1FLVA

Structure of the oxidized long chain flavodoxin from anabaena 7120 at 2 angstroms resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
168
Chain Sequence
b'KKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
molecule tags Electron transport
source organism Nostoc sp.
publication title Structure of the oxidized long-chain flavodoxin from Anabaena 7120 at 2 A resolution.
pubmed rcsb
total genus 61
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 1992-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1flvA00
1H69A 5LBTA 4LAFA 1D04A 4PTYA 1JA0A 1BU5A 4N65A 4PU0A 5LBUA 3UXHA 4YAUA 1OBOA 2D5IA 1ZWKA 4YAWA 1ZWLA 1FX1A 4YQEA 1B1CA 2V5UA 2W5UA 3FNIA 4LA4A 4XDGA 1X77A 2KLBA 3NHJA 3NHYA 4ZVKA 2FAXA 1RLJA 5B3LA 5LLDA 1YCFA 4H6PA 3KAQA 3S2YA 4BMPB 4XDHA 2Z9CA 1AKTA 2M6RA 4QOJA 3SVLA 1AKUA 3F6SA 4YALA 3N39C 1YDGA 3NLLA 1F4PA 2HPVA 2MOKA 2QX6A 2Z98A 3EYWA 3NHPA 3NHUA 4C14A 2B3DA 1OFVA 3HA2A 3OWHA 4FGKA 3FJOA 4N9QA 5LMCA 1CZLA 5NLLA 4Y7CA 2OHIA 1I1OA 3W78A 3NHLA 1D4AA 1YCGA 3TE7A 2M6SA 4ZVLA 3OX2A 2QX4A 4FGLA 4S24A 5LVAA 3TEMA 2FZ5A 2QR2A 3P0RA 3RPEA 1FTGA 3NFRA 4PTZA 5FA6A 3D7NA 4DY4A 1TIKA 3KAPA 1XI2A 2MT9A 3O2NA 3ESXA 1H66A 4QODA 2OHHA 5EAIA 1YOBA 1OBVA 2FZVA 1YRHA 1T5BA 3W7AA 4GQIA 4H2DA 1CZOA 3OVMA 4GI5A 1CZNA 3OWXA 3EDOA 3U7IA 3UXEA 1J9ZA 2V9CA 2X2OA 3O73A 3R6WA 4C0WA 4F8YA 3G5MA 5EMNA 4GR9A 2BZSA 2XOEA 3N3BC 3L9XA 3TZBA 1FLAA 3F6RA 3NHKA 4R81A 4LTNA 4N82A 4C0XA 2GSWA 2HNBA 1GG5A 2XODA 2F1OA 2FCRA 4FX2A 3OJXA 4OXXA 4QOHA 5NULA 5ULLA 3OX1A 3FVWA 4LTDA 5LJIA 5F12A 1FUEA 1QBGA 1AMOA 2MWMA 1TLLA 2HNAA 2R96A 3ESYA 1RTTA 1J9GA 1WSBA 5BUCA 3QE2A 1E5DA 1YKGA 4ICIA 4ESEA 5FX2A 1C7EA 1J9EA 4U7HA 1J8QA 3NHWA 4QOGA 1SQSA 2Z9BA 4QOEA 4Y9RA 1CZHA 4CF6A 1KBQA 2Q9UA 1CZUA 3GAMA 1AKWA 3ESZA 1QR2A 1RLIA 1DXOA 4FGJA 3GFRA 4YAFA 1XYVA 5LJLA 4ZVNA 5F51A 5FUQA 2Z9DA 3OJWA 2ARKA 4U7GA 3QFRA 6NULA 1FLDA 1AHNA 3FX2A 3W79A 3LCMA 4YAOA 1AKRA 2X2PA 1FVXA 2N1MA 1XYYA 4CETA 1QHEA 2FVXA 2OYSA 2BF4A 3B6IA 1C7FA 4QOIA 1V4BA 2BPOA 3FW1A 1ZX1A 3W77A 4C76A 3F90A 5JROA 2MTBA 3NHFA 3K20A 3ZHOA 2BMVA 2QMYA 1CZKA 2WC1A 3NHRA 4J8PA 4BMOB 4DIKA 2Q62A 1DX9A 3ES9A 2V5VA 3LT5A 3L9WA 1CZRA 4QOFA 2ZKIA 4ZVMA 5B3KA 2QX8A 3B6KA 2A5LA 2KQUA 2RG1A 4M0CA 3GFQA 1QRDA 4Y9UA 5A4KA 1NNI1 3KLBA 1FLVA 5F4BA 3B6MA 1BVYF 4D02A 3N3AC 3U7RA 4HEQA 4U7FA 1AKQA 2QWXA 3JSXA 4NLLA 4DILA 2AMJA 3HLYA 1WSWA 5EA2A 1D03A 3NHSA 3QFCA 1FLNA 4LTMA 1JA1A 5TGZA 1AG9A 2OHJA 2BN4A 2FDXA 2FX2A 1DXQA 3F2VA 1T0IA 2QX9A 3KEGA 4NULA 2R97A 1AZLA 1RCFA 1KBOA 4HS4A 1XT6A 2FOXA 3GFSA 1AKVA 3K1YA 1VMEA 3B6JA 3HR4A 1YCHA 3OX3A 1SG0A 2FLVA 2QMZA
chains in the Genus database with same CATH superfamily
1NN5A 3O8CA 5E3JA 4B32A 2JD0A 3DOFA 1ZVQA 4ZT5A 4RTQA 3CX6A 3SI7A 2YC2C 2ZR8A 5JZBA 4JYPA 2GKOA 2DVMA 4PHHA 1OR8A 2YHIB 4G41A 5JAMA 3ILYA 3N2YA 3PHGA 3FM9A 1Q7GA 2YHAA 4Y2GA 3GPIA 3BZUA 1CKEA 4FJ1A 2RJOA 3BF8A 4QOJA 3SFVA 3GFVA 1ZQ9A 4RE6A 5GJVC 2F1HA 4CQLA 2ZYWX 3AEYA 3EY4A 4OUDA 3W9UA 1HRDA 3I76A 3A4MA 1VG9B 4GRIA 1CUUA 4WBNA 5HZHA 4NATA 1V7PC 1SEVA 1QHIA 5F2KA 5F35A 2FZEA 2PL5A 5AO9A 4EGFA 1JSXA 3GAFA 3P32A 1VYTA 3O82A 1XDUA 3IURA 1K4YA 5FT9A 1YZQA 3G17A 4NEHB 1IQ0A 4MPJA 1EVQA 2RBEA 1XMIA 2ALJA 2NT4A 4PTZA 2H0QA 2JIDA 4JI4B 1GQOA 5F5NA 3VNUA 2YIMA 4D99A 2GPJA 4NJEB 5F3WB 3G2NA 4KI0A 1TJNA 1J1IA 3G2MA 1R4MA 1R7RA 1OT3A 4IDBA 5GJBA 4X66B 4DC0A 3MJFA 4L72A 4EKNB 1KFCB 3GUCA 5EQTA 2ZRCA 3ZWCA 3B3FA 4K8RB 1ZD9A 4DCSA 2EP5A 5BV2P 5AXBA 3ZYCA 4HWPA 3L4KA 3GEIA 5E9WA 2C3PA 4IH1A 2Y1DA 2R87A 2XH8A 7REQB 4F92B 4DUZB 1NXXA 2I7CA 5H80A 1VIVA 4INOA 5IANA 1V1MA 3P5SA 1U9CA 4IXWA 3WK5A 4TS1A 1KVTA 4QUHA 4IZHA 4P34A 3RVMA 2JS7A 3KVVA 4F4IA 3ETCA 3REFA 1GUFA 1V4NA 2AKYA 4HEA6 5FA8A 2ASVA 1YGYA 3VOAA 1TO6A 2CF5A 5H5JA 4ZI3A 4QLAA 1YI8A 4EY3A 3GLIA 5AM3A 3C5EA 1Z56C 1F8XA 1HO3A 3OQ1A 3SYNA 4EPRA 4G85A 1FLDA 3KSAC 2R68A 2IYVA 3CKYA 2FW1A 1PV1A 1SVIA 1W2GA 2QL5A 1TYZA 2W2KB 2BGNA 2P79A 3QEMB 4URZR 1G3QA 1JR3D 1U31A 4QYTA 5EZQA 4LFAB 1NUPA 1G8FA 2HRBA 2NOAA 3B6IA 5HKKA 1M54A 4S1VA 2XNHA 1O95C 3VNRA 1PK8A 3HXPA 2RIPA 3O6VA 4RIEA 3WB9A 4B71A 4JC8A 3RI3A 5ALFA 4BQQA 4RUKA 5LUAA 4DBLE 4AKSA 4C6TB 2NO4A 1VJ1A 2QQ5A 2X4DA 2KQUA 1V1JA 3E4CA 5JZ9A 1P6QA 3A58B 4CKBA 2A4KA 1U2TA 4DCGA 8MHTA 2XYRA 3WLNA 3ZDXB 4XGKA 1R6DA 4O1MA 1Q3TA 4IIJA 5EVCA 3JZFA 3ZE8A 3N3AC 3LRPA 5JO9A 4BNDB 4UFOA 4FCTA 2HA0A 1ZJJA 1XTRA 1D1PA 4J29A 1MEEA 3TFWA 1MDFA 4MVCA 5AM0A 3SF8B 3ZY3A 1E1CB 2F3SA 4FUTA 1GPWB 2WAMA 4FT2A 4KXLA 4JLKA 3RT7A 1D0SA 4ZMRA 2O2JA 3GQBA 4TRMA 5LZ8A 5B12A 4FJ0A 2WINI 2HU2A 4OGFA 3EZXA 3GLSA 3P9RA 1P60A 1B3RA 1YL6A 3UXHA 4CGYA 2Q2QA 5KCMA 3ZZ1A 1WY7A 4ASUD 2NVUB 2I78A 5CNKA 3PWSA 4DWVA 4DPKA 1HTTA 5ITVA 3DWIA 4ND6A 3RV3A 4DAOA 3TGWA 1YJCA 1XXHE 1JYEA 1UPUA 2RJNA 1IH8A 3ZD7A 3ANYB 3B7WA 5K5EA 5KQMA 2XOKA 3T3NA 2B1JA 5CCBA 1J2EA 4DJEC 3L40A 3R6DA 4QFDA 4EO7A 1DAKA 1QP4A 3O7WA 5HF9A 4WMLA 1H6DA 5C2JB 3HYSA 3LFHA 3AB8A 3LW7A 2NW6A 4LHSA 3LTEA 4BVFA 2B2CA 3KPUA 2V97A 3KYIB 3FLEA 3P4UA 4JBXA 4R8VA 2PSHA 3TPFA 3I4FA 2F3RA 1ITZA 5I8WA 4MRPA 1R0RE 3CF4G 1LF0A 2UZ1A 4M0EA 4MQLA 5L7TA 3SZ3A 1A9SA 1VL6A 4F4JA 4Q4LA 3EQZA 4MVJH 4FOSA 4EATA 5AKHA 3A3NA 4JI8B 5SZIA 3WQSB 3WJAA 3I5AA 4UBJA 2QMOA 4V0MA 1F1BA 4YT4A 3U7GA 4DQLA 1YRWA 1USUA 1YE8A 4UOZA 2V55B 2ZQZA 4CR8A 2TSYB 4X60A 4HRAA 5A4FS 2OC4A 3E7WA 1K2WA 1WHSB 1CP2A 2H1LA 1SMKA 1VHDA 3OUZA 3JYHA 3L7BA 3M4NA 3QNMA 1L8XA 5CP8A 1GGNA 1YASA 4WZZA 1H4VB 4EPTA 2CBZA 4JP3A 3BMNA 3BKWA 1CEXA 1QGDA 5JNLA 4KN8A 5HIKA 2VSQA 3E5NA 2DUMA 1P4JA 4IIDA 2AG1A 4B2LA 1WDMA 3K5PA 3IR6A 4QASA 4B3MB 1S2GA 4O2AB 2Y2UA 2NVWA 1ZXBA 1LJLA 5BUZA 3FNBA 3BWXA 1L5NA 1E3TA 4M55A 4TTVA 3W8DA 1FOEB 2EFDB 2D2IA 3AXSA 5GZ6A 3EIHA 2AV6A 2TMGA 4GT1A 2Q7DA 5IDYA 2WU8A 1ZY2A 2VN8A 2XUKA 2Q9BA 5FAKA 3MG9A 3DAFA 1MH9A 3KZKA 3ZE6A 4BLTA 1BHSA 1P4AA 1STOA 4M9XA 1GU0A 2VK1A 3FVQA 4MR8A 4OGKA 4PO1A 4XIFA 1USWA 5KJEA 3VKUA 1N2CB 3ROPA 1DO8A 2QRZA 1I3NA 3IELA 4Z4IA 3MTQA 3P52A 2C4UA 1L8OA 1UJMA 2ZI5A 5KNCD 4IICA 1LSSA 3QE0A 3R3UA 1E9AA 3U0VA 3LC7O 2Z2IA 2I0FA 2WVHA 2XE7A 1UZNA 1KWGA 4P84A 1UOOA 1HF3A 4A6EA 3AHIA 1I2BA 3K6KA 3AU9A 3BERA 5DJ5A 1ZVVA 1TU4A 2XB4A 3IP6A 4BX3A 4RPIA 3M3PA 3OCUA 3T7JA 1E6WA 5B2EA 3UHOA 1Z4JA 3RYCB 1RQPA 1E1YA 2ZR0A 2H6EA 3SHOA 3D5QA 3WLPA 4ZJZA 1YA6A 2IBTA 1TTQB 3SC3A 4V0OA 3ZD9A 5AUOB 3AEZA 4CR7A 1SUWA 3ZLUA 1NF2A 2QMZA 3WOVA 1P1JA 4GZ6A 3SVZA 1CHNA 1BU5A 2P5SA 3RFFA 3M9XA 3V4FA 4H7KA 8ATCA 3LWBA 4J2TA 4RTNA 3BH6A 5A71A 4A8TA 4OKSA 2ERXA 2RSLA 4NS4A 3VR2D 2EWWA 5AVYA 1WZUA 2GRUA 4I8IA 4BZQA 2J3HA 4FYKA 1KAEA 4DWJA 5IXJA 2AFVA 1J0BA 2GXUA 4V0LA 3COPA 3MINB 4V3BA 5AIAA 2MJLA 4DDWA 1KDTA 2CXSA 1YQDA 2HSEA 4EM6A 1L4NA 2V6BA 4HBGA 1NAIA 1B6GA 5AKLA 1BS9A 2ZYRA 4BNHA 1GRQA 5K05A 1M7HA 4BCBA 2HV8A 3P2MA 2CNOA 4YRJA 1G8JA 1ONOA 2BJVA 4IO0A 4KHZA 4LMRA 4FYYA 2GO7A 2WSYB 5AJYA 2MT9A 1MA3A 1PGJA 2GAIA 1IPHA 1ZOIA 2ZCUA 4OX9B 2E4AA 2LNDA 1OUMA 3UOWA 4D0SA 4BHTA 4ALIA 3GK3A 1XZHA 5G4KA 1ZN9A 4ZOBA 3UGKA 2IYPA 2AFHA 2B5OA 4TMYA 4KV9A 1JV2B 5BV0A 3GRPA 4NAVA 1J0XO 1I2ZA 2FSFA 5JXIA 2CSXA 2CJFA 4HLNA 4W5WA 3C3YA 3K4HA 3KTAB 2PKQP 4J7UA 4JL8A 3LXXA 1KIMA 3CR3C 4FQ7A 5ALDA 4A8JB 2Q7OE 1T91A 4D9NA 3BIOA 1EEHA 3UJ9A 3H5TA 5C8YF 3S8YA 1P3Y1 4C21A 4GVPA 4YP0A 4L8VA 3I5UA 2UYCA 2GEFA 2R96A 1ZMOA 5L3QB 3IX7A 3WAKA 2ONZA 3QQ5A 5KX5F 4B82A 4QVKA 1SKMA 1TKBA 2R84A 5C8XA 1MC1A 3IULA 4PZEA 3C6KA 4Q4AB 3SXUB 2IPOA 5M3BA 3RK1A 2G5CA 2FWPA 1IDN1 1ACJA 2X9QA 1OPXA 2PGJA 1BE6A 3MC1A 4TKMA 4RZIA 5GOZA 3ZWYA 4AO6A 5KOHA 2VQEB 4MTCA 1CJSA 3I52A 3PC4A 2JJ8A 2VXYA 1WXIA 3R3JA 4ZODA 4LBVA 3JQAD 4ZARA 5KNCH 4MS3A 2HXSA 1X39A 2AEEA 3F9CA 3RBVA 3TDKA 1DDIA 3V4RA 3S0JA 1OLUA 2J45A 3DTVB 3H42B 3R24A 4LCEA 4DJFC 3LY8A 2X5JO 2EP7A 5HFNA 2UAGA 4E5NA 2PGXA 4ENVA 3GDGA 3FFBA 2ACEA 4OATA 3HJFA 4MKGA 1M0TA 3BWMA 4Y8VA 5KSZA 4EYOA 1MENA 1A72A 3MYYA 3ZTTA 1T1SA 1W25A 5CPFA 5HDBB 3BA1A 1UQRA 5AFSA 4ZVUA 3LTNC 2ANBA 3ANNA 3P96A 1JYSA 3PC7A 3C3DA 2RG1A 5H9VA 3K1AA 1Q84A 1XQVA 3D64A 1EK2A 1GNSA 1WWKA 1TCCA 4XPIB 2IYYA 2MSLA 2B37A 4IL5A 5D3MB 2O8DA 1RLOA 3ILSA 4W8GA 3VV3A 1DAPA 3AT1A 2OD9A 4R1SA 3A7EA 4CWAA 1J24A 1WEKA 2EC5A 5EKUA 4C3VA 1JIQA 1E1QD 4OYYA 4YT2A 1K3FA 3B1WA 3ET5A 4UHKA 2FN8A 3T3PB 1V6AA 3PCTA 1OSNA 3TRKA 5IMSA 4Y9DA 4PG7A 4E5YA 2ZYHA 4LCJA 1UK7A 3I2KA 3OZUA 1FNBA 2OB2A 4RAOA 3D0QA 1RQXA 1VPVA 3CVOA 4EX7A 4ER6A 4LRSB 3T8YA 3UTDA 4O2LA 1DWQA 5C7OO 2HREA 2H2GA 3WIDA 1D2AA 4B76A 3QP9A 4QAJA 3SEAA 4DLRA 4NXMB 1R00A 1ILWA 2QRUA 4B7UA 4R1MA 5BMVB 1C1HA 3FYHA 5CB0A 3PJEA 5KYWA 2H52A 5FPPA 5BN5B 4D4IA 1JKMA 2O9JA 2Q0SA 1SD1A 2ZRKA 3RC7A 4N18A 4BRWA 4R9SA 2O3QA 1KJZA 1FVHA 1E66A 1EFPA 3AQIA 1M3SA 3I2IA 3K9HA 1GO2A 3D8NA 3JALA 3C70A 3Q98A 2DY0A 3GI1A 4BATA 3ZI4A 1W73A 2H2FA 4HMOA 3JYLA 3Q7RA 2NU9A 2Z2JA 3OZCA 6YASA 3NBMA 2J85A 4BO1A 1AKYA 1BXGB 2FK7A 4LSZA 1GCGA 1HC7A 2ZJZA 3UMSA 2VFAA 2VT7A 4WNCA 2XA9A 4KL8S 1R1DA 3CLRC 4HD8A 4QM7A 1IUPA 5JSKA 1PNOA 1OFUA 3KKOA 4Z2YA 4KX5A 2E48A 1NY6A 2W58A 4GXTA 1L7QA 1IUNA 3L6OO 5ALJA 5ENVA 2V6MA 4ZU6X 5H82A 3OQIB 4E88A 4G5FA 2ODTX 3C3KA 3NC0C 4WZBE 2QT1A 4IS2A 4GL4A 5JARA 4TT3A 1NVEA 4YV0A 1H2HA 1VCOA 3AG6A 3QYPA 1IWBB 1W96A 1LPBB 2OPBA 4XARA 3S2SA 3WXBA 4DMRA 2E4VA 3FH0A 1HZZC 4B4VA 3PXAA 4CEJB 1V9LA 2QY9A 3ZKAA 2P11A 1E32A 2YZNA 3C5WP 5B5SA 3BKXA 3KLOA 4X54A 1WXEA 2XQIA 3DXZA 1YXMA 3E3NA 1ADFA 4BFLA 1C7EA 1A4UA 1OFGA 3T7KA 5CD9A 2CLIB 4FDTA 4N3CA 3HADA 4DYHA 5KYXB 2QLTA 2XQKA 3COJA 1EIZA 1O03A 1WIWA 2J9RA 2JCYA 4DSOA 4YJ2A 1I7SB 1OW3B 1G17A 1QIHA 2OY0A 6AT1A 2NZXA 1N2JA 4C6RA 2V03A 2WYOA 1U0BB 3GZNB 1JHDA 1KOLA 4CMHA 4IDFA 5AK5A 1WP4A 2GLTA 2PX0A 4KI7A 3NI2A 3A6DA 2WQ7A 5KO2A 4ISCA 5ESXA 4Q7QA 4A2CA 2GAOA 3MF4A 3MCTA 1YZGA 1VHQA 2B5WA 2BPOA 3E9ZA 1ZX1A 2IU4A 3QSGA 4MVJA 1XC7A 4I1RA 1XPOA 2ZRQA 2QYHA 4U7WA 4WLFA 3DBHA 1F17A 3JSAA 4XWKA 3FOFC 3DMGA 1AGXA 4IGKA 4XQ9A 3JQ9C 5CK5A 4PHCA 2FCAA 2J9YB 2CMKA 4RJJA 1G5IA 4PGAA 2OHGA 5C53B 4B6QA 1BW9A 3PPVA 5FBQB 3T06B 1MB0A 3ZIUA 4DANA 2VK2A 3LS2A 4N03A 4RFSB 3ZUPA 4YRDA 3H8JA 5DW0A 3TG2A 2XY4A 3C1OA 4ZOAA 2WFLA 2EL7A 1G64A 4AJJA 1Q57A 2Y0PA 1OWPA 3PQ5A 4HWOA 5E6SB 1UINA 1JKJA 5ECDA 3VOBA 3ICVA 5CYPA 4LJAA 3WNCA 4DJJA 1OJ7A 3GGSA 5HTOA 5A1JA 1JFRA 2WF8A 1I0LA 1VBFA 1JTFA 3E1SA 4CTOA 4W8OA 2IU6A 2QUIA 2V0GA 3IUJA 3LP6A 4LOHA 3H9JA 4LJLA 4YAUA 4JFAA 1J21A 1K92A 2AJ8A 2NV0A 1RPNA 2X3YA 1FJHA 1M7BA 1C9JA 1EDEA 1NC1A 2P5YA 1Y8QA 2QE7D 2PDAA 2XA1A 3HU3A 4TZ0A 5D51S 3ROGA 1A96A 1WU7A 2Q3HA 2Z5GA 2CHEA 1KA9H 1X7WA 3GRUA 3ICCA 3UN1A 4U8GA 1YZTA 4TWJA 1Z6PA 2A88A 4HQOA 1CV2A 3DLBA 4LS3A 4MKFA 3JZMA 4G67A 1LRJA 1CY0A 1UMBB 4XE5A 4B3JA 4CV0A 4LJSA 3QLEA 4JP5A 4BJHB 1NXWA 2ISQA 4L02A 2VHWA 1XQ9A 4RVNA 5A4DA 3HJRA 4BKMA 2B8NA 2ONKA 1C4KA 4Q3OA 4MOWA 4URHA 1M2KA 2YBEA 4ZT2A 3CKMA 4AMBA 2ZBDA 4MYCA 4DY4A 1BCSA 2FN7A 4RELA 1G8MA 3HABA 5FQNA 2XEXA 4NNPA 1JDZA 1TEHA 2EDCA 1AV6A 2I34A 3PXGA 1IY9A 2DHCA 3VR3A 4H6XA 3REQB 3LYHA 3SQOA 4CLOB 3CF2A 3MTGA 3HP7A 1M73E 3UMYA 1FJXA 3NTOA 1H94A 5F5LA 1YQXA 2QTWB 3VA7A 3KJEA 4OB8A 3OKFA 3H1FA 4EA6A 1LK7A 1VLLA 3PNYA 2COUA 3VYRB 3PB3A 2G70A 3M6VA 3P9QA 4WDRA 3IAM1 4GQBA 5A7GA 3GPLA 4MI6A 2JHCA 3ROQA 2ZIEA 4HVTA 5FB3A 2XTMA 2G9VA 3GLRA 3HHEA 3KE9A 3MWKA 1RKUA 3L01A 4DLBA 1L7PA 2YL2A 3C98A 2ES4A 1FDOA 4U6SA 3NTRA 5BSVA 1B43A 1CJMA 9MHTA 4L0CA 4QL3A 2FSGA 1ZHFA 3F4BA 2IH5A 3PHIA 3BB3A 2G1UA 2EX4A 4QO7A 4DREA 3HI6A 2YWJA 3WB2A 2Q07A 3G2HA 3MWDA 3NHBA 1XVIA 3IP1A 3PZBA 4JGGA 1U98A 4MB0A 4DLSA 5AYVA 1AHNA 4E11A 4OKIA 5A05A 3CVYA 3HYNA 3ETHA 3Q3EA 4EYQA 1T9DA 4KXVA 1ZIYA 3LZ6A 4PC3A 4D9KA 1U2DA 3A4VA 4J16C 1XWIA 3TPZA 2VAMA 3WGIA 1JHRA 1R10A 2YZ7A 3ML1A 4ARAA 5JROA 3T54A 1WHSA 3Q1KA 1GZ3A 5U4XA 2RHCA 3SWWA 1DQNA 4AU1A 4BUJA 4XYLA 4E2WA 1EYZA 2QOEA 1MO4A 2ZUWA 5I9SA 4HT3B 3AIOA 4OK6A 4G84A 5G3YA 1WLSA 3B36A 4R2LA 4EY8A 4NP6A 4V0SA 3UK0A 4W5NA 4JQOA 4FWIB 4EEKA 2F3QA 3MFQA 4OHZA 3A9WA 5IEJA 2YYSA 4KP7A 2QSJA 3DLTA 4PAOA 4ESHA 1UPBA 4DB4A 3CEAA 4GKBA 2DSNA 2CMGA 2XNDA 4UXIA 4JB2A 3A3PA 4CKWA 4BJ6A 3P4YA 4LNUA 1L4YA 1Z5ZA 3CW8X 1TA9A 1WF3A 4DQUA 2E89A 1MX1A 4X61A 4O1IA 3Q88A 1G21E 4CKCA 2G8NA 3JVDA 4IHJF 1XVLA 5JANA 4K6FA 5CLQA 3GU3A 3ZNOA 1JR3A 4EG8A 4Z1OA 5JD5A 1UEIA 1EP9A 1TVKA 1UKVY 4MI1A 4NICA 2NAFA 3HGQA 5I9NA 1AUVA 1YMQA 2VT3A 5EFOA 4QZVA 4D79A 2QK4A 3PNQA 4OLAA 1JWAB 2QTBA 1KYVA 1LTKA 4S1TA 1EINA 3L43A 3L4BA 4CQNA 4WOPA 1QZ3A 1LLCA 1N2CA 2BRUC 5P8WA 1GYPA 1UC8A 1UMDA 2WLSA 2RHJA 3LCJA 5FCDA 5HJ7A 2P8JA 1RYDA 3LLMA 3MWYW 5A04A 5T4BA 1JIUA 4NOLA 3NYIA 1XMPA 1MD9A 3CUTA 1MPTA 3GY0A 2XF8A 3Q5DA 4X90A 4BQNA 2ZJFA 1YR9A 3OCYA 3EC1A 2BE9A 4LOKA 2C0PA 5B6PA 5AOAA 2Y1EA 1GKKA 4BMZA 3IEKA 3MERA 3L49A 3OEYA 3KT6A 2KLHA 3TNDA 2WQ6A 2DXIA 1H8HA 1QH8B 4H59A 3G59A 1RYMA 4LC1A 2ODWA 3WS7A 3H9EO 5KVCA 4QXRA 1S2MA 2E18A 3QVGA 1B74A 3K32A 4R0NA 3OOHA 3A28A 1AK2A 3OCVA 4P7JA 4ROSA 3RS0A 1KNXA 4JKYA 1FSSA 3KXIA 1SA0A 3QQPA 5H3LA 1ES9A 4XB1A 2FCRA 1G38A 3W06A 1GPYA 3CEHA 3AVPA 5IBRA 3ADOA 4GRAA 3ZX4A 3SYLA 1DWPA 2BTEA 3D81A 5E9QA 1E59A 2P5TB 4MUGA 1QAOA 4BO8A 4CKWB 3QJYA 3E5MA 4IIHA 4GQAA 1XEWY 5JD6A 2IY7A 2HKIA 2XRMA 1IK4A 3AX6A 3PJDA 1SQSA 4OQMA 8ADHA 3FMFA 4PR3A 5DI3A 4P58A 2PGAA 3FPKA 2HJ9A 1NM5A 3RTGA 4AYXA 2M1ZA 1A1VA 2ZUFA 3A6LA 1H0HA 1C0KA 1M9NA 3ZQ6A 3OA2A 5DHFA 1EH5A 3W6ZA 1RXYA 3ASVA 1TLFA 3QBDA 4Q4HA 1FXUA 2X22A 4IM7A 5DGIA 1MC4A 5JMOA 1SB9A 1TDJA 2JGRA 1AX9A 1A50B 1Z33A 1DZIA 2BTQA 2I3ZA 1T6YA 2ZIGA 4RKFA 5HBGA 2ZI4A 5TC4A 2C2OA 1Y1LA 4AROA 4BFYA 4EG6A 2G63A 3U3XA 3X2SA 2XUGA 4FP9A 3WV5A 4CTJA 2QZ9A 1Q20A 3A27A 3MOSA 3MT9A 5GAJA 5BYBA 3B9BA 4H7IA 1BC5A 2LW7A 3RJTA 3BM5A 3VTAA 4EG0A 1OWMA 3MUNA 3QVWA 1TQHA 2AG6A 4AY6A 4LE2A 3QOYA 2HN9A 2Z1MA 1X80A 3DFMA 5JVDF 5DEIA 1YIAA 1DBRA 1BVYF 1L5HB 3V4SA 1IVYA 1L4GA 1N2XA 2F59A 3T61A 1Z6ZA 5J47A 1PYOA 2O23A 1ZUHA 5KTMA 3FFTA 1W0JA 1Z8DA 3E03A 7MDHA 1AGYA 1RAGA 2FUEA 3KEGA 3EFEA 5IJ0A 2NU6B 5IS2A 1JH9A 1OIWA 1VRVA 5AK4A 3OHMA 3MUFA 1N9KA 1XHEA 1Q19A 2G4VA 1XKXA 3CPSA 4L4SA 5EP2A 4YP6A 3UEOA 1SG0A 1TAUA 3VC3A 4GD3Q 3PQEA 2JFFA 2QM7A 4NDZA 5EKDA 2VSXA 2AVNA 4I0WB 4QTZA 3AIIA 1CR4A 4GI7A 5KYUB 3UPDA 3LPAA 1EFRD 4GSLA 3EVGA 1ESCA 1P2FA 4NBWA 4DW8A 3LQQA 2XXAB 2GFHA 3EAQA 3TFOA 2HA6A 4Z8YA 5ED0A 4AW9A 4IHQA 2HM7A 4KUEA 4NFLA 3RGGA 2GILA 3AI2A 2HRDA 4H3VA 1ML4A 1VJTA 4G0NA 5LQSA 3BHMA 1QOPB 1SVKA 2AEJA 1MRNA 2P2NA 4I3GA 3HMQA 1VJ5A 3AONB 3Q8LA 1R16A 3E53A 4QGHA 2OP1A 1QRRA 2XW6A 2ZRBA 4I3FA 4OXRA 4ZI7F 2V5AA 1WCYA 5KPJA 1WZIA 5BSKA 1OAOC 1UIMA 1MQ9A 3WKAA 4TLLB 2HAEA 4J75A 3N75A 1L7OA 3TLEA 2VK4A 1JJIA 3ENQA 3EZYA 4RSHA 3BHIA 2WI8A 4Y6RA 4E3ZA 1DB3A 3HR8A 3H65A 5ALZA 3NUQA 1QQBA 1M2WA 5JLAA 4HZUB 1KO8A 2QN3A 3EOAI 4NDAA 1IZ7A 1I13A 1Q6YA 3JR3A 4FNGA 4XTCS 1NXVA 4F1WA 4OHFA 4D0GA 4OHBA 4YXWA 4QM6A 2OHOA 1MIOB 1SCAA 3HB9A 4N0QA 4N82A 4A9AA 2Q4DA 4L3VA 3RABA 3HKDB 3U4HA 1B8UA 3VFDA 1CF2O 5AVRA 1E9CA 2PCJA 4W1QA 1JAYA 1U8YA 2WU1A 2X1MA 3S7ZA 3F78A 3UK6A 2G5TA 4DLZA 3PXDA 4WINA 5IXYA 4MR9A 1A9YA 1YKSA 4G25A 1NSFA 4HUJA 5EPUA 4KREA 1A4RA 3G0CA 2J0UB 1TQDA 4NBKA 4XM2A 1Q7BA 4HGYA 3GGPA 4F72A 5COAA 5KYWB 3ESZA 2BDEA 4ZIRB 3O8QA 3ZWOA 1KQ3A 2PKEA 4ZVNA 2O3UA 4I99A 3RTAA 4NOKA 4Q1VA 3H87A 2QYOA 2E7ZA 2XNSA 3ZN2A 5I9MA 5C4IA 2PGOA 1USIA 2QD2A 5F98A 3V4LA 5AKYA 1QE3A 2K7FA 3JX9A 4Q48A 3R7AA 3A1EA 1JVNA 1IY2A 4ADSG 1GGHA 4KWCA 3G2IA 3EQ9A 3O1HB 5IVKA 1DAOA 1NR1A 1AN9A 3CBQA 4PC2A 3MJ4A 3Q5EA 5LQKA 3GVCA 4NCBA 4L28A 3B5JA 2VNKA 4KOAA 3U3DA 2OBBA 4TWBA 1NLUA 5HE9A 5IJAA 3ETJA 5JMWA 4KWHA 2ZB4A 2A59A 2IKQA 2GNAA 2Z6VA 4PO3X 1ATZA 1KMNA 5KYXA 3K9GA 2DHEA 4NSNA 3CWQA 3UBTA 4BY9E 3K2EA 4NESA 2YHUA 1JIJA 3W6PA 1JLLA 3ZS8A 2FW7A 3CS3A 3KKEA 5ALNA 1MOZA 1EB8A 1GV0A 2O2DA 2WZQA 1L4LA 2LIPA 1XU9A 2QORA 2X19A 1OA0A 5IBCA 5KEIA 1LFDB 3PGXA 4JN6B 2WTUA 3B6JA 3C1TA 4HLQB 2JLSA 1M1YE 5CD1A 1K2VN 3GLVA 1NQWA 4PCUA 1CQIA 3P9PA 3W04A 1OJLA 4GP9A 2IP1A 5HS4A 2CFRA 4UNPA 4QHSA 2YS7A 2XMZA 1QX3A 3DMNA 3T1NA 4JU8A 2BI7A 1NV9A 4PLTA 4E33A 1FU8A 1HYBA 5LDHA 2GHIA 3EBOA 3W3AH 3FETA 5HK9A 2O2CA 1SHTX 1E2QA 3O2SB 1HT1E 2WHYA 3VX3A 4Q4JA 5BWOA 1GRRA 2LWIA 4MARA 2W48A 1QH1B 4QREA 5BNTA 4MA5A 3I3SR 4H4DA 1VG0B 1WW2A 2F8MA 2HLDD 3AC0A 3LNTA 3NASA 2IXTA 2PWZA 4U6NA 4QSHA 3WIUA 5KU7A 3WDSA 1N2EA 5K3SA 2J3IA 2QLFA 5CBKA 1UBTS 4L3OA 2UYOA 3DVLA 4AMZA 1E0AA 3ZVLA 4G4GA 4ASUA 4CCWA 5TPWB 1SHZA 1SUCA 3IOMA 1JPVA 3O4GA 4JKOA 1JG1A 1T4CA 1VE3A 4AP5A 1DXHA 1A7AA 3Q11A 3CZRA 1MO6A 2C0CA 4KQKA 4KR3A 3K70B 2GERA 4KR7A 2B0JA 2QR5A 1NX9A 4D3DA 4P0PB 1E8MA 5LWHA 1E2DA 4HVLA 3TKAA 4INAA 2VDPB 1JFVA 3U0BA 4ND7A 5CFZA 3LX6A 3FROA 2ZUSA 3NO4A 4AURA 3HN2A 3ZNPA 1ESZA 4YAGA 1R9NA 1CHDA 2ZGVA 4Q7LA 1XDGA 5SICE 2IS1A 5I9BA 3B38A 4ERXA 1DAMA 1NBOA 1N5DA 1JFLA 3E1KA 3GA7A 3QMMA 5CLLA 5AXCA 4GWGA 1DKMA 2PL9A 2QRJA 3PX7A 2HBZA 3DMFA 5EOVA 4U6QA 1Z0KA 1DFIA 4UE3S 3J81k 1AIPA 3OETA 1NATA 2H7VA 1F2VA 1UMBA 1GPUA 2QTVB 4JROA 4U0KA 3MMZA 3RBAA 3VZSA 1U3TA 4JYZA 1PZMA 3G9TA 2VP0A 5I4KA 4LXXA 4G4IA 4NMXB 4OPMA 4KEAA 1ZVJA 3QTBA 3ZTYA 4AWBA 1XDDA 1XCOA 1R37A 2XXBA 3B52X 3IVGA 4LJ6A 4XOIA 5JLJA 1ETUA 2PMCA 4EZBA 1PFVA 2GZ2A 1DSSG 2AOWA 2ZWPA 9ATCA 1P1BA 1NTOA 1Q1QA 1NXQA 3GJ8A 3U3JA 3IAHA 4HMPA 3UWDA 5IT0A 4IRUB 4YJGA 3I1YA 4P7BA 2VHZA 1Q44A 1OGYA 3VO8A 1DKPA 4I1UA 3X1XA 3IP8A 3JAMA 4TYNA 4IBOA 5CA0F 4OLFA 3REOA 4FXOA 4KG7A 4N6GA 4QBTA 3EXHA 4MR7B 4MUEA 4A73A 3TVDA 2VQ6A 1MJHA 4I5EA 3NXSA 2EIXA 4DM4A 5IWAB 2AZ4A 5JAQA 4UEJA 4MGKR 4V0QA 4NOJA 4XIYA 2C07A 4CHTA 4BVHA 2UV8A 2CJYA 4Z6KA 1BKYA 2J0VA 4HN2A 4OMCA 1JA1A 5J58A 4LZOA 1X1TA 1V8OA 2CV2A 3OFSA 1WF6A 2IYXA 5GJCA 1EEXB 1WXFA 1Q0LA 1SZJG 1DCMA 2XBUA 3FHTA 4XKJA 4IY1A 1I94B 3UO8B 3L82B 3WKBA 1TTHA 4TMTA 1KEEB 3DAPA 3HYRA 2QUHA 3PIDA 4KFUA 1YE5A 5AM5A 2H2AA 4Y2RA 4NDNE 5LBUA 3ZY2A 3KU4A 4BB6A 1RHMA 4B2IA 4IUDS 3DYBA 1X2BA 3ELUA 3WDKA 3FPSA 3WMXA 4GEKA 3KSDO 3ZIAA 2B4RO 3CNEA 4DSAA 1MN6A 5IEBA 5I7HA 1Y1PA 3BK2A 4FMCF 1AUQA 2NTNA 4JGIA 1L3CA 1VIDA 2G40A 4ZQIA 3SJCA 4WE3A 4TLCA 1QYWA 5AM1A 4DCCA 2NNLD 1E9RA 1JDPA 5EP4A 4PS0A 3VKFA 1RRMA 4RGBA 4EHKA 1NQAO 1K7CA 3VPBA 3RWMB 5F7XA 4ZAZA 2Q3FA 4G97A 2QE6A 5EXTA 3R5TA 4Z5XA 1BN6A 1FDUA 3RIXA 4FMCB 3BQ9A 2IOHA 2D2XA 3W3ZB 3VZRA 1FFBA 3O7MA 4AG3A 5K8IA 5ALIA 3ZGNA 1PZHA 2FPIA 3WFJA 4EEXA 1V45E 4JJ4A 3H2BA 4CKCB 2I5PO 2W6IA 2AWNA 3KDSE 1IOLA 1MZPA 2QE7A 3P0FA 2JJQA 3NHKA 4Y1RA 1O6GA 1GPDG 4QOHA 1G7CA 1K27A 5FADA 3PLRA 3MLAA 3DFUA 4N4AA 2CLFB 1SVOA 4JSTA 3VXKA 3PHHA 1F12A 3BDIA 3C3PA 1SHKA 3I0NA 1G55A 2X5KO 2XVXA 4DA4A 3AVUA 2WYHA 3AZPA 4M21A 3WLEA 4C2AA 1O0CA 3ROEA 4HUTA 4E1AA 1MABB 1FYVA 1OTHA 4I50A 1VKHA 2BVNA 2H59A 2QRGA 1KEEA 4FMDB 3GT0A 1CDOA 4KAXA 2V3CC 2VHTA 4I1IA 3EXG2 3MLEA 1SVNA 3IBFA 3NUGA 1NDQA 2NTJA 4ZALA 3MT8A 3SE0A 4I3HA 5CA0B 1T8UA 1TL7C 1RYNA 2XRFA 1T9KA 3ROKA 1QZXA 1G291 4I5DA 3DE1X 1GG2A 5FYDA 3W90A 2D54A 2ZQ5A 5IARA 2B4YA 2ZDGA 3QKWA 5HZGA 4LXHA 1L4FA 4R5HA 4CCAA 3GR6A 4BNIA 3IAEA 3HKBA 3OZVA 4XGRA 1S1CA 4MMXB 2JCVA 4X63A 5EPEA 5CAEB 4A0RA 3CZQA 2FHPA 3QXHA 3H4VA 3OO0A 4QBFA 1EVJA 5TQ2A 1O77A 3FY4A 1JR4A 4R2KA 5EJAA 5B3KA 1GAWA 2QTCA 5KHOC 4GOND 2ZSEA 1E0JA 1N25A 3GVXA 4JKIA 3OPQA 1N6LA 2PH7A 2WJVA 3EFOA 4ZXFA 1GWNA 3I2HA 5FRDA 2PX4A 1K8ZB 3V9PA 5CB8A 3QVUA 3RAPR 3FUVA 4XUCA 2HWYA 4Q4HB 2AUTA 4MGEA 2ZIWB 4YJ3A 3FVTA 4XUDA 3TBFA 4BDTA 5KNBH 1E99A 3EDCA 4DNXA 4F04A 5DI3B 5TQJA 5JDCA 2L42A 3K7EA 1U2RA 3E9EA 1V7ZA 2FPMA 1R6AA 3FPCA 1HM5A 2GHQA 2GTPA 5DSTA 4G5XA 3AOGA 2ONJA 2IW3A 2FAXA 1XZJA 4P33A 3EPPA 3TDNA 3N2KB 5HIAA 2GRAA 1UBKS 1GR1A 1ZCJA 4ZI2A 5J5AA 3U62A 1T6NA 1NUTA 3QBEA 3RRMA 4BMPB 3A6EA 3GJ4A 3HJBA 4H9GA 4KW7A 1MGPA 3UK2A 4AJOA 5J3JA 2HO4A 3NBYC 5AVZA 5LC1A 1A69A 5DGHA 4XWWA 4EI7A 4DMFA 3UJBA 4S2EA 4X7MA 4H1TA 3C7CB 3HWWA 1M76A 4PZZA 4ALNA 4LGCA 1VJDA 1U8XX 4EY4A 1F51E 1T0PA 1VTKA 1PL8A 3JZDA 4G23A 5LDGA 5DLDA 3RC9A 3V7NA 1MW8X 2O1SA 1Y1TA 5T4FA 2EGHA 1PEAA 2ODPA 1B73A 4RTJA 4FB4A 3EC2A 3OC0A 4S04A 2IYWA 4QEDA 3HEAA 3CUWA 4N3NA 2P9ZA 3RS8A 3UGTA 3JV7A 4RU1A 3PWTA 2G67A 3RUDA 5EG5A 1N6RA 3OOEA 2JI8A 1WUJS 2B99A 4JEIA 1LSJA 2AFIB 1N2SA 2M1XA 1EUDA 2NSHA 4MPDA 4NOMA 2J5KA 2QPLA 3R3YA 3GRVA 4DXHA 2QUKA 3EW9A 1B8PA 3U80A 2JEZA 1FJGB 3HZZA 4LHWA 4PAGA 3KB8A 1E6KA 4RY2A 4X44A 5DTRA 2R7KA 3B8EA 4RNCA 1E5TA 2GBLC 3P97A 5K3EA 5LM3A 3AVYA 1JHOA 3T1YB 4OU5A 1V5IA 3BE4A 4L5CA 5JSUA 1MA0A 1RXUA 3KKZA 4J3NA 2WSBA 1HL7A 3LC1O 3TJZA 1GSHA 3CRNA 3ANLA 3IT1A 4LHZA 3SF8A 2Q7XA 3P0EA 4XIIA 2HSWA 4UHFA 2C1EA 1DO2A 5DULA 3P2KA 1SUPA 3NEPX 3PLNA 1UDBA 1WMAA 4UTXA 2VJKA 4OP3A 1I3OA 2VSYA 2ZRGA 2FWRA 3CX7A 3THYB 1A2KC 2A9PA 2A9FA 2C77A 1V71A 2ZAOA 4ZYWA 4EVQA 5T4EA 4RJLA 4BMYA 1T9BA 4KPUB 4YMWA 4IPTA 1EJ0A 3M1LA 2LZ0A 5KWVA 4LOJA 5I7AA 2CE2X 2JI4A 4BJ3A 5JS6A 2PMEA 5LZ5A 2VCYA 4Y0NA 2RGGA 2C58A 5BYAA 4TMWA 2A9KA 3IV6A 1W85A 2DMRA 2VAWA 4OF4A 2PRYA 1ZA1A 2JF0A 1SEPA 3PFIA 1OV4A 1SXQA 1I2DA 1XBTA 2GRJA 4I9GA 3I12A 1V9CA 5CM9C 2DPGA 3O8QB 4ZREA 4E13A 4Q1BA 4G5OA 1UP6A 5HF8A 1E8DA 4JYMA 4BEWA 1KYTA 2F3TA 3HDQA 1O0BA 1M75A 3X0DA 1DOZA 1DKOA 4OYRA 1U4OA 4XXHA 1PUJA 4JJ6A 1EUZA 4J3FA 4BNJA 3AUUA 1SG6A 4E5PA 5K0SA 3QYFA 4F4HA 3DMTC 4WUTA 4GOLD 1L9XA 1KFJB 1YZKA 2CXRA 3AUFA 4TUYB 4YCJA 1ZWKA 2V7QD 3WZ2A 1W4AA 4KFRA 2W00A 4E3WA 5BV8A 2W6JA 1M6VA 2JFQA 4LYEA 5IH7A 3E22A 4YAEA 1TD1A 1QDLB 1ZCZA 1G6HA 2BKEA 3DEZA 1MR3F 3F97A 4DVGA 4KN6A 1RLJA 4KPFC 3TBHA 3OPXA 1YDWA 1KZ7B 3A36A 1RR6A 3D6MA 5HKLA 2Q3MA 4ETWA 3OLQA 1A3CA 1ORHA 3SYMA 3H9UA 4B5LA 4Q3KA 4Z9FA 3TTUA 4TWZA 4CVNA 2WWIA 4YP1A 5FLKA 2IPMA 3JQCA 1DLJA 3QX8A 5EUMA 4RO0A 4JLUA 5FPHA 2OOSA 3WA7A 1GDTA 2WPDD 3H1EA 3L8EA 1KZ9A 1TTTA 1J70A 1E6MA 1R6XA 2AA3A 2PX2A 3OZSA 4Y0VA 1T0JB 1K6MA 3FDZB 1OREA 1ZINA 3GGGA 4UEQA 3D6UA 4OHMA 4NENA 2C8JA 3OQJA 3N8HA 2P27A 1EX7A 1FA9A 2CE7A 3MMXA 4DMLA 1Z37A 3PE6A 4YR7A 1VYHA 2HA2A 3L4JA 3OM9A 4B43A 3MUEA 4R3NA 1I30A 3T95A 4U8HA 1PS0A 1T9HA 4Y6LA 5CH5A 1UJCA 1MOSA 5P21A 4D8TA 1P0PA 3X1DA 1XFAA 2C5HA 3OZ7A 3IUMA 4D44A 2D7DA 3CUVA 1PLLA 4NFYA 1HQYE 1EXNA 3IL2A 1PDWA 1AD2A 3E7PA 1Z4OA 3LZCA 3DQZA 2Z3ZA 2CXPA 3EFHA 4B44A 1TIBA 2ZWOA 2RHBA 4IV0A 4RZXA 4WKBA 821PA 1EA7A 4F4DA 4DMCA 2A92A 2YYYA 3IBYA 1VHWA 2DKNA 2QN9A 4IFTA 2IXEA 5LXTF 3TRFA 4BLPA 1Q2UA 4UEWA 3W4IA 1RRCA 1QTNA 1X3SA 1N7GA 3UB4A 1C8KA 4MKHA 1CDEA 2ZI7A 1KBQA 2H0AA 4NTZA 4BWGA 3PJRA 4RZ2A 1OLXB 1RXIA 1RS0A 2EJWA 2NVBA 4RANA 1INLA 2J4DA 3FZEA 1L1QA 3RVQA 2P7HA 1A5BB 3OEHA 6Q21A 3VR2A 2VHYA 3CGWA 1ODIA 3G8DA 3BE8A 2VTDA 1KVQA 1P0FA 2GZDA 1GVHA 5EJ6A 4R40A 1CJCA 1LLFA 3C43A 1SBHA 1U28C 1HYQA 1YH3A 2AQHA 3AY3A 3L6CA 3OEED 1JQ3A 1JDUA 2C3OA 2CMFA 2OV4A 4CIYA 3MBKA 4G0MA 2II6A 3MOIA 1LDMA 4YV7A 5J2TB 1X1AA 4IF6A 1AHHA 4Y2YA 3WYBA 1U7TA 5IABA 4NMMA 3A0UA 4MW2A 1PT7A 2Q50A 4HBZA 1D2EA 3T5PA 3ABIA 5DWDA 4G01B 4J9UE 4PPNA 5ALOA 5CEEA 2V1XA 3ZJ4A 4LV8B 3WNQA 1VPDA 1RJWA 2I8AA 4R8MA 1B14A 1FBNA 2X23A 4M88A 1W76A 2HX1A 2XADA 4WXYB 4KNYA 4BFVA 2Q5OA 1RNLA 3CX8A 4GYJA 4LXGA 4YCNA 2ZI3A 1N57A 3GD7A 2B1IA 3TIVA 2BFDA 5ALYA 3SXJA 5H59A 1SU8A 2HMWA 4B8YA 1QGUB 4ZAYA 3D8HA 3VNQA 4PRKA 4NFSA 2XX3A 3JQGA 2FZKA 3D0RA 4ARIA 2DCMA 2CL7X 4BVLA 4FOOA 2B34A 4Q39A 1KI7A 2P6OA 2HIMA 3KQKA 5KKCA 5DE3A 1KU6A 3L79A 3MTIA 1Z6GA 3DDZX 4R5MA 4IIYA 2NZWA 3BILA 1Y37A 5DRYA 2BFMA 5EYPA 3VR6D 3ZBTA 1IJBA 4ML3A 4LOAA 3QY9A 2BDUA 5AVVA 1E7YA 1W1UA 1YCFA 3ADBA 1IZ8A 5LMNB 1DLIA 2ZRFA 3W1WA 4D6XA 5HKAA 4MI9A 4AECA 4HJXA 3RANA 4YRZA 3AUSA 4ZK2A 2F55A 3W5AA 2WIDA 1OFVA 3PHLA 5IMBA 3AKZA 1M6WA 1WSAA 1JKXA 1ZD4A 3HYCA 4QUGA 3PTAA 4YS6A 4ZGBA 2QDXA 1WBJB 2OO3A 3N2IA 2G9RA 1T9AA 4Q00A 4DUGD 6CHYA 2Q5IA 3M5DA 1K7SN 5ETJA 4BNZA 5IKOA 3WYAA 5DASA 1L4UA 2W11A 1T3TA 1O89A 1I6LA 3HS3A 1P4RA 4LYHA 5T3UA 5C8ZA 1ZNYA 8GPBA 2AQIA 2JKYA 3DB2A 1E20A 2JIBA 2IXGA 2H57A 3U7FB 3GN1A 2PLWA 1ZKMA 2IYTA 3CEMA 3B85A 4XD7D 3EPKA 3AVXA 2YVLA 3K53A 1MNAA 4W82A 3TOCA 5F2OA 1KL7A 4ENWA 1B0PA 4IRMA 2QAIA 3LAWA 1H2XA 4Z8XA 2QI9C 4H6VA 2QRMA 3LLUA 4UATA 2QP3A 2QJTA 4R54A 4OXXA 1S3FA 2JJMA 4FYPA 5C35A 3ZJTA 1XCMA 3KDAA 4TRJA 2D0IA 2GLUA 1PBTA 1M34A 1XRLA 2VLIA 4KBGA 5A3QA 3WRVA 1DU4A 3GCDA 3RUFA 4AF7A 3L5KA 1ZLXA 7GPBA 2FH5B 1BE0A 3J81A 2QBYA 3NRCA 3Q3CA 2LD4A 5IDQA 2O8NA 2Z5LA 4AQDA 2VNHA 3GEGA 2X0DA 3ZWQA 1L9KA 1VHLA 2QG9A 4C4ZA 1I10A 4ATNA 1CZHA 2YWFA 1G5FA 1Z38A 4JUCA 1CZUA 4MQEB 5DGCA 1SIUA 2G4CA 2OFOA 1GGFA 3IQZA 1NAHA 3A6JA 3JR7A 7AT1A 4C0BA 3PP8A 4WXMA 3I4CA 5ANRB 1HDCA 1W59A 1HY3A 4PXAA 4R8SA 4U39A 4FI3F 3EVTA 4BVEA 3FCAA 1WXDA 4ACBA 3MWEB 2J0EA 4IIJF 3TGPA 1Q7CA 2XRYA 4GX1A 1FW8A 4GF5A 3HWRA 3MGAA 5EINA 1HGXA 4LRTB 1H4SA 1P0QA 1Z2AA 4Z0TA 2D6FA 1VPWA 3PC2A 3D4PA 3L0SA 4GMXA 1RBYA 4W5HA 5F9HA 3BIFA 3IIMA 3KLPX 2H54A 4KK4A 5HJ5A 4IIXA 4R83A 1EE1A 3LQRA 2YQ5A 3Q3VA 2D3TA 4M2LA 1Y42X 5LA6A 3O2QB 3RWOA 1LC3A 2PK3A 3ID6C 4JODA 2AF4C 2V7BA 2VT2A 4TWRA 5T57A 4U7JA 4C5BA 1MLDA 2ZBVA 2IBMA 2GM9A 5C7IO 4D8YA 3TX2A 4FFLA 3FSRA 2HSZA 2NYRA 2R8BA 3DKVA 1AURA 3H5LA 2Y2VA 4Y1RB 1UFKA 5HE8A 1VKRA 3HXLA 4A5SA 1D6JA 4II2A 2W2VA 4A7PA 4XJVA 1WD5A 4LZPA 4FCWA 4H3SA 1M2VA 2HF2A 1TAHA 4V1CA 1K5HA 2GK4A 1VOTA 2GSDA 3TLCA 4IHKA 2QA5A 4E5KA 1T35A 4K9SA 3DHYA 2WTXA 2HPZA 1UKYA 2NU7B 1QPGA 3HZHA 4HAWA 2PEZA 4RK1A 5LBTA 3TQIA 3WHLA 3FBTA 5JCJD 1VRCA 1OVGA 3OQHA 3OZAA 4U2FA 3TI7A 4MCHA 5J2UF 1BDIA 3L7YA 5CLJA 2YUTA 2C04A 2GMWA 2YWDA 2JFPA 5JC8A 3EEQA 3PZRA 5K0CA 3U6KA 3BSFA 1H8HD 1HKHA 1GFZA 1R74A 1XLWA 1C1DB 4EVRA 1QO0A 1KEUA 3FKSD 5E6UA 2G04A 2BMEA 4JB0A 3FVVA 3UAYA 4LGYA 3I8XA 4GW3A 1FYDA 4HFJA 4I6EA 1N9GA 1SPBS 4G3XA 4RHYA 2DQZA 2Z98A 1RPZA 1YB5A 1ZGGA 4C87A 1O97D 2EBHX 3EBLA 2A3NA 3UF0A 5CFNA 1U63A 2PBLA 2W6JD 3O92A 2Q2NA 1NNSA 1BEUB 4K40A 5TSDA 1A82A 1VE1A 1QF6A 2VF8A 4CMKA 4L6AA 2ADOA 2ZE6A 3D7NA 1AO3A 3OLWA 4YJ3B 621PA 5KDLA 1EE2A 3AYXB 2HR1A 1SHLA 2QLBA 2WG2A 3UG7A 2R8YA 3G49A 5JFOA 1KYIA 1U80A 2W6PA 3H3JA 2A0XA 1ECJA 4MYDA 3CLSC 1CUVA 2Q3EA 3DBOB 2V96A 3E7FA 2H3HA 4G2NA 4HB3A 4M54A 6REQA 3O4FA 1XAIA 2RK4A 2NWQA 2WU4A 4DQ0A 3WICA 2BFEB 2C00A 2IU3A 3FUXA 4H17A 4JJIA 4ZVSA 2OYRA 1E7QA 5AW3A 5CFOA 2PVCA 2JRLA 2QRLA 4CM3A 3UV3A 1EVIA 1K5GA 1XPJA 2JHFA 2P6UA 4ZO8A 3A26A 2VP3A 1UL1X 3QUAA 4MWSA 1DC5A 4R1LA 2Q6KA 1QCDA 2R0QC 1A2OA 4NRDA 3WGUA 4M1SA 3A37A 4PFJA 4DEYA 1SD2A 1ZIDA 3HUEA 4IV8A 4RFSA 3BL6A 3IEIA 4GPBA 2HIAA 1P5ZB 4AWAA 2J09A 3CE6A 1TU3A 1W2WB 3EVDA 4X1IA 3U19A 3FR8A 2Q6LA 5KNBA 1G21B 4LISA 4GPD1 2IUTA 1YQ9A 1EJ6A 2BMDA 4CUJA 5FWYA 5HW0A 2REQA 1G6OA 1UPAA 3G2PA 4LKRA 5LFAA 1T36A 2ZS9A 2OCIA 1JEEA 3IHWA 5LZ7A 2OV8A 2E1PA 5DP2A 1GSOA 2AOVA 2QQEA 3K8ZA 3MNFA 1SIOA 2F2TA 3QJGA 3TYXA 3Q3HA 3TUIC 3UMRA 3FFXA 4A26A 3ITEA 5IT9A 3ZE0B 3MSXA 2G9ZA 4LXTA 3C45A 3DHEA 3I6MA 3VPHA 5JNWA 2J7KA 5FF9A 5H7XA 2IV3A 3G9XA 5TLSA 1O8BA 3K3PA 5FNVB 2NYAA 4DIUA 2VA9A 1Q92A 1VE7A 2ATXA 3WMEA 4NHOA 4CI0B 3DBLA 3IDOA 4LZWA 4RCYA 1VL8A 3LLVA 5KVAA 1Q1AA 1SWVA 5JISA 3NWOA 1DTEA 4JEHA 2PSDA 1RBQA 1W44A 3GT4A 4NZNA 4C2TA 1MV8A 3DC2A 4JITA 1EUDB 3VAZA 5FJIA 4YCLA 3SNHA 3O03A 2CXOA 2R97A 5DFAA 1PJ8A 1ZMRA 1ZU4A 5BP7A 5M34A 1ZLYA 4GZ3A 1KARA 4UHCA 5JBNA 1HE1C 1L5MA 1XTQA 2WJJA 4RAQA 2BFEA 2D0DA 4MQ6A 1TMGE 3OLVA 4F5WA 4JEMA 1TFUA 2E5FA 2APJA 4GBJA 1G5TA 2G0NA 1YQTA 2J31A 4IV5A 1GP2A 5M7EA 3R6TA 3H5RA 5CPBA 2Q2OA 2CEAA 4K9KA 5AOBA 1T9CA 1B1CA 3P2JA 1IEWA 1RQ2A 3MCAA 4LA4A 5HCUA 1YBAA 1KP2A 1X9GA 2DPLA 2GZMA 3ITKA 3O4VA 2XNJA 3TQCA 3U1BA 1LA2A 2HA4A 3PFHA 1AHIA 1PFUA 4MJ3A 3GLIB 4F38A 4OBBA 1CUHA 2GUGA 3RSSA 5I7RA 4R1NA 1G21A 3UC5A 3SX0A 5KUTA 1ZIXA 1NBWB 1TA4A 2I6QA 4HFMA 4TX1A 4DV2B 2VWPA 1J2YA 3ZXXA 3KWJA 4D9CA 5A7FA 5KVQA 3SDBA 2P67A 2QHXA 4P1ZA 1WZ2A 3TLXA 3K94A 3N2GB 1QKKA 1MTZA 3NYRA 3AVWA 3FPJA 2V7UA 4WKCA 1UP4A 1YZNA 3BHJA 3L7AA 3VDXA 1MW9X 4K05A 1HDXA 1SBQA 3D6AA 3SJ7A 5ILGA 4A91A 2G76A 1J0EA 2HU8A 3D8RA 1QSGA 4OA5A 5BO5A 4JB3A 3F9RA 5FNVA 4BGDA 2FRDA 1L5WA 3E35A 3EGEA 2WFAA 3ASYA 1QHXA 4BEVA 2AYYA 1B76A 5C1BA 3ZQ4A 3QVMA 4K6KA 3JAWB 1Z5PA 2XECA 1OXUA 4HYEA 4MMZB 4OY3A 4U2EA 2EFHB 1JEYA 2O2GA 1NHWA 2VVTA 4HDNA 5JHGB 1U7OA 2BFFA 3WAGA 1MHPA 4QNNA 3WDMA 4EUFA 1KTIA 3VSBA 1VLZA 5BMOA 5EJMA 3SYKA 4M1KA 1ZK0A 5F3DA 3QKSA 3WRXC 2Z3VA 1GVNB 1RM0A 2C1XA 2AD5A 4AZ3A 2VEOA 2Q1UA 3QE3A 5FP0A 3R76A 2QD4A 4G1FA 3TL3A 4B3CA 3M6XA 2Y1KA 5FLYA 2E6UX 5JJBA 1SCKA 4ZHQB 4RMHA 3D1VA 1PT5A 3CA8A 2RG7A 3OUUA 3JVUA 4KLNA 2XE6A 4RF5A 3DZIA 4AJPA 4R71A 721PA 3NT4A 2GXQA 3C3WA 4PTLA 4BLSA 3DZCA 3TTVA 3ZQKA 2CNBA 4J0DA 2HYDA 4KJZA 4YAKA 4Z2AA 2BGGA 2P1ZA 3EARA 1ISFA 1XZMA 4PSCA 2RGRA 1ZZGA 1QONA 2OZPA 3OT1B 4AZ0B 3FDIA 2HMUA 3LP5A 3LUAA 4LSMA 2VDOB 1H1TA 4KLZA 3N59A 1P5JA 4EK9A 2UUCB 4BMOB 1PKXA 2A0WA 1EXWA 2A14A 2MSWA 2OCXA 3VZPA 5AUQA 2IOQA 3VHXA 2DKOA 1A5SB 3LT5A 3WB0A 5BPFA 3STVA 3VAYA 1Z13A 1VHTA 2CL6X 3K0FA 2UZ1B 1MVNA 2JLZA 3JQRA 4WXPA 1RAFA 3BSSA 5BRAA 3TPCA 2GYYA 1WNTA 1WTAA 3ST7A 4QQ8A 3KSBC 4EBBA 3NW9A 3P9CA 1VL5A 3R5XA 2VHVA 1T2VA 3WDLA 1OLXA 4LRYA 3GRKA 4WXRA 2J6HA 4Y9TA 2WE7A 4L51A 1J06A 4YRAA 4PNEA 1ZC3A 5EGNA 4CG0A 2ZRIA 1QHGA 3WBBA 1O5OA 1YCDA 2ZI9A 3PPWA 3VVMA 2IZZA 1KK2A 4BTVA 3LY7A 1LQUA 2QU8A 2JKZA 2JFZA 2DFKB 3E3OA 2RGDA 4PTYA 4BO5A 1WUTA 4OFBA 2A0KA 4OQEA 4A0QA 5HXAA 3L6EA 1YZFA 4ZOLB 5K0BA 4HAVA 3GMIA 5E38A 1QHHB 4O2AA 4BZXA 3ETLA 4K6OA 1IWOA 1V5FA 4BBZA 1YVPA 1HQCA 5IWCA 3I01A 3CRQA 2QAGA 4X6UA 1U0GA 2FEKA 1BYUA 2O7SA 4FDVA 1KFKB 4P86A 2JGMA 1I7LA 2GN9A 1IBMB 1BJRE 1P1RA 1SVLA 2P9YA 3F0TA 3HACA 3KUXA 2VXOA 3KFLA 3OQVA 4N9QA 4U7PB 3SZMA 1O94C 3TIXB 3I9KA 1ZRSA 3EUEA 3WVNA 3W78A 3BREA 1JWLA 1E1MA 5IRCD 1FFEA 1JEQA 4FBGA 1PT6A 4KIJA 3IQGX 2GKGA 2Z2YA 5E7MA 4REOA 1W87A 3UG6A 3KCQA 2LVBA 3QV2A 3CRMA 4AIIA 1FNCA 1CEYA 5B37A 2FPRA 4WZBB 3TZKA 3WFZA 2O19A 1CETA 3I3OA 1CZOA 2A5FA 2DULA 1CZNA 4WESB 2ZAIA 4Q9LA 4XLZA 1ZI9A 2AYZA 4QYWA 2NUTA 2CLOB 1UBFA 4BP1A 4BRUA 5KMGA 4WFJA 4MR8B 4YP5A 2W9XA 4AY3A 2BZSA 5COBA 3JQEA 1ZR2A 4R2IA 5CX1A 2HYIC 2FPUA 1W19A 3G2OA 4OTZA 1OAKA 1IL0A 3FLBA 2HNBA 1VXOA 2W7TA 1CWUA 4IDCA 5DOVA 3SJUA 4F5YA 1DBQA 2NLOA 3NCTA 4MPPA 1IVNA 3D2AA 4EITA 3QLVC 4Y2TA 5BYKA 1P0MA 5U9CA 3I9OA 4EH1A 1KAQA 3DDSA 3NAGA 4JOBA 3E48A 4PX5A 4G0VA 2C7OA 2P8SA 3IRVA 1ZA2A 4RF2A 2CKMA 4FDMA 2FP4B 4GI1A 2NPFA 2GBIA 4OM7A 3WWZA 2HZBA 1FMFA 1BG6A 4AF8A 4IUCS 2FF7A 3UXMA 3AVOA 3F1LA 4E5MA 5EE9A 5IAEA 2DHRA 1JAIA 1A8PA 2IIPA 2XB8A 4X91A 1F6WA 3PRHA 3PUXA 4NV3A 2XOXA 3TINA 3WWYA 2WTAA 1PNTA 4GPZA 3FOAA 3GAAA 4G4SO 3AHDA 2VJDA 2PUEA 1B6TA 4E46A 1JAZA 4QA9A 4ZVPA 3T0GA 2AN4A 3NDPA 4KACA 1Q12A 2WILA 2L2QA 1ARZA 2XWJI 2WUFA 1M34B 4D9JA 4JQSA 5TQ0B 1UEXC 4OSPA 3M1AA 3H2HA 3OM1A 3HBJA 1EFVA 1L6RA 1W5BA 5LQNA 4LQCA 4AY4A 1Z06A 2PQ6A 1Q15A 3EGWA 3WZLA 3F6EX 1GKLA 2AFHB 4AY5A 1QUEA 3HN7A 4NLLA 2NUTB 4LZLA 5KMGB 3QIAA 4TL7A 2RH4A 3FLAA 3FRHA 5AKZA 4HAXA 4DNFA 1USVA 3T5DA 1MJGM 5JAHA 3R77A 5E2BA 1H5QA 4C7KA 1SC1A 3S4YA 2V9ZA 1ZGAA 4HS4A 4W5RA 4CL3A 3LKVA 3GWZA 1GU1A 2MSNA 3T99A 2BGKA 2E4YA 2GEBA 3WC4A 4EW3A 2C5GA 3GPBA 4ZV7A 4EKYA 1CVIA 3A10A 1KPIA 1I4EB 3NFYA 2PSEA 5K0LA 3DJYA 1X7YB 2Q46A 4JI6B 2WOJA 2Q9AA 1FX1A 3MGGA 2DC1A 2OFXA 2JVIA 3NM6B 2IGTA 2GFQA 2QN2A 1EGAA 4GOMD 2BEVB 4OSOA 2B4TO 3AERA 4ZKDA 5B3LA 3PUIA 4PQYA 4FC7A 1UFQA 4NV0A 3NLLA 1T2FA 1MGOA 4PVCA 3ZQJA 2E87A 1TNDA 2PSFA 2QJWA 4IDNA 3VH3A 2ZR7A 5L3QA 4MYSA 1HURA 1Y89A 2IPLA 1I1OA 4HDCA 5AR1A 2E4XA 5BN4A 2OHFA 4K6MA 4FHDA 3EGDA 4J0CA 4A0GA 3MAGA 1U0JA 3W5IA 2OUIA 3FF4A 1B1AA 1TX4B 4YRFA 1SBZA 1TF2A 4TYWA 1YR1A 2HT6A 3GGCA 4OIMA 2H2HA 2DBVO 2CJWA 3GVHA 3R9IA 1WB9A 4BNXA 3B53X 5I01A 1G3UA 1YOBA 1OBVA 3GD5A 5BMVA 2EGGA 2ZUUA 3ONNA 4KE8A 5FNZA 2X8JB 3U13A 4I1OA 5DYNA 3ZHYA 1EFVB 5AI8A 2CFIA 3GWGA 4XWGA 4KX3A 4LCBA 3EGXB 4I9NA 1VA5A 4CEIB 1M5UA 3TS1A 2IUSA 1C1DA 3P9ZA 4MRMA 4OB7A 4QPNA 1WKBA 3KYCB 4WK0B 2B35A 2JDIA 4IIJB 4MJ7A 2GSWA 3SQXA 1SXJD 4A03A 1O9GA 4KIGA 2OV1A 2XBMA 2KB0A 2XITA 4JDPA 3MQFA 4NZMA 1PD0A 1A5TA 2OSBA 1YA4A 4U2DA 1XZCA 2ATEA 2HUPA 1U0RA 2GX6A 2GVDC 1H2AS 4PZYA 2H9YA 1CR0A 2HQOA 3ICWA 4UU1A 1V5WA 1THGA 3DDCA 3UA3A 1XRQA 2PNFA 5EL0A 4YUVA 4L0MA 5I45A 3NVKI 4WLEA 1FUKA 3SHVA 3TLMA 1JT2A 3EY9A 3IUNA 1JLRA 3Q5GA 5FHQA 3VU1A 3GJ6A 3KNZA 1O3YA 1T3LA 3KKNA 4H08A 4G9EA 2BHNA 1UFVA 2UYQA 3NX4A 1EFDN 1XMSA 4WNAB 5DO9A 1P1HA 5HVNA 5IVHA 3KVOA 3ZWXA 3OPYB 3FAZA 3DBIA 3ZDDA 3KQYA 1ZOOA 4US2R 1O2DA 5EEHA 2XB2A 1MJFA 4BGUA 4EUEA 4N12A 4G81A 5KAMA 1RMYA 3N0VA 1AU9A 4WLUA 1UFOA 4MXDA 3OQMA 1XMXA 2G0TA 4MNTA 3TH5A 1RW4A 2PO5A 4GLJA 2P2SA 3TQOA 3Q6NA 4MV1A 1UBGA 2QM3A 3M3HA 3GEHA 3G88A 3RW9A 1RXVA 1BD4A 4UARA 4A15A 4ZXPA 3AJEA 4HVCA 3M9WA 1CU1A 4EB6A 2Q2VA 2IGBA 3FD8A 3S68A 1X92A 1H1LA 3ESCA 4TVOA 5I7FA 2VTBA 3O4RA 5KJFA 2CHUA 3L06A 4PGHA 3S7TA 3UOGA 5IT5A 1T5OA 3TQHA 4XUGB 4OX9Y 3KZCA 1U90A 4M8SA 3AV0B 1Y3CE 2JCBA 3PYXA 4KK3A 4UJ5A 5J4VA 4MCAA 5I6DA 1X8KA 2YIJA 3AWDA 5KYVA 1JH8A 3DBHB 1KS2A 2FI1A 3L0IB 2YV3A 1G0NA 4W63A 2CB9A 1XU7A 2WYWA 4IEIA 4G5QA 4OJKA 1WDWB 5DLQC 1L8LA 3F46A 4H6WA 4AKHA 4HYQA 3AJAA 4DCJA 4Q0MA 2IVZA 5JQGF 3ZS9A 4L8YA 5ALWA 1NNLA 1G5QA 5TX7A 3RNLA 5KX5A 3DWFA 1X1DA 3A7DA 2JAQA 5KIAA 5EXXA 5GMOA 3VH1A 2VJLA 1F4LA 5CNIA 3OMLA 4L76A 3PEFA 2ZM6B 2JIZA 4FU0A 3N74A 4WLNA 3R5FA 2YMMA 3R40A 5LP6B 1THTA 1GAJA 2C2XA 2XGGA 2AHOA 3PDJA 4R3WA 1I0IA 4EJ2A 4F06A 4EY5A 3VVCA 3I5YA 3VISA 1W93A 4QUEA 3LOQA 1T5HX 1U8FO 5CB4B 3OX2A 1BE8A 3ZDQA 1J22A 1UWCA 2ZUCA 4ZYVA 4TYPA 3EZ6A 1MFZA 3F71A 1C4XA 3FKJA 1UPTA 4ND1A 4RPLA 3CW2A 5DI9A 2ODBA 2JLCA 4RKYA 1RFGE 1ACMA 1HUQA 4UE2A 2IDMA 3RVKA 3G5UA 3U4AA 3O8LA 5FL7A 5T67A 1FDTA 3WV4A 1X42A 4ZAXA 4F91B 5IM4F 1IMOA 1WZEA 3WLKX 4OHOA 1DJMA 3Q7IA 1ZK3A 1GXSB 4HGPA 4ZANA 2FRXA 4FEGA 4M98A 3D3EA 4A92A 5ALVA 4AB1A 1GQSA 3CH6A 1GG5A 1QO0D 2FEWB 2IYEA 2X5NA 2Y9MB 4UEOA 2DPYA 4CETA 3U6BA 1AGRA 1W36D 1YVDA 2JBAA 4TQUS 2X8LA 4YJGB 4ND2A 4R98A 2OV6A 4OBEA 3AV3A 4N1AA 4UU8A 1I6WA 4TS4A 4J9VA 5LZ9A 3HYTA 3PHJA 3E70C 4GXNA 5EUBA 3RVDA 4YMVA 3DDOA 3ICEA 4JV5B 2R6CA 3TNLA 4BVBA 3E2PA 4BFSA 2I4IA 4QU8A 4IFEA 1T6ZA 2OO5C 2Z0MA 2QZ4A 3L0YA 3IQIX 3QMWA 3T5GA 3KAJA 3T12A 3I53A 4EAQA 3NBXX 2PX5A 1J5PA 4CM8B 5EWJB 2XWQA 3AKYA 2ZUDA 3AR9A 2NZ2A 5JVDA 4D3XA 5BWLA 4E12A 5JWOA 1XYYA 1BCRA 4QOIA 2IS2A 3TZHA 3NEAA 2LKCA 1SQ5A 3CT6A 3AI1A 3L77A 2EXXA 3ZIDA 4NECA 4BNFA 4X92A 4YRIA 1E3EA 1ORDA 4G0PA 1KJIA 3M4XA 3QWFA 4FZJA 1BTOA 4JP1A 1GCIA 5I5GA 2JASA 5ALRA 4ZVMA 5DHUA 1R6VA 2EJVA 2WFZA 1P5RA 2YJ6A 1BZYA 1QF7A 1NPDA 1BXRA 1PAUA 2QQ0A 3HH8A 5EIFA 2ZTSA 2GD1O 1Y4ZA 3TWOA 4YONB 2VXBA 3ZU2A 5A5VA 4DS3A 3BIWA 4CM7A 5K8VA 1CY7A 1G63A 5D5PA 4B9EA 5EA2A 3VQTA 2VDLB 3J7TA 1RMQA 4D9FA 4WJLA 4YMLA 3FUWA 2W8ZA 4MW0A 1G2PA 4RM3A 3ANTA 2GNPA 4P5PA 2QP4A 3H2ZA 3IT2A 3WAJA 1RHQA 3KJHA 4C0SA 1HE8B 2H65A 3IR7A 4F3TA 2ATVA 2GF9A 2YCBA 5DU2A 4WEQA 4PC7A 3P2YA 3V8RA 1B16A 5A5DA 1WU8A 4UNRA 4QTTB 1VKNA 2P9CA 4E4YA 1W9MA 1NUUA 4L5YA 5F3RA 3GBVA 4RTKA 3MJHA 3MUOA 1DNPA 4OG2A 4GE3A 4JI5B 4W9NA 4IUYA 3AYZB 4BN0A 4RDXA 1TM1E 4N5NA 1C7JA 1NF8A 1E4EA 1W6RA 1WZCA 2CUNA 4B3FX 3HN6A 2UZAA 4H1HA 1CUIA 1IXRC 2PXHA 2YJZA 4O4LB 3A1NA 3O90A 3OP4A 4UAVA 1AKNA 3DL2A 1C8LA 3AQ4A 3B13B 5EE1A 5CFQA 2X7JA 4MPRA 3PDIA 2PMBA 3D4OA 1E2EA 4WHMA 4CJXA 3FFAA 3U44A 4Y2SA 5FLEX 4MLZA 2QMUA 1XTPA 1YTLA 1IE3A 1U7ZA 4HQRA 4M46A 2PZ8A 2HWXA 2V58A 2X42A 2X2OA 4K0KB 4AS1A 3FOCA 1E3WB 2GUWA 2HRQA 3AOEC 3OICA 2PS1A 4TMKA 4QGBA 4R81A 3Q6MA 5CCDA 1MDBA 3W4KA 1X7XB 1ZCAA 4GXRA 4HRVA 4KODA 4CTNA 4V2IA 5ALMA 5CAEA 1T8WA 1LLDA 4HH1A 1JIKA 2OQIA 3DSRA 2JGNA 1ZD3A 2F1RA 1RU3A 1U3VA 3F3KA 4JUIA 4TSKA 4HEJA 3TSOA 1GZDA 4OHRA 5IBPA 1E5DA 5JJKA 3AG5A 4R4JA 4FDLA 1MFPA 1XHFA 1ZUNB 2WSLA 1DHTA 4H16A 1QP0A 2CHVA 1QIJA 2X1VA 2BBOA 1M7GA 4B47A 4F6CA 4TKVA 1PQPA 4IIEA 3OTGA 1YDHA 2LR0A 3AHHA 3H83A 5GGYA 3ROZA 4QWWA 2Z9DA 3HA7A 3VNBA 2VDWA 1IK6A 4BQOA 4RNDB 2FUKA 2IS4A 1DKUA 1JPUA 3NB0A 1JHVA 3C7KA 1XQWA 4LYFA 3SN6A 4B6JA 2Q8NA 3IYLW 3EVAA 2CK3D 1HYEA 3LCVB 1Z8HA 4QU0A 4AN0A 1N9ZA 2A5GA 1JDNA 4P4TA 4UHJA 4MWGA 4HFNA 2JARA 4D0LB 2WHXA 3U4QB 1XFDA 3R5SA 4BO2A 2J33A 1UBNA 2B36A 3BZBA 4O4LA 5HKBA 1TGYA 3WG9A 1RZRD 2ZUEA 2VDMB 1QFZA 2C9ZA 4IGAA 1XLTC 3R8CA 4FFBA 4WA8A 2PT7A 4JCOA 4JJ8A 3SJBA 5EJFA 3OZWA 3CLTC 2EV9A 3GLGB 5CM8B 2JFBA 4ISBA 9ABPA 3FOEC 1EXDA 1KVUA 1JHAA 2X8AA 5TY0A 2Q4TA 4GLBA 3DCIA 5B3AA 4UNQA 5JRDS 1T2AA 1XTTA 2GPTA 2IZOA 2BGMA 3L8FA 4XW2A 3NWBA 4RPGA 3NHSA 3QEOA 5E8JA 5DWVA 3SSNA 3V7FA 2ERYA 2WF9A 2ZCVA 2WWXA 5E3IA 3FTEA 4O8ZA 1PJAA 1Z6YA 2WJAA 4HP8A 4ZAGA 3RT1A 2ZT5A 4QFBA 5JS7A 4ZYYA 3AVTA 2Q5HA 4EJ0A 1NYQA 3KWFA 1Z2OX 3ECCA 1QGYA 1PQWA 2W93A 2W5UA 1Y8RA 2YWBA 3QTTA 5L3SA 2G88A 3A6KA 2HJRA 5JBIA 3CNBA 2EKLA 3E18A 4ZD6A 1C3XA 1N8NA 4PPYA 1QMGA 2MMCA 2GT1A 3FPGA 2IPNA 1TUIA 4LBWA 2ZB2A 4ND5A 4B9AA 4EEZA 1V2GA 1X7HA 3K6RA 5GV8A 2XI4A 2BMJA 3IA2A 5TRTA 5DT9A 3RKSA 3CMCO 1SOAA 1B0AA 2AMFA 4IDGA 3TE7A 2XWBF 3KPWA 4RBNA 1P77A 3RU9A 2IDJA 2XGJA 3E7XA 1T5SA 4DEXA 5ICCA 1MC5A 1Z4LA 2WABA 1DQRA 1WQ3A 4NK4A 4A5OA 5B1HA 4PW0A 5FOWA 2VL7A 3O91A 1ABFA 3OQNA 3IKTA 4RFLA 3OY7A 2ZBEA 4BUZA 4EG1A 2DFNA 3H2GA 3H8SA 1L7MA 5CT9A 1U0FA 5IT4A 1JFTA 4R2WA 1T1EA 1Q0ZA 2FFQA 2ZAYA 3AY7A 4BL5A 5KYNA 3AEQB 4YAJA 3KFXA 1IXKA 3U81A 4F8EA 1Q5PA 3C97A 3OSZA 3UGJA 1OFUX 3EXEB 2B92A 3P45A 2B83A 3R6WA 3IQDB 3BH7A 2PSSA 3GLQA 3PT5A 1YHZA 1NP7A 2WV9A 1ZJZA 4XCVA 2QUBA 2PV0A 1N2BA 1CLUA 1E79A 1E2HA 1X8LA 3MB5A 4BJ5A 3AR8A 5HP4A 2IQIA 4LTDA 4UMVA 3CVWA 5KWJA 2F4VB 1KKUA 1U9IC 1QS0A 1RM4A 1RTTA 1BRMA 1Z26A 4CMIA 1QQ6A 3EISA 2GN8A 1Q1GA 3EDQA 1LLUA 2BBSA 2VDJA 1T34A 2L19A 3ANMA 4HQNA 4KMSA 1KYZA 3QKUA 5L6MB 1S2OA 2KI5A 1XYVA 1J7JA 5DNDA 4EG5A 2HC9A 3OJWA 3BXGA 4I55A 1PX0A 2DY1A 4FW9A 2XVZA 4LDRA 5FI5A 2YWRA 3FRIA 1GZ6A 1JBQA 5HGXA 2FW0A 3PXCX 1KI1A 1DMSA 4N3GA 4OHXA 1P7ZA 3CM0A 1M1YB 1O54A 4Q24A 4D5GA 5CITA 4ND8B 1N5KA 1IQUA 1TCBA 2G83A 2QDKA 1ZHOA 1J25A 3OCCA 2A94A 4PN3A 2I99A 1IAVA 4OL0A 2DWOA 2DQSA 1ZNWA 3ZY5A 5L3VA 1QGAA 4EYGA 1RBMA 3SP1A 3V3KA 1VCNA 1XD8A 3IMCA 1SAYA 3GFPA 3L93A 1GQRA 4Q1AA 2XT0A 5TARA 1I4TD 1IHUA 2V6IA 3KZNA 1V9SA 4LG1A 4K8OA 4QSMA 1QGOA 1WDTA 5CNJA 5EXSA 3UH1A 3FPHA 1SCDA 4M86A 3B6KA 2R8OA 2FWMX 3TQRA 2HT1A 1LX7A 2CBGA 4O0LA 1S3IA 3DVQX 2C82A 2Z5VA 2O0HA 3V6MA 4FXPA 2X6RA 1B4DA 2ZVDA 3QX3A 1L5FA 5JH7F 1NP3A 1AB5A 5EJIA 2C4HA 1G20E 2HK9A 3L0CA 2XT9A 3GGDA 1N7JA 1M34E 1E5XA 3P27A 3I2GA 4B8WA 4Y2XA 2FDXA 4BQRA 2X9NA 4A2QA 2F8LA 3TL2A 1GUZA 3P9SA 3TW6A 1R5BA 5FOXA 2RAVA 1VJCA 3IDSA 2I8CA 3V48A 3R5KA 1TT5A 4K86A 1F8YA 4KKVA 4N5LA 5DYIA 4H15A 5TR9A 3Q2OA 3T1VA 3WLOA 5K4HA 4MHTA 4K0RA 1D2MA 3V55A 2ZSIA 1U7DA 3OBIA 3ZV4A 2WWWA 2HXYA 2MR6A 3INGA 4Q1FA 2PE5A 2JLVA 1L7EA 2ETXA 4E7OA 2FPXA 3I01M 5HQ3A 3VU0A 3PEVA 4GECA 3MZ0A 3MCZA 4WNAA 4ALMA 4WWHA 1OKKD 5AW7A 5K03A 2XTNA 4UVGA 3PUYA 1H5NA 2XUIA 3MA0A 5AW6A 3BAFA 3H0EA 4NAHA 3NTVA 4PEVA 2O2YA 3UJPA 3AESB 4C2UA 2MIIA 3LCRA 4DPMA 1RXEA 2BHLA 3OJOA 3T9BA 3T1TA 4JR1A 1MO3A 4W5JA 4WNIA 1F2TA 3FHJA 3II6X 2LXNA 5ENZA 1QNFA 5ADHA 4HF7A 4F9EA 1B7GO 3OZGA 2WMDA 3AHFA 4LW8A 3RIHA 1C7RA 3E81A 2QXYA 3EZGA 2PWPA 1UMKA 3MD9A 3NYQA 1YDEA 4PXYA 4X9XA 4XX0B 4Y6GB 4ZTBA 3UHPA 4BQSA 4C7BA 5FBVB 4UC0A 1BGWA 1GV1A 4YWJA 3EOZA 4RV4A 1QVAA 2WRZA 3QWIA 4YI5A 4GQIA 1PUXA 1PR3A 3D31A 2HCTA 1XOIA 3PQ4A 4RHTA 2PA3A 1BDBA 1VIAA 2FN9A 4WKNA 3WO0A 3H5IA 3V2IA 4YRBA 2EL9A 2I8LA 1HFWA 3F5QA 3DKRA 5A4JA 1BQ3A 2FA9A 1V47A 4LJ9A 3BICA 4O59O 5SZHB 3T5BA 3GBPA 3BXZA 3UMBA 4C3UA 2A7QA 3K09A 5CXUA 1AUXA 5CDTA 3GJ0A 5KDOA 4MW5A 2QRVB 1K3UB 4DG5A 2Z2KA 2CZQA 1JKFA 2YMQA 4FZRA 4GGMX 3UTCA 2V59A 2IWHA 2CNDA 3JW8A 4RORA 5KHAA 5T6MA 3ZHSA 3HXOA 2H4FA 3JWIA 4HEHA 4URVR 2LGJA 4C4OA 1D1SA 1MEJA 2G82A 5IFKA 3K5HA 4YIHA 3RUCA 3T0FA 3K1ZA 1QYXA 4HNAA 4L5BA 3T41A 3AUAA 4K2HA 3LUPA 4A0HA 3HBMA 4F5ZA 3N0RA 1RZVA 4BWFB 2KX7A 5CDYA 4GICA 1CP3A 2IYQA 3DJFA 1NVAA 1QQ5A 4NCNA 1ODCA 2VEDA 4OGLA 4NNJA 2IYNA 4RMIA 2H63A 3IPAA 3O93A 4JIMA 2HHAA 3OO1A 2VH1A 4M9RA 3AU8A 4YUAA 3KB6A 2C95A 2DGDA 2DSTA 2HCRA 1QRAA 2WPDA 3E05A 3ONVA 3PCXA 1J42A 3SLGA 2LIVA 5EIBC 5HF6A 1W4BA 4ZZ1A 2J07A 1VSQA 3O2JA 4WNYA 4RTPA 3DT9A 3BD9A 4O4IA 1M2OB 2O1WA 2C9DA 4BBPA 5A9RA 3KPYA 4WGFA 3T3IA 3FOZA 2HADA 3QPUA 1JZSA 2A5LA 3ENVA 3JQBC 1KDZA 1N2IA 2LCIA 4DTIA 4DRXA 1VSVA 3G89A 5K2MA 3G5TA 1T15A 3SPXA 2JZCA 4Q4JB 5H83A 2BZ1A 4HAZA 1M6HA 1O57A 2H8KA 2WJGA 1M8KA 1ZCBA 2FG6C 1R3UA 2HDWA 4IR7A 1C30B 4LTMA 2Q3DA 2X6TA 2ZU6A 2VCEA 2OBXA 3C6YA 3NALA 4N01A 5U1PA 3UV6A 1AZLA 5DOZA 3SK0A 2JZOA 4BS9A 4DCNA 2O6HA 2WJ4A 2Y1LA 4KQMA 3ZCQA 2XF2A 4IOLA 2Q49A 3MXTA 1HT3A 2RI6A 1HBJA 3IDFA 1NQXA 4M87A 4MTLA 3EPHA 2VUIB 3I6BA 1V8DA 2EJUA 4RXTA 2DJ5A 3B12A 3DMDA 3T4EA 4BO9A 4IDHA 4RZQA 4CMEA 1X77A 2NZVG 2QQGA 1ZMTA 3A32A 1E9EA 3FHOA 3KUCA 4KDFA 4GUAA 2ADFA 3PQ8A 2Z04A 4KQCA 4QXPA 3CLUC 4ZP1A 5DBHX 1PWXA 2BONA 3FRJA 1SU4A 3KYBA 4IQ0A 2R65A 3AB3A 2K7ZA 3B2NA 2TYSB 3KUUA 3QOXA 4FE4A 3D8TA 3OTWA 2F8SA 3UXYA 5E95A 2OZEA 1SJ9A 3WK4A 2XMPA 1WP9A 3Q10A 4H7HA 4FFNA 3AMVA 1T24A 2XYPA 3GCWA 1QDEA 2PLAA 3DOHA 3B6EA 4RHCA 5AI0A 3TAHA 2G6TA 4L5AA 4ZYUA 2Z2ZA 1NFQA 1WXWA 2H1IA 2JL1A 4G1VA 5A7HA 3THXB 3CR7A 3DOOA 2HK8A 2PTGA 1PW5A 1SK9A