1A1SA

Ornithine carbamoyltransferase from pyrococcus furiosus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
313
structure length
313
Chain Sequence
b'VVSLAGRDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGGIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORNITHINE CARBAMOYLTRANSFERASE
publication title The crystal structure of Pyrococcus furiosus ornithine carbamoyltransferase reveals a key role for oligomerization in enzyme stability at extremely high temperatures.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transcarbamylase
total genus 116
structure length 313
sequence length 313
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 1997-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 1a1sA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 1a1sA01
3TXXA 4KGXA 1PG5A 1RAFA 3LXMA 4KGZA 4AMUA 1FB5A 1EP9A 4KH1A 1DUVG 2ATCA 5AT1A 4WTOA 3CSUA 3KZOA 1TTHA 2A0FA 4JFRA 3R7FA 1OTHA 1VLVA 1RAGA 1F1BA 1I5OA 4KH0A 4A8HA 3TPFA 3KZKA 3L04A 1RACA 4JQOA 3L05A 2FZCA 2W37A 3E2PA 2FG6C 1FVOA 4EP1A 4FYVA 4A8PA 1SKUA 5ILQA 1A1SA 2I6UA 4H31A 1AKMA 1ACMA 4JHXA 3M5CA 7AT1A 4FYWA 4ANFA 1RAEA 4AM8A 4KGVA 1Q95A 4AT1A 3GD5A 3NPMA 5G1OA 2H3EA 1ZA2A 2EF0A 6AT1A 4FYYA 1R0CA 2AT1A 4NF2A 3D7SA 4F04A 2YFKA 4F2GA 9ATCA 1NBEA 1R0BA 5G1PA 1XJWA 2QGFA 4KWTA 4BJHB 1ZA1A 4A8TA 4FYXA 3UPDA 1TU0A 1RAHA 2FZKA 1PVVA 2RGWA 3D6NB 4E2FA 1DXHA 1D09A 1ORTA 8AT1A 1RAAA 1TUGA 8ATCA 3Q98A 2BE7A 2HSEA 3M5DA 1ML4A 2IPOA 3MPUA 2AIRA 2OTCA 1EZZA 3L06A 1RADA 3L02A 4OH7A 3R7LA 1EKXA 2FG7C 3R7DA 2P2GA 3M4JA 3M4NA 1JS1X 3GRFA 1RAIA 1C9YA 2FZGA 1AT1A 4IV5A 2BE9A 4EKNB 3KZNA 2QG9A 3KZMA 2G7MC 1RABA 5G1NA 3KZCA 3AT1A 3SDSA
chains in the Genus database with same CATH superfamily
2WMNB 4PX2A 4JWKA 3CF0A 3B6EA 3A6LA 4KQWA 1RAFA 3VOBA 4DQKA 2IZOA 3RLIA 3W4IA 2OOKA 3E8MA 2JZNA 1OFTA 3QBEA 4IDDA 5KREA 3AL0C 4KQCA 4DDVA 4QDZA 1DJOA 1SEPA 3MM4A 5F7XA 1RCUA 3RCBA 3R7FA 1T2EA 3LBNA 1LU9A 1BYUA 1PJ2A 3AZOA 2BKAA 2RHTA 4HUQA 4U2EA 2ZJOA 3G9QA 1EXNA 3WGUA 5JSHA 4B3TB 3L0BA 2ZVQX 3H6KA 5ARCA 2YV3A 4DCVA 3OTOB 3L07A 2PZFA 4AKGA 2PUFA 3DAHA 1LBSA 3KQSA 3SVZA 4PN7A 1E69A 3C7KA 2F7SA 4EY7A 1E3MA 1UXOA 2VP5A 2ZSBA 2PMEA 4EMUA 1QLHA 1ACJA 3JS5A 3V8MA 3NVAA 1B6SA 4Q7QA 4ODIA 4TXMA 1CDEA 1BHO1 1PFYA 1UDRA 2AG0A 2X4GA 4UU8A 3SXJA 1PGPA 4MW5A 1NX6A 3DOOA 4GXNA 4KUGA 4XIJA 3TBFA 1XN1A 3EXEA 3KLBA 4TLLB 4X8LA 5LL6P 2YRWA 4F9TA 1J5EB 7AT1A 2P40A 2O5VA 3UCXA 2FPPB 2PT9A 3IT0A 1GN9A 4IJKA 1QCDA 4EH1A 5IFLA 2GPNA 4M1EA 4NDNE 3MUEA 5EIFA 2BHSA 4Q7JB 3IJPA 3PC8C 1VHJA 4MPDA 5EGNA 4AKSA 3PE4A 2VKQA 3W7BA 1NP3A 4WBNB 1KEUA 2CNWA 3RJMA 4E5NA 5JC1A 1Q57A 2J85A 1U3VA 3JARB 3PHBE 3ER6A 4HF7A 3WYEA 4BWFB 3I9JA 3RUHA 2FZEA 2JLSA 2QDKA 3KAPA 3I37X 4RWEA 2OXTA 1Z35A 1SIUA 3DPIA 5ADHA 3A7EA 4G4IA 5I7VA 3GH1A 1K27A 4KNYA 3AR3A 2RI0A 4CT4B 2IUUA 1ZVQA 3H2JA 4NJOA 1CUBA 2BGTA 1QQ6A 2ZULA 3EIEA 5EERA 1O2DA 1U80A 1L5SA 4AJLA 2VP6A 2KLBA 3CPEA 3LNCA 1PL6A 1BNCA 4NENA 2FDCA 4JEMA 4MRSA 5U1PA 3ZGVA 3O03A 4TTAA 5KTNA 4I6EA 3DVQX 1FLDA 1SUDA 2HSEA 1N2ZA 1PJZA 2BFEA 4XWYA 3K73O 3TVTA 1KY4A 1AIPA 1SQ6A 1X7GA 2XUQA 4IOJA 5EI5A 3TLKA 2BFBA 3E9DA 1WF6A 2PTGA 3GIWA 4I50B 2PZ8A 2ZYRA 3M1LA 3QVUA 4ND6A 5CLIA 4DBLE 2W2OA 1RADA 1Z07A 3OURA 4GI2A 2I5PO 1GT6A 2P30A 2P0YA 2BD0A 2ZI7A 4ND1A 2P2GA 4C7KA 4FSXA 4LRTB 3QXXA 4D9KA 1QPBA 3R3VA 1YF3A 4EFDA 4M0MA 1QC5B 2XGGA 4H1WA 2GDJA 1GGHA 2AW3A 4R7ZA 3RBVA 4F2PA 2KJQA 4UAGA 1I3OA 3BRSA 3TR6A 2X0JA 3IRVA 1EFHA 3ITNA 2MTBA 1Z0FA 1DDGA 1XZDA 2OM6A 2P9BA 5GONB 2JIQA 1Z08A 2RDMA 4E15A 5C51B 3UATA 2NVWA 1H1LB 3HI6A 4BNXA 1CZRA 1YB7A 3K6RA 4R71A 4I6GA 1GY8A 1PZGA 1JXOA 3U0BA 2CJWB 1QGED 2C07A 2NZUG 4J2OA 2VNKA 3LXMA 4G5QA 4U8HA 1TQ2A 3TOXA 4M8IA 3ZD8A 1PT7A 2JH9A 3GZ4A 4HMQA 1NNUA 3L8YA 4Y6PA 3ADCA 1BWSA 2ZYHA 1QGYA 1FX0B 2W2PA 2OFWA 2IY8A 1D0IA 4J29A 2AI3A 1KJ8A 4LNAA 2D3TA 5E9AA 2WT9A 4O02B 2V4MA 1GFIA 2GSWA 3AILA 1E79A 3H6HA 2M6KA 2QZPA 4E1BA 3GLHA 2RGDA 3DKIA 2GEBA 3CUWA 4OQZA 2IZ7A 1D2MA 3ILXA 5HUQA 4CV2A 1YZ3A 2ZUUA 2XZOA 2FPIB 4EHBA 1L8AA 2OEPA 3S40A 4IJ6A 1TCBA 2FDXA 5KOHB 3KQKA 4LV5B 1ECBA 5FCDA 2QRUA 2X9LA 2ZRLA 3VZQA 1M34E 1S2LA 3BVPA 4U9UA 2J9YB 2QW8A 4WOJA 3VNSA 4ABTA 2H9AA 3AY0A 3OUTA 4C78A 5KJFA 1A3CA 1ZK1A 4IDFA 2ZJFA 4D4HA 3RYCA 2PX0A 1YC2A 3LUAA 4ZQEA 2JI6A 3VYVA 1M33A 4XX1A 1M6YA 1NW9B 3KBBA 3KV3O 4RQTA 2H4XA 1M54A 2VXYA 2C98A 2KPOA 4RVCA 1HFKA 5AJZA 3BHIA 4G5SA 4MVCA 3RU7A 4IHJB 2HL6A 2VNJA 2YL2A 2REOA 3T1NA 3WK4A 1TUIA 2ZIFA 4BGUA 3EVZA 1P6UA 4G37A 2HJGA 4GLJA 2I6FA 3FUTA 4BBJA 3CUVA 3CLSD 4ARCA 1U65A 2GN1A 3AI2A 2HUPA 3FXAA 3G5MA 1DAHA 3H5TA 4UCXA 2RGAA 4UXIA 2R7NA 5I47A 1OIWA 5DT2A 3BJRA 4OL0A 3EGXB 4LOHA 4H6PA 4HAYA 4Q7MB 3ZIAA 2IUYA 3TNLA 3FWHA 5LIPA 4C29A 1ULZA 2BWJA 1CXZA 3ESYA 1QCYA 1E6WA 2C4TA 1BXGA 2FX3A 3GJ7A 4AJEA 4GPTA 4AO8A 3ADBA 5BWCA 5IZCA 1UWCA 2J3HA 4OY3A 3NKVA 1Z18A 2A1TR 3DE0X 1OAOC 3EGDA 1TUGA 1NF3A 2WLTA 4GGMX 1LV8A 1T2CA 5DGIA 2ZRAA 3COSA 5T3UA 1OZGA 3HJTA 1ADFA 3BCUA 5B4VA 5BNWA 4CEHB 2J59A 4OYYA 1FFSA 1V8BA 1E0SA 4RKQA 1E2LA 2PXCA 2ZLBA 3JQAA 2GYUA 2RHGB 5FI5A 3AV3A 3DTVB 5G0SA 2HT6A 2QR2A 4AMVA 1MW9X 2W5UA 4NBSA 1FTWA 2GVDC 2IIQA 4UUNA 2Q0SA 1GQ2A 1R00A 1HE5A 2XNJA 3SOPA 1E62A 1MN6A 1OWOA 2HNKA 3HYLA 4CG0A 5JTUA 1AG9A 2V6IA 2IP2A 3VAAA 1RXCA 4O2AB 2WWWA 5GZ6A 5BNZA 4OQEA 2H06A 3A4LA 4MIOA 5IC5A 4X66B 3EA5A 4MCIA 3KLNA 4YMSA 5F3DA 3V7YA 3VVLA 2FN3A 3P32A 2G1PA 1RABA 4Z8XA 4PWYA 5AO9A 3IHTA 5DNEA 2EBHX 2GEKA 3QMMA 3QVOA 4WZAE 4KCGA 2PY6A 2XMCA 3DAPA 5CXXA 1SCUB 3H42B 4OSOA 9LDTA 1OKKA 2X0NA 1EDEA 3TLXA 1XZNA 4TRRA 3V7FA 4C76A 4EUSA 2R84A 5KYYA 4JLOA 1D2CA 1XNJA 1XCLA 4YAUA 1HZZC 3NR2A 5DNVA 1FMLA 3PNYA 1QBGA 3SBOA 3HBAA 1XRLA 2GF9A 3LIPA 2IHZA 3K9WA 4J7UA 2IZ6A 3NT4A 4NOMA 3D4PA 4JOCA 1IRXA 2VBFA 1R88A 2D59A 3WWDA 4ZOLA 4DIFA 1XTBA 3VSBA 4OAPA 3EVCA 3RABA 4R54A 1U0NA 4KJXA 3BRWD 4KNVA 3EBPA 1M2VB 1ZOIA 4CG3A 1K7CA 1SOVA 4GUDA 1YRYE 4WL0A 1QZZA 1WQ4A 2VH1A 5K2MA 4AURA 2F55A 1U0FA 2EKBA 4BEBA 1E8NA 4PYIA 4XQ0A 3N86A 2X0IA 3QJYA 3ESRA 1SO8A 4J03A 4QO8A 5CDGA 5J4YA 1JHPA 2W83A 1WUTA 3R24A 4NESA 4KVGA 3OU2A 4GYJA 2IUSA 4Y18A 3CRNA 4HSGA 1NVTA 2R2GA 3E1SA 5DYYA 4HPJB 1ZN2A 3ZWYA 1MRNA 4M0DA 4A0SA 1EWQA 5IDWA 2QN8A 2WM3A 2B5OA 1J97A 1MNQA 4JT4A 1O4VA 3TE7A 4GD3Q 1OLXB 4ACAA 4LUCA 3SZ3A 2HRDA 4IYJA 5KNDD 3VU1A 3GXOA 4G56A 2H31A 5ALRA 3A06A 1GG2A 1RPTA 1ZD1A 3B51X 4KDCA 4ARZB 1U2EA 4KGXA 4CKZA 3WTBA 1R0CA 1PQPA 3CE9A 1MAWA 1Z2EA 2QZZA 3PHJA 3Q5GA 4PHGA 2IJGX 4FKZA 4MTCA 1EK5A 1ZK2A 1KSFX 3T06B 4XAQA 3ME5A 3V6LA 2G71A 4GG1A 2CLKB 4H0CA 4KR7A 2O2YA 4RL4A 5MGNA 1ENZA 4X44A 2NU9A 3OA0A 1Y4DE 2F8TA 4F2HA 1E0AA 2FY8A 4FEEA 4MYUA 2SNIE 3KKKA 3T9DA 5B30A 2ID7A 5A4AA 1BVRA 3UG6A 5JY1A 1L5HB 1RJGA 4BRSA 3K0CC 4ML3A 2GYWA 4Y2XA 5EIOA 3I62A 2D2VA 3RUFA 3ZZ0A 2VJPA 4JVOA 3RBXA 5CFQA 2FWIA 2DY1A 1OBCA 3HA2A 4R8MA 1BYIA 1PQYA 3DBRA 1ML4A 1MTZA 2CLIB 4GC5A 3VR1A 3I1FA 3CNNA 3K9GA 2M1ZA 5JBIA 1SAYA 1VL1A 3CLHA 5KSYA 5HK9A 2G3YA 2R86A 3ZCRA 4MW1A 3ZD6A 1S1CA 4WOPA 1LQTA 1DKOA 2IEZA 5SZIA 2IYOA 3E0QA 3F98A 4CCYA 1E3TA 2B4YA 1YZYA 3BIJA 3BXOA 4K87A 3JRNA 4OHBA 1IDOA 4PYLA 1Z6YA 5H82A 1YS4A 2VQ6A 4RD2A 2WJJA 4D80A 1IL0A 3FYHA 3AUJB 2VK4A 2BN4A 3PS9A 1NW8A 4OQ4A 5H9VA 3VR3A 4BLSA 1E1CA 4D56A 1O6GA 5K3BA 4MGZR 4DQXA 1G0OA 2CXXA 1GZ6A 3HUEA 3I3OA 4KIJA 1XCMA 1N9GA 2QAIA 4ARBA 4O4IA 1NASA 4RZ2A 4TQ9A 4E08A 1Z06A 4ZO6A 2J6CA 4JEIA 1YCDA 4YMUA 3GOQA 1OXXK 3UV3A 2ATEA 5J58A 1AF7A 1OGJA 4UTPA 3JQ8B 1N6LA 4OXXA 3I8SA 5A0TA 3R3UA 1A7JA 4F6RA 1KFBB 2HSZA 4FX5A 5A6SA 3PNKA 3ZWWA 5LP6B 2EF1A 1WP4A 4JFRA 4IZ6A 4YAWA 3ZZTA 2BL4A 2AWNA 2ZRHA 2PO7A 4LXYA 4PRZA 1NXSA 2IH4A 3WDKA 4Q4CA 3JQEA 3D3WA 3GD7A 2P3QA 1D0SA 3LBAA 3CMMA 2XJ9A 2BTOA 3GH3A 2QTVA 3VR5H 1QP4A 5JSZA 1KI6B 1Y9AA 3KQHA 4CM3A 2IYLD 4CMAA 1HG0A 1HT0A 3EEQA 1RLIA 4G26A 3SZUA 1CEQA 1P6QA 2FZCA 1E18A 2BFFB 2R1VB 1EDZA 2EYUA 2OXCA 1UODA 3NVDA 1J33A 5DRYA 5FFMA 3AC0A 4N0DA 1XPOA 2SKEA 2NTYC 1PS9A 2OC9A 3NP9A 1JXAA 1L5WA 1GV1A 5EJFA 2Z09A 2C97A 2DTDA 1ESMA 1HL3A 3CB4A 3D7KA 4GMXA 5HF5A 3OBIA 4EFNA 1ONNA 1XLWA 1TK3A 3MAGA 3G0CA 3O9ZA 5JSQA 1LJLA 1R5OA 4RABA 4LXHA 4CTOA 2ZB8A 1Z4QA 3GJQA 2C2GA 4BFZA 1W48A 2OENG 5F21A 4KXXA 4I4CA 1A7KA 2CBZA 4LQCA 4I55B 3WQBA 5JS8A 3F96A 3DCYA 4IIFA 3G7NA 1PUXA 5TX7A 3K35A 3GARA 1DQSA 1EUDA 2GZ2A 2Z08A 3EZFA 1VYVA 1WS6A 1R4AA 3C6ZA 4JB8A 4JT2A 4EG4A 4F72A 1KWKA 4P3XA 3IUYA 5AVKA 1JEYB 1ODSA 3N7AA 4HAVA 4MKHA 5KYGA 1UQRA 4DA4A 1G8FA 3UHAA 2BFCB 1FFHA 3TGWA 3ACBA 2VP4A 2ZB2A 3K6KA 3ZG6A 1GKUB 2W2NA 2X5JO 4D4JA 3E58A 5I9SA 1P1IA 1TT5B 1JDPA 2A7XA 3AUTA 3RV3A 4MULA 5AICA 2A5YB 2F1IA 3BEDA 1IY9A 4UU0A 1B00A 2CCKA 3D7MA 3C1UA 4OGLA 4BP8A 4REOA 4E32A 3DOHA 3SOZA 5AXCA 4EHIA 5FEMA 3MTAA 4MUHA 4OFBA 2AA3A 3HFRA 5CCDA 5CBPB 3GWZA 5JROA 2IEGA 3BMQB 1KJJA 1RFGE 1G19A 1GAWA 1TCCA 3L77A 3RIHA 4OMCA 1T0JB 3D4BA 2AF3C 5H7XA 4KN9S 3NBKA 3PGKA 3QJ5A 3QSGA 4JI3B 2A9KA 3OF3A 2L82A 3VJMA 5L4NA 3EPHA 4HWTA 1MV8A 4ALMA 3E53A 4J0KA 1LZLA 4EMBA 2H2DA 4RK4A 4WVFA 2E5LB 1FQJA 5I9NA 5H9WA 1T3LA 4RIHA 1DRJA 1X9GA 3Q3CA 3M0EA 2LCIA 4L9SA 3Q9UA 2CMHA 2YICA 2LBPA 3ZJVA 1Q7RA 1CB0A 2RJ3A 2IOQA 3ML1A 1PJ3A 3O2JA 4IDNA 4ZQBA 5BYAA 3P52A 2UDPA 3CKLA 3DNMA 4QJ4A 5T8KC 4EA7A 5JMOA 3GQVA 2WWFA 4P83A 1FF9A 1TKCA 3N0WA 2IYPA 1T3SA 3NHFA 1VMIA 4G24A 4QNRA 2ZJ6A 4EI2A 3RO7A 5ICEA 2D5LA 2OILA 2YR0A 1SXPA 5DPMA 1U3WA 5LIRA 4LGCA 3RIXA 3KT0A 2QRLA 3RAPR 1X9IA 3QVSA 2W6JD 4UCQA 2G07A 3SJZA 2Y71A 2CJFA 3HGQA 4CM4A 1DO2A 1ZBQA 5FUXA 1L4EA 2QJRA 3E5MA 4LXXA 5FO0A 1UEXC 1CNMA 3A9CA 4ZRMA 3U13A 4CJXA 1PHRA 3CRZA 1O87A 1KU6A 1WXFA 4IIVA 2NUAB 5ERXA 4LF9B 1FJXA 1I5OA 2B36A 2RK6A 4QXRA 2HRZA 3WAKA 2NO4A 5DI9A 1IDN1 5DT9A 1XCPA 1R6VA 2R5NA 2VCEA 5FNVA 1FDIA 1PYOA 5D01A 4KDFA 5D84A 3WY9A 1L5KA 3IAS1 3O3OB 4UCFA 3ITEA 1YA6A 2CXQA 4WRRA 3SZMA 3KPVA 3MRVA 4II2A 1UXIA 2C00A 3MCVA 1XKTA 2PR7A 4GI5A 1FP4B 2VDWA 4GI7A 3U0VA 5DM2A 3ZE6A 3EARA 1TZKA 3PRKE 3HDJA 2SCUA 4LWZA 3L4JA 4CI0B 3S2SA 1K7SN 1MJNA 5L3SB 2XUFA 4W7IA 4EG6A 1RMQA 3PFNA 1YRAA 4W63A 3GEBA 4D41A 3QOWA 1E9FA 1ZMOA 5JTTA 4ARUA 1IUOA 2CMGA 4DG8A 1U2SA 1E6UA 3OOJA 3HJRA 1KNQA 4V0NA 2QTCA 1BZYA 3DT8A 1LWOA 3NHWA 3CNHA 1IG3A 4DLKA 3QGMA 3D8NA 4MRMB 1V5EA 1ULUA 5DW3A 5LLDA 1O5TA 5BQXA 3WFIA 4BDSA 3NYWA 4N0PA 2IV3A 3WKCA 4G41A 4AG5A 2QVCA 3CCFA 3IUSA 1LNZA 4HB4A 4RVOA 1POWA 4MDEA 2FPUA 1WMDA 3DDOA 1DKRA 1R5JA 4NMLA 3EPPA 3KKQA 4RIEA 3HSYA 1CRQA 2PGLA 1Q77A 3DM5A 3N0VA 2QRPA 5BW4A 5LPNA 1S5PA 1DSSG 4JVNA 4U2KA 3NHRA 4X6XA 5EWLA 1V5WA 2P4HX 2CL0X 3L7KA 2CVZA 4JYBA 3GA7A 1XMQB 1SD5A 5BQOA 5HFAA 3GLFA 5H5JA 2CHGA 3A1EA 4F96A 2R6GA 3WI7A 3DTNA 3GYGA 5AM0A 4EGFA 3W6NA 1IEXA 1LJ8A 2VATA 4ECAA 1YONA 3AETB 2P4QA 2OZLA 5K0EA 3CX8A 2Z2IA 1Y1QA 3K5WA 5JZ9A 1SZJG 3EJ6A 1TXGA 3EUFA 3QU9A 5AKEA 1AGNA 4GLBA 4EPVA 1IQRA 3CUYA 1F0KA 1EM8A 5BSTA 2VT2A 3V5NA 5KHOC 2YBDA 3FCUB 2PD4A 3CGWA 4MB2A 2EJTA 1HL7A 3P45A 3VPHA 4MW6A 1SBZA 3SHTA 1J07A 1MUUA 4L3WA 1Y8ZA 1UKAA 1WB5A 3FTDA 3MWDB 4UASA 3VJRA 2D54A 821PA 1OX6A 2R6DA 3KZMA 2JIPA 3OIFA 2HH9A 4B0PA 4CMCA 8OHMA 5KS2A 2XB2A 1P1JA 3MB5A 3VZPA 1U28A 3CF2A 1M7BA 1T5TA 4W6ZA 1K0UA 2QAGB 2O3SA 2RC6A 2W2VA 3AIOA 4A2CA 3WNCA 1Z7EA 4J0FA 1P2UA 2O0KA 4R2XA 5BPFA 3W06A 1XNGA 2WYUA 4LZJA 4KB5A 1PJRA 3STHA 3WRWA 4B7UA 3S8YA 1P31A 5EVCA 3FB1A 2XMRA 4L95C 1Y7PA 1T9AA 1VJ1A 4ONEA 3I5XA 3BGIA 3H3FA 4PZ9A 3OE7D 2JF0A 5AW7A 4TWBA 5GGYA 5FPHA 4HRXA 3P97A 3JVIA 3LQRA 2KB0A 3HTXA 1NN3A 1XP5A 2FLKA 2ZE6A 3CKYA 2IZ5A 4FJ0A 1VIMA 4LYFA 5HBRA 4TYNA 1APBA 2DU8A 5GGXA 4L3VA 1G8PA 3UB4A 2Q3MA 3T54A 3HG7A 4KG7A 3L04A 1KSHA 1RU3A 2V5UA 4WD3A 5J1TB 1DAKA 4W7SA 1RYMA 1JI0A 2QY9A 2NXJA 3FWPA 2XD4A 3ZDEA 3IMEA 3T3EA 2QRVB 5HPYB 4RHXA 1BSVA 3I53A 3J7AC 1JAYA 1WSWA 1XLUA 3ZBQA 3ETHA 4GWGA 4NARA 1QH8B 2HKIA 3TTUA 3IAAA 1PG2A 3U1TA 2WE7A 3NHBA 1SZPA 4UQLA 4WVLA 3DJFA 2KLHA 2DYKA 1TKBA 3KHUA 4Y2PA 4ZU3A 5JH7B 1GPLA 5J63A 1GCGA 1UAAA 1GZ5A 4GBED 1BE1A 2BMDA 5DBGA 3FOAA 4HEHA 4K1LA 5G1OA 1GQOA 3OO1A 4EA9A 1AU9A 2JGJA 3DOJA 2WFMA 3R3JA 4UD2A 1TL7C 1ZHFA 1N2SA 4MR9B 3GJ0A 1IJEA 1TGYA 2I4TA 3OIVA 2M6LA 3LPCA 1VIVA 1Z5OA 3CWZA 4LRWA 5B2ZA 3ZU4A 3KQOA 4IIJB 4MUGA 4LTNA 4YCLA 5HIAA 2MSCB 4E5YA 3KVOA 3AGPA 4K6GA 3CW8X 4LDRA 3B5JA 1EP1B 4YK7A 3Q7IA 4AULA 1J2RA 2FPPA 2BMWA 3PQFA 1UDBA 4P3YA 2O6LA 1KOFA 3CISA 4EJ2A 1TGVA 3KM0A 4L22A 3IKLA 2PUCA 3K30A 3K9CA 2PUDA 2X4DA 4XCXA 2ZJ3A 3JXEA 4WBNA 1CJMA 2B61A 2OAGA 1YS1X 2P8SA 3VRHA 2YJGA 1P81A 2JFGA 3M9LA 1E3IA 1QG2A 2WSIA 2KE5A 4X95A 4P58A 2NTVA 5FWXA 4WT7A 5KYNA 2A9QA 1XP8A 3AHGA 1IM2A 3IQGX 3FYUC 4OH7A 1OYOA 1K8XB 4P38A 1XQYA 1A2KC 2ADMA 3M4JA 4JMLA 2Z2XA 4O63O 1EFVB 5IYZB 5CFNA 3HZHA 4UBIA 4CQMD 2WHXA 3HKBB 2ZR9A 4IPTA 2NPFA 1SC1A 4OI4A 4L5AA 3ST7A 4BATA 1KFEB 3ICOA 5C7LO 1K0FA 4KYTA 2PFKA 2DWCA 4D8UA 4PHCA 3PC7A 4Q4JB 4DNFA 3CKKA 4LTDA 1O95D 4WPGA 1T5OA 1U0GA 4J8PA 3NTQA 4TMZA 3P0HA 4UE6A 1FVXA 1O89A 2LVBA 3HRKA 5DK4A 1G7CA 2DX7A 2LR0A 4I50A 3N74A 4Q9IA 1D6NA 5CYPA 1XGKA 3VDMA 3DM9B 5C8YF 1KZ4A 1BDJA 1PJ4A 2ZJ0A 2G09A 4HQOA 3QWAA 3WBBA 3OHMA 4XFDA 1EP9A 4ZA2A 3IR7A 3ZXSA 3DEIA 2BM1A 1RHJA 4O8ZA 4RZQA 3RTEA 5A2QA 1YVPA 3W77A 3U4AA 3AL2A 3ASUA 3HUUA 2QLLA 3EQ8A 1F06A 2LTAA 1QC5A 3AKYA 3U17A 3FJ1A 2VQ3A 2VNAA 3PYXA 3WMEA 5HKKA 3F3YA 3SBDA 5FFFA 2EIHA 2B4QA 4YXFA 3BK2A 4HWGA 4BTLA 2ZUBA 2WUFA 5GONA 4UTNA 1HE3A 4FD3A 4A27A 5ANRB 5K4GA 5EOVA 3A9UA 3OKAA 1M1YB 1FMTA 2OHJA 3C74A 2XNHA 4A36A 3UJ8A 1H1LA 1Y8CA 1KA9H 4L51A 2QD5A 3OEEA 4XARA 1JUDA 2CJWA 1SBCA 1JB1A 3SQMA 4B0OA 4HMOA 3FGPA 3P0FA 3SU8A 4B43A 2B5WA 1J0BA 1JU4A 4FLFA 4YJKA 1LUAA 3D0RA 4QVKA 4AXBA 4JC8A 1M2GA 1ACMA 3ILHA 4PW0A 5EYPB 3TXAA 1FX0A 3NAZA 1JQLB 3M6XA 1AV6A 5JNVA 4IGKA 1JHQA 3KUXA 1YMQA 2OO3A 4BUCA 3WYFA 1L7OA 3AEYA 4P53A 4JB2A 5GP1A 4B7CA 1WDMA 3WK8A 2D62A 4IS3A 4QHTA 4ZMRA 2FPIA 2JAQA 4X84A 1VCHA 4RC9A 1VC2A 4OI1A 3HBNA 5CEEA 2IZZA 5KOHA 2R96A 2DGDA 5D00A 3F5DA 6AT1A 3KR1A 2ZSAA 4D92A 1RZUA 2HJHA 1SXHA 3IEXA 3DE3X 3IE2A 4AWXA 5CB4F 2ZUWA 5AOVA 2D2XA 5BUQA 2C7QA 5D87A 2OQVA 2P1RA 4MKFA 2PX6A 2R6AA 4MQ5A 3W05A 2JFPA 5HA5A 3VGJA 3LGSA 4P4LA 2PRJA 2ZIXB 4X1YB 2J3DA 1ZK4A 3T5CA 1GPAA 4W4TA 2CNKA 4B71A 1NW6A 3L0SA 1N0UA 3C70A 4BO8A 2O1EA 4D9IA 3HV0A 4HNHA 1JDBC 1BRMA 4WLUA 3M33A 4N3GA 3D6NB 4NOLA 4IHJA 4IDCA 4GRAA 2NU8B 1YE3A 5JAOA 1VGQA 3TD2A 1YZFA 5F1PA 4O6VA 1W5SA 1NXOA 2YQ5A 3GRVA 4J0EA 4X7RA 4ZT5A 3PX2A 1GPBA 3CJQA 2D5BA 5DCLA 1YDHA 1MOQA 4K8OA 1QRDA 5KC8A 4K6OA 2OWDA 4S0XA 3GCXA 2I6GA 4G0QA 1G7RA 1C7QA 2CL6X 3EGXA 5A3VA 3WWYA 1FFBA 4EG0A 3RAFC 1M8FA 1TF5A 1E9RA 1GQYA 1S3GA 1W5EA 2HA3A 4ZT4A 2ZQ5A 2OO5A 1OE0A 3B89A 2OXIA 4F4DA 2BR3A 3B7GA 1FXWA 4G6ZA 4K9DA 4CT5A 3E3NA 4Z54A 4XQ9A 5FWDA 3LECA 5EUMA 3WFJA 1NBHA 1W36D 2GM5A 4FJ1A 1GPNA 2GT1A 2G9UA 4H4DA 4MP6A 1MKYA 2E37A 3DLCA 2GAFA 5DWDA 2X0DA 3WZLA 4CEHA 3I1JA 1P8JA 4RLQA 1KBZA 4PANA 5HFNA 4X24A 2VZ8A 3PB3A 3RRNA 3DTVA 1RQPA 4MMXB 2IHUA 1CBUA 5DTJA 1OXUA 3FHJA 3FPBA 1PJBA 1NLZA 3HWRA 2ID4A 2VWPA 2VSFA 1JIIA 5CA0B 2VP3A 5DULA 4S05A 4N7BA 4Z9XA 1QONA 2VP9A 5C52B 3PFGA 1AO3A 2OV4A 1OC2A 4O2AA 4CGYA 2V65A 3DUWA 1SN7A 2HW8A 1ABBA 4AQ7A 4JLVA 4Q4HB 3R9IA 1QHIA 1JG7A 2SKDA 3OOYA 4Y1RB 1N2GA 1A9QA 1S6YA 2UZ1B 3FNQA 3ISTA 3IUMA 4LZNA 3VAZA 4QG3A 3U60B 5M7EA 5D3MB 3ZCVA 2V4UA 3L46A 1L7PA 3T7SA 5EZYF 2YZ2A 5I7SA 1RM3A 1SCUA 5GOTA 1P73A 2OK8A 4TMYA 4C43A 5TRTA 5JUWA 2R8EA 1BKYA 4U2DA 2QT1A 2D06A 1QRSA 4ZCQA 1P7ZA 1R64A 2HF2A 4LKRA 4ZZ0A 1KO5A 3LZ6A 3RJ9A 3PCTA 1I94B 1LPOA 5GM2A 3IELA 3OCXA 5FDFA 1R8JA 2JJ1A 3GGJA 4FHEA 3UAWA 1SHJA 2OVFA 5BV7A 4D97A 2HN9A 3IP1A 4IO0A 1H6AA 4HS4A 2ABWA 2O3RA 4X1IA 5DCYA 4ZQGA 5HOQA 2ALJA 1U0OC 2I2WA 1SCBA 2BH2A 5A7FA 2VUIB 4U7DA 1MMFB 1NLMA 2X13A 3WKDA 1M2VA 3OY2A 5ICSA 4FQ8A 2XBLA 2FLWA 1TZBA 1XELA 1Y3DE 2FPKA 1G8SA 1YBMA 1BQ4A 2B9EA 2R5FA 3GUYA 3PFCA 2WF6A 2LV8A 2OBNA 1A27A 1HWYA 2PKQP 2Z83A 1LB1B 2RBKA 1VOTA 2GPYA 3E5NA 2P3SA 2VNIA 3I04M 4HEQA 5KI6A 5KTRA 1U1FA 2J09A 3NHLA 1GM5A 1PNOA 4YMIA 4CW7A 1ADYA 2FG5A 4PLTA 3FH0A 2PVPA 1SQSA 2HEIA 4DUGA 5JLJA 3G0IA 4ATNA 4BEJA 3DWEX 4C21A 1Z7BA 4R1TA 4F4JA 2I2CA 3KOWA 1OLXA 3DB2A 2QLFA 3SYLA 2I2XB 1XX6A 1BMDA 3N8IA 4MB6A 4WAUA 4L6AA 5IANA 4ARZA 5H3HA 5C32A 1U90A 4Z51A 4UHBA 3IVMA 5C81A 2ZSIA 4Y1GA 4OLJA 3ZQ4A 3ECAA 1FRNA 3X1MA 5J4KA 1TM7E 4TL8A 5AW9A 3T35A 3OFND 3G2OA 5FP0A 4TTRA 2EFGA 3LDUA 4FTWA 2PL3A 3H2YA 4BO7A 3I5AA 1PJSA 4P4TA 3GJTA 4RPCA 4ZGGA 1KPGA 3VX4A 1ECGA 2OORC 5E1MA 5FD8A 1F9AA 2DPYA 4JAVC 4L02A 3AG6A 2W6PA 4ZDWA 5IWAB 1MOZA 4JUAA 3R41A 4LVOA 4WESB 1XCBA 3KPYA 1FRVA 2AG8A 3FBGA 3NB0A 5I9BA 4ZFNA 2E18A 1L5HA 3RC1A 2R65A 3HXKA 4MPRA 4MJ7A 1G3QA 4L2IB 3STWA 3ZE7A 4QXPA 2QUBA 2VOEA 4Q1EA 2XQGA 3ZZNA 1IHDA 3B1KA 2C94A 1JMVA 4Z9BA 1E1MA 3PVZA 2I8LA 3C5CA 3OZEA 3QPDA 3FROA 2B92A 1YBVA 2CD9A 4RXUA 1HKHA 4DSUA 2I62A 2ON6A 1WQ3A 2Z8XA 4G5FA 1SPBS 5I9LA 4O59O 1C3JA 2CZGA 1G66A 4RXTA 1DUVG 1L5ZA 1F5NA 2F8LA 2H0QA 4KFUA 5AJHA 4LJRA 1G5HA 4XGKA 1E32A 3ONDA 3SP1A 2DLDA 1O97C 3QY9A 5IEBA 4K81B 2AZMA 3LOQA 4R68A 3Q2IA 4Q4LA 1EJ2A 4MS4B 2LKDA 3PR3A 2RAFA 2DHDA 2R8RA 5D5QA 3PVCA 3EN0A 5B37A 3I73A 4N9WA 3TEJA 5F64A 4ENQA 4G2TA 5F98A 1DVRA 5FTJA 2XT0A 2WF5A 1QHHB 5IJWA 2IYEA 2EEPA 4UOQA 3VNRA 4IFTA 1V1RB 2AOVA 3DW1X 1TYCA 5G4KB 2DWPA 4C0KA 3VHLB 4AN0A 5IG2A 1NR5A 1X87A 1NF8A 1JQ5A 2JJ8A 3JQ6A 2XTJA 2NO6A 3ZDCA 5TMEA 1E8DA 1JKIA 3C1OA 1IOLA 3K8OE 2PU7A 3GDWA 5LP6A 2H2FA 1XO1A 3HA5A 3AU8A 3VKHA 4R1PA 4B6EA 2V9ZA 1A96A 4YJGB 3ROZA 4KI0A 3MD0A 5JSFA 2PWPA 3EEOA 3QIAA 1K9VF 2JD2A 2OKCA 1E59A 3C87A 3JTMA 4RKWA 2BGIA 3ZV5A 4U00A 5TPWB 4PEVA 4F12A 5IZCC 3TNDA 1KI6A 5P8WA 2YJ5A 1Z0AA 4FYHA 1KY2A 4QBGB 5HJ2A 1W5BA 2ZE8A 4Q48A 3UK6A 2IK8A 4CMGA 3A14A 5HZKA 1G9TA 2BFFA 2R1VA 4AY6A 3N05A 1R1DA 4O4HB 3ZR4B 4CQMB 3A6PC 4TXHA 1Q11A 4RPGA 5CYGA 3AM1A 4BAGA 3UKOA 4PG4A 4BBAA 1I2AA 4MW0A 3FWYA 4CTKA 3OCYA 4BFSA 4BFWA 1LFDB 1Q0SA 1E1DA 2QGFA 3DOFA 1JKFA 4AJ2A 4L85A 4ZCRA 3WZ2A 2IUTA 4JR0A 3LZDA 1FUYB 1R6TA 2JGKA 3DEHA 4YH1A 3UPDA 1OUMA 2NWQA 4WINA 2GFQA 4I55A 4FE3A 4G81A 4GC9A 5HHTA 2RKBA 2FX5A 3ZDYB 5K05A 2CSXA 1GZDA 1EX7A 5JO9A 4MV3A 2L2QA 4PAGA 2B83A 3AINA 3PF9A 2G67A 4QUIA 5JYDA 2K2WA 2FDRA 5AOCA 4YIHA 4LNHA 3A6EA 2GTHA 2ZRPA 3G2QA 3GLKA 1A8UA 1JEQB 1S8NA 1PWHA 2CVQA 3ESDA 2OHGA 5EUCA 5HIJA 1D2HA 3N2GB 1JEYA 1QOQB 2GBLA 2CY0A 1HDRA 2XZDA 3CRQA 4MS3B 1E9AA 1X39A 4I8IA 4CIDA 3M4XA 2OA0A 1MA0A 4BCCA 2QF7A 3JYNA 1RXVA 3IODA 4JJ4A 3GPBA 1E1KA 2OQRA 2ZRBA 5CYOA 4EUFA 3NHAA 2VYCA 4N40A 2JLUA 4ZVOA 2JJMA 3VHQA 4ZO7A 3DE1X 1FJ2A 5LQDA 3GMDA 1Y7TA 4UFPA 2P4UA 2QM8A 3KTOA 1E61A 1M1UA 3OM9A 4F4HA 4P35A 3ZWPA 5K01A 2AN4A 1KZ7B 5K8CA 2PA0A 5CBPA 3A4YA 3TD9A 2EGUA 3OQVA 3BMQA 3LUPA 1TO6A 1G7TA 3QX7A 1V1MB 3SICE 3IP7A 4M98A 4MQEB 4LBYA 4QBFA 3ZQ6A 3FDFA 2BCJQ 4YRPA 4NOJA 3C3BA 2Y76A 2QUAA 4AMBA 3NRJA 2DM6A 2WB2A 3DGFC 3HSSA 2I9PA 3O2QB 1OFUX 1DAOA 2GCIA 2Z8YA 3Q6NA 4FS3A 4KWCA 1TOAA 3WNBA 3SWWA 4HY3A 5CJPA 3GZJA 5DM60 5LJIA 3OF5A 1DNPA 3DHEA 2PGOA 4HI0E 4IVQA 1L7AA 1VLJA 1BDBA 4QXOA 4YJ2F 4JXZA 3UPUA 1L3IA 2QMZA 2JBWA 3M5WA 2YHUA 1T2DA 3CN7A 4CLRB 4OFZA 4RMHA 2OD9A 5HX7A 3FOCA 3GGOA 4BX2A 4XLLA 5JYCA 3C6KA 3M6LA 4JDUA 3MWYW 1IN4A 1N2IA 4TL6A 2ZBVA 2XMQA 3STYA 1Z62A 4FHGA 4DSOA 4C30A 4B33A 1T91A 4NG5A 5EHZA 1YOBA 3O3CA 3OTIA 4FYKA 1DJMA 5K8VA 5LZ7A 3NHMA 3QWBA 1I30A 1JTEA 3GAFA 5FRDA 1COWA 2ZYDA 3U31A 1HNNA 2NUAA 3NEJA 1JPJA 4KBGA 4DF3A 5C53B 5IHXA 2IDKA 521PA 1Y6QA 3GFPA 1Y4SA 4C6RA 3SS7X 3LRPA 5EJAA 3LX5A 5CVEA 4DLSA 5K0GA 3L6CA 3B1YA 1YVUA 3CMCO 3GJYA 3OBBA 1D2NA 1KI3A 1RW4A 1W30A 2QK4A 2VAWA 1V7PC 2A35A 2G63A 2R87A 3ZHZA 4NY1A 2WP8J 4ESEA 3QUAA 1EP2B 9ATCA 1YZTA 3L8ZA 1FP4A 3NQ41 4LY0A 1JB9A 4MZXA 1JTFA 3GJZA 1W36B 4P5EA 2NACA 5H16A 1QKJA 3DBOB 4W5JA 1AS0A 2IW1A 4NV0A 4C7XA 1DC3A 3OIDA 3EG9B 2FETA 4L0MA 2W11A 4W1RA 5L3SA 3EQ9A 3DE7X 3LX8A 4J76A 3VGPA 3C41J 4EHFA 4G0WA 4YMWA 3DZKA 1M1XB 2VUSA 1QWSA 2OESA 5I5GA 3SYMA 1IXSB 2G5CA 1VJGA 2CKMA 3D2AA 5AI5A 4HGNA 1OWMA 2IU3A 2PL5A 5BVGB 1QVVA 1OXBB 1SRQA 2EJBA 4BB0A 2G5GX 3ETNA 3OE1A 4PCAA 1PG0A 2XGOA 5KTKA 2ZT8A 3W8EA 1Q6YA 3LX6A 2QSJA 4MRMA 2XVAA 3K0EA 4AYXA 2CUKA 5M3BA 1THGA 1E4EB 4N5HX 4WSOA 3VDXA 1C7JA 1VCOA 3DKPA 4Q03A 4OHCA 4JA2A 2G5PA 1XL0A 3RIYA 1E2IA 1Y4ZA 4HWSA 4B6QA 421PA 2RGRA 1KGSA 3OLCX 1OOEA 1XQWA 2JIRA 4S24A 1VCNA 3SIRA 3CVYA 1SU4A 4PBRA 2J5RA 3FMIA 2I91A 3VU9B 1VBKA 3JWIA 1KBOA 4X5OA 1GL9B 3QUBA 5CPFA 1X1RA 1YZHA 2INGX 3M6WA 2QJOA 3AETA 4WKCA 7MHTA 3ZDFA 3MPOA 4KDEA 1V71A 3IIMA 5A4FS 1AB6A 4JR2A 5GADl 1N77A 1DLIA 2NXCA 3K3PA 4RDXA 3IOCA 3MWKA 3FKJA 5TB5A 5JXWA 2FEMA 4AJPA 2JJ2D 4M9UA 3FWNA 1QXSA 4XEHA 1V6CA 3J81k 5D5HA 1TYDE 2WWIA 3RVPA 4BV9A 1EWTA 3RKRA 1TKAA 3MWDA 5H80A 4Z2YA 1W76A 4ZT6A 3P9KA 1QP0A 3WK9A 1BHJA 1JHRA 1GG8A 1TJPB 2DZDA 2K5UA 3DVLA 3GCGA 4MEAA 3X1JA 4ESHA 4R31A 4YCCA 2QAGA 2FWPA 3FTEA 4L8GA 2X22A 2A59A 3ZVKA 2O4UX 2OB2A 4ZVLA 2ZXEA 2JGIA 4ON9A 2H9YA 2AEMA 4RHCA 5AM4A 2EKPA 4QTZA 3V4OA 4KYIB 1O6FA 1XDSA 5AHXA 1VP9A 5KNDA 1RTKA 5DRTA 2FFRA 2Q2OA 5DV9A 2GK3A 1E1NA 4KRGA 2X76A 2I2FA 3FTNA 3AJRA 2GPBA 2C4UA 1BN7A 1GQQA 2XNDA 3WX0A 5B1IA 2W2KB 3AKEA 3HP4A 2OPBA 4QD3A 4O3FA 5DK6A 3RHFA 3ZX4A 2AB0A 1CWUA 3MT9A 3I0MA 4AX8A 1SCJA 3K72B 3CZAA 5B1YA 3M6IA 2I54A 3BTVA 1B73A 4AUMA 4AXXA 5KTTA 2Y1CA 4QU9A 2QYHA 2Z4RA 3H99A 3OECA 3PNSA 3B20A 1T5IA 5FI0B 2QRVA 1PKXA 2H1CA 4NX2A 1Z29A 2VNHA 3CWCA 3JY6A 2ZTVA 4FN4A 4MPJA 4YVFA 4B4UA 4CFSA 2VR1A 4E5VA 5ESDA 5LQCA 1QH8A 4DHEA 5KYWA 4S0ZA 4G8CA 4PYNA 2LP4Y 3LM8A 2ZU0C 1I24A 1N78A 5JMWA 3N8GA 5JH7A 1L5QA 3RPEA 1ARZA 4B3HA 4UATA 1U0TA 4ME6A 5BYJA 2ZYIA 4QU8A 2V59A 3WJAA 5DFAA 1XDWA 2FHSA 2XKBA 2C9DA 3F46A 4EGCB 1T1RA 3NJ8A 4P08A 1S89A 4MR9A 1CUUA 1G8JA 3VDNB 5DX8A 2PGDA 4QRDA 3MGGA 2C0PA 5ICMA 1RYFA 4IIJA 4B32A 1HE4A 2AC4A 5K0NA 2QR5A 4FEYA 1H2BA 2EZ9A 2ZBUA 3HJAA 1DS6A 1E7WA 2EHJA 3PEFA 4RF3A 1NPDA 4UTZA 2B82A 1N6RA 3KL4A 4DILA 1FJGB 4HATA 4OJTA 3RVDA 1M6NA 3M1YA 4HLUC 5DHPA 3RS0A 4YRSA 2ODEA 1H2YA 5BMVF 1LS1A 3OEYA 4DJDC 3U44A 1PT6A 4PSVA 1PSZA 1XU7A 3QYFA 3RJTA 4A92A 4UTRA 5AM2A 2E5FA 5AKHA 3T0GA 4ASUA 3F8TA 4MUAA 3KP1A 3V9AA 1ZUWA 3TRFA 2GH1A 2JI8A 4CZ2A 4XGQA 3TZBA 3BBLA 1YSCA 2C5AA 4JKIA 3KPUA 1XZAA 3HL4A 3JQFA 4LJ8A 4F60A 3VUFA 3UA3A 3C85A 4FYJA 3LY5A 3JYLA 5AVWA 2P9TA 4EG5A 3R8FA 5BORA 4H17A 3DF9A 3SDSA 1ZEJA 3IKVA 2WKQA 2PQ6A 3V7UA 3HB4X 3RVSA 1LQUA 3DZFA 4C22A 2QD3A 2ZYGA 3N2NA 4L8LA 4OXNA 1U0BB 4N8EA 5KQMA 3WAJA 3NYRA 4N49A 3D5TA 3L7OA 1UR5A 1EFVA 4PFJA 5IYZA 1NWCA 1W9MA 1J23A 1NFFA 3HVKA 3NETA 3HKBA 2FR0A 1R3UA 4HH0A 1G16A 2AJTA 4B46A 3L0YA 3CO5A 4L4YA 1P3Y1 1V26A 4Q4JA 1K66A 2NQ8A 4UAVA 4QPNA 3L4BA 4B2IA 1TA0A 3NTUA 3CHYA 4C0XA 5ILOA 4JP3A 1L5MA 4DCTA 3EULA 3V1MA 2DQKA 3GBSA 4LFBB 5L3QB 2BUCA 4FD2A 2G5TA 4KR9A 2ZJZA 3HLYA 1T6NA 3R7WB 4ND7A 4C0WA 3A6KA 3H4VA 5AVXA 3QSYA 3ICWA 3C4JA 1NMSA 4WDRA 3T9CA 2QD2A 1F20A 4UUQA 4PZZA 3WG9A 1LXCA 1E64A 1U8YA 1VSTA 2JANA 3SLGA 1WVIA 4O33A 4MQUA 7ADHA 1KAMA 3GRKA 4I7EA 4PBSA 1KQOA 1I33A 2Q6VA 4JJEA 1F48A 4WN3A 3JAMA 1ZJZA 1JBEA 1PU2A 1DOZA 3BUSA 4DSAA 1M1YA 2DRIA 3IBSA 2QW1A 1ITZA 5YASA 1UPBA 3VDQA 3IAFA 4G2NA 1H22A 3T6KA 4QGHA 4UU7A 4DABA 2AG1A 3EDRA 4EHKA 5KOIA 2PMCA 1KVRA 2QE6A 1H2ZA 1WV1A 4TMKA 1B16A 1XE3A 3D8TA 5EYPA 5FBRB 4F97A 4XRGA 4EHNA 2FOLA 5CB0A 2B7LA 1BFUA 2Y1FA 3G1UA 1E9BA 2GRJA 2GTPA 1UPUA 4JASB 1QUEA 1VZ2A 1OV4A 3K70D 2PJRA 2WU3A 4AD8A 5JATA 2WU8A 4FZJA 4DT1A 1Y9JA 2BSAA 2C7PA 3UT0A 2HD4A 3VO9A 3O8OA 3E1KA 1N33B 3JRXA 3Q9LA 2AEFA 1JFVA 2IYRA 1ZD4A 2J87A 4HLNA 3HS3A 3GEMA 2OHOA 1FLNA 1O54A 1B1AA 4IEFB 4LMRA 4QPPA 3ZLBA 4G25A 3FHTA 4LE2A 2VAPA 3SXPA 1YCHA 1R0XA 3CLRC 1D5WA 1N7GA 4XVHA 5DDIP 5EKXA 2WUEA 2ZE5A 4OHFA 2HF7A 3LWNA 4L7QA 1M3SA 3MCTA 2ZIXA 3EZGA 3WJ2A 1K5GA 3MLEA 5JJCA 2XH8A 1Y5RA 2XB8A 3QVXA 1E1YA 1I01A 3QU4A 3LYHA 1UXGA 2E5WA 5F78A 3KALA 4L78A 5DM1A 3SF8B 2FPOA 3CZCA 3BWCA 2NU8A 1G6KA 1D4ZA 3F6PA 3IAXA 4Q0MA 3W2FA 4M8SA 4OXKA 3QNUA 1FYWA 2BGNA 1XROA 3GR6A 4HQ6A 4MV1A 5DM4A 1SY7A 4TRMA 2QVZX 1QLJA 1YJQA 4FQ5A 4OATA 2W6JA 4PR3A 2VK2A 2ZGVA 4Z49A 1BDHA 4TZ6A 5DSZA 4LPSA 5ARBA 3PQ7A 4OOFA 5DISB 2FP3A 3BHJA 3AEZA 3N2KB 1A9TA 3ASZA 5J2TF 3E3MA 3E27A 1YDEA 3H1FA 2RE8A 5F33A 2A5FA 3RLFA 1H8EA 1LF5A 2POQX 4PV7A 3F7MA 1DL5A 1TTHA 1Z4KA 2HUNA 4G5XA 4M1MA 4NK4A 2MDTA 4DCOA 1FPMA 2B1QA 3QKIA 4KBFA 4XD7A 2Z6QA 4GLOA 2V74B 2JGEA 5DHRA 4D46A 3FPKA 1W9HA 2E3JA 4YT4A 3HJUA 2WD9A 3DL0A 2VEDA 1TA9A 5G02A 3UJ9A 3UNXA 1KO1A 2QTAA 2Y3IA 2ZB4A 4J75A 5AMXA 3ANTA 2II6A 5K6AC 4ENTA 1R50A 2NPIA 3TZCA 4B85A 5CA0A 5MN4A 3JWJA 4P31A 5FEUA 2AZDA 2GD1O 2D74A 4C20A 2DHQA 3R4VA 5ALNA 3OOHA 4EX6A 4I2NA 1XRPA 1NNLA 2JGFA 3EVAA 3VSAA 3Q88A 4JVMA 3QUQA 3FYTA 1WMSA 4Q4HA 1E5TA 5A5FA 3QPAA 4Y1RA 2CVPA 4J43A 3ONEA 4LJYA 3PUWA 4Q05A 1LZKA 5FBWB 2PX3A 2CYAA 1JFFB 4FFPA 2WHYA 5D3MA 2VDOB 3FI9A 2WVJA 3OA2A 4DV7B 2H16A 4MTLA 4DB4A 3PNMA 3PP8A 1JG3A 3A7DA 4NAUA 4B5KA 1SC6A 5J47A 3EZ9A 3NM4A 4HR7A 1UEIA 4V03A 3DMTA 5DNCA 1XCJA 1RYHA 2NQ2C 3T7AA 1RLMA 3EGOA 4IXNA 5DP1A 3DO5A 5C80A 2R4TA 5GZ3A 2HQ1A 1PWEA 4BE7B 1IUKA 5CIWA 1NW4A 1FNNA 2R0QC 4UM9D 4C6HA 1XEWY 1H4TA 3D81A 1SRRA 5FPSA 4N76A 1EWVA 4QUDA 2QSYA 5EE0A 1L5FA 3OIUA 1VECA 2O1XA 2VZ0A 4Z4EA 4LOJA 1WKBA 3FN4A 4ER7A 3AJEA 1D9ZA 3CVVA 3OJLA 5I7EA 1P61B 4REMA 1G8YA 5BUSA 3L7MA 2VF8A 3RRBA 3EF0A 1ORDA 3T7KA 3D7LA 3HBLA 4WJZA 1C8VB 1N2CE 2ISCA 1B0ZA 2DPLA 2DTEA 1SHZA 1I80A 2GM3A 2V3VA 3B6ZA 3JVDA 3LHIA 4IIDA 5E4JA 3GAMA 3Q7TA 4JUCA 4D5GA 4DA9A 3E82A 3K1YA 4JSTA 4DZRA 4RF5A 4X3CA 1SIWA 3F6SA 4MK4A 1GWNA 2ZJ8A 3LBFA 4F1KA 2RARA 4LHEA 4LSMA 3ZPXA 1UZNA 1QFJA 3W6ZA 3RH0A 1NULA 3MUOA 3OZWA 1I51A 1F2TB 2C54A 2ZDQA 4MUFA 3CUTA 4OLBA 2PMWB 1HK7A 2EW8A 5B58T 1RJFA 1WLSA 1V1JA 2ENUA 1D1PA 2ID9A 2QL7A 5T41A 3UKJA 3LT4A 2AN3A 2BFWA 1Z3CA 4ZVQA 3AYZB 2Q50A 4Z7NB 2KBFA 2RKOA 3LFTA 4DM4A 4YRAA 1W4ZA 2RKWA 4ZAYA 2BRUA 3DWGA 2P6PA 2Q8PA 3H2KA 3IJRA 3MLAA 2VXCA 3S7ZA 1U94A 3D0QA 2QX7A 1QOZA 1Y0BA 2IOFK 3HC7A 2CJPA 3TRIA 4CIXA 1H2HA 5AXAA 2QU8A 4BRWA 4E7PA 3K9FC 3GI1A 4EY8A 4L2IA 4J4TA 3SZGA 3RE1A 1WTCA 2WP0A 4DQDA 4OGFA 5C8VA 4MCAA 4DC1A 1WLYA 1T9CA 2A6PA 1U2DA 1KERA 2V7QD 1HQYE 1XEFA 3OPQA 4U5XA 1LPAB 3H83A 1WDLA 1V37A 5FLKA 4ZRDA 1S02A 4DREA 3AEQB 1A69A 3HN7A 1Z7YA 3KZKA 4UQPA 2JGMA 5E7QA 1KZHA 3BFXA 3O2NA 3ZC3A 4MS1B 1WUYA 2A1IA 4B6JA 3MC1A 1OI2A 1DRVA 5KNBD 3S44A 3ZZ1A 3IV6A 5KINB 2PRYA 2G82A 4CKBB 3IOEA 2P6OA 4IYRA 2NXEA 3Q0IA 4MICA 4YRBA 1IXRC 2C9CA 3MJDA 5D1HA 4DW8A 5LXTB 2X19A 3T9AA 2ATXA 2ZPAA 3DV0B 1N6KA 3KXIA 3OO0A 3OU7A 4MS4A 1CQIA 1EXMA 1W4RA 2IHBA 4HEA1 4Z0PA 1JPUA 4Q9AA 1XF1A 1NJ1A 5FYQA 3C1AA 4O4JB 2IQ5A 5F3RA 1VRWA 2JFUA 3V4ZA 7REQB 1QHHA 1KAEA 3QMPA 3QOXA 3RUDA 4F7WA 5IZ4A 1V1RA 4FNAA 1O96B 5FH9A 5K45A 5G4KA 1DIHA 1XYYA 1UPAA 2SECE 3WKEA 4EUEA 3TTSA 4P98A 1JSLA 4U7WA 1NDUA 3VPAA 3LCJA 2E82A 4J3FA 1T29A 4YWJA 4JYZA 2I67A 5EIBD 1W35A 1MZVA 3O3MB 2NSYA 3TI9A 3KQMA 2P41A 1RSZA 4OTZA 4YJGA 4MUBA 7YASA 4TMWA 5JRZA 1PE0A 4NG4A 2XUAA 3BX1A 4NFYA 3RSHA 1L4HA 1DC6A 2DPXA 1M0WA 2I8AA 2QL9A 3EX7C 2NP6A 4WXRA 2YH2A 3A1TA 5TPWA 4RQAA 2IHKA 4AP6A 4F9GA 1CZLA 3SHOA 1SOUA 4CKXA 5ITVA 1ZZGA 1T4BA 1RFLA 2ARKA 4FCTA 4EO9A 3R20A 3SLKA 1XZMA 4QQ8A 3WNDA 5C18A 1ZD3A 4O4HA 5LUAA 4CQMA 1MVLA 3EZXA 1Q83A 3H7IA 3SEAA 1P6XA 3VPFA 5JVDF 3DXZA 2F90A 1XUOA 2VCYA 2XE8A 3ND6A 2Q6TA 5T4HA 4E12A 4EY5A 4MVJD 3SIXA 3WQRA 3ABOB 3PZRA 4D0NA 3LY9A 1PTJA 1Z2OX 2XITA 4RE5A 2WPDD 4RACA 4Z0NA 2GZHA 3HO6A 4JIMA 1MQ9A 4DEVA 4W8HA 5LYJB 4ETNA 2X4IA 3GWGA 2BP7B 5JARA 2RK3A 3T95A 5K9ZA 1SBNE 3EQ7A 3TRHA 1UT8A 4Y9TA 4Y98A 2ST1A 1LC0A 3HFSA 4I8DA 3B78A 3RNLA 1X74A 3WAGA 1XYVA 3Q10A 1EFKA 1UM9B 3Q4GA 1E5LA 2N42A 3C8DA 3OOSA 1Q0HA 2Q6OA 4NU5A 3EAQA 4Y0NA 3IUQA 1JLKA 4QLBA 1JEQA 1TADA 5DCWA 2CXPA 1C8KA 3BD6A 4F45A 2EFDB 1D7OA 3N2GA 1DUIA 3T4XA 3WNQA 1DQZA 1IEVA 1G3RA 3T7EA 4MRPA 3GFFA 2W6CX 4MS3A 2O4CA 1YMVA 4UNQA 3AB3A 5L8VA 1X1EA 3HY4A 4QUHA 5L6LB 1OH6A 3IR6A 1HF3A 4HAIA 1D8TA 3HHEA 2ATCA 5AT1A 5FUWA 1Y1RA 3BORA 4JJAA 4PTZA 3SKVA 3AR5A 3GG9A 5ALPA 2IYTA 2WINI 1ISMA 5P21A 4E6PA 4G0VA 4QREA 3NC1C 2JIOA 3GNQA 3KV1A 3LUCA 4P84A 3SM9A 4GAEA 2NSDA 3KG2A 3GJ5A 2RH5A 2X2PA 4QFMA 4BVAA 3NOQA 3CV3A 3A6FA 3O8RA 4XSVA 1FPQA 5B58C 5DNUA 5I7HA 5DYWA 3PR1A 2OMEA 1HT2E 4GWKA 1T2AA 4HVTA 1MZPA 5KVSA 2UUAB 1Z6ZA 3D5QA 3HWSA 2P9CA 4RETA 1V1MA 1BO6A 1BHSA 3K70B 4JI4B 1PZNA 2ZJ5A 4Z3KA 3YASA 1I6WA 1CR6A 1VMDA 1SD1A 1AZLA 3PRHA 2ICAA 4EB8A 2I4MA 3B5IA 2JARA 3UKDA 4HX9A 1XA4A 3P0IA 3W4KA 1BAPA 1RHRA 3FZEA 3IHLA 3W2EA 1Y1PA 2BEUB 1TMKA 3CZRA 1Q12A 2WAXA 4UQOA 3BFJA 3HKDB 2WNHA 3H5VA 5AKKA 3LRTA 4J9VA 4CNQA 3WDMA 1KF0A 2X1HA 1T0UA 4BZPA 4F1WA 3ER9A 4PGHA 1R5NA 3PD1A 121PA 3A6JA 1SNYA 2XY4A 3KZ1E 3R0ZA 4ZPJA 2WVGA 4NPCA 1A9XA 2YWGA 4FMDF 4CLRA 1HXHA 4WFQA 3R1IA 5KVQA 4DRXB 3UWSA 4NIMA 4UEQA 3PJRA 4RIFA 4DR7B 4GKJB 5FJJA 2UYHA 2JK0A 2QM7A 3HZZA 4KE9A 3M6VA 4N3AA 13PKA 5KWSA 1BXRB 2CJXA 4MOWA 1C1DB 2FZ5A 3RUEA 1QFYA 4NE7A 1FBTA 3DW3X 1ZD2P 3CRMA 4M0LA 2BOVA 1NYLA 2J3KA 5FWYB 5IUKC 3VI4B 3OLXA 2P9ZA 1XG5A 4HNSA 3OPYB 5T64A 3U6KA 1JA0A 2I4IA 3LOUA 3MTDA 3FAKA 4B34A 4TROA 1U5CA 1XA0A 2B6HA 2QJTA 4ZI3A 5EA2A 4V3BA 3WWZA 2X2EA 2BMVA 1TB4A 3P4YA 3UICA 3HVHA 3OZRA 2YY7A 4JB3A 5C5EA 2BM9A 1GZSA 3C7DB 3WLTA 5T57A 3K16A 5BUZA 1VXOA 2Y1XA 3DQZA 4L9RA 4LYAA 1NOIA 3GLGE 4YLEA 1UK8A 1MIHA 4WASA 4PRLA 1IVSA 4ETIA 2XCQA 1X8LA 4LYJA 3A28A 3WR5A 4ZAZA 1BCSB 1XDDA 3HE3A 3EG9A 3NLLA 3VR2D 5FBHA 4X65B 4G97A 4IDBA 1NIJA 1AX9A 2OSVA 3CVUA 1F60A 1O8BA 1V4BA 4AICA 2JFXA 1VE6A 1MX1A 1CRWG 3BTSA 3UUEA 4C4RA 1L6IA 3FM9A 3KZXA 3C14C 1NXXA 2Q3DA 5IAEA 1NM5A 1Z45A 3BDIA 3E70C 2L19A 3IX7A 4UFOA 4M4SA 5C31A 3RR2A 3SS9X 5IFKA 5BVGA 3HXPA 4GZ5A 4U9HS 4YB8A 2CSUA 4MWSA 5CXSA 4HS9A 1KH2A 3DWFA 3T3PB 1L7BA 4BMOB 4EMSA 4A5OA 1E2PA 3TXXA 4ZTBA 1TM4E 2GCPA 1CY1A 1J7JA 2XVMA 3LPLA 1R8SA 4HMPA 5I4CA 1DIAA 2X15A 4A8JB 5KTPA 5GIOE 2ZRFA 3EVEA 1E4EA 3U80A 4F93B 2O8EB 1JR3D 4DIDA 1UEJA 2AE1A 4LI0A 4R5MA 2GXAA 1QIKA 1KQPA 2O7RA 1ZLXA 1XN4A 3TB4A 4OHOA 5L45A 1ZESA 3W5CA 2DY0A 3RU9A 3AUFA 1NYQA 3CZ5A 1K4YA 2A0XA 2FR8C 2R751 3U7HB 1X3SA 1OWPA 1QP8A 2C31A 2GZSA 1KJ9A 3TR0A 3HXOA 3QPUA 4YHHB 1SOWA 5T3YA 3UHOA 3VU9A 1E4OA 2C7VA 4KVAA 1PEAA 1ZUD1 4M9CA 2FSHA 2C2HA 3N7TA 1TO2E 3EA4A 1JT2A 4IJWA 3Q1LA 4JUFA 4UVGA 5AJWA 4ZEXA 3VBCA 4TT3A 1QKKA 2FW0A 1MABB 3IQEA 3WLHA 2JHPA 3ICQB 1VDMA 3ROPA 2VJOA 4AMYA 3F5QA 4HDMB 1KS2A 1QHFA 1AZSC 2IEIA 1WUHS 4HFMA 5MFPA 3G59A 4YY3B 4RPLA 1T3GA 2X5OA 4F6CA 3PSAA 5IT4A 1RWQA 4M76B 3IVCA 1U8TA 1N8SA 3TXYA 4C6TA 4PS0A 4AM8A 2VHXA 3KJQA 4JC4A 4E88A 5IF3A 3WGNA 4JI7B 3V8PA 2YHIB 1BROA 1GD1O 3OU6A 3H8JA 5IBPA 3DO6A 1ISRA 4H16A 2IRWA 2FE1A 4TYPA 1USIA 2HIGA 1UPXA 3CNBA 3IMCA 1K98A 3EW9A 3LL7A 4KQ1A 2IPNA 4JODA 1KJNA 3A0RB 1F8UA 3G82C 1EFRD 4MKZA 3N8NA 1ZITA 1PJ8A 3O9MA 3GPCA 4QJ3A 4L4RA 3MJSA 4GU5A 1X9HA 5HW0A 1ABFA 1CW2B 4MRAA 2WJGA 2X3FA 3ZJ5A 2EP5A 5ESXA 4EJ6A 2W42A 4X62B 1ZJ5A 1EUYA 1Q22A 3LQ1A 3OX3A 3R5JA 1WW2A 1HH4A 5JNRA 2W2KA 1ZA1A 2GESA 1QMPA 4FYXA 4QRHA 4ZANA 2R8OA 3MIZA 1PLLA 2A1TS 2YMQA 1JU3A 1RAHA 4KI7A 4ENRA 5B4TA 3ZYZA 1AF4A 2V0NA 1NX9A 3UJNA 4N3BA 3U3XA 2JAPA 3C45A 2IYXA 1YVRA 1ABEA 5PGMA 2TMYA 4HB3A 1U9YA 2CVHA 2ZPTX 5K0TA 3L9WA 1SA0B 4HRYA 2Y93A 4ZTZB 5B7NA 4RD1A 3BJEA 3K0FB 4NBWA 4BVLA 3X44A 3GMSA 4ZC8A 1LPSA 1P5RA 2VPQA 4PQGA 1VLHA 2CXHA 1Y5IA 2AI2A 4HDNB 4LYEA 5FKJA 2AFHE 3ZWCA 2R3SA 2Z9BA 4D9EA 4K26A 4DG5A 5TQ0B 3TQTA 5JYEA 1IN6A 3P9PA 4BRZA 4ER0A 3CH4B 1C9YA 4RPHA 4K05A 3A9TA 3U9TA 3V8NA 2R62A 1L7VC 1NKSA 3BGVA 4IXWA 2C5EA 1M8GA 1O5OA 4CEJB 4OL9A 3V8QA 1QDUA 5LA6A 1GNPA 4QM7A 3KFVA 4D25A 1U02A 2IT1A 3WKBA 1BFDA 3KZCA 4LC1A 2ONYA 3C5HA 4LYDA 4ZREA 5LYYA 3QE0A 1CUEA 2QL6A 3DFMA 3SKYA 2SHKA 2PYDA 3GV0A 4TV8F 4LV6A 4B45A 2VI5A 2WWRA 1PG5A 2Y0CA 1L5GB 4J3JA 1C2YA 3UAZA 2ET6A 3ZDRA 4RVSA 5BPHA 2CFRA 5FL7D 4LCEA 1C80A 1QKIA 1KDTA 1VRCA 4MDHA 3S8EA 2UZ0A 2Y27A 4R8VA 1XSEA 5JYBA 2JFBA 3KZOA 4OP2A 1Z28A 3ZGNA 2PL1A 4KDRA 2F62A 1G6HA 4NU0A 2WUWE 5B1SA 3QUSA 3LZCA 3WADA 5ALQA 4JOQA 4KODA 3ABRB 1G42A 3U3RA 4OG2A 5FBZA 4IICA 2P79A 1E2MA 3X0DA 3ZI7A 4YTEA 2ZSHA 2NPOA 3K2IA 3L6BA 4CUZA 1M0EA 4LZLA 1NRIA 4BQQA 3FETA 3UCFA 3BCRA 3ZS8A 5IABA 4TLMB 1WULS 1ZLYA 4XSGA 2JKYA 2ISQA 3GRAA 4F4FA 1O8CA 2DVMA 5J2UB 4OXRA 3T5MA 3ZQKA 3FFBA 1NMEA 5T4BA 2HJRA 1C14A 4FM9A 2AR9A 5JPIA 2PD3A 2J5XA 4I50F 1X1CA 1W581 3DBIA 3KQNA 3TLGB 1C0IA 4EZIA 1CRZA 1D6JA 2BKEA 1BFKA 1YHNA 4I3HA 4GR5A 3GFTA 1CYDA 2ODBA 3G68A 4OB6A 5EQJB 1BMFD 5BT9A 4ACBA 4US2R 1Q0TA 3IKJA 4OI2A 4LF8B 5EMKA 4XDHA 4MQMA 5AK3A 1S3SA 5L3QA 1GXSB 3IBFA 3MWFA 3HJHA 4KMRA 3NFRA 1VE5A 2CLEB 2WJHA 4QSMA 3R7WA 1UL1X 2Z0MA 4R8LA 2XMGA 5CX4A 2GYYA 3JD3A 1KVSA 1T8UA 4LBVA 4OHUA 1U9IA 4BX8A 2W6ZA 4HO1X 3A6GA 1Z82A 3D2CA 1QH9A 2E4ZA 2YWBA 4TV9F 1HC7A 2B0JA 3IQDB 4QHSA 5DBHX 3FMGA 4G1FA 1Y34E 2BGWA 3IAEA 2AHRA 1Q92A 3HDHA 3BBPA 3FRHA 1FFXB 2ANCA 1ZMTA 4HNQA 1Y1KE 4ZVSA 1L3BA 3ZUGA 3ZJYA 5JCJD 3THYB 2JLWA 1KDPA 3E0XA 3ABZA 3I2YX 4UZSA 2Q7OE 4LQDA 3T3MB 3WHPA 1TM2A 1J56A 3NUGA 4FT4A 5TDHA 2PSSA 4H7KA 2Z5FA 3HJFA 3O8CA 4PSKA 3IGFA 2UAGA 1XK7A 1ZI8A 1GTG1 4AJOA 2H5EA 4FFBB 3CZMA 4FVTA 2GSDA 1WETA 2OGTA 3DFFA 4MO9A 3B1FA 5JDIC 3C98A 3UZUA 2GJSA 3TNJA 4F86A 1PQWA 1RRPA 3DO8A 3VNBA 3T0IA 5LC1A 2O23A 3KFXA 3EZ6A 3EMKA 1FX1A 4OO3A 1V8DA 2ZBQA 1VHLA 1XHFA 1Z9BA 3C5EA 3HBJA 4E51A 2HCTA 4EKEA 3RT7A 4XQCA 3WK7A 1XHLA 2I9KA 4WBXC 1RM4A 1V35A 3T4UA 2DQYA 2EGHA 2W8ZA 3WOVA 3ZBUA 5HVNA 5AHOA 4QJBA 3IERA 2WTXA 1M2OB 5KSWB 1FW6A 3H9CA 3UMBA 3GDOA 2HPAA 3Q5EA 4TZ0A 4MVXA 4OLFA 4LE0A 4AZ3B 2I34A 2PUGA 1D2EA 3VR6A 2JFYA 1EAMA 1DX6A 1YHZA 2GN9A 2XVYA 2Y9PB 4ZZIA 4S1WA 5CA1F 1IONA 4AX4A 4ZI7B 3R0QA 3LGXA 3PXCX 3SF8A 4CMEC 3AJ9A 5LU8A 1V4NA 3QLVC 3GW8A 1G2IA 4UTXA 1KYYA 5CUQA 1TECE 4Y9UA 1XFAA 2XA2A 5UKDA 4QDTA 4EB6B 1Q0RA 4IUYA 3HZRA 2PX5A 4HFRA 2O2XA 4IFBA 1MORA 4QPDA 3TE6A 2MIIA 1IZYA 4NK5A 2GKGA 4V0ME 2JDID 4JI5B 4BXOB 5ER9A 1BW9B 4C3OB 4E2XA 1CZOA 1IG0A 2LRHA 2GILA 4R01A 1Q15A 1BEUB 3SX2A 3ZHYA 3PCRB 3OTGA 1SQGA 1DKPA 4PZUA 3ZKAA 2IXGA 2JFVA 4EG3A 4EW2A 5CDFE 1WVMA 3WA6A 1I5RA 2ZTLA 4KHPB 3CPSA 5TV2A 3ZXUB 1RPZA 4AI6A 2JS7A 3Q3IA 1JEAA 3OZAA 3FYUB 1KI7A 3CLKA 3WGLA 4EQ6B 1MDBA 4HAUA 2QS9A 2WSMA 3UM9A 1W7AA 3ET4A 4FYYA 3B6MA 1CB7A 3H2IA 5A06A 4YV7A 4Z3OA 1VSBA 4GM4A 1X2EA 3C3CA 4GPZA 3LUJA 2RH9B 3A1DA 1HYBA 4C7BA 3PSHA 3HJBA 2XRZA 1MFPA 1XTIA 4NONA 1FSFA 3U62A 2IYWA 4G0NA 4AN1A 4CBVA 2P77A 3RFVA 1UBTS 1DCMA 1YR2A 3REGA 2EBUA 1Y98A 4DB2A 1WL8A 2HDHA 3EC7A 2R6CA 2C7BA 1X0XA 1W6RA 2HOQA 2PGXA 3HKEB 4H7IA 5EC8A 1C1XB 4EPWA 1TTPB 1KYQA 5B36A 4OKIA 2C78A 1JFFA 3BH0A 4R8KA 4HZUB 2CF5A 4U6NA 1TAHA 2X41A 3UA4A 1X1BA 3RUCA 1BKSB 1UZAA 4QXMA 1MC4A 1DJPA 3E03A 3UV7A 1JJBA 2DQSA 3KJFA 1EUCB 2XZTA 1NRWA 1JVBA 2GD6A 1RWNA 1C5KA 1NUHA 2CDRA 2LXNA 3BWEA 3G9XA 4FGKA 3N70A 2DFNA 2YYZA 3DHVA 4RF2A 4X6LA 2IXTA 2CT8A 3OWOA 4RGYA 1G20E 5AW0A 1OSNA 2QEQA 5EIXA 1SK9A 3I2FA 3OUUA 1W4LA 4QLOA 4DLZA 1SVSA 3QX9A 1II0A 4CUKA 2IV7A 4PYQA 3UF0A 3L6DA 5IAKA 1MB4A 3U48A 3GXBA 2BDUA 2GARA 5B3KA 4JLWA 1UBEA 4REQB 5G2OA 3EYAA 3O8QB 4NZOA 5JG7A 3KNZA 3X2FA 5AIAA 5AR1A 3NBZC 4AS3A 1H9BA 2ZJ1A 4RZ3A 3TZEA 1A77A 1GN8A 1OJ7A 3IURA 3V4SA 1SC3A 2ZM6B 1RHUA 4J1SA 3L6EA 4QFCA 1M75A 3ADOA 2KSQA 5KC9A 3IMKA 4I1RA 1QV9A 1XL1A 1DTEA 1JYFA 4OUDB 4YREA 2E0IA 3VTZA 2WU1A 3U7GA 2Z58A 1OXVA 3PENA 3ED5A 4LCBA 1O9GA 4LHXA 4M87A 4M8LA 1GPMA 4TX1A 2IHNA 1R8QA 1DQYA 1O6ZA 1ZO8A 4TLDA 3ZDDA 5LZ9A 5BQ3A 3VC1A 4WERA 3M3HA 5F1KA 3OWXA 4EYQA 1XEWX 1TC2A 4G8DA 1XC7A 4XVUA 4Z6KA 2C83A 1AE1A 1DIRA 1ICEA 5CJ2A 2R00C 5E2AA 3ADDA 4HCJA 1ILWA 4B8ZA 5F7OA 1Y5NA 1F2TA 5FNZA 5G3ZA 1RJ9B 1T36B 2IDJA 3OFVA 4FDLA 2C3YA 3DC2A 4X7BA 3ZH2A 3JQ9C 4ZIRB 4J16A 3PC2A 3EIUA 3OPYI 2HY7A 3NKFA 3PPIA 1G6OA 1BN6A 3U61B 4FKBA 2DKNA 4MROA 1ZJWA 3RQSA 5JWHA 1PEDA 3I32A 1QPZA 3RC8A 1Z4OA 1FU8A 5SV2A 3G8CA 4QT0A 3SFTA 2XWPA 3DS8A 3LL4A 1ZUNB 2BFPA 4QTTB 4RNCA 2MMCA 3GN1A 3IFSA 2WG2A 2XW6A 3CX7A 5EJGA 1Y3CE 5JS7A 4XJTA 5K03A 2CHVA 5D51S 1NY6A 4INOA 3S2EA 1A98A 3ILVA 3NGLA 1YASA 2DLCX 1G18A 4DLPA 4I5DA 1XMOB 3B8HA 2PSJA 4P3NA 5IVDA 5LMZA 4DV4B 1SH7A 1VTKA 3NZEA 2FMXA 2CW5A 2H2WA 2YS7A 4W9RA 2ZYVX 3AR4A 1GRRA 4LJSA 3AEQA 1NU6A 3A05A 4EDHA 5J4HA 1K6XA 4E0BA 4W9MC 4YCSA 2OYRA 3TJZA 4MS1A 4HDCA 5BSHA 3U16A 4HJXA 4BLPA 1QO0D 2WF7A 3FSRA 4FFDA 4LRXA 4BNYA 1V11A 3HB1A 3MQ2A 1DDIA 3SY8A 3LP8A 4CKBA 3G1TA 2WVAA 5DW0A 1UOQA 3H5RA 3LT1A 2ETXA 4W9NC 2O2GA 3BEOA 4WKPA 5PNTA 1DTSA 3KEGA 1O0BA 2V3WA 2GS9A 3DV0A 1Q1AA 3HYNA 3O84A 2ZS7A 5EWJB 5FV4A 1RE1A 2XADA 3DD5A 4B73A 1OREA 1KC1A 2NTNA 2OGZA 1R0WA 2QN1A 1K3UB 3IC5A 4GNKA 3REFA 1SCNE 1DIGA 3E2MA 1CFJA 1JE1A 4O4JA 4U9IS 2ETVA 3ZWMA 1YJBA 7REQA 3NS7A 4J7AA 3OCUA 5ALXA 3ZWOA 8ATCA 3DVSX 1UT5A 1WDWB 1I4LD 3QV1A 4LXQA 1O96A 2QUHA 4JEUA 4NWIA 3RHTA 5AK0A 1H2WA 5ALMA 1FNMA 1Y9DA 3HDVA 4M54A 3UBMA 2WFLB 3ZXIA 2DH5A 3A3PA 1NBAA 3O8DA 4IRMA 4XYMA 1ZW6A 5DGCA 5IBRA 3K09A 4MR8B 3RFFA 4B31A 3HEAA 4QT4A 3I01A 4HNGA 2FW8A 3LCCA 2IBSA 2HMWA 1SPXA 3AERB 3QP9A 4M60A 4M89A 2VDQB 4AZWA 1M7HA 4MINA 1KVUA 3WBKA 3H2ZA 2WI8A 5DTQA 4D9CA 1HDIA 1HNXB 5G53C 1P29A 3I61A 2FUNB 4IJUA 4YI3A 5A9TA 1KHTA 1YCGA 4K5QA 3AR8A 4PAOA 4YRZA 2ATIA 5G0UA 4MB0A 2B3DA 2PS1A 1I7SB 1GNQA 1MU0A 3FKSA 3JD0A 3KUUA 4IZIA 1B0AA 2WRZA 3ZLTA 4IX1A 2Y4NA 1N8KA 1A97A 5ELXA 5KVCA 5LSAA 3ROTA 1L4MA 5AESA 1FDVA 1VHWA 2B21A 1NKTA 4I55F 5E7JA 1DG3A 2D4AA 3QU7A 4YJ3B 3QHQA 2AKAB 4MCJA 3B9BA 1FB5A 3GJ6A 3DFIA 2YNMC 4EVRA 3RV4A 3DDUA 2A8YA 4EEXA 1B0UA 2IODA 1IAQA 5LYJA 3PUYA 2A0FA 1A8QA 2BP7A 1SUAA 2YX1A 3O9VA 1CQJB 4IXDA 5DIFA 3KT8A 3M6UA 4LZOA 1CIVA 3K1JA 3LCUA 3W8FA 5I9IA 3OIGA 5JCPA 3BCSA 5CJJA 1UM9A 1Y8AA 3WO0A 5AKJA 4RA9B 4UJ5A 1HEYA 5K0BA 1IK6A 4N65A 3EA0A 5HTKA 1N2CB 2P2LA 3ANXA 3N8KA 2CLLB 2GUWA 4WGGA 4JQCA 3RBAA 4Q7EA 1SIOA 3LT2A 1E1QA 2GQ0A 3EGIA 5TNXA 1WIWA 2GF2A 4QELA 1TE2A 3U56A 2G28A 4MAFA 5DKFA 4Q01A 3QKRB 2ONCA 4H31A 2CNWD 3L6RA 3FTFA 3PDIB 1YV9A 2XUOA 1GVHA 3UUGA 3EPKA 1RKBA 5TGTA 3CR7A 2YKGA 3T94A 1HPLA 2ZWVA 1Y8QB 3BTUA 3JQ7B 3KVYA 1YZLA 1N2BA 1ONOA 1OROA 3E9MA 1FDSA 5DHSA 2AW5A 3RI3A 3NPMA 1BS2A 1PEKE 5ADWA 3ACDA 5HM6A 3AJ8A 4N9QA 5EJMA 1BGVA 3TEFA 2VK8A 3URKA 4NP6A 1IOZA 3CH5A 3IJEB 4KFRA 1I1NA 2JHCA 3RW9A 1LBHA 1HQDA 5CH3A 4L50A 2QZSA 1PLJA 1A9XB 2A14A 2Z5GA 1GUYA 3AI3A 2WJ6A 3O0DA 1FYDA 1GQFA 1MJHA 2B8TA 2PRZA 3KUDA 3LTNC 1K3TA 1F6WA 2HNAA 2PKXA 4GVLA 4HWPA 3EMBA 4MLDA 4QGGA 4BPBA 1F3OA 4BGDA 3RS8A 2FLVA 4BFLA 1U2TA 4Z4IA 4Q1FA 5ALYA 2BEUA 4PPQA 4XQGA 5G41A 5EHXA 5JHGB 3HKDA 3MNFA 4YRLA 2OXFA 4FGUA 4J1TC 4UVEA 1SFRA 1CY6A 4OA8A 4PPFA 4U7PB 3NNSA 4IO1A 5GV7A 4PINA 1G8AA 1ISHA 1U99A 2N1BA 3QUTA 4QYIB 1Z15A 4Y6GB 2HWKA 2Z8ZA 4RK0A 3O90A 4BWVA 1RP7A 4P3PA 3PR2B 3WNVA 2YIDA 3U7JA 1R10A 3CLTD 3ORSA 4KPUB 2JEYA 4DRXA 1I4EB 3ND8A 1M72A 4C87A 4E1VA 4MA0A 1B23P 4JH0A 1FP7A 3T9EA 5AWFC 2NVOA 4BN5A 2HTEA 3LBYA 1ZH8A 5K0SA 4J0HA 1BXRA 4J3NA 4HTFB 3T5PA 1ISPA 5I4BA 1C1DA 4M9XA 1TX4B 1Q3TA 3KD2A 3O83A 3R44A 4X8OA 1EZ4A 2I2AA 5FWYA 3HUTA 1E1RA 2EC5A 4DA6A 2GCEA 5JJBA 2CDAA 1U3UA 5B7PA 5C4MA 3KR0A 3OPYA 1NL3A 4MRRA 1YJ8A 1TQDA 5IKMA 3WGJA 3IT1A 5K6TA 3GGCA 4KN5A 1TCUA 1BH2A 2G7MC 3K5PA 5AVSA 4TUYB 1F51E 4EARA 3SZLA 4BC0A 4R16A 5L40A 2N3ZA 3QFHA 1YZUA 2PX2A 3I9OA 4AJNA 2XBMA 1HYGA 1L7RA 1YKSA 1HI9A 2ODNA 2G9NA 1FIUA 2PS9A 2X4LA 3LSTA 4L8YA 5MN6A 3G02A 4OQXA 1TW3A 4RVDA 3I92A 1BCSA 3FTPA 3KYCB 1I13A 4HDSB 1NVVQ 1UH5A 4MW2A 4MYCA 5DYIA 1ZISA 1AQJA 1YA4A 1NF2A 1ZRMA 3PFKA 3SJCA 5ES3A 1C1HA 4IVRA 1IFXA 2QTHA 5ALZA 2CMDA 2W71A 1LS6A 5HDQA 3TJRA 4DCSA 2IX3A 4BNGA 2PGJA 3H8WA 3PIDA 1B7GO 2VK1A 1D4AA 3KELA 4BB6A 3DMRA 1X6VA 4TTPA 6Q21A 4V0RA 5DMHA 3I4LA 1SU7A 2YN0A 3FUXA 4W5HA 5NULA 5KUTA 3NBQA 1AQNA 4F91B 3RT9A 2I4NA 4IUCS 3W9BA 1AGRA 3ZY5A 3A31A 1TJ4A 5A3JA 4R98A 4AS2A 2Z98A 1UAGA 2QVXX 4A8JA 3SQWA 3TS1A 1L5LA 1NSTA 2HTFA 5FHQA 2O8EA 4BNIA 1Y7IA 3IAM6 2CK3D 2LW7A 1KJYA 1Q0LA 2IS4A 2GASA 5TVKA 5JI3E 4QQNA 3T5GA 4UM8B 2NV6A 4IWNA 5FUVA 1TJ3A 2C5GA 2WJIA 3B38A 3ZTTA 2ZB7A 4DKXA 1XXHE 4PE5B 2VDLB 3D1VA 2VHCA 4FFNA 1BG6A 4ZO8A 2MMGA 3W1VA 3IQZA 2GHTA 2B1RA 2BJVA 2Q9AA 1HEUA 2J41A 1C9EA 3OUZA 3U4MA 3FDJA 4DLXA 3PHGA 5BSVA 2PUJA 3CVWA 1XJ5A 1DHTA 2HBRA 3DMPA 3HXTA 4JOBA 4ZEVA 2WHPB 4FMCB 1II9A 1SOAA 1MABA 6REQB 3RRMA 4EPTA 2P2NA 4C6SA 1DFIA 3TB6A 4LWQA 4HDMA 1T8TA 1P77A 2G36A 1JDUA 4GXRA 4BFYA 4C88A 1VMKA 4DBVO 5C1DA 1IBMB 4C89A 1NBEA 1IHXA 5DBOA 3I8OA 1PKEA 3FOZA 2HV9A 4B3GA 2PKYX 1TD9A 1DKUA 1Y3AA 1YL7A 2DR3A 2QVGA 2XYRA 2XRMA 3B53X 4RESA 3COYA 2L42A 5HS6A 3AM4A 3NWEA 2OAEA 2EZUA 5TIIA 5JIBA 4GMKA 1P1KA 3FMVA 1OTYA 4FOSA 2V6BA 3FVVA 2ZUDA 3Q98A 1XF9A 5BOSB 1ZHHA 2JGNA 3WQQA 1VPTA 1A5SB 2BE7A 3QPCA 4GO1A 4HLQB 4M1YA 3S55A 4B7ZA 4ENUA 5K8JB 3C3DA 5A3QA 3VZSA 3MPUA 3OKCA 3W3ZB 1K7FB 3DMHA 2FU5C 2ZAOA 1JZSA 3ZTYA 2EXXA 5KU7A 1YDGA 2XCIA 5F3WB 1NW7A 1XTPA 4WXMA 4G23A 4Q9LA 4A4DA 4DR1B 4MGHA 2B4AA 3LLMA 1SXJE 2REXB 2WJ4A 1TA4A 3AV0B 2PSDA 3KB2A 3I6BA 1IIRA 2DUJA 2ZBRA 3T9BA 6CHYA 3L41A 3AUUA 2I6SA 1KYZA 4WACA 4DCMA 2OO7A 5KAMA 4NMHA 5ETJA 4JBLA 4OKSA 2PYIA 4ZALA 1ZPDA 4RJIA 1N25A 4DNXA 2HFJA 2ZTSA 4CCWA 1R9MA 4HN4B 3IVAA 1SA0A 3KQQA 1MW8X 3D59A 4DLBA 2