1FLVA

Structure of the oxidized long chain flavodoxin from anabaena 7120 at 2 angstroms resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
168
Chain Sequence
KKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Structure of the oxidized long-chain flavodoxin from Anabaena 7120 at 2 A resolution.
pubmed rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 61
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 1992-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1flvA00
3ZHOA 4LTNA 1KBOA 1OBVA 2FZVA 4R81A 5JROA 3QFRA 5TGZA 4H6PA 1E5DA 3B6JA 4HS4A 3OJXA 1QRDA 4H2DA 3QE2A 5NLLA 2Q62A 2MT9A 3R6WA 2QX6A 1AHNA 2RG1A 4XDHA 2R96A 2QR2A 4GQIA 1SQSA 3QFCA 4QOJA 1ZWLA 5NULA 1NNI1 2Z9BA 4NULA 4DY4A 4NLLA 2FCRA 2XOEA 3N39C 1J9EA 4ZVNA 1AKVA 3OX3A 4ZVMA 2BPOA 3NHYA 1AKUA 1V4BA 2X2OA 2V9CA 1FLVA 4YQEA 2QMYA 3OVMA 3GAMA 1WSBA 1CZRA 2KLBA 3F90A 1YCFA 3L9XA 4FX2A 3W78A 2QX4A 1RLIA 4BMOB 2Z9DA 4DILA 3FNIA 2V5UA 3NLLA 2XODA 1AKWA 1OFVA 3SVLA 1FLNA 2X2PA 1F4PA 1VMEA 1YCGA 3NHLA 3F2VA 3TZBA 1FUEA 3ESZA 3OWHA 4YAWA 1GG5A 5F12A 5BUCA 1I1OA 1CZKA 3UXEA 3TE7A 3O73A 2V5VA 1C7EA 4Y9UA 4BMPB 4ESEA 3NHFA 2B3DA 3HA2A 1FVXA 4YAFA 5A4KA 3OX1A 1J9GA 3OJWA 5LMCA 1JA0A 1JA1A 4QOHA 4YAOA 3W77A 1ZWKA 3OWXA 1D4AA 1ZX1A 3EDOA 3D7NA 2FDXA 1AMOA 1B1CA 3S2YA 3B6MA 5LLDA 2QMZA 3NHJA 2BZSA 1KBQA 6NULA 3TEMA 1CZOA 2AMJA 5EA2A 1FLDA 4Y9RA 2HNAA 1AG9A 1YDGA 4QOGA 2HNBA 4LAFA 1RCFA 2Q9UA 4Y7CA 1CZUA 4ZVLA 1AKRA 4LA4A 1D03A 3FW1A 5FX2A 4ZVKA 4QODA 4N9QA 1H66A 4U7GA 4PTZA 2MOKA 5LJIA 2W5UA 4ICIA 3K1YA 1OBOA 5LJLA 3RPEA 4D02A 2F1OA 1DXOA 5LBUA 1X77A 3B6IA 2M6SA 2QX9A 3LCMA 5EAIA 3FVWA 2WC1A 3LT5A 2GSWA 1WSWA 1XYVA 1QHEA 2M6RA 5EMNA 1QBGA 4U7HA 4PTYA 5F51A 1T0IA 3G5MA 3N3BC 1H69A 1J9ZA 2HPVA 2QWXA 3KEGA 5F4BA 3ES9A 2OHJA 3NHPA 5FA6A 4QOIA 3O2NA 4FGJA 2FZ5A 4CF6A 2MTBA 1YOBA 4U7FA 3FJOA 3UXHA 1CZLA 2Z9CA 1XT6A 2OHHA 3NFRA 3FX2A 4S24A 2FOXA 4YAUA 3EYWA 4GR9A 5ULLA 4HEQA 1FLAA 3KAQA 2ARKA 3K20A 2OHIA 1RTTA 4N82A 3HLYA 3U7IA 5LVAA 1BU5A 2QX8A 1XYYA 2KQUA 3P0RA 3NHWA 3JSXA 1DX9A 1FX1A 4FGLA 1CZNA 4FGKA 2FAXA 1YRHA 4C0XA 4PU0A 2R97A 2FLVA 3ESXA 1QR2A 1T5BA 1BVYF 1C7FA 3U7RA 2Z98A 4C14A 5B3LA 1TLLA 3L9WA 3OX2A 1FTGA 3NHKA 1XI2A 3NHSA 1J8QA 1AKQA 4C0WA 4DIKA 3ESYA 2BF4A 3B6KA 1AKTA 4YALA 2A5LA 1CZHA 3W79A 4F8YA 4GI5A 4N65A 3GFSA 4LTDA 5B3KA 3HR4A 4C76A 3NHRA 3W7AA 3F6RA 1D04A 1DXQA 1RLJA 3GFRA 4XDGA 4QOFA 3NHUA 1SG0A 5LBTA 4J8PA 4QOEA 3KAPA 4CETA 2MWMA 1YCHA 5FUQA 3F6SA 1YKGA 3GFQA 1TIKA 4LTMA 2D5IA 2N1MA 1AZLA 3KLBA 2OYSA 4OXXA 2BN4A 2FX2A 2BMVA 4M0CA 2FVXA 2ZKIA 3N3AC
chains in the Genus database with same CATH superfamily
2EFHB 1M2VA 4U2CA 1VIVA 1DRWA 1JPJA 4KZKA 3B1JA 3CU5A 1RC0A 5AM4A 4OYHA 1KNXA 4FFNA 4DYHA 3NDPA 3HXOA 4J43A 1P5FA 5IC4A 5K03A 3CKKA 1ENYA 1QUFA 3FWYA 2ZS8A 3OU6A 4PE5B 4YK7A 2FZVA 5EVJA 2AGVA 3HU5A 1W75A 2INGX 4UCFA 3PL5A 4RL6A 3ZWOA 2BKXA 2E4ZA 4L9RA 5JJCA 2HBQA 4UOEA 3B6JA 5D6NA 3OCCA 2WSMA 3HDVA 3BRCA 5EJIA 3ZZMA 4AJEA 1DXHA 4YJ2A 5KREA 1EVQA 4RLSA 4TXJA 5AW5A 4ETIA 3QV2A 5LXTF 2VTBB 5F2NA 1NMSA 4P35A 5J2UB 4QASA 5A05A 4KWHA 5ADWA 4BFUA 4K3UA 4CIWA 5CD1A 1U7ZA 4I4CA 4C4XA 1R0RE 3LPCA 1NUAA 3LX8A 1EIZA 5FH9A 4BE7B 3BOSA 4I9UA 4PSAA 3QKRB 2GD6A 1X1AA 4E2ZA 2JLRA 3QTBA 4MWTA 5HIJA 3THOA 1Z47A 3Q5EA 2ZS7A 3OI7A 4QXRA 2D8AA 3WLSA 1P2FA 3OEHD 4ZQFA 4B87A 2UVPB 2DECA 5CG2A 2APJA 1KMCA 1H2BA 4MO9A 4NMWA 2J4FA 4E5DA 4O3MA 4RL4A 1VLHA 5J2UF 3QLUA 2AE1A 3D4PA 1J9EA 3DZ8A 2Q3EA 2FZGA 2IXGA 5ALWA 4IJKA 3SI7A 4GKAA 1GL3A 3UV7A 3BJZA 3FYUB 3PVSA 3LC7O 4QELA 4Z9FA 3CW9A 3O8QB 4BUCA 3C97A 1B8NA 2IOFA 1K5HA 4A9AA 3WK6A 5F7OA 2X2OA 2AOWA 2ZJ4A 4B2LA 1SIOA 2VF8A 2A4MA 4LG1A 3H17A 4CLEA 2FDRA 4BASA 4DSOA 1WCXA 4L5CA 4RSGA 2VHJA 3E05A 4Q4AA 3R7AA 2XKBA 3HYTA 1UBOS 1QYWA 1ZCAA 3IGFA 1ZJJA 1CZRA 1NVEA 2L17A 1FYWA 3FE2A 5FAXA 1SCAA 3MJFA 2C2BA 5FWXA 2V03A 2P2NA 2XB9A 4O8ZA 4ZI7B 1DCFA 5ES3A 4Z53A 3D7KA 1NLMA 3G88A 3NETA 5FUBA 1G4AE 2WDZA 3CJRA 1NQVA 3QMMA 1TM5E 1V48A 2IHTA 2CJYA 2IYNA 4JASB 4TZTA 3VVMA 4BMOB 3ZDCA 1JMKC 2NO0A 4H6WA 2YWEA 3ZDFA 3VPGA 1K86A 1ODCA 1V0JA 2FR1A 4OHFA 4OYYA 3D64A 4UVIA 3DG9A 3BCRA 3W2IA 2VYFA 2XUQA 1YQTA 2OGSA 3C6ZA 3KJQA 4JCOA 4QL3A 5AOCA 5J2TB 1JHVA 2CLDX 1PF7E 4DCSA 1T6NA 2P9GA 1PP4A 4RY8A 4P3YA 3T5GA 3D4BA 3H65A 4XX0A 1HYGA 2DWPA 4HFMA 3KELA 1MAAA 5DFAA 1LPAB 3H3XA 2BR5A 2F00A 3LI2A 3OJOA 3R8CA 4KNVA 3WLPA 1MU0A 2X5XA 5IF9A 2KLHA 4KKXB 2BEVB 1Y37A 1LSOA 1T6XA 1XIVA 4P83A 2P2YA 2Q3LA 2WT4A 4ZI7F 4ONEA 1TGVA 3IVCA 1EXMA 1F51E 3N0VA 4LRYA 2XCSB 3VJRA 1OILA 4PY2A 4KLZA 3Q87B 4TXMA 4LNUA 4JXKA 2A33A 1QGOA 1G2PA 3CF0A 3MK31 4IJWA 3N2NA 4FWIB 4PAMA 1ONPA 1K4KA 1BHJA 1H9BA 2BJHA 3AY3A 1ZUIA 4UZFA 1L4KA 2HLDD 2PWAA 5J2TF 1I3NA 2G77B 3GLHA 3KYCB 1MOSA 2Y3IA 3M9LA 1FUEA 1F0PA 4OI0A 1W1IA 1EFKA 2N3ZA 4EG0A 1NQUA 2GXAA 3HBAA 3O4VA 4LBYA 3IE0A 4JL5A 3ENKA 1DX4A 1USVA 4A2PA 2X41A 3CCBA 2K6GA 4DBZA 2WSYB 1Y5MA 2OLEA 3NBZC 1EE2A 3P32A 1GL9B 4H1TA 4JLDA 4D81A 2WV9A 2IYSA 4X5OA 1RR6A 3OJCA 2FEXA 2H11A 3R5TA 5BR7A 3JS5A 3IESA 3CG4A 1ECLA 1FS6A 2EGGA 5DO9A 1RVV1 4MW4A 1LUAA 2QL7A 1SKYB 3FPKA 3NV9A 4Y9UA 1PG2A 1F38A 1SOAA 2VG8A 3NCTA 5SZJA 3RU9A 4AJ1A 4TKMA 1VCOA 3ONWA 1ZISA 1CEXA 1L7PA 3JD0A 4Q4JA 1CHDA 2WLSA 5K0SA 2E49A 3FHTA 1EAYA 1IHUA 1M66A 2O8VA 3KU1A 5L8VA 1TA9A 4B6OA 2WI8A 3QWIA 3BK7A 3EDMA 2VT7A 3EF1A 1Y48E 2H1VA 4J0KA 3SVZA 5BRAA 3G82C 1HI9A 2I66A 3BTUA 4LXXA 2OGWA 3W77A 2EEPA 1F8XA 3DULA 4MDYA 4Y2XA 4GL2A 4YUXA 3D3WA 1U0BB 4S05A 1IM2A 1AKNA 1YDMA 5GJCA 1C14A 3EVDA 4UBKA 5HXAA 1JI0A 5JDCA 2J9YB 2BTQA 2QN1A 3LVFO 1WVIA 3DBIA 1QH0A 2ZBQA 1H65A 5DYGA 1Z0JA 5FWDA 4G1FA 1ZIXA 4GI2A 2IW3A 3JQCA 3WIVA 5G40A 4DLRA 3JASB 3GIWA 2PXHA 5M5BA 4AROA 2BZSA 1YFJA 2C9BA 3GLHE 3P2YA 4MLPA 1E8NA 5IEBA 5K3SA 3P2IA 2Y0CA 1D2HA 2I4RA 4OQQA 2WJ4A 4X7PA 1LGYA 3G8YA 3AEQB 3K72B 4B1FA 5CDUA 3WOVA 3UJNA 1O96B 1DTEA 1I0ZA 2B37A 3CR8A 2AMJA 3IO5A 4FZVA 3WJ1A 5JG7A 3WYCA 2DRIA 1CJBA 2NU6B 1OROA 2O2SA 1P91A 3PXUA 3Q2IA 1X3LA 1XTIA 3Q0EA 4PHHA 3W2HA 4B5LA 2CHVA 3NH9A 2ISCA 4J0QA 1E7SA 5CAEB 1JQAA 1X1DA 2QTBA 2GN1A 2Z83A 3PCRB 4IFIA 4MV6A 4BWFB 2H7VA 4QIHA 4F46A 3HY3A 3N75A 5KSYA 4GM0A 3OD1A 5COBA 4ARAA 2FPWA 2EP8A 4XIJA 3WYNA 4KVAA 4I50B 2DBVO 2ZB2A 3SMVA 4EUEA 3U3MA 5K0JA 5ELXA 4MQBA 4X0EA 1WXIA 1WCIB 2QW8A 3HHEA 3PB3A 2HNBA 1MH1A 3Q4GA 4NJEB 4L1KA 4TMZA 3QI2A 1FRZA 1JBKA 1ISIA 1XKTA 1B6RA 2G70A 2G7MC 2YMLA 4J7AA 4P22A 3TW8B 4ZN6A 1P3JA 5LUAA 3C2QA 4FEGA 2R62A 3SYNA 1CZUA 4XWAA 3FDIA 1QGDA 5KINB 2BUBA 4YONB 3K6SA 3NONA 1U1GA 1JHPA 4Q7QA 5G1PA 4XRGA 2JFUA 4EZIA 1AUQA 3P19A 1UWKA 3EA4A 4MEBA 4KXXA 4QODA 3FLEA 3VPHA 3NP7A 3ILXA 3ECSA 2J31A 3RS5A 3DE7X 4URYR 4C7OA 4I50F 3A1WA 1ZVQA 2ZTUA 2NTVA 4NCHA 4QGGA 1CJVC 3O1HB 5AKHA 2IH2A 2WIDA 3SP1A 1KK0A 2YUIA 4XWWA 5HTKA 4Q4LA 2FMUA 2WKQA 4G5SA 3FOFC 4ICIA 2Q5LA 3MFYA 3QH4A 2WUWE 2I2XB 1KJJA 2ZRCA 3DL0A 1CY6A 1LXCA 4GBJA 2IVZA 4NI5A 4A26A 1VZ3A 2WHPA 5LBUA 4N3AA 3Q0TA 3RRNA 4CN8A 5LM3A 2M6SA 5KAPA 4V0RA 4OD0A 4YRQA 1X13A 4PAOA 2RGUA 4IYJA 4ZANA 1L5HA 3S6JA 1KSHA 3E22B 2BFEB 2OFFA 4US2R 5FKJA 2P4HX 4Y0AA 3M5WA 3OHMA 1JE1A 1ZW6A 3BJRA 4UM9B 1XYVA 3KZNA 1OA0A 4FBLA 5HE9A 3RCBA 3WLMA 2H0RA 4KR3A 1ABBA 4HR7A 5FEUA 4AMVA 1H2EA 3FY4A 4ZVVA 1UBLS 2I33A 2J0UB 2J5XA 2OXCA 2VJYA 3G2MA 4PTYA 2P69A 4EUFA 3C7CB 4EITA 5K3FB 5TMBA 1IY1A 2AYZA 1NI4B 4TYPA 4IIBA 4YIKA 3CY6A 1J9ZA 5A0TA 1QSGA 4EI8A 1N34B 1F6DA 5HRAA 2ANCA 1GA1A 1XZDA 3I5UA 3PHGA 4D9KA 4WNAB 2ZIGA 4Q9IA 2E2WA 2AB0A 4OKSA 4ZQIA 1V4VA 4F3TA 2HJGA 3GN2A 4D8VA 1OIVA 1SD5A 4HX9A 1KFEB 1YACA 2GA8A 4N7MA 5BSHA 4NZYA 4PEVA 3GUCA 2BGLA 3S0JA 5JNSA 1DQYA 4PO3X 4U2FA 1RD4A 1X92A 2C7GA 1GAQA 2QY9A 3IQEA 4IIYA 1MAHA 3VV2A 1RHMA 1EG7A 2FZ5A 2GAJA 2B6NA 4RMIA 3KS9A 4B76A 5JASA 5KYYA 3FNFA 1F2TA 1I24A 1K7FB 2YWRA 3A1NA 3TUZC 2Y1EA 4U2GA 1K1EA 1JALA 4IQFA 3AR5A 3SD7A 4CMIB 5HM8A 1IONA 1E89A 3V8MA 3H19A 2A9PA 3L7CA 3G2PA 1LX7A 1TA4A 1YQUA 2XMGA 3D54D 2GKGA 1YFZA 4X1YB 1U8UA 1EP1B 4R9SA 5EUMA 1D8TA 1ZGAA 4KBGA 4LQDA 3FPSA 4WXEA 1SR8A 4CKCB 5EL0A 2DJIA 5JAZA 1RXVA 3HB4X 1ABEA 2D62A 2GWHA 2PUFA 5EE5B 2ZFUA 2WWVD 2RH4A 3YASA 1SCQA 1T4CB 1BG6A 3EASA 1VRCA 3HN2A 3W6NA 3K9HA 5KJCA 1RDFA 2DQKA 4YASA 1USUA 1PQUA 5CH5A 2CYCA 1FUIA 3FB4A 3UVEA 4UHDA 4CCYA 4PQGA 4CRWB 5L3SB 1QM5A 2P4UA 4OMCA 4Q03A 3UHPA 4K40A 4G0WA 3QY0A 4XD7D 1A76A 1WNFA 1N6RA 3RIGA 1DKOA 3RASA 3D59A 3HPQA 2WSLA 2NAPA 3L6CA 4PGGA 2FSGA 4AN1A 5JU6A 1ATZA 2XB6A 1DINA 1RZRD 4RKYA 4MV9A 4UC0A 5LB4A 5B4UA 3F5MA 3GOHA 2VC2B 5FHQA 3W8RA 2GI4A 2PEZA 2FSIA 3ADKA 5DCUA 3TLGB 1JKIA 2R751 2WJIA 4PGMA 3TVYA 2O2CA 1RC1A 2Y68A 3E7XA 821PA 4YHBA 5JWOA 3LG2A 4XCXA 3K9NA 4JBXA 3WS7A 1P0FA 4OIFA 2PSJA 2F3UA 1OT3A 3KLPX 2YZKA 1XROA 2FLVA 2QD4A 3E9QA 1DIGA 2VTDA 3ESXA 4BXOB 1DOHA 3WFJA 4DMHA 2JFOA 2VYCA 2A88A 2D1TA 2QMUA 4RKQA 1KRHA 1UXJA 4XIIA 2TYSB 1VSUA 3HVUA 2Z2XA 3NASA 1I2ZA 4IDBA 4EEXA 1E6CA 1R4NB 2BRUC 3ZUGA 2VSFA 2C31A 5CA0B 1T9KA 5IJAA 2Q0SA 4M9RA 1YUBA 1ONSA 4LGVA 3QHPA 4O08A 4FE4A 3TLZA 1FFHA 1FTGA 4J3FA 3TUIC 3UCFA 3K2IA 1A8UA 4R3UC 1IOWA 4B7XA 1SZJG 3SLRA 3IH5A 5FAKA 1Q92A 4EZBA 4ZHQA 4MV7A 4OHOA 4WKOA 3PLRA 2OB1A 3CM0A 4JN6B 4X44A 1EUCB 1W4BA 1JLLB 4A4DA 1IZ8A 1FDRA 3R5KA 3T3IA 5ARBA 5JQWA 1WCWA 2NSLA 1UMBB 3IQGX 4ACAA 1BOOA 3ROGA 4GVLA 4ENWA 5GZ3A 3NVDA 1FDSA 2IGBA 2M98A 2VN8A 1QIEA 4MICA 5C5EA 1DBRA 1KZ1A 1GXSA 1TKAA 2HI0A 4BQQA 3B1XA 1P6UA 1SJ9A 5HG0A 5CA0F 1T2NA 2IZZA 2PX5A 1Z22A 2FSPA 3VR4D 4GOJA 2H31A 1G64A 1W0KA 3KZ1E 3KU4A 1TVCA 1VHQA 1DWUA 1HE5A 4IWNA 2ZWPA 2NWQA 3GPDG 1UK8A 4ZT6A 2HB6A 2OZLA 2ZETA 3L18A 1Z5PA 4JEHA 4I81A 1M2GA 1GD1O 1FX0B 2P2ZA 421PA 4A1FA 1YKSA 4WBSA 3IJRA 1WABA 1XD2A 4PSUA 3IEVA 4PONA 5CFOA 1DKMA 3QA3E 4RDHA 2FN9A 2HOQA 3H2HA 4M1EA 4MUNA 1Y0BA 4U5QA 1M2JA 3U4CA 2YJZA 5FBLB 3WLQA 4R4JA 3RC2A 4XGQA 1KU0A 5GVSA 2XTJA 1ZI8A 1VJCA 2IS1A 3AVYA 5F98A 3ISJA 1U4SA 2BIFA 2GETA 1FFAA 4IWXA 2LIPA 3K0CC 3EVGA 4UJ3A 3VR0A 1RXCA 2ZUCA 5LQMA 1MC8A 3SU8A 5EWMB 4MVJG 1O08A 4CFSA 4TM8A 1ETUA 1H93A 1Z0ZA 4OXXA 3V46A 4EX6A 1NURA 1LY1A 1I1QB 1XZPA 3EMKA 2ZTVA 3O4HA 4IQ4A 1XC7A 4KMSA 4MMZB 4JGGA 2QTFA 3QNUA 2ZUFA 2HGSA 1Q16A 5CVTA 3UJPA 1IRIA 1NIPA 1YR3A 1WMDA 2DWQA 2I1LA 1JG4A 2WYHA 4GOKA 5FD8A 3KSRA 1KYQA 1AKMA 1HE4A 1TYAE 4R5HA 2XYPA 1WULS 3UM9A 2ZT8A 5G4KB 5D5PA 3W9SA 4F6LA 3T4XA 2OHOA 5BW6B 3I39X 3R44A 2D1FA 4M0CA 1AZSC 1WJGA 3IUQA 4AYXA 5I48A 2IS4A 2WPDA 2Z0MA 3VSEA 4GSKA 2VH1A 2O2IA 3LK6A 3ZOKA 4DNQA 1PZGA 1O95D 2EKPA 2MR6A 4CQLB 2Y0PA 3LRPA 1OGIA 3CX6A 5AJZA 2W2VA 4F2HA 3UK0A 4DB4A 3MCWA 1D1TA 2F64A 2D00A 1NW8A 1JN0A 5A1JA 2PBRA 2DFKB 2GPAA 3QMPA 3SYLA 3VU1A 2X9NA 1IZ0A 5EEGA 5ERYA 4C4OA 1IVNA 1ZUHA 4BRSA 2OXRA 5LQRA 1LRKA 2CK3A 6LDHA 4RH0A 4UQPA 3STYA 4KRXA 2GXSA 3OKCA 4YMTA 3HO8A 2R1TB 1HZZA 3IQXA 3OCJA 2NOAA 2ZLBA 4L7QA 4I6JA 4ON9A 2F55A 3DVAB 4A1OA 5JZVA 4IL5A 5H8WA 4EFDA 3U39A 3HTXA 1RI1A 1PUIA 3QX7A 3STUA 1ZU4A 3WL6A 2FFQA 2J0VA 2OBMA 3G7SA 3R6WA 4MPRA 5DYWA 3HEAA 5JMTA 1XVVA 4JHXA 2HLHA 5BQ5A 3WLLA 2BH2A 2Q21A 3SE0A 1QZTA 2YYZA 3BTVA 4CIYA 1P62B 1UIMA 2A3RA 3ANMA 3E3AA 3NOQA 2RHBA 4KL8S 3VR4H 4B3XA 2GN6A 5BRJA 5K4AA 1YOVA 2H4XA 2Z4TA 2JGFA 2VWHA 5CJPA 3PDIA 2G25A 2AFIA 5GONA 4XLZA 4HXFB 4DW8A 1OV6A 3GXBA 3HRHA 2YQ5A 1T24A 4Q19A 1ACLA 2BGIA 2H52A 3ROPA 3OJLA 3DAPA 2E87A 2VNJA 4FBGA 4Z9YA 3CIFA 2D06A 4DMLA 2PD4A 5JMWA 4O33A 4UEKA 1D09A 3EGIA 5JZOA 3PTZA 1D5CA 1L7DA 5I7UA 1J33A 5TQJA 5EXXA 4QJ5A 3O26A 5I7HA 1CF4A 4TTPA 1TVKA 3O8CA 3BF8A 5CDGA 2CLEB 4G5QA 4DAEA 4WK2B 3PQ2A 1IBSA 2OEPA 3LQYA 3EWNA 4XSHA 2R11A 2FN3A 5DYYA 5H9VA 2QTMA 4YRZA 1SXPA 1N33B 4IMJB 2PRJA 4AKHA 1EX1A 1GZHB 2VP5A 1RPJA 3KEOA 3X2EA 2CD7A 4DGQA 1HEIA 1JXAA 4W5TA 1GPJA 1Y5LA 2WAMA 2Q4OA 1YCFA 3CXRA 4OQYA 1C29B 4OFZA 2HF7A 4UVHA 5CK5A 3ZWMA 4KIUA 4ZOBA 4CF5A 5HKAA 1NLYA 1FVHA 2DAPA 1EEHA 3HCDA 4A10A 3P45A 1K7SN 3F49S 2DUJA 4EECA 4YREA 1LTQA 2WICA 1PVVA 2HDWA 4I1VA 5GPBA 2HA5A 3K70D 1HQYE 3AJDA 1LNQA 4KYVA 3EXEB 3TKAA 3UK7A 3DDNA 5IK2D 2WABA 3FF4A 3REQB 1FUUA 2XE6A 3H2JA 5FWNA 2D3WA 2JGEA 4KLNA 2QM8A 4LQ4A 4CQJA 3RC3A 3VR5H 1ODIA 1JKJB 3RRBA 1S2MA 2AFIE 3AM4A 3HBFA 2OGZA 5AXBA 3DMYA 2GT1A 2GBIA 4HDNA 4YDRA 1IN1A 1XR3A 1AZWA 1AQ6A 1PG0A 2ORIA 2BGGA 3TBKA 4PQRA 3BEOA 4GZLA 5ADHA 1U1DA 1NI3A 1RFGE 1V5GA 1HDGO 4QBGB 2YNMC 3K9QO 3B3AA 2MSNA 4IJQA 4GM1A 4LHXA 4R05A 1ZIYA 3EXG2 1CQPA 1DAOA 1G0NA 2WWHA 4JLVA 3TIGA 4LFCB 3ZGYA 5ICEA 2YJNA 1Z0DA 1NBMD 1P77A 3GOQA 3NHLA 4NATA 1CY7A 3V5NA 3H0KA 3RYCA 4NHEA 4YDHB 5LPNA 1EDEA 3IDZA 3TSCA 5E6UB 3H6HA 2I6QA 3H8JA 1V16A 2OM6A 5I4IA 1LBEA 1VKNA 2QQ0A 1QHFA 1DTWA 1J2JA 1YQQA 3LDAA 3NATA 1TMGE 1VBKA 2ZZKA 1K6EA 4IQ8A 1XRPA 3ZBQA 1I6MA 3WMRA 4WXPA 2V59A 3R3HA 5G1NA 1Y6QA 2ERXA 1ULAA 3COVA 2WBLC 3K35A 1JR4A 1T2AA 1OXTA 1MEEA 4F8EA 1BH2A 3PDCA 1FP4B 3AP3A 1VG1A 3FHOA 3RVDA 3FWPA 3IAHA 1V6CA 4N3GA 4A0FA 3GVIA 5DIFA 1L7VC 1C4KA 2CLSA 2Z57A 3WGZA 1M2FA 2WINI 1U7XA 1DV1A 5JT1A 2UZ1B 1V45E 3FFTA 3KFXA 3LHKA 1PGNA 4M49A 1L4YA 2OYRA 3EXFB 1G21A 3HZRA 4QYXA 2DKNA 2ZG6A 4D44A 2C7QA 5IFKA 3C3KA 4RF2A 2HMYB 2I1QA 4LZZA 2R1UA 2PZMA 3B9RA 2PTHA 3MWEA 4RF5A 5HMMA 2CKMA 1NPYA 2R6R1 4D92A 3HJHA 1KO5A 5A4KA 5K2OA 1E2FA 3OE7A 2A78A 1MHTA 2FW7A 2H2AA 2FY8A 2GPNA 1PFGA 2R6DA 1OT5A 1A9TA 3JRXA 3OWXA 4FI3C 2OV6A 5JTUA 1XTJA 4RK1A 1C81A 5T4BA 1CB0A 4ZT7A 4OQNA 5BN5A 3VR6A 1T0PA 3C5WP 2JF0A 4X84A 4HB3A 1NJGA 2BFBA 3S2YA 3ZHSA 2IDZA 1TECE 1IM8A 2P3SA 5L3SA 4DA6A 4RVOA 4UTRA 3FN4A 3TNFA 5EJ8A 4DIUA 1Q0SA 2I4TA 3QMWA 3W3ZB 5JCZA 1A5SB 2HEIA 1QWSA 1F2UA 2UUCB 9ATCA 1OD6A 4FD2A 3TYXA 4RY9A 3TEMA 4M38A 2O05A 2HL6A 2ZTMA 1HE2A 3V7WA 4KLCA 5EKDA 3TNJA 1UBSB 1FQWA 1AE1A 3PQ7A 3JAWA 1JECA 4LWZA 3P0HA 4NZNA 3ZWBA 1MIOA 1T2CA 4XTCS 3SFVA 4KTVE 5BV1A 4QPNA 3OIUA 3EFOB 1ZUD1 4AZ3B 5AUNB 2PHZA 2JEZA 2WT9A 3C3AA 3A4LA 2A0UA 3LVBA 4P36A 2EZ9A 4RCZA 3SFZA 3B6ZA 5FP0A 2HNAA 2OK8A 1YIAA 1XMSA 1F60A 2QB5A 3HB9A 1FA9A 4QICA 1FBNA 3Q15C 3CUKA 1YZYA 3R7WA 2PSDA 4UFNA 4WOPA 2XEDA 5H83A 5CDSA 5AW4A 4JODA 4M7OA 4KI7A 2YQ4A 4HGNA 1MO5A 1LBQA 2GVDC 2HEGA 1G21E 1Z4LA 3B38A 3EISA 3LUAA 5ED0A 2NU8A 1CS0A 3OZDA 3FKSD 5TB5A 3C3MA 5KDDA 3ZDZB 3MMNA 2F8MA 4NTZA 1W34A 4RS3A 1XTSA 1C9JA 3W5JA 3SF8A 3PEWA 1T9DA 4NY1A 3C1TA 5ENDA 3KTAB 5CIQA 3OF2A 3TJRA 1WP9A 1M10A 1R0CA 3HDGA 3GPBA 3QKSA 4IOKA 1XVAA 3W7VA 2GM4A 1K7EB 2PKEA 2XGOA 2Z95A 3MAGA 1JDJA 3FG9A 4W7HA 1GZVA 4E6EA 4U63A 3GLGE 1G8KA 2DBRA 1RMTA 3A9VA 5SZHB 2PRYA 1Z2NX 1YDFA 5AKEA 3SZRA 3O91A 1IEXA 2DZDA 2FVYA 2C2XA 2QLBA 3LP5A 4MGKR 4N8EA 1GPUA 5ECYA 2MSDB 2P9JA 1YS1X 2LVBA 4IXNA 5IDQA 2HHJA 3L82B 3M49A 5ED4A 2K7ZA 2CBXA 5F9MA 4B32A 2PS9A 3NRCA 3RYFA 4S1NA 1X7GA 4DNPA 3ZD7A 4JLWA 1MPXA 2Q0QA 4CKXA 2AR7A 1URPA 2FJPA 2IY9A 1GAWA 1UWCA 1JBQA 3ET4A 1XMPA 3FKQA 4PAQA 4RE5A 5G02A 1HLFA 2JFWA 1QZUA 3ESCA 3K2BA 2H3EA 2V54A 4FOOA 1YI0A 2OD2A 3FSEA 4DCGA 1QVAA 3DAOA 4XGIA 5DLQC 3WG9A 4D6PA 1D2GA 1SKBA 4FOPA 1IIBA 2RAUA 3H5TA 2F6RA 1JZQA 2F8LA 1DJQA 4Z4GA 1RHJA 3IXLA 4GGOA 1O94A 3WZ2A 5K8CA 1TO1E 4ITVA 2IHJA 3IOEA 1OHHA 1LSSA 2OVFA 2Q2QA 2O7SA 3AHEA 2VDUE 2PSSA 2CCKA 2SHKA 3LVRE 5DM2A 2ASEA 4QDZA 4YH1A 1L1FA 4ATNA 4B46A 1ECBA 1UBMS 4EK9A 4E7PA 1QVVA 4MVYA 4GMGA 3DGEC 1R8XA 1UXKA 3SYKA 2NACA 4K9LA 2WJWA 5JSKA 3IUBA 3FF1A 3LXUX 1YA4A 4W5RA 2VXBA 4EUSA 1BMDA 5CURA 4MWEA 2FJ0A 2XBMA 3I1JA 2NLOA 4BB5A 1QRSA 1AOXA 3C41J 1WMEA 2V7UA 1Y8RA 4EYGA 1NUUA 2VNHA 3L4EA 1I51A 2W0SA 1ZS9A 3GPIA 3LYUA 4FGJA 1SWWA 2CYBA 4G5XA 2FEWB 5TGTA 2NUTA 4AX8A 1U0FA 4ETMA 3O7WA 2E21A 2GDZA 1IZZA 3QFHA 1W59A 4J2TA 3C1OA 3OQ6A 4G25A 4M83A 4CM9A 3JRWA 2I6GA 4U9IS 5J47A 2HJVA 3DVQX 3I6ZA 1GG9A 3RQSA 1H94A 1YT5A 4Y7DA 1W6RA 4O1MA 4RD2A 1Z07A 1NV8A 3KJIA 5GV8A 2GLTA 1AV6A 4OJQA 4YP7A 1ZJYA 2NO7A 3H2BA 1NRIA 2PCJA 3L05A 2YJTD 4LYYA 3NEJA 2DBZA 1XVIA 1FYVA 4V0NA 3ZC3A 3L7BA 3EYWA 3PDJA 5J4KA 1ZCFA 5EMLA 3HMKA 4L08A 2NPIA 4E3WA 3GJ4A 3MTBA 1FB5A 2JLZA 1SOMA 5TVGA 1DKLA 4HT3B 4NSNA 1QYDA 2G4CA 4FN4A 5C1IA 5K45A 1C8BA 3H4IA 1N1GA 3NUQA 3NWJA 2W6MA 4Q9AA 3IP3A 4MVJD 4CDNA 1UT5A 4EHAA 1C3VA 3PXCX 4HQFA 5CFNA 4KWEA 3L7OA 3QFTA 4V3BA 3E5RA 5M2QA 3OZEA 2XA2A 3IRUA 3AILA 2BUAA 3UA3A 2RCYA 1NG1A 3I28A 3P2EA 4G41A 1BU5A 2C57A 2EYUA 3KZXA 3GY0A 3MWDA 1PL7A 3AF1A 1UDWA 4GMDA 2IS2A 1V37A 1A0OA 2XRMA 2WOOA 4KUGA 3U9LA 4G67A 4YEDA 2W37A 3CF2A 5FOTA 3WL5A 2NT4A 1WZCA 5BV0A 1JAXA 2ZRNA 4FGLA 2X76A 1BWRA 2IUTA 4R01A 4D42A 3C8UA 5AUPB 1GL6A 4TX1A 4WZAB 4D9MA 5I7SA 1CUYA 2XV1A 3CA8A 1E7QA 2HYDA 2YWDA 1U28C 3ORYA 2R97A 2W8BB 4QBTA 4BKMA 1QNFA 3KJHA 2G1KA 2XCUA 1JSXA 4MR8A 3UT5B 2NXEA 2HRQA 1A8QA 1S1MA 4Z4CA 4YAKA 5CIYA 1JRLA 1FDIA 1DMSA 3VHQA 4BC0A 5AW0A 1H3NA 2HF2A 2HU8A 4IS2A 4NU8X 2BFPA 2AN3A 1MO2A 1F5SA 2W6CX 3L0DA 2WUGA 5KU1A 2O0LA 3P0IA 3TDMA 5C2JB 3NQ41 4MRSA 2O4UX 1K88A 1FW8A 3VMMA 3ZQKA 3QGMA 3TTXA 1KVUA 1T43A 5DJ5A 5DBIA 4YDSA 1LPNA 3T5AA 4G0UA 1E63A 1J8QA 1LNZA 2YV5A 3JPYA 5CFMA 1JJ7A 2BKUA 4YRCA 4MRRA 3VSBA 3DHEA 1JDUA 3VU8A 4HVAA 4DIKA 3GGPA 2V0CA 3RBXA 4RK5A 2I2BA 3TTWA 3V1LA 1ZJ5A 5I9NA 1Z5OA 1AA6A 8GPBA 2VPZA 1XTQA 4M8KA 1WTAA 2J6IA 3G0CA 3IPAA 5SV2A 2H1CA 2O23A 3HSYA 3KOOA 3LVQE 3N7AA 4O29A 4AWBA 4L02A 1E1DA 2XYRA 1KZ7B 3GJTA 2ST1A 4UHCA 4D45A 1ZJWA 1F6WA 1I5EA 4JBWA 2QM7A 4CR8A 1T36A 1DOAA 1IWPB 3CEAA 1JFLA 3WP1B 8ADHA 2V7TA 4PX9A 2IH5A 1VQ1A 1YQXA 2QEQA 1JDNA 2MMGA 3GWZA 4ZAGA 2RAPA 1K66A 4WCFB 3OT4A 1IDN1 1NW6A 1G2IA 3R23A 4HWSA 2VWGA 4I6GA 1N9GB 4P93A 3THYB 2GSDA 1MRZA 1SU7A 1GFZA 3R24A 1O0BA 4OU5A 4RH3A 3DL4A 1YGPA 2YVLA 1C8KA 3G7UA 2VLIA 5GOTA 3L1VA 1WETA 4TLDA 3A14A 1KS9A 1P6XA 1LC0A 3NHMA 3SIRA 4JD5A 1JIJA 4BUZA 2PGDA 1T1IA 3TVDA 1ZRSA 1N2XA 3AEZA 3AVOA 4MVJH 1C4WA 2J45A 4JQSA 4OHBA 4AY2A 5L3VA 4YMGA 1BE8A 5EE3A 1ICEA 4MI9A 4EO9A 3ELDA 4M0EA 2VXOA 1OX4B 4JVOA 4KBFA 3NWPA 4BLPA 3D3NA 5AHKA 5GIOE 2ICAA 1SA0B 1DQNA 1JJBA 1NGSA 4W1PA 3HDJA 2Y1GA 1KEZA 1ML3A 2BFCB 4Z0NA 1DT3A 3D8HA 1EZ1A 2R68A 5JCJD 5HK8A 3DZIA 2LZ0A 1SNYA 3RTDA 1CFZA 4MP6A 2ZIXA 3AVQA 1ADCA 2GR9A 4B47A 5HIAA 1A8IA 4Q3NA 4F3CA 4AU1A 4D4JA 1GWNA 3KXIA 5JMPA 4S2EA 1ND6A 2ANBA 3NH6A 3S99A 2IYXA 2FVXA 3OQIA 1JU4A 1GPDG 1T10A 2EJUA 2Q1XA 3H11A 3OTHA 2XNJA 3WGUA 1EM6A 3NYQA 1V11A 3VTFA 3U5ZB 3EGEA 3EBOA 1Y4ZA 1PD0A 3PC8A 3AJRA 2VXCA 4G5YA 2MSCB 3MXOA 4UHBA 5KKCA 4YNBA 3HCNA 1KMIY 3T38A 5AWFC 1L5NA 4TYYA 1IOVA 2WUDA 2QROA 3DXYA 3IPCA 5A02A 3L4KA 1Q7CA 4BEWA 3GUZA 1OJLA 4RQTA 2A5FA 1ECGA 1DO2A 2W93A 1TUEA 4F97A 1H3EA 4KAAA 2EZ4A 5E0KB 2ZYTX 2P41A 3K8YA 2WYWA 5DW3A 3NMUF 1TJPB 3ZXXA 4JB8A 1J25A 2AOXA 3AH8A 4MA4A 2BR3A 4LHEA 1AK2A 1TC2A 2AJBA 3RJTA 3EAFA 3PR2B 5DGIA 1FQKA 4WBNF 3FDZB 4G65A 2O19A 2B0JA 4CLOB 3QF4B 3T5BA 1G5PA 5A4MS 3FSGD 3N7UA 5DTJA 4I99A 5KTMA 4A2QA 3AF0A 4GQIA 4BNNA 3FPJA 1ZD9A 4CKEB 1PK8A 1EHCA 4RV4A 3SC2B 4P34A 4XQ9A 2II6A 2P0AA 4ZAFA 3BM5A 4Z1OA 3UMYA 1R9GA 4I1SA 1GSAA 5GQSA 2EJBA 4C29A 3KXPA 2ZRMA 1R6VA 4BGEA 3KB8A 1Z5GA 3RKRA 4FHFA 3VM6A 1Y9JA 3S2ZA 3AZQA 5AUOB 4M8NE 1XKQA 2GLUA 4QHSA 4XEHA 2CHFA 3W2TA 4CM1A 1HDOA 2XDQB 2QE7A 3GEGA 3TLJA 1TUBB 3LNCA 3PPWA 2RGRA 3CCFA 2V7GA 1YDEA 3SVTA 2V9PA 2ZRDA 3WQSB 4R6WA 2J9GA 4OUDA 4C7KA 3DHYA 2VPQA 2C4NA 4L78A 2X14A 1W0JD 1XTTA 4UZSA 2Q3MA 1I13A 4WY2A 3W5IA 3DVSX 4HNAA 6CHYA 3NDIA 5ER6A 1VKRA 2XTNA 2FW6A 3F3YA 2CXRA 3CSUA 3N70A 4JFAA 2EJTA 4IHQA 1CY0A 2E89A 4I46A 4RHYA 5J5AA 3PBKA 1P7VA 2RCNA 4KW7A 4B81A 2PZBA 1NULA 3U56A 3L7MA 4BO4A 1GZ5A 3TSAA 1HT0A 2YBDA 3HLTA 3P8ZA 1MPTA 1GR1A 2FU5C 2WW8A 1XRRA 1M3SA 2P2CA 1NI5A 1ODJA 3ZGOA 3EZLA 2WTUA 4GPAA 2E4UA 4HC4A 3MN1A 4ISCA 2QGFA 1QYXA 2BHRA 3GROA 4HPJB 4HY3A 1RZUA 3A9TA 2GXQA 1FUKA 2YYSA 1ZD1A 2I80A 4ND8B 2X4DA 1E8DA 3I0ZA 5C80A 5HNKA 1SVWA 1WVMA 2QPLA 3L0SA 3MSCA 1NMQA 4O2AB 5H4HA 4KR0A 2IHKA 3L7YA 4QECA 1MX1A 3EA0A 4HQLA 4BGVA 4OFBA 4QBFA 2O7VA 4DVGA 4GMKA 4X20A 1WHTB 2ZVQX 3TZ6A 4J1QA 4XVHA 4Y6QA 2QAIA 4HUQB 2G09A 3A6GA 4NOLA 5EJEA 2QKYA 2CJXA 3M6VA 5JBQA 1C3OB 4N76A 2EX1A 3QVGB 2HRZA 2Q28A 5B3AA 4YRDA 3IPLA 5AIAA 1OFVA 2AXEA 1CTQA 4UTZA 3C7DB 1N0VC 3VYSB 3CIOA 5ADUS 5G4LA 3WMFA 3T7JA 2W6IA 1TMOA 1FSSA 2EG5A 1AD2A 2WFAA 3KB2A 3BKXA 4EL5A 4P4SB 3F1KA 3T5TA 2FW9A 5BW5A 3OZIA 1DRJA 1PBNA 2QZJA 2C5SA 3KNZA 4IKEA 5A71A 3SF0A 2BEJA 4G5RA 2HSEA 3N6VA 1G3QA 5JNTA 3FZNA 2C3YA 4M99A 4YPOA 4CF7A 2WVGA 2P67A 2DU8A 3PPXA 2ECQA 1F0KA 1RJ9A 2P9QA 1T3ZA 4ZVTA 4BLVA 1KARA 4DS3A 3WKCA 2F1KA 2GESA 1BDJA 1W0CA 5HCIA 1LKZA 2YV4A 4LYDA 1VLLA 2GMWA 2UYOA 1Z4NA 4RNDB 4WLVA 1ESZA 2VHVA 3WL7A 5DCLA 4EKYA 5JOQA 1JPUA 3M81A 3W1WA 4MVWA 1C3JA 4ZOLB 4V0MA 5GOZA 3UMCA 4ZZ2A 5JPDA 1A9XB 5G0VA 4DG8A 3WGIA 1BXKA 1V9CA 1C7EA 3RD5A 1EAMA 4H08A 1INLA 5DGDA 4ZALA 1GZ3A 3WMGA 4PTLA 3C4VA 2G36A 5BXQC 4LHSA 3COJA 3MCTA 2ZAIA 1JSLA 1KFBB 3H9JA 5CMLA 3EGVA 1N2CA 2A94A 1HFJA 1II0A 4G1EB 3TDKA 5DM60 5TQ2A 4M7RA 3ZY4A 3HA2A 5ETJA 5HGJA 3TM5A 1BFUA 2QW0X 4DNXA 5C35A 5C5IA 1EDOA 3HJAA 3OOSA 1HZZC 1FVXA 1TM1E 2DPMA 2HA4A 2QT0A 2FUG1 3L8ZA 2X0NA 3LLVA 2G72A 1LVUA 3ZWWA 1WZ2A 4NG5A 5I51A 1BMFA 2WIBA 4RD0A 4TVOA 5KOHB 1QPBA 4ZOLF 4OK5A 2IU6A 1LDGA 1M9NA 1C41A 1M6YA 1X38A 3OJEA 4Y6OA 3WDSA 2VT3A 3LHIA 2HTFA 2J6CA 4OGGA 2EKBA 3RLIA 3EEOA 2IKQA 1QP8A 2XMSA 5DNWA 2A14A 3VMFA 4M76B 2NPOA 5KWIA 5FPQA 3EEBA 4UE3S 3Q7QA 4EFKA 1SIBE 5KQRA 5E8RA 4V0QA 3NRJA 1XF1A 1FTQA 3FPCA 2WF5A 3F71A 3PE4A 4HO1X 1YHNA 3NS7A 1N5DA 5JXWA 1C9YA 1MC4A 2WKSA 4W6ZA 1X1RA 3OZ7A 1DEXA 4D9NA 1YTLA 4BLQA 2JVJA 2R65A 4WKCA 2ZAYA 1X2BA 2C4MA 4G8CA 4I1UA 3V2UA 4ZJZA 1FQJA 4G2NA 4GGPA 3K8ZA 5KPJA 1SXQA 3EX7C 3I73A 2AWOA 2C8KA 4QWMA 1UKEA 4JI1B 2EP7A 2IOFK 5IT5A 1BW9B 4LRQA 4HK4A 4MB6A 2H4FA 4PZYA 2YFHA 3Q2KA 4TTAA 2G67A 3SZUA 2SBTA 3ZDAA 1UXIA 3HN6A 2F1HA 1Z4IA 3M5PA 4DVJA 4TTSA 3IAUA 1N2CE 2CDAA 2ORWA 4C78A 3MBOA 1Y1TA 4Z9XA 5DASA 1PQWA 2QG4A 3SNHA 3PC6A 3OA0A 4C0AC 4YXWA 1E9RA 4CQMB 4AKGA 4REMA 4KHPB 4NU5A 2VRWA 1BMTA 5LD2B 3CLSC 1UBFA 3GLSA 4L2IA 5T67A 3FW1A 3FPFA 1XTBA 4ZVKA 5J40A 5M3BA 4DXDA 3O2JA 4PZCA 4YS6A 1ADFA 4MVCA 4CQNA 4DQLA 3Q3IA 1KH2A 3BA1A 2EL7A 4MVJF 5FI5A 3ZWNA 5M7EA 4B8ZA 3JTMA 3DTYA 4LC9A 3V34A 4B43A 1OI4A 4Y1RA 5C18A 4DLTA 4G4GA 4BNFA 1C5KA 3BE5A 4M0DA 2AIRA 1TUIA 1YIOA 2BHSA 2FSSA 3A9CA 4HQKA 1U0OC 4OHRA 4OJKA 2M6KA 2GPJA 2ZJOA 3E9CA 3QZUA 1NM5A 4JLKA 1E69A 1SUWA 3PRKE 1ZOIA 3V9PA 2BBWA 1BXRA 2VDWB 3LLCA 4IDHA 5JLJA 1W8IA 4BJ3A 3OIFA 4XYBA 3O7MA 4MQEA 4QJ3A 5BSUA 1G20B 4EGAA 3EIWA 3VZCA 1FDTA 3DEFA 4PO9A 1WEHA 4U2EA 2HV9A 3BWDD 4QQ8A 4ARZA 1XUOA 3RUHA 1KC3A 4PZ9A 3CPHA 3H83A 2NZYA 3HP4A 3S8EA 1QO7A 3QJYA 1QBGA 5AR1A 1VBFA 5E6SA 4ZDJA 4OLHA 1K2WA 1YJXA 4KQ9A 4A8PA 5TLSA 1R0XA 2UZ0A 4G2TA 4M0LA 1IOLA 4G01B 4PZLA 4HEJA 3N8IA 1QE5A 3C39A 4RF4A 1AC5A 2HPVA 4WASA 2PMWB 2QWXA 2IDJA 4BKRA 5FA5A 4C21A 3FHLA 3CKMA 2QU7A 4N0DA 4UASA 4D82A 2X42A 2WHRA 1PZMA 3H5WA 1EJ2A 1DLIA 2X2EA 3H8VA 4BMSA 3LE8A 3IKVA 3CX7A 3ESBA 4E2FA 3BBLA 4EJMA 3R3UA 3GLIB 5B53A 1IAVA 3IIIA 4QOIA 1XRLA 4R5MA 2BT4A 1US8A 5IKPA 2HBRA 4TQ9A 4Q48A 4FHGA 2F7SA 1B2LA 2DLNA 2EZ8A 2GAIA 3E4DA 3H0EA 5BYJA 4Z3KA 4ZK2A 2FP3A 1C3EA 4BU0A 1XZ8A 4B3IA 1XZQA 1Y4UA 2I4MA 1NXSA 1XMQB 1EFDN 3UFXB 2HWYA 3KYDA 3GT3A 1JEEA 1MEJA 4RWZA 2UXBB 2B8NA 5A2QA 3AETA 4IDOA 4II7A 3S68A 5DN6A 4BBZA 1B7GO 1QG0A 4W63A 4TKZA 2VWQA 1KBZA 2GNPA 3B8EA 1Y42X 3VDMA 2C5FA 3HM9A 1Q1BA 3MGCA 2CV1A 3RYIB 1N3BA 3ML1A 4WA7A 1I7DA 1ND5A 3C15C 3HFRA 5C46F 1UMDA 1P2GA 1U02A 4MQUA 5CEFA 1PWZA 2JLCA 3D7SA 4GMHA 2HK9A 4UEJA 3TSWA 4JP5A 5K6TA 2XMPA 4HVLA 3NALA 4NENA 4FDUA 4KMMA 1CUVA 5IM4F 2J3HA 1R9JA 1KR2A 3T95A 5BNIA 4L8LA 3O82A 5IH3A 3OEHA 3O8RA 3EIUA 5K3CA 3LUJA 1ZHHA 4P5DA 3LLSA 1OF1A 2OBBA 4EHDA 3BHIA 3S44A 3L04A 3BVPA 5DWQA 1W25A 3UWPA 4B33A 3VNRA 1YGYA 3LFHA 3X1ZA 2E4AA 5IABA 1JHRA 3OY7A 2G83A 1R10A 2VHTA 3MWGA 2VK1A 4ILEA 4IRXA 4JJFA 3ZCSA 1KYYA 5B7NA 3I8XA 3SQLA 4E22A 2G40A 2GYUA 3FAKA 2FPGB 3MD9A 1W5BA 3QLVA 4RA9B 5CW1A 1FX1A 4ZVQA 1LSUA 3Q11A 4IQ0A 4JLAA 3OTQA 4PG8A 2C9ZA 5TY0A 4PG4A 1MVOA 3AEKA 1O6ZA 2WTXA 4OK3A 4PU0A 3VU3A 4UUMA 2AFVA 3CGGA 2PIDA 4JV5B 4XGNA 1E7MA 1IHYA 4CWAA 5IJ0A 3TRHA 4MWSA 3ETEA 2IV3A 3L2OB 4H31A 3M6WA 2BM8A 2M9MA 2MSEB 2OBNA 4M22A 4DEYA 3QOFA 1FNCA 2Z58A 1QPGA 2PKYX 1FL9A 1E1QD 2VHCA 1YB2A 3BK2A 4RDIA 2EBUA 2XXBA 1UZUA 4RIFA 4YRGA 2F8SA 2DHDA 4KOAA 1G9SA 2IEYA 1RVDA 4PFSA 3WK7A 1DAEA 1WMFA 1AXEA 1WDTA 3L8EA 1YHZA 3OX2A 5DWDA 1Q1EA 3MYRA 1SOWA 4RLHA 4WJKB 4AJOA 1F9EA 1V1MA 3D1JA 3THSA 5EJ4A 4EA7A 1F06A 1AU9A 4HLQB 3WGGA 4FM9A 3SWWA 4BBJA 4OJNA 4WZZA 4DRXB 4EVRA 4RKWA 1AUPA 5DTQA 2Q4BA 5FCDA 3FUCA 2AFHB 1QE0A 2B21A 2YZ7A 3GZNB 3MBKA 3O5AA 4K81B 3WQQA 3ZD6A 3DOJA 2OCKA 4RWEA 2CXPA 1A4RA 2HCBA 1SXJA 4TT8A 4S35A 2OVBA 3DBLA 3FPGA 4WFIA 3KLOA 2XXAA 4K87A 5FI1B 2V7PA 1PR0A 4BFYA 4D3DA 5KVCA 2HO4A 1U9YA 5GADl 4LXTA 2HGZA 2Q0HA 1U9CA 3MTAA 1ZD5A 4EKIA 1PUJA 3PQ5A 1C1YA 1KKUA 2PQ2A 2BP7B 3GLFB 3RKSA 2JB9A 2JW5A 3ZCXA 1Q7TA 1QO9A 3JYHA 1LS1A 5H3CA 3UJBA 3VO2A 2F3RA 5AI6A 1O94C 2A7QA 4PX3A 9LDBA 3DOFA 4X1IB 3O90A 4LVCA 3OZSA 1TL7C 4H6XA 2OL4A 2RC5A 2H4HA 3CF6R 1I01A 3KDSE 3TMKA 4W5HA 1V5EA 3JQGA 4ODIA 5AHWA 1I9GA 4LDQA 3R0VA 3RFVA 1SK8A 2WHQA 3QLJA 3VAZA 3ZTWA 2YWCA 5HF9A 5JWRA 4QYIA 4BB9A 5EQTA 5IANA 1Y1LA 2BM0A 2CL0X 2AI1A 3ANXA 4Q7MB 5EWJB 4CJXA 5K8TA 3RGWS 1ISRA 4LK2A 4D0LB 3E7PA 3K2EA 4NICA 2OPBA 1D0SA 3FOCA 4NBRA 2JJMA 2DQSA 4H0NA 1J06A 1HORA 1RRKA 5B2ZA 1E1LA 4WXYB 2HUNA 1AXGA 3DE0X 4X45A 3URKA 5B36A 1J0BA 1JHZA 3OPNA 1U5AA 2ZRGA 3BL5A 3N2KB 5J4YA 1Y6JA 4BMXA 3U40A 3W1VA 3BB1A 3KV3O 2H7XA 4ZJPA 1XXLA 2BMDA 1UANA 2LWIA 3SLKA 1N9KA 1SXJE 2PMFA 1AS0A 1R3DA 2QRPA 3LQ1A 3RSZA 3GRUA 4JI8B 3EDYA 4YRMA 2MYUA 4GKVA 4V1CI 1Z3CA 4N5IX 4L8WB 2FQWA 3R3XA 2OQ2A 2W6JD 3AFIA 2WTEA 3MQ4A 2GPBA 1O03A 3PHBE 4D3XA 3QXJA 4DJDC 4V0LA 2FDCA 3O31A 1NF9A 4P3PA 6AT1A 3ETJA 3PVZA 4MPJA 3DP7A 4I9FA 5DCYA 5BSWA 2AL7A 1G7CA 5IYZB 1G2OA 4R8SA 3OF5A 1X7ZB 3EZ2A 1E1CB 3DSRA 4LOJA 1CQJB 1TMKA 3EULA 3SNKA 5JXHA 2JI9A 3EZNA 3HI4A 2D2IA 2Z8ZA 4H17A 3V1TC 5BYAA 1VP9A 5YASA 1GQQA 2GK4A 2IXBA 1ZK1A 1WXHA 1JMYA 5AJTA 2VJQA 1RYYA 3T5PA 6REQB 1DFHA 1E6LA 2B83A 3FTCA 4MIKA 2WG1A 4XFJA 1MJ5A 3SOZA 1KF0A 4AM8A 1SBHA 3UPUA 3NIWA 4REQB 1SKUA 1EVZA 1N3YA 2AZDA 1X7DA 2DYKA 2EBHX 2I1VB 2PMCA 2TMKA 2WG2A 1DAHA 1NA5A 3KL2A 4COKA 1AHNA 1X86B 2C97A 2RG1A 521PA 3WRXA 1W9MA 2I2DA 2FI1A 4EG3A 1A3CA 4YI5A 3U3RA 1XXHA 2I65A 5JD5A 3IKTA 2MSKA 2Y0BA 2GWRA 3B1FA 4QOJA 5GV7A 3ZKWB 4D4KA 1TVEA 3HUTA 4DPKA 4EW2A 1NNI1 3PQCA 5ICCA 4QEDA 4A8JA 1G6OA 3BWCA 1Y5NA 3OWOA 4NULA 4F3NA 4NFYA 2AC7A 4F93B 1XTZA 3NBKA 3P9RA 4PO1A 1G18A 4EFMA 1CCWA 3IB3A 3OEED 1GZ7A 1KY2A 3JQBC 4HZUB 3MTIA 2RSLA 4W8OA 5LOVB 1PWEA 1JB9A 3IPYA 3MILA 2X15A 3QFSA 3F9CA 1MV8A 3QU9A 4WEOA 2IL1A 1T1GA 4Q9KA 4DABA 3H87A 1IBLB 1NC3A 2P4EA 2P79A 3PNMA 4BLTA 2PBFA 1AKUA 4UVGA 2YIDA 1QDLB 1Y80A 2EHDA 1Q1ZA 2OQRA 3N76A 2J6HA 4MCHA 2C8VA 3BSFA 4PLZA 2Q1SA 1USKA 2DTDA 1RWXA 1UJMA 2JJ2D 2V9CA 2QGNA 5REQB 1WB6A 2BSQA 1AUVA 1EB8A 1E3WA 1UEXC 2PYDA 4Q18A 2SKEA 3K4PA 3D6UA 1E4EB 5EPEA 4ZAWA 2O8CA 3RTBA 2HSWA 3A05A 5JS1A 2GXUA 2X8BA 5HUHA 5FBWB 4MRPA 4PSVA 2XUIA 5E1MA 2VFAA 3BRWA 3DGFC 1OTHA 3DHNA 4DA7A 1HQCA 2J08A 5LOVF 1HYBA 2GJSA 2O2DA 3AHIA 1F17A 3R5JA 2O2EA 4JR2A 3WLFA 1UZLA 2H85A 3VNVA 3MJTA 2X5OA 2GEKA 4G0OA 4ALKA 1YUNA 3WFZA 3MBIA 3OPYB 1U0RA 1A96A 4DUGD 6PFKA 8ATCA 3PE6A 3SOPA 4QVGA 4YBRA 4NDAA 3U3DA 2RJOA 3EC1A 4GI3A 3U4AA 3OPVA 1X9GA 4DILA 3O9ZA 1XXHE 4RZQA 4R8RA 1AA9A 1I80A 5JXIA 4EA8A 1KY4A 4XVUA 3JYPA 3ZCPA 5HQTA 1Z56C 1B41A 2FF5A 2SCUB 1QMPA 4FN5A 4UUPA 5TQ0A 4DYDA 5ICSA 2OCYC 2ZVJA 4KIGA 4OFWA 2WA2A 5THKA 2VYND 4E15A 2XODA 4JLMA 3RSSA 4AY5A 3FYDA 1OLSA 5DN9A 1W2HA 1EFTA 2GPWA 4QHYA 2OR3A 1SPBS 4II3A 2CJFA 2VATA 4BFLA 2PMBA 3UH1A 1T2UA 1I2DA 3PGJA 3C45A 1P80A 3AVVA 3JZFA 2BMFA 1DKUA 1DOZA 1Z4PX 3A1TA 3HS3A 2JHPA 1QQTA 1NOIA 2IPMA 2VJAA 3FYHA 1OI3A 5T6BA 4N41A 1CK4A 1M1NB 4CGYA 1JR3A 1VDZA 4O02B 3ODPA 3AEYA 3HRIA 1HBJA 4FE7A 4UNRA 3ELBA 3IXQA 3KR2A 5CK4A 5EMJA 3U0VA 1SU6A 3C43A 3GHHA 2E37A 1TXGA 3OWHA 4TMYA 2Q5JA 3A06A 2DLCX 1W36C 1MB9A 1UK9A 2I34A 1H8ED 1RRPA 2I22A 4RVNA 5M34A 2QQ5A 1T13A 3T1YB 1WU8A 3AR9A 4TSKA 4HLUA 4BIMA 3CMCO 5IBRA 1DCTA 3R0ZA 2HHHB 3AQ4A 1LZKA 1RBQA 3CE6A 1JJIA 5TMEA 2QOEA 3TAXA 4EY6A 1QQ5A 1CJUC 4JSRA 4JVSB 1FYXA 3O73A 2QVBA 4GSLA 3DP9A 5TJHA 2XIJA 4BLOA 3U2QA 3PNQA 1V8OA 4XGKA 3RFCA 3B3JA 1C1XB 3HPRA 4LBZA 5ESRA 2QI9C 4QPJC 4RSHA 2Y1CA 1W93A 2GJ4A 4XD7A 5BN3B 3ZWYA 3QPCA 3EGCA 3JPWA 3I2IA 1UBGA 1Q0HA 4XYLA 4EO4A 1DHTA 4YV2A 1H8HD 2FA9A 1IYZA 5DCWA 1YE3A 3OIDA 3LQFA 1SHJA 1UWLA 4JAVC 2UXDB 1KKLA 1AUOA 4QU8A 2ZBGA 1NR5A 4P32A 1X1TA 1K5DA 3BGDA 4Q7JB 1N2JA 4ZFNA 3N0WA 4INZA 4ZTZB 1M1YA 4B71A 2GRJA 5C3MA 1J42A 1T5OA 4EEKA 4E2YA 4A6PA 4HN9A 5A5GA 3LDGA 3Q12A 1JR3E 1U8EA 3WIBA 3TXAA 3HBJA 2R84A 4KVZA 4UMFA 1VHWA 3UHJA 4AECA 1RTKA 3L0OA 2JIZD 3QJGA 2C3MA 4I4NA 4X95A 1CF2O 5JNWA 2A67A 1SKAA 1ZM3A 2PKRA 1A77A 3MJ4A 1YAHA 3LZ6A 4XFKA 4HQRA 1L5OA 3ED1A 3A04A 3IJ5A 2YZNA 3T52A 2G4LA 1USGA 4IXMA 1IUPA 4BNUA 2PXAA 1RAHA 4MV1A 5EA2A 4TQGA 4DY6A 1EYZA 5DDIP 2QTVB 1J5XA 2WJGA 1B42A 3DO6A 3NIGB 4DNOA 4EG7A 3UWKA 3GA7A 4PS1A 3AY0A 1Z08A 1IEVA 4O25A 4RMHA 1UDRA 1IFXA 1TMYA 1X7XB 1AG9A 3OICA 3R9IA 2RARA 4AYTA 4LV6A 3VNAA 4PC6A 1LLUA 5JBIA 1AV7A 2O1WA 4FMPA 3OG9A 4FHZA 1JIUA 1KETA 3FKJA 4KN9S 1FZTA 3CN7A 4YQFA 1RCFA 2NZXA 4QOSA 4C3OB 4NBTA 4DLPA 2OPHA 1IXSB 2XYHA 4YCBA 4G84A 4UMDA 1UMCB 3AESB 1EWRA 4P38A 4UAGA 2OV1A 4ER7A 3BPSA 2XE4A 1HG1A 1LFAA 3VR4A 1CP2A 3IUEA 4JLOA 1C9KA 1AK1A 5JDIA 4X6XA 1JHDA 3MG9A 3EGXA 3GHYA 2Y71A 1M1YE 3GRYA 4FZ3A 4YECA 3KD3A 5DMHA 3K73O 1ITZA 1GQRA 4BLWA 4OOFA 1Z75A 1XVLA 3C3EA 2AJLI 5KBYA 5CYGA 1Z6AA 2H07A 2Y0DA 4R0NA 1ARZA 3AXSA 4COOA 1D6MA 1E7YA 3ZWDA 1G5HA 5EQJB 1GRVA 4LJRA 1P5HA 3ET5A 2RK6A 1XF9A 2H51A 2G76A 3PNBA 4G24A 5FI3A 2E0IA 3K1YA 4RV9A 1EVJA 1EVIA 2XT6A 1Z8HA 1U3CA 5FTNA 5CVDA 2PS0A 1PG5A 1E9VA 2PGNA 4QDXA 5FTWA 3LIPA 3ZW8A 3WB1A 3F46A 3EG9A 1W5SA 3ANSA 2O2HA 5BURA 1FUYB 4Q4HB 3HY6A 4FUTA 1VI6A 4NYMR 1F0YA 4AJHA 1X77A 4GG1A 5FL3A 4DXHA 2XHEA 2K2QB 1UPAA 2DR0A 1HQDA 3K3PA 4XYEA 3LY7A 1JXOA 5CGZA 5AICA 1CG6A 4C5BA 5KWVA 1YI1A 1T8PA 4D4HA 4IPTA 3T7EA 4E5SA 4EG5A 1Z63A 1AQUA 1MO3A 1ZMOA 3AWDA 4GC9A 1WPRA 2FMXA 4BE4A 1LRLA 1QHEA 2M6RA 1E9FA 2LPMA 3ME5A 1VZ2A 3CURA 3PSHA 4RACA 2A9KA 1I33A 1WZIA 2PD6A 4MS3B 4MUJA 4PG7A 3T99A 4DR5B 2YOFA 4ZMSA 1WB9A 2YXPX 2DQYA 5IN4A 4EABA 5IRCD 2FKAA 2FRXA 2W9XA 2FXIA 3I3OA 4MR7A 3IP1A 4TS9A 2H59A 1E4OA 3JAMA 3ROEA 4ZTBA 4BJ6A 5E95A 3JD3A 3BJEA 1YBHA 2ZBUA 2Q7XA 2AX3A 1XPOA 4BLSA 1JWBB 4F6RB 1BXGA 2GAAA 4JP2A 3V4ZA 3MGAA 4RVHA 1REQA 2G4VA 4C2BA 1YNSA 2O57A 5D3MA 3V97A 1KEEA 2XB2A 3ZXSA 3IIJA 4DA4A 2OCBA 3LX4A 5I5GA 1SVIA 3L4BA 2ZJYA 1VLJA 3O8OA 1W2GA 2AW5A 1UJ2A 2GCIA 3G0BA 5I5EA 5M29A 1ZITA 3D3EA 3R9XA 1T5HX 4YAJA 5KJ1A 3MMXA 1SVUA 2XVZA 4BO5A 4JVNA 4RC9A 5CITA 1W52X 1XEWY 2IIBA 4XUCA 5BQOA 1QAQA 3L5KA 3T1QA 2DSTA 4MV8A 5HX7A 1A7UA 1NJ5A 1TK2A 1PFYA 3DTVD 2R7NA 5J3JA 2FP4A 4C08A 4GPD1 3GO4A 3GDGA 4OG2A 5JVDB 3ZZNA 1C1DA 3MTJA 5JFOA 1R4MA 3V33A 2E4VA 3AKYA 4HCJA 1Q0UA 2YXNA 2ZYSA 4JIMA 4R16A 4PGHA 2GA9A 3AJ9A 4Q6WA 3RUDA 2HD4A 2J9XB 3CS3A 3NTOA 4RQBA 4MQ6A 2QMEA 1JEOA 4ED9A 3DD1A 1Y1QA 1ZVJA 5LZ7A 3WE7A 3BMQB 3LGXA 3AT1A 5ILGA 1YS2X 3TIVA 4B3TB 3SHVA 3FSJX 1T4MA 2IFTA 1YL5A 4FFBB 4PYQA 4CLRB 3HO6A 2FN7A 2R2GA 3U7IA 1FRNA 2WJ6A 1G3UA 2BM9A 4RPLA 3TL2A 4E21A 5CDYA 2HBYA 2DR3A 3NJ8A 4JR0A 3ENVA 4PZ0A 3PA6A 5E3IA 5JVDF 5BVHB 4NG4A 1FXWA 2O2ZA 1RBMA 3WBBA 5LN1A 1ZYUA 4BMZA 2YY5A 3KOYA 4BNYA 4J90A 4BQOA 1VG0B 4LY0A 3FNGA 4L75A 5IDVA 5CFPA 2FAXA 2JARA 4V03A 3IOCA 1X9IA 5D8DA 3JATB 3UOAB 3WLTA 1ECCA 4BMDA 2BH9A 4D99A 3GLVA 1IXYA 3DC2A 3VU9A 3AVWA 3A58B 2J4CA 4R2JA 4S1WA 1DAIA 1DHRA 1EUDB 1F2VA 3L7NA 3STHA 1QIGA 4ZARA 1P1HA 4B82A 4DDTA 1M34A 1CHNA 1RI2A 2GF2A 1NRWA 2IVFA 2QHXA 3FGZA 2HRRA 3RTAA 3HYRA 4UHEA 2VJPA 1Z15A 3AI7A 2IUEA 3UWSA 1NU8A 1WR8A 2Q27A 4WY8A 2J09A 2GYVA 1JLSA 5C4IA 1YJCA 1WXGA 3UMFA 1J2RA 3ORQA 5CCDA 5FFFA 4EG6A 5IK2A 1PW7A 3MWFA 3TQFA 4JX9A 1TW2A 4CG1A 4FZRA 2QVCA 2ZDQA 5AMXA 2OZKA 3PIIA 2O0JA 4YALA 3PXGA 3SC6A 3DBRA 1NM5C 3K1TA 4EW3A 5HUQA 1PR1A 2AQKA 2H57A 3GPLA 3IMCA 4BAUA 1A97A 1JHQA 1M1ZA 5DP2A 3W3AD 1NQ5A 3WK8A 4N3CA 5A5DA 5C8VA 5HKKD 2A35A 4E11A 1M72A 3GUVA 1KWKA 2GK6A 4LI3X 4RQUA 2C96A 3OQNA 2DOKA 2I62A 3IDSA 1S3GA 2F43B 3QPAA 5F7ZA 4FUQA 3H9QA 1GU0A 4B4KA 3MGGA 3GLQA 4FCTA 4C76A 2YRFA 1T5DX 2H5LA 3PUHA 3ADCA 2AN9A 3BRQA 4R2LA 3WGYA 1COWA 4EJSA 4B2PA 5K5EA 4G0MA 2ACVA 2P91A 1NBMA 4BV3A 1PTJA 1NWHA 3G2JA 2NU9A 5A4DA 1FP1D 4QT4A 3TRJA 1GQOA 1KZ9A 4BMYA 1NBAA 3BCSA 3K96A 4GE3A 3RU2A 4QKQA 3G9QA 3RHTA 3HGTA 1NMZA 3L0PA 1RWNA 4GMFA 4KFSA 1K97A 3S1AB 3T3PB 3QEBZ 2WF8A 4KPUB 2QRLA 5CVEA 4MYSA 1M34E 5EP3A 1Q74A 2JAPA 4OAOA 1XNJA 1A9QA 2BGUA 2GD1O 3M6IA 4IILA 5IJWA 1XALA 1ANKA 4HDMB 1KDYA 1C9EA 3ER6A 2JCSA 1CUUA 1U9ZA 1XLVA 1T29A 1W5FA 4A82A 5F9FA 4BY9E 4E88A 1GQ2A 3R4VA 1U65A 1GTG1 1V96A 2BFDB 4JUCA 3TRFA 2JFQA 3KYBA 4RIEA 1F14A 3KLBA 2DFNA 4MGYR 1EINA 4FFVA 4LJ6A 4M3NA 3PGLA 5HVNA 1RABA 1W6UA 2WU4A 1DC6A 1O97C 4GGMX 4FBMA 2O8BB 2EU8A 1HLGA 1N6KA 2XQKA 1WY7A 2KHZA 3ONNA 5LKAA 4RNCA 3RC1A 3BHMA 5IBCA 4JITA 3VNQA 3TOSA 4Q66C 4C06A 4R6XA 1DEKA 5DYIA 1WA5A 2RHRA 4EJFA 2BHTA 1J7JA 1U2QA 3HMQA 3VOBA 3AVUA 4RIIA 1PJ3A 4JKOA 4B9EA 3MWJA 3CISA 2IUUA 2I9PA 1F8FA 2G9ZA 1KAHA 3KT8A 1N7HA 2G0NA 1VLQA 4Q5IA 4N0MA 5FJIA 5LQUA 3HJTA 4J0DA 5KOJB 3DAGA 5FR2A 4JJ4A 4N8SA 1XSEA 4NYMQ 5C3UA 4O5AA 4W5QA 5BNWA 4KO1S 3I72A 2F8TA 1XAGA 2N0SA 2PUVA 4WLEA 5FUWA 1VSBA 3QEMA 3ADPA 3LDHA 2B3TA 4H60A 3DZGA 5IAJA 3Q7EA 2A3NA 3IHWA 4GAEA 5CD9A 1ZOSA 3V1MA 4YJFB 1GQSA 4O2RA 2JAWA 3VVBA 3LWZA 5BUSA 1YZUA 3IKJA 3NBFA 1EUQA 3U7JA 1W4AA 1WV0A 4OXYA 1HM5A 3JSAA 5D3ZA 1G42A 2QYHA 4R7ZA 1X74A 2JA1A 2NG1A 4CUZA 1Q0LA 3BXZA 1XJ5A 4BJ5A 1DQSA 4GZ5A 4JOSA 4CF3A 3K92A 3U4IA 4GBMA 3BMOB 1GZDA 3HYNA 4DCTA 5EYPB 1FFEA 4DLAA 5A5EA 1PL8A 1CV2A 2NXJA 4YRJA 1E5XA 3AJ8A 3UC5A 1KO7A 4KIJA 2PVPA 1N6PA 4PSDA 1ZO8A 1E6KA 1Z2OX 2H2HA 4NOMA 2QR2A 4FDAA 4JMPA 4EARA 1SKQA 2OAP1 1C0PA 3GAZA 5JSUA 3QFCA 4OYLA 2XWQA 1DC5A 2XUKA 3AP2A 3PWZA 1H23A 2C5AA 3FKSA 1MJFA 4WGFA 3QW2A 1SZPA 1DU4A 4TZKA 4PYKA 1O6CA 2Z08A 1WHSB 2JIQA 2OAQ1 4L73A 4RZ3A 1FFXB 3ICVA 1H05A 5IT9A 2PKCA 1PR3A 2I4IA 2PKQP 3Q3VA 1NUPA 4HI0E 5LBIA 4B8WA 4FOSA 3TLBA 3HDTA 1ORTA 2AD1A 2ID4A 3PXEA 3W5SA 2PX0A 4JU8A 3UOWA 2O5CA 3O84A 3JQDA 3TTUA 4F21A 3W5UA 4Y1GA 1N7IA 1QE3A 2B4TO 3A70A 3B3GA 3MT8A 3S5UA 1GNSA 4NEGA 1BH6A 1ONOA 4O4HA 3RVJA 3PDHA 1PL0A 4M9CA 2QT1A 4IHJB 1JIQA 1LJLA 1NUHA 4OKIA 4TS3A 3VC3A 3PNVA 4DM3A 1A7JA 3ZTTA 4ND3A 4G0VA 3ZGLA 1J39A 1SZDA 1MNQA 1DI0A 1MZVA 2CL5A 3BMCB 4DIDA 2WM3A 4FT2A 5SY4A 2HIMA 2QVZX 1Z8FA 1FLVA 1QOPB 3AR4A 1JGTA 4RORA 5EZYB 5B58C 2GN9A 2W71A 5FQNA 2HFJA 5CLIA 3FBWA 5MN6A 5H70A 2EBFX 1SXJC 2C2OA 2ODPA 3QWFA 4TLAA 4WUVA 3HSKA 1C0EA 1YFKA 3BD9A 1NSYA 3ZEAA 5K8LA 3P71T 2VDLB 1TGYA 3Q3GE 3GBPA 3QWBA 2ZJZA 4EB6A 5J59A 5AYVA 4ERNA 3IOYA 4HN4B 5AVYA 3ZHXA 3D6TB 1GDDA 2ACWA 3MT9A 2FUCA 4R8KA 3L4SO 4BVFA 4KNWA 2JAOA 2ZEJA 5BPHA 1KJ9A 2EKDA 1I6WA 2Z9DA 4WVLA 4XWKA 2ZRFA 4C0HA 5D5QA 3SM9A 3A2KA 1LBIA 3IT3A 4QPDA 1IQUA 5EZYF 4RXMA 2Y6UA 1LW6E 3K6RA 4JNKA 1JLMA 4RSRA 3QUTA 3RM3A 3ZYCA 2NNLD 3JQ8A 3NLLA 1RWMA 1PX0A 1LF5A 3GGGA 3PXDA 1BROA 3E3LA 1VGQA 1WXXA 3UJ8A 3EEYA 1FMCA 2FLWA 2ZIZA 2QA5A 2YVUA 4B6PA 5CNIA 4E1BA 4EHHA 2B94A 3E4CA 1QK4A 3NBQA 4JA2A 1FLNA 1QH1B 4AKEA 3KJZA 2A1IA 1VFNA 1J1IA 3K5WA 7REQB 3SAJA 1V5IA 4DIMA 1G59A 2Z6UA 3F5DA 1E92A 1QYIA 2JJQA 4QG7A 2GRUA 4TT3D 1E2LA 1PNOA 1UFVA 1Z5UA 3EZ7A 4LCJA 4L3VA 4WESA 1GRCA 5EJ7A 5A4FS 4KGDA 4CNQA 2CW5A 2RAVA 1S2IA 3T5DA 3K0BA 3ZGVA 4KTTE 2GRAA 4S3MA 4ZQCB 4YLYA 4H0FA 3A6LA 3GRVA 2P2SA 3QYFA 4LZPA 5J4HA 3LU1A 3TSOA 2YY6A 2YWBA 4JT4A 3U4DA 1W4LA 1TCAA 4X3OA 3U4HA 2XBUA 1QGUA 5KVAA 4KQCA 1D1SA 1KI6B 1FOEB 3GI1A 2XE8A 2YN2A 4BFZA 2BZ1A 4X1KA 4PR3A 4B2IA 1WM1A 5DM4A 1R16A 4IINA 5JS6A 1UK7A 3P20A 2D7JA 1P17A 4E5YA 1SUBA 1N6LA 4NDNE 2XRYA 3IUPA 1A9SA 3W7BA 3WKEA 4A3SA 3G2OA 4DUYB 3Q10A 1JP7A 3BH0A 1SBNE 2HY7A 2ZJBA 1KEUA 3OO1A 4KFRA 1KJIA 2A2ZA 2GS9A 3UAYA 621PA 3L0ZA 2H5EA 2QZ9A 1UFKA 2EBWA 3OAAA 2WE8A 4WCVA 2PXCA 5EZ5A 4EMSA 3W4JA 3X2SA 1AVTA 1JDBB 4BNVA 1WS6A 3PRJA 2DTEA 3OA2A 2ZM6B 2XJ9A 3HFJA 3G8BA 2C7RA 3IJEB 5FOSA 1LQ2A 5LP6C 1UC5B 1JA0A 2BI4A 1NVDA 4IGKA 4CN9A 3CH4B 3P4XA 3CE9A 4DA0A 1VSVA 1ECFA 4FOLA 3M3HA 3OZRA 4ALJA 3RT9A 4HYEA 1PI3A 1TZCA 4TV8A 1S96A 3ZXIA 3D7NA 1MLDA 1PEAA 2XMDA 3PFCA 4BZZA 4B45A 3LFTA 4RVDA 5DBHX 1AMOA 3A3NA 1L4EA 1W30A 2YZMA 3OZVA 5KX5B 1TIPA 5JH7A 2AQ8A 3KUCA 3JAKB 2N1BA 4D2IA 4A8JC 4JZKA 2GCOA 3B70A 3M2TA 3OKFA 2IYWA 5ITZA 1IY9A 4UTNA 4EVIA 1U2TA 1ZUNA 3F9IA 3IP6A 4ZYXA 4Q82A 4LIPD 2Q9AA 4MUIA 3DTVB 2JRLA 2PLRA 2WNIA 5ALEA 3TQTA 5JI2E 1FNDA 2OXEA 3HXKA 2GHTA 4XDZA 2LR0A 4IUYA 3CZPA 4ZK6A 5JD4A 2V6IA 1P2VA 1E77A 1QONA 1TEXA 5EXSA 5F78A 2VHXA 4DMRA 1UBHS 1UEJA 4E51A 4Y6PA 5JHHB 3EGDB 2ZIEA 4I3FA 4AS1A 1M2KA 1PGJA 3KK0A 1DP4A 4LZWA 3V7YA 3ZU4A 5KX5F 2JAHA 3LCCA 1WE2A 2RHDA 3ROKA 1FSPA 3E6AA 4EYSA 5ADVA 1GFIA 3EGWA 2GTIA 4KHZA 4M98A 5JLAA 5F9HA 4Y9TA 3ZZ1A 2V6BA 4NAUA 1UBEA 1L5LA 4QRHA 4Y7CA 2L69A 4A2CA 4N47A 4ZMBA 2B6HA 1E3EA 3OP4A 3U19A 4ZVLA 4GZ6A 3C1UA 1U2ZA 4Y2PA 3V7UA 1E8MA 4C4PA 3EDRA 2JKYA 1H2YA 4HWPA 2B25A 4FGZA 3FXAA 2G1PA 4PV7A 3ADBA 5EHGA 4OLAA 4C1NA 4KODA 1C80A 4LXHA 3K9BA 3DOUA 1Y9AA 2VYQA 4LJSA 1VE6A 3UGJA 5KOYA 3IBFA 3HKDA 1Z0FA 4WY5A 2YCBA 4ZIRB 3ORSA 5KTOA 3PF9A 3QFFA 1UL1X 4IFBA 5LJIA 2E6KA 1P7WA 1PRYA 1OBOA 3QX9A 3RABA 3P0EA 3ITKA 1ZICA 3GT0A 3ZS9A 1TYBE 1TYCA 4QUGA 2FQ1A 3CUSA 5T3UA 5LNK6 3HYSA 5K2MA 4K1XA 1YRWA 2WP0A 3A6DA 3SQMA 1UUFA 3A7EA 4RGQA 1Z0AA 5ALOA 3TW0A 5A3RA 5KNDD 5SZIA 3OBBA 5FLYA 3L46A 1YZ3A 4J0GA 2H92A 3BFKA 3OD5A 3PC7A 1LEHA 4J03A 1LVHA 3RUCA 3VR2A 3VV3A 4F9GA 5CEJA 1KP3A 1UT6A 3FIUA 3PFFA 1FCJA 3WR5A 1YE5A 4HAIA 4JLSA 4X3CA 1JQ5A 1GYPA 3IV6A 3QHQA 4GXTA 5JCJA 2RHTA 3T9CA 4BECA 5LQKA 5FNZA 3V80A 3DCIA 3HO1A 3DR5A 1OREA 5E7JA 1VG8A 4A8HA 2HA3A 4ZAZA 2DT8A 3GQBB 2J67A 3DBHA 2Q5HA 3P2KA 3L84A 3GV0A 4R1SA 2H3HA 3I76A 3IAS6 3NEAA 1I9CA 3RE1A 4RPHA 4E09A 1I2MA 1OVMA 3C6MA 1ZXBA 3DXZA 4L4SA 3TRIA 2OO5A 5IWCA 5GP1A 5C34B 5JCOA 3TPCA 5KDOA 4HLUC 1JHMA 1MABA 1WW2A 1SCNE 4RZUA 4YMLA 3OQHA 3IUNA 2R8OA 1K4YA 1NSFA 4IO0A 1D3AA 1HX7A 2XNSA 3AKEA 1YVPA 2R1VB 5JJIA 2ZRAA 5FUVA 5HA5A 3FBTA 3FCXA 5TMDA 2JFGA 1DBVO 1V8DA 3WMXA 2QRQA 4DDUA 2Z6AA 1G8YA 1T9BA 1EP3B 4ZU6X 5HPYB 5F33A 3EPJA 4KXYA 2YOGA 3KPJA 4GI7A 1AT1A 2F2TA 3RU7A 5CM2Z 3SBEA 1QB7A 1KO4A 5J9FA 4J94A 1LK7A 4DIBA 1BIFA 1I4EB 1FJ2A 2AJDA 4F06A 2B7LA 2XADA 4MK4A 1CX9B 4AZ0A 2PX2A 4L7VA 1Y8QB 4AVYA 4BFCA 1R5OA 4EY3A 3C14C 1EB9A 1KI9A 3FSGA 4KIWA 2P68A 2BMWA 4OSPA 2DUWA 3RSOA 2X1MA 3RVKA 3SK0A 4ZTUB 4BNTA 1JEQA 1IPEA 1GHTA 2AXQA 5JYEA 1OH5A 4L85A 3A0RB 1E9AA 4TL7A 1YRYE 1K7CA 4HEQA 2I4OA 1UQUA 2RGGA 4UDOA 4PBRA 4ESOA 4LFBB 3D2BA 2RK3A 3ZY2A 1PFVA 4F5DA 4ZCTA 4YCNA 5AK4A 1IG3A 1A9OA 2YXDA 3U3OA 3A6JA 2AEMA 4DG5A 3T8YA 2LXNA 4MB0A 2VTVA 1U5BA 2IE8A 4TRMA 4AQDA 2VPXA 5FUMA 1PE0A 1P7CA 4UE2A 5D86A 1J5PA 1XEXA 2QX8A 2HXYA 3K8QA 4PO8A 5B64A 2Z30A 1XFDA 5G0WA 1ZJ4A 3HKCB 4LSGA 3TB6A 5FBZA 3ZLBA 2FSVA 4DLBA 3INNA 4MV5A 4CKWB 2WHXA 1U8TA 1TC1A 1RKVA 4BTEA 3BDVA 2IIQA 2VP6A 3FUVA 3ZVRA 4DLLA 2V6GA 2HSGA 2FWPA 1G5IA 3C1AA 5FLXA 3SHOA 3KQYA 1T5BA 3OUTA 5KNCD 2Z4SA 5EKTA 3AFMA 2ILVA 1RWBA 2C59A 3HKEB 4FYVA 1KK1A 1DL5A 2KE5A 4RJ2A 4P7KA 1EE9A 2PR7A 2FUKA 3GGDA 1HNNA 4BNMA 3KWLA 1PSWA 3B3FA 1XZIA 3HL4A 1TFUA 2FPPA 2XCLA 3CWZA 3N53A 3VPXA 1M2VB 4GT1A 1UFOA 1Q3KA 3B5EA 4MQMA 4W6QA 1CY8A 2V6JA 2VH2A 4EMTA 1TPZA 4K9DA 3KB6A 3URMA 1CNFA 5CFQA 1KP9A 5E9QA 1KA9H 2DM6A 3DMTA 1EHIA 3DYIA 3U31A 3ZU6A 2VBCA 2X19A 2OXFA 3GAFA 4TMKA 5AJVB 1U99A 5FULA 4PG5A 2VQ6A 4OBBA 1PS9A 1ADYA 4GF5A 1PS0A 1GUAA 1U8CB 1H2WA 3LBFA 3OFNA 4L76A 1NBIA 2DPLA 4IXWA 4ABTA 4YJ2B 4P0PB 1JFRA 2JLBA 1QHXA 3ICCA 4AMBA 1YU9A 4I4LA 1YUMA 4LVUA 2VR1A 4QU5A 3T5MA 1WP4A 3DV0A 2CSXA 5D01A 4LOKA 2ZR7A 4Q05A 3GFOA 2JD2A 3H42B 1CDZA 1RRVA 4NU6A 4PQYA 3DEIA 4QULA 3OMXA 4RLQA 4AXXA 1LD3A 3KLMX 4NS1A 1Y98A 1Q7EA 1MP0A 1UIRA 3MOSA 3WWEA 1KSJA 2NV2B 4UD2A 5LU8A 3I9LA 2WILA 2ZRIA 3SIWA 2F9FA 2YCLA 1HOXA 1C9DB 4J0HA 5A4JA 1LLDA 2B4RO 2VK4A 4QOFA 1W94A 1X1EA 3GPCA 1VYHA 4KGVA 1ZD4A 1G9TA 4PAGA 4YACA 5JJ5A 3I04M 1KE2A 2H16A 1AGNA 1I32A 3QQ5A 2ONZA 3KAPA 4YJ2F 3TI7A 2CNWD 2AZTA 2RG7A 5EIFA 5JSQA 5F5NA 1G8JA 1SCBA 2DULA 3BFJA 4ITUA 2VRCA 3PYLA 4I55B 1LPSA 4YFVA 4OI4A 4V2IA 4HNSA 5KQMA 3I30X 4FI3F 4JP8A 3GLTA 1CRQA 2VPPA 4GLFA 4JT8A 4CL3A 3ZHQA 1CPYA 5AXDA 4N0PA 2D5IA 1G4UR 3I1YA 2F9LA 1AZLA 2VRBA 1KHHA 3CRZA 3TE6A 1W0KD 4RAOA 1X7HA 1PEYA 2JKVA 3LWDA 4Q3OA 4K0KB 3LY5A 4FPXA 3DZCA 1BD3A 3LSTA 2A9QA 3AUFA 2ET6A 1J70A 1NLFA 1NRJB 2Z1NA 2HMAA 2GZRA 3ZK8A 4GYWA 5AVXA 1SKYE 4FB5A 2JFZA 5KQSA 2QRGA 4MROA 3VPCA 1IN5A 1P1CA 1NY5A 4AY4A 4Q4AB 1QKKA 4BL5A 2ADOA 4QTUB 5B5SA 3DZDA 2YMMA 4UD6A 4DEXA 3ETNA 2YN0A 1VDMA 2N9UA 4MKFA 4CG0A 1ZMRA 3N2LA 3OSZA