4R81A

Nad(p)h:quinone oxidoreductase from methanothermobacter marburgensis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
199
Chain Sequence
ASMHVYILFAHPSRKSFSREVLEAFTEGLSEAGHTYEVGDLYRMNFRSELSQEEYLREISQEAGSPLPEDVMEEHERIGRADALAFIYPLWWSDCPAKLKGWFDRVWTYGYAYFGTRIDIEKAVVLCSAGHTEEDLEGTGIAESMRSVMLGDRLLGVGVKNVTMEILGGMVPGDDSCREINLMRARRAGRNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH dehydrogenase
publication title A novel cytosolic NADH:quinone oxidoreductase from Methanothermobacter marburgensis.
pubmed doi rcsb
source organism Methanothermobacter marburgensis
molecule tags Oxidoreductase
total genus 75
structure length 199
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r81A00
2BMVA 3K20A 2Q62A 1RLJA 1T0IA 1YRHA 2QX6A 5EA2A 3FW1A 1DX9A 3NHYA 3TEMA 1D04A 2QMYA 4Y9RA 4QOJA 1J8QA 5NLLA 4FGKA 2HNBA 4LTDA 1SG0A 3KLBA 3HLYA 1RLIA 3EDOA 2ZKIA 3FJOA 3B6KA 4QODA 4PTYA 2FDXA 1J9GA 1XYVA 1NNI1 2Q9UA 1VMEA 3UXEA 4N82A 4ESEA 3RPEA 3NLLA 4ZVKA 3GAMA 4FGJA 3LCMA 5LBTA 3SVLA 1AG9A 1WSBA 3P0RA 4QOHA 3TZBA 1OFVA 4ZVMA 2X2OA 5LMCA 5FA6A 4C0XA 5BUCA 4YAFA 1BVYF 4Y9UA 4XDGA 2R96A 2BN4A 3UXHA 1ZWKA 2B3DA 2OHJA 2QX8A 3W78A 1TLLA 4PTZA 3U7IA 1F4PA 3TE7A 4LA4A 3ESYA 6NULA 4J8PA 3EYWA 2OHIA 2Z9BA 4ZVLA 2N1MA 2MT9A 3OJXA 2KQUA 2FOXA 3KEGA 1XT6A 2AMJA 3F90A 3NFRA 1FLAA 2GSWA 4C0WA 4NLLA 1DXOA 3G5MA 1QR2A 5LLDA 2QX9A 4QOIA 1H66A 2MWMA 1FLNA 1CZHA 1H69A 5LJLA 1XI2A 1ZX1A 1KBOA 4H6PA 3O73A 3NHFA 3NHRA 1OBVA 4GR9A 4ZVNA 3NHWA 3HR4A 3OWXA 3D7NA 3W77A 3OJWA 3O2NA 2BZSA 2FAXA 3OVMA 3KAPA 5LJIA 1J9ZA 4OXXA 1V4BA 1AKQA 2X2PA 1B1CA 1FUEA 4CETA 1FLVA 2FLVA 3NHSA 3NHJA 3F2VA 5A4KA 1RTTA 3KAQA 3QFCA 3OX3A 5JROA 3QE2A 5F4BA 4BMOB 4C76A 2A5LA 3S2YA 1AKTA 3N39C 4FGLA 1FVXA 2V9CA 2KLBA 4YQEA 5LBUA 4GQIA 3ESZA 2OYSA 1JA1A 1RCFA 4QOGA 1YCFA 4N9QA 1AZLA 4XDHA 1YCHA 3ES9A 1CZNA 1CZLA 1TIKA 1AKRA 2Z9CA 3F6RA 1XYYA 4ICIA 5F12A 4CF6A 1AHNA 5FUQA 1QHEA 1AKVA 3FVWA 2WC1A 3B6JA 4DY4A 1X77A 4QOEA 4YAWA 1QBGA 5NULA 1KBQA 3OX1A 2V5VA 1CZKA 4LTMA 1BU5A 2V5UA 3ESXA 3R6WA 4U7HA 1CZUA 4FX2A 3W7AA 4H2DA 4LAFA 1ZWLA 5EAIA 4YAOA 2FX2A 4Y7CA 2F1OA 1I1OA 4QOFA 1T5BA 3N3AC 3FNIA 2XOEA 2QR2A 4PU0A 3GFSA 1AKUA 2QMZA 3OX2A 4YALA 5ULLA 2M6RA 1YKGA 5TGZA 4HS4A 4DILA 3N3BC 2Z98A 2Z9DA 3ZHOA 2MTBA 3L9XA 5B3KA 4BMPB 4S24A 2M6SA 1QRDA 3W79A 1FLDA 1YCGA 4U7FA 2HNAA 1WSWA 2ARKA 1GG5A 3L9WA 1CZOA 4N65A 4U7GA 2QX4A 4HEQA 1JA0A 3NHUA 2BF4A 1SQSA 2HPVA 1AKWA 1FTGA 2OHHA 5LVAA 3LT5A 1CZRA 4R81A 4LTNA 3FX2A 1AMOA 5F51A 1FX1A 4GI5A 1OBOA 2FVXA 3OWHA 1D03A 3GFRA 1D4AA 2MOKA 3B6IA 5FX2A 3K1YA 2QWXA 3NHLA 4DIKA 2FZ5A 1YDGA 3NHPA 2R97A 4F8YA 3GFQA 1C7EA 1DXQA 5EMNA 4M0CA 1E5DA 3NHKA 4C14A 3HA2A 3QFRA 1C7FA 4NULA 2FCRA 1YOBA 4D02A 2XODA 1J9EA 4YAUA 3F6SA 5B3LA 2D5IA 2W5UA 2BPOA 3B6MA 2FZVA 3JSXA 2RG1A 3U7RA
chains in the Genus database with same CATH superfamily
1J0CA 3IR5A 3JYHA 1Z6YA 4W6QA 4CGZA 2WT8A 4MUJA 1VKOA 3K20A 4WVFA 3WISA 4EG4A 2GXQA 3BWDD 3MLBA 3AF5A 2N42A 4EJ0A 1C1XB 3IUQA 5GONF 3RADC 2DUWA 1YQTA 3ESBA 5CM2Z 2WFLA 3CCCA 5TGDA 1SXIA 4YXWD 1VL6A 4EQ6A 4GI1A 2W8ZA 4LXUA 3L82B 3HVJA 4CTKA 3SX0A 2AS0A 1JN0A 4B2PA 1DCKA 2BJHA 1QRRA 3FYUB 1UK8A 5NLLA 3V33A 5DNWA 3BXPA 2P2YA 1E9CA 1BO6A 5DM4A 4N40A 5DXFA 2GQ0A 2HKIA 1CY0A 1DRKA 1JHUA 1KY3A 5I9NA 3KCQA 2HA3A 5EQTA 3EQ6A 2OK8A 4FNOA 1C7IA 1E3TA 3DEJA 5IKEA 1AS2A 2GEJA 2XZOA 1YR1A 1H94A 1WV1A 5L7TA 1F3LA 3TW6A 3H2SA 4NCNA 1RLIA 1DINA 2ZAGA 4RE6A 3BERA 1AY0A 1YRYE 2GBGA 1B93A 3IBGA 1BQ4A 4WV3A 2X5KO 4IKEA 4L4UA 3E18A 4ZT5A 3X1MA 4ARCA 1FYXA 1E4YA 2UZ3A 2XKJE 4ZV7A 3MCTA 2HAEA 3ZX4A 5B4UA 4FGUA 4ZOLA 2GYVA 3HH8A 3R0ZA 4OA5A 3OPVA 1EE9A 3PXDA 4I9HA 1T2UA 1U8TA 2QAGC 2VEOA 5B3JA 2J3EA 3NGXA 1XVAA 4KACA 1MKYA 2HQSA 2RHMA 4UBOA 4RW0A 2XRZA 3TI7A 3AHFA 4RM3A 1JXMA 1TD1A 2HF2A 4TKMA 3NTVA 5E95A 4R1NA 4LDZA 4MWEA 1PFWA 4FEAA 1S8FA 1JPUA 3DGFC 2ZT8A 8MHTA 4AQYB 2NPFA 1A8PA 2W6OA 1FYWA 4RMGA 2VYND 4KX5A 4M0MA 2YL2A 3QK7A 2QRUA 4XGKA 5REQA 3MBOA 1GZUA 4BL5A 4OSOA 3PT5A 5C5EA 4RJ2A 1UADA 1JSCA 4MUXA 4YS6A 4BFTA 3O74A 3TRJA 2ZDHA 4AJ9A 3TLGA 1LRJA 2CXTA 3DMRA 1JG7A 5LBTA 3AF6A 4J1NA 1RBMA 3FWKA 3WV4A 4ZTZB 2VAWA 4P34A 4AXXA 4C5CA 3GGDA 4CF7A 3QNMA 3KPJA 1NE7A 4FYMA 5CTAA 4ND8A 4KE9A 2VL7A 4MPJA 1STOA 1WAMA 4OA8A 2HA0A 2YMQA 1GR1A 1A9XB 1HQYE 2P9HA 3NDPA 2OQVA 3U19A 4DIOA 1HOTA 2WAMA 3WQHA 3NV7A 2BHRA 1X80A 3IHKA 1ODLA 3DL2A 3VPXA 1GVHA 3EXAA 3OCWA 3OLCX 4RJTA 4BKUA 5BWMA 3L1JA 4R8KA 1JEYB 1XHLA 5EWJB 3GK3A 3C5CA 4KQ2A 4LF4B 1JKIA 2J8ZA 3D6VA 4ZDWA 4P82A 4RL6A 1KR5A 1U3UA 2BJVA 3H2GA 1VJ5A 2X7XA 3OT1B 5CYOA 1XZCA 1P2GA 4H15A 4HFRA 1U1EA 1M0TA 1D6SA 4K6GA 3EGOA 4IQ4A 3QBTA 4L9RA 3X2EA 1RRMA 4ZGWA 2C4TA 4HNQA 3K0CA 1IONA 1Z3CA 4DCPA 4NJEA 3BD8A 1DVRA 3DFFA 4PW0A 2G9NA 4QUHA 5F23A 2MT9A 3KOXA 4OCZA 2G09A 3B53X 1BGVA 3MNFA 2HIMA 3WLFA 3H4MA 3F5DA 3W4KA 1YD7A 1YZGA 4ILEA 3INNA 3FIJA 2YCBA 3I76A 5BSRA 5FF9A 3OZUA 5KJEA 1I4DD 2KQUA 4WWHA 4YX9A 4QLOA 1IY1A 3KEGA 5EWLB 5I9MA 5DNCA 4MUHA 2NU6A 4DLUA 5FQNA 5IBRA 2HJRA 4OJKA 1CC1S 1I5EA 2ZR8A 2RGBA 4QO8A 1MAWA 2DF8A 5CYGA 2NO6A 1NSFA 3NHAA 4TTQA 1JG1A 4GOOD 4DV1B 3QX3A 1DXOA 2IA5A 5JS8A 3AVUA 1YAHA 2WP0A 1HDOA 3D3EA 1XU4A 3ENVA 4LSZA 2H2HA 1A9SA 3IA2A 1VL0A 4R2IA 3EIQA 3IR6A 3PNLA 2JL1A 2EJWA 2Q4DA 4GD3Q 5LLDA 1E94E 2VJCA 3FKSD 4UM7A 1FUYB 1Q44A 2WV9A 3KQKA 4JI4B 2JI7A 3DBVO 3VU9A 1JJIA 2IDMA 3EXHB 2F62A 4Q34A 5JAOA 2XMQA 1S2IA 3D81A 2HLNA 5A0VA 1E18A 5F2OA 4NBKA 1SULA 4P81A 3BRWD 2X8AA 1DO2A 4TUYF 4RBNA 3VZBA 1Y6GA 4Q4CA 2VHCA 2G1PA 4UEJA 3G23A 3W34A 2EVWX 1WX1A 2XEDA 1A2BA 4HUTA 5CJ2A 2VSFA 4QDZA 5DVZA 3EQ7A 2OM2A 2HRQA 5H82A 1KZ9A 2A0WA 4P0QB 1CP3A 1CQIA 5JJBA 2GO1A 1E96A 2BI8A 4ZVQA 3QUCA 4BO3A 1FFGA 2EW8A 4JP5A 5EXXA 1WETA 1I36A 3L77A 4JD5A 1WSAA 3HCPA 4M1KA 1P8AA 4MMXB 1VPDA 3R3JA 5C81A 1I3MA 2YYAA 4LXHA 3QTTA 4KJXA 1MOSA 2WM3A 1I2MA 1NP6A 4HH0A 2J3LA 4NU8X 5FWXA 4GXNA 3ND8A 3NEPX 2NNWB 1L5FA 4MB2A 5CT5A 5AYVA 1C9KA 4R1PA 5HMMA 2YYYA 1ARZA 1FRQA 3MXOA 3UJ8A 2ZS7A 4A92A 3OLQA 4WINA 2HSGA 3EIFA 4AWAA 5HYVA 1D1TA 1VZ3A 4HDSB 3HPQA 1CKEA 4CIVA 5CA1F 5LZ9A 2OWDA 1DRVA 1M6WA 5IVDA 1Z0KA 3QI7A 3KQVA 3N59A 3HMQA 3ZU4A 2BHSA 4E08A 4EA6A 4URXR 4OXXA 3RGGA 5JQGF 2VVTA 1AKQA 4P54A 4BRUA 4MV3A 5A9SA 4DR1B 3DHEA 5A1JA 1PFQA 5ES4B 3S2SA 4JR0A 3DP9A 1GPNA 2XT0A 1XHFA 1KPHA 5HKBA 2AOTB 1F1JA 2BE7A 3C45A 5HBRA 5LUBA 3UJPA 2WZCA 1B3RA 4R8RA 4IQ8A 4DJAA 3GX1A 4Y0VA 2A0KA 1DKQA 3S6JA 4HQ0A 5B7GA 5C53B 3A14A 5I9SA 3RIHA 5AK4A 2IS1A 1M5UA 1HI9A 3GELA 1L5SA 2DFVA 1ZJZA 2Y6VA 5CCDA 4Z86A 2QZSA 1FBTA 1JVSA 1X2EA 4FU0A 4MRAA 1Z28A 5K0GA 4ITRC 4XD2A 1PJAA 1N0WA 4E09A 4S12A 1PLLA 2EW1A 2V7EA 2J0EA 2XQVA 3MJRA 3OEHD 3T7KA 5DHPA 3ELDA 2ZAYA 5DW0A 1KQ3A 4B73A 5HOEA 4MV8A 4BUZA 4OFZA 1MTZA 4LJ9A 4ZI7A 2H00A 3GRRA 1PR1A 1M8FA 3VYVA 2PS3A 3A6EA 2GEKA 1PJSA 3OZXA 3C6BA 1OR8A 4L15A 4MJLA 3C3CA 2G3YA 2QP9X 3MW8A 2VBGA 3BWCA 1RXVA 1BMQA 3PJGA 4BX9A 5IZ4A 5JSZB 2IYSA 3T7CA 4KFCA 3E82A 2IYXA 1WPXA 3V5NA 3WIEA 2C84A 2ZUDA 4OI0A 3D0QA 4PG4A 1NE2A 1NUSA 2P3SA 5EWMA 2COKA 5CYPA 5EIFA 1OXMA 1UFVA 2WSBA 5ALZA 4RLSA 2JCBA 4C4OA 3MHTA 3BDVA 2OFPA 5CIQA 1LDGA 1WD7A 2EX4A 3FPHA 4AN1A 2GARA 1CY2A 3GEDA 1NJ6A 2EF1A 2WWXA 2HF9A 3KLNA 4L0QA 4PYMA 4BO6A 4M83A 3ZJTA 2X2FA 3OU2A 1UMCB 4BDSA 3HZOA 1ZN8A 3LUGA 2IUSA 1T43A 5AT1A 3BORA 5F12A 3D7SA 2GR9A 1ONPA 3DMTC 1HEUA 2ZQYA 4FZ3A 1PR3A 2HRZA 3OPYB 2NOAA 4RLHA 3UPDA 2X13A 1JS1X 3MTJA 1KQNA 2ZBFA 3PSAA 4AG5A 1EFVA 3EXIB 4BNHA 4DY4A 4EFLA 5KWSA 4EUKA 4ENRA 4DCVA 2X58A 3GMDA 1WTAA 4G1CA 1Z73A 1O9BA 1WY5A 3A04A 3O8QA 4JS0A 1QFMA 1I3KA 3RUEA 4A6PA 3GLFE 3ITNA 4X90A 4MVJP 5DHRA 1Z2CA 4AZTA 3HHEA 2V7XA 2P9EA 3ETGA 1VP9A 2H4WA 3Q7IA 3B1ZA 2JVKA 4G85A 1ZU4A 4I55A 2X8JA 3F9RA 4RD1A 3LW8A 4OXIA 3GDOA 1CZUA 1ZA2A 1NW7A 2D4HA 2UYGA 4PO3X 3SHQA 4DDTA 4WT7A 4D9KA 1BROA 2E87A 3TZ6A 4FMBB 2GJ8A 3TLZA 3WL6A 1HORA 3I2IA 5TMEA 2BCGY 3HBAA 3L7YA 2VSQA 1GNQA 4LAFA 4XIJA 1MV5A 1RHJA 2JGMA 1U7TA 2PKQP 2CLSA 1CNFA 3G68A 1KP2A 3JQGA 2WUDA 2RHJA 4MPTA 4S2UA 4X7PA 4UM9B 1PN3A 2PWAA 3KX2A 4F45A 2E4AA 4F96A 5BN3A 2HGZA 2PZLA 4UU0A 3DVRX 3LP5A 4Y2TA 5CJPA 2DQKA 2ZVJA 1TK9A 1P1FA 2WIFA 2HPHA 4HAOA 5AHRA 4W4TA 3VGJA 4BC1A 5BY2A 2XMSA 3FVTA 2VHXA 3NTUA 2CB9A 1OU0A 2EKPA 4E4YA 4H0FA 2X0EA 4FQ5A 3QY0A 1RYYA 2RFLA 3GFSA 1VMKA 3FWHA 1ZXBA 1BKDR 4HPXB 4RWEA 2I6XA 3ZTYA 1FMFA 3GD5A 1PV4A 4U00A 4WK4B 3K9WA 1W35A 2JBWA 3KOWA 5JANA 1NJ2A 3EGDA 3KU4A 1FRVA 4CM9A 5DI9A 3EHEA 3U3RA 4KR0A 3G9TA 3T61A 3MJFA 4XR4A 2BR4A 1VIVA 2B4YA 5DEIA 4B0PA 1N32B 1BX0A 1MAUA 2IHJA 4O4JB 5HXAA 2VG8A 3NONA 3W7VA 1LLCA 1MC8A 2EDCA 2KYRA 5DOVA 3EC7A 1ZGAA 2FP3A 4QJIA 5EUBA 1E1LA 3OM1A 4RK6A 3TSCA 4DCNA 1NOJA 2XUQA 1YFLA 2FXVA 3JD2A 2QQEA 2IIQA 1W8IA 4JMLA 3DS8A 1M67A 4RWZA 2WSMA 1CHNA 2DCMA 4KODA 4UUOA 1YUMA 2CLLB 4D2IA 4G0WA 3WRXC 1C3LA 1QCYA 4YWHA 1AGPA 1W2HA 1UZLA 1ZH2A 1F48A 2JPDA 2QMQA 2ZTLA 1CJKC 3IQDB 3C16C 2J5KA 3LUJA 4IRXA 4O2AB 5HSGA 4CDGA 1UJNA 4FOSA 3G8BA 3ZE8A 4WEQA 1IBKB 2BIFA 2I99A 3GGJA 2OTCA 3BMXA 4J0IA 5DOZA 3DT6A 3OAAD 3ZE1B 4PVCA 1P1RA 3TLAA 3SS8A 4A3SA 1JA0A 1TVKB 3PWSA 4IIFA 4F2DA 4DREA 5DGTA 3O21A 4FTWA 3YASA 2QMOA 1W46A 2B7LA 3EC1A 3GVXA 3CGWA 4IUCS 4ER7A 4UTVA 4L3WA 2BFWA 3AUYA 5CLQA 4UMVA 2CNWD 4KSCA 2Z56A 1IHUA 5F3WB 1ZK1A 2PGXA 2E0IA 3U17A 3WB9A 4YDSA 1AM4D 3CUUA 1JE1A 2PU7A 2E5FA 3GRVA 1NW6A 1Y8QA 1SXJB 4MEAA 4IDOA 3ZWPA 1Z6TA 2BMFA 2I4NA 4ABTA 1X70A 4QX6A 1OMOA 1WV0A 3ZD8A 3ZY4A 2WR8A 1UC8A 3FX2A 5JD4A 2XMRA 3GOHA 1RS0A 3RHFA 3RRBA 1OX4A 3MCUA 1P1BA 4EB6B 5THXA 2Z2KA 3FZQA 5J40A 4ER3A 1JTFA 4GNRA 1MG0A 1Z0IA 4I66A 3U7JA 2NV6A 3F4LA 4GDMA 3T4EA 3SF0A 4E33A 4FX5A 3CLRD 5ILOA 4H77A 3VR6D 1C81A 1LC0A 2FXIA 1ZEMA 4IH9A 3ZXIA 4EYGA 4UXHA 2G7MC 3WZLA 1BDJA 1O96A 1M2VB 3PF9A 4INPA 2ATVA 3EFEA 3GJ8A 4UZFA 2O8DA 4O29A 3RG2A 4YMUA 3GW8A 5KNCD 3L0BA 1Z6AA 4JEMA 4NK5A 2QX7A 1RVV1 5JPDA 3C2QA 3K9BA 4EKNB 1NBAA 1J0BA 3LO8A 5E3IA 3SNHA 1W9MA 4YAJA 4OO3A 2WSYB 3RFTA 3R41A 5GP1A 1JG3A 2XE8A 2FFQA 1VB3A 1RPNA 1JF8A 2CE2X 2VRNA 1GL7A 1UBFA 3QVKA 4J2TA 1SOUA 2FY8A 5HGJA 4C14A 2W22A 3SHFA 3W2EA 4IDQA 5I4BA 2XF2A 3RYCA 2CLMB 1L7VC 1YMUA 2O6LA 4X5OA 2ECQA 4HMQA 3WKDA 2N3ZA 2DUJA 2O2JA 4FMCB 5M34A 2AH5A 2C95A 3RSSA 3HMKA 1HZZA 2GBLC 4FK8A 4YAUA 5WRFA 4PLGA 3JWPA 2OV8A 1YDMA 2PVCA 5F7JA 1EE1A 3TZKA 3TKAA 1K68A 4E5MA 5K4GA 1WCYA 1KYIA 3INTA 2O54A 1ZDMA 1BSVA 4IJKA 1TYAE 1LI5A 1RXIA 1N92A 1FFWA 2PZBA 3FYHA 3BTVA 2ATEA 3E6AA 3DVAB 4E3WA 4K9LA 4LYGA 1L7RA 4OH7A 5KWVA 1ZL2A 2A1TR 3FNFA 4GM1A 3L7OA 5LC1A 3RVJA 4DA0A 3G0DA 2VZ8A 1JIJA 3UJAA 1T0IA 2JLWA 1IBRA 2NUAB 1H2WA 1IH8A 3C43A 2JS7A 3H4IA 1KI9A 4ONEA 1EUYA 1XYGA 1YQEA 2Q21A 2QYTA 4HTAA 1LUAA 4KW7A 1NMEA 3NHYA 2W4IA 4RLFA 4YGXB 3R24A 1G6Q1 4N41A 3JAKA 3FUUA 4HV4A 1Q1ZA 1CUFA 4TMXA 4CEHB 5JD6A 2GWRA 2RC5A 1KYWA 1Y1RA 4V1CI 1VXRA 3Q8XB 4GLFA 4CVNA 5AW3A 1LTHR 1RRPA 1DBRA 4JU9A 3TLEA 1QHSA 1O2DA 1V2HE 2WILA 4CU5A 1P9RA 3DULA 1NVEA 1IEQA 1UT6A 2FMFA 4NONA 4BO5A 2X0RA 3JZIA 3QFSA 3SF8A 4A8PA 3LU1A 4JC8A 4MKIA 3A7DA 4Y67A 1GYQA 1TM3E 4LF9B 1EUCA 3PHHA 1C3JA 3T7TA 3T3DA 3CCBA 5MN6A 2VQFB 1FOEB 2PUTA 3R9IA 4OOFA 3RYFA 4AJLA 2EEPA 2RONA 3OTIA 5DSXA 5ELLA 3TD6A 5CTJA 2ZKIA 3H8WA 1JMVA 3H5IA 4QJ3A 3MIIA 2CW5A 3JD3A 1X1EA 2AEJA 3JALA 1DAIA 4O1MA 3UJHA 3IOYA 5LZ5A 2FQ1A 3SQLA 3B6KA 4KREA 1W581 3WGJA 2AK3A 1W4RA 3ZDRA 4IRUB 1ZD5A 3BD6A 3E58A 3HB0A 2BMDA 3N7AA 4M49A 5ALIA 3WGMA 2QF7A 3D8SA 3D43A 4ZMSA 1XWWA 3PEVA 3ZHSA 1DADA 4ZPXA 3A3YA 1SUWA 4YRNA 4KXXA 3GGSA 4OHWA 3TQRA 5HR5A 1DELA 1NC1A 2WJHA 3JATA 2BGKA 3ETNA 3K1JA 2NU9A 3OPXA 2YJ6A 2XVZA 1E2EA 4NESA 1I7DA 3SQDA 1EFAA 3E84A 3R0JA 2GVZC 3ZV6A 4RPKA 5EQFA 5EG5A 2OLKA 1THTA 5C51B 1PJRA 4FPXA 3IIKA 2HCJB 1RCUA 5A06A 2PUVA 3K0EA 3RU7A 2PIAA 5J1TB 4KQJA 5IF9A 3RK0A 2QV0A 3S27A 4Q12A 1KK1A 1TT5A 1UMKA 4JYCA 1MUUA 3OIDA 1U2PA 4H4CA 4HAWA 1T9AA 2P7HA 5C3MA 5JY1A 3UNXA 5C8VA 3DCJA 5DBFA 2B99A 1E3WB 2JKZA 3BX1A 2QPOA 4KN6A 4NCXA 1II8B 3FDIA 1NAHA 2W2LA 3QVGA 4XGNA 4X71A 4OHRA 4XXHA 3TBHA 3GEMA 3HJBA 1N9GB 5JAZA 2HOQA 2IOHA 3I1FA 5JNWA 1UZUA 2WVHA 4O0MA 1EGVB 1PGNA 3L6CA 2O7SA 3SEFA 2IEIA 2Q5QA 3IL2A 4L7VA 1DMSA 1UT8A 2NADA 1FZQA 2DX7A 1QP8A 3DJYA 1ZBDA 1I5OA 3B8HA 1VXOA 2B3DA 4E5DA 1IZ9A 3KTAA 1QU3A 5IPFA 4AZ3B 4CMBA 3PIRA 2YFHA 1HT3A 5B7PA 2R6HA 3C3MA 1I7PA 5KC8A 4QXOA 3I2KA 4R0NA 1ML3A 2WD9A 4CL0A 4CDRA 1I3LA 2QRGA 4R4JA 5LP6C 5IG2A 3WYEA 2HK9A 2V4ZA 1Q3HA 1L7BA 1O9HA 1Y48E 2OKGA 1LRKA 3AUAA 3IT1A 4O4JF 4BVHA 5BUQA 4M1SA 5I45A 2CNBA 1H6AA 3PUJA 5EZYA 3IT2A 4PRLA 2YICA 4H3KB 4Q4HB 5CVJA 2K87A 1OLXB 1PUXA 3AR6A 4DJFC 4QJ4A 3P45A 5AIAA 5IARA 1FXSA 1VL5A 2AXQA 4KDFA 4TTPA 3NORA 1C30A 2YHAA 3AHCA 3W8DA 1XXHB 2CXUA 4DMMA 4MUGA 1U2RA 3TNDA 2XA9A 1ISIA 3THXA 1TLFA 2IEZA 5J59A 9ABPA 5FJJA 4W5RA 3H2ZA 4D3XA 1JYEA 1M54A 3I0NA 2C8VA 1QR2A 4HZUB 3IIJA 4BTLA 5BW4A 4Q1CA 2HU2A 1VLQA 1W0KA 2ZANA 1JLMA 5FTLA 4GP7A 1GR0A 2UUAB 1O0SA 1COWA 3UN1A 4XVUA 2ZT5A 3II6X 3LFTA 1KDZA 2ZTHA 3RAJA 4AJ4A 4BBJA 4FFDA 3PC7A 3FPLA 4RPIA 2JGLA 3KVOA 3TW0A 1YUNA 4E1BA 2I6UA 4M37A 1P60A 1YZLA 3KP1A 3WIVA 5BN1A 1ZHHA 5HMLA 3ND7A 4IX9A 1ZUNA 1OV6A 4UCWA 3T3OA 5AJWA 1KSGA 4E51A 1XQYA 5CXXA 4UUAA 4P84A 3MT7A 4ALIA 3KYIB 3AZOA 3DMPA 3E70C 2UZ0A 2VSYA 2C3UA 3RYIA 1Q7GA 5JASA 4LNHA 1V3UA 1R8SA 4E5NA 1TGYA 1RVDA 2VP2A 1EH5A 1VYVA 3DEKA 3R09A 2PFGA 3KR0A 5JXHA 3DM5A 3TIGA 1ZN7A 1OCEA 4UHBA 3TLCA 3WGYA 1K97A 1LTQA 4ESOA 1IM2A 1E89A 3G9ZA 2FQWA 3LUKA 4HMOA 3TKYA 2FPIB 4UFNA 3OVMA 4MUYA 2F1IA 5LIRA 3CVUA 3PA8A 4TYPA 3AFHA 4H1HA 4UQLA 4Q4JA 4C7OB 2Q3HA 3MTEA 3AILA 4V1CB 2GO7A 4M99A 1BXZA 1E1KA 4B79A 3S5JA 5I7AA 5ALUA 2PMEA 3WMEA 1LU9A 4EATA 3LDHA 2JEZA 3GG2A 2AZMA 3M1LA 5F35A 3I92A 4C1NA 1OI2A 4DABA 4EDFA 3T06B 3U0BA 1HKHA 1Z17A 4BNDA 1QO7A 2AN4A 4GPD1 1VIDA 1GA6A 1KS9A 5DCYA 3T4XA 2YWGA 3SY8A 1E6WA 4QGHA 3T54A 1KVUA 3O3CA 4MW2A 4TWIA 5F3RA 5A4DA 4RTPA 3EMVA 5T6MA 2WKQA 4CM7A 2DJIA 4FMCF 3A9TA 1WTCA 2NO0A 2Q5EA 4ZOEA 3REQB 2RAPA 1Z4NA 2O8BB 4KG7A 5CFZA 4YLGA 1Z4QA 1N2CA 2VWPA 1UDRA 1XD8A 2WOOA 2YWBA 3CW8X 4NFLA 2WQ7A 2Q6IA 2IKQA 3A1VA 1O77A 2C9CA 4YAEA 3NFYA 1HRKA 3OLVA 4ZT4A 4BP9A 2X0FA 1A7JA 2Q1YA 3QE2A 2LDBA 2P4QA 3TEJA 2AYXA 5DNDA 4EPWA 4XASA 1RXCA 3JPWA 1E1QD 2VC2B 4HLCA 3PJDA 3AHIA 4LRXA 4P4SB 3R9WA 3VR4H 1VC2A 1L9KA 5DHQA 1TIPA 2J87A 3VDRA 4ZVVA 4OG2A 5IM5A 3SAJA 3F97A 5A71A 4YUWA 1CE8A 1NXVA 1SVIA 2ODTX 3H1FA 4AJEA 2P9FA 3IV6A 4V0MA 3CURA 4FFOA 1ZFNA 3AETA 4RFLA 1TFUA 3GPLA 5E8RA 3JQBA 1AU9A 3CKKA 3V1TC 5DM60 4RQBA 1ANKA 2JCSA 2HBYA 3C4JA 3K9NA 4HB2A 1EXVA 2WYIA 3RSLA 4MUNA 3GEHA 1YOVB 4GXTA 2VPQA 5ALXA 2PDAA 2WTXA 5G1PA 1EFPA 5EFZA 1M6EX 1JG6A 4LRWA 1N7HA 1VBNA 3C6KA 3JAWA 4L85A 2JFVA 1W0JD 2BVNA 1GG2A 2OCXA 5E3JA 4HB3A 1M2NA 5E6UB 2IV3A 2OV4A 1PZEA 1AHPA 4IXWA 1BE0A 3ZCQA 1L5GB 1KP9A 1SD2A 2FE4A 1E6EA 2OBNA 2XCOA 4R83A 3ZXXA 4C05A 1C9JA 1CZNA 3K2IA 1GAEO 2ZPTX 1ORTA 5I9LA 4N3NA 1IQ0A 3R7BA 1Y1TA 2EHDA 1BDHA 4LV5B 3U4AA 3E3LA 1CY4A 3RSHA 1FMJA 4LFBB 1E9EA 1TM1E 2BM9A 3RUHA 2Z9CA 4HGYA 2JGKA 3MLEA 2Q4EA 3JQ8B 1GN9A 2B8NA 3FUXA 4IVRA 4J9VA 2Q9AA 3OQOA 5B58C 1JLLA 3WFZA 4RA6A 3V2GA 3WRWA 1Z5UA 2X14A 4OQEA 2IYLD 4WMLA 5G4KB 5L7YA 3RIGA 4D5EA 2PFSA 1Y34E 5JYCA 3KWMA 4CI9A 3B7GA 4LGCA 1GADO 2Q2VA 2VZEA 1M7HA 3SHWA 3ELUA 3RNLA 3CZAA 3AFGA 1CYEA 3B1YA 3BHJA 3L5OA 1E2BA 5TPZA 3PEYA 4K1XA 4XJSA 5JXIA 4EVRA 1JXAA 3PRYA 4PC3A 1BG6A 2P6UA 2R5NA 4Q4DA 3C6ZA 4S05A 3EA5A 1NT2A 4EGSA 4B6QA 1I2ZA 2MSLA 3R7FA 1K88A 1SM4A 1TPZA 1ZVKA 3IO3A 3Q5EA 3Q7SA 3R6WA 1EVIA 1OFIA 2PIDA 2K4MA 3FFBA 4PGAA 4D74A 4EAAA 1QH1B 2ZR7A 1XC7A 1NU6A 2C9YA 2I3DA 2GM9A 3LL7A 4R2KA 5B3AA 2BDUA 2B0CA 2V7PA 2X8WA 3ND9A 2VNJA 2XD4A 2ZU6A 1K06A 1NVAA 3FZGA 4H2DA 3ZC3A 4AW9A 3H8JA 3ZQJA 3L4EA 2WJZB 1FSZA 1FQKA 4IIHA 3S2UA 3OTQA 4LDAA 2XZTA 4M6WB 5F5NA 3COPA 5FRDA 2J9RA 2WPDA 2VDWA 2PL3A 1PEDA 2OSVA 1H3NA 2C29D 1P1KA 3B9RA 3DKRA 2PWPA 4HN9A 4BFLA 1CRLA 1J6UA 1M72A 2HB6A 4UBNA 1X42A 4A8JA 5CFLA 5HUJA 1H3FA 3SXJA 4E32A 3N58A 3PFNA 3QRWA 2X77A 5L7WA 4DIMA 3F71A 4KQEA 2E4XA 1RRVA 1VL2A 4IWYA 2V7VA 1ZZEA 3EGXA 4RIHA 2CLEB 3CUWA 4MVJD 4CUKA 1LPNA 3OLZA 4CODB 4QVKA 3X2SA 3PRKE 1V8DA 2UDPA 2NP6A 3E2PA 4JSYA 3B7WA 2J3DA 2OMEA 3T34A 3QVTA 2Q1TA 3PFBA 3H75A 3JY6A 4L5JA 1EFKA 4X1IA 1CQPA 3QYPA 2AG5A 1RI2A 3MJCA 3R6DA 5JD3A 4EKIA 2QKYA 3NWOA 4I46A 3DWFA 5FI0B 4OREX 5HUQA 3ESQA 4L6AA 5CB4A 3Q10A 2QTNA 3BXOA 5IT5A 2PRZA 2ZFUA 2H4XA 3PNPA 3OIVA 2AFHA 4HDOB 4S24A 3EXG1 1RAEA 4QKQA 4LDPA 4B8WA 1E9FA 3TD9A 1YCGA 4HZIA 2BGJA 3GJTA 4L0DA 3PCXA 4DHWA 1Z7BA 4R2MA 2CFRA 1YDFA 3HNOA 1WDKA 4QAQA 4XM2A 1WXXA 3W5SA 2CKMA 4RTQA 4WN3A 4CN8A 1THMA 1SXGA 3BSSA 3ZEAA 3JQPA 3FTDA 2RGCA 1ICEA 5K3AA 4LVOA 2QX4A 4IDGA 3TQOA 1M8JA 1OY1A 1QIDA 1FP2A 2G76A 4WESA 1JEJA 1NI4B 4IXNA 5FOVA 1ZMBA 2O4UX 3OCYA 3AUUA 2J5XA 5P21A 1Y1QA 3UWSA 3OM8A 2ZYUX 4TWZA 5E7IA 3P4YA 1KR2A 4MRVA 1UWKA 1JFVA 2DPLA 5DI3B 4Q3OA 3HBNA 1SC9A 5FWYB 5SY9A 2FZ4A 4UVEA 3C8HA 5L95A 1QC5A 4KU4A 4BQIA 4BQQA 1C14A 3COVA 3FETA 3MELA 3CUKA 3UGJA 3IDQA 1ZN9A 2CXNA 4YVFA 3UMGA 3TG8A 2DERA 2ZIGA 5DGCA 1RQNA 2A3RA 3O9VA 1LCIA 1M1YB 4FSDA 4AKSA 5K8IA 1UXJA 3L8YA 3VNBA 2PO7A 1QH8B 5EKTA 1PK8A 2ODNA 1C1YA 2AFIA 2H1RA 1Q0UA 2I6FA 3C15C 3HKCA 3L6EA 4TSRA 4YP7A 4ARIA 2IHVA 4AUEA 2O0MA 1YR2A 4ZAWA 1B23P 2R6FA 1KJ8A 2PGAA 2Y2VA 4TM7A 2ZROA 2OZKA 1PD0A 4RM2A 4GYYA 2G4VA 4X95A 4FB4A 5CBPA 2XHEA 1LD3A 5A6SA 1QGUA 3O75A 3R9KA 2EGUA 3NHLA 5K51A 4WNYA 1ZD8A 2B21A 2GDZA 3O31A 4YCCA 2NYRA 2WJ4A 3DE2X 5AVKA 3SK0A 1F2TA 1EP3B 1U1GA 3D7KA 5JS7A 1RHRA 3ZWNA 3G89A 2R97A 3ANTA 3B51X 2MSCB 2H4ZA 5LXTB 2A5YB 1JV2B 1IY8A 3DYVA 2PANA 1ZH6A 4XPIA 2Q46A 3JQAA 3L79A 2AT1A 1WZIA 3K4HA 4HGZA 3BGDA 4IZHA 5GV7A 3THSA 3QFRA 1GKLA 5COAA 2C4VA 1FW6A 5K3FB 3U80A 3HB4X 1UKYA 1VPLA 1YACA 3ZDQA 5AQEA 3DE1X 4BRSA 1YFKA 2QTLA 1GA4A 2ZAIA 5KIAA 1KKLA 1J9EA 4GHWA 4IMPA 2XHZA 1TVCA 4JODA 3PDJA 4JBHA 5AVVA 4KMMA 2XTZA 1C7RA 3LLUA 3S0JA 3BFXA 4JOQA 4M98A 3OZDA 4Q4AB 4A8HA 4PWZA 4UOQA 2SECE 4LNUA 3T5GA 2W83A 1VI5A 4LRTB 1RM5A 5HJ2A 3NQ41 4FZJA 1HFJA 3MJHA 1TU0A 4UASA 2FJPA 5AKJA 4FBMA 4AIIA 4A10A 4UVIA 3UHAA 3GDHA 3LDUA 3OO1A 4BJHB 2GM3A 4CMCA 4FHDA 4WZZA 1EK6A 1ZK2A 1M2OB 1FXWA 2BUAA 2F3PA 3A1UA 1O5OA 4PZPA 4DDKA 4F4UA 1SHJA 4D8WA 3KOZA 3IYLW 3L8HA 4DJ5X 3VA7A 1IXYA 2ACVA 3CA8A 2PKCA 1LVGA 5CG2A 5KINB 4JLPA 3AESB 4ALLA 5GADl 3ZK8A 3Q8MA 2QMYA 1RFLA 4WNCA 2C7OA 1A04A 2EAUA 3NBKA 3STTA 2HLHA 4Z51A 1QQ7A 3A1NA 5DNUA 5LU8A 2HZ7A 3U26A 3NVDA 1J8QA 4HNHA 3FLMA 4KPUB 5BRNA 3WMRA 4L7QA 2KHZA 1YFZA 2C57A 4H7KA 4BUCA 3JD4A 2F59A 4NPHA 3VYWA 2OD2A 4CE6A 4IH4A 4CRWB 2VRWA 4I4TB 4OPMA 1AUXA 1FYEA 3VYUB 2FFHA 2PYIA 1L7MA 2XXBA 1P9LA 4OHBA 2FZWA 2QRHA 4ER6A 4M1TA 2GD6A 2BR3A 4GS5A 3KLBA 2FN4A 1HWYA 2CT8A 3A58B 2SCUB 1RC1A 3MOIA 3DT8A 5D00A 2RHRA 3BWXA 3LKDA 3H5NA 4BAUA 3FCAA 2I3ZA 1V25A 4A15A 3SE0A 3WIOA 1MBZA 1U5BA 3HBJA 2K2QB 3P9SA 3PGXA 3NPAA 1IK4A 2BDTA 1U9YA 1ZJYA 3N28A 4NP6A 1LEHA 3KTFA 5KMGA 1GV0A 1HURA 1U9IC 2H06A 4JVMA 4KRGA 5AOAA 4FR5A 4ZJZA 5J43A 1L4HA 1G21E 2GPJA 3EFOB 3OUUA 4ZCQA 2DWCA 3WK5A 1YF3A 4FIZA 1ESDA 4M86A 1FA9A 1P31A 2JFFA 3AOGA 1H0RA 3NBYC 2VJMB 1NMXA 2RG7A 5DASA 1D4OA 4LJAA 1Q6YA 2C8LA 3C48A 3QE0A 4Q5IA 3AOEC 4RS4A 1WIWA 4UEWA 1JH8A 1REQB 4L27A 5TLSA 3UB4A 3CLUC 5GGXA 5IM4F 1UKVY 6REQA 1WWKA 1VGQA 4F6LA 3GHHA 4OFBA 5K2MA 2GEBA 3P9QA 1J5XA 2VZLA 4URYR 3PGKA 4CFZA 3MINA 2OC4A 1O6ZA 5F9FA 3BK7A 1WKVA 2V1XA 2XX3A 4V0SA 3DZDA 2BJWA 3EZ6A 4JOCA 1GO2A 8ADHA 3RC1A 3K8QA 1LPAB 1KDRA 3REFA 1ZLXA 4I6GA 3WDSA 2O8DB 2YUIA 3EVEA 3V9PA 1ATIA 1CYDA 1IUPA 1ZOOA 1T2CA 1WVMA 3NTRA 3LIIA 4C6TB 3GLKA 3BREA 4R1LA 1NN0A 1PP4A 4GX5A 3ZN2A 2CXQA 3CLTD 1LDBA 3PF8A 4REQB 5ECWA 4M55A 1K5HA 5FTNA 3Q2IA 3ZYCA 1JDBC 3R3HA 5CH8A 1Y82A 2QX8A 2FFRA 2J85A 2W6JA 1YMQA 4LK3A 1VJCA 5I9BA 3N8GA 3LUDA 4RVOA 5E0OA 4DV2B 4OQLA 3PV0A 3JVIA 1G20A 2IF0A 4JUDX 4RV4A 3TJZA 3S2ZA 4PHGA 1F3OA 1L5HA 4GKAA 3I3OA 5FFNA 1DIRA 2D1FA 2PD6A 3G7UA 4A2CA 3MWEB 5BV8A 4IEEA 2W11A 5AVWA 2WLSA 3FSJX 4YASA 3HXPA 5FPQA 4OQYA 2WHYA 2GAFA 1QYWA 2I4RA 2XQKA 2HEGA 3PI7A 3D3WA 1SUIA 5GONA 2DMRA 1FTSA 2FPPA 3LOPA 4Y2PA 4AMVA 3I5XA 2WZDA 1E5QA 4KR7A 2ZRPA 2PCLA 4PO8A 3F4BA 1RKXA 3DOJA 1PWHA 3L7JA 3NM5A 3DFIA 3QV2A 3LT2A 1H0HA 1ORHA 1TMKA 4OX9Y 2JAHA 5T3UA 2CF5A 5JS1A 2G06A 1G8KA 4PIPA 1XRRA 2Z09A 3BM5A 3KQOA 4JYAB 3B12A 1XQ1A 2ZE8A 4WK2B 3HSSA 2XTNA 1AQLA 5KBYA 2FCAA 1E66A 4UTZA 1E79D 3OOHA 1QV6A 1IY9A 5LZ8A 1ZR4A 2FLKA 1K5GA 3FRJA 2OO3A 3PYLA 1ADGA 3H2YA 3NVMB 4YONB 3CPEA 5LBIA 4ID9A 3NIWA 1HDGO 1N2IA 1WZ2A 1H66A 2DHRA 2B0JA 4JI3B 1DAHA 4CTOA 5HZHA 1UF9A 1L5MA 1T1RA 1J42A 3C3XA 5KYYA 1R6XA 2NSYA 1A4IA 4TVKA 1JJFA 3ZNOA 4BP3A 3DG9A 4LFCB 4CMIB 3CH7A 2XY4A 3VJMA 1M0EA 3WWEA 1VMAA 3D31A 3UGKA 4XI9A 5GV8A 3B89A 3HEBA 4EHLA 3NHBA 4KWEA 1N2CE 1KA9H 5CXSA 1ZAKA 2SHKA 2ISSD 2W2KB 3O94A 3K6RA 3IP8A 3AY6A 1UL1X 4WKOA 4YQZA 3ROPA 1AF7A 5EYPB 1Q14A 3ADKA 1PWYE 1PT7A 1YQGA 5BVHA 3H05A 1U0OC 1EM8B 4FEYA 1NPDA 1KAQA 5KQRA 2VPIA 4IY1A 2YIVX 1JDJA 2ZS9A 2HDOA 2Q5JA 3O0TA 3DVQX 1ORWA 3FPCA 3WZMA 1W0CA 5EIOA 4CKEB 5KKNB 1P1JA 3ER6A 4G1MB 2RH5A 1NVKA 3BYZA 3HU2A 3GFOA 1Z4MA 1V48A 1VG1A 3QKWA 2O19A 1A5BB 4R1TA 1WXGA 4ENTA 4F4IA 3VVCA 3A6KA 1SOVA 1RTKA 2H4JA 4HNRA 3B1FA 4B6FA 1DUIA 4NTZA 5CAEB 3UQYS 1I2DA 2LKCA 1V41E 1XZDA 1KFJB 1TPYA 3CF6R 3KEFA 4OK5A 3ZGVA 4QGAA 1SMKA 2I3BA 4EGQA 2Q6LA 1UINA 3LNCA 1K6JA 2IYZA 1PG0A 5LXTF 1VHDA 1X74A 3CKLA 4BV9A 5JTTA 1OI3A 4OL9A 1GQOA 2A92A 2C5SA 2E3JA 3DZKA 4KXNA 4CHGA 3GJYA 4RZ2A 4CR8A 4EMBA 2OO7A 2R00A 3L1VA 4U0KA 5B3JC 4MR9A 1EIWA 1AOXA 3T3MB 1HOXA 2PX5A 2VNKA 3GJRA 3WICA 3PZBA 2FJ0A 4HDKB 2G17A 2WVGA 3HB5X 2J67A 2SNIE 1S01A 4HYQA 4ZI5A 4GKJB 2C3MA 1EU1A 4IDNA 5FLKA 2HGSA 1P0FA 3ODGA 1Y9DA 5EKXA 2ERCA 2OQRA 2PD4A 3AIIA 1PHPA 1TADA 3MS2A 1XRJA 3AQ4A 1KIFA 2IIVA 4FHEA 1V39A 1U99A 3RSCA 4ACBA 1CD5A 1E2QA 1Z7WA 4WKBA 1QYIA 2R48A 3F6PA 1EWTA 4BNMA 2I4IA 3OOWA 4C7KA 3QENA 4M36A 2NO1A 1AKMA 1LTKA 4OHYA 3VUEA 3PUWA 2P3OA 2PMWB 1I9GA 1LF5A 4CQLB 3A4MA 4R7ZA 1UH5A 2Z57A 5H8WA 1AKNA 4CDNA 2CSXA 1TMYA 2B2NA 4AJHA 3A9SA 6AT1A 4H7HA 3PGLA 4MUIA 1U9CA 3ZI7A 3L41A 5K7SA 4KXMA 3TTXA 1PYGA 3QUBA 3P9KA 4M7OA 2VUUA 4UTOA 2VWGA 4OF4A 2JI8A 4AJPA 4RD4A 1J24A 3OTHA 3E05A 3JWEA 1QRUA 1GRNA 2JFQA 4DUZB 3JWIA 5BUSA 4G5YA 1KO5A 4R1UA 1WEKA 3RVMA 3A32A 4HAUA 3BA1A 4L9WA 2Q41A 1RC0A 4ZAYA 5KSOA 1GRVA 2I8LA 2NTJA 3W6UA 3Q9UA 2EKLA 2GGSA 1KEZA 2ZYSA 4HADA 4HHEA 4KK4A 1SZPA 4PBRA 4Q9LA 3UMFA 1I13A 1M6HA 3IAS1 3L1HA 2IUFA 3EXFB 4NH4A 2F7SA 3SZRA 1Y8CA 2WFAA 1P9OA 1AO3A 3OZBA 4LUCA 2W4QA 4EY8A 3PTAA 4RJKA 3L6DA 1NNUA 3WLAA 3MWDB 1MO5A 3F8WA 5F77A 5G0WA 4EMTA 2BMWA 3OHPA 1KHTA 1JFSA 3P0JA 2EG9A 4TUYA 1SUEA 1TYBE 3ILVA 3K0CC 2CNOA 4FXPA 1L8QA 4I8DA 1TIKA 4FMPA 4ER0A 3K6SA 2WIJA 2RGYA 3NEJA 1AKVA 1ZC4A 3KZOA 2C2ZA 3SR3A 2Q3JA 1JEQB 1GGHA 5LZ7A 4MYUA 4IHJB 5DCUA 4B6PA 5LQNA 3GEIA 5DNAA 4RMJA 3S2EA 1L7NA 2VRBA 3OQIA 4LOKA 5DNVA 2VJLA 1C5KA 1JYSA 2CDNA 2PO5A 3D6UA 4LZOA 4PHCA 3ZGNA 4C4RA 3WE7A 5L8VA 4YAWA 4ZCIA 5HQ3B 4D9FA 1P4RA 2ZDGA 1PO7A 4B3JA 1KDOA 2AF4C 3NC4A 1QB8A 1EX9A 3GLIB 4CKZA 4RZUA 2AFHE 3X1KA 2CMGA 1VA4A 2P6PA 1K86A 5EQJB 2JAWA 1JT2A 2H85A 4QDUA 2QL6A 5T3YA 1AC5A 3VDQA 4L8FA 5CA1A 1VRCA 2VKQA 4RX1A 1USGA 2BT4A 2P7IA 3X2FA 5KVAA 3TFWA 2IH4A 3FPSA 4I2VA 5IT0A 2V7QD 2BBSA 4XQ9A 4BQEA 4MS4A 5TQ2B 4D57A 4MARA 5JQGA 3RRYA 2VYFA 1WXQA 2IX3A 1J0EA 2WD7A 1XQ9A 3HJFA 4WTOA 1IY2A 2NSHA 1TMOA 4N6GA 1A0OA 4I4LA 4O5AA 4BBAA 3QPAA 2EYUA 3ZKWB 4HQOA 2G40A 2P2SA 1V8PA 1A4XA 1DRWA 3OC6A 1M5TA 2G9UA 1W59A 1N5MA 2EZUA 2IOQA 2PBZA 4FFBA 4JA0A 4JCOA 4WI1A 4Y9DA 4Z4EA 3TZQA 5IAJA 3U4MA 2G4CA 1FF9A 5KYWB 4KI7A 1ECCA 1RM3A 4OK3A 5BWCA 2D2FA 5JNSA 3MVEA 2C31A 2PX3A 2C9ZA 3N2IA 4KFTA 4B76A 3BHNA 5L3SA 3ONEA 4Y6GB 1IXRC 2VJDA 2ZBQA 2QD3A 1RKBA 2YVAA 1UIMA 2M6RA 3AXSA 3H9QA 1OX5A 1WO8A 2IV7A 4GMKA 3W4IA 5AR1A 3OX4A 3JV7A 4KOAA 3UY4A 4JH0A 4I6EA 1OV4A 1WUJS 1SKQA 4MYDA 1NYTA 2C8KA 3HU1A 2CWWA 2GASA 1UBJS 4QT4A 3VOSA 4KO4S 4Z7QB 5B3KA 3STHA 3MUFA 5FORA 3PXGA 2HPAA 3CJQA 1QRDA 5CA0B 1NUHA 1KKMA 1MW9X 2D0OB 1ADYA 3KWFA 3MWFA 4MS3B 3ELBA 1C1XA 3CRRA 4IG4A 1AS3A 2EQAA 3SD7A 4CLXA 3MN1A 1UIRA 1KAGA 3LYLA 3AF2A 2PRIA 4BKOA 1J5EB 3H1AA 1R4NB 4F04A 4OHCA 1V8OA 2OL4A 5K9ZA 2NU7B 1GG5A 3WGKA 4EY3A 4F97A 2VF7A 3V8BA 2QJTA 5BSEA 2MYPA 5JMWA 1GZSA 3FYUA 2O0KA 1I01A 2OQIA 2XLCA 3IESA 4ZK2A 2W0MA 3SBXA 3GOQA 4RESA 5CDYA 3PBKA 2CY0A 3F4KA 4Z2YA 2OUIA 4QBIA 1RWQA 2FTKE 2P4HX 4AXBA 3EVTA 1XZJA 4G37A 5BR8B 3CNOA 2X42A 2X15A 1SUDA 2AHOA 3D8TA 4L5BA 4MTCA 5H1YA 5C7YA 1NKTA 3QUQA 5IAEA 1FTGA 3KWJA 2R1ZA 4DRZA 1R4ZA 1YO6A 5DBOA 4URWR 4Q6WA 3L7DA 3HU3A 4LXXA 2D8MA 4O2BB 3URMA 1QZ3A 5GPBA 3ZE9A 5FNZA 3LHKA 3LCUA 3R3UA 1JDUA 4LYEA 4MRMB 2J7PD 3N7TA 2XDQB 3ELWA 4NPCA 3HY3A 3LYHA 4LGVA 2WWYA 2NTEA 1P17A 2WT4A 2JH3A 3N87A 3FF1A 5HIMA 5FBWB 1SCAA 2RGNA 1D9ZA 1VG0B 2X5XA 3PPXA 5I7OA 4LJ7A 3EH1A 3O4GA 3Q7TA 2R2GA 2XWPA 3QF4B 4NEHB 4UD6A 5SZKB 4S1NA 4TZ0A 3G2LA 1IEXA 4ZAGA 1MJNA 4RVSA 3KEQA 4BNGA 4CLHA 3DDHA 3UB2A 1VRWA 4DMCA 3DV9A 4OQQA 5JFOA 4QXRA 4C7XA 1R88A 3WWYA 3QU4A 5DYGA 3DR5A 5GOTA 1JR6A 4HQ6A 5TGTA 5IWAB 2YZ7A 3Q3EA 1T9HA 2J41A 4RGBA 3RS3A 2VJYA 1CX9B 4HWRA 1GYPA 1LS1A 3AB3A 3P19A 5DLYA 1SVLA 4GOLD 5GJWC 2DKNA 3DXXA 1A9XA 1X14A 1T9GR 3K30A 5AKXA 4JUFA 1LJUA 2V6GA 1E2HA 2A67A 4D7AA 1QGOA 1W19A 1Z75A 2QQ0A 5AH0A 5HTOA 4D02A 1CR1A 3SJCA 3W9SA 4ROSA 3I4CA 2CNLA 4TXMA 1UJBA 2D5BA 4NOMA 4C43A 1S7GA 3IAUA 1HC7A 3VHRA 1EGQA 2CCJA 3PEEA 4K9KA 4L4RA 3A2KA 1U98A 4O4IF 3F6SA 4PPFA 5GMOA 3SQWA 2IBSA 4WEOA 1PVOA 3MD9A 1JEYA 1ZNXA 1ZD3A 2AG1A 3MGGA 5EWJA 2O8VA 2EHJA 2P5YA 3F6CA 2FZLA 3P9ZA 4RE5A 2P2GA 1A9PA 4DLZA 1WG8A 3HBLA 5PGMA 4DC1A 4ECEA 2IS4A 3P2OA 2GCIA 3N8HA 3B6MA 2YVUA 3PVCA 4XEUA 3MGCA 3TR0A 3OT1A 4RKFA 4P1ZA 3AR8A 2Q0XA 1VMDA 1GSIA 2QAJA 3EULA 4RQTA 5L3QB 1H8EA 4AQ7A 1KI7A 4LI3X 4Z2AA 5KYNA 1T15A 4DXAA 3CBQA 3KUXA 3HR8A 2Q2QA 4M0FA 3SZGA 3UUGA 2ZWAA 2EW2A 3Q8WA 2FDCA 2ZXFA 4ZDJA 1FDVA 1U7UA 2ZUTA 4XARA 1ISGA 4PGHA 4BU1A 1SCBA 3QX7A 1DX9A 4N7JA 3THWB 2BFAA 2FQQA 2EFDB 2ROQA 2YC2C 5IJZA 1FFCA 1X8XA 1HEIA 2V7GA 2C2OA 4BO2A 2ACEA 5EWLA 1EG2A 3VZSA 1V3TA 5CGZA 4DSUA 2B6NA 2ECFA 2FFJA 2QNRA 3OPMA 1G64A 4JL8A 4JENA 5JI3E 2AR0A 1I33A 2BCEA 3JQ6A 1MNQA 3DE3X 4FGKA 4X64B 5F78A 2XDYA 3ZCSA 4F72A 3DC7A 2DJ5A 2WVJA 5KOJB 3AEZA 2VLIA 3H5TA 1NVUQ 1YZYA 1P7YA 5HKAA 1Q7TA 3H4TA 3OKCA 4DCUA 2XWSA 1MJFA 1VFPA 5AKZA 3ROTA 3B9QA 3I8OA 3A6JA 3HCNA 1M0SA 3EC2A 2QTWB 3H2IA 4NMMA 1FFHA 1TA0A 2FW7A 1PR9A 2G04A 2H2GA 3EXHA 4E03A 2Y3IA 2NZWA 4D9BA 4QQ8A 2R68A 3KQLA 4G41A 3R7NA 2JLYA 1W76A 1KY2A 2NVBA 1VI2A 3EH2A 5AOVA 4CMHA 5AJYA 3UFXA 1KYYA 2HA6A 4RJLA 2FPOA 4OUDB 2ODQA 5EESA 4BLQA 5B57C 1VMEA 2IYRA 1OFUX 4NS1A 1G20E 5CITA 4RCZA 4IHJF 2ORVA 4QEKA 4QNRA 2GVDC 1V5FA 3ONDA 4K40A 4Q24A 3C39A 2UZ1B 4Z9BA 5G1NA 3ZCVA 4M1ZA 3UMCA 4ABYA 2ZLBA 4AKTA 3D1VA 4EVQA 2ZRHA 3NNSA 4L08A 4X7MA 4AKGA 1J4AA 3R6TA 4DTCA 4GDFA 2IZ1A 2PL9A 1WUYA 3ANXA 1IB6A 3WQQA 4ENUA 3SDBA 5C8YB 4IFTA 2NPOA 4GKVA 4HDSA 4RFVA 1HE8B 2XVYA 3JQ7B 3PNVA 3GLHB 2CHFA 4W7HA 1D1SA 1MD9A 4JLVA 4C0LA 4DGQA 4EB3A 4YECA 1G3RA 4B3CA 1TM2A 5M29A 5C52B 3I62A 3JU3A 4NU5A 4L5YA 5J47A 4O25A 5IP5A 3ABSB 2H7XA 5FBKA 3KD2A 3OZRA 1XVUA 4IIDA 4B3TB 1P61B 2WI8A 2X0DA 1T13A 2AGVA 4DPKA 4EX7A 3FNQA 5LKRA 1ZIYA 2OXRA 1F2UB 1J23A 1Y3HA 4PINA 5SICE 1FMTA 4C0XA 4YAGA 2WTNA 3N2KB 4L9SA 4BXOB 2FN7A 5H16A 3VSDA 3O3OB 4MP3A 4S1WA 1WB6A 3IPLA 1OWOA 1C8KA 2AOTA 1QLWA 5A2QA 3S8EA 2G82A 4XTRA 5AHOA 4JNKA 3FN4A 3NGLA 4N4AA 3AB7A 1I4EB 3JXEA 1KBZA 4R1QA 4CM3A 4M1MA 1LPSA 2AN3A 2CKDA 3LSTA 4RKWA 4EITA 1OF1A 2Y0EA 4U0JA 1R0RE 1OWMA 1G8AA 2H08A 2FWNA 1LFDB 2BGLA 5DK4A 2GPSA 1PKXA 1S3FA 2Z83A 2Z8XA 3KAKA 2VF4X 4DOMA 3PGA1 3HCEA 1KXJA 3VMFA 1W2GA 5CDHA 1J99A 1K8QA 3TNYA 1GCAA 1PT9A 1E8NA 3QVOA 4P58A 4C3UA 4OHXA 3N2LA 2WG2A 4LCJA 2JAPA 2QXYA 1QS0B 5CA0F 3NFRA 1NY6A 1E32A 2CJPA 3PXEA 4XJTA 4L07A 1P29A 3IDZA 3ZQ6A 5INTA 1Y3CE 3U3MA 5ALPA 1GDTA 2OCPA 1P7WA 3IJEB 5G0TA 4UUQA 1MJ5A 4K9DA 3O2QB 4JQYA 4L8WB 2RAVA 3ETHA 5JRJA 2XAAA 4YJDA 1NF3A 1HZZC 1YK0A 2I7CA 3DLTA 5FNVB 4CG3A 3CUTA 4EW1A 5JSZA 3FPAA 3O3MB 4BFUA 1R9GA 2C2MA 2QTHA 4NI5A 3OA2A 4U7FA 5HS4A 1NSTA 5JCJD 4IGIA 3W6PA 4N5DA 3IBYA 3C3KA 2C9DA 5CVCA 4CTJA 2ZXUA 3KIPA 4OHZA 4QOIA 1RT9A 2OC9A 3VJLA 1FNSA 3QHPA 4N1AA 3OWOA 3ML1A 2AI1A 5AM3A 1O89A 3G9QA 4IILA 4E30A 3OCVA 1M66A 3CTMA 1MDBA 1E7QA 5E9AA 4N7RA 1UMCA 3PRJA 4BMXA 1QG6A 1UDBA 2I03A 4GSKA 1ZNYA 3IODA 4MGEA 4TKVB 5K3BA 3Q3VA 1RYMA 2PHZA 4O2BF 2AHRA 1ZUIA 3NHFA 4RL4A 2O57A 4K6KA 2WWVD 3OPYA 2HCRA 3GA7A 1DLJA 4BE7B 2ZULA 1L6IA 3AVPA 3EXIA 1A5ZA 3I72A 4KYIB 4UPEA 4N47A 3OZGA 5ALEA 3CBGA 4E4RA 1MX3A 4ZMRA 2CUTA 3LKVA 4QU9A 4CM9D 1J20A 2I62A 4OHFA 3R6GA 1SXQA 1WNTA 1UJ6A 3FPFA 4JSTA 3UTCA 1Y5RA 1TL7C 4LX0A 4DV5B 1GLGA 3WNZA 2E5LB 1PNTA 2HPZA 1CF9A 1C8BA 3B52X 4LC0A 4YJ2B 5A1TA 1TQ8A 1MW8X 1WF3A 5BNTA 1H1TA 3WNCA 1L4LA 4KR2A 1K8ZB 3WKCA 3K6SB 3KTOA 4EEKA 1U2GA 5E8JA 3STWA 2YQ4A 4Z0PA 2J0VA 4NV1A 5IS2A 5BNWA 2RGAA 2HT6A 2XE4A 3EEQA 3K1ZA 5DM2A 5KYTA 1T26A 4OFXA 3ZGZA 1UMDB 2L42A 1Z26A 3V4VB 5CX4A 1E1RA 4F60A 3V8QA 4M1YA 3TJMA 5EJ6A 1MB9A 1Z0SA 4B32A 3K5IA 3EA4A 4JL6A 5TXGA 3HVIA 4QE3A 1VKZA 3RJ5A 1QG4A 3DKIA 2E18A 4HX9A 1E9SA 3CVXA 2AE1A 2B30A 3A6GA 4PX2A 4RHEA 4DLPA 3B48A 3PS9A 3GBPA 2CJXA 3TQCA 3TRFA 5BRAA 1KAMA 3S5UA 1KSHA 1ZIXA 4FGZA 2FX3A 3IDOA 3FDFA 2LE0A 1NQVA 1Y63A 4F7DA 4NNJA 1UZAA 4N6OA 1IXSB 3M6VA 5AI8A 5H02A 1K0UA 4NBSA 2BLLA 4BTVA 2FPLA 3WK4A 1D09A 5EPEA 4JHLA 3Q12A 3G3EA 3ORYA 5ITSA 4AU1A 5ANRB 2J9XB 1IBLB 3L06A 1RAGA 2PZJA 3PDCA 4HGPA 4RA9B 4RHYA 5BOSB 4O4JA 4IDPA 4OLJA 2JD0A 3R1IA 4ZO8A 3PNYA 2XA1A 1K8XB 3MF4A 3TGLA 3ADBA 4R31A 1I7NA 3TS1A 1W49A 5LBUA 1G7SA 3C1OA 4RHTA 5C35A 4RANA 3EODA 5AK5A 1JKXA 1M1UA 4G0NA 3MUOA 4G4SO 4BO7A 5HJ7A 5DGHA 1VL8A 2JI6A 2B1JA 2RIPA 2H8KA 4MCAA 1XOIA 2R4UA 1WW2A 2FW0A 2VK8A 1JBKA 1UODA 3R5JA 4O2AA 4IWXA 3HDQA 3PXCX 1KZGB 4QRHA 2YIDA 5LP1A 2ILTA 2PKWA 3PITA 1J21A 2Y6UA 3UK7A 3NP7A 1ZJ4A 2CJWB 4L02A 2XLBA 4MQEB 1XDZA 1XL1A 2B92A 1TVKA 2V3VA 2XEXA 4FD3A 2D7DA 2GT1A 1NBMD 2WB4A 1DHTA 3MCVA 3AVVA 3QKRB 4L6IA 3ANYB 4PG7A 4YROA 3EB9A 2IE0A 1MA3A 4L8VA 1C8VB 5CLIA 5AJZA 4AZWA 4WZ6A 5SY4A 3ZZNA 3VYRB 1CJTC 4PAMA 3PC4A 3QWAA 5FI5A 3R3ZA 4ICIA 1AHNA 3O84A 4NFHA 4RQUA 3SFVA 1ODSA 1SXJA 1AKEA 1VJRA 2C96A 3Q0IA 4EG7A 3DC2A 1S6YA 3ZNQA 3KJGA 4NE2A 4F7WA 2IW1A 5EERA 3AVWA 1DC4A 1KPIA 3ZY6A 3T0IA 1VYHA 2HA5A 4QOEA 4S04A 4WA7A 4DYDA 1WUTA 1T2DA 5KDLA 3LFHA 1YQDA 2VOEA 1NV9A 3BK2A 3GEGA 3RJ9A 4BMDA 4EB6A 2V0GA 2CFOA 4NF2A 4MYRA 4MQMA 2HY7A 4B2LA 1BRTA 1JQLB 1P0IA 2V5VA 3GNTA 3ZHRA 2JGDB 4PGFA 1MOZA 3PEUA 4KFUA 5T8KA 4IFIA 4XQEA 4HK4A 1KNQA 3E7PA 4F56A 4ZPJA 3MMSA 1WMDA 1Y4UA 4LCBA 4LY0A 5EI5A 5FP0A 1M2VA 3ECCA 4J49A 1Z83A 2JIDA 1AKYA 3AW9A 3HKBB 2BUCA 1E4VA 1CUIA 5C8YF 1ND5A 4CIAA 3VR0A 2PPVA 3B1VA 1HSZA 1OB5A 1TTPB 1ENOA 1O95D 1U0RA 2HMVA 4OYYA 3CX6A 4KO1S 5HZGA 3HCOA 4H31A 1YB4A 2PYZA 2X4LA 3SU8A 4QU8A 4FYYA 4F4CA 2XB2A 1MP0A 2YRWA 3LHDA 5JZMA 1XPOA 3IEXA 3ZDYB 2F1OA 3DNPA 4JFAA 4D4MA 1I80A 1ORRA 1I0LA 3FCEA 2V6JA 1H05A 5FOUA 3SS7X 2PEYA 3ILYA 4JVOA 1RQXA 2XCQA 1VDZA 1FFSA 3P2EA 5C4GB 2CVFA 2M6LA 5KU7A 1CUEA 1MQ9A 4G8DA 4J43A 3U60B 1UBLS 5EPOA 3D2CA 3OG9A 5EIBD 1EK0A 3QA9A 4KR9A 3VC1A 4B09A 3V8VA 1XZNA 1MQ8B 4P53A 3VQTA 3WWOA 4EZIA 1JHPA 1E7SA 4HDRB 4LIPD 4LISA 4YALA 5DMXA 1ACLA 2BGIA 1CRQA 3W0LB 2DBVO 3AH8A 2F8TA 1ID8A 4KI0A 2JIOA 4LS3A 4MPDA 4NCIA 1R16A 4Q18A 4M3NA 5JDCA 3DVAA 5IT9A 1OAAA 1OZGA 3N6XA 2X22A 1OHHA 5CW2A 4BB9A 4ZVOA 1EX7A 1R0XA 2O7QA 4EG0A 3A1FA 1HGXA 1GGJA 3WYDA 1B73A 4OGLA 1H2HA 1DQNA 2NUAA 4BIMA 4COKA 4HQNA 5ESWA 3S40A 1EFRA 2RK3A 4WFJA 4EF6A 1B3BA 4EJSB 3CNHA 5EXDA 2AYYA 5BORA 2H5JA 4ITVA 1LLDA 3OC0A 3KQTA 3OU6A 4G5GA 4MYCA 4WN9B 1FPMA 2WIAA 2ZSKA 3HGMA 1LSSA 3T5TA 2QJWA 1YQXA 2MCFA 4I7EA 1A8HA 2VXOA 5AM2A 2I2DA 4WHMA 4ZO6A 5FH9A 3ZVMA 4OB7A 3QEAZ 5LYJF 5LOVB 3BB4A 3GCZA 5ICMA 3O2JA 3ER8A 2WYOA 3IA7A 4G84A 3W9YA 1I9CA 2G5GX 5EHNA 5FNVF 3SX2A 1O57A 5AW0A 2BF4A 5TMBA 4L95C 2VTKA 1W4BA 3RHSA 4AZSA 5BWOA 2VDMB 4RO0A 3TTWA 1Y5MA 1VP3A 4P7FA 4KDEA 1YS7A 2W8BB 4R9NA 2F4VB 3LUCA 3DVSX 1Y5IA 3PDUA 4ZDIA 3GWZA 3KM0A 3I9KA 3SIRA 1IMJA 4HQLA 3E5NA 5EXTA 1FDSA 1TOAA 4Z0TA 4DZRA 1PT6A 1UKEA 2KWIA 2XR1A 3L40A 1KNXA 4D8UA 3QXGA 2HJVA 4DBVO 3ZD6A 3GU3A 4RXMA 2FMIA 1V9CA 1Z7GA 3BMCB 3JQBC 1H4SA 3NT5A 2B8WA 3H11B 1SBNE 1W34A 4IVQA 1U0NA 4K8OA 5CGQB 4ZZ2A 3VC2A 2AUTA 2B34A 2AN5A 4B85A 1G3UA 1ADBA 3M81A 4ARUA 3IIMA 4C78A 4LXYA 4H7PA 2PA0A 3HO8A 5FTKA 4DNQA 4EFMA 2BEUB 2G9QA 1VTKA 3VU8A 4FCTA 1QKKA 3HLTA 2YWHA 5ERXA 2I0FA 1PFKA 1CUXA 4JBGA 4QZVA 1N6HA 2VO1A 1LPPA 4DUYB 5A5GA 1QPZA 2ZRJA 1N7IA 3EXG2 1ORVA 1OLSB 4TTSA 2ATCA 3A9UA 4TL9A 3VBCA 3LYUA 4YJ2F 2RGXA 2BFCB 4M54A 3TVDA 1G9SA 3NVKI 5LZ4A 2Z3WA 1M2WA 3HP7A 4LG1A 4X66B 3UW1A 1RJGA 1B6TA 1UOQA 2MMGA 2W48A 3WHLA 1E6MA 4JGIA 5LSAA 1FIUA 2FPGB 3HA2A 4DYHA 1E3WA 3N7UA 3NBXX 1PL8A 3O93A 1II8A 3P4XA 4BWVA 3IP3A 3KXKA 4NULA 1D5CA 1N9GA 4KXUA 4W8GA 3T94A 1F7VA 3SDZA 3PNBA 3UO8B 4QGGA 3KOUA 4F3KA 5I7HA 1VCHA 2X76A 2HA2A 3H9GA 3VPFA 3KB1A 3LXUX 3T5DA 2J3JA 2AMFA 2TRSB 1TZBA 5DSTA 4L4ZA 3R8FA 2E89A 4ZA2A 3CY6A 3K05A 1UR5A 1N1DA 2NUTB 4NZPA 4J2OA 4AZ3A 4U3JB 3C3WA 5AMXA 4B3IA 4IO1A 3K92A 5M3BA 4IJ6A 1GEEA 5EHZA 1WQ4A 2MDTA 3GQBB 3NJ8A 1FMCA 2YRXA 3U7RA 3Q0TA 1NUQA 4EBBA 1QMPA 2OKCA 3DE0X 5JIBA 1OFUA 5A4IS 3LGXA 3QLVA 2FZGA 3LA6A 4NOKA 4LC1A 4DLLA 1OXBB 2R7MA 1MT0A 5BQ3A 4PZCA 2AG6A 5BSFA 4XWAA 1GTSA 1SUCA 1XZQA 3CZ4A 4CIWA 3AVQA 3TEMA 4K2HA 1EVJA 1B1AA 4KQIA 4Q4HA 2OYRA 2IOYA 1UK7A 1OLXA 4Y7DA 4O6VA 2Z4RA 1ZK4A 1T1EA 5BR1A 1C9EA 2R79A 1VE3A 1J2YA 1QVRA 4K6HA 3U44B 2DLCX 4D9MA 4A8JC 4FW9A 4E22A 3C0KA 5CD1A 3I61A 3UHFA 5HP4A 5AW7A 1E61A 1XXHA 3AWIA 2C97A 2QE7A 2ZSHA 3S2FA 1MX1A 3O38A 5CT4A 2PKEA 1QSGA 4BFZA 3PCTA 4KLNA 4PTLA 2B2XA 1TCAA 3L4BA 1PZFA 3UPTA 1TVMA 2WTMA 3RVKA 4D9HA 3PVSA 1CUWA 2QNIA 1UXOA 2IYWA 1SR8A 1JIUA 3KZMA 1OXVA 4DV4B 3TNFA 4YP9A 3EDOA 5IT4A 1NR7A 3L1UA 4HZUA 4EI9A 3G9XA 4GBED 4IJ5A 1GNPA 4QDXA 4PLYA 1U2ZA 4B17A 1M83A 3T3EA 4ZCMA 3UPUA 4E46A 1MG5A 4ZVPA 4OEHA 1Y5NA 3LX6A 3HY6A 1GNTA 1ZOPA 4GO1A 2BI4A 1ZM3A 3RBVA 4YCMA 1T24A 1GILA 2WWHA 3HZHA 4DR7B 3T5MA 1GDDA 3N74A 4N82A 1Z2EA 3UGTA 5KYUB 1XNJA 4FM9A 1BE1A 1HETA 3A31A 3GCGA 3U4HA 3VR5D 4ZFNA 1PJBA 3ZVKA 5CLLA 2PUGA 2Y4OA 4TYYA 2ECKA 1A2KC 3VVMA 1C9NA 1LZKA 4BS9A 4M87A 1YVUA 1DTWB 2IU6A 2XD9A 2YWEA 4J7UA 1TUBB 2ZJFA 2DUMA 4R2XA 1AHIA 2GEDA 2YZNA 4UBKA 3QVLA 5L3RA 1EPUA 1V3VA 1WCIB 2EKZA 1JZTA 2N75A 2WE7A 1X6VA 2ZE5A 3JR3A 1OZFA 2H9YA 3L7IA 7AT1A 3CX8A 3OF2A 3P0FA 2A9RA 4ALKA 2PGLA 1F0YA 2FPIA 2CL6X 5L6MB 1OYYA 2P0AA 3Q7QA 1DG9A 2WNIA 1XTIA 2FE1A 3TCNA 1YVPA 1GIAA 1SXPA 4V1CA 4C7OA 5K0JA 1J1IA 1UOOA 3GDGA 4EELA 4BZZA 3F7NA 3SIPA 1GWNA 2XUGA 3GJZA 4HZGA 4JX8A 2WZBA 2ZG6A 4URZR 2M9MA 3PU6A 3IAEA 2QL5A 1I51A 3D3JA 2NSLA 3H0CA 5D7BA 5K0NA 4AP6A 4GGPA 2OZPA 2PZ8A 2Q0QA 1BVYF 1OH7A 2Q7DA 2JCGA 3G0OA 4LZNA 2IODA 1R8JA 1H5QA 5C46F 2AN1A 1F5SA 5E2BA 3D4PA 1QHHB 4J3JA 1KFCB 4QDTA 5CK5A 3RW9A 4C07A 3SS9X 1I30A 3PVZA 4TMZA 3BJMA 2BD0A 4G23A 1FSFA 4OM8A 4LJ4A 4UAVA 1Q1BA 1E3EA 2G9VA 3BIJA 3REQA 2WKPA 1Q0SA 2WIBA 3LQYA 4OLHA 1TLLA 2AKYA 3H6HA 3VSEA 2O8BA 3IBCA 5ETJA 3KJZA 3U7IA 3HNPA 3OI7A 3FFXA 2Y1XA 3ZHUA 5JNTA 1IG0A 1GLVA 3RKSA 2ZRQA 4WUVA 2G8NA 5L4SA 3GGOA 1XSEA 2JARA 2ERYA 3X1YA 3EWSA 1MAHA 4P4SA 4FR0A 4D1YA 3B78A 3LG2A 1SHTX 2A30A 1NP3A 3VZRA 2GN8A 2FWAA 1I4OA 3KQHA 3QSYA 2GRJA 1Z35A 4PLPA 3PKZA 2A94A 4FYKA 4WL0A 1TFRA 4ZT7A 4IO0A 1XT6A 2VR1A 2CBGA 1NRWA 2WF7A 3F90A 1B4DA 4IOLA 2PLFA 2YXPX 1Q21A 4GYKA 5G2OA 1I6KA 1M8PA 2GPBA 3D8BA 4QT0A 4D8VA 4KVGA 3MB5A 4RACA 3HCCA 2PV7A 2YFYA 1YOVA 1MEEA 1WHTB 1B6SA 1P81A 1VECA 3CRW1 4XX0B 4GYJA 4ZOAA 4JP2A 4AY6A 3RSQA 3IPXA 4M9XA 4PLHA 1RWXA 3ASUA 2GBPA 1VHWA 4PXSA 2FEPA 4B6OA 4DIFA 3T1NA 1NKVA 5E6UA 4BFVA 4AY3A 2FHSA 5KQLA 3KQSA 1ENZA 1S5PA 1SBTA 5G53C 1JKFA 2V9ZA 3Q7PA 4GUAA 4GGMX 1AVTA 4K88A 4BNXA 4HPWA 4D79A 4DYVA 2AKAB 1X1SA 3R75A 3QXSA 4JEIA 1G4HA 4NRDA 3V48A 4ZT3A 4NBTA 3GP8A 5K0LA 4DMKA 1Q7BA 1F51E 1FU8A 3K9GA 1E9DA 2ZB8A 4JB3A 4TQUS 1JAIA 3KE8A 4LF6B 1C2TA 2R65A 4KGDA 5AI6A 4YCLA 4KHZA 3JQ8A 1XA4A 4HQRA 1XAGA 3T0GA 4WJLA 5J4VA 6ABPA 4CEJB 4PIVA 1KAEA 2W70A 2GUGA 4V3CA 1TTTA 4TV9B 1EHIA 1INLA 3FF4A 5G4KA 4US1R 1JLRA 4GR9A 3EHDA 1N5JA 1AZSC 4BHTA 3PKIA 2ZVPX 1IWPB 3WADA 2WIDA 1Y6FA 3GHYA 1Z6PA 1GZ3A 2EJCA 3KZ1E 1NXSA 3GT7A 2PZEA 3PYXA 3ERCA 1Z2OX 1Q0ZA 2EWVA 4I5GA 4BMYA 4BYMA 2DR2A 3F6BX 2HI0A 2BZSA 3B9BA 3QA3E 2OXCA 4FHFA 4Q01A 2FAXA 4BEVA 1DJQA 2HJWA 1UPUA 2CLOB 1USVA 2X19A 3GIWA 3GJXC 1I7QB 3IVCA 3MWYW 3M4ZA 4X93A 2CV1A 5DF1A 4KQ1A 3FM9A 2W4MA 2ZSEA 4FLFA 1MRNA 4GR5A 4URUR 4BVBA 1JR4A 4IDAA 4BVLA 5EUCA 2GZAA 3TECE 1QH1A 3N8IA 1LVHA 2FRVA 3E3AA 4D8YA 4Q1EA 4PQGA 2P1ZA 3KB2A 3RSOA 1JHYA 4NWIA 2POCA 3FNGA 3ZU5A 4WOCA 3EDQA 5HDBB 3SSMA 1NBME 1QOZA 3DDSA 4HATA 5FUXA 4FC6A 4F4JA 4BNZA 1EDDA 2LZ0A 4M6WA 5SZIA 5EHXA 2O5VA 5CEFA 1D2EA 4IV0A 3NKFA 1USUA 3AUFA 3NR2A 3UAYA 1ZRSA 3ID6C 4NPAA 2Q2WA 3OFNA 1I6WA 3AJDA 1HFEL 2ILVA 4C08A 2H4HA 1NW3A 1TF7A 2O7RA 2JD2A 4YRBA 4UOEA 4MLDA 5FI3A 1SFRA 2H3HA 3E0QA 4W5HA 3SICE 4LWQA 3GT4A 3NBMA 3PNQA 3URKA 4AROA 4BOYA 1X7HA 2RHTA 2Y1EA 1JLKA 1VLVA 3BFPA 4IPTA 2EZTA 1BMFD 1QMGA 1MABB 3TDMA 5K8VA 2UV8A 3PEWA 4EO4A 1NZJA 3KHSA 4RZQA 3PNKA 1NRXA 4OGKA 3TSAA 4B46A 4DXHA 2Q6TA 5AHKA 5DTIA 4CKBB 1ZJJA 4RNDB 3KSDO 2V9CA 2VH5R 4CR7A 3RH0A 3HLKA 2H57A 1PBNA 5FOWA 2CBXA 2BBOA 2DPHA 3UAVA 4K0RA 3TMYA 4NU0A 2KLBA 3RHTA 1UXHA 2NM0A 1FCJA 1OAOA 4QPCA 4Z3KA 3MCWA 4MO2A 3OSUA 3VNQA 2GRAA 2C3YA 3D2AA 3CZPA 4G8CA 2AJCA 2QD5A 3ESZA 2FKNA 1SCJA 4GE3A 1A4RA 3PQEA 3HCDA 5SY6A 1WHSB 4ZQBA 3PI6A 4CV0A 2GJ4A 5K0FA 3B5EA 3LWNA 4KO8A 2OYSA 2QDXA 2NZXA 3RS2A 1CRWG 1QHXA 2D0DA 1EDBA 4PANA 5A0TA 1LV8A 1ZNWA 2D0IA 1XZLA 2Q49A 2ZRCA 3FWPA 1XDUA 1P74A 4INJA 4H3SA 4RTRA 3UH0A 3QYJA 1AZLA 4KDRA 4MUBA 1G5FA 4EL0A 3UMSA 2G4LA 2WKRA 1NI4A 4IVNA 4O5OA 4DCMA 2XCIA 1QANA 3DEFA 4JIMA 4U02A 4Y1EA 1H4VB 1NRIA 1H1DA 4MLPA 1Y98A 4F8EA 5D1NA 1DE0A 1X8LA 2XNHA 3DD5A 4W1SA 1N4AA 3SHOA 3MQ2A 3BCUA 2NZ8A 3VPGA 5DI3A 4JBYA 5C3UA 5FWYA 1L5LA 3FVQA 3O4IA 2CMFA 3GI1A 2PLAA 3RT1A 3VTAA 5B6PA 4DLXA 3TRIA 2ID9A 1QO0D 2O48X 3LECA 4H4EA 5CMLA 3OMLA 1QHEA 2AQHA 3TXYA 3A26A 4QUBA 4WIAA 4F8JA 5IK2D 4MW1A 2BKXA 1NZFA 4UOZA 1RPJA 2WC1A 1NW8A 1LC3A 4MRSA 1KJWA 3VDMA 2JFNA 1M1YA 5BOVA 1OH6A 5HWSA 4MI6A 4XWTA 1GUAA 4LVUA 1QH8A 1Z2DA 3EEBA 4LMRA 3E3MA 1FNCA 2ZYAA 3ANMA 1WBDA 4QULA 3T7AA 1PQUA 1VOTA 4U8GA 1NVMB 1CZKA 4O4LB 3RJMA 2XCRB 3UT6A 4AJJA 2JG3A 2O2XA 1OIWA 5JZSA 5ECDA 2LIVA 2VF2A 1PX2A 3BJZA 5AKEA 4Q9AA 4NKRA 3WLRA 1SD5A 1L4BA 1T5HX 2XWJI 5JSKA 1U81A 3KXDA 2K6GA 3UFBA 2KS6A 3FJ1A 3H5OA 5DLPA 5DO9A 4MULA 1R3DA 2KLHA 2ZVQX 2XMPA 1ILEA 1PG2A 5DN6A 5LXTA 4JJAA 3V80A 3DNMA 1DQRA 3N2NA 5DTEA 3WP0A 3OPQA 1XXLA 2PG3A 2YS7A 3GT0A 4R84A 2CVZA 5EY5B 1IJEA 4R2HA 2FW1A 4ZGBA 4ZQEA 1XNQB 1OGIA 3WK7A 3FJYA 1CEQA 3T4PA 1OXTA 2W2VA 3FNIA 4B87A 5K3FA 4ERXA 4ENWA 1NLUA 2DQZA 1L3CA 5AK6A 1S2NA 4DLRA 1P2BA 1P2FA 2IXTA 3B20A 3F67A 4CM8B 5BURA 1J90A 5CFQA 4DUGA 4MHTA 4XH9B 5CDFE 1G8YA 3NVAA 4PSUA 4DIUA 5JDIA 2VHYA 3L6OO 3PHIA 4Q4AA 2F1KA 1YQUA 1DEKA 3BL6A 4GU5A 5EIWA 4K03A 5F64A 4ON9A 3DOFA 1AZWA 2WWIA 4YO8A 1CJMA 1U3FA 1TJ4A 1URPA 4W5WA 2AQKA 4Y18A 3OQVA 2J7KA 5KVQA 4C89A 6ADHA 5I5GA 5BSKA 1RZRA 3SM9A 4ATNA 1HFKA 3M6WA 3WYCA 5J63A 2Z9DA 2GCNA 3FUTA 3JVDA 4BMCA 1XDWA 1NONA 2PSSA 2Y93A 1M2OA 4YC7A 3IE2A 3N8KA 1FLDA 1XAIA 2E4ZA 3K70C 1ISHA 1J49A 3G2MA 3N6RA 2JDIA 3IIEA 4WNIA 1FVFA 3AL3A 3NOQA 3AESA 4NY1A 2R00C 4AQDA 3L8GA 3ZOZA 4DA7A 1EI9A 1KK0A 4AUMA 4U7GA 4YJ3B 4DJEC 3NYQA 3G7NA 4KPUA 1WB5A 4FJ0A 1UFQA 1V1MB 1DAOA 2ST1A 3CT4A 1OZAA 1LI7A 4LCEA 5CIWA 3EDMA 3LHFA 1Q84A 1BJRE 4L78A 2PTHA 3CSUA 2WDZA 1C2YA 2ADOA 2VCYA 3E2IA 2C9BA 2BBWA 4I4TA 4KPFC 3WO0A 5ITZB 4Z53A 3P9IA 3OU7A 2G5CA 5T64A 3OMXA 4JN6B 2C9OA 1CS4C 4NNOA 5DYYA 1PIWA 1RBYA 2GJ9A 1GXSB 4LJ5A 3Q3GE 4CTNA 1OWPA 4EFDA 4Z9YA 3WS7A 2FFBA 4N8EA 2OOSA 3GJ6A 2SCUA 1Y7HA 2IP4A 3WOVA 4BKQA 1DCTA 1E3MA 4OIMA 4E88A 3IKVA 5C1PA 3ZCXA 4YUZA 1ZESA 3HRIA 1W93A 2AJTA 4XRRA 1Y3BE 2TYSB 3OT4A 3KEMA 5HZMA 1P6XA 3KQNA 3OA0A 2A9FA 3QVUA 3HB7A 4D5GA 1P62B 1ULSA 3R3WA 2FU5C 5T67A 3U5ZB 2AC4A 2JFPA 3IQFA 4GVPA 4Q7JB 4XD7A 4Z4GA 5C8DA 3ACDA 4TV9F 2YZKA 3EFOA 3S1LA 1AXRA 3IKLA 1JA9A 5DTMA 3X1DA 4RVCA 1NAIA 1V11B 2VJMA 2MOKA 3E9QA 3OOJA 4YO7A 4C4XA 2XNDD 2GTHA 4IL5A 3KKLA 1D0SA 2AOVA 4DIKA 1OGYA 1REQA 1WUHS 4TMYA 4JAVC 3RS5A 4BWFB 4BEWA 2ZP1A 1FZTA 3OCCA 3QELB 5EEHA 2GF2A 3QQPA 1GCOA 1Y7PA 2NAPA 1CG6A 2OV1A 1RYDA 4Q9HA 4YRTA 4IRMA 1JIQA 1NIJA 2OD9A 4LN1A 4CQMD 4V0LA 4H16A 2QUKA 3JVUA 4KXQA 3N07A 2CFIA 1XRSB 1BWQA 4G25A 3CMCO 3M89A 1ZNQO 4GLJA 3JYNA 1RNLA 1MEJA 1R74A 3AUJB 2CV0A 4BN4A 1Z82A 5MN4A 3LZDA 3TR5A 2GK3A 4M9UA 4YLEA 3U4DA 3DFMA 3FSRA 3CIOA 3RROA 3RAFC 3ZEIA 3BRSA 3AFOA 1VLZA 3GUVA 4JLMA 1CVRA 2FCRA 2GMWA 3A0RB 3COYA 3LRTA 3CH4B 2YNMA 1QIHA 1CUGA 4PPYA 2V6BA 4C6TA 1MIOB 5EE3A 1I4WA 1VSVA 3HV0A 3UUFA 4HX2A 4EAQA 4OXNA 5IDYA 3LQFA 4QFDA