1A1SA

Ornithine carbamoyltransferase from pyrococcus furiosus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
313
structure length
313
Chain Sequence
VVSLAGRDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcarbamylase
molecule keywords ORNITHINE CARBAMOYLTRANSFERASE
publication title The crystal structure of Pyrococcus furiosus ornithine carbamoyltransferase reveals a key role for oligomerization in enzyme stability at extremely high temperatures.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 116
structure length 313
sequence length 313
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 1997-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 1a1sA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 1a1sA01
2HSEA 1AKMA 1ACMA 3TPFA 1ORTA 1R0CA 5G1NA 5ILQA 4AT1A 2H3EA 3MPUA 3KZKA 8ATCA 1A1SA 3D7SA 1C9YA 3L06A 3L04A 2AT1A 4JQOA 1DUVG 4AM8A 2EF0A 2RGWA 4KH1A 4FYYA 3M4NA 4NF2A 1ML4A 3R7LA 3UPDA 2P2GA 1NBEA 4FYXA 4ANFA 1ZA2A 2QG9A 4FYVA 3M5DA 3Q98A 1TTHA 2G7MC 7AT1A 3D6NB 3L05A 3M4JA 1EKXA 4BJHB 2BE9A 1RAAA 1RACA 1ZA1A 4KWTA 1FVOA 1D09A 1TUGA 9ATCA 1Q95A 1EZZA 3AT1A 4KH0A 4A8PA 1JS1X 4F04A 3TXXA 4KGZA 1VLVA 6AT1A 3KZNA 4IV5A 2FZKA 3KZOA 2FZGA 4AMUA 2A0FA 4H31A 4JFRA 5AT1A 1RABA 3M5CA 4EP1A 3E2PA 4EKNB 3GD5A 3GRFA 3NPMA 1SKUA 5G1OA 1RAEA 1TU0A 3CSUA 3L02A 4KGXA 2FG7C 1RAIA 4A8HA 1F1BA 8AT1A 2IPOA 3LXMA 1RAGA 1OTHA 1RAFA 1RADA 4KGVA 1EP9A 4FYWA 2BE7A 2FG6C 2YFKA 2AIRA 2OTCA 4WTOA 4F2GA 4OH7A 3KZCA 1AT1A 1PG5A 4JHXA 5G1PA 1FB5A 1PVVA 1XJWA 1I5OA 1R0BA 2W37A 2I6UA 3SDSA 2QGFA 4A8TA 1DXHA 2FZCA 3R7DA 4E2FA 2ATCA 3R7FA 1RAHA 3KZMA
chains in the Genus database with same CATH superfamily
3PHHA 3D7NA 1IH8A 3UWOA 5GIOE 2QSZA 1FTYA 1MB2A 1JEJA 1B8PA 3EGWA 1G8KA 3EG5A 1BRMA 2HBRA 1XZBA 3GJ3A 2BF7A 4UMEA 3ROZA 3SGLA 3IAHA 3WRWA 4OHYA 2G28A 1IXKA 1EWRA 3AMVA 3NXSA 3O1LA 1P7CA 1ZZEA 3TUIC 3WNQA 5K99A 1J0DA 4NU5A 1WUHS 3IRVA 4FINA 4TTIA 4YIKA 3W5HA 4H7DA 3JD4A 4HH0A 1D6SA 3MTBA 2F9FA 3PRKE 4UBLA 2GXUA 1XHLA 2I1VB 4ZODA 5ENVA 3DE3X 1MG0A 1O3YA 1B0AA 1NUUA 2GJSA 2YV5A 4B3CA 3CRRA 1L5WA 4KB5A 4CT5A 2NT3A 3EQ9A 4GBMA 3JQ6A 2ONYA 4PZUA 1A8IA 1ZINA 3CLUC 3HGMA 4C88A 1KMIY 1SVMA 1YOVA 5CR9A 5ITZA 1M67A 4L2IB 1N9ZA 3RS5A 3FGZA 3VU0A 1EDDA 1RYMA 4D42A 5CT8A 4FGLA 3TIIA 1PQYA 4KV7A 5D86A 3X3HA 1QHEA 3KKZA 4V39A 2C82A 5KI6A 1OLXA 3Q9UA 1RAAA 2FW7A 4A73A 4CMBA 2NO0A 3OECA 3OLCX 3I76A 4OKIA 4ZKDA 1HE4A 3X1XA 3OQIB 4Z7OB 5C4GB 1YQTA 4AI6A 3NH9A 3OOWA 3WMWA 2KB0A 2UUCB 1TVCA 3HVKA 1FFEA 2NUAA 2O8VA 4M6WB 4UASA 2RHLA 2JI6A 3QIVA 1EIWA 1KSFX 3AINA 3KZNA 3PUXA 3RFVA 3ZW7A 3INYA 2DERA 4KR7A 2VXOA 1O94C 1Z56C 4XFJA 3LL7A 3WGGA 2L82A 3MVEA 1ID1A 1G19A 5AKKA 1O57A 3IYLW 1RHUA 1U3UA 5BN3B 2O7VA 4YT2A 3TQFA 3ZTTA 1C81A 3IDAA 3FPFA 5ALKA 5AW6A 4JSRA 1PKXA 4NK4A 4L5CA 4DLSA 2FSHA 4KIGA 2R00A 2UYCA 4LF5B 2BEKA 3G2MA 4X24A 3HR7A 2Y4NA 2ZI9A 4MEJA 3CLRD 5L4NA 4NYJR 4EPVA 4NYIQ 5HF5A 3BSFA 4GM4A 4ZO8A 3CX6A 5ALPA 4MQLA 3HABA 3DAOA 4XQ0A 1K92A 4XGNA 1E5QA 5K05A 4BQQA 4ENTA 1HOTA 4EGFA 3FOFC 2JFWA 1K2VN 1FP4A 4ZEOA 3V4SA 3BE4A 2PUCA 3EIXA 3ED5A 1UC8A 3KYDB 4IHQA 4YMUA 4TVOA 1WWKA 2CMFA 2FPWA 2OMKA 4JVLA 3ODPA 4BRUA 2VXYA 3DXZA 3NHJA 5DIZA 1SULA 3LP6A 6PFKA 1O96A 1N2XA 1JHRA 1DCFA 4ZKEA 3OTOB 2R86A 3OM9A 4JOBA 3UK1A 3M89A 4WXMA 5H16A 3SHQA 2EP7A 2A4KA 3HUTA 2PY6A 2WMDA 2Z3WA 4MGKR 2EATA 4TYPA 4B6RA 5HKKA 5IANA 5KMGA 2HSEA 5LJLA 5BN5B 2PYZA 2AD1A 4Z0HO 5E6RA 2JGAA 5TSDA 2C2GA 1G5HA 2UYYA 1RRFA 2C0PA 3GJSA 4OF4A 1YZQA 4FKMA 3VTKA 5L3RA 1OLSA 3ZV5A 1QDEA 4ZHSA 4LTMA 2E9SA 3C70A 4RF2A 5CB4A 1PZNA 5EP1A 5IDVA 2CMHA 5CBPA 1NW4A 5H3HA 1XL1A 5ALQA 3ZGLA 1I94B 3HY4A 4L4UA 1MTZA 1AXEA 3DLIA 5AHWA 4XWAA 2GCIA 2VBGA 4I4IA 1W85B 3O1JC 2Y71A 3C5WP 3HLTA 2V7BA 1G2QA 2GPTA 3G2HA 3ID6C 4WZBA 3I61A 2REOA 3GW8A 3FZQA 3OCWA 1U9IC 1GSOA 3EZLA 2Z8XA 3KZXA 4J75A 4JVSB 1PG2A 4IMJB 4O02B 2FN7A 1XROA 3D7RA 1VG0B 4W99A 1ABFA 4E21A 3J7AC 4UCWA 2Q27A 4XASA 3TB6A 5K0ZA 4MZDA 2VCYA 3K1AA 4E2ZA 1XDWA 4ZJYA 4RHTA 1E5VA 1SC3A 5I9NA 2CZCA 3TG8A 5J2TB 4JYAB 3Q8XB 2P4SA 1NU6A 1LTKA 4UAGA 2D4HA 3HWRA 2A0KA 3A2LA 4C5AA 4WFJA 5B7GA 1OILA 1XMSA 1Z47A 2PUTA 2R62A 3DMYA 2Z9BA 4XM0A 2HL6A 4AJHA 3OU2A 4D6PA 2X0NA 5DYIA 2AN5A 4G9BA 1K5PA 1AOXA 5IJ9B 1N6IA 1HDZA 4UQOA 4CUKA 5COQA 5TNXA 3ICWA 5AIBA 1OGIA 1WCIA 3FOAA 1ZC4A 2YOGA 4B7XA 4PZEA 1NX9A 3W3ZB 4JYMA 4WIAA 1IJEA 3UHFA 2B2CA 2FVXA 3WQHA 3FUCA 4KWEA 1E89A 2P6UA 1Q95A 4M0DA 5EGNA 5H68A 2GKGA 3IGFA 3BZWA 3CBGA 5IXYA 2FI1A 4MWZA 4TS4A 3WTBA 3YASA 3P7MA 1OBVA 5K2MA 3ZD8A 4AQDA 3WMRA 3T3NA 3MHTA 3ND5A 2OB2A 2PO7A 2YYZA 4UZEA 1E63A 4RX1A 3RVPA 2QAGC 1C8VB 3LXUX 3HN2A 3QGMA 5FR1A 5CDFA 2EGGA 1K3TA 3IEIA 3NP7A 1QIKA 3ZDDA 5BXQC 4WRRA 3S5JA 1T6BY 2B69A 2C31A 2P6PA 3WGLA 4A23A 4ZYXA 4ZDJA 4MITA 4Q39A 4RZIA 2XA9A 5CDGA 5AW0A 1OI4A 1M34E 1OTHA 1TMYA 2W6ID 4JUFA 4DDVA 3KSAC 1RAFA 3JZIA 4DJAA 1D0IA 1ZHFA 3CKLA 4ZEVA 1KSJA 2JD1A 1N2GA 1K0UA 2I22A 4EKDA 1ECPA 4C22A 3CWQA 4LC1A 4MS3B 3HXMA 4N0DA 1DJMA 4DGQA 1GGJA 1L5YA 1KRHA 3PDCA 4C0AC 4RQUA 4CR8A 3MWFA 2QUBA 4PIMA 5EKDA 2ZB2A 4LFCB 2WIFA 2BGGA 3MTGA 1SPXA 4LBZA 5IH7A 2VIIA 3NEJA 4RW0A 1L8XA 3G8DA 3IQZA 4JZKA 4KL8S 4E1BA 4UOZA 2J48A 4X7RA 2X2FA 4DCPA 3HJUA 3ENVA 2BFMA 1JFSA 2FEMA 2LKDA 1KR2A 4YIHA 5I7FA 4H08A 1BQ3A 1E3DA 2GCOB 3TM4A 1E1DA 3VR1A 4PLPA 3X43A 1G59A 3LX8A 3RU7A 5FT9A 1UC5B 1DAFA 3N59A 4QTXA 4XIJA 3EEOA 1EJ2A 1PW7A 1NVBA 1Y1SA 2HJHA 3QP9A 4LYFA 5H59A 2YXDA 1UZLA 1FS6A 3D0OA 2HZBA 3KJZA 5KQMA 4MK4A 2NYVA 4G5HA 4MULA 5AVKA 1TQDA 3KDSE 4YCBA 3RSZA 1Y1QA 1B2RA 2BFFB 2GN9A 2P2LA 2WP0A 4P93A 5AKXA 3UMJA 3NGLA 4WADA 1WB6A 3LZ6A 1XPUA 3NMUF 3OX4A 4KRFA 4UTVA 2BRUC 3MCTA 1WOMA 4CI9A 4IMRA 5JJ5A 5K0EA 1IN8A 1MIOB 1KHTA 5CH3A 5E9AA 1ZD8A 2GJKA 2Q0HA 2V5VA 3KALA 3S2UA 5HP4A 4I1YA 3FUTA 2G83A 4BO8A 4B0PA 4YB8A 5DNAA 3WAGA 1DKNA 1IG0A 1SVUA 4RPCA 3G02A 5DVZA 2J1LA 2XYQA 4I4LA 5DCUA 1VCNA 2W4MA 1GZHB 4KE6A 2ZJ4A 1EWKA 3ETEA 1VLQA 2B61A 1PL7A 4H1UA 3TQOA 4BBJA 3EWNA 1HQYE 2BBOA 2Q45A 1QTNA 4MPDA 2EV9A 1CQIA 4MVJI 3Q87B 5F7XA 3H5TA 5MN4A 3K8OE 3L7KA 3OC0A 5GJCA 1OR8A 3LQRA 4K6KA 2UDPA 1IHYA 2QWXA 3BJMA 3ANYB 4NCXA 5BOSB 4CL2A 3PENA 4N4AA 3QBDA 2WD8A 1NV9A 3OQVA 4Z9XA 1DAGA 3ZQKA 2P2YA 1CY4A 4NOMA 3GMIA 1V1RB 3TLCA 2QMUA 2XOXA 3GAMA 3MGAA 5J1TB 3MSXA 2ACVA 1FVOA 3H2KA 2A3RA 3HO8A 5NULA 5C31A 3I0NA 3O6VA 3D1JA 1YS1X 4WE3A 1P0IA 1JS1X 2IEBA 3A05A 3W3AH 1XWWA 3QFSA 2JGFA 5C35A 3VU3A 4TKZA 4FOSA 2C5EA 2AMVA 1GT6A 1JA9A 1YB5A 3F78A 1QZTA 3EY4A 1RJWA 5C18A 4M87A 5REQA 4OQDA 3W1EA 4D4JA 3GLSA 3GLFE 2JDID 4KR9A 3WGKA 1ZU5A 4JLOA 4TKMA 2ZRMA 5HS4A 2QK4A 1YRLA 2ZI6A 3EPRA 3U1BA 3T4XA 4RHFA 3D6HA 1SCNE 1A9QA 4BBPA 1K5DA 2W2OA 4DMKA 2PMKA 3U44A 1HSOA 3SPXA 1WVGA 4CUJA 1RI1A 2EGUA 4P53A 3D4BA 3ZY4A 1GY8A 4PCLA 2XCSB 3PFCA 1QNLA 3HKCA 4I1VA 1JFLA 2PSJA 3V8PA 3M6MD 3CF2A 3FW1A 1HEUA 4KTVE 2DT8A 3WLQA 5KOJB 2QQEA 1SIWA 2J6CA 5DWVA 1Y1RA 4YDHB 1BMFD 1QXSA 3GJ8A 1O58A 1U2RA 1I6KA 4IOKA 4MPJA 1QLHA 1VDMA 4RVFA 5AUNB 4UFOA 3GJ0A 4LWOA 3NTQA 1QF9A 1L5OA 2MWMA 5LMNB 5AHKA 3D6TB 1YA4A 3WP1B 3PSHA 4KWCA 3V97A 1UKAA 2AFIE 1YFLA 1E1KA 1Y5RA 4ZQHA 5EUQB 1PEAA 3ZGYA 4DR3B 2Q07A 3WLHA 3LT1A 3CEHA 1HZZA 2ZJ3A 3IEPA 3FPJA 1AHNA 1XEXA 1B0UA 1JA1A 3HO6A 2FSUA 3H2ZA 4ZQFA 2F1JA 3ZWWA 2FPMA 1VJ5A 2H0RA 3BDIA 4FZRA 1XWIA 4RDCA 4GXQA 5C8XA 5AM2A 1SU6A 4EBBA 1BCRB 3VHQA 4ER0A 3M3DA 3UV6A 4CXMA 1XTVA 4V1CB 4EK9A 2C88A 2VYNA 4WL0A 1C1XA 3V3KA 3TLMA 1FTNA 2VDNB 5ALNA 5KTRA 1CJVC 1MV5A 1AQLA 1DFHA 3UXEA 5L3SA 2RHCA 5B4VA 1UK7A 4G0WA 3C1AA 2W6PA 2WIDA 1TD9A 4MQFB 1W2GA 4IM7A 4M8NE 4OO3A 3H5IA 4KDCA 1N2CE 1EX7A 4MJXA 3QE0A 4LDPA 4EVSA 1LPAB 1BMQA 2X0EA 1ISPA 2O23A 3QRWA 5HIJA 4L78A 1W52X 2AQ8A 5JZSA 4HRAA 4NJEB 3TQCA 3N2KA 4CKWA 3P0EA 3R5SA 5WRFA 5I7AA 4BXOB 1X80B 4FSHA 3JV7A 4MKFA 4HN9A 4UDNA 1CPYA 2RHRA 3VKWA 4EW6A 4RHYA 3RUIA 1SXPA 1KDTA 4Q3OA 1PYOA 2AOUA 3UJCA 4ZCTA 5AWFC 1E3SA 3V80A 1GZ3A 1QYWA 1MHTA 3LSTA 1PJAA 1UL1X 1L5HB 1TTHA 2BDEA 1K6JA 1MENA 2BR3A 4QBFA 2D62A 3NHRA 4QGHA 4U7PB 2C61A 2PUGA 3IR7A 4B84A 3CT4A 1DE0A 4Z53A 4IIYA 2VTBB 3LC2O 2PTHA 3DDCA 3FRHA 1BMTA 3LO5A 4P3NA 2O0KA 2WHYA 3LRPA 3EQZA 4ZRMA 1A9ZA 3AGPA 3A9TA 3F3YA 4P86A 4FLFA 3FSRA 3L92A 5F7JA 1HFKA 4FZ5A 4HGOA 1JEYB 4R0VA 3BA1A 3CJQA 2X9QA 3V55A 2E85A 1MEJA 3B7WA 4DJDC 5KQLA 5JZ9A 3HBNA 3IPAA 2FZGA 2F43A 2PANA 2H4JA 5T64A 5KDLA 3OPQA 3PWZA 1Z22A 2G1PA 1RMQA 2H1FA 2I6QA 4KW7A 3ZY5A 3UUWA 2VDWB 2GBFA 3CNEA 3G2KA 4JUCA 7REQA 3B9PA 1DX6A 3T4PA 3MB5A 1RAIA 4X7BA 4DQXA 2VK8A 1SZJG 3B3FA 1CUYA 4YJ2F 3A1EA 2MSWA 3EMVA 3A25A 1G20E 1MH1A 3QBEA 5B64A 2HJGA 1FQWA 5EKUA 3L79A 1RBMA 2RGCA 3I5XA 2QVGA 5I3ZA 4PZLA 5F2NA 4OATA 5GZ6A 4UUOA 3T5GA 1V47A 3HNOA 1WDLA 1EA5A 5L51A 1BGWA 4HNHA 4ZOAA 3AZOA 4D45A 1PR1A 1WQ1R 3F7NA 2ZP1A 1T5SA 1DO0A 1XD2A 4PTYA 1O08A 5GIPE 2DGDA 5I9TA 4K9DA 4YAJA 1U2DA 3JQ9C 4JHXA 1W73A 2HMYB 3ICCA 1JIVA 3LCCA 1LLUA 1XTKA 4MTCA 5CNKA 1UK6A 4JJEA 2G9VA 4OSPA 3E05A 3PJRA 1JHPA 3KLBA 2B98A 2ODNA 3FYDA 4JD5A 4D8XA 4L4SA 3MQ2A 4LDZA 3TOXA 1CJBA 2B9EA 2ODPA 2RH9B 4U3JA 2CV2A 1OTYA 3BXEA 3GF4A 1BHQ1 1KIFA 1YGPA 2YWEA 1YS2X 2EBWA 2JD0A 1ODJA 1UC9A 1IQUA 2JAWA 2JARA 3WWOA 2VQFB 3ICEA 2GA8A 5EHNA 4DSOA 4ZT4A 1XTPA 4QFBA 4MIKA 4QRDA 1TVMA 1J33A 4AW9A 2VHXA 2PLWA 3D3WB 3JQAA 3LX5A 1XIVA 2X2OA 3H11B 3DV2A 1Z12A 1SBHA 3GRYA 3DV0A 4KVFA 1CQJB 1IM2A 5ICGA 3PQ5A 3UXYA 2YV4A 1R6BX 2WP8J 3ABSB 4E70A 3E61A 1H0KA 5T41A 4O08A 5A62A 4ARCA 4UMDA 1Z25A 1ICIA 2DCMA 4E1AA 3QV1A 2REQA 1JR3A 1DRUA 4KXVA 1FW8A 3PEFA 4DMRA 3WDLA 1F7UA 4H7FA 3BG5A 3LHSA 4QSMA 3VUFA 2GAOA 1WDTA 3BL5A 3PDIB 1BROA 3Q3VA 4ITUA 3T35A 5CITA 3RC8A 2B6NA 2ERYA 1P7ZA 2IV3A 2KMLA 5HS6A 5ENDA 5BN4A 3C8MA 4YRAA 3CR8A 4YALA 4JEMA 5I7RA 4AYXA 4QLBA 1E79D 4BUJA 2FWRA 3FDZB 1CQWA 2R5WA 1M66A 1PE0A 3TDKA 4CRWB 2O2XA 3DF7A 2Q5JA 4ZRNA 3WV5A 2AHOA 5F3RA 3VKVA 2I2BA 1UEIA 2I99A 1BVRA 1IY2A 1QMPA 2VG8A 1E7QA 5A3VA 3GDGA 1KZHA 1JYEA 3KQQA 2NADA 3EOZA 5KYWA 2QSUA 1FRFS 4CLOA 1ZAKA 1I1HA 4N18A 3OQ1A 4LF9B 4J94A 2GM4A 1O9HA 2YDXA 1ZVQA 1IK6A 3VU8A 3VX4A 2XUJA 5LLDA 3RK1A 1VPWA 2NO9A 2FRDA 2P2NA 4A8JC 1JFFB 1WBJB 4MEAA 4V0SA 5AI6A 1V5FA 1I7SB 2AJBA 2H4WA 3MBOA 2JLQA 5DULA 1KFBB 3NNDA 3FX2A 3DTYA 3TSZA 1AZWA 4FEAA 4MNTA 1SEVA 3WRXA 5DO9A 3A3KA 1AGNA 2EWWA 4JJFA 2I6FA 1RC1A 2CZGA 1BRTA 4IYJA 4O8ZA 5LA6F 4E1VA 5BUZA 2O2GA 3I9V1 1FYWA 4LX0A 1ENOA 1L7OA 5IMBA 3HR8A 1G64A 2ZAMA 1N0VC 3U7EB 4JASB 3GPIA 3K1TA 4YH1A 4EJFA 2N46A 4HTFA 1Z73A 1KXJA 3EB9A 5FV4A 3DCYA 3REQB 3GFGA 4FSDA 1W30A 2ES4A 3OKPA 1OBOA 3A32A 2OTCA 1OYWA 4B09A 1VBKA 3FUUA 2C78A 2QYSA 4HZUA 2MOKA 1KAHA 2BLLA 3PXCX 4RXMA 5ALYA 2FEOA 4EA9A 2Z08A 3KPYA 2GPWA 1T91A 3BMQB 1G7SA 1X86B 1OX4B 4MVJF 2I65A 5AKLA 4NL4H 3T3EA 4Z6KA 4UTOA 5HZHA 4BL5A 2FW9A 5ICSA 4D9HA 2GKOA 4PZ0A 3W6ZA 4K46A 1PTJA 4G23A 4KMMA 4B2LA 3CLKA 4OMDA 5ESWA 4ZCRA 1EFVA 2XUOA 3DDNA 2QRPA 3KUKA 4P35A 4OB6A 1SHTX 2Z1NA 1RS0A 5F51A 4U1RA 5AJWA 5JD5A 5AOVA 2X76A 2O7SA 2A0YA 2ID7A 3GA7A 3HXTA 1REQB 3TKLA 1ZAYA 4KZPA 3N87A 4R0MA 5C5DA 1LPSA 4K3VA 2HREA 5ITSA 2CLLB 2WU3A 4LGMA 5FBVB 2P9JA 4NEHB 1YD7A 3FVQA 1MO5A 1DAIA 4LW8A 4IDGA 2ICAA 4FE7A 1NW7A 3N0RA 5HEKA 2O1SA 1G8SA 1K6IA 4RSMA 1GDDA 1XXHE 4NYIR 1EU1A 4RTOA 1R3DA 1XZHA 2QN3A 3AC0A 3H97A 3L49A 1FRVA 3N2GA 4PYRA 1TEHA 3FSEA 2QXYA 4HDRB 4Q9LA 2J59A 2OORC 3E22A 5BN3A 1FYXA 4BPBA 2FVYA 1UFRA 4ZPJA 4RY0A 2V55B 1PFQA 2VPPA 4KX5A 3HYNA 2BMJA 1KDRA 4XX0A 2GD1O 3LQQA 4DEYA 1MF7A 5BWLA 5CDHA 3H2GA 4FLEA 2FPGA 4IXDA 1P2SA 3CRW1 3W04A 2OVFA 1WEKA 2QSJA 5LR6A 4F4CA 3KB2A 4E4TA 5DM60 3DZCA 5F35A 4CG0A 2JAUA 1KJYA 1SD1A 1YJAA 3FIJA 1QORA 2OBXA 4DCVA 2HA3A 2QTLA 2Z83A 2YW9A 3MTIA 1E6WA 4JSYA 1AQIA 4F21A 2O2YA 4UJ3A 4XIFA 1HH4A 3FTDA 4IFEA 2YR0A 3FETA 3RD5A 1ODKA 1Q0HA 2Z1DA 2GK3A 3BJEA 2QUZA 5D3MA 2OCIA 1OXBB 2G04A 4C4PA 5JNSA 3KL2A 1M5RA 1T8TA 3F6RA 1L1QA 1XA3A 3KYDA 3SS9X 3AVXA 1DBSA 5EUCA 2LVBA 5TQJA 4BNVA 1IQPA 1Z3IX 2K2QB 3RI3A 4KPYA 4G1MB 4X7PA 4Z2AA 3TIVA 5KINB 5JCPA 4EY6A 2XGMA 3DD1A 4FB5A 4MQ4A 1W75A 3QMPA 1PJQA 5LUBA 3V1UA 4EP1A 2QW1A 3ZS9A 3SMQA 2R96A 2WF8A 3OP1A 3PLRA 3O93A 1SOVA 4UHDA 1WZ2A 2F1RA 2A5GA 4DIEA 1TYBE 4KFCA 1SEPA 1EVEA 4PHGA 1NN3A 3FCSB 5FPSA 4EYSA 1DC4A 3GVCA 1RJ9A 4FFWA 1HKHA 1XLVA 4X61A 1HZJA 4AJ2A 1RZRA 4UM9D 2ZCVA 4FOTA 3DBVO 1FX1A 4LX8A 3AVUA 4ZREA 1BOFA 2JBHA 1R6TA 2YOHA 3QEOA 3LDAA 2XJ9A 4DC0A 2LZ0A 3K09A 3M1YA 4MVJP 4BFWA 4F72A 5CXSA 5ALUA 1SK9A 4BMPB 1CIJA 5JJCA 2VRWA 2QBYA 2CF6A 1E2BA 1NFFA 4F4FA 1SXJD 1ZH8A 2FV8A 2CNDA 3EODA 3LT0A 1B26A 1LTQA 3EXHA 5JAQA 1Q16A 2YIVX 4OJYA 3ZZTA 1S4MA 2P75A 1UM8A 3E7PA 2FW8A 1NV8A 3KYBA 4MR7A 2QOEA 4Q9DA 4BZPA 4C0WA 4FMDF 3EEIA 1C5KA 1W5FA 2OAGA 1W93A 2EKQA 1RMTA 1JPVA 2BMEA 1NXXA 2G09A 2WI8A 5UKDA 3WBFA 5CLJA 1YZ3A 1F7VA 2HYIC 2I7VA 4ZICA 2BKEA 2XMCA 4D8UA 1EAMA 2XTMA 4ZAVA 2OXCA 2SKCA 2IHYA 4UU7A 4DB4A 1NYLA 3LQYA 4RIHA 1H3EA 5C7YA 4YAEA 1GUFA 4E13A 3LT5A 1YSCA 3SXPA 5C1PA 1BYIA 4CDRA 2J5XA 2HSZA 4BBAA 1N5JA 1NASA 2QVXX 3KELA 4WY5A 5C1OA 1Q3TA 1L7DA 3AESA 3CUSA 3QIAA 5G1NA 5BORA 1PW5A 2GD2A 1D0VA 3LF2A 4KR0A 4CWAA 1SCDA 3H87A 1E20A 3DNMA 3AEQB 5BWMA 1W8IA 1DJOA 4PO9A 3S2IA 4JJAA 3L0CA 4JQZA 4D9NA 1BEEA 1G8PA 3B60A 1D2GA 2B37A 2PSHA 3EQ7A 2YVQA 3GUHA 1W2HA 2CEAA 3OO0A 4HSGA 1SVLA 1DG9A 4Z3DA 2V6IA 1J0XO 2IXTA 3FXAA 4POAA 4CMIA 1RWQA 1AKRA 1KVUA 1N9KA 1I13A 3N6VA 1QBKC 2N75A 4RMJA 1JQLB 3QKWA 4UREA 3MIZA 3PWTA 1JSRA 2O19A 4OIMA 1ZCFA 2FMKA 2GHIA 3LHDA 1LDYA 1JZQA 2RDMA 4R2MA 1J2TA 2BGLA 2AOXA 3ZU3A 1B15A 1COZA 1NM5C 3O84A 3F4LA 3H04A 4KUGA 1BA2A 1WXWA 3ZN2A 2EWMA 3TR5A 1Q2UA 1U5BA 2KW5A 1TM4E 1YAJA 4INAA 2O14A 1DTWB 3PR1A 2C2KA 1D7AA 2NSLA 2I8AA 4US0R 1Y9AA 5EG5A 5EZYA 5HTKA 2OYRA 4DREA 1L8LA 1E1YA 3ZY3A 3F74A 2H2IA 4B6EA 2J5KA 4LFBB 4ZAFA 1BS9A 2VQDA 1XGKA 3V8QA 3KWMA 3DZIA 2G6TA 2JFPA 5DYGA 3X1JA 4E4YA 5CG2A 1KY5A 5AM5A 1TX4B 3TXXA 4PGFA 2A88A 3U9LA 4LYHA 1A88A 1D4ZA 1R0SA 2R1ZA 3FFTA 4H31A 2AOVA 4MMZB 3S4YA 4GOMD 2K4MA 5K01A 3IEMA 4LZAA 2OD7A 2WTNA 1GCUA 1I3CA 1Y9JA 2XYGA 4A8JB 1G0NA 2DR0A 3O8NA 1RAEA 1WUIS 3ASVA 5HWSA 3C5EA 5IYZA 4F92B 1L1EA 3H4VA 5JFTA 3MT9A 4RTJA 5TT1A 5AKZA 1UJNA 1VSUA 4K6MA 3LC1O 5SICE 2J3IA 1I9CA 3G5LA 5I45A 1XVVA 1VP3A 3LA6A 5BRNA 4LYAA 4JB2A 5K03A 3CLSC 1SURA 4G1EB 2IU3A 5B58T 1H6AA 4AROA 2FPXA 1UZAA 5HUHA 4MW9A 1AMUA 5FLYA 2AOWA 5H83A 1P4HA 3FZNA 5HE9A 3TTSA 4PCUA 2WFAA 1EVLA 4RKEA 3AL3A 2QRLA 5EE3A 4Z0PA 2BM8A 1TMKA 3FN4A 3KQNA 1Q1QA 1EG2A 5KNDD 4IRMA 4RYDA 4HAVA 4FW8A 2P9BA 3ELBA 4U9IS 3SC2A 5C1IA 3TX6A 5T4FA 2ISQA 3LOQA 1WV1A 2ZS8A 1RWXA 1YJCA 2JHGA 1XPOA 1D4OA 3EXFB 3JQFC 3G1UA 2I8LA 1A5SB 2FWNA 4HFNA 1UBEA 2WIAA 1E2JA 2QGFA 2VO1A 2G71A 3G0GA 4P33A 2NVUB 1SMKA 3UKDA 2GX6A 3PJGA 1WMBA 2ERCA 3GRVA 4IQGA 2ZWMA 2ASVA 3QA9A 4PLZA 1IZ0A 1PV4A 5IS2A 2I78A 2HADA 3L3BA 3QFHA 2P7HA 4N5IX 2XMSA 3I6YA 3VKHA 3I1JA 4D82A 2CUTA 5U1PA 4KO2S 4KXXA 4BB6A 3ISVA 1SOMA 4A1FA 3LXXA 2FRVA 4LZPA 3I9KA 1JPNA 1KK0A 2DFKB 3SIXA 3GBVA 1CRWG 1QE3A 5AUQA 1I2MA 3GC6A 5JNVA 5JLJA 1TZKA 1XRNA 1DIHA 2JGDA 3O3CA 2NP7A 5LQCA 1UUFA 1PDVA 1XMPA 4XUGB 4QXRA 1E6UA 4F6CA 1MC1A 2F62A 4QBTA 4XZ3A 1P6XA 1O4VA 1O94A 4R1NA 1Q44A 3NHFA 1V5GA 5JSKA 2ZB7A 3R09A 3I8SA 4K2AA 2YDYA 2LNDA 3U13A 3WMXA 4ENPA 5AJZA 1SC6A 5K3FB 1T4DA 3OOYA 3SYNA 1CG6A 1ESNA 3IMKA 2BI4A 4BNUA 2VPZA 1H0RA 2XTZA 4C3OB 2DHDA 2DOKA 4GICA 4BX8A 1MT3A 1XVUA 3AR3A 3K70D 4S1PA 4MGIR 4JHLA 2YHUA 5F78A 4L1KA 3DL4A 4LWPA 1KR5A 4UARA 2HBYA 4ROSA 1LDBA 2AD5A 2PUHA 1KJWA 2V7TA 1FLVA 3L5OA 2ZWOA 2XYPA 2QM3A 3GZNB 1F6WA 2I7CA 2MR6A 3MILA 4CCYA 3WHKA 5JAPA 3DQZA 1VPEA 3O21A 3FLAA 4GPEA 4BKMA 4C0XA 3IUSA 3VZCA 3HXLA 2HHCA 4GOXA 5ALOA 4RULA 1ZI8A 2HMUA 1QQAA 3WLFA 1Y9EA 3FGPA 4XUEA 4BZXA 3H84A 3Q0TA 4NBVA 5KVQA 2Q28A 4JITA 3CSSA 1TJPB 1MQ9A 4WA7A 1BD3A 1EVYA 4C4AA 1M75A 1R0RE 3OLZA 2YVKA 3CIOA 3IE1A 1DIGA 1SCKA 3BORA 1XNQB 3FTNA 3SEFA 3SKVA 1QWSA 3N53A 3GJ5A 1EFRA 4PRZA 3D1VA 5CK4A 2Q3HA 4B7CA 2ACEA 5DN6A 3S8EA 2XBMA 4MVYA 3QVWA 1F2TB 5BSMA 1UMCB 4BQNA 4EG7A 4JJ8A 1KYXA 3BIFA 4ZVUA 1KIMA 1V7PC 2OD2A 3OJXA 1CBUA 1F4LA 6LDHA 4UUQA 1XRSB 2PCJA 4HGNA 2LRHA 5FOTA 1KYIA 3DXYA 2O52A 3I9V6 3FHJA 5LQKA 2RBEA 4ARBA 5ERXA 4TTQA 1U9IA 2Y92A 4FDTA 1S3GA 3T99A 4V0RA 1NYRA 3VR6D 4F4JA 5ED0A 3TJMA 1W96A 4DR4B 1U0NA 1TJ3A 3C0KA 3VSAA 3L0DA 4QFDA 3DTTA 4HDSB 1WCYA 4J0CA 1U8EA 5B6IA 5LZ5A 2Y1EA 2H1VA 4NZOA 3ZWNA 1D8AA 2OWEA 5L6LB 3W5DA 5LL6P 1N77A 4WESA 4QNRA 1VECA 2TMYA 2O8CB 3CUUA 3OETA 1O6GA 2AFHB 4X97A 4XKJA 5FUVA 3F90A 2DHQA 4Q1CA 1GTJ1 3CLTD 4F9GA 4PG5A 3BKWA 3IP3A 4HF7A 4J0EA 5DWQA 2D0PB 4L74A 3SDSA 2C9OA 3CUEF 4TLLB 1NFRA 4Q15A 3C1TA 3BCHA 3ORYA 4JI1B 3EEBA 2MSEB 5J9FA 2H48A 1ULSA 1XQ9A 2PLAA 4Q0MA 5LDHA 3OX1A 3ZDFA 3OA2A 1GA4A 4LDQA 5DNCA 4S1TA 4PRYA 3MCAA 4JLDA 1E2GA 1IQ0A 1NJGA 1Q6YA 1B6SA 3JD0A 4QDJA 2XKJE 1YV9A 4EPRA 4QGSA 2H06A 4IJVA 4OGKA 4XOUA 4HH1A 1X77A 3LHFA 3EHEA 2QAGA 2D2IA 5HGJA 3GGOA 1SZCA 3AIKA 3LF1A 4TTTS 2G1KA 4XQ9A 3UAGA 4BVKA 4XRGA 3ZDCA 5HCNA 2ZROA 1AU9A 1GKKA 2DUJA 1OI2A 4QOGA 3LS2A 3SYRA 5CHEA 4IZOA 4R40A 1Q7TA 4NNJA 5JWHA 1O54A 4K9SA 3UPDA 3CVVA 4WFQA 4QZVA 1QIHA 1B6RA 1QRRA 1XT6A 3UG6A 1Z15A 3O1IC 4K9OA 5EHZA 1Y6JA 2HOQA 5E1OA 1KAEA 1SIUA 1X7ZA 3KXDA 1YACA 3NBXX 4FWIB 2IJGX 2SNIE 2UVPA 3KDPA 1SUSA 1E18A 1POXA 3BMXA 2P7IA 3BXFA 3M6VA 3WL5A 1PD0A 1YI0A 5EWMA 4JEUA 1TYAE 5ELXA 4HNRA 3D2LA 3HB0A 2DH5A 1GQSA 3QBTA 1U0OC 3UMRA 4WJLA 1HA3A 3BGDA 4L4RA 3FWHA 3S8YA 4J2OA 1T36A 2HUPA 2ILTA 3GRKA 2VPQA 4MW5A 4QICA 1T8RA 3R7BA 1RBQA 3IOBA 5IKPA 3ZWKA 1KQPA 1UXHA 1G8GA 1R4MA 2OCDA 4KAJA 1UKZA 2FWMX 3OE4A 4NONA 4RJ2A 5DTJA 2H85A 1PBNA 5G3YA 1IN5A 1NJ2A 3KWLA 2IP1A 5DFAA 1KQ3A 4JIGA 1KBQA 4KQ9A 3MNFA 4GVPA 1TDJA 1NX6A 2ZRIA 3AJ8A 3GA5A 5FORA 1HFJA 2FX3A 2Q46A 3WDKA 1NLUA 1MEEA 4O4HB 3BHMA 4QBIA 3UJNA 3HLKA 2CNBA 2HWKA 3EJWA 3BH0A 4GX5A 3L6RA 1L9KA 1GQ2A 1QCZA 1JEOA 2BOVA 1DQSA 2XUQA 3DGFC 2BRUA 3ECSA 3KKEA 3R3YA 2ZBGA 4MVJG 1KOFA 4UMVA 4GEGA 2F3PA 1GAXA 3AKZA 2BP7A 1E3QA 3TZLA 5BW4A 4KODA 3GYBA 1VMEA 3KOZA 3VR4H 1TM3E 4UNIA 4I50F 2PZMA 2IYFA 3EXEB 3R3XA 4LPSA 2QTCA 5FQNA 3RWOA 2IW1A 5C3MA 5KYUA 1TQ2A 2GEJA 4AKHA 4TSFA 4HR7A 5DKFA 4ER3A 1YVUA 3EGXB 3QUSA 4A2WA 3ZLJA 2QI9F 4UD2A 4G5GA 5EERA 1QH1B 1H8ED 2ZSAA 4W1RA 4RPLA 3SIRA 2GTHA 2CFTA 3AHCA 1U7HA 1P0FA 3EGEA 4WMLA 4GE3A 3OM0A 3IAS6 1LS6A 2X58A 3VOBA 4M1SA 3RS0A 4CU2A 3QYJA 3ORHA 2XB8A 2PQ6A 5KKCA 1GUBA 3R5TA 4M0PA 3F7TA 2C7VA 4X1KB 4BCCA 1A9PA 4TLMB 1MJNA 2VDLB 4UUPA 5JYCA 4TUYA 2DWCA 1ISGA 4I2NA 4DXHA 3P9ZA 4BRWA 1AN0A 4Y2TA 3ZU6A 1KH3A 3DKKA 2XAUA 1G2PA 3MWDB 3QPAA 5LQNA 1Z5OA 1QR6A 2CLIB 3WLIA 2W6JD 3IIKA 4B1FA 1ENYA 3IUEA 1SC9A 2FGKA 3KZKA 2HHHB 4MCHA 2NAPA 4W4TA 4GPBA 4MW0A 3OIFA 4O4LA 4V3BA 3SBXA 1MZPA 2OFOA 4C01A 2Y9MB 4G0UA 2RHJA 3M5PA 4RZSA 3KCQA 4MJ3A 3PU6A 3TZ6A 1U1DA 3NFRA 2XQVA 2PCLA 3L7NA 2PGIA 4CIBA 1KWGA 2UUBB 4JJKA 1PS8A 2W2XA 4MRMA 4ETNA 2BEUB 2CYBA 3BTOA 2SKEA 3O4JA 2XGGA 3AF1A 1HC7A 3E5MA 2EFEB 1U8AA 3L4BC 2AYYA 2JKVA 1T5OA 3T0FA 2I7DA 2IXDA 4ZRDA 2JFFA 3RW9A 2DB3A 1KBZA 3TNDA 1Y34E 4F4IA 3Q98A 3T9BA 1JAXA 1Z83A 2FZEA 4Q03A 6YASA 5JYBA 2ODQA 4R2HA 5HDBB 521PA 3AFHA 2IVZA 2LUOA 1WLSA 2ORED 1X13A 1V25A 2XTJA 1ONBA 2BVNA 3EYAA 4TLCA 4EPXA 4P83A 2AEFA 4DV1B 2JLWA 2QIPA 3BXZA 3JWJA 3T12A 3IOMA 2XLBA 3CMMA 3NO4A 1OJ7A 4CF7A 2FWAA 2P8SA 4DM3A 3OFND 4UTRA 4EGJA 2ZJ2A 3NVAA 3UJBA 4ND7A 4DA6A 6AT1A 5AVSA 3THYB 1VSBA 3PUZA 2R6AA 3K5IA 1MV8A 3QPBA 1V95A 3A6KA 3TLJA 1DRWA 2HLDA 4TZ6A 1VL8A 2DCUA 4IIDA 3N75A 3HVUA 2QY9A 3PFFA 3DOEA 1M7BA 3C8HA 3GN1A 4BJ1A 3NIFB 5JAUA 3CZQA 1JW9B 1HEYA 3KTAB 3LDUA 3ZV4A 1EDZA 2DY0A 4Z1MD 5DCLA 4LECA 4OP1A 3HEAA 1QHIA 3FPSA 3IBTA 3RROA 3HJHA 4ZYUA 4RGBA 4ZOQI 5IBRA 3E82A 1E9DA 5JVDB 5K3AA 3UT6A 1VXRA 3U19A 4PYJA 1WSAA 2OKCA 4J3JA 1R7RA 3LUCA 3AQ4A 1ZG3A 3TZHA 4ZZIA 2C5GA 3IJEB 5GONF 3PNBA 4HUJA 1Z6AA 4KC0A 1M2KA 1QVVA 3EIUA 2FY8A 3JXEA 1HK7A 2QV7A 5T5QA 1BXRB 2DBYA 4AMZA 3FKSD 1D1SA 5DW3A 1KBOA 1Q0UA 2FF7A 4CEIB 2VJBA 2DKNA 5KWVA 3QPDA 3FCYA 3QNMA 1T6YA 4WXYB 4Q4JA 1J8DA 1U31A 4HDKA 3NKLA 4L8VA 4OU5A 1C1DA 1ZIOA 4BKQA 4C0SA 4GI7A 3TQHA 5A4IS 1VKOA 2A67A 3MERA 3MWEA 3UVEA 3FPCA 16PKA 4FR5A 3V8RA 1TJYA 3L1JA 4Q16A 4A8TA 5CJJA 3U61B 1P9RA 2IGBA 2PGJA 3N70A 3K16A 1FK8A 1XB2A 4Q4AA 2CVFA 2VT6A 3VPFA 1MKYA 3QWAA 3REGA 5AJYA 2XYHA 4A2PA 4E2WA 5KVSA 3W3AA 4D4KA 1EUQA 1TU3A 3G9ZA 1Y89A 2YKGA 4CKBB 3H1FA 2QTHA 2PZAA 4MRVA 1HRKA 4S24A 4DMGA 2I8CA 2IS6A 3SF8A 4LVUA 2IC5A 5TF0A 5CRIA 1JKMA 1XD9A 2E5FA 3PQDA 4D41A 3P2IA 4HUTA 4JBXA 3DE7X 4L51A 1DQZA 1I2AA 2BWJA 1K7SN 3C41J 3OICA 4OHUA 2P0EA 4NZNA 1TQ6A 1R16A 2X19A 3DCNA 1T1SA 4ARSA 2BBTA 3BICA 2J31A 3BD8A 4ZMRA 1LLDA 3VBCA 1XK7A 2VHYA 4DMLA 4H6PA 3W5SA 2GK7A 2CFCA 2QSYA 4ESVA 1F0YA 1M5UA 3PGVA 4TT3D 1J5EB 1KJ8A 5IN5A 1IULA 4HDNB 3PR2B 1SOUA 4RS3A 4L7VA 5A4JA 5EZQA 2DR3A 4I5IA 5DBGA 5IUNC 1PR6A 1ADYA 3M70A 4QUKA 3B51X 1CFZA 4GMFA 1AA9A 2B82A 1SQ6A 1M3SA 2P9EA 2REXB 2X5NA 3HH8A 4U7JA 3X2EA 4AZVA 2CXTA 4C4OA 1H9BA 2HJ9A 5CM9C 3GLHB 4J2HA 1CERA 2V0CA 2W90A 3B5JA 4G8DA 2FB9A 2VQ3A 1C0KA 2C5AA 3U31A 3WB0A 5C8YF 5HR5A 2CY0A 3AB3A 4OFXA 1N75A 1NI4A 1XALA 1XJ0A 1BHO1 2AQIA 4WCFC 2GZAA 1YC2A 3JQ9A 5ECGC 4Z7QB 3A9UA 1RCTE 1YQ9A 1RE1A 2ORYA 2IWRA 1EK2A 3GWZA 2EZ8A 3U3DA 2GAFA 1NR5A 2QRVB 1PVDA 1T1EA 3ESYA 5KSWB 1PLJA 4EPYA 3KKQA 3VNBA 2WG0A 3L4EA 1OWNA 1GL6A 1TFUA 4URZR 1QIEA 3VNRA 3OQHA 5EN4A 3ZU2A 1M2OA 3IT3A 2GBLC 4N1AA 2NZVG 4NMLA 3NPMA 3D6FA 3R6WA 2B9VA 1AUOA 1XRMA 3PKJA 5IT5A 2D13A 3IKJA 3IUQA 3F8SA 3OQJA 5K6RA 3V8EA 1L5RA 3VZBA 4BFCA 5FOVA 4Z7NB 4RL6A 1CYEA 4E5SA 3I12A 4D97A 4F6RB 4HAOA 3HP1A 1JECA 3P2YA 3AR8A 4LE2A 2BN4A 3Q2IA 1WW2A 1Z16A 2NU7B 1DBRA 3QITA 4L75A 4O2AA 5EMJA 2C2OA 4P0QB 3DBLB 1QGDA 3RG8A 1NMZA 1O77A 1HETA 3IBGA 3IIJA 2AXQA 3C4JA 3IJRA 3AEKB 2ZBPA 5EWJB 3DZDA 3INGA 3AY0A 4XVUA 2A9KA 4DVGA 5K0FA 4W5OA 3M6WA 1QYRA 1V35A 1X1QA 2JI7A 1F9EA 2ZBFA 5C8ZA 3SDZA 3IELA 5B57C 2NSYA 4R54A 1VCHA 3WY9A 4M1KA 1Q57A 4I4TF 4BKPA 3P2JA 5F12A 3H8SA 3RYCB 4RAOA 1PJRA 3LNCA 3P0RA 4Q1DA 1DJNA 1JDBC 4DG5A 3P97A 3T1VA 4ARVA 1R0BA 2Y1CA 3AONB 1ZN9A 1K06A 2OXRA 4CMGA 1J7JA 4NVRA 1PT6A 4U4AA 3ZDRA 4C06A 5FWYB 1JEAA 2H0QA 3HB1A 1U94A 2VJOA 3AV3A 4G26A 4ZVPA 2XOKD 5DWDA 1DHRA 1FOEB 1O8BA 2IVFA 4Q1EA 3MXTA 1GKLA 4G1UC 3HUUA 4G3XA 2IZOA 2EL9A 2PGNA 2ZUSA 3CPSA 3CM0A 3G0OA 3P0HA 4TWJA 1C41A 1KDZA 4P31A 1KSHA 3NXKA 3WADA 1U0FA 3WISA 5M3BA 2AOTB 3PPVA 3OE1A 4EW2A 5KYVA 2I2WA 3H2SA 1GOTA 1O5IA 5EWLA 3AILA 1J20A 2UAGA 5CT9A 2HA7A 3F96A 1ADGA 1Z0SA 3L0BA 4MW6A 4BLRA 1RM4A 1GA6A 1XX6A 1RPJA 4OAOA 4A8JA 2EC5A 1QDLB 3C3YA 1K75A 3K2EA 5AHRA 9GPBA 5IM4A 4EJ2A 4HLNA 5BR7A 2E2WA 2F55A 3D2AA 4A0GA 1R66A 1TB4A 1CE8B 4UU0A 2E5WA 2HF2A 2VZ8A 3FCOA 3JWHA 4ND2A 1R8XA 2V1UA 3E3LA 4Z4IA 1I6MA 4Y7CA 5ED4A 4RMNA 2RFLA 1A8SA 4ZP1A 4N6NA 3COPA 3STYA 1PV1A 3ICVA 4C5BA 5AVYA 5KHOC 3VHXA 3M5DA 1EFCA 3GLIA 4IG4A 4ETIA 3TTYA 1DKUA 2HWWA 1GNVA 5A4DA 4OGWA 3I2HA 1O0BA 3T5PA 1JNYA 1PU2A 2CLCX 3B1VA 4JSTA 4K81B 2YHAA 1Q74A 1RI2A 5JTTA 2AZXA 2J9XB 1QHXA 5JAMA 4RFVA 2V96A 3SI7A 5IK2A 4YCSA 1L5ZA 1P80A 5LZ2A 1SG9A 3V7UA 3I2GA 2JJ2D 1OVMA 4K1LA 3W4IA 2PZEA 3PIIA 5DCYA 5K0CA 2J3JA 2LV8A 3H2YA 1D6NA 2NVUA 1VLVA 1GCGA 1QG4A 4X3PA 3HSYA 4BHTA 1QANA 1T4CB 3B6JA 4ZFNA 1G66A 4GBGA 1Z2NX 3H13A 1KEEB 1JYFA 4QOEA 5IKOA 5AHXA 2WDZA 2CXQA 5JY6A 4M0MA 1EA7A 4C30A 2W2QA 2PEYA 3IUNA 3U4DA 4ZMBA 1Y0BA 2W83A 3B89A 3HDGA 4URFA 1WNTA 3F0TA 3ND6A 5KYYB 3O8BA 4F6LA 4C43A 3CXUA 4I9FA 1JFVA 4EGQA 2O5EA 1RADA 5BSHA 2HHAA 4BU0A 4EFLA 4MUHA 2IXBA 3KR1A 4ER7A 2EZ9A 2JIBA 1WZNA 2ACWA 4RA6A 1LDMA 1Z75A 3OT1B 2OORA 4M98A 5AVQA 2DF8A 4EA8A 4F5EA 1JLMA 3OPVA 1QOQB 5LCXA 2P4UA 2XD4A 5JJKA 3O3MB 5GMOA 5GM2A 1DTSA 1PJLA 2VEDA 4BE4A 2EEPA 3QVKA 4D0NA 1M0EA 2HCTA 5EQDA 4NULA 1X15A 3PUVA 3BRSA 3K9LA 3WL8A 2P11A 1JAZA 2BCJQ 4B85A 1C14A 4DLTA 4PWYA 1TLLA 1UQRA 2TRSB 1KI6B 2ZT5A 2OZLB 2GEKA 3QJ5A 4YRRA 3IUMA 5GV8A 4HYQA 2WWWA 4IJ6A 4XIIA 3QKTA 4AYTA 3Q3GE 2C58A 4QXQA 1T5DX 2Z0MA 3PNYA 4RBNA 3DL0A 4DRZA 5A3QA 1RAHA 3D81A 3O0TA 1XAIA 1Z0FA 1IYZA 5ER9A 1HLDA 2JIZD 4IPTA 5AI5A 5IARA 5GGYA 1LBIA 1TCUA 2MT9A 3PQCA 5EYPA 3X1DA 3E03A 1P0MA 2QQFA 1UOEA 2CF5A 2G70A 2QT1A 3MMSA 4N54A 2MCFA 4C0HA 1LY1A 4QUAA 3AUSA 2R6FA 4BFYA 2YY6A 1XZJA 5CX4A 3F5SA 3HJCA 1QRAA 3V8VA 2IZ7A 4RZ2A 4H4EA 5K3CA 3WLEA 1WKBA 1NVDA 5JZVA 3NUQA 5FWDA 3D7SA 2O2DA 3PC2A 4YNBA 1T2FA 5FBZA 3VTAA 4AL4A 2I29A 1EBBA 4H1VA 4P38A 3I37X 5L3ZA 4UVDA 1P7YA 4YMWA 4DR1B 1T9HA 1Z82A 4G1FA 3LK6A 3U0BA 5EQFA 4H7IA 1YFKA 2N0SA 3NGMA 4J3FA 2O6LA 1QYVA 3ZLVA 2HO5A 1WPGA 1B3RA 4DAOA 1G0OA 4HYTA 3KEOA 1XF9A 5FWNA 3UJ8A 3VVBA 1WXEA 3GCDA 3LWDA 2ECFA 3PLNA 3MK31 4FGWA 3V1NA 4ZO7A 1AHIA 3GX1A 4LYJA 4RPHA 3CF0A 4WZAB 4PPFA 5HXAA 4YYEA 5AW7A 3JQ8B 2IDJA 4R16A 1KU6A 1Y4DE 5A9SB 2X5XA 4WBNF 3EMKA 1LPNA 1N9GB 4HPXB 5J40A 3W9BA 2XAAA 3R9WA 2WMYA 1A9XA 4QO7A 1RD4A 5IM5A 4EW1A 1RWNA 4HUQA 5JQGA 4CLRA 3CX4A 4O4IF 4TMKA 1NNUA 2CK3D 1GZ5A 3A27A 4PX5A 1CZKA 2C4WA 2VL7A 2ZUBA 2ORWA 1QTIA 2AFHA 1N5MA 2Y1KA 2Z30A 2YWFA 5TT0A 3ILSA 2GD6A 5FA8A 4LNUB 4PNHA 1F4VA 3RQSA 2WU0A 4LVCA 2QM7A 2C2WA 4ENUA 3AVVA 4O8CA 1PWHA 1T8YA 3DVSX 3P5BA 4Q93A 4QG7A 2QGNA 3NGXA 3UOWA 1FFGA 4EJSC 3V7WA 1DO2A 4DR7B 2HU7A 3I92A 4F91B 1VKHA 4OYYA 3JALB 2PQ2A 1FBNA 3OFVA 1IEQA 2D1TA 2FKNA 2C3YA 2GYUA 2ZYVX 3Q1KA 5H02A 3F2IA 3D31A 3DFKA 4LUCA 3VH1A 1QGUA 2ORIA 3ESDA 1YZKA 1WD5A 1BE8A 4F60A 1U7DA 4HX9A 5EQJB 3PG5A 4C6TB 4H18A 1AXGA 1JDSA 4FR2A 4X0EA 1AHHA 3IMCA 3IS3A 1BEZA 5T6BA 3I3OA 5C8VA 1UMBA 1WNFA 2R60A 3WGQA 4C3ZA 3EASA 4EJ0A 4AMGA 3Q7EA 4R3UC 4XB2A 1C4OA 4RTSA 5I9SA 1UXKA 5AJUA 2B3DA 2Y67A 4WTOA 1E1QD 2UZ0A 4PHFA 3V2IA 4GMGA 4C0BA 3H0CA 1QQ7A 2W5UA 3BMOA 3B2NA 5AM0A 3C97A 3L8HA 5DM1A 5KTOA 3PC4A 2JHFA 1ANKA 2WLTA 4HGZA 1U9JA 2CJPA 1UFVA 5G1PA 3OZRA 4BMZA 1NPDA 4YWHA 2FEPA 4QWWA 4U6SA 1Y33E 4EUHA 1KYVA 2ZLBA 3JYOA 4BVBA 1NM5A 2VAPA 3SSMA 4C4TA 4O2BB 5GZ1A 3HKBB 3QVXA 2X14A 1L4GA 4GSYA 3ODGA 5BVGB 1V39A 1JQ5A 2PMDA 5PNTA 4AIIA 2KBEA 2CDCA 3LCJA 2CVQA 4V0LA 2R1VB 1Y48E 4WEOA 4YO7A 1Q1ZA 7ADHA 4XYGA 4WOPA 1NQOA 5KNBD 3AI2A 3E3OA 1M2GA 1ACMA 1OFUX 1TO2E 2J3HA 2O1WA 4MQMA 3IO5A 2CLFB 2YC4C 3K35A 4MYDA 5ALEA 5FBWB 7ABPA 1PKEA 3DEJA 3DS8A 3LWBA 3FYTA 1RM0A 3T0GA 2QTZA 4BFXA 3C24A 1A2BA 2QUJA 2GEBA 4GR9A 4D44A 1EP2B 4ZK2A 1N32B 4A36A 4XDGA 3A1WA 4EYGA 1NAHA 2Y0BA 3QE2A 5A0TA 5DMXA 1FY2A 5G0UA 3V4VB 1V5WA 2W6QA 2OZPA 1ZOSA 4UTXA 2BLNA 1NVKA 4MHTA 3M6LA 4EELA 2JLCA 3WK7A 2VVTA 1DRVA 4OD0A 4YJKA 3CH5A 4NBLA 1JIJA 1Z5WA 5ARDA 5EJ4A 1KPGA 3WMEA 1QTQA 2GN6A 4DWJA 3BK2A 3NPAA 2XKAA 3RM3A 1UKCA 5KSZA 1N6PA 3NX4A 4M1QA 2XQJA 2PL9A 4QX6A 3HP4A 3IKLA 3IURA 2XKBA 3KSUA 2PLFA 4FS8A 3LQKA 1IY8A 4BWGA 1O4WA 4MI3A 5A0VA 1PWZA 1P1RA 1QVAA 3F71A 2EFHB 5KWSA 1U8ZA 4GT1A 1XZFA 1K8YB 2DG2A 1T25A 3LY8A 4JJZA 1I7PA 3DFIA 2QJTA 3NV9A 1C7JA 5JT1A 2HDNB 5CTJA 3PRYA 1ZXBA 1E2HA 4NENA 3X44A 3BGOS 3I9MA 1QYDA 1GIAA 4P4GA 3JQFA 1MNAA 2NUPB 2TMKA 3EZ9A 1C1HA 4UC0A 4UUMA 3I9LA 3M6XA 3R8XA 4BB5A 2GPNA 4FD3A 2BFEB 4CEJB 3EXG2 1JJIA 1G3MA 3P9PA 1BXGB 1E1RA 1MU0A 3UAYA 5JXIA 1MX3A 2HW8A 1GZ4A 1SKUA 5EE0A 4QUBA 3RS9A 3T7SA 1W36D 1PNQA 4H7HA 2JCGA 5BNWA 2ZIEA 2J9RA 2J67A 1QQ6A 3LKZA 2Q4TA 3EFOB 5FUBA 2R8BA 3CN9A 4L95C 2N1BA 4PZPA 2R2GA 1S89A 3QJGA 4DMCA 3SE0A 2AXPA 1JDVA 4EFKA 3ABIA 4P81A 2V59A 2X1MA 3WLRA 1BGVA 1MA3A 1XVTA 1Z06A 3DMRA 4LY9A 1PNRA 4HFMA 4K8OA 1RWPA 2FFBA 3HB4X 3UG7A 3WK5A 2JVJA 2OCAA 2QN8A 5FNVF 1AIPA 3NTRA 1ZCBA 3FMPB 5A5FA 1ZUHA 3MEQA 2BKVA 2BEUA 2BKAA 4L6IA 5JNRA 2WDPA 3NHWA 5JSYA 3U1TA 2J0UA 1K97A 1YRBA 4JT9A 7MHTA 4EKEA 1RXUA 5F33A 3U62A 1DKOA 2A9JA 2OSBA 3D3JA 2D7CA 3AR4A 3JTEA 3WTCA 1UJ2A 4K88A 4R83A 4EW3A 3C3DA 4N7JA 1ZH4A 2EBUA 2I62A 1C3EA 3UTCA 4D3FA 3NT5A 3QXXA 1T3SA 1ZRSA 1ZIYA 2QP9X 1NZDA 3H5WA 3LQ2A 1O95C 2RKOA 1OZ0A 2G1JA 2ZANA 5CAEB 5SY9A 1XYGA 3IO3A 3VZPA 4ENRA 1MJ5A 5E3JA 1ZONA 5F4BA 1V11A 1RW4A 1YDMA 3KXIA 4M0CA 1DL5A 2FQ1A 2XRMA 1HE3A 2IYXA 3LC0A 4LJ6A 2VFAA 1CVLA 1FS5A 5DASA 3GRUA 5B1IA 2XA2A 2OYCA 1MAHA 3KLNA 4KUHA 2R8XA 4WW0A 1J9ZA 5FPTA 4TYNA 4HKTA 3UO8B 2CDAA 2OC4A 1VYUA 2PMBA 1KZ7B 1KYTA 3HUFA 4CVNA 1QE5A 3GFVA 4ID3A 4OH1A 2XCIA 3TWOA 2JIOA 1ZVJA 1Z35A 4RHXA 5CLIA 3OZUA 4EHKA 1FJHA 2VLBA 1AH2A 3C4VA 2RB5A 4L5YA 3AVYA 5KYXA 1YNSA 3AJEA 2IL1A 4FZ3A 1YULA 1VYVA 3ADPA 1UPUA 2EQBA 3QXHA 1ACLA 2QA5A 2TSYB 5JAIA 2YZ2A 2NZ8A 2CUKA 1QPZA 2TECE 1VB3A 3LL4A 1Y7LA 4LZNA 4YR9A 3LLVA 3OE5A 5FOUA 4F3RA 3GUUA 5LQUA 4KHPB 4DPMA 4R5MA 4KXYA 4Q18A 1TD1A 3DXXA 3E48A 2QJFA 2F9MA 3AEYA 3RRBA 1UDBA 5B12A 1L5GB 4H1HA 2DQSA 3LW7A 1A95A 4Y2UA 3W78A 1LK0A 5CEJA 2ZYHA 1C30A 1CVIA 3LYAA 3I5UA 1ZM4A 2FE1A 1PSZA 1BXRA 4TMFA 3KSBC 1XAGA 3C1UA 2WICA 4DR5B 4KDRA 1RRKA 2X8AA 2G80A 1M1YA 1AMOA 1AUXA 3MCWA 1M1UA 1B1AA 1TQHA 4LI3X 2ZRPA 2PKWA 1CZRA 4E11A 1EUYA 2BL4A 2WTAA 3DBHA 3GDOA 2C4HA 4MWDA 4PLTA 4UNQA 1DU4A 4URWR 3W2EA 3K72B 3ZJYA 2X0FA 1ZUNB 2W2MA 2A0UA 1G21E 2H8KA 4OI2A 3CSDA 3U7JA 1WF3A 4C9BA 4ERXA 1G42A 1FXWF 5TARA 4MEBA 4F86A 5F9FA 1Y9ZA 4TWZA 1KVQA 1SN7A 1WW8A 5CLLA 3TAUA 4AMVA 4DABA 3OQNA 3L7IA 3OEHA 3M5CA 4GKJB 4ZV9A 2YWXA 4P8RA 1GPNA 2WBLC 4GAEA 4EI8A 4KI0A 1NUPA 2UUOA 4B46A 2FN9A 1HFEL 1D4FA 2JAOA 3MHPA 3N0WA 2P0AA 3OZXA 3JQGA 2ACKA 1JJ7A 1CP3A 4II7A 1ZNYA 3MTJA 4L4YA 4RHCA 1JTFA 4ZHQA 4AY6A 4I4NA 4O6VA 3V1YA 5FPKA 1V7QA 2N3ZA 4FDVA 4L9AA 4P4NA 1NW9B 1I9GA 3QVTA 4YV2A 3TQQA 5DB4A 1C1YA 4D5GA 4BUCA 4L0DA 2VYQA 2PMEA 4X1IA 5IKXA 2Q50A 4WFKA 3AR2A 3Q6IA 2C95A 3H05A 2GXSA 3M9LA 1P7PA 1RU3A 1NKVA 4IHJA 4WFIA 4IKEA 4ER5A 3ZDEA 5HKKD 5L7TA 2GAAA 4WKPA 4IVPA 5CA1F 3O8OB 2ZZMA 3D8BA 2UV8A 2XNHA 1ZXLA 2X8LA 4IMPA 1F3LA 3TLXA 4QLAA 1CF9A 4OQPA 4ZTBA 5I7WA 1WZUA 3PHCA 1GHTA 1PJ2A 2GPYA 5B1SA 2AG5A 3DHNA 4YJ2B 5CDSA 4LEIA 3ZE8A 4EY4A 1KC3A 2XJ4A 1ZH0A 3KU4A 1NY5A 5KJCA 4Q3LA 3ROFA 4WJZA 3SCZA 3DE0X 3PGJA 3ZCSA 2ZRBA 3IFSA 1W581 4L5JA 2IYYA 2OAP1 3PFHA 4Y1GA 3R74A 5A4MS 5AESA 2FOXA 3AVOA 2QIOA 3GLHA 5DX8A 2ODWA 3T3HA 5AYVA 4R98A 3D2CA 4WHMA 4NPHA 1NJ8A 5LUAA 1I4EB 1ECLA 4KAXA 1ULHA 5DYWA 4K7JA 5DXFA 3A4YA 3D9QX 3I9OA 3KO8A 5FP0A 4QRHA 4AT1A 2ATVA 1G8YA 1MO3A 4QAQA 5AI9A 3SZOA 1YB2A 3H5NA 2GWRA 5EMNA 3AERA 2YYAA 1DKRA 1H2HA 4IKPA 4RDIA 3WNBA 1MAVA 4MWGA 1L5NA 1R15A 4JJ6A 3DCIA 3ZD6A 4B17A 3LVRE 3L7JA 2GJAA 3FR8A 1M6HA 4GQBA 1FZTA 3T3MB 2BHLA 3ZLTA 4LBYA 2IH5A 4KITB 1FP1D 5DGHA 5DP2A 3ZWCA 1ZY2A 1DZIA 2XCUA 2DTEA 1JHDA 1JFTA 4EABA 2NU7A 1U80A 3MMPA 1ZCZA 1GD1O 2C59A 3NWEA 2I6XA 3Q2KA 5KVAA 2Q5EA 1XZLA 2Q0QA 1YQQA 2CNWA 1PJ8A 2PH5A 2O48X 1JRLA 1SCJA 1VJTA 2V4ZA 4FCVA 2QG9A 2J3DA 2JBAB 3DO6A 2W48A 4FHZA 1CY2A 3E9NA 4XFDA 1P4RA 1EM8B 3OQMA 2B8TA 1DBWA 4CE6A 2OT3B 4IDPA 4JI0B 4J7CA 4WKCA 4UFNA 1ZH6A 3WKDA 1I7LA 3G8CA 1SKAA 1M1XB 1N5LA 1XUOA 4NPAA 3FOZA 1GNSA 2FZ5A 2PUWA 4FYMA 4ZVSA 5FUWA 1GGVA 1NTOA 4Z0TA 3ZI0A 4P3XA 1U3TA 4R2LA 3HCFA 1EFHA 4RF3A 5HMMA 3I9JA 4II2A 4QASA 5EJFA 5CCBA 3GUZA 2QORA 2WM8A 5LD2B 2CKDA 3NOVA 4J29A 3BBPA 1GL7A 2IUEA 4G84A 3B8EA 1L4BA 4NZPA 2GNOA 2ZUCA 1Z0AA 1UDCA 4HNAB 4R2WA 5F2OA 1FX0B 3RFCA 3WLTA 4BAUA 1DIBA 4Z3OA 3QMVA 1PZEA 1TO1E 5DI3B 5HMLA 1AS3A 2V9PA 1HNNA 1SJ9A 2ZRJA 3ZDBA 3C6KA 3L6CA 4C4ZA 4QTTB 3JQ7A 2ZB3A 3NANA 4WZZA 1CJSA 3OX2A 1T8UA 4QDTA 1F2DA 1RJDA 2WJIA 1Z7WA 4JB3A 5F2KA 2E89A 1JHXA 2XMRA 2FWJA 3EW9A 4AZ0A 1RLIA 2R1TA 3SJUA 1NIPA 2QL9A 4XR4A 4XWGA 2R44A 5JECA 1X1EA 4QOJA 3MYYA 1PGOA 3COZA 1EGHA 2C9ZA 3F97A 1YKFA 4X90A 3BDAA 4YRNA 3O8RA 2Z2KA 1QZUA 2YVUA 2HRZA 4TV9A 3UFBA 1ZK0A 2HQSA 4MB0A 4WKNA 4CT0A 1E60A 3EDCA 3L4BA 3I23A 5TB5A 2XZLA 2XIQA 2O2CA 5JU6A 4K28A 1QQTA 1Y8RB 3C87A 4KYUA 4RXTA 5AW1A 1LGYA 3Q2OA 1W29A 2UZ4A 2XXAA 1H85A 5EPUA 3PT5A 2VDPB 5LA6B 3SXUA 4IGEA 2ZUEA 3SZGA 3LX6A 4V1CI 3AQIA 2RAPA 3R7WB 2LKCA 4P3YA 1GGFA 5C4MA 4LXTA 3QU7A 2I76A 2BFCA 4XRRA 4WOKA 5ALJA 3SWWA 4CKYA 1YR2A 3IB6A 3GYGA 3QYAA 4JOSA 5EIFA 4B6SA 1Z4QA 3ENZA 3JW8A 4HD8A 4L9WA 1BW9A 3CV3A 3LUJA 4IH9A 1ZM2A 2I4TA 5GGXA 4CJXA 4GGMX 3WLKX 4ENQA 2IH2A 4NDZA 1G3QA 1VE7A 3QEAZ 1EX1A 3WBJA 2G40A 3O8LA 3WIDA 1K4MA 2A1TS 3G89A 3VMMA 3QUTA 2GA9A 3HGQA 5KDOA 1YB1A 4R1UA 4DCJA 5CEEA 4PF1A 2C97A 2BV3A 4DKXA 1UKBA 2FLKA 2YWGA 4Z4QA 2K6GA 3WJ7A 1MAUA 2FUNB 4PICA 2OAQ1 1VC2A 4S1VA 2QRJA 2HCFA 4RIFA 4Q9IA 3ZK9A 3S1SA 1JVSA 2F59A 4WGFA 4M38A 1GSHA 5DM4A 3K0EA 4BWYA 5BSFA 2PFSA 3AUJB 3VR4A 3OQOA 4C4YA 4L0MA 1RWWA 2I2CA 2ID4A 3NHMA 5AVRA 1Y6ZA 2HPZA 4TRJA 4ZU6X 2WF7A 4NJOA 1WZEA 3RLIA 4OQMA 4LYGA 4QYIB 1SUIA 1Z5UA 1DLIA 4I6JA 1AKQA 2X2PA 1N6NA 2PKQP 3VKFA 4D0RA 2J3LA 2IP2A 3ASUA 3M6AA 4XWWA 1KK1A 1N8TA 4FI3C 4NCNA 4Q02A 5CJ2A 4KPEC 1KL7A 4QFCA 3EVCA 3KQPA 4X3CA 5IMSA 3I9FA 1KXZA 2FSPA 3N7TA 3O1HB 4QQ8A 4WZBE 2NPOA 2Q1YA 2WOJA 4QOSA 3ROEA 3STVA 3UOGA 3DZJA 5JBNA 5KREA 4KDEA 1WULS 4IX9A 1T4GA 2C84A 1MCZA 2XEDA 3QEMA 4R3NA 3V9AA 3RO7A 2GBCA 5E6UA 4JI8B 5IEBA 5SYAA 2W2LD 3V7NA 1B8NA 4ZAZA 3WAKA 3ZVLA 4DXAA 1LF0A 4YVFA 4B45A 1Z34A 3OD1A 4KH0A 3MBIA 3BXOA 1O9GA 2V97A 2F1IA 2Z2YA 1I6WA 3KOWA 4KGZA 1X94A 3E0QA 4IYRA 3ZWDA 2X3FA 2W2KA 3DLHA 2YCBA 4CKCB 4UXJA 5CFZA 1U65A 4XSGA 5KAPA 4D3YA 4FWTA 2H4YA 2IV7A 2D8MA 1LZKA 4IL5A 5LP6C 5CP8A 4YUZA 4DXDA 1BX0A 2YX1A 5MDHA 3FPLA 4IGAA 1W4LA 4R01A 4ZO6A 4IH1A 3CVYA 4NSNA 2KE5A 1NQVA 3N8HA 4RCVA 1JWLA 2J45A 5IAGA 1VCMA 2VAMA 5I3CA 1I4TD 4MIYA 5K8CA 1Y3FE 3SLRA 3FUWA 4FIDA 1U3DA 2OV4A 3IXMA 1OGYA 3LCMA 1XMQB 1YJBA 1UQUA 3GBPA 3HVRA 5TXGA 1ULUA 1J0CA 4IOLA 4BASA 5M29A 3B9BA 1OWOA 2HK8A 2XGSA 1BSVA 3HKDB 2JA2A 3H6KA 2YHIB 3MF4A 5CLFA 4PPYA 2PWBA 2PL5A 4KXWA 1GPDG 3O90A 5B3KA 2INGX 4OU4A 2PBRA 4PTZA 5B6PA 3P27A 2O0LA 2ZT6A 5CDFE 4X20B 2AEJA 4QAJA 2VP9A 3ZCVA 3PFWO 4AX8A 5B3AA 2X9GA 5FPYA 3BULA 3BEOA 4Z54A 3UHJA 3ZI4A 4YCLA 1DP4A 1VG8A 2LGJA 3HA2A 3PDWA 4KQ2A 4MTLA 2ZK7A 1GQQA 5JQWA 2O5CA 1Z4MA 3QPVA 2IF0A 4MAAA 2BGNA 1MGPA 1E5TA 2QPOA 2X8JB 2EF1A 1KI4A 1J2YA 1S2LA 3DSRA 4ML3A 4ZVVA 4MV0A 3TEMA 5ICMA 5JPIA 1I36A 2BJVA 2B20A 2E82A 1EZ1A 3MFYA 1FFBA 1U3GA 2FP4B 3V1MA 4RF4A 4B3FX 4DIKA 4N39A 4GPIB 3H1EA 3DLTA 4TWAA 4WCFA 5I5GA 3RCBA 4D4GA 3SHOA 3KB6A 4B32A 2FHPA 1KJZA 2J6HA 1GV0A 1MBZA 1UBTS 1WG8A 1DDIA 2ADMA 1TUBA 4M1ZA 3JRWA 3KNZA 4RQBA 3WWCA 1XQ1A 1OCEA 2EJUA 2RARA 2CL7X 4TVBA 4QM6A 5KDDA 3CG4A 2GBLA 3LUKA 1Z4LA 5LKAA 4LVNA 2AKEA 4R7GA 5CD1A 2FQQA 4GZ5A 3RAJA 1PZMA 5EEHA 4EFMA 2FW1A 3E9EA 3ESXA 3OHMA 4HNSA 4NY1A 1UBMS 4HMPA 4PR3A 5F4ZA 3WJ1A 2EIHA 4F8YA 1SVNA 4P80A 4WA8A 2RGWA 2V6MA 1YU9A 4NF2A 1JKJB 4LY3A 4WNAB 4UHFA 4IDAA 4U5QA 1EDBA 1JP7A 3G2NA 4H7EA 4QU9A 5DTRA 3T38A 5CFRA 5DRYA 1AV6A 4HB0A 4FCWA 4HWSA 5TS3A 5INTA 3K5PA 2I3BA 3RGWS 1IVSA 3KQSA 4ND5A 3DP7A 1EXDA 4QPPA 1FFXA 4NBSA 2QUAA 3IMGA 2NNWB 1JA0A 5CPBA 4D8YA 2IHJA 2OLEA 5BQOA 2NQ2C 4NZYA 4TWBA 2JLXA 3RH0A 3WIOA 3WWZA 2C7QA 3ONVA 3QG1A 1E59A 5JHGB 1U6IA 2DPXA 1QZ3A 4IILA 4PG7A 3MT0A 4W9MC 5FL7A 5FF9A 2MSCB 4TKVB 1RHQA 1FNSA 1V16B 3HJAA 4LK3A 2SICE 4TGLA 3HYRA 2A86A 2H2FA 4QHSA 4WN9A 3RRXA 4EG8A 2AN3A 3KFLA 5C32A 2ZJ1A 4ZT5A 2WT4A 3U4QA 2C4VA 3EF0A 5AT1A 4KLCA 2YCLA 3BPSA 4TM8A 3E4CA 1YKSA 5IW8A 1ZLXA 1NPTO 4LQLA 2WYIA 1D6JA 4G9GA 1OT5A 2WTUA 1KAQA 1TM1E 3IJ5A 1Y4AE 3MJVA 2BTQA 3T7EA 2ZSFA 5EINA 3OZWA 4HYEA 1MFPA 3P5SA 3W77A 3B3JA 5LNK6 1TUEA 1VKRA 2P4QA 2QHXA 2AJDA 2BUCA 4KGVA 4M9RA 3GLGB 2W2VA 3A28A 4DAEA 4EZIA 1TMGE 2O50A 1G2IA 2PJUA 5BVHB 3AM5A 4YUWA 2FG6C 3B5IA 5KX5F 4EG3A 1SVOA 2ZUDA 1ODLA 3F9IA 2ZKIA 2B21A 1US8B 2NO5A 3E3MA 2ZJFA 3M7IA 3PCTA 4L28A 2FRXA 2VAWA 3NALA 3S1AA 5JWOA 5EOVA 4C2TA 1Y8QB 4D8VA 4AJKA 5AW3A 3ZVKA 5FBHA 2I4OA 1QHHB 4QARA 4MQEA 1YR1A 4YA6A 5SYNA 3JYPA 4CM4B 4DANA 4C3UA 1KFJB 1XEWX 3GFTA 1LVHA 3ZZNA 1P5RA 3FGOA 4RTLA 2ESRA 4XSVA 2W0SA 2WVAA 3MZ0A 4BX2A 4RJTA 2GN2A 3JQAD 4G81A 1M6VA 2AC4A 1R74A 1ZUD1 2QTNA 2DHRA 1P3Y1 3KOUA 2OXTA 4GMKA 4RLSA 4B47A 3KQOA 3KQLA 1KEVA 4FFSA 3GFRA 4E4RA 1DQNA 1ZW6A 2GASA 3BFJA 3O4RA 3OF3A 4R84A 1HTWA 4UM8B 4Z8YA 3PHIA 4YLYA 4XCVA 4ZZ2A 3BWMA 4IAOA 1ZCAA 4P3KA 1JR3D 4BIMA 2X4IA 2PT5A 4MHSA 4CLOB 2V8OA 1VJ0A 3D3QA 3R7SA 1OBCA 3QOFA 1FYFA 3TNJA 1R2QA 5CLHA 2GHQA 3EQ6A 5TPWA 3UKJA 2GO1A 3AF5A 4YP1A 3OZFA 2B0CA 3A1DA 4QNMA 4OQ4A 3AF4A 1QIMA 3CW9A 3TJZA 1LX6A 4ECEA 2FZLA 2IYWA 1MP0A 4MCAA 4QGAA 4F71A 1QHGA 3O9ZA 4D02A 3CKKA 3GY0A 4CI0B 3RJMA 2Q3EA 4Q9HA 5FCDA 1ABBA 1T2NA 4XH9B 1YNOA 2Q2QA 1X14A 1NY6A 4GRIA 3RBXA 4YP0A 1GR0A 4HDMA 4HQFA 1DMRA 3G2PA 4OYRA 4U00A 3TOZA 3TRJA 1W88A 1S3SA 3E15A 3DOHA 2WAYA 4PN7A 1T43A 2CSUA 2WHQA 3A06A 3FYSA 2WJ4A 1WUTA 5A0FA 1E32A 3TFOA 3HJNA 3GLVA 1B16A 2EVWX 3KJNA 3WLNA 3MFQA 3H9EO 3K9HA 1MPXA 3VZDA 3L46A 3LQ4A 5KNBH 1JLLB 3HS3A 2F48A 2Q4EA 4WJKB 3PQFA 3R5JA 4KBGA 1L5MA 3INTA 1KO8A 3D8NA 5TS2A 3Q40A 5J58A 1T1RA 1O1YA 5JI3E 1UOQA 2XE4A 1T24A 4REMA 3IP7A 2CE2X 3MJRA 4A8PA 2OMEA 3HBJA 4ZVOA 5HF9A 4OBWA 3VV3A 1GARA 2C98A 2FQWA 2VHJA 4GLFA 2A0FA 4EPTA 5J47A 4BCBA 4DV0B 1WY7A 5C5IA 1N6RA 2A9RA 1MOQA 4R1MA 5DBOA 2VHVA 3TDMA 1WXQA 1J24A 3S55A 4F93B 1SHUX 3HRHA 3GRAA 5KTTA 4E5VA 3TEJA 5FI3A 3NM4A 5FOXA 4Z1OA 5HW0A 4Y1RA 3IPLA 1X2BA 2ET6A 2JJYA 4QSHA 1SWWA 5TV2A 4BTLA 2BTEA 1QRUA 4FEYA 4JKIA 4MUXA 4F84A 5KVVA 4D0LB 5TLSA 5DYYA 4CEHA 4X71A 2PX8A 3LHKA 1G5IA 4LF6B 2ZSIA 1LVGA 2DH6A 3AVQA 2GBPA 4IR7A 1RHRA 3QUQA 4KQ6A 5LWQA 4XGIA 1J8QA 3QELA 4B8WA 2DP4E 2VP0A 2WJVA 5FTWA 5LIPA 5D00A 4YAIA 2HMWA 3TEFA 2IOYA 4Y2PA 1X87A 1XEWY 3C15C 3N5KA 3EPLA 1VHWA 4H6WA 4C7JA 5AJXA 4I3GA 4MS4B 2WSSA 2AMFA 1E8MA 3WIBA 1KO4A 4DBVO 1RI4A 1ITZA 4FU0A 1XDSA 4QXMA 4WDQA 2FEXA 4REQA 4PFKA 3AFGA 3DAFA 3SJBA 3RS7A 1X0VA 2NSHA 4CL8A 3NHPA 1LV7A 1PG0A 4FDUA 4YRJA 4EF5A 1KMMA 1V43A 2GQ0A 2QM0A 1BVYF 2P3LA 3AI1A 3BMCA 3CUTA 2AGVA 3OPYB 4QEKA 4YJ3A 2OA0A 3DLPX 1MB3A 3F7MA 1G8JA 3FWYA 1T4MA 1Y8CA 2GLUA 3K31A 1WDKA 1Q91A 1W49A 2IOFK 2WWHA 4HEA1 1TM5E 2VH2A 2DY1A 2OHXA 4OGLA 1NNSA 4UCFA 5EKSA 2FUCA 3KKLA 3DPSA 2OE2A 4FR0A 5CH8A 3T3GA 3MG9A 1PYGA 1LCIA 2VF8A 3NDIA 3PQ3A 1GAWA 2Q1UA 2VTDA 1JALA 2N47A 2RHGB 4KQGA 4QJ5A 5F9MA 3KR9A 1KO7A 2HLNA 3RYHA 5KWJA 5E4TA 5AW8A 4XCQA 4S2EA 2ODBA 1W5AA 2OQRA 3GFBA 3H9JA 1JHVA 1F6BA 1M34B 1NBOA 1K7EB 2QAJA 4JJ4A 3MCZA 5AVOA 1V41E 3MLBA 3ZLBA 4D43A 3EF3A 3I04A 4S1WA 3SC4A 4DNOA 1KY4A 1W76A 3L06A 2LIVA 4EJSA 2HRQA 1F20A 1XL0A 4G65A 1U99A 3MXOA 4C1NA 5K4GA 1Y4SA 3ED1A 4Q4DA 4AYWA 4EYEA 5LM3A 3B6KA 1IPFA 1NBMA 3AP3A 1WPRA 3DFMA 3DW3X 3E9RA 2O20A 3CKMA 1X7XA 2NO4A 1ENPA 3GRCA 3HL0A 4FXOA 4OBBA 2EJVA 3FMGA 4DA0A 3L93A 4PFJA 1NPYA 1QH8A 1UEJA 1WEHA 2IOHA 1RKXA 2OL4A 3CMCO 4I0WB 4NCHA 1JVBA 1KOLA 1OC4A 3SHTA 4LRXA 4M54A 1SH7A 4QE3A 5IDQA 5JASA 1I0IA 1ST3A 3BIOA 1OFUA 5E8JA 1Y5MA 2XUGA 1W46A 5J4LA 3KUDA 3V4OA 4KXUA 5MGNA 2WHPB 2VA9A 4J6EA 4QU5A 2GWHA 3OM1A 1M1ZA 3QBJA 3K92A 4GOKA 4O4JA 4E94A 2RC5A 3PRHA 3FCCA 3OZDA 4O1MA 2VJQA 2BI8A 4HN4B 1WCV1 4K9NA 3FY4A 4IV8A 1EHIA 2GFQA 2NYRA 3DAYA 2J7PA 4YDQA 5G3ZA 3FHTA 5I8ZA 1X7GA 2R8RA 3UAXA 1RZRD 4N65A 4D4IA 2O1EA 2X3UA 4Q3KA 1SVWA 1BOOA 1JHZA 1NVGA 1RQ2A 4GX1A 1YRAA 4M99A 4EYKA 5IBQA 4QEZA 4HWOA 5HTOA 2JI4A 2X8BA 1IWBB 1PHPA 2PXXA 3ULKA 1ZIDA 3VVMA 2B0JA 2X6QA 1F8UA 3UKOA 2V58A 3NQ41 2VRNA 3DWFA 1UDRA 3FF4A 3OOSA 3E6AA 1DEAA 3IPCA 3LUBA 2BJWA 1INLA 3FHOA 3C14C 4DA8A 3CH4B 1T3TA 3EY9A 3LPLA 1LBSA 5EAIA 4ZI7F 1JYSA 1FDUA 5IEJA 2J3MA 1AURA 2V4UA 1M54A 4OJNA 3EG9A 2ADOA 1JXQA 1M1NA 3DYVA 4RL4A 2G4CA 4AUNA 2PUDA 2VJDA 1UC4B 4Q12A 1O9BA 3WLMA 1X8KA 4ZANA 2O3SA 3O3NB 1RRPA 2QTVB 2VNKA 1A9YA 2HWYA 1JDZA 3CCCA 4JB0A 3K8QA 3UWDA 3W34A 2HPVA 4HNVA 2OHHA 5F5LA 1PFYA 3AUYA 3TINA 3ROGA 1HE8B 1TEVA 4NCIA 4DUZB 4PC7A 3KYIB 2Q8QA 2VWGA 3IX7A 4QULA 4X1OA 5CM2Z 1HT3A 3EDMA 1CYDA 1XJCA 2QW8A 2ZDGA 2RJNA 4KG7A 4KP7A 4L02A 3EH2A 4BLUA 3CRZA 2ZAOA 4BEJA 5AVVA 3MUNA 3L8DA 1U9YA 5IWAB 1KO1A 4FGUA 4FC7A 2HT1A 1HMPA 2WAOA 2PUFA 4I50B 2WTXA 2PS3A 2ZQ5A 4Q4LA 1WZCA 3TW8B 5KQRA 4YPOA 3IAM6 2B8EA 2J9ZB 4JWTA 1NW5A 3PV0A 3GLFB 4OX9B 4ZDKA 4Q3DA 4I99A 3AF3A 4PFQA 2X86A 3IEXA 3UT5A 1QGAA 3IUPA 3O4HA 1HWYA 1TYCA 1L5LA 3OJFA 3AP1A 1ZI9A 2ZIAA 3PX3A 4OXNA 3SP1A 3MMNA 3QJYA 4J9UE 4ZDIA 3R40A 4S0ZA 4B81A 3NVKI 1CZNA 2IYNA 3DEHA 3GJ4A 4OYHA 4HVLA 1SAYA 3NTUA 3EVAA 3TRDA 1N1MA 1KF0A 2GZRA 4LQ4A 3I01M 4ESEA 3GUVA 1N25A 4M89A 2A5LA 1A50B 3BD7A 1JJAA 4I55F 1A5BB 4ZCMA 4FYYA 3FTQA 4EDHA 2X9LA 1I33A 4LXGA 2FWPA 3MM4A 1RZVA 4JL8A 1R8QA 3HU1A 4XM1A 4CMAA 2YIMA 4QQNA 1AZTA 1BDJA 2WZCA 3CO5A 4OA8A 3IDSA 3BWXA 4AC9A 1SUEA 5ECYA 1TTPB 4KXQA 4FJ1A 4C76A 2AFIB 3FNBA 3NIWA 3U5TA 2G7MC 3RVOA 1JKXA 2AW5A 4B80A 1N57A 3H2HA 2GRAA 2NXEA 2CE7A 4NHOA 1LSSA 2NVBA 5E3HA 3VH3A 2C1XA 4JC4A 1JLSA 3WXBA 4GP7A 2C54A 2EG9A 1M76A 1FSFA 1BMDA 5D8DA 1YONA 4PYNA 4BO3A 4Z51A 2OBLA 1LWNA 3TUJC 3NHZA 1Y8RA 2AUNA 2XXJA 2VJAA 2QNBA 5LDGA 3OUTA 4KYTA 5A5EA 3I30X 4MWOA 3H1TA 1D2RA 4UTPA 1XCPA 2IPLA 5BSGA 5FUMA 1QS0B 3B85A 3WB2A 5E7MA 4D9JA 1RDFA 1O95A 3RABA 3FHLA 2QF7A 1OXSC 3QLEA 1RLOA 4QHYA 3QKRA 4BC1A 1Q5PA 4KSYA 1N2CB 2RIPA 3AV0B 4LJYA 1MX9A 4TZKA 1QC5A 3HP7A 3FFBA 4HX2A 4KIFA 1B43A 3A9VA 2X6TA 6REQA 3SKXA 3VH2A 3PTAA 1NW8A 2NUTA 3BBLA 2ZBUA 4CMHA 2Q9UA 3PEEA 5IVKA 3CLUD 1DOZA 1WPXA 1V1MB 1MC5A 2IHZA 4MVJA 4U2KA 1IE3A 1AMNA 2P9QA 2H92A 2EKPA 1IXSB 4WVLA 1U0SY 4XYEA 2WUEA 2ONZA 2ZAYA 1VSVA 2P4HX 4YK7A 4H1WA 2WWVD 1CS4C 5FADA 1RKVA