4R81A

Nad(p)h:quinone oxidoreductase from methanothermobacter marburgensis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
199
Chain Sequence
ASMHVYILFAHPSRKSFSREVLEAFTEGLSEAGHTYEVGDLYRMNFRSELSQEEYLREISQEAGSPLPEDVMEEHERIGRADALAFIYPLWWSDCPAKLKGWFDRVWTYGYAYFGTRIDIEKAVVLCSAGHTEEDLEGTGIAESMRSVMLGDRLLGVGVKNVTMEILGGMVPGDDSCREINLMRARRAGRNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH dehydrogenase
publication title A novel cytosolic NADH:quinone oxidoreductase from Methanothermobacter marburgensis.
pubmed doi rcsb
source organism Methanothermobacter marburgensis
molecule tags Oxidoreductase
total genus 75
structure length 199
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r81A00
6NULA 3GAMA 3N39C 3QFRA 1FLDA 5TGZA 1AKWA 3FX2A 1KBOA 1RLIA 1XYYA 3GFQA 4ICIA 3KAQA 2Z98A 4YAFA 4NLLA 4N65A 1J8QA 1D04A 5LJLA 4FGKA 1CZHA 1V4BA 1XT6A 1CZLA 4FGJA 3OX1A 3FNIA 2BPOA 4C14A 3NHSA 2QWXA 1I1OA 1OFVA 3OJWA 5F12A 2OYSA 5JROA 4QOHA 1FUEA 2B3DA 4H2DA 3NHRA 4R81A 1C7EA 2Z9BA 1SG0A 4GQIA 3B6KA 4ZVMA 1GG5A 1TIKA 3B6MA 3O2NA 3B6JA 2X2OA 1CZUA 4J8PA 1J9GA 1YCGA 4S24A 2D5IA 4FGLA 2OHHA 2GSWA 3ES9A 3L9XA 3FW1A 1FTGA 5FUQA 2QMZA 2FZVA 2FOXA 1TLLA 4CF6A 3OWHA 1AMOA 1KBQA 1DX9A 2N1MA 1WSWA 3OVMA 2ZKIA 3ESXA 4QOJA 1VMEA 5EAIA 2WC1A 1NNI1 4CETA 3W7AA 4FX2A 2A5LA 3FJOA 4D02A 4Y9RA 4N82A 4Y7CA 1ZX1A 1QHEA 3S2YA 4DILA 4ZVKA 2R97A 1AKRA 2FCRA 3OX3A 2MOKA 4BMOB 5LBTA 1RCFA 4U7HA 3JSXA 1XI2A 3GFRA 3TE7A 4F8YA 2QX6A 3GFSA 3D7NA 2X2PA 3O73A 1AZLA 1JA0A 1YDGA 3NHYA 3LCMA 4U7GA 4XDHA 2FZ5A 2RG1A 1YOBA 1FVXA 2KLBA 1QBGA 2XODA 4GI5A 1CZNA 2KQUA 3F6SA 3HR4A 3NHJA 1T5BA 3N3AC 3OJXA 3K20A 1B1CA 4N9QA 3W78A 3R6WA 4GR9A 3QFCA 5FA6A 2W5UA 2R96A 2OHIA 4DIKA 3G5MA 4ESEA 2AMJA 4C0XA 1SQSA 1FLVA 5F51A 1J9EA 3L9WA 1OBOA 3B6IA 2V5VA 1CZKA 1FX1A 2V9CA 4H6PA 3RPEA 3HLYA 1CZRA 3UXEA 3OX2A 3NHPA 1YRHA 1QRDA 3OWXA 2V5UA 1CZOA 4PTYA 1D4AA 1RTTA 2QR2A 4U7FA 3TZBA 1DXOA 3NHFA 3QE2A 1QR2A 1OBVA 2XOEA 3ESZA 2HNAA 4HS4A 4YALA 4LA4A 1BU5A 4BMPB 2M6RA 1WSBA 2ARKA 4LTDA 1J9ZA 3NLLA 4Y9UA 1T0IA 3HA2A 1JA1A 5LVAA 2Z9DA 4PTZA 1C7FA 2BZSA 2FVXA 5NLLA 2F1OA 4QODA 4C0WA 2QX9A 3W77A 2Q9UA 1E5DA 1FLAA 2BN4A 5ULLA 2M6SA 2QX8A 3F6RA 2FDXA 3NFRA 1H66A 3P0RA 5LJIA 3NHUA 3SVLA 1DXQA 4HEQA 3U7IA 1AKVA 2FLVA 5LBUA 3ZHOA 3NHKA 5LMCA 3FVWA 1YKGA 3LT5A 2BMVA 4OXXA 1AKTA 5EMNA 4YAWA 4NULA 2QX4A 5LLDA 4YQEA 1BVYF 5EA2A 1H69A 3TEMA 5F4BA 1AG9A 2FX2A 3W79A 4M0CA 5A4KA 2MT9A 4C76A 2MTBA 3F90A 1F4PA 3EDOA 3N3BC 3ESYA 4YAUA 1X77A 2HPVA 2Z9CA 4QOFA 4PU0A 4QOIA 1AHNA 1FLNA 3F2VA 4QOGA 1D03A 1ZWKA 3NHLA 2OHJA 3UXHA 3KEGA 2HNBA 2FAXA 3KAPA 1AKUA 5NULA 2MWMA 2Q62A 5B3LA 1YCHA 1RLJA 5B3KA 5BUCA 4DY4A 4ZVNA 1YCFA 1AKQA 4QOEA 4ZVLA 4LTNA 1XYVA 3KLBA 4YAOA 3NHWA 3K1YA 2QMYA 5FX2A 3EYWA 2BF4A 4XDGA 3U7RA 1ZWLA 4LAFA 4LTMA
chains in the Genus database with same CATH superfamily
1CRZA 2B6HA 3HBFA 4DPMA 3TZQA 2VNIA 3VYSB 5L8VA 5JZOA 3GAMA 1T8TA 5AVQA 4DLLA 2L19A 1SCAA 5TJHA 1T6XA 2PFSA 2QYSA 3VNBA 3OA2A 2FJ0A 1ZZGA 1T4CB 5HOEA 3VQTA 2HGSA 4AG6A 5HZHA 2HEGA 3SWWA 4O63O 1Z68A 2A9PA 3EAGA 4ZO7A 5F7JA 4BU0A 3LPCA 2WG0A 5TDHA 3H4IA 2VWHA 3O93A 2CXNA 1B3RA 4NE9A 3W9YA 2O5CA 4FZVA 2YZKA 3T0GA 3EXIA 4LGMA 1J8DA 1DKLA 6REQB 1WX1A 1L5OA 4HNHA 5FOTA 4OYRA 5G0VA 5I9SA 5EIBC 1U0TA 4NENA 2EG9A 1ISIA 2QRPA 2ZGVA 5FOSA 4AZ3B 3AL2A 1GPUA 4RZIA 3BA6A 1GG2A 4TMVA 3O4VA 2X6TA 2YVLA 3L6BA 3A8TA 3PJGA 4KXWA 4M8LA 4RELA 1TYZA 2POCA 2BHRA 5BR8B 2V3VA 2XZLA 4LOKA 2EZ8A 2C88A 2HA6A 2WU1A 3DFIA 4C3ZA 1J8FA 3S7TA 5E4FA 1RJ9B 2H0QA 4WINA 1V8BA 1A5ZA 1NRIA 4O2AA 4JT4A 5D5PA 1DFGA 3H6HA 3MTQA 4C14A 3AHCA 1TK2A 4ZXPA 3RR2A 3UICA 4BV2A 1VFPA 5KWSA 1FZQA 1AC5A 1VI2A 2ONZA 1ZIPA 2GM9A 1KYXA 1J2YA 1LI5A 1DWPA 1P60A 1W93A 3NBAA 2IV3A 4CL0A 1ZGGA 5I7SA 4AMBA 4J3FA 1BXKA 2PKCA 1WHSB 4QHYA 3S5UA 2FUNB 1QQTA 4JI1B 3E2IA 4LE1A 1RPTA 1A88A 2DBZA 2ZBFA 5JBIA 4B33A 1KJZA 1WLSA 2VTDA 3FR7A 2IUTA 3C5CA 4ON9A 3HKBB 4Q9AA 4DLSA 3OZBA 4PLYA 5GGYA 1IL0A 1YACA 3OZAA 2Z9BA 1HOXA 1WUKS 2RH8A 4IIGA 2FG6C 3FVVA 4TRMA 1JI3A 1FUUA 4XSGA 2EVWX 4JGGA 4KO1S 1H93A 1P2FA 4QGHA 4RQTA 4YP6A 3QVGA 4D9CA 5H80A 3IAHA 4ENQA 3B6KA 3I6MA 4ZVMA 2CB0A 2ADMA 1C2TA 4IGIA 4NATA 3BMXA 3ICCA 1YRYE 1PJ4A 1H1DA 1M1ZA 4PSUA 3LUFA 5FT9A 5IYZA 2H2IA 4F6RA 4U3JB 5I7FA 4JDUA 4P6VF 4LZOA 3FA2A 5FPHA 3OFKA 4NI5A 1C0PA 3WG9A 4JIGA 1J07A 1OR8A 3LY9A 4BPRA 4E33A 1B8VA 2P7IA 4OGWA 3ZE9A 1FRQA 3GQBB 3A1VA 4M8KA 4RDCA 4Z9XA 3S3TA 3SDBA 3R8FA 2P1RA 3A4TA 3D4NA 3ZHBA 4G5YA 4AIRA 1F2TB 1YCGA 3FHCB 4S24A 2I4LA 4E12A 4J29A 1UEXC 3WIUA 5KHOC 4P9NA 4MRPA 5FPPA 5B1IA 1L3IA 4YRGA 4L6CA 2IIVA 3W05A 2HA0A 3BCRA 2HB6A 3PR3A 1X7ZA 1GGEA 2PMWB 4FYMA 1ZVJA 4KRXA 4RTSA 4WK0B 2XGMA 1Q7RA 4HZUA 4NCHA 2C59A 3ROPA 3TI7A 3U1TA 5FWNA 3OQIA 3ZKWA 2Q3BA 3BWBA 1KFBB 4DQVA 1W25A 4LEIA 3GFFA 4ZT6A 4X3OA 1BCSA 4OH1A 5DTMA 4R8KA 2Q6OA 4G09A 2OCIA 4M6WB 4O25A 5E38A 3WO1A 4CF6A 4CVNA 4M46A 1UC4B 1URPA 1NN1A 1V6CA 4UUBA 2QD1A 5E7QA 4C4ZA 4ZTUB 3ZHYA 1KRHA 4TKLA 1BZYA 1DEOA 3NXSA 2JC3A 1PKEA 3FNQA 5D3MA 3SK0A 5D5QA 4HDOB 3LFTA 1Q7EA 1WU8A 3VSAA 1YZUA 2HQ1A 2WSSA 2ZWMA 3MT7A 4HDRB 1E59A 4P36A 1MF7A 4CBVA 5H9WA 5HWSA 4B47A 1ECFA 2IHZA 2G17A 3O3NB 1ZU5A 4AUNA 2Y76A 4R3WA 3BDVA 5DNCA 5GY7A 3TLBA 1Z5NA 3HVRA 1OQAA 9MHTA 4MV9A 3TX2A 3KSUA 5C2JB 3C3AA 3L6CA 1UJMA 4GM1A 4QTYA 4DIEA 4OAQA 3QV2A 1JMVA 3BHJA 3LC0A 2HLPA 3UAYA 3FOWA 1XPJA 3ETGA 3HWWA 3W6ZA 4BN5A 3PL1A 1K6IA 3KP1A 1M8JA 3A7EA 1N9GB 4NDNE 4E4YA 4AJIA 3A4NA 2REXB 1TE2A 3F5QA 1CR6A 2XMCA 3CLUC 2C5BA 3ZC3A 4ZQCB 3RASA 2ONCA 3UN1A 4F2WA 4YCSA 4HYTA 1X1RA 2OORA 3TL3A 4HWTA 1X92A 2HFKA 3FHOA 1GZ4A 4KQ9A 4B71A 1SEVA 3EARA 3SHQA 3ILXA 1OH6A 1DJOA 1Y8QB 4MDHA 4HGPA 4U5QA 4HB0A 2QX6A 3GFSA 3HCNA 5LNK1 3LT4A 4W7IA 2H1FA 1U8CB 1RSZA 2RG7A 2EQBA 4YT8A 1JALA 2JGRA 4C01A 4R2LA 4DA9A 4U7GA 1ZL0A 3X1MA 1T9DA 1Z0SA 4H7KA 3N0RA 4LK3A 3UNXA 2WEKA 5CDHA 5KTNA 1V6SA 2KLBA 3M5DA 2I6TA 3BJMA 1D4FA 5CA0F 1IVYA 5T67A 3BD7A 5GINE 4KHPB 4L07A 1OX5A 3QVWA 1UP6A 5SY4A 3VX3A 4D0NA 3ZDZB 5BMOA 2V1UA 4QO7A 2H1OA 4YIHA 1H1LA 2XYHA 4EEZA 1OIXA 2B5VA 3GMTA 1H3NA 3B5IA 4H17A 4US0R 4UEWA 4YIKA 3FDIA 1TW3A 4WTOA 5JCOA 3UA4A 1WXFA 3DDWA 4J6EA 4C7OB 1P5RA 2PSJA 2DWOA 1MO6A 1JE0A 1VE3A 4CIBA 5HNKA 1CC1S 4NYIR 3I12A 1M2OA 3WBJA 1JPJA 2GX6A 5KNLA 5LMUB 2OGUA 3B12A 3PXAA 1KAMA 3OTGA 3TX6A 5FUWA 1C3JA 1ECGA 4QUJA 1DC6A 2ECFA 1VGVA 4QQRA 2E6KA 4MQEB 1YONA 4Q01A 5JZSA 2QMUA 4TTJA 4R40A 4QDTA 4UBLA 2XKAA 5CBKA 1TAQA 1UIRA 4HY3A 2WIBA 4E03A 3AC0A 5TRTA 3QYFA 1ADGA 3CWCA 3M3DA 1MT0A 1D5CA 1SQSA 5DBEX 3TW4A 2PYIA 1MGOA 3ZV4A 3LA6A 3PE6A 4NARA 3VYRB 1PJLA 2G07A 3VR3A 3FDFA 3MCZA 3SYRA 1GQRA 2C2XA 3Q41A 2O8EB 1QOQB 3AXSA 1M76A 3T52A 3GI1A 2O2CA 2Z6VA 3I53A 3P9ZA 4YV7A 5LOVB 1ARZA 1OH8A 3STXA 721PA 3PFKA 1OBOA 1BHSA 3L7KA 3M3PA 1LD3A 4K9OA 3U3OA 3CGGA 5FEUA 4PO9A 4X71A 5AVSA 1RXWA 2A5YB 3ZE6A 5EP3A 1UC5B 2WF5A 3U5ZB 1M7GA 1R9GA 3Q7SA 1MU0A 3UXEA 5BSGA 1AD2A 2PH5A 3KQKA 5AMXA 1B8PA 1UODA 1W4LA 3IUEA 5E9JA 3MERA 3OO1A 2CJPA 1ISJA 1NG1A 2B34A 5AKHA 4GFDA 3GRVA 2M1ZA 4L85A 1ZP6A 1FUKA 3JQQA 1UDWA 4GUAA 4AQ7A 5C37A 2X8JB 4P92A 2ZSIA 4K26A 4J7UA 1PJZA 1C7IA 2R5NA 1DKOA 1OW3B 3DLIA 3FCUB 2VNAA 2QD5A 3NUGA 2QZPA 3LFHA 4D3FA 2QR2A 2VR1A 3QYJA 3PGXA 2FEWB 2OPBA 4RTPA 1QTQA 2CXTA 4EY3A 4J1TC 3ZD8A 4BJ3A 3U1BA 3HKCA 1WW2A 1K6EA 1ZSVA 4Q1FA 5IZ4A 1UJCA 3V34A 2O4UX 5IM4A 4YTEA 4L08A 4A9AA 2O50A 1U2SA 4CM6A 1Q0SA 4Z53A 3IT2A 2AN1A 3FB1A 2WABA 1IZ0A 2IIBA 1P0MA 3I23A 3ILHA 4BX0A 2XQJA 1R9JA 4L75A 3SYNA 3L41A 3HUEA 5B3JC 3PQ8A 3TKAA 2KJQA 1E2LA 3A4IA 4GXRA 2IOFA 1J09A 5A2GA 3OPNA 3R3JA 1OZFA 5HVNA 1Z0DA 2OECA 4PGGA 3K30A 5CM8B 2H57A 4HMPA 4EAAA 1KEEA 2DHEA 2I29A 1C7FA 5F23A 4LMAA 2PL5A 5BXYA 2OXFA 3UENA 4ER6A 3ZCXA 3E22A 1H42A 4LF4B 2NYRA 3X1JA 4MRAA 3U48A 1KMNA 2C9DA 4HZIA 3ZWMA 4WWHA 3KV1A 1XF1A 3NS7A 3AJRA 4KI0A 3TW0A 2L17A 1NSTA 2PXAA 1OBCA 2LXNA 3WKAA 5BN5B 3HRIA 4MW6A 2MDTA 4FP9A 2G7ZA 4MVYA 2XYQA 3B1JA 2RI1A 3CF4A 4YP7A 1IXRC 3HU2A 3ABRB 3LVBA 2DBQA 3OIFA 1QOZA 4TL8A 2CNNA 4JVLA 4ZALA 5KOYA 1WL8A 2ABWA 2WPDD 5DM2A 2AVNA 2JANA 2RI6A 4NBSA 3G8AA 3GJ5A 4OMUA 4Y2HA 3MRSA 1ZUWA 1J1ZA 3N6VA 2VT7A 4U7JA 4MRVA 2I80A 5BNWA 1NY6A 1XCBA 1OREA 3SFVA 3HBMA 1QHIA 4ENRA 5KYXA 1E2UA 2JEYA 1OTXA 1PFYA 4N40A 2GPAA 4BFZA 1YRQA 3B53X 1TLTA 2EJWA 3FGOA 3HPQA 3SX2A 2R11A 3CEAA 1FDRA 1ZC3A 3T38A 1NI4B 3ET4A 2QUJA 1U2RA 2R8BA 2QZ4A 3N8IA 4A6XA 2QQEA 5FWXA 1Z45A 5HF6A 4LJSA 2IHKA 2SKEA 3HK2A 1YVRA 3KXDA 2CMFA 2EFGA 4QREA 5DTIA 3RIHA 4PBTA 4OGKA 5IRCD 3SLGA 1IBKB 4UDXX 4QGGA 3FR8A 1H0SA 1O5IA 1RLUA 4ARZB 4BQIA 4EMTA 1U63A 3FTNA 4EUHA 1AM4D 4BEWA 3N2LA 5EHNA 4YGYA 4ZI3A 1U5AA 4CXMA 3RSZA 4AZSA 4UNSA 1WXDA 2W6JD 4RLHA 1NNUA 2C95A 4WK2B 3QVXA 3S1LA 4A10A 1QCCA 3DOHA 4FD3A 3LZ6A 3VHXA 1G1MA 4GP6A 1JQ5A 1PN3A 3UQZA 2QW8A 1O77A 2E3JA 4G9GA 4MVJF 3V7FA 1NRJB 1KU0A 3OSZA 3RIXA 3TEMA 3PEUA 2Q5CA 4NSNA 1DDGA 1L5SA 1LI4A 3TQFA 4EI2A 4PNHA 1EA5A 2R87A 3HO1A 3P9RA 1CEXA 5C32A 4ZQGA 2JARA 2ZVPX 1JJBA 2J3JA 2ZATA 3EFHA 3IPXA 4P4GA 1Q0UA 2Z5FA 4GRDA 1G7SA 2J6HA 2H1CA 4DLRA 2CEAA 5KYUA 1L5GB 3O1IC 5AXCA 1KZHA 1DAGA 4LVNA 2D4AA 4EF6A 5FBLB 4H3HB 3RLIA 1IOLA 2OQRA 3C14C 1Y7TA 4MA0A 4TV8B 3I30X 3I9MA 4V0MA 3TQCA 1QV6A 4EA7A 3ND6A 3OTOB 2NSJA 2QLTA 4LF8B 5D3QA 2DT5A 3G3EA 5KTRA 1SGWA 1CCWA 4RTNA 2Z3WA 2PJUA 1KJNA 3NWBA 4RTOA 2PKYX 2RKWA 3WLRA 3GFTA 1GZHB 1SRRA 4ZV7A 5C1DA 3SZLA 3WFIA 2YHIA 1WMDA 4S3MA 5EJ4A 3FDZB 4RCZA 4KQJA 3QBTA 2WAXA 4L0CA 3O9MA 1H2RS 3EDQA 1GM5A 4ABTA 3WLAA 2J31A 1Y7HA 3GZNB 4X3CA 2P1DA 1I0LA 4X44A 1XQYA 1NW7A 1O6BA 2XDYA 3HCOA 4XDYA 5A0FA 3HCDA 4D4MA 2A3RA 2X5NA 3DD5A 1PKXA 1QCYA 1G7CA 3ZK7A 4B0OA 4MCJA 1YCHA 5D85A 3NEAA 5FBKA 4AM8A 4UAUA 1KJWA 5B3KA 2QTZA 3EZ2A 3WIEA 5FOQA 3O8LA 2I8AA 2IX9A 2WD7A 1R0ZA 3SC4A 3O8RA 2NT3A 2O8VA 2PZJA 4B48A 1XALA 2M98A 4QOEA 1U31A 3BORA 5CG2A 1UT8A 4DVGA 3ZU6A 4RPGA 3AETB 5I7UA 3N1UA 4MHOA 3GRZA 4H7IA 3P26A 2UUBB 2C4WA 5K0SA 1Z0ZA 3ER9A 621PA 2B1GA 4EGCB 4WD3A 3RJTA 3A05A 4ZVQA 5TEWA 2PYZA 1CS4C 3QPDA 3CB4A 4ZZ0A 1FP1D 4D6PA 3AVWA 1EXDA 4GOKA 3V80A 1IG3A 3UHAA 3DKRA 3RAGA 2OFXA 3OU7A 1DC5A 3MG9A 2QTVB 1GEEA 1H9BA 5BMVA 2ORWA 2QHXA 4WXEA 3T1HB 2PUJA 2F8SA 2P35A 4LTMA 1P1RA 5DZSA 2OG2A 3WWEA 4UTRA 1QH9A 4KPUA 3REQB 2RH5A 3QU5A 2HJSA 4ERNA 1FUIA 4Q4LA 1MB0A 4DHWA 3GPBA 1Y8RA 4KG7A 1PV2A 3GXOA 2QM8A 3HY6A 2OXTA 1R7RA 2Z08A 3PCXA 3ZHSA 1C3OB 2XD9A 3NOVA 4U6QA 3ZU3A 3QFRA 1A5BB 4EMBA 3UJCA 4BNZA 1VFNA 1QVWA 1BO6A 1EM8B 1NYLA 1PUJA 2EL9A 3L8ZA 3IVXA 4HMQA 1RM5A 2PH3A 2CHQA 5JAIA 4IJWA 4P3PA 1L5HA 5H68A 4PO8A 4LJLA 3W5BA 4ER0A 1Q7TA 4JI5B 4DY6A 4AMVA 2ID4A 4Q47A 4LF6B 1L3CA 1OXBB 2NNLD 1YE3A 4BV9A 3O5AA 1SVSA 3U0VA 1CT9A 4F5YA 4YRKA 4YAFA 3PXGA 1MFPA 4UHEA 1MAAA 1RM0A 1G8YA 1LBHA 1W0CA 4US1R 4EI9A 1LRLA 1D1PA 5FV4A 4P7JA 5EIBD 4YYZA 5I7OA 1XN1A 4H4DA 4X20B 1A96A 1GPBA 2I55A 2GD2A 3VH3A 1X6VA 4DA6A 3U7HB 1XMXA 5CB6A 4HLNA 3B1XA 2RGBA 4OATA 3KD3A 4MB6A 1FVFA 4UBMA 1Z28A 5JQGA 4ZV4A 2EKDA 3TKLA 5ALQA 2NU6B 1T2DA 3GARA 2BPOA 4Q4HA 5IPFA 3TJRA 4A8JC 2FVYA 2XGSA 2Z2XA 4WLUA 3JPWA 2LD4A 1YZQA 1ECCA 2MSKA 4NAVA 5KDLA 2K2QB 4ENTA 2GERA 3VXKA 1JW9B 2LDBA 5L7WA 4UARA 2X41A 3OJFA 4PLTA 4GC9A 2VDNB 2BCGY 1UXHA 2DUNA 3FBWA 1NVXQ 3SOZA 2GCNA 4IOLA 1S01A 2A3NA 4BECA 2P4HX 3L1HA 3ZHXA 3NM5A 1U8TA 2JLRA 2VK1A 2AXQA 2YN0A 1ECLA 2BGKA 4N6OA 2IQIA 2J0UA 2XVAA 3BMQB 5JNLA 4G56A 5IARA 5AW1A 3T5AA 1XNQB 2I78A 5I9BA 4HATA 5AM5A 4I5GA 3VMFA 4CWAA 5IHPA 2X7JA 1A7AA 3N87A 1LQUA 1KS9A 4HAZA 4NX2A 4YJFB 4XSHA 1H23A 2RHBA 4EJMA 2Z2KA 2D0OB 2F3RA 4JY7A 1PEAA 4UHDA 1TKRA 3MGCA 4YFYA 2IU0A 2CNWD 3CN7A 4L02A 2V7QA 3KQQA 4NV1A 1E9FA 3Q10A 4JX8A 3AEKA 3O4FA 2PYDA 1OB2A 2OV4A 4IXMA 2R4TA 5DOZA 3AVOA 5CB4B 4G8DA 4BWYA 3JY6A 5HIMA 2AFHE 3EMVA 2IYRA 4HAWA 2XCTB 2V9ZA 1ZN8A 4G3XA 3TZEA 4XQ0A 3CKMA 3D8NA 3HNPA 3K5PA 1A9TA 1AZSC 4RSMA 9ATCA 5KJCA 4C2UA 2CXOA 2EKQA 3E8SA 1QFJA 2JBAB 4Q1DA 2VAVA 1U5BA 4ZAXA 3IR6A 4UBKA 1QTRA 1W2WB 2HFJA 2Y99A 4IVPA 3P2MA 4B3GA 1EINA 1Y1PA 1WUJS 3I05A 3DFUA 2IFTA 4XDHA 4B3TB 3GD7A 3REFA 1XEFA 3NNNA 1T9GS 4BNVA 1NJ5A 4F3CA 2ZIXA 3B38A 2QE6A 5CB8A 1EP2B 3CJQA 3JTEA 1GDTA 1PT7A 2F43A 2AE1A 5AHRA 5B1DA 1UMDA 2E85A 2YVUA 2J07A 5K03A 4BNDA 4HP8A 1ZNXA 3WJ7A 5EUMA 1CF4A 3U3RA 4D41A 1K7FB 1XZCA 4Q7LA 2PR7A 2CC2A 4TRRA 3WK7A 2VHVA 2VDKB 4FNAA 2EBFX 1GU7A 4RGBA 2XA2A 5GQSA 5F78A 4B81A 3D3WB 3MWGA 1U0LA 2HWYA 3LWNA 4N48A 3D6UA 1I7PA 3G2MA 1O5TA 5JYEA 1TW2A 4PWZA 1P1BA 1NG9A 4CUZA 2PGJA 4CETA 2HIGA 3H0KA 3HJGA 4J0EA 4L7QA 1NZDA 2CGEA 1I7DA 1IK6A 1BWSA 1X86B 2PMDA 4IO1A 4A2CA 4WJLA 4N82A 2Y1OA 2YY7A 1V1RB 3LYUA 1NR5A 1RVDA 2Y1DA 1H0KA 2GJSA 1EUQA 4JQCA 2RCNA 4NMWA 2NTYC 4NU5A 1C2YA 1E2MA 1A7UA 2Y8EA 4YONB 3KQSA 5JCJA 2NXCA 4WAUA 4KFCA 1EK6A 1PEYA 1T2VA 1YGYA 4J91A 3HYLA 1UPAA 5FOVA 2DSNA 2JGDA 3ZHCA 1QGOA 5LYJB 2AZMA 3IEXA 4RDHA 2YYSA 1IG0A 1POXA 2A9KA 4EFMA 1QYIA 2JPDA 3TZHA 1Z12A 2GRAA 2H59A 1OT3A 1XVLA 3EY4A 1W1UA 4GW3A 4IGEA 5TS3A 5GMOA 3ND5A 3R20A 3H13A 3WGTA 1E6EA 3EG9A 1OI2A 3C6KA 5EGNA 5LDDC 4S0ZA 4K1LA 1R4MB 4R1TA 3I9V6 4U2BA 1ZEMA 5ED4A 5HDQA 1R15A 4EHKA 3LL4A 1O89A 1Z4OA 5CGZA 1H4TA 4Y9TA 2ZZMA 2ZIVB 2VPIA 1RM3A 4JB0A 1ITZA 3L40A 3L0IB 5FA5A 5H3CA 3THSA 5EJEA 4EJFA 3BXHA 4DRZA 5IANA 4F4FA 1BSVA 3M4JA 2OYRA 5BY2A 3AY0A 3DT9A 1G291 4PS0A 4UTNA 4KQWA 3HXMA 3RABA 3SEFA 3UTCA 2I9KA 5CNIA 2XODA 4UUPA 4BJ6A 4RLFA 3DT8A 1RWNA 3EIQA 1UBHS 4FHGA 1MB4A 3KYDB 4MWSA 1Z16A 1VIDA 4RTKA 1Z9BA 3VX4A 5I7WA 1Z2OX 5BN3A 1YMQA 4W4TA 3C1TA 5BUQA 1VJDA 2IELA 3CWQA 3F7NA 1KK0A 3F8WA 4OAPA 4TT3A 3MTDA 5LQSA 3WB2A 2YIMA 2GM4A 5FTNA 3ZOKA 3B78A 4MW7A 3ESCA 3E5MA 1W76A 4N3BA 4L78A 8OHMA 3BWYA 4BVJA 4O2RA 1JEYA 3LUHA 3V8RA 2SECE 4NE7A 3FM9A 4QDUA 2WYVA 1V5FA 2W2KB 2ZJFA 4IHKA 3IAEA 4A26A 4AKSA 4TXJA 3VDMA 1DU4A 4YUXA 4AN1A 4US2R 3DZHA 1GZ6A 4UZEA 5K0NA 4FR5A 5EHQA 4EARA 1F60A 1YFZA 4MX8A 3MILA 3O4JA 4ZI7A 3LTNC 4CQLB 4DS3A 3EZ9A 1PFWA 1WPXA 2AQKA 2G06A 3O4GA 5ENZA 5EJ6A 4IHAA 4QAQA 2J59A 3VYVA 2I7DA 4EUEA 1T5SA 2L69A 1RI4A 4NHEA 7REQB 1ES9A 3FBGA 2ENWA 3V4PB 4DCNA 5H82A 2RHJA 5DX0A 1QDLB 5JH7F 3DDSA 1R3UA 4CF5A 4Q82A 2XKJE 4B3MB 4MDFA 1W36B 2JGJA 1LDNA 3NBUA 3NI2A 4N5NA 3B6IA 2IP2A 1EU1A 4KCGA 4ITRC 1XQ1A 4RGQA 3EWNA 4G07A 5A4AA 3FTFA 2V5VA 1GLGA 1M1YA 5CTJA 3GEBA 2HTFA 1JEYB 4Z7NB 4XD7A 2XADA 4ZK2A 4ZOLB 5ADHA 2R5FA 4MPTA 2Q07A 1O0SA 1S7CA 4AY5A 2WVHA 1C4OA 3S8EA 2QTMA 3QPVA 5F5NA 2C1EA 2AYZA 4XJSA 5FO0A 1E4EB 1PG5A 4XCVA 1RTTA 1CQPA 1B76A 2ZPTX 4WXHA 2OB1A 2PRJA 1R4NA 1BE8A 1E5VA 4LYHA 3ZTYA 1P2GA 3CPHA 1OBVA 2CCJA 2VCYA 2WFAA 4S1TA 3T3GA 3H2JA 1BAPA 3I4LA 4FMPA 1AKYA 3Q11A 3TIIA 1CDZA 3U16A 1P91A 1O94D 2DR0A 4PZAA 1GP2A 1AA9A 4WMLA 4RTMA 1SHJA 4CM4A 3TQSA 4XUCA 4A0FA 3O8BA 1HEIA 1N2SA 1Q0HA 2CDRA 2OFOA 4PPYA 3FN4A 3M4ZA 3SR3A 3LXRA 5IU6A 1QRSA 1HFEL 1X8LA 4L74A 3UOAB 4B8WA 5FTLA 4DNOA 1WAMA 3NKFA 2H5EA 1NI5A 4CCYA 4HEHA 1NP7A 3R77A 1B14A 4IZOA 5CDGA 2OSVA 3HVHA 1Z6PA 4KXNA 1KQOA 2PJDA 1UKAA 5DASA 3OIDA 4LNHA 3TIVA 1OA0A 1C29B 1SC9A 3FETA 1P77A 4YRRA 1U3FA 2AR7A 2F7SA 4TXLA 3SKVA 2H31A 1WQ1R 5LWHA 4DUGA 1GCUA 3WZLA 4NXMB 4D3SA 2VRBA 1NU6A 2XMPA 2W2MA 3CF2A 3F7OA 2Q3MA 3R3YA 4KHZA 5EE9A 1UDRA 1Q15A 2LPMA 2REQA 3LQRA 3O94A 2PUEA 3RSGA 1E0JA 2LCIA 2ZIFA 3DUFB 1IN5A 2QY9A 4ETIA 2ZXFA 3KUUA 1SZCA 2XEDA 1S8OA 4CM9D 1FBNA 2WZDA 1TM3E 5AW5A 1PBNA 2OFWA 2XB8A 3B9QA 5CT6A 2RMKA 2BFPA 3VKUA 1JEQA 4CMHA 3SJ7A 3RIEA 3K2IA 5C9ZA 5KOHA 5JTTA 5I5GA 3FWKA 1CBUA 1EFHA 4JC0A 1Z83A 1N7JA 1BE1A 4YR7A 5J4LA 3H9JA 3TRIA 2IYTA 4AJ1A 2P69A 3L7JA 1S2OA 2B78A 3V3KA 4D9JA 3GFGA 2FLVA 2C0QA 2JD1A 4CTNA 4Z3KA 2JCXA 5M29A 4BN0A 2EP8A 5LBUA 5SV2A 3ENQA 3ENZA 1GUDA 4QGFA 1RJDA 4NU0A 1J2JA 3VZRA 2YJZA 5I4KA 4PLGA 4G1CA 3OFVA 1HK7A 4JBNA 3UJBA 4EFKA 1RBQA 1WV0A 3T1NA 2ZCUA 3M7IA 2Q1UA 5CJJA 1QCZA 1AV6A 1FXWA 4EYOA 1J22A 3CH4B 1K8XB 3D8SA 2V96A 2XITA 4HRAA 4RPCA 5JNVA 1MW8X 2HF9A 3LWDA 3PK0A 4HL6A 1EFUA 4IYRA 1OFTA 2A9JA 2ONKA 3BFJA 4TUYA 4B6OA 4HVLA 5KJFA 1K8RA 1AKTA 1N2XA 2AEEA 2PMBA 1CD5A 4N5MA 3BAFA 4OOFA 2PXXA 1P2UA 2RGNA 4RZHA 4TSFD 4YCJA 3JAWA 2GAAA 5AW9A 3WO0A 3BWVA 2YZ7A 4K6FA 2WIGA 3DVAA 3PDIB 1H05A 3MTIA 3VO2A 3RBVA 4NULA 1E58A 2WTMA 3F6BX 3IGFA 4QE3A 4RMJA 4RV4A 2HJRA 2Z04A 3IEVA 1O9HA 2QQFA 4LRYA 1H2HA 1X3SA 3AVPA 4PLVA 4EKYA 1JRLA 1DPFA 1TL7C 4IUYA 1GAQA 5E7MA 1TXGA 5IX8A 2ODAA 3LUDA 4FJ2A 1IHUA 1FFGA 2PS9A 3M9WA 3RU3A 3ROKA 2ZB8A 3A25A 3K7EA 4KVGA 3I1FA 3NGXA 4RVOA 4OM8A 2R6R1 4AY2A 4Z1MA 3B2QA 3G7NA 3NDBB 1R4AA 3PC3A 5BSVA 1DJPA 4BKUA 1XLWA 5CXSA 5I01A 1J4AA 3AFHA 3X3HA 4D3XA 4BV3A 4IDDA 2EZ4A 2RHTA 4HGNA 3EBOA 3QEJA 5DX1A 4CYMA 4YXFA 4Y6GB 4I55F 3PFFA 2JGNA 2XNDA 3PJRA 1GKIA 1JR4A 2XUOA 3MTJA 5HGXA 2DPMA 3RUFA 4QDZA 2HK7A 3B6EA 4C7BA 2ICAA 4NIMA 4RPKA 3RAEC 3IDAA 4JUFA 1ZM2A 4JI3B 3O1LA 3NKLA 4E5YA 2UZ1B 4ZFNA 4QM7A 5L95A 1DAFA 3Q6NA 3LGAA 1FU7A 2OCPA 5D1NA 3EQ7A 1IJKA 2JBWA 1BWPA 4JODA 4UBOA 3PLAE 1G66A 1XD2B 2D2FA 3OZCA 4H3VA 3V7YA 4FDVA 4XPIA 1ZUHA 1NSFA 1XOIA 3DM5A 3UAVA 3QWIA 1LF5A 4JBLA 3ZVLA 1LNSA 3DO5A 3OHSX 1PR6A 1FOEB 2XY4A 3WLNA 1QGED 1WEKA 2FEAA 1HFWA 4ZVPA 2XUIA 3H2HA 4LVCA 4MAMA 4B3XA 3GLFE 4L9RA 4O4LF 3PX2A 2VLBA 2MJLA 3PD7A 1BS2A 3PFWO 3EA0A 4QPJC 3UT5B 3WYNA 4DCGA 1JV2B 4DY4A 1B8UA 1EZ4A 1H0HA 2AH5A 3FFXA 1FDVA 2NM0A 4TLDA 4D4HA 4EY4A 3OBBA 1HL7A 3HB0A 4PRZA 4V0SA 4A5SA 5EE1A 1NOIA 1QH1B 3HB7A 3KLBA 4K7JA 4RESA 2IS6A 1JHPA 2DECA 2ZS7A 1EP1B 4KFSA 4EYEA 2NQTA 2R62A 3NHWA 2A35A 2H4WA 3G7UA 2CNBA 1MNAA 3LP5A 4MRNA 2QMYA 4BQNA 1H2AS 3LMKA 5ALLA 1Z5WA 1KK1A 2MHCA 2P2YA 1XXHE 3HACA 4AF7A 4CL3A 4M7WA 5FX2A 1LJ8A 3ETLA 1M7BA 2PFKA 4ZOBA 3GGCA 3HVUA 3ZWNA 4WZBE 1R10A 1SVUA 2G67A 4JVSB 4D97A 1T1SA 4W5TA 4JLWA 3I61A 2JLSA 5DGIA 3ZQKA 4Y2QA 5DTEA 1GRQA 1VCMA 4FE7A 4G67A 4JS0A 3P94A 4MP3A 4Z9AA 5HGJA 1P0PA 4IDAA 1QB8A 1T2AA 5DP2A 3B20A 4K81B 3L7MA 4F46A 5KTTA 1QQAA 1WW3A 4JSYA 2ZBUA 4CE6A 4OX9Y 2QAGB 4XFJA 1YA6A 1CUGA 2VPTA 3K0FA 2WJZB 5ALGA 3WB9A 1U1IA 4AIIA 2V3CC 2GR9A 2G25A 3I01M 3W1EA 2BISA 3VZQA 3H9QA 3BH6A 3WGQA 4E5NA 2YJ5A 5J5VA 1EVEA 1FLDA 5JJCA 1NF9A 1T10A 1J70A 4HPXB 3PIDA 4MYTA 2NTJA 2Y6UA 1ESDA 2ZBGA 4FHFA 4IGAA 4OQYA 4PLFA 4QU8A 5DFAA 3UMSA 1G20A 1T0UA 3Q3IA 4HAXA 1RR6A 1LF0A 4NJEB 5IWAB 1FP2A 1XZLA 3ZS8A 2G6TA 3UJAA 1V3QE 3FSEA 1H6BA 1N2HA 1EUDA 3D8HA 2QMQA 1UK9A 2ZYUX 3ANYB 5K3OA 4QUIA 3K0KA 2CV2A 2Q45A 1IZ7A 3LW8A 1DG9A 2AS0A 4XLLA 5A9TA 4EYQA 1NSYA 3I64A 3TIGA 1EE2A 1KIMA 4Z0NA 4FGUA 4WJKB 5DTJA 1M1NA 2QKYA 3IHKA 5TY0A 3N0VA 3ZK9A 1HZZC 1JDPA 2YS7A 3FPKA 4OHFA 3JQCA 5AK4A 5IAGA 3S2UA 3ZW9A 4NCAA 3L8FA 5EGSA 1P7YA 3CX7A 1V71A 2BOVA 1E1MA 2GAFA 3MBIA 1L5KA 5ITVA 5JXWA 3HRKA 4R6XA 3KQLA 2H2WA 4HXFB 5J2UB 3R9WA 5F5XA 1FZTA 3JCZA 4WL0A 5ECDA 1OFUX 5JO9A 1Q1ZA 4B1FA 4FB4A 1S89A 5BQXA 4JYAB 2XTJA 1XDGA 1X9HA 3M5CA 5SYNA 3QW4B 1NQWA 3A1SA 1JXMA 1PUXA 2BBOA 3GBSA 3NHSA 3PWKA 3ZHTA 4JJZA 4ECEA 3PYMA 1X7HA 2VJAA 3NTXA 4N5LA 5KAPA 2X0KA 4AG5A 3FUWA 2IHTA 1WS6A 1W47A 1ZQ1A 4AX8A 3KZXA 1G55A 2FSUA 3KDSE 2VLIA 1RM4A 4GF5A 5AQ1A 2V4ZA 4EF4A 4YHBA 1VCNA 4GKKB 4NYJQ 1CWUA 1AZTA 4RTQA 1R6VA 4Y2VA 2CLDX 1UK7A 1SG0A 1KSJA 1KC1A 4EKDA 4RH1A 3KQUA 3HTXA 5K3EA 1WV1A 2V6JA 1IEWA 2ZWOA 5JFOA 3QIVA 4BMCA 4MR7B 1UFQA 1NN0A 1JDVA 2EBHX 2FB9A 2ZI4A 4NL4H 5AJUA 3IT1A 3U4QA 1M3SA 4YAKA 2A9VA 4F2DA 1XELA 3EXHC 4X62B 4JOCA 4GOND 1T4BA 2GHQA 5H1YA 3LHSA 5CNKA 3IJPA 1ISFA 2E55A 2FMFA 2O2GA 1PDVA 3L8HA 3PS9A 3TB6A 3F5DA 4L5CA 4XGKA 3JD1A 1I0ZA 2TMYA 5BOSB 5EJ9A 1K6XA 1QYRA 3ZEIA 1N57A 5DYGA 2BFEB 5KYYA 2FEKA 1V11B 4XB6B 1IQ0A 3RKUA 2I6GA 1QG6A 1GTVA 4FIDA 3AUSA 2D62A 1A97A 4P4LA 1Z62A 3IVRA 4W5QA 2PNFA 3QVUA 3A3OA 4FDUA 3N28A 4CKBA 3F46A 2CV0A 4U9UA 2WSBA 3SOPA 2FPXA 2VDOB 4BBZA 4YASA 3RS4A 2VT6A 4JSTA 5BWBA 4Q93A 3ITNA 4IIVA 3R7WB 4O5OA 4LCBA 1BCRB 4JBXA 5DWVA 1POWA 3AESA 3A04A 4MJLA 2JW5A 3LT0A 1Z4JA 4GSKA 1PUIA 3FCYA 4Q3OA 1LPPA 1UM9A 1JDTA 3EHEA 4FYXA 1FFAA 2V0NA 5BVGB 5ALEA 2W11A 2Q2WA 3T5CA 4BIIA 2CFRA 1PG0A 2ZRLA 2BDTA 2WJJA 4FW8A 3RU9A 1R6UA 3VYUB 4X1KA 1FP6A 1T8SA 1TDJA 3IT3A 1H3EA 3EMDA 5L3QA 1SH7A 4XRRA 1N2EA 3MYRA 4DBLC 2GBFA 3ONDA 1ZHHA 4F1KA 2WMOB 2BFMA 2CLFB 3LCVB 1S2DA 1GITA 4HWOA 4CL2A 2R9VA 3A6DA 1NR7A 3D81A 5D7BA 4QHSA 3ZD7A 3RV4A 1U3VA 3EA5A 5FWYA 1E4OA 3AW8A 3VPCA 1JVSA 4PSKA 1XIVA 1TZKA 5BNZA 3D4PA 2B8TA 4AURA 4B4OA 1NNI1 2OGWA 1GZ7A 1U90A 2Z1NA 3B3JA 3DEYX 5H4GA 3W2TA 3KKOA 2JIQA 2C83A 2ISSD 2BJHA 3PDCA 3HNRA 4OSPA 4RA9A 3T4XA 4BWFB 5E4TA 5FJIA 3CCCA 1DV2A 3AF2A 3QMMA 4ID3A 4BRWA 4RHCA 1L5ZA 3OLZA 4LHXA 5LL6P 1WB6A 2XIQA 3BEDA 3JARB 2XB2A 2I34A 3OLWA 2YQZA 3LF2A 2GDZA 4NK5A 2ZI6A 2R1VB 2B4KA 1ZN7A 2YL2A 3AIKA 3K32A 3ZLJA 1X0XA 5SY6A 3AK4A 2C42A 4I3HA 4JK3A 4XAQA 1R8QA 3QKSB 4X6XA 2B6NA 5AVUA 3NCHA 3VPBA 2VDMB 4HDQB 2F55A 1D3AA 2KSQA 4HKTA 2F3TA 4PZYA 1DJNA 5L7YA 1P80A 1U7PA 2GRJA 2ZYRA 2CFIA 3FUTA 4FFPA 3UH0A 3W9UA 3VUFA 4DUPA 3Q40A 1M6YA 1P7WA 2WJ6A 2Y1KA 3DR3A 1BMQA 3NDIA 3IOMA 4FZ3A 4LDPA 4EUFA 3NRJA 4F8YA 4II2A 4U4AA 1QYDA 2P9BA 3KEOA 3U44A 2ZB4A 4C3UA 1ZCBA 3K35A 4F2PA 1OAOC 3DOEA 3NHYA 3COVA 5CK4A 3DE1X 3P0IA 3FB4A 5LCXA 1LC3A 1WP4A 1ODTC 3BSWA 5JCJD 2PJRA 5IK2A 2PUGA 2YVKA 3ZDQA 5PGMA 1ENZA 1Z4MA 1U0HC 2NPOA 4KH0A 3LI2A 1A98A 3W3AH 4CFZA 1ZH4A 1U28A 3I34X 4IHJF 3TW8B 1H2WA 1QBGA 2BDUA 4FN4A 5KSOA 1YTLA 1X7DA 3KSRA 5ERGB 3SXPA 4MW0A 1R00A 2QRLA 1OMOA 4IJMA 5ETJA 4BNXA 4RVHA 3ZE0B 4D9EA 4G6ZA 3TGLA 1VBMA 1ORDA 2FPKA 1M8KA 2QL7A 2VYFA 5EXTA 3VSCA 3HR4A 3BXEA 3BWDD 4FUQA 1H5UA 3BC1A 3KFXA 3N3AC 4KIFA 1N5LA 4OYLA 1ZLYA 1WBDA 1RI3A 2H4HA 1FU8A 2I1VB 3H9BA 1BRMA 2A57A 3TSAA 4K40A 1S0UA 5I9NA 5EKTA 1T29A 1NA5A 2VTVA 5I48A 4NPAA 3TLCA 2B36A 4JJ6A 1GG8A 4PLWA 2GYUA 1JZTA 4UFPA 2HUNA 5G0WA 5HJ2A 5KQLA 1W5FA 1G9TA 4FTWA 1AGXA 2C5HA 3H5IA 3ZKAA 3MWJA 5FD8A 2HK8A 3MGGA 4K0KB 4J0GA 5KREA 3E27A 2IITA 2A9OA 1HXHA 3EQ6A 1BEUB 2VBFA 4K6GA 4O2BA 3HABA 3CEPB 4Q3BA 4PX3A 1NPTO 1CQXA 2QNRA 5HCUA 1E60A 3B13B 1MABB 2PUAA 4M88A 1XTVA 4IILA 3CEJA 3K5HA 2FW1A 1NYRA 4LC1A 4FMCB 4EPTA 4EJSC 1J21A 1T36B 3KSMA 1FTSA 3OTWA 1VBKA 5DCYA 3R1IA 1T5HX 2WAAA 3GJZA 3X1KA 1GQ2A 5TQ0A 1K2VN 3C3XA 4MV6A 3U4DA 4F60A 2H2HA 2O3UA 3O1HB 5H5JA 1CQIA 5A9RA 3EVFA 3MWDB 4BAGA 5DM0A 1N8KA 3GPLA 2Q9AA 2ESRA 1K9VF 5EIFA 3CVYA 4PVDA 4KE7A 4L9WA 4ZMRA 1XO1A 5AUPB 2GXUA 2HT6A 1Z2DA 4LXGA 1DXHA 2PKWA 2XNCA 2WT8A 2YC2C 3K9BA 3R5JA 2VRCD 5FFFA 1P7ZA 1PWZA 2J3DA 4EPXA 1VB5A 5JZVA 1A72A 1AUOA 2ZTHA 4CR7A 3H19A 3AUUA 2BLNA 2UKDA 5A5GA 1GTRA 1PFKA 1TRKA 3DE6X 3HDYA 3WA7A 2HPAA 3F1KA 2CNOA 4QLAA 5DI9A 2PDAA 3WBBA 1ZD4A 3FZEA 1Z2PX 2WOJA 4FJ0A 4XIYA 3R5SA 5U9CA 1QFYA 1Q16A 3LA8A 4C0QC 4ZI2A 3VVMA 1PGJA 2WU4A 4PONA 4DA4A 2QRQA 4P4TA 3WLFA 3NB0A 4QUAA 4Z9YA 1GDDA 4BNIA 3ESZA 1C9NA 1KTVA 1RWXA 3STVA 5C8YF 5ICCA 4AXBA 2ZZKA 1O9GA 1ZYUA 5K05A 1XZHA 3EUFA 4GI1A 1T35A 3CYFA 1UPXA 4YALA 2EJVA 4IX9A 4M1OA 1UEJA 5LSAA 3NBQA 3WVNA 5HZGA 3VU9B 1XRNA 1C30B 1FE8A 5HG0A 2I2FA 4GVXA 1TI7A 1SK9A 3ZHRA 5CJ2A 5JANA 2IH4A 2V0GA 3G1TA 2P7HA 4BVEA 3A4LA 1KYWA 1U9CA 3LBIA 1X42A 3LIIA 3PPYA 4GH5A 3EH1A 5AI0A 2CFTA 3QGMA 1J1IA 4P31A 4HB3A 3VGJA 1PL8A 2EDAA 1WNFA 2HXSA 3HJUA 3P0JA 4J0CA 5JVDB 3RYHB 3K70C 3L7CA 3AJEA 1E3IA 3BGWA 2GTIA 4IV8A 4REOA 3ZHQA 2P9YA 2CSUA 2CHFA 5E0KB 4JP8A 1U3TA 5BQPA 3FF1A 4MCAA 1EVJA 2A5GA 3G2JA 4G5FA 4WKGA 3Q9SA 2C3PA 1KQGA 1ZJWA 3PZBA 1BGWA 3GEDA 3GJ3A 2Q28A 4NOLA 3ZWCA 1YDHA 4R1QA 5TGTA 2AFIE 3KE8A 4KQXA 4ZHQB 4ZCPA 4AW9A 1II8B 4MW2A 1D2HA 1FDOA 2HIMA 4KXFB 4B3FX 3C0KA 2BRUC 2ZSJA 1DQRA 5TQ2B 3JASB 2UZ0A 3AJDA 4BCDA 3F6RA 3ZZUA 2YCBA 1ETUA 1H4VB 5KJ1A 3D2CA 3VAAA 3W5CA 2WIKA 1F5NA 2Z6UA 1IPEA 3CJRA 3I2FA 2P62A 3KLNA 1U65A 2J9FA 4GWLA 4HMOA 3KB8A 1GRRA 3NHUA 4JI6B 1C3XA 2VUHB 1AQLA 2N3ZA 1L5VA 1MRSA 4DUGD 2JLYA 3OWOA 3K0EA 4GRIA 1DTEA 4XWYA 2DWUA 1RIFA 1Z47A 2WHRA 3EIHA 4KOAA 3EIWA 1NQ5A 1UQUA 3P8ZA 1CY8A 4PV7A 4CKXA 4Q9IA 4DRXB 1HTBA 2CN1A 2VZ0A 2ZVDA 4JN6B 4QNMA 4CDMA 5IS2A 4ZOAA 4E7PA 1JFSA 1KAEA 4OXXA 3ULKA 4XVCA 3GUYA 5C52B 3ABQB 2VHCA 2IODA 4LFAB 3DVQX 1MX3A 3LRXA 1BHJA 5EZSA 3GDFA 2MSEB 2RAPA 2QLMA 3L7YA 3O74A 3SQDA 4GS5A 5AJVB 3LZCA 3AHIA 2GDJA 3DE7X 1AGPA 1QBKC 4P33A 3HJBA 4HRYA 2V7UA 4NG5A 1JHYA 4D0GA 5E7JA 4MI1A 3RS7A 2PS3A 1AVTA 4KAFA 2C9MA 4GZ6A 3AR4A 2OD2A 5HP4A 3T7TA 2C7RA 1M72A 4HNRA 5GWXA 1SU7A 3RLFA 4E2XA 1FSFA 1M34A 4HNAA 2E4YA 2OG1A 3C85A 3NDRA 3QVMA 3R0VA 3T7IA 1VSQA 3S2EA 5KOJB 2JKZA 3QSYA 4BVGA 3OPVA 3KLPX 4Y9SA 2ZRHA 3NNSA 4C30A 1MTOA 5AFSA 3UMVA 4PAGA 4GI7A 1EFDN 3BHIA 3IODA 2GSDA 1AXGA 5DTRA 4R8LA 1KDTA 1XQVA 2A14A 4WHMA 4PSDA 2W37A 1ILWA 1Z34A 1Q17A 1SVLA 2BFCA 2RGDA 4UHFA 4B82A 2IS1A 1KH3A 2JFUA 2QLNA 3VC2A 3WIOA 4E6PA 2IEGA 2QPTA 3D1JA 1TM5E 2G09A 1USKA 2GHIA 3H3XA 3TAHA 4YCLA 4I5EA 1T26A 3K96A 4F7DA 1V16A 2W8BB 1BXRB 2O3RA 3BX1A 4GKAA 5B1HA 1VL2A 1A8PA 5AHXA 3JQDA 1NXWA 2AXPA 3OM8A 5EL0A 5K7SA 5B6JA 4A8TA 4YP0A 2XR1A 2ZJ7A 4OY3A 5JSZB 2QRVB 1VMAA 3BIWA 5BSRA 1GPLA 4OFZA 5TPZA 5LZ4A 4G8BA 4A91A 2M6KA 3T4UA 1CLEA 5H3LA 5J47A 4R16A 2CLSA 1NVBA 2ZI9A 1FNNA 2UYYA 1XCPA 1FNSA 2C1XA 3BDIA 3DEKA 3FKSA 1LTQA 3GEIA 3LQ2A 5HIKA 3F6CA 2NW6A 4JLJA 4V03A 1XPOA 5EG5A 4PHGA 4BLVA 4L9AA 3AJ8A 4G2NA 5T8KA 3P9QA 2OM2A 2QTBA 3AEUB 3PE4A 2IXEA 4ZVLA 3PEFA 1VCHA 4B7XA 6PFKA 1KC3A 1OASA 1OXVA 4Q9NA 3E7FA 2P77A 2XLCA 4TL9A 5JD4A 3JYNA 3JATA 1DKUA 2A0FA 1GVNB 5LN1A 2ZZNA 5JJLA 2QE7A 2X5OA 5HQ3A 3AUJB 3TFWA 1DRVA 1R9MA 1QPZA 4MHTA 3DTYA 1YI0A 3AM1A 4Q19A 1I3MA 3RVLA 2BFDA 3KYJB 5C53B 1YFJA 4WK4B 4PR3A 3RS5A 3BVPA 4B6QA 4RSHA 4JEIA 1XMJA 4EDFA 4D8VA 1RWBA 3OLVA 4YUAA 3Q8MA 4Z4IA 4D9IA 2JCGA 1CIVA 5FPSA 1XMPA 3IIJA 4G5GA 2C04A 4GZ3A 5L3VA 3FOEC 2XOXA 2ZRBA 4CQMA 5C5EA 3EGIA 4D79A 4CKCA 3HJTA 4WZZA 3GC6A 1ZH6A 4LRUA 3KALA 3WHIA 3IQZA 5CFNA 1K7XB 5GADl 4H15A 1W9HA 3SQMA 4DNXA 3KEFA 3VR0A 1OB5A 1QHFA 1PD1A 2I2AA 1L5RA 3K92A 4Q4JA 3V00A 1FS4A 1ZVQA 4EUKA 2HLNA 3SNHA 3U1VA 2XX3A 2QVZX 3NHMA 5TGDA 3WKBA 5HYVA 1NQXA 3RK4A 2AG8A 2J5RA 4RC9A 4JLSA 1KVQA 221PA 5EERA 4X94A 2Z2JA 3CB2A 2NUTA 1HSZA 2HCTA 2ZRIA 4YJDA 1L8OA 3AY3A 3T99A 4DNQA 2ZUTA 4BE7B 3UTDA 1YUBA 5C8DA 3PICA 5IBCA 4TS4A 4BU1A 1QX4A 4IDGA 3MMSA 1N2CB 4OV6B 1GTG1 1UOEA 4YT5A 1RWPA 4K9MA 3M70A 1YAHA 1P6QA 2OBFA 1QZZA 3J81A 1G5FA 3M2PA 4MUAA 3O7WA 3W0LB 1CVLA 1S1CA 3A06A 2XVMA 3NOXA 1SKBA 2Q4TA 1LA2A 2YOHA 3D64A 5AICA 4DBLE 2F8TA 4Q3CA 2QIOA 4OA5A 4ARSA 2DBRA 2BFBB 4C6TA 5HIIA 1FMFA 1OIWA 3I42A 5KVVA 3QNUA 3SYKA 4EK9A 1QP7A 3LKBA 5KX5F 4YCDA 3SZMA 1XAJA 4RK0A 2P2DA 3VDNB 1P75A 4Q18A 1UR5A 2PT7A 1G3RA 4I5DA 4V02A 4GGPA 3VR6H 5CEFA 1G3QA 3QYAA 1IWOA 4QRHA 1M75A 5F9FA 2FEOA 4HZUB 3DCJA 3MCTA 1UMCB 2PEZA 1P9WA 2F3QA 3NHRA 4H2DA 2VAXA 1CQJB 3A70A 3E18A 4MQLA 3IUJA 1JE1A 3RWMB 3A9SA 4GE0A 3FLAA 2XUPA 4A1OA 2D8MA 4EVQA 3AB3A 4GQIA 4O4JB 1ONNA 1XGKA 3ETEA 1HEYA 1K86A 1Q1NA 1VHDA 2O3TA 3ECAA 3HCFA 3I8XA 4K9SA 4UASA 3E3MA 2WJGA 4WBNB 3VNSA 1GGKA 1UKYA 5LZ9A 5FBZA 1I4OA 1PJSA 3INTA 5ALRA 1PR3A 1Y5NA 3BFVA 1R66A 2O6LA 3VR4A 5TIIA 3KTAB 1EQUA 4RDIA 2GJ4A 4QG3A 3QE9Y 3KU4A 2NYAA 1RYFA 3L8DA 4G0MA 4CN8A 4MR9A 2NZJA 1R74A 1NQTA 1ZRNA 3H2ZA 1QK4A 5KNCA 4WY2A 3B89A 3LLUA 3H42B 3KD2A 4QL3A 4ZO8A 4UTXA 4U7PB 4INZA 4TTQA 3W6NA 3W4KA 4AKTA 1I9CA 3F4LA 3VPDA 2PMFA 4DIOA 2PWYA 2NNWB 2CLKB 3HLKA 4J3JA 4BZZA 5B4TA 2J9RA 5H83A 3ES9A 1XK7A 2PLRA 4AICA 5JR3A 1O08A 2Q1YA 2Q49A 4PW0A 3KDPA 4QG7A 3DMTC 1Y4AE 2VJDA 5L51A 1U1GA 2J9ZB 3JALA 5BVHB 5L3SA 2O8BA 2GAJA 4HGRA 2IE0A 3DEHA 1C8KA 1RI5A 4WLFA 3VOSA 3WE7A 1OHHA 2K87A 3E9DA 1NWHA 1EPUA 1TUBA 3IKVA 3ZU2A 1QZ3A 3ITDA 4UTVA 4QHTA 5IWCA 1Y37A 1ONSA 3HKEA 4RMHA 3DAOA 2PIAA 4GSYA 1XA4A 2PKEA 3HL4A 5DHRA 3WZMA 4ZZ3A 3UKOA 3T1OA 3BD6A 1WCWA 5AJZA 3QM1A 4QBFA 2N0SA 1FYFA 3LUPA 2QUAA 4TLMB 5CA1F 4XIGS 4RKQA 4M7PA 2A1UA 1WIWA 4OHCA 1IOVA 4ZKEA 3WKCA 1VMEA 5K6TA 4GPIB 3GP5A 2AG6A 2H5IA 2DR2A 1KEVA 4AYWA 1QG2A 4F4HA 2GBGA 3H6KA 5GPBA 5IDVA 2FQXA 1JQJC 4F71A 4QUBA 1VZ3A 2A5LA 4B6EA 4D02A 1X14A 2HDHA 2JLCA 1PR9A 4TWZA 4A0SA 5CXUA 2W42A 1TZCA 4EZBA 4A6PA 1S2NA 2B94A 3VR5A 1Q0PA 4MUMA 2X4GA 4CFSA 3OPYB 3JS5A 4NBUA 3UOGA 1BJTA 1KNQA 2FCRA 121PA 2J3QA 4N5IX 3WGMA 5DHPA 4G5RA 4ZVVA 1WLYA 4DIBA 3IKMB 1ATIA 2WHYA 4L4YA 2AR0A 3ONVA 3HCBA 2X3UA 1A4UA 4OREX 2VF8A 4H7FA 3T5BA 5EFZA 4F9TA 3V4ZA 4HRVA 1DIRA 1H3FA 2PZLA 5I8PA 3GIWA 1G98A 5JCPA 2X3FA 1N2IA 3HU3A 1RWWA 3DT6A 4I9NA 2XLBA 3U13A 1Y89A 3N2YA 2XBMA 5PNTA 3RRMA 2HQOA 2YBDA 3MWEA 4GI2A 2A84A 2ZI5A 5CVVA 3KKNA 2EFJA 1TZBA 4DSAA 1AUVA 3X2FA 5AM4A 5LNK6 2Q6LA 3FYSA 1RTKA 3OOWA 3HQ4O 4FKZA 4WA7A 3LE8A 5EP1A 3PHCA 1X2BA 2P3OA 1MAWA 5THQA 3V42A 2I7VA 2HRBA 2YUIA 4D9BA 3CKKA 3I5YA 4IDPA 3KHSA 1YQTA 2SBTA 4NZNA 2XZOA 4PY2A 2EFYA 4Q24A 5K6AC 3HO8A 3BM5A 2GN0A 1XROA 1QUFA 1MX9A 1QGDA 3ASYA 3IERA 3LGXA 3OQ6A 2D3WA 3HP4A 4G5HA 3ESAA 3M9LA 3MD0A 5BORA 1TKCA 3WGKA 5JRZA 2ZIEA 1RHKA 3KYCB 1FYDA 4G1EB 3K20A 3DLTA 4NH0A 4HVAA 4JVOA 1WUTA 1DQZA 2VXCA 3JQAD 5F7ZA 3DE5X 3OESA 2DTEA 2XAUA 2JDID 3L7OA 1A4IA 3R3VA 4U5XA 1NMZA 2G0AA 1MHTA 3ODGA 5LDHA 2GZ1A 2I7TA 3Q12A 2F62A 4S1OA 3KB1A 4P84A 5LP6F 1KEZA 5KJEA 2DE0X 2CD9A 2IA5A 2CXPA 3UCEA 3D3NA 3F2IA 2OZLB 3R5KA 4IFTA 3G7SA 4B2LA 1FU4A 5F1YA 1AE1A 2ILVA 4CEJB 4AWXA 3LKZA 1B6TA 4V1CA 4FQ8A 2BE9A 1PTKA 4K8RB 2HXGA 3DW3X 2V97A 5DGCA 1GR0A 2W00A 4OFXA 1QH8A 3G59A 1ZVVA 1EHIA 4QELA 2ZBEA 2X0IA 1X1BA 5GTDA 4L6AA 3KQNA 3P2JA 5LU9A 2HMTA 1B26A 2BFFA 1KARA 5I8ZA 1YAJA 4Z2AA 4WJZA 1DS6A 1RRVA 1AS3A 4IIBA 4LDAA 1U2QA 2J5KA 1U2PA 2QMHA 3N2EA 3FPSA 3H83A 3ZE8A 4TSRA 1U0JA 4FUTA 4H6PA 3ZPXA 3SJBA 3VU3A 1VDMA 1CVIA 4LPSA 1Q1AA 4OO3A 4QJIA 4YUZA 3I3OA 1X15A 2P27A 3CMMA 5JEDA 5KS2A 1WPGA 4P0QB 1NVVQ 2RBEA 3O1JC 1G0NA 4ZCTA 2ETVA 4AQYB 5H70A 1C9MA 3OF5A 2H6EA 1ZW6A 4MICA 1DI0A 4XB2A 5MHTA 5EZYB 4RULA 3EVCA 4RQBA 4YUWA 1N3LA 2PZEA 3T5DA 3W2GA 2AN5A 1V48A 2EW2A 1R6AA 3N2IA 3OUUA 4U39A 2H4JA 4QT4A 4G4IA 4HX5A 1K5DA 3WLTA 3UUFA 3DNFA 1ZK2A 4QUHA 2XOEA 2F6RA 5K09A 1G21B 1W9MA 5TT0A 3FZNA 3HEMA 2CVHA 4G23A 3U49A 2H7XA 5AHOA 4E5UA 2HZBA 2YWFA 3Q7QA 2GZDA 4LA4A 1NW8A 2CXHA 2QB5A 3B8HA 2GNPA 1DBRA 3OOJA 3PT5A 4MLZA 1IM5A 1BU5A 5ALTA 1SURA 3VOBA 3WBKA 9ABPA 2QY6A 3AOEC 1L7DA 1ULBA 5BYBA 4DG8A 1BFDA 5HIAA 1Y6FA 2AC7A 4XFDA 3RIGA 1U3UA 3MJ4A 4GKJB 3CEHA 3ZWVA 3QA3E 1NMXA 4FN5A 4B75A 2IYQA 4W9NA 3FNBA 5CM9C 1SELA 4MS4A 1GSOA 4RH3A 4YV0A 2G9ZA 3KOYA 1J24A 2B82A 4IICA 2ISCA 1DBVO 1IHDA 4DVJA 3K5WA 5MN6A 2F1HA 2QENA 4PYJA 1LZLA 3HA2A 2AJLI 4MSUA 1K98A 1FW6A 2AI3A 2YFYA 2P5UA 4J1TA 3ZQ4A 5FL3A 3NM4A 3T7CA 5IJ0B 5B57C 2A8YA 2AYXA 3GRUA 5GJBA 1QTIA 2UYQA 1EDBA 5U4QA 1U7WA 4QODA 4R8RA 4EGAA 1STOA 3L1IA 4W63A 2IUYA 1RQPA 4R69A 5EWLB 5CJPA 1SXGA 3PTLA 4Q7QA 1JB1A 4DL9A 3DOOA 3UF0A 5LZ7A 2HU2A 2JLQA 4TYWA 4JLBA 4UJ3A 5B3JA 1BD3A 2YV1A 2JHFA 4QXAA 1PU2A 1FLAA 4FPXA 2VPZA 4JGIA 1EX6A 1LVGA 2JZNA 2QX8A 1ZRMA 4JL5A 4HPWA 1AUPA 4RF2A 3CY6A 1F7UA 2YXPX 5HKBA 1W0KA 4IV5A 1ODIA 5EZ5A 1PGOA 4D45A 1GRCA 4ZGWA 4ZQEA 5DNAA 4EGQA 1CUUA 1DRUA 4JEUA 3CBQA 3TDKA 1WXXA 2DVMA 3L18A 4MRRA 3DEAA 1HR0B 4FEAA 2VPWA 1M54A 4CM8A 2ORYA 4MH0R 1Z5PA 1YFLA 5ILQA 2AC2A 1U8UA 1MZPA 2Q4BA 3BICA 5ARDA 2N9UA 1YZNA 4AP6A 3QF4A 5C7OO 1U1CA 2ZTUA 4MGYR 2H65A 1SOMA 4R68A 1I2AA 5T4BA 1F8GA 1YIAA 4FNMA 2HJ9A 1FA9A 4GO1A 1NAHA 2H4YA 3ZDXB 3WXMA 3BTVA 4UHKA 2IYOA 5IZCC 4KWEA 2UZ3A 2C97A 4PO3X 5DRTA 2ZR7A 2J08A 5JW6A 2OHOA 3A37A 1JQLB 3GUVA 4MXDA 4FYVA 4UU0A 3OAAD 1P0IA 2YY5A 4OKIA 2X7XA 4K6HA 4JC8A 5AVXA 1ACLA 4XIFA 4DT1B 2EZ9A 2UYCA 3WP1B 2EFHB 3HYCA 3NYWA 3ZR4B 1TTQB 3I83A 4D96A 3FZYA 2O8CB 4NMXB 5CH3A 1QK5A 2E82A 4RHYA 3DE2X 4KUEA 4TZTA 4RETA 3GWGA 4FYYA 5CP8A 1XHLA 4YAIA 1Q2XA 2MT9A 1G6Q1 3T3DA 2IEAA 4ZARA 5GM2A 1JIVA 2FE1A 4DE5A 2ON6A 4MAAA 1MO4A 4MUHA 5I7RA 3GO4A 2IYVA 3KT6A 4N3CA 5TMPA 2ACKA 3TSYA 1OBFO 2BC9A 1LH0A 2YZMA 2I7CA 4QYSA 3MN1A 1QAOA 1YMVA 2Z9CA 2Q5JA 2XWQA 3WRXC 1EWYA 2H48A 4MZXA 4MI9A 1SVNA 1NTRA 2ZTVA 4R51A 4PQGA 4G4SO 3E3OA 4IIDA 3I09A 3CJTA 5C35A 2I2XB 3HPRA 3GRRA 3QFHA 3OKPA 6CHYA 3PLNA 2QYHA 4WZAE 1XZNA 4HUQA 1LPOA 4JQZA 1J42A 1JN0A 3TQQA 2VHEA 1GUBA 3M33A 5FH9A 4G8CA 4EQ6B 3UG6A 3WICA 2IF2A 2AG1A 3NBKA 1G5IA 2ZUWA 3WK8A 2BMJA 3WY9A 1N8TA 3H8WA 3SMVA 3LUKA 3U26A 3CXRA 1LVHA 4YMTA 2QOEA 5CITA 2J0QA 2VKQA 1N7GA 1YBVA 1JKFA 2R8PA 5GONF 4LY6A 2G9QA 4CODB 4HAYA 1MP0A 1SKYE 2VP2A 4OMFG 4BO2A 4D46A 2Q4DA 5AW7A 4ZVRA 1G6OA 1C9EA 3VVCA 4YMGA 3TGWA 5JWHA 1ISMA 3W5SA 1DUIA 1PGNA 2CYAA 3CMCO 1YDWA 3RTBA 4I50B 4X1IA 3SM9A 1TUGA 1WXEA 3H7IA 5JECA 2DKFA 5LMNB 3V1KA 1JEDA 3L7LA 5DM70 5F4ZA 2JHAA 1AHHA 3QPCA 3BQ9A 3GEMA 5JO0A 1LS1A 3LRPA 5DYWA 2UV8A 4D4KA 4QLOA 4NPHA 3ZWOA 3GMIA 1SUIA 4MULA 4EHHA 1HMYA 2FMXA 2C2OA 3LPAA 4OXKA 1TVKA 2V74B 5DNWA 2GXSA 3ZCUA 3CONA 4EB6B 2M9MA 1U99A 1U6IA 2BI8A 1WEHA 2O9JA 3ITEA 4JR1A 5CYFA 5E9QA 5AXAA 2Z6AA 3NG1A 1DXYA 3LK6A 1O6FA 3FCEA 2FWPA 1FYXA 4C5BA 2F3PA 2DMRA 1KMHA 2WVJA 4L4ZA 3RYIA 1H8HA 2X8WA 2OGTA 1YBAA 1EEXB 2OORC 3HVIA 1C8LA 1Z2AA 3QY9A 1F3LA 3UM9A 3WL5A 4DDTA 3CZ4A 4N47A 3GELA 2NZ2A 3P9NA 3JV7A 2G70A 2GD1O 7GPBA 4OJMX 1L9KA 3Q8XB 4H6XA 5IBPA 4C4AA 3BE5A 4BX2A 1I9GA 4I08A 3TDNA 2BBSA 2O8CA 1HH4A 2WFLA 3L8GA 4AWAA 3TM4A 4D81A 2QE7D 4Y1FA 1QMPA 3AEXA 3ORHA 4HDKA 1MB3A 2X4DA 3I5AA 4IWNA 3N75A 3RUEA 1HTWA 3TJMA 1DRJA 5B1EA 1X80B 3L1JA 4E3ZA 1KJQA 1YDEA 4Y9DA 3OCUA 1D6SA 3IV7A 2WM2A 1X1SA 2DFTA 3KVOA 2EZTA 2DPGA 1XDZA 1ZUNA 4Q4DA 3OIGA 4LYDA 4DR2B 1XYYA 4WXMA 3RTDA 4QRDA 5E1DA 3DQZA 3E58A 4ICIA 3RVSA 5LKAA 2FSPA 4A0HA 2DWCA 3GLGB 1NBME 2Z98A 1ZD5A 4KVFA 2FPOA 4FSHA 4BWVA 5EE3A 1G4HA 4CQMD 2JNWA 3D43A 4HVTA 5AJXA 5LJLA 4JIMA 2QW0X 3UFXA 4TL7A 1YBMA 3PV0A 1XT6A 2VAMA 4BO6A 1BDHA 3F3SA 1I4TD 5CR9A 1A2QA 2C8VA 4RD2A 3R3HA 3DFKA 4FFMA 3K8ZA 2CWWA 1OXTA 2JK1A 2AUTA 1ZJ5A 5A0TA 1U7ZA 3MYYA 3HB1A 4TMZA 1LBSA 1UJNA 3FFAA 3ZYZA 2GEFA 1IJBA 2AOTB 4EB0A 1JBEA 2EKPA 1X8JA 3EXEB 5KSYA 1E6KA 2Y67A 5J2TF 1SUPA 1XTKA 3B2EA 3M6UA 1TGYA 4IZ6A 1A9PA 3TDMA 2AT1A 5JV5A 3C6BA 1AS2A 3KWJA 1KEKA 4H60A 5JBNA 2CBZA 4Z0HO 5IAEA 3RQIA 2BEWB 3EZNA 4NF2A 3V55A 1EK0A 2BFNA 1RHQA 3BZUA 4QXRA 2D1SA 4BO0A 4YBZA 3FE2A 1U04A 4Y2GA 4EO4A 5HKKA 1PK9A 1C7EA 1QDEA 3P9YA 3HUTA 3R23A 4HAIA 5IAJA 1OPXA 1Z7YA 1V8FA 5CVTA 3NP7A 2PQ2A 1KVTA 1M7HA 2CNKA 2O48X 1Z5VA 3UIEA 3ETCA 3KUXA 4NEHB 1L7RA 4HYEA 5EESA 3S6JA 4A8JA 1M83A 3ZDBA 1EVQA 4QYXA 2F4NA 3GFOA 2H08A 3C6QA 4INOA 3GEHA 2PUBA 3V9PA 4LDZA 1BX3A 4E4TA 5ITSA 3AHEA 3BJIC 4RVSA 1UAGA 3S29A 1PNQA 4G5SA 1S8FA 4LKOA 3RNOA 1ST3A 4ZZ1A 4O4IF 2W2VA 1PSWA 1P3JA 2HSWA 2PGIA 1CJKC 1ZMRA 2LCFA 3IQFA 4OQ4A 4XM0A 2VOJA 4Y2YA 5HJ7A 2P9CA 2D2IA 2JJ1A 2ZUFA 2K2WA 3W5IA 4B7CA 4BKMA 5HM6A 1A9SA 4J8PA 3D4LA 2BBTA 5CT9A 3NALA 3RK0A 3VZDA 2O8DB 4Q12A 1VXOA 1QS0A 1CR2A 4KPGA 3UHJA 1YB2A 5ER9A 4CLRB 3V7UA 4QYIA 2WHQA 4ZYVA 1L4NA 4ZZ2A 2J4CA 2WTBA 4OQMA 1CE8A 3NBXX 5L4LA 4DQDA 1GPNA 1TD9A 3EW7A 1FNBA 1ZMOA 3VNVA 4WASA 2YVAA 3BSSA 3C3EA 4Q37A 3SVZA 4DTCA 2ZRFA 3A0UA 2P30A 2BEUA 5C8VA 1K3FA 1TTTA 5CUQA 4BXOB 4FFDA 2WWXA 5G0SA 1EI9A 1TU3A 2HMUA 1PS8A 1KI6B 3OOYA 4OH7A 5JT1A 3L4SO 3ZY4A 1B8NA 2XVZA 5BR1A 3N2KA 3MTBA 1XN4A 3CBGA 1J7KA 1YHZA 1AQ6A 4QX6A 2FMHA 1KMMA 1E1RA 2J3KA 1DGQA 4GE3A 4KR9A 1P1FA 1QP0A 3MD9A 3AIIA 5LP1A 1WB9A 1DRWA 1HE8B 2O5RA 3ASVA 4WNAB 2CFSA 4LHSA 1UXKA 1MN6A 1ZO8A 2ZSDA 3QTBA 4QO8A 5JZ9A 4FZRA 3IEKA 1EIWA 1W1WA 2W2XA 3R8XA 5A3RA 5C5DA 4WN9A 1IPFA 2PK3A 3VJKA 2YWJA 5B53A 3K73O 2Y0EA 2QF7A 5CX1A 5BR4A 1T1JA 3BS4A 3GLHB 1FJGB 2BHNA 4CV1A 2GZMA 4L8WB 5JNSA 4Q6WA 1RMTA 1LCIA 1DMRA 3GJQA 5IEJA 3KQYA 2IYXA 2VDWB 3C3PA 4FT2A 1RXIA 1T3LA 4KMRA 6LDHA 2IH5A 3H2SA 4D4IA 3MHTA 1F48A 2IXGA 3WIDA 1YNSA 1N9ZA 1TJYA 3TH5A 1L6RA 1HT3A 1KAHA 3KOXA 3ZU5A 4UUAA 2H1IA 1YQ9A 2XOKA 4N5DA 5LXTB 3C5EA 3U4CA 4GMFA 1H9AA 2ZJ0A 2H2DA 2C84A 3AYZB 3IP7A 5ALNA 4HQRA 4TN1A 3NVKI 2CEKA 4O2AF 4MB0A 1QYXA 3PXCX 4BNGA 1N78A 5TR9A 4CIVA 3CUUA 1RPAA 1E7WA 3IBFA 1VPWA 2LP4Y 3HDGA 3BD9A 3OIWA 3FPAA 4IEIA 1XTSA 1HSOA 4TSKA 2APJA 4TMKA 1P8AA 1SQ6A 4V0OA 1BGVA 1LLQA 4QDOA 2OZPA 3A6ZA 1S9HA 2Q7OE 4CKWA 1UOPA 4MKRA 5TF4A 1XZFA 2A0KA 3VNQA 2ZS8A 3C8UA 2NVOA 5ALUA 4D98A 1TO2E 4AJHA 4OGGA 2P9FA 3FOFC 5EIEA 3R6LA 1F7VA 3M9XA 4EAQA 2JIBA 2D1QA 3W5HA 3W5DA 1RXYA 5JXIA 4KQIA 5EJGA 1USVA 2X77A 4RD6A 4AN0A 1CUJA 4HNUA 5ELXA 3RFFA 1G3MA 1U0BB 5DXFA 4C4TA 4GYWA 4YJ2A 2IZ0A 3H2IA 1KSHA 1L4EA 3FPJA 3K1ZA 3HJFA 2GPYA 2JIPA 2GM3A 3WB1A 3U7QA 2FPIA 4K9PA 3TLKA 2CVPA 2Q3EA 3EULA 5IYZF 1VE7A 3DWGA 4F4JA 4YV1A 4UM9B 3UJNA 3I2YX 1U6JA 1E5XA 1HNNA 4D82A 1MB2A 3RG2A 1RYHA 4EOGA 3IE1A 1GAJA 2N47A 2VJLA 3PVSA 4N8DA 3JZMA 4A16A 3HZHA 2JASA 1CUHA 1XNJA 1ZG3A 1UUFA 3CWZA 1U94A 3GJ0A 2G8NA 3DP9A 1EXMA 1PT8A 2FRXA 3AERA 3P4UA 1WM1A 2QRJA 4LHEA 4Z0PA 3DHNA 1JKJB 3F4KA 3LUBA 1PR5A 3ESBA 3FTDA 3TS1A 4HAVA 3F6PA 2Y71A 2JFBA 5EJIA 3HBAA 1W96A 2O3JA 1Y3IA 5J40A 2ZIUB 1X7XB 1ZK4A 2X1HA 3LS2A 4EG5A 3BRQA 1TYDE 2FPMA 2H4XA 1UBNA 3CFYA 3PZRA 4UBIA 4DIMA 1ZJJA 2O3QA 1XRMA 3VBEA 3BJEA 3N6XA 3KL2A 1V3VA 5LYYA 4EHDA 4BWGA 2OHFA 3CUEF 3PJEA 1D4OA 1P3DA 3NHAA 4D56A 5IT0A 3AF1A 1DMSA 3JU3A 1NM5A 4LQCA 4WBSA 1BROA 5FNVF 1E9CA 4DPKA 5CIYA 2MSWA 1SZDA 1T1RA 2WM3A 4IDHA 4RJTA 2EJTA 1NXTA 3LYLA 4PIVA 3G49A 4TKZA 4PGFA 1ADFA 4HDAA 5B7QA 1GPKA 3GEPA 3KKMA 3S1AA 3UG7A 3AF4A 3G8CA 1Y3DE 4M9SA 3VFDA 3EGDA 3SFZA 1Y5LA 2E89A 3D2AA 3LBYA 5A4JA 1YRHA 3HWX1 3QV1A 2JAOA 1Y4ZA 1J90A 1JHRA 1FCJA 3C3KA 3HDJA 5BN4B 4LQLA 4FMBB 3SZGA 5CB0A 4OB8A 4OSEA 2AEFA 5F1PA 3QHPA 1IEXA 2Z5LA 1T5LA 1EBBA 4UEOA 1J6UA 4UM5A 3TUZC 3FKQA 1QF9A 2QRMA 2WBLC 3PI6A 4REMA 4KLZA 4HGQA 1BHO1 3BHMA 5AXBA 3AR9A 3OEYA 2O3SA 2IYEA 4LBYA 3SDSA 1HDOA 3KE9A 4IDQA 5FUYA 2PXCA 4RV5A 4G0PA 1NMYA 4Y1RA 2NQ2C 1E2IA 4LMRA 3VYTB 4NQZA 2CUTA 4KGXA 4ZQBA 3S55A 5LWQA 1VMDA 1GNLA 4LTDA 4EG0A 3FG9A 1M2NA 1YB7A 3CLTC 3L01A 3I9OA 3QPUA 4QBKA 1TYBE 4NCJA 3TLEA 1XMVA 1MO5A 4I5IA 3K71B 5HQTA 1QVRA 4XKJA 4S12A 3R3WA 1KHTA 1ZBDA 5FR2A 4ER7A 3DCIA 5C3MA 2Q5QA 5DW3A 1PK7A 5KNBH 3GMDA 2RHLA 3ELYA 3I73A 4ROSA 5EYPB 2FG7C 4QOSA 4CR6A 4BVFA 1E3WB 2REOA 3VNRA 4WCVA 1JFVA 3P2KA 4FCCA 4BO8A 4F4DA 1TU4A 5DCUA 1I7QB 4L0DA 1TTHA 1FMTA 1THZA 5IVPA 4MS1A 5HMMA 1GEGA 2AMVA 3OPYI 3ZCRA 2EAUA 3D3KA 4ZU1X 1B0UA 1M74A 2OKGA 1N1GA 3A10A 3PF8A 3DAFA 2FGKA 1T34A 4UVIA 3N8KA 4GPD1 1B6GA 1HPLA 3HA5A 3T3IA 3ABOB 4BRZA 3O47A 4X8MA 3RVDA 3V6MA 1AA6A 4ZVTA 4KQMA 3UA3A 4BGVA 4HRXA 3BMCB 1ZL2A 4AS2A 2XCLA 3IB6A 4K05A 1ABBA 1WTCA 5FOXA 4DJAA 2DBVO 3V8MA 3P0RA 4KZKA 4HYQA 3S68A 4BZWA 2EKBA 4YFVA 4GSLA 4HDMB 2GF0A 2WWYA 3LLVA 3SHFA 3REOA 1CR4A 2WTAA 4AX4A 1ZGJA 2A0UA 2YMLA 2P8JA 4GLLA 3VKWA 4RIHA 1VG1A 1Z36A 3JQGA 4QPNA 4HK4A 1JZQA 4CKYA 3L7BA 3R7FA 2QX7A 2VJCA 1EFVA 4KE8A 5DEOA 3FCCA 1I2MA 1D1TA 4B76A 1E1LA 7AT1A 2ZBVA 3HBLA 2XSZD 2P2LA 4P0TA 1G8FA 2VXOA 1UKEA 3WYAA 1SQ0A 1XF9A 4JLUA 3G68A 3GGGA 4I1SA 1Z13A 4TKVB 4P80A 5AVYA 2JLVA 1P4GA 4B3SB 2XCUA 1U0SY 1ZOSA 3HUFA 4BO9A 1E0DA 2J3IA 1MJFA 3GPIA 3I3SR 3EXG2 2H0AA 1A4XA 5HCIA 4B5KA 1OJ7A 3NTRA 2FGJA 1WHTB 4EKEA 2AC4A 4MVJH 1SVIA 3KAJA 5T64A 4DJTA 2X6QA 3C6YA 1ADYA 4JC5A 4LK2A 1YE8A 4MUKA 2VRWA 1ENYA 2FWNA 2G1KA 3D3JA 2GCOB 3DD1A 2NU8A 3CLRD 4NG4A 1E0AA 4LWQA 4NESA 5ALMA 4IIJB 4LYFA 1HF3A 1IK4A 1GQFA 1GKUB 3L7NA 2PUWA 2WRZA 5IUJC 1I13A 1Q3KA 1H69A 4KTVE 1F6WA 3E9ZA 5AHWA 3SZUA 3OQJA 3VTZA 4HGOA 1GGJA 1BYUA 2X23A 4RL4A 4FJ1A 4ZYWA 1JL3A 4ZN6A 2KYRA 4JR2A 1TT5A 5IVHA 3F0TA 1RP1A 1GA4A 1W46A 4I5FA 1NN5A 2Q2QA 1P7VA 1YZVA 2B1RA 2P90A 2WMYA 3GN1A 4LOIA 4B35A 2XE4A 2GNAA 2GPTA 2P6RA 1SBIA 1Z5GA 2R6CA 4F06A 3NV7A 1CSEE 4JUCA 5KTPA 4GMXA 4HDCA 3ZQJA 3ILSA 3IRVA 1X77A 1REQB 2WZBA 2ZQZA 2X2EA 3PR2B 3WJ2A 3MEQA 2VYNA 1N7HA 2OGZA 3BZBA 4QU0A 1YB4A 1CP3A 4Z8XA 3KELA 5DLYA 5LA6A 4RACA 3RAPR 4BBJA 3ORSA 3HCCA 5IM4F 3CZPA 6AT1A 1RQ7A 1UFVA 5DOVA 4MW1A 5MF6A 2IPAB 3AFGA 1MO2A 4RMIA 4AJ9A 4JMPA 3FCXA 3JQ7B 3QWBA 3OTIA 3UK0A 5LQDA 4ZQHA 3EZYA 4W5OA 1FL9A 1TF2A 5AKIA 3DWIA 3UXHA 5K0GA 4P7BA 4XX0B 4RKFA 3QJGA 5JTUA 4B6JA 3FDJA 2LZ0A 1Y81A 1KS2A 2GS9A 1W36C 4HVCA 3ZJVA 3IAFA 4RLQA 4AECA 1M8PA 4UPVA 4FZ5A 1MW9X 1Y34E 2X22A 1NXVA 4V38A 2NACA 1W8DA 1FJHA 2JLAA 2LVBA 4AUMA 2AFIA 4AJPA 1V9LA 1P0QA 2MINA 4M83A 3TZ6A 3GR6A 4LV6A 5B3LA 1H2BA 2X76A 4YECA 4V0NA 5CFQA 1Y9JA 4BVKA 3DNMA 3BG5A 4B3BA 4KIWA 3GP8A 1J25A 1X1DA 2QD3A 3IFSA 4L2IB 4LOLA 2AR9A 3PNKA 3G2LA 3AR7A 5EKXA 3RFVA 1IZYA 2YV4A 4XE5A 2Q3LA 3A9WA 1DKPA 3BB3A 1DWOA 5JCXA 4OQFA 3JYLA 3LPDA 4WESA 1NXOA 2RC6A 4RKEA 1YUMA 1ODKA 1P6UA 4W99A 1X7YA 3GFVA 2YXNA 4UE3S 4C4PA 4J0DA 2GZAA 4JBHA 4MW5A 4WCDA 1LPMA 4F4UA 3EDMA 2XT6A 2Y77A 4LRWA 4DCVA 3LP8A 4C88A 1DTWA 2NZYA 4DADA 5CG1A 5FL7A 5JADA 3Q5EA 4XDGA 2ZUCA 4GU5A 2BAGA 2IUSA 2XIJA 3V4VB 3OM1A 2Q50A 4FMDF 2PSSA 3ILYA 4W1RA 5CFOA 2PX8A 1KE1A 3BTOA 5F5LA 2FOIA 3EG5A 2XHZA 3I5UA 4K46A 2H54A 2ID8A 2NXJA 3U7EB 1AO3A 4L15A 3SYTA 2JLWA 1JIIA 3DUWA 3OKAA 2AOWA 4TPKA 4RBNA 3A1TA 4X85A 3MINA 1QG0A 3RKSA 3TR6A 3FLMA 3H11A 3RRBA 3X44A 1BN6A 3SC2A 1MH1A 2GMWA 3E0QA 1H8HD 3KR2A 2QG6A 4PM4A 3KSZO 1JYFA 4FCWA 3D8RA 3JQPA 3UC9A 4AAYA 5ESRA 4JLKA 5JS8A 3ZG6A 3LRTA 2PG3A 3LGSA 4QARA 4CLOA 3AZQA 2QW1A 2VH1A 1TT7A 4U2EA 1A3CA 2E21A 4RZ2A 3WJAA 1D2MA 1JG1A 4EJ0A 1N8NA 4RVCA 4GYJA 2A0WA 5G4KB 1JJFA 1KOLA 2ZP1A 3TWOA 5K3FB 3B9PA 2ZT6A 4TTAA 2UXBB 2WF6A 4AJEA 2VZ8A 5EMKA 1V4BA 3RJZA