9A 4NOJA 3WGIA 1G2OA 4H4EA 3Q2OA 5BO5A 1YI8A 5F2EA 1RS0A 2XE7A 3KOWA 4PYOA 1RYZA 3UMVA 3RG8A 3SXPA 1U9IA 1J1ZA 5BY2A 3C6YA 1S5PA 2EX4A 3H3FA 1UEIA 2Q07A 5SYMA 4BFYA 3K0FA 4G0YA 2FW9A 4EHFA 2DWUA 2XCSB 3SHOA 3ZZTA 4HWTA 4OHYA 3DDZX 1VB3A 3BXPA 5LQKA 1Y7LA 2W2LA 3KCQA 5IABA 3M9LA 2BGRA 4N1AA 1K7FB 2FP4A 1X7XB 3MWFA 1JYFA 1UDAA 2VDJA 3KZNA 4UMEA 3D0QA 4FFLA 2CNNA 2EU8A 2XKAA 2MWMA 1ZQ1A 3AP1A 3S44A 4A36A 1AUOA 1CDDA 1K08A 4L5CA 2IVFA 3RC2A 3RSZA 3RRNA 3OTGA 3IOBA 4BO2A 5AKEA 1DKOA 2VDMB 4CMEC 4WNAB 4WFIA 3VYSB 3HA3A 1LDBA 4MKZA 1KWKA 5FFNA 2YTZA 1FDSA 3GUHA 1TVCA 3JQ6A 4KV9A 2M32A 2GF2A 2GRJA 5AKXA 6CHYA 5JR3A 1EFKA 4GZ5A 1VPWA 3MJFA 4RY0A 2PV7A 3DWEX 2HW8A 2QTRA 3N7AA 4I5EA 1K3UB 3H2HA 3UJ7A 1WDWB 1J8QA 1TAGA 2K7ZA 4NE7A 1Z4KA 1XNJA 4WLFA 4KQ1A 2OFFA 1SGWA 2GCNA 2VHJA 3TSZA 4WH0A 1NNLA 5JLAA 2XHZA 3LC2O 3HADA 1RAEA 4GI1A 1XG5A 4C7XA 3TRFA 3WRYA 4DGSA 4Z3OA 1F8FA 4A6XA 2J3QA 5CITA 2V5VA 2JD2A 3OWOA 3ADDA 3LS2A 1HRKA 3EH1A 1W96A 3VDQA 4BFCA 4I50B 3RS8A 3DFIA 4QPCA 3GFOA 1U3GA 4B6QA 1WXDA 2CJFA 1RAGA 2FW6A 4ZV7A 4BRUA 2C1XA 4I9HA 3HCFA 1SQ6A 2QN2A 3D8BA 1SUFA 3H9CA 3WGTA 1UKVY 1QE5A 3KKMA 4ASUD 4YRNA 4LHXA 2AN1A 2GD0A 3SM3A 2J46A 3DVQX 1ZJJA 3ESCA 4QSHA 4HBZA 4ZQGA 3WQQA 1KJWA 4HTFB 4DQ0A 4Y2UA 4N18A 4O5AA 1YZLA 1KC1A 4D9FA 1ZOLA 2J9FA 1LQ2A 3AOEC 1IJFA 4B3FX 4WGFA 3LQQA 3ENKA 3QFSA 4HL6A 4KIJA 4YREA 5T8KA 4M8LA 8GPBA 2JVKA 4EEXA 5B55A 2WHXA 5GZ1A 3UO8B 3BFJA 3DF9A 4N0EA 3MQFA 4HAVA 3A4IA 3OLCX 4FW9A 2X41A 3HP7A 5C53B 4W5TA 3FGNA 1XZEA 2DVMA 2FXVA 3D6HA 3KJIA 4V38A 4XDZA 4F3NA 3E9ZA 3QTTA 2PX3A 4AKHA 5MGBA 1U7PA 4YAIA 1PJ4A 4N6OA 4EMUA 1Y6QA 2QN8A 2Q2VA 4IMIB 1JEQA 3K8OE 4C04A 4DRZA 4S05A 4B7CA 4XRGA 5KWJA 2G06A 2WTUA 2BZSA 3HO8A 1B2RA 3E9YA 3R5FA 5BW4A 1QHGA 3GROA 4UDOA 2RHTA 3VSEA 1VMAA 1X3SA 2A33A 5TJHA 4OKSA 4F7WA 1W581 1WVMA 1TQ2A 2ODNA 1DXQA 2HD4A 2Z98A 3B20A 4FSDA 5JLJA 4K0RA 1NJ8A 2H1CA 3AKEA 3OE1A 3PFFA 1JG2A 1B0ZA 3BJMA 4BVFA 1HE1C 3PL5A 4N5DA 3H75A 1O9HA 4F4DA 1PFQA 3CWQA 3QYAA 1ZDMA 4FDVA 4BCDA 5JYDA 2J9ZB 1R4MB 2M6RA 4OFBA 3HN2A 2VUHB 1OTHA 4AZ3B 4CVNA 3WWCA 3PDWA 5DYIA 2MSDB 1R6XA 1H1TA 3HDQA 5JBNA 1NJSA 3T4UA 1FU4A 4KN8A 1XHLA 4G5SA 4BKMA 3BAZA 1MNAA 1ODTC 5D5HA 1FB5A 1BWQA 3EXEB 2ZRNA 4KHZA 1OV6A 4DM3A 1K2WA 2NUPB 1QP4A 2FF7A 2Y0DA 3RU7A 1OD6A 5K0LA 4BJ3A 1XROA 1ECJA 2BUAA 1DT5A 1BD3A 5IUKC 3SR4A 1HDGO 2YJ6A 2AOTB 1DG3A 5TVKA 3F5FA 3I6IA 3ZV3A 1A9ZA 2CBGA 3K73O 2FR8A 2BC9A 1PLJA 2HSDA 1F4LA 2ZR8A 5IKMA 1A9RA 5LXTA 2BRUC 2I1VB 1Z0SA 4LYGA 4WN9B 4CCYA 1G3RA 2VJKA 4AWAA 4ECAA 2HGSA 5E6SB 3IH5A 4BCCA 1RXIA 5JSYA 1JR4A 1EFLA 1RLJA 2XNDA 3JSXA 3KJFA 3FNQA 4IL5A 1K89A 1R5BA 1HY3A 2HLDD 4KFUA 5LYJB 1SOUA 2XPCA 4QQRA 3DCIA 3HCPA 1DT3A 4IJQA 3TI9A 1EHIA 3X0DA 1RXSA 4B4DA 2J0UB 3OPYI 4PPGA 3EGWA 1QYVA 2X6QA 2GCEA 1QP7A 1EWQA 1JHDA 3C2QA 1Z3IX 2A9KA 1H2XA 3FVQA 3Q3HA 3OOYA 4GX2A 3C87A 2IHBA 4EI9A 1V5IA 2QZ9A 4GP9A 2CLOB 3N1UA 2LBPA 5CNJA 1WY5A 3LY5A 3QSGA 4AMGA 4QUBA 3R5TA 3ETJA 2NU7B 4L6AA 2B78A 3DFKA 2PUDA 2H1OA 3VC3A 4N12A 5F7JA 4X1IA 4UNQA 3UW1A 4HZUB 3EASA 2OO7A 1E3DA 2XXAA 4DCJA 1DEXA 2ECPA 1TK9A 5FQOA 3N2EA 1BVYF 1LLDA 3E03A 3IUJA 4QXAA 5K1ZA 4IGIA 2XUAA 1E3SA 4ITRC 2VSQA 2ERCA 1Q15A 1H22A 1YCFA 3MJHA 5AVOA 3WP1B 4J0KA 3ZK7A 4CTNA 4KKVA 4KXFB 3OU7A 1WWKA 5CRIA 4D5GA 2PZFA 1ZIOA 3NTLA 4HRVA 2IH5A 2V96A 1CEQA 1GGHA 5DYNA 1BVRA 2FDXA 2QR2A 4UOQA 1D09A 2QZPA 2W6ID 3RK1A 4LF4B 4FK8A 4MCJA 4FZ3A 4TT8A 3IXLA 1EBBA 5DSXA 3UMRA 3AM1A 4L0DA 4GVXA 4B3SB 4RDXA 3BRQA 4NF2A 1JHZA 3QVTA 4BE9A 1CP3A 1NJGA 5IRCD 2V8OA 4NYMQ 1LZLA 3CRRA 4F97A 5KC8A 2B36A 4CF4A 3B3FA 5KOIA 2AHRA 3T94A 3BL8A 1X1QA 3GLHB 5AICA 1XZHA 4CYMA 2AYYA 1Y6GA 3EXG1 4GW3A 4AWXA 1X8JA 4M99A 4WZAB 1SG0A 2ZKIA 3H1FA 3M3PA 2JFZA 3NBUA 3TLGB 3ZXXA 1T24A 5EUMA 1QP8A 2QDKA 3O47A 4W9NA 1E6LA 3UN1A 3A1FA 1WF6A 2O3RA 2VRNA 1RJFA 4NHEA 1VSBA 5CVUA 3UCEA 3V34A 5DVZA 2XB2A 1M74A 1PW7A 4ER6A 2P6UA 1QIDA 2I2BA 4CQMB 3R44A 3PLAE 3K6JA 2GXAA 4BE4A 2VTVA 2YRFA 3MGGA 4ON9A 1P45A 3WJAA 5J43A 4IGKA 3B6ZA 2GI4A 4IIUA 3WIUA 1L7EA 3NTQA 1I9GA 4B85A 2HHLA 5B6PA 3JQ7A 4Y67A 2ORIA 2C99A 3IB3A 4FX2A 4U6QA 1KQOA 3TLCA 1BQ4A 1M2VB 4S12A 1VFNA 3A4MA 1N34B 3IJPA 4CL3A 2SKDA 4IO1A 4MO2A 4LWPA 1NQTA 3AVVA 3R9KA 4DG5A 4Q4HA 5DEIA 4CEHB 1ZRHA 1F14A 5KTKA 5ARCA 3UKDA 2IOYA 5ALTA 3RBVA 1ZN7A 2IDMA 3CZMA 4O2BB 3T7RA 1YC2A 1ADBA 2E4YA 1O97C 1HA3A 2AUMA 2G1AA 1Z06A 2HBRA 3DGEC 2A78A 2FQ1A 4NBVA 4YRIA 1YR3A 1XDBA 1ZH2A 3FDXA 4H7DA 5EIBC 3WGHA 4TYMA 4KBYA 3BMOA 1U9JA 2DQZA 1I30A 5H5JA 3CF2A 4HQOA 4BNJA 1J0AA 2IY9A 3QWBA 4G0NA 4ZVVA 2BYTA 2PGAA 4NOMA 4EDFA 1SBQA 1XPUA 4P0TA 2J5XA 1SUSA 2WAOA 2X7HA 1YXMA 1E2PA 3EMVA 4OP1A 2ZJ7A 5I8ZA 1ZIDA 2MSNA 2NO1A 3HSYA 4X71A 3THSA 3PICA 4OGWA 4ZC1A 3KVOA 4HBGA 3P20A 5B3AA 5TEVA 5B4TA 3NDRA 3PHBE 4ENVA 1COWA 1LC0A 2HF8A 3E9MA 1CLEA 1F51E 1QC5A 1QFSA 1TJNA 2ODWA 3E35A 4E51A 1W29A 4TYQA 1RADA 2H6EA 2H85A 2XWBF 2BI4A 2HJGA 1XMXA 1WZ2A 1KBOA 1SBYA 4ANFA 1JAZA 5DI9A 4Z4FA 3N0WA 5KX5A 4H0NA 2FHPA 3WGYA 3MK31 1E1RA 3VDRA 1U11A 1N2BA 1BFKA 3MUOA 2FJPA 5A5DA 4H1WA 3R7BA 4OLAA 4TMYA 4UZSA 3IRVA 1P80A 1T3HA 5H3LA 1KIFA 2XCQA 3QHPA 2X0FA 3TQSA 8AT1A 3QMPA 3NC1C 4PCUA 3TN7A 3U44A 2ZROA 5F3WB 3T3OA 3TKLA 1HQKA 3NI2A 4IDPA 2H65A 2PH1A 2P7HA 3C8ZA 3LPMA 4XR4A 1EFVB 4KAXA 1WLSA 3RT9A 3VGJA 4C7MA 4ZOLA 4R3WA 1UPCA 1E1YA 2Z6QA 4OI1A 2PUJA 1CUYA 3PJEA 4NCHA 3RTAA 4AJ9A 4J4TA 1U9IC 4AL4A 3JS5A 3OLQA 3I0NA 1Z0ZA 1ADJA 3PQEA 3FMFA 4IRMA 4Z5XA 1FRFS 1ISIA 1GNRA 1IEWA 1ZW6A 3JD0A 2ALJA 3Q9UA 4R51A 4XEHA 1P0FA 3MERA 4DNPA 1XU7A 5FQNA 1AKMA 1PZMA 4FBGA 1WPGA 3RKSA 3NP9A 1VPVA 2IPMA 3B89A 3CRNA 4FT2A 1E2DA 3VNQA 3W2HA 5BVGB 4EBFA 4F5DA 5K6AC 2QW8A 4Q93A 4QUDA 4UBOA 1Z0JA 3LUKA 1XDSA 2GEKA 2IIQA 3DG9A 1U28A 3EIXA 4MKRA 5HTKA 3BSFA 1W93A 1T2VA 4NU0A 4OFXA 3UQZA 1HRDA 1CVIA 1AZWA 2VP4A 2BGIA 2PKWA 3I5UA 2OO3A 1ECGA 4OD0A 3WL5A 1NI4B 1CZLA 2DCMA 3AF3A 3WRXA 5ES4B 1I33A 5E8JA 2VH5R 4OMUA 3T1NA 4A1OA 4L5IA 4US0R 5GPBA 4MUIA 4F8YA 1SXIA 4RA6B 1X70A 2BT4A 3GP3A 1EZ4A 3OCWA 2CL5A 3LUFA 1Z7WA 3HB5X 4MW9A 3V1NA 1YK1A 1Z8NA 1J0EA 2Q46A 3CUKA 5G0TA 1J2JA 4L8WB 5E1MA 3KUDA 3ANXA 1YQGA 1OU0A 1DFIA 3H17A 4KB5A 5HGJA 4Q0MA 3TCXB 4J0QA 1LSOA 2ZRMA 5LDGA 2QRUA 1J8VA 1U5BB 1NLMA 5BNWA 1TQ4A 3V48A 4JFAA 4LWOA 4F04A 4A8JB 2BE9A 2ST1A 1JT9A 3IVAA 4LXTA 2BM0A 5B3LA 2AS0A 4BO0A 3JR7A 2IHVA 2I6XA 4E6EA 1ENOA 1L7RA 2IH2A 4IIXA 2RHDA 1YMVA 2FEXA 2FVYA 4I1SA 1B74A 3FUUA 1L6RA 3OOWA 3CUVA 2P1RA 5ALSA 2XECA 2D7CA 3UANA 1C1HA 1C1YA 1FDRA 1VOTA 2HA3A 3A1VA 2P79A 3ML1A 4RV5A 3C43A 4OLJA 1OH6A 3DW1X 1CNFA 3HZRA 4QWMA 2ISQA 5F7ZA 3K9WA 5CVTA 4R2XA 3VM6A 1TJ3A 4AROA 1VRWA 1QUEA 2FG5A 2VJDA 3N59A 3SHWA 1T5TA 3ZU4A 3PFHA 1AUXA 5DASA 2REQA 4FQ5A 2PX0A 4JEIA 2O1EA 4KJXA 5B36A 5JASA 3AB3A 4URUR 5DGDA 2DECA 4CT4B 4O4JB 2VT7A 5CDGA 1E66A 2ID7A 5AKKA 1JDUA 1QQ6A 3EGDB 3O2QB 2KBFA 4RMNA 4DN6A 4RTKA 5EJ5A 5CH8A 1E5QA 3LECA 1KARA 4QRHA 3WV4A 1PU2A 1GPDG 1VKOA 2BZ1A 5KJEA 3TRJA 3E4CA 4R1NA 2YV5A 4QNNA 1RXCA 4UARA 3M9WA 2OD2A 1FW6A 4TGLA 2CMDA 3REOA 2FMUA 3DJYA 4ZI3A 3FMPB 3EWAA 4JA2A 4J3JA 5HE9A 4EG5A 2H2WA 5LDHA 1LW6E 3EGXB 3KOOA 3FY4A 4RCYA 3S40A 1XU4A 2WD9A 3Q9SA 3JQQA 2FEAA 4L5YA 3CF0A 3GDHA 5CTAA 1QO9A 4XFDA 4NYIQ 1RBMA 1FYXA 1Z47A 5TQ0B 4KXVA 4M37A 2F8MA 3CO0S 3P1JA 4GEGA 4RESA 1JBQA 4H17A 4C5AA 3RS3A 4DT1B 3N05A 2AFIB 2NTVA 2UXDB 4Q9DA 3EDRA 1MJFA 1GNQA 3SBOA 3UFXA 2CCKA 1Q7BA 3V8PA 1I6WA 3GGDA 4JJEA 2O2JA 1DG9A 2RGNC 4L4XA 5LZ9A 3ZU5A 3Q3IA 2OCPA 4WT7A 2PKEA 3V1KA 1I5RA 1ZHHA 2CFRA 5CX1A 3D4BA 3S29A 4CGYA 4DW8A 3CVWA 3HJUA 1ZVQA 3PHIA 4DKJA 2AZXA 3PIDA 4XASA 4A16A 4YO8A 2NP7A 1KGSA 3HYNA 4EVRA 1CUBA 1NMQA 3U81A 1JQKA 5EIAA 4I4TF 4LYJA 4MQ5A 4DLPA 2OL4A 4TT3D 1W4BA 1WV1A 2OAGA 1QZZA 3I8SA 4Y9TA 2FR8C 5IARA 2ISSD 5SYNA 5JTTA 3E3OA 1JAYA 3UT0A 1P29A 1JFFA 3FOBA 2ZRKA 5FHQA 1WX1A 1J8DA 2ZYDA 2LDXA 2VPPA 3EZ9A 1UDBA 5KYGA 1N6IA 5IYZF 5F51A 3B70A 3DVAB 4I2NA 4FWIB 3DAOA 4BUJA 2W2XA 3C3BA 1OLUA 4DQXA 5DLEA 4TQUS 3NH9A 1GRRA 5GM1A 5HUJA 1O7JA 2GDZA 2UAGA 1A5TA 1K7EB 1QKKA 4YP7A 4ZO4A 1SQFA 3PI6A 4UEJA 3AVYA 3TW8B 3CGWA 2FEKA 1UJMA 4AJIA 5K2OA 3A6LA 3IIIA 4M87A 2RGYA 1IBMB 3WL7A 3FSGD 1I6LA 3FYSA 1H5NA 1FQWA 3PFNA 1Z12A 3T1HB 3CKMA 5F9FA 3D5TA 4INPA 4BQEA 1H4QA 4ZEOA 3RJMA 4ZGWA 1DVRA 4PS1A 4U2GA 2NYUA 1JHAA 2ZRQA 3NP7A 4HG2A 3TFQA 4BB5A 4EW6A 3GAZA 4Y6SA 1TNDA 2GZAA 1CX9B 2ZSEA 1UPBA 4Y0AA 1E7MA 1QORA 3FSEA 2YHBA 5AQ1A 1Z2DA 3HKEA 5JFGA 3I3OA 4D82A 1XQVA 2JK1A 3NOVA 3QIVA 4LC1A 4HT3B 4QGSA 1TQ6A 3LCVB 1V7QA 4NMXB 1VCIA 1XLTC 2XZDA 5BYBA 3U7RA 3L4KA 3LOUA 3U7GA 1O6FA 1Q3HA 3OPYB 1P9RA 4RWEA 1QM5A 2JANA 4M9RA 3QWFA 2E6KA 1OASA 3N58A 5I6DA 1UPXA 1K9VF 2AB0A 3FTDA 4YDHB 4IFEA 1BHO1 3STWA 1UXKA 2Q5EA 1I3MA 1ORWA 1KFCB 1O5OA 2ZJ2A 2DBVO 4MR8B 4TTTS 3OTWA 2C0QA 5CJPA 5LP6B 2WG2A 3AR5A 4ALKA 1MB2A 2E55A 4RTSA 1HURA 5JDIC 1JALA 5ECWA 1UM8A 2PJDA 3H9QA 1EFHA 5J1SB 4JI2B 5CG1A 1PJLA 3HVKA 3N8DA 4ZC8A 5AKIA 4Z1MA 3QEKA 4CL8A 4F4UA 3PX7A 5F64A 3T3EA 3WLLA 4LXUA 4BJ5A 1GVNB 1VL5A 3G8AA 3R3ZA 5I5GA 4H15A 1JLMA 4IW3B 3ENVA 1JDPA 1FDTA 4TLAA 3LX6A 2OGWA 1VG1A 4KK3A 5JO9A 4DLWA 3TG8A 1JNXX 1I5EA 1OREA 4DGQA 3RANA 4CQMD 1QR6A 3C8UA 3JQGB 2AOUB 4OHXA 2QRHA 2XCOA 4ZQHA 4A4DA 4IUYA 4QEZA 1GZSA 1QE3A 5FBWB 2BGWA 1R3UA 1KTIA 4M6WB 4QUAA 4JJAA 3WBKA 1W75A 4D9JA 5FLXA 3TPCA 2CEKA 3O4VA 1YFZA 3ETNA 4BC0A 3TTWA 1QO0D 3WK5A 3QF4A 5I5EA 4QYIA 4QX6A 2UYOA 4C0BA 2CXXA 2BUBA 2CFIA 4EAAA 4V0OA 5EWJA 2XOKD 3FFWA 4KGVA 1G7CA 3H84A 2ZGVA 4Q3NA 2UUCB 1G20E 1QX4A 5E7JA 1NJFA 1FRZA 1RKUA 3NHBA 3D6FA 1JJVA 3CLSC 5FLKA 4EH1A 1D2EA 2QN3A 2VK2A 4PQRA 4CZ2A 2L18A 4UBLA 3W7VA 5CYOA 4QXOA 4YVFA 1OX6A 1TGVA 4ATNA 3QA9A 4PHFA 5CNIA 1PR6A 3GRPA 4BDSA 4PONA 5DWQA 2X5KO 1QMGA 2GVNA 5F12A 3CJQA 3FZQA 1VJGA 1YDWA 2VDWB 3F6BX 2NACA 2PU5A 2IK8A 3Q7PA 5FL7D 4EP1A 3JYOA 1SAYA 1YL7A 1YZYA 3R3VA 4GH5A 1V2GA 1KOGA 2X3UA 3IQDB 1LVUA 3SBXA 1US8B 2DGDA 1NN0A 1QS0B 4HLQB 1EXDA 1XRPA 1PJ8A 2H4XA 3DC2A 2Q6VA 3OZVA 3VZBA 1XCGB 4ABYA 2LCQA 3N2KB 4V39A 1Y6FA 1LQTA 1B43A 1IHUA 2ZITA 3UHOA 4MDHA 4JAVC 1OH5A 4LYYA 1NBHA 2I4IA 4HGRA 1DKMA 4HLDA 3W1VA 1DXYA 3GHHA 1QH9A 5JXWA 1O3YA 4RY9A 1EAMA 1QHHB 2PTGA 1XVTA 1YULA 4FNAA 3CNHA 5I9SA 5IJ9A 3OX4A 2FN9A 5CEEA 4NE9A 2FPIA 1T0BA 4UUBA 1S8OA 2HIMA 2FWBA 1ECFA 5KTMA 1QHEA 3B60A 5A3SA 5F76A 2WNIA 2VF7A 1OB2A 1QSGA 2NO4A 4J91A 4W4TA 3ZJUA 1WMAA 5C7OO 1N3LA 1E1KA 3FRIA 1YCGA 3KQOA 4ZOEA 1SCJA 1T6XA 4HN4B 1QVVA 4BO9A 4D46A 5HX7A 3Q7QA 1V71A 1BXRB 3ZD9A 4JYCA 4F2GA 4P4SB 5JQGA 2FWIA 4G5OA 4ZAZA 2B82A 3CZ5A 2P8SA 2GLTA 3DMDA 4UTPA 4DJAA 1EVLA 1G8GA 1TIKA 3UJCA 3FRHA 3DJFA 2XZLA 1ZY2A 2H2GA 3ELWA 4OF4A 5HKKD 1EB8A 1GUAA 5KVSA 2YQ5A 3NTVA 1QB7A 1TM5E 4Q48A 2BSQA 3ZU6A 4DIMA 4R9SA 4PQEA 1A7JA 2D0IA 1WPRA 4OA8A 5KYKA 3ZGYA 2RG1A 4X97A 4ACAA 2I7DA 1FPMA 1VCMA 1KSFX 2I78A 3G8CA 1PNRA 2VJMA 1JDBB 1NJ2A 3PS9A 3EGIA 5BV2P 1KZGB 1PHPA 1OFUX 3D31A 4JLKA 3HUTA 4I55F 2H3HA 3E22B 3OESA 1CJVC 3RFCA 4AG6A 1YIAA 4TMWA 5I3CA 5AM2A 1TB4A 1YNSA 5LA6A 1RYFA 3BXXA 3G49A 3IV9A 1NV8A 3OTHA 5L6LB 1ORHA 1X0XA 2XVYA 4M0EA 5D6NA 4WCFA 3WGLA 3CE9A 2YWFA 4IG4A 2CJWA 2W70A 1I4DD 3SZMA 5CT9A 2QJWA 3DLPX 4LHYA 3ISTA 1NRXA 2FRVA 3CX3A 4RACA 1P0PA 1NW4A 2GPYA 1YD7A 1XP5A 3I2YX 3W2IA 3DKIA 3KSDO 4QKQA 1MIOA 2FP3A 2WA1A 2ZB7A 2NAPA 5FYQA 2XMQA 4XOUA 3TH5A 2JF0A 4INZA 1GJRA 1O95A 3PBKA 4B0OA 4RKWA 4Y2PA 1PR9A 4MW5A 3MD9A 2CZQA 3JQDA 1Q3TA 1TXGA 3GBSA 4MJXA 3WI7A 1R9JA 3BJZA 1DC8A 1O08A 1TIPA 3AF5A 3CZQA 3FYUB 4TVOA 1V3VA 1EHYA 3C70A 1E79D 3IX7A 3ZKWB 1JQLB 1RYHA 5JZOA 4P31A 2JJ2A 3PRJA 4PS0A 1R10A 1TJPB 1ML4A 1VLQA 2WRZA 4BVGA 3UV7A 4JROA 1QRDA 3QBVA 3AW8A 5SY9A 5HIAA 5IG2A 4J03A 1V45E 3QVJA 2FGKA 5DB4A 1GZ4A 1KE1A 2WFAA 3OQIB 3RVLA 1X1CA 2GT1A 4ZKEA 3P0EA 3CF6R 4RD0A 2ISCA 3TDNA 1Z5WA 3QVOA 1B7GO 3ZBUA 1IU9A 1SC9A 4FHEA 5HUQA 3AI7A 5LB2A 3DAFA 3F49S 3G2MA 4OHWA 2XV1A 4KOAA 3RI3A 3ZOKA 4DPMA 4J6FA 4P0QB 3QOXA 2BFFB 3D1VA 5KZMB 1J6UA 1LPBB 1WA5A 2C4TA 3H83A 2AJBA 2WIFA 1YJQA 4QT4A 4U00A 4URXR 3BDVA 2NYAA 1MAHA 3GDFA 5JS8A 1E2GA 3JRWA 4UQPA 5A9SA 3OZGA 4P7KA 3TX6A 2IDJA 1J0BA 3QYPA 2L0XA 4U7PB 5LQUA 5K0GA 2QVYX 4YRZA 1AQNA 1KZ6A 4CM4B 4F85A 1L5SA 3ZD6A 2BPOA 1OXKB 2BKLA 5F7OA 2DFDA 2VWGA 3HBMA 4MR7A 4NEHB 4ND5A 2PWYA 4B8ZA 4C4XA 5K7SA 3U7IA 2HHJA 2JCXA 2D2FA 3OU6A 5KTOA 5TIIA 3ISJA 5BORA 1H1LA 3DBVO 1CYDA 1CJKC 4Q4DA 1BQ3A 2OD9A 3N07A 1T4GA 4UTRA 2Y68A 4PBSA 5HP4A 4FUTA 2V6GA 2PGLA 2N46A 3PSAA 4DY6A 2WTAA 1QRRA 3JPYA 4I1OA 2OTCA 4URYR 3IV6A 4NE2A 1YWGO 2QU7A 3CC8A 1XZBA 3LL4A 3OIDA 2O2DA 3TSOA 3W6OA 2IZZA 3LD9A 3RYFA 4AK9A 4JYZA 5ALRA 5KOYA 4IIFA 1GQSA 4D25A 4PNHA 4A15A 5K0EA 2AQIA 4X1YB 1JQBA 1HDZA 2FH5B 1JU4A 1D1QA 2IEBA 1A9SA 3KPUA 1ZITA 2XA1A 2WWXA 2GUGA 4F91B 1RXEA 3TSYA 1EM6A 2YDXA 2SHKA 2JEYA 4J76A 2FMKA 4K6OA 3X1ZA 2R68A 1W30A 3VV2A 3P9XA 5ELXA 4ZCRA 1UKAA 4CKBA 4YUYA 2XYVA 1BJRE 3ZHTA 4LDPA 3DMFA 4EFLA 1FVFA 3KS9A 4D8XA 3TQCA 3S8EA 5DK6A 1UXGA 5JXJA 3QPWA 1O96B 4ZCLA 4Z7NB 4WK0B 1IXKA 4HDKB 3EH2A 2HFKA 3TO5A 1FA9A 3CN9A 2FWNA 3DWFA 3F3MA 3K1AB 3MJSA 4GX0A 1ULAA 3ZE6A 5BWCA 4Y2TA 1IQUA 4WECA 2NVUB 3FMGA 4EEKA 3QEMA 2C95A 4D9BA 4CV0A 3PPYA 5E95A 1MXFA 4CM9A 1AKVA 4F6LA 2UVQA 1JDBC 2A1UB 2DHEA 3C16C 4HEHA 1XA3A 4QO7A 2JFPA 3PGJA 4KBFA 1KFBB 1A5BB 2EJCA 3GNLA 4KLRA 4R8LA 1YRHA 5TQ2A 4LF5B 1NE7A 2V7GA 1C9DB 4Y8VA 1NKSA 4MWBA 4RTLA 1KDPA 2XXJA 3JVDA 1CR2A 1HDYA 2XUGA 3RABA 1NXTA 2B37A 4DR7B 4CR6A 4OI4A 4M0CA 4TQAA 3F78A 2V0NA 2PH7A 3HFRA 4FGKA 4L27A 4K6KA 4HFJA 1UZNA 1IQRA 1O0SA 2Q27A 2QPOA 3QEAZ 1FFYA 5JJLA 2GETA 3LA6A 6GPBA 1GPLA 5AMXA 2Z6AA 1MEJA 2OAP1 3EIQA 4LJYA 4TV8F 4KMOA 3W8RA 4AZWA 4EYKA 2WK1A 2FK8A 521PA 2C03A 5ES3A 1B93A 4Q5IA 3RYTC 3CW9A 3SKYA 5JS7A 3AFHA 3M5DA 1PBTA 1LJ8A 1NR5A 2Q4DA 3MBIA 5CYFA 2DR0A 2VKQA 5DTEA 2VDPB 3G85A 1I3LA 1MT3A 3B6MA 4NU6A 1KEKA 1AURA 2NN3C 2GYUA 1E20A 3M6UA 1PJQA 1W76A 2GPJA 4HGOA 3U1VA 5KNCD 3D6VA 3EF3A 3C74A 1GV1A 1KKLA 1YQQA 5D3MB 4ZMRA 4RJTA 1ZCZA 1N5DA 4R1LA 2NT3A 1QVAA 1Z15A 3A05A 1L4KA 2V7UA 1FTSA 5A4AA 2ABWA 2O0HA 1EVZA 4O3MA 1YR1A 1Z3CA 2YWHA 1A69A 1E3WB 4FM9A 2O0MA 3AFOA 4FMCB 4I1RA 1UFKA 3EFOA 2VHQA 4OQDA 5FOWA 1GVHA 4ND6A 3PKZA 2AG8A 1JX6A 2ZTHA 4BQQA 3QKRB 2Y8EA 3B51X 4D8VA 3D7KA 1JG4A 1JQAA 3GX1A 4ED9A 3KWJA 2HIHA 3DL2A 4MYHA 1R18A 1Q7EA 1RI3A 4HB2A 5IAOA 4FIDA 4H2DA 4IFTA 1YKFA 3C6KA 1POWA 4PAGA 4NBTA 2CDBA 1GIAA 3IIMA 2N0SA 5I7EA 3NAMA 5CDFE 1J22A 3G1WA 1ZK0A 3BA1A 5JSUA 1B8PA 4E5DA 4QYWA 4S1TA 1N2EA 1RHJA 1QGOA 1KSJA 3IEPA 2W6PA 2OCIA 4PLGA 1V16A 5C51B 2VS1A 3DV2A 5KPDA 1FTGA 3QPAA 3B9RA 2W8BA 4MP6A 1NW7A 1TX4B 5FUBA 2CNBA 5K0BA 2IODA 3LLCA 1MD9A 3D8TA 3ENZA 4RD6A 2PVCA 5G4KA 4FINA 4DYVA 8ABPA 2AUNA 3P8ZA 3SKVA 1JIVA 4GZ3A 4NLLA 1SC3A 1J0CA 3ZWCA 4PO8A 1HDIA 3TOZA 1XQ1A 1J21A 1IJEA 2ES4A 4BTEA 4FKMA 1PGQA 1IVSA 5ALZA 2ACVA 3S8YA 2F8TA 2WQ6A 1I4TD 3N7TA 3U4IA 1ABBA 1R6UA 1ETHA 1G6HA 2EYQA 3RKRA 1WZIA 2GK4A 1PWXA 3R0ZA 3NIDB 1J8YF 4ZU6X 2QD3A 2QRZA 3U37A 1N2ZA 1OWMA 4MA4A 4OG2A 3BERA 1HDRA 3A58B 2YKGA 1R0CA 1U1GA 4UHBA 1KR2A 2WTEA 3B3GA 4WLVA 3S99A 1SFRA 3C1TA 4BNGA 3WL3A 3B48A 4U7GA 4EI8A 2NTJA 4Z7QB 2DUJA 3GF4A 1KY3A 3AF0A 3PEVA 4M88A 4Q82A 1UEJA 4B1FA 3QLUA 2OYCA 2E1RA 1II8A 1ZKDA 2ODQA 1GRVA 2WIKA 3TBKA 3BG5A 3P2EA 2QYSA 2HNAA 4FOSA 1E7WA 5E1BA 4BWVA 1HE4A 3H9UA 5E6RB 4NWIA 5IVKA 2IPNA 2NGRA 5K3AA 3FCOA 3LDHA 3V4LA 4B0PA 2DSTA 2W6IA 3BSSA 2JBAB 4NMMA 4ZAXA 1M9NA 2IHTA 2FCAA 2VLIA 3JQ9A 4N3CA 3SP1A 3TDMA 4OFZA 1SHUX 2DJIA 4R2JA 4MYTA 4CCAA 3RRFA 2UZ1B 3KYIB 3BBLA 1MKYA 2O52A 2ZVQX 3G8YA 1GAJA 4BS9A 3ZBPA 2D8MA 3P0HA 1F6WA 1HLPA 1YJ8A 1AUVA 4P7GA 1NF2A 3IKMB 5H0IA 3VR4H 3WGGA 1A50B 1R27A 1OFTA 4N7RA 5ELMA 5BVHA 1AIPA 3QVUA 1JHYA 1EPUA 2JI6A 2VF8A 3NIFB 4G1CA 1MGOA 4IINA 4JLBA 3SEQA 3VISA 3BMCA 4Y1GA 2V6FA 4F2DA 3K2IA 4NNOA 5K0FA 1FQJA 1XDUA 3V7YA 2B3DA 3FLEA 2ACKA 1IUNA 1U8FO 1C3JA 1Y6JA 3EG9B 3G0CA 2Z6UA 1Q6YA 2IYAA 1GAXA 4W5JA 2I3ZA 1ZZEA 3TQOA 1SNYA 4COOA 1KPIA 4WBNB 4GRDA 4HDSB 2XJ9A 4PAOA 3I1JA 2QIPA 1JQ5A 1B1AA 4K88A 5CLJA 3DMYA 3FYDA 3NU1A 3NNSA 1L8QA 4U7HA 1YSCA 5AUNB 2D3TA 1W48A 4E7OA 4ZI7F 3GO4A 4ITUA 3W7BA 3IL2A 5K0SA 2IPLA 2XH8A 2H51A 1L1QA 1UJ5A 3EVNA 2XVZA 4AO8A 1XCMA 3D1LA 3N87A 4DADA 2FPUA 3EG5A 4WCFC 1UOOA 3G2NA 1GNLA 1WMSA 2WG1A 4BX3A 1ECLA 1C7QA 3DQZA 4QGFA 3NGMA 1RQNA 4DSNA 2V0GA 3WK6A 2FWRA 2FZ4A 3W04A 3NAQA 2JI8A 5JPDA 2AJDA 3T8YA 1NL3A 2BGUA 1DDOA 2I6GA 1A8SA 1H2BA 2ZCUA 3AEUA 3KR1A 5HBGA 3UJHA 3ZD8A 4D56A 2O9JA 1DI0A 3B38A 2Z5LA 3FNFA 2NUTA 5ISMA 1QTIA 1U5AA 2WJAA 2PGIA 3PDHA 4AP5A 2HF9A 2ILTA 3BXOA 3G88A 1TYEB 1X15A 3LUAA 3MJEA 1JF8A 1HEUA 4M0UA 4Y3UA 3WDLA 4DYDA 3K3PA 2CE7A 2P9HA 4UM8B 5CLHA 4ESHA 3QNMA 4EI2A 1UXOA 1ND5A 4HVTA 1HYBA 1QWOA 2QTGA 4LJ7A 2FKAA 2RDMA 4O33A 1FW8A 1J2UA 3BWVA 4IH4A 4OHUA 5IEBA 5KYXA 2IUYA 3ZNNA 3WE7A 1OROA 3HNRA 1EA5A 4QOHA 2A30A 1RD4A 4D0SA 1RKXA 3PYXA 3B3AA 1ZH0A 1E60A 2X22A 2BEWA 2NXEA 3AJRA 2VL7A 3ELDA 3FDJA 3N86A 4TWBA 3VR2A 2IU0A 4D42A 4XWKA 1O8BA 1PF7E 4G5QA 4X91A 4F1WA 2JRCA 3B7GA 3D5QA 4OGLA 2GZ3A 5ALLA 2H1FA 1ZSNA 1JHVA 2UVPA 3G0DA 2O8EA 3KVNA 4DLAA 4G1MB 5ICEA 1KKUA 4PSVA 2WWYA 2BMVA 5GJVC 3DONA 2GAOA 2V7QA 3KQPA 3HBFA 5AKGA 5CFRA 1N1GA 3DHVA 3LCMA 3OTIA 4MVJF 2ZRHA 4QDKA 1B0AA 4PYQA 3VO9A 3WMEA 2EJBA 4KQEA 2Q6OA 1P81A 1BU5A 5AUQA 4S1NA 4NV0A 2PLFA 3I62A 4B32A 3A4LA 3A4TA 2WINI 4GLOA 4ZREA 2ID4A 1GNSA 3ZE9A 4C76A 1HMYA 3FVWA 2O0JA 1F2TB 1ACJA 3PGLA 3NYWA 4ND8A 2H7VA 4WESA 3I0MA 4BX2A 2QRVB 1VL2A 1AN9A 3W8DA 1M6VB 1W88A 5TJ9A 3IBYA 3B52X 2F1JA 3ZTTA 3P9PA 4V0ME 4Z2YA 3DDHA 2JRLA 3OPNA 1J42A 2YV2A 3UK7A 3HHPA 1OLXA 4B4KA 4BL5A 1X7XA 4RD3A 1IG3A 2WTXA 1JDVA 4ODIA 5IX8A 1E9FA 4ZK2A 4JR2A 4L2IB 3H5VA 4QULA 5AW0A 4YRJA 1Q5PA 2ZJ6A 2Y1GA 4AURA 1RBZA 1UBTS 5T4EA 5AVUA 1MAAA 3FSJX 1OZFA 3BXFA 4BEWA 5DDIP 5FA5A 3U2QA 3UATA 4BEJA 1U8UA 3A1DA 2OCLA 1KAOA 3ABQB 3H5LA 2CN1A 1ZL0A 1NZDA 1KORA 1TYDE 1Y4ZA 2I9PA 2OD7A 2W6MA 1QFXA 4KN6A 4RHYA 5JAQA 1CQIB 3U3DA 3ZCSA 1EK5A 1VGRA 4X64B 5FTLA 4XD2A 3PFWO 3V1YA 3WGOA 3LQYA 3EJWA 4LTDA 3M82A 2JAXA 4XVCA 1P0CA 1JA9A 1PRYA 3E48A 1A4RA 4YFYA 5F3DA 1ZOSA 3ZV5A 2CVZA 4XWYA 2D2XA 1JSXA 5DHPA 1WNFA 1WY7A 2YWBA 3DAYA 3N0XA 1KZ1A 4FS3A 4RK0A 1ULUA 1WXQA 1AN0A 1UK7A 1P1BA 2AI3A 4C7OA 4NYMR 3UVEA 1IC6A 4B46A 4D0GA 1P72A 1VP9A 1FOEB 2HPAA 2WUGA 4PU0A 1DRJA 3QBJA 3FF4A 2GDJA 4QDZA 3WBBA 1I7PA 1YMQA 3W5AA 4IV5A 1G18A 4ARAA 4RS4A 1XYGA 1EXVA 2W8ZA 3U3ZA 4H7KA 4N5NA 2I76A 5INTA 4HTFA 1HE8B 1UJ4A 3O1IC 4YJHA 5DX0A 2IZOA 4RKFA 2E6UX 4CR8A 5KYNA 2NMVA 1Y42X 4WASA 1QKIA 2BFNA 5LZ2A 5LU8A 4DV1B 1M76A 3KFLA 1PQWA 2P2YA 3KAJA 4KR3A 4MW7A 2Y99A 4MEAA 1EDBA 1QNFA 2PRKA 3NXSA 5CH3A 4P98A 2Q7OE 3RYCA 1PV2A 4EF6A 1BXGB 2P8JA 4YO7A 4DLZA 1N0UA 4OHOA 2EGHA 3LW7A 2HK8A 1QP0A 3BE8A 1E99A 1FX1A 3UC5A 3MWDA 4JLUA 4LISA 5JYBA 2C5GA 2P9CA 4XIIA 5KREA 3F7OA 3GGJA 3ZKAA 4CETA 4PLCA 1Q77A 1QNLA 1QF6A 4OXRA 4CV3A 4JH0A 4ZOQI 2X76A 3O21A 2LCIA 3B5IA 1NMEA 3DOEA 3Q3JB 1YOBA 4GLBA 4MRMB 2O3SA 7AT1A 1UBUS 4KNYA 3MOGA 4BPRA 2C9BA 3UJ8A 4XQ9A 2EEZA 3X1YA 1J8FA 1JEDA 2H2IA 3ZC3A 3CWZA 2PX2A 1JWLA 3OZFA 1MW8X 1I3OA 3GIDA 2A5DA 3JASB 2G71A 2ECFA 4LGMA 3QLTA 3ANNA 4WBSA 1IB6A 1L8XA 4WXRA 3DXXA 3PWKA 2KQUA 3PD0A 5TS3A 4IZHA 4U9UA 1CHDA 1TVKB 3KALA 4WNIA 4YP1A 4M0PA 5IM4A 1C0EA 1JILA 2VAPA 3G5LA 5KAMA 2CUNA 4XWWA 3RTCA 4WGGA 3MMPA 3ZWOA 1NP6A 2C59A 2AG6A 3U17A 5GJBA 1JR3A 5DRYA 4I4NA 5ALXA 4O0LA 4QVKA 4ZCIA 5DNYB 3IP5A 4G1FA 3QFCA 4NBSA 4E4YA 3I58A 2QX8A 4IXTA 3QXHA 4EPXA 4HVCA 3GLVA 5AVVA 3CO5A 2RGUA 4W7HA 1Y5NA 1T0HB 3HKCA 3U48A 3EXEA 1J5XA 1JA1A 4KAAA 5FUYA 3L0ZA 3IAXA 1XZPA 3GUZA 1A88A 2V55B 5IZCC 1P9LA 2CK3D 4O4IA 2EJUA 3PFCA 4W99A 3DBRB 3Q6IA 1HYHA 2AZ4A 1Z5UA 2BFCB 1YOVA 2V6IA 2IYYA 3QU5A 4GX5A 3FOWA 4BUZA 4PLFA 2AHOA 5CB4F 3BGSA 3R5XA 5D00A 2Q3MA 1VKZA 4ZCSA 4H9GA 3O7WA 5EWMB 4E5KA 2YFKA 1BX3A 1M5RA 2X5XA 5GWXA 1RWXA 5K3CA 3NHLA 1QTQA 4C2UA 2WABA 3NOQA 4EHNA 5LYJA 1OIVA 3LCJA 1VPLA 2X8AA 5F23A 1YONA 1WO8A 1UWKA 3EC7A 3HJTA 5E7QA 5EMKA 5KNLA 2WPDA 2Q5JA 2P41A 4RLHA 4ZXFA 1QK4A 4FYHA 4MWTA 1FLNA 3C7KA 2JHCA 4XQGA 5DHFA 4A10A 3GEGA 5IANA 4YAUA 4TUYB 1RBYA 4NTZA 1B8OA 1LPPA 1NM5A 3PJRA 3FHOA 4KWCA 3P4UA 3OUTA 5H59A 1EB9A 1UOEA 2GJ4A 2PH5A 3AR4A 3QOYA 3RVJA 5BUCA 3HXTA 4R1QA 1IULA 3FCYA 3GXOA 4ACBA 2PNFA 1F2DA 1M0TA 4AKSA 3O8LA 2P9YA 1J2TA 4HZUA 4NAHA 2ZAOA 1NW8A 1R4NB 2JIOA 3F7TA 3HVIA 2Q5QA 3KAKA 4GWKA 2HJHA 2R1TA 1HTTA 2HMTA 4RGQA 4X3OA 5EJMA 1K92A 1AT1A 4CLDA 4DWWA 2JEZA 3FHTA 1PJRA 2WYUA 3T9DA 2IXDA 1YA8A 4F9GA 4ZIRB 1YBVA 3KR0A 4MI6A 3IAM6 3S2FA 5FWNA 5CCEA 1KJZA 4DQUA 5K8UA 1SBIA 4MRVA 3AHCA 2RH9B 2A5GA 3L0OA 1Z8DA 4D3XA 1J39A 1CEYA 3BWBA 1TM7E 3CEPB 3HU3A 1LRJA 4F1JA 4YRAA 1USVA 4OB7A 2CYBA 3ANSA 3RFFA 5ITSA 3F96A 3KAQA 2R8BA 3RSSA 2G1UA 1NJ6A 1NVVR 2RGXA 3KJEA 4N3BA 3ZH9B 3AB7A 3DDNA 4L51A 4YGXB 1EK6A 2Z8ZA 1NKTA 2DWQA 1YS2X 2SICE 4N3NA 3W5JA 2FU5C 5BQ3A 2CF6A 4RJ2A 2B8TA 3GJQA 4HV4A 2A1IA 3RSHA 4R9NA 4OJMX 1FSFA 2PIDA 3L1UA 3MWLA 1XDGA 5EA2A 5A9TA 1W8IA 2QX7A 3ASUA 3AR7A 3PE4A