4R81A

Nad(p)h:quinone oxidoreductase from methanothermobacter marburgensis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
199
Chain Sequence
ASMHVYILFAHPSRKSFSREVLEAFTEGLSEAGHTYEVGDLYRMNFRSELSQEEYLREISQEAGSPLPEDVMEEHERIGRADALAFIYPLWWSDCPAKLKGWFDRVWTYGYAYFGTRIDIEKAVVLCSAGHTEEDLEGTGIAESMRSVMLGDRLLGVGVKNVTMEILGGMVPGDDSCREINLMRARRAGRNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH dehydrogenase
publication title A novel cytosolic NADH:quinone oxidoreductase from Methanothermobacter marburgensis.
pubmed doi rcsb
source organism Methanothermobacter marburgensis
total genus 75
structure length 199
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r81A00
3EYWA 3HA2A 2OHIA 1FLNA 5TGZA 3ESXA 2OYSA 4YAOA 2FZVA 2MTBA 3W7AA 1KBOA 1YCFA 1J9GA 3EDOA 1YCHA 1QHEA 5LBTA 2Z9BA 1XI2A 4FGLA 1D4AA 1ZX1A 4N9QA 2X2PA 1KBQA 2X2OA 4S24A 4YAFA 3NHKA 2QX8A 2RG1A 4J8PA 4C0WA 1OBVA 4F8YA 2Z98A 1FLVA 3NHRA 1FLDA 4DY4A 5FA6A 4Y7CA 5BUCA 4PTYA 5LJIA 2MOKA 3RPEA 5F4BA 4D02A 3ESYA 4FGKA 5EMNA 2FCRA 4CF6A 6NULA 2BMVA 3B6IA 2Z9DA 3JSXA 3L9WA 2BPOA 3KAPA 4H2DA 1DXQA 1FUEA 1E5DA 4Y9UA 2R97A 2QR2A 3UXHA 3N39C 5NULA 3W78A 1AKUA 4NULA 3GFRA 4FGJA 4QODA 4YAUA 4QOEA 4HEQA 2N1MA 4XDHA 1CZKA 3B6MA 2B3DA 1CZLA 3NHFA 2D5IA 3R6WA 4GR9A 2FAXA 3OX1A 4LTDA 3F90A 4QOGA 4N82A 4LTNA 2XODA 3KLBA 3GFSA 2V5UA 1CZHA 4ZVLA 3UXEA 1WSBA 1D04A 3K1YA 1CZOA 3F6SA 4ESEA 1AKTA 1AHNA 2BF4A 2WC1A 2FVXA 2FZ5A 3D7NA 5FX2A 2OHHA 4C0XA 4DILA 1XT6A 1C7FA 2FDXA 1SQSA 5LBUA 4M0CA 5JROA 2V9CA 1RLIA 5EAIA 3OX3A 1ZWLA 1JA1A 3NLLA 1OBOA 2QX4A 1J9ZA 2FX2A 3K20A 2QMZA 4PTZA 1BVYF 2ZKIA 3OWXA 2ARKA 1FLAA 1YOBA 2QMYA 2BN4A 1SG0A 1TIKA 3FJOA 3NHUA 5ULLA 3QFRA 2A5LA 1WSWA 4OXXA 1X77A 4QOHA 3NHJA 1RLJA 3N3BC 4R81A 5LLDA 3QFCA 3KEGA 2F1OA 1TLLA 4C76A 1B1CA 3OVMA 3W79A 3B6JA 3KAQA 4CETA 4C14A 4N65A 3TZBA 3U7IA 2M6SA 5LVAA 2HNBA 3OJXA 5F51A 1DX9A 3TEMA 3GAMA 4DIKA 2W5UA 5NLLA 3W77A 4YALA 2Q62A 3O73A 1XYYA 2Z9CA 3NHPA 1VMEA 1H69A 1AKRA 1FVXA 4QOJA 4GQIA 5A4KA 3L9XA 4H6PA 2AMJA 2GSWA 2V5VA 5F12A 1FX1A 1D03A 2BZSA 4ICIA 1J9EA 4XDGA 1YRHA 3ES9A 3SVLA 4ZVKA 3OJWA 4LAFA 2QWXA 1CZRA 1H66A 3HLYA 4QOIA 2M6RA 1T5BA 1ZWKA 1QR2A 5B3LA 3P0RA 4U7HA 3F2VA 4BMOB 2R96A 3S2YA 1V4BA 3TE7A 1J8QA 5FUQA 1CZUA 3G5MA 4YQEA 5EA2A 4NLLA 3NHYA 2HPVA 1QBGA 3NFRA 4U7FA 1DXOA 3FW1A 3U7RA 4ZVMA 1F4PA 2FLVA 1AMOA 4HS4A 2OHJA 4U7GA 4YAWA 1CZNA 1OFVA 1QRDA 1I1OA 5LMCA 4BMPB 1AG9A 5LJLA 2MWMA 3LCMA 3B6KA 1C7EA 2QX9A 1XYVA 4LA4A 3LT5A 1AKWA 4ZVNA 2Q9UA 3NHWA 1AKVA 1AZLA 2KLBA 3F6RA 1YKGA 4QOFA 2FOXA 1YCGA 3OX2A 4LTMA 1RTTA 2KQUA 1FTGA 5B3KA 3NHSA 3NHLA 1NNI1 3O2NA 2QX6A 2XOEA 1YDGA 3FVWA 1RCFA 3ZHOA 1GG5A 3HR4A 3OWHA 3FX2A 2MT9A 4FX2A 3GFQA 1T0IA 4Y9RA 4PU0A 3N3AC 3FNIA 1JA0A 3ESZA 1AKQA 3QE2A 1BU5A 4GI5A 2HNAA
chains in the Genus database with same CATH superfamily
1P1JA 4QGBA 3FLAA 2PIDA 5A1TA 3EOBI 5I3CA 2P9BA 3LK6A 5I48A 5FOQA 5FRDA 3DV9A 1K7FB 2Z1MA 1THTA 1VE3A 4QJ4A 4XGKA 2OO5C 5KKAA 3DTVD 3Q40A 3B51X 3G2PA 4IAOA 4OXIA 1ZBQA 4UUMA 3UANA 4KFUA 3AQIA 4IL5A 3T1YB 3Q1KA 5HIMA 3DSRA 3U5ZB 1UMCB 2OYSA 5KNCA 4IIVA 3ZQJA 4UPVA 2I6XA 3KZMA 1P0FA 3H1FA 4U2FA 2XTNA 5HMLA 4JB0A 4TZ6A 4HN2A 4PHHA 1Z47A 5G0WA 1NTOA 4KBFA 5BV2P 5BVHB 3MUEA 2O5VA 3UAGA 5K6RA 2D5CA 3S8EA 1ZVKA 3FF1A 3PX3A 1P6XA 3O03A 3PE6A 4ZGGA 3QI7A 1PAUA 2QMQA 2C4HA 4DXAA 2P4SA 2Z9BA 5CB0A 1JG7A 1DI0A 2C5GA 2YBDA 3IP1A 3TG2A 1Y1RA 2B99A 2OYRA 5D3KA 3DFIA 2VZ8A 4FINA 3PQ7A 4GVLA 2EBHX 4K05A 3N70A 1VJTA 3DQZA 1ZN2A 4NE9A 5LZ4A 3S2EA 3INRA 1Y1LA 4YJ3B 3PGKA 3A1UA 5DM4A 2RHWA 4OOEA 2SHKA 3MYRA 4OX9Y 1CJKC 4FDUA 4F2PA 1Q21A 3OZVA 4XR4A 2MSKA 2XCSB 1CS0B 1NLUA 1GVNB 3PTAA 1LLFA 3W2IA 4MV8A 2BHRA 1YZUA 2IU6A 3W6ZA 4F8YA 3NVAA 4LVCA 5JJCA 3CVUA 4I1UA 1FLVA 2CGEA 2DETA 5AJTA 2B8TA 2FWIA 1T6YA 2A4KA 2ZRIA 3OTHA 3KDSE 4G67A 3H5AA 4BU0A 5IWAB 3QVTA 4UUNA 4RVNA 1JEQA 4WLEA 4WZAA 4IIDA 3WDMA 1H2XA 2D1FA 4B7UA 1OUMA 2EGGA 3TIIA 2WIAA 1RYEA 2BFEB 1H0SA 4IQ0A 4UC0A 4D02A 4OQYA 3ABSB 2WIFA 4FGKA 1LBEA 4Q3OA 3HXPA 4DMLA 1FK8A 1RMTA 3HDQA 1ORRA 2E9SA 3N0TA 4FJ0A 4XR9A 4E1BA 1E20A 1K5PA 4K3UA 4G0YA 2VQEB 2WF5A 4KIJA 2FNAA 3IP5A 3OQJA 3QVOA 4TWIA 1NNSA 4X1IB 4UU1A 3U80A 3G8YA 2I7TA 3GWGA 1T29A 4FOSA 5B1HA 5LKAA 5K6AC 4F85A 2FJUA 2JI8A 9GPBA 4PLWA 5DIFA 5F5XA 4GNRA 3WB1A 5AM0A 5SICE 4KHPB 2VNSA 1CETA 1E5XA 4CKYA 3CUTA 1WZEA 2HQSA 5AJWA 4EI7A 3U3ZA 2HPHA 2G77B 4YJKA 5LB2A 3TFQA 4QGGA 3T61A 4AXBA 3WIDA 2E6UX 2IPNA 1WXQA 3TZLA 1JYSA 4OLBA 3H0KA 3LUGA 1XMOB 1SZDA 1M8KA 3LLMA 1RYNA 5JCOC 3PJRA 4X3CA 2NGRA 1WF6A 2HXYA 2J0EA 2PVPA 2OOSA 4R69A 1OXKB 3EVFA 2H5JA 3GN1A 2H16A 1GV0A 2H8GA 4XWYA 5IT9A 1RQNA 2W43A 4IGIA 4FOOA 4LXXA 4K1XA 3IMFA 1KYVA 1S7GA 2GO1A 3G2MA 2XNHA 1UWVA 5SZHB 1VCMA 1Z2PX 3EASA 3OP4A 1U0FA 5LQAA 1TO2E 2GYVA 4TMFA 3WGGA 1W36D 3C7CB 4IRXA 2JK1A 2WJVA 1MAAA 5JBIA 5L6MB 4ID3A 2J6IA 1D4ZA 2Z8XA 4GP7A 2QMOA 5IDWA 1Z06A 2PS9A 2A9RA 3LX6A 1IQRA 1NUAA 3NHFA 1XZDA 4YHBA 3VM6A 2COKA 2DT8A 3DKRA 1GDTA 4PZ0A 1S2MA 3I76A 4AX8A 2Z2IA 3A4VA 4BO8A 1TM4E 4XASA 4GR9A 4J90A 2EZ9A 2F1KA 3QPCA 4O1IA 1V6CA 2XVZA 5TT0A 1VXRA 5C51B 2D4AA 1HPLA 2GNAA 3T7IA 2PUDA 4NAVA 3PLRA 1WXGA 3W9BA 3WE7A 1DV2A 1SXGA 4OMUA 4L8FA 4QARA 1QHNA 1F4VA 3AVWA 1CRQA 3TR6A 1KEWA 1TDJA 3IQFA 5AHXA 4KI7A 2HEIA 3WY9A 4HB0A 4Q6BA 2XODA 5CK5A 3R76A 3RFVA 1T9AA 4ZCPA 4DIOA 2EX1A 3ILVA 3JYNA 3CLRD 4H3HB 4Q1EA 2J9FB 3IQDB 4Q3NA 3SSOA 1AA6A 5CP8A 4WNAB 4CL2A 1PUIA 2WT4A 1O9HA 3AO0B 3HU2A 3EHDA 3OD5A 4HPXB 3ER8A 3CNHA 3ZNQA 3EB9A 2RGDA 3D7NA 3DMDA 1EG2A 1TM1E 2CFRA 2DQKA 4PZYA 3SC2A 5CBPA 2O6HA 4PNEA 2NYVA 2DXIA 5AXCA 2VCYA 3BMQA 3VSAA 1RC8A 2IUSA 5FNVF 3HUTA 4OB7A 3ZHTA 5AW9A 2A58A 3VR6H 1SCBA 3PFIA 3TCKA 3WQQA 2I8LA 1NP7A 4WZ6A 5FTJA 5LBUA 4I8XA 4F5ZA 4PS1A 3MS2A 1GEGA 1OFIA 2H2FA 3ITEA 1P0CA 2P78A 3A6JA 4HMQA 2VF8A 4KQHA 1YC5A 1ARZA 4KU4A 3C43A 4L6CA 2EG9A 5EAIA 4G2TA 4NENA 5IKOA 1IY9A 4XYMA 4BVJA 2C88A 1U9YA 1Y6JA 1TM3E 4Q4HA 2J8ZA 3THOA 1FFCA 1A2OA 3VKWA 4MIKA 3K9GA 4W9MC 4M9RA 2B98A 2VKQA 1TC2A 2G3YA 2QQGA 821PA 3OHPA 2AC2A 2HTEA 3P9YA 4MLPA 2ODBA 1P18A 4MDFA 2FWMX 2RI0A 1KAMA 2X9QA 3JWHA 3OTGA 4GI1A 4MW0A 4N3BA 4ZC1A 1IM2A 1XQYA 1QAQA 2FSVC 1DQSA 1DQNA 1M34B 3AX6A 4AS1A 2D2FA 4V0LA 4KV7A 2B1JA 1YE3A 3A05A 2ZR9A 2JBHA 5HRUA 5ADHA 4DV1B 5EEHA 2D0IA 1LTQA 2AJBA 5FUMA 1Q7BA 2PRSA 4RK1A 3UAXA 4EPRA 4ZYZA 1W87A 3FGOA 2WV9A 4QBIA 4R1NA 3ZDXB 4IEIA 1SQ5A 3NONA 1ODIA 3X1ZA 5K4GA 3WJ1A 2VQFB 2HW8A 4OJKA 3WLIA 3FJOA 4JSRA 3EG5A 3OP1A 2C61A 1J20A 2JCGA 3UF0A 2VWQA 1B8OA 1ZH0A 2CJYA 2P9QA 3G9TA 3SYTA 4OXRA 4PZAA 2A0UA 4LUCA 1DCTA 4EYGA 1QG4A 3VVLA 3KCNA 2V03A 2XA9A 4LF6B 2ZJ6A 2F3RA 1ISRA 5JWHA 4IG4A 4MQUA 3IL2A 2HSEA 1ESEA 3MMPA 1J1ZA 5HUQA 3T95A 3DCYA 1BQ4A 4HTAA 2G80A 3F5FA 1M1YE 4RVCA 4BEBA 1T2NA 4K40A 1U90A 3QPWA 3PB3A 1L3BA 1IJBA 2J33A 2VAMA 1UAYA 4K6KA 2Q1TA 5IXYA 4CEIA 3AKYA 3M49A 2QP9X 2P69A 2Y66A 2CF6A 2ZJZA 4KVAA 4AJ9A 4QKQA 1Y6ZA 1GGHA 1WXXA 2J08A 4OQXA 2XUHA 5DEOA 5EMMA 2CNDA 1TTQB 3CS3A 3HI6A 4QYIB 5HHTA 1YFJA 2JJ1A 5LYJF 2ALJA 2JFZA 4F3RA 5FULA 5KYXA 3DMHA 5FDFA 3H2ZA 4EZEA 5F98A 5H59A 2ZSJA 3R3SA 1H6DA 3AEXA 3O3NB 3UV3A 5H7XA 2QMEA 1I80A 4D7AA 1NDQA 2QD5A 1V1MA 4L27A 5HWSA 3E22A 4MQ4A 4B6JA 4QPDA 4OH1A 1XMQB 3EBOA 2QI9F 3OQMA 2B78A 4RKEA 1A9SA 2QL5A 4JT9A 3B6ZA 8LDHA 1QQ7A 3FPGA 3ZBTA 3PNYA 2C03A 1TAHA 1SOMA 4AECA 3O73A 4C0SA 1JPNA 3FRIA 4MNTA 4OQPA 5DHAA 5LYJA 1B8VA 1N92A 3AV3A 3S2UA 1LW7A 1UL1X 2FOIA 1FJ2A 1NQWA 4CQMA 1JX6A 5FBLB 3R7DA 3U7GA 1UFOA 3OC6A 4OSPA 5C5DA 5I7RA 4MVCA 1FIUA 5I6DA 3CLRC 1I36A 1RE1A 7GPBA 1F0KA 1GPKA 3F7MA 3FDZA 4WE3A 2CEAA 3IBFA 2F55A 2IDMA 2HMAA 2QVGA 3FGPA 1Z0UA 1E2UA 4D9BA 4BLSA 5BW8A 3BL8A 3ZLVA 2IIPA 2NZYA 4CUZA 3RBZA 3DW1X 2NP6A 4ZI2A 1W0CA 3R74A 2Q5LA 4JCCA 1XEWX 4QBFA 1YRHA 5BQ3A 3VR2D 4CLOB 4N8DA 2QF7A 4QRHA 3OJWA 5EZYF 1OAOC 5CW1A 4I4IA 2HA5A 1IN4A 3QE0A 3NHAA 1WF3A 1DWQA 4UNIA 2G9UA 3T9AA 4JX8A 2XY4A 2B7BA 1PUJA 2F1IA 2OQIA 1XTBA 1WEKA 2J3DA 10MHA 3NMUF 1FZTA 2HOQA 3DE1X 3R5TA 3L07A 3STUA 1FDSA 5B3LA 1USIA 3HCEA 2W42A 1W4CA 3KALA 4X6YA 1C9YA 2HU8A 1RI2A 5C5CA 1J2TA 2XJ4A 5JUWA 1SURA 1TJPB 3TOSA 4UVGA 3NGXA 3OY2A 2ASVA 3LP6A 2B8EA 3LCJA 2WY2D 5EZYA 1ORTA 3P0HA 3SKXA 2PAFA 2H65A 4LV6A 4V0ME 1AV6A 121PA 1TIPA 4EPVA 2IYXA 4Q7EA 1IY0A 1J8QA 3UAZA 3OKAA 2H1OA 1DTEA 2C9CA 3QXXA 4WA7A 1QX4A 1VQ1A 4G24A 4Q7KA 3IX7A 4LE0A 3K72B 3PA8A 3TGPA 2OG1A 2Q0XA 3UV7A 5CLLA 1R16A 2WZQA 2P0AA 2ZRDA 4MA5A 1QBGA 1C8BA 2NQ2C 3TPFA 1FNCA 2G25A 5JALA 2GVZC 4MWZA 1A3CA 4GMDA 4RV5A 6ABPA 1QP4A 1WXDA 3JATA 1YKSA 2VTBA 1IY1A 2ISQA 1KTIA 3K9FC 2EWWA 1NZJA 421PA 3QX3A 1WM1A 2N47A 2XGGA 3FNBA 4TXLA 3USZA 2FLVA 2ZT6A 1HLGA 5GOZA 4ZCQA 1Q1AA 3MINA 3NXKA 3DNFA 5AT1A 3V3KA 1SKQA 3T1OA 4AMBA 3MCVA 4A92A 2DUNA 4C1BA 3T7RA 2NPIA 3C97A 4PN3A 1XALA 2IX9A 2AEEA 3QPDA 5KWJA 1D1QA 1CQIB 1I1OA 2ZETA 1QH0A 2Y0DA 1GTZA 5JQGB 4QA9A 2VBFA 3R6TA 1IEWA 1FVFA 1LBQA 4MICA 1AG9A 3OBBA 1C4OA 1QRAA 2ICAA 5DBEX 3B8EA 1URPA 4OAPA 1O94D 2F4NA 4V03A 4ZQHA 2YWCA 2IW3A 2BM9A 3I6YA 1DT5A 4FQ5A 5TQ0A 5IFLA 2XXAB 2CLEB 1M83A 1DKMA 3V9PA 2QN9A 4Y2XA 4FYYA 1JTFA 4GLOA 1N6IA 4LYAA 5IJ0B 3BZWA 3JYHA 1DIAA 1EVQA 4DRXA 2YCBA 5AQEA 1IZ0A 2EFJA 4LZPA 2HIMA 4MWBA 3SD7A 1ND6A 4OFWA 3OLWA 4XYGA 1F4LA 3IFSA 4MW4A 3D8HA 1T6ZA 3DFUA 3KZ1E 4QM6A 4FGWA 2B4KA 5IULC 5KU7A 4MV7A 1N8SA 2OSBA 3EFOB 3FPKA 1PFVA 1J2EA 3CSSA 4TWRA 5FPTA 4ERNA 4C7OB 2BGIA 2P6OA 2NUTB 4X1KB 2G36A 4QOFA 1JR3E 1HFEL 1T0HB 1V7PC 2Y1DA 1NRIA 2VNJA 4IRMA 4L0QA 3UK1A 1XUOA 1V41E 3V8PA 3FJYA 4D0LB 3DJYA 1JFRA 1GZ5A 1RQ7A 4TZKA 5B3KA 5H0IA 4MW1A 1QQ6A 1H2BA 3HHEA 1F2VA 2YINC 3RVKA 5GZ3A 2CLCX 1E9AA 3BD7A 5L3VA 1SIOA 1YZYA 1J0EA 1JLHA 3C8HA 3VH3A 5JNVA 5JSUA 3ZDAA 1XLVA 3OSZA 1NBHA 5PGMA 2UYGA 1VI5A 5C81A 2A35A 3FNGA 2OB2A 3GI1A 2PUTA 1ETHA 4DLTA 1P2VA 3P9PA 4TLBA 1V11A 3BA1A 4G8DA 4A2PA 5K4HA 4DCTA 1TJ4A 1ULTA 3GH3A 4P38A 3P9NA 4RPHA 3W3AD 4CM9A 1Q7CA 1WMDA 1YR9A 2BZ1A 4P8RA 3T99A 1DVRA 1JTEA 3GFQA 5DGCA 2VHWA 3TR0A 3LSYA 5IAOA 3DZBA 2BCJQ 4JKIA 4B80A 3N53A 2PCJA 1R9NA 4NIMA 4AX4A 2C2WA 2OAP1 2ACEA 1VHWA 2GXSA 2NTNA 2PZGA 2IHBA 4UXJA 2P62A 1VJ1A 3AZPA 2J59A 4ZU3A 3T8YA 5BORA 1GRCA 3LCUA 3M0EA 4F3KA 1LEHA 1GWNA 4V0KA 2FFBA 2FR8C 1VE7A 4D6XA 4HNQA 4Q01A 1UAGA 2Q5HA 4TKZA 3CVXA 1OZAA 5ALLA 4AQYB 3N2ZB 3VI3B 2HIAA 3HM2A 1W4BA 3EYWA 3NRCA 1G8YA 3NZEA 3I4CA 1SC9A 1SZCA 2OD7A 4B40A 5C1DA 3HCDA 1HG1A 2AZ4A 3HKEA 2F8LA 3NHZA 4C04A 1ZESA 3KR0A 1G5IA 4YHHB 2VYCA 4B4UA 5DXAA 1OROA 4AF6A 2RHCA 4NDZA 4RZ3A 4ALNA 3GFOA 4PCVA 5CLHA 1IBMB 2H29A 3CFYA 1R5JA 5LLTA 5F2KA 1UKZA 5IAAA 4BY9E 3TD6A 5BWCA 1TO6A 3OCXA 1FEZA 4MMXB 2PGAA 3DXXA 1XCGB 3M9LA 4BQIA 4JR0A 4POOA 4IWXA 4CPDA 2FSUA 2XKAA 1FFXA 1ORIA 2HHHB 4BP9A 4AJ1A 2AW3A 2BGNA 3HJRA 3STVA 1PR4A 3G2IA 2Y1EA 4LFAB 1QHEA 1QHGA 4YPOA 5KQRA 1IM5A 2H92A 4CKXA 3HFJA 4KGDA 2AG8A 4EBFA 3JZMA 2Q28A 4XW2A 2XRMA 1O5IA 1SMKA 4N9WA 2AOUB 2JEZA 5AJXA 2EFYA 3KTAA 4PC7A 3EDYA 3U61B 1FSPA 3CKKA 2R7AA 3DE4X 2QR5A 4KDRA 4HYTA 3ZE2B 3OMLA 1ID1A 1L8LA 3CG0A 3WLKX 1KHHA 1OLSA 3DEIA 3MIIA 4Q1FA 5BNZA 3TE6A 1O94C 2EQBA 1SXHA 2IJGX 3MBIA 1SVOA 4ARZA 3DOUA 4M99A 1GGVA 2AUNA 3ORYA 4QVIA 1P3Y1 4B2LA 3ZWWA 5E6RB 1CR6A 2KX7A 2QIOA 2C29D 4B3XA 2ZLBA 5FP0A 4QNRA 3U4MA 2VH5R 1GPYA 1UEXC 3CKMA 4JLAA 4MRMA 3PVSA 5ICMA 3R7SA 1LV8A 2VPZA 3KQVA 3ENKA 3SDSA 2G08A 3WMWA 4Z2AA 5K05A 1BJTA 1GP2A 3FNFA 4RC9A 2Q1YA 3S2ZA 3VJLA 2WJIA 4ANFA 4ZDJA 1ZG3A 4MDHA 5GJWC 2WRZA 3PIDA 3UMRA 2G5PA 5DBFA 2PSDA 4REMA 1XN4A 1QPZA 2F6RA 5LP6A 3EVDA 5THQA 3UFXA 5F1KA 3NYQA 2W6NA 1QJCA 4EYOA 2AC4A 3FMVA 4MUHA 1W0KD 4Q9JA 3M8KA 1CY4A 1LV7A 1JJVA 1P1HA 7MHTA 4GKBA 1N9ZA 4IO1A 3D7KA 1DLJA 3RRBA 2PKXA 2Z56A 1U9IA 5EJ2A 3BQ9A 1DEXA 1MIHA 1Y4UA 3B3QA 3IO5A 2CXRA 1SH7A 1XLTC 3VZBA 1XDSA 3A6ZA 4H2DA 4RFSB 2XWJI 2QPOA 4RIHA 2NU8A 1DAPA 1ZHFA 2QRUA 3PNPA 5A9TA 1QV6A 4L6AA 3LHDA 5F1PA 2C59A 4CR7A 1ZU5A 3PEEA 4MR9B 5U1PA 1SVUA 2X14A 4FFDA 2QR2A 4HLDA 2VSFA 2EV9A 3A3NA 3ZGXA 5BRJA 2PZMA 4HQLA 1M10A 2G0AA 1TKBA 1XL0A 4DJAA 1SQ0A 2XA1A 1NBOA 1DKOA 1B6SA 1SN7A 3EHEA 1E3WB 5AKGA 3T7TA 4JOBA 3NVKI 3C6YA 2BLNA 3CPJB 4O2LA 4BAGA 2YZKA 1EE1A 4OSEA 2BGMA 5KHLB 3ZVKA 4A27A 3CEJA 1R4ZA 2OCXA 4UVIA 4NOJA 3WGOA 4FCTA 3JQ6A 1QGAA 4LOJA 4QOEA 2AJ8A 3L6DA 4WAUA 5TB5A 2B1IA 3NOQA 1AGRA 5JJKA 2ZIUB 1ULZA 5JH7F 4LKRA 2HU7A 5GV7A 3L6EA 5MFZA 1MMFB 4HP8A 4IDFA 5HS6A 1XA4A 3ZS9A 3TW8A 4L74A 1J42A 3NX4A 1UPBA 3B1VA 5B58C 2V45A 2AI1A 4MZDA 1G41A 3DUWA 1EUQA 3R9XB 1LFAA 1Q84A 1R6BX 1ZCZA 4LPSA 5FOVA 3AW9A 5T5QA 1X87A 4MCAA 3RTGA 2IYZA 3LU1A 2PHZA 4DIFA 1DTWA 2RB5A 4WX2B 4OFZA 3V34A 1Z2AA 3DG9A 2F1JA 3CXUA 4DDKA 5JSFA 1XCBA 2ZWPA 1BROA 1F0PA 1JRLA 3OJFA 3LD9A 1P1BA 2M98A 3LS2A 3U49A 4BNKA 1SUSA 1GLVA 2VUTA 3A1DA 4LF5B 1CLEA 3M4YA 4B7CA 2P8JA 3IVXA 1QG2A 1EDEA 3QPAA 3G23A 3COSA 4UM8B 3BFKA 3GW8A 2XUQA 2X77A 3Q12A 1JLMA 2IC5A 4C3OB 3OZUA 1ZD4A 3GCZA 3NUQA 2CY0A 1ONSA 2JKYA 2OT3B 3SJ7A 1BE0A 3PD0A 5ECDA 3LC1O 5ALXA 3LBAA 5LZ7A 1AKTA 3ACBA 4QQ8A 1G7SA 1F38A 4D81A 3VYUB 1FMTA 3A0RB 3GIWA 1GFWA 3A6DA 2NZVG 1XAGA 2P2NA 1ZUIA 2JEOA 1GTG1 4QATA 4YT5A 3T4PA 5I4IA 1PG5A 4ABTA 3ZGZA 1B8PA 3I2YX 4LCJA 4NK5A 3DHVA 3NIGB 3LPNA 1ENYA 2YIVX 4FFNA 3WL6A 1R0YA 2QZ9A 2OSVA 3LOPA 1Z7EA 3EZYA 4QDZA 3B7GA 5M34A 1KBZA 2FDXA 3IEMA 1A8UA 3CUSA 4KITB 2JK0A 1GUYA 2DKFA 3COZA 5JROA 1G38A 2XTZA 2GM9A 3I1JA 5A0VA 1ZI9A 1G5RA 4DAOA 3IDFA 1QZUA 5JCJA 3RS4A 3DA8A 3NEPX 2ZJYA 2O7VA 3NAZA 4GBGA 2TMYA 1VIDA 4OM7A 1UJMA 3Q87B 4WV3A 1RYYA 1UPTA 1MX3A 4Y2QA 3TL6A 2P5TB 4D3ZA 2F62A 1ZUD1 5BT9A 3EZ2A 3FMOB 3HKCB 4U3JA 8MHTA 4KG7A 1FL9A 1O97D 3BGIA 3H3FA 4FQ7A 1E4VA 3RYCA 3ADPA 2Y0BA 2A0FA 1Z9BA 2FX2A 2Z8YM 3ZHXA 1XZPA 3ONDA 2FY8A 4I9NA 2A3NA 4ESVA 4QOSA 5ECGC 3MSXA 2WYVA 1UT5A 3B8HA 3RJ5A 3QJYA 1Y33E 1ZU4A 2YS7A 3A37A 3AHJA 3BHNA 3HXKA 4OREX 5TF0A 5ALSA 2YQ5A 2LGJA 4LIPD 4XEUA 3WIUA 5TMPA 4FLEA 1W6UA 4YV0A 2FE4A 4XARA 1YBMA 1QE5A 1RZUA 2QMYA 3H6KA 4TTJA 1VDZA 2C4MA 3OJLA 5I9NA 1YULA 2QXTA 2VTEA 3WTBA 4ZTUB 1T8TA 3CIFA 1HE3A 2WKQA 4B0PA 5DK6A 1XQ1A 3DBLA 1K4KA 1QYDA 1UQUA 5IUKC 2V6FA 4DEYA 4JI0B 3KWJA 3B1KA 2F43B 3N2IA 5KNDA 2JF0A 2PSSA 2RJ3A 2Y76A 1OFUA 3TIXB 3DAOA 2QRQA 5FADA 1N5RA 4D3FA 4DY6A 2PD4A 2E48A 2WU0A 1OTHA 4S1PA 4C0KA 1IVYA 3CW2A 2R4QA 2WI8A 2ORVA 2GF9A 2UZ3A 3Q7IA 3AUXA 3ZYZA 1HYGA 3JZFA 1PEYA 4L8VA 3P2OA 4EGQA 2C8VA 1F6BA 3C6MA 2R2AA 2IUUA 3QQ5A 3BB4A 3DKPA 4EO4A 1F0YA 1E2IA 2CLFB 1TD1A 1SY7A 2QU7A 3LY5A 4P22A 2O8CA 4P9NA 4KYTA 2JH8A 4KR9A 2BYTA 2CZGA 3MUNA 2RBGA 4MW2A 4U02A 1LBHA 3WAJA 4BKPA 1B1CA 2LCIA 3OUZA 2D7CA 5C2JB 2QLFA 1OLUB 1AKMA 2RHDA 4QU5A 4DLKA 1ML4A 3GJTA 1NMSA 1RM0A 1VLMA 2I2DA 2X9VA 1M1YB 4GE3A 1T2CA 2XBLA 4ZOCA 3MAJA 2X0DA 4N65A 4KQWA 1NP6A 2PN1A 3V80A 1AM4D 1NBMA 1X7DA 2NTEA 3BE5A 1PGNA 3O8BA 4LGMA 2QJOA 1SUEA 3O84A 3DJFA 1N6HA 1KVTA 4UMVA 2NU9B 2V9PA 4QXPA 1YOVA 1MD9A 2J4DA 3ABOB 3G0DA 4DA6A 1KMCA 1JQ5A 2TMDA 3K0AB 4DGQA 1ODLA 3KKLA 3RQIA 4DMRA 5ARBA 4MB2A 4EG8A 4K9PA 4R7ZA 4CDGA 2XDYA 2QQ0A 3LHKA 3V1UA 3ZEIA 4CU5A 5H3CA 2D5BA 3BDAA 1BN7A 2EXXA 1E79A 2HADA 2PLNA 2OKCA 5FNZA 1VKHA 4FU0A 3LKBA 1JI0A 1QIMA 3RRMA 4YMWA 1FVXA 5AXBA 4XFKA 3W04A 3WXBA 3WKEA 2QTCA 4RH0A 5B4VA 1TQDA 3PPYA 1LTHR 5TGTA 3PYXA 4O25A 3ICEA 3LVFO 3UT5B 2XMQA 1JLKA 2GWRA 1FX1A 1XTRA 2BW0A 3DT6A 1RYMA 3WGVA 1IXZA 1T3TA 5DULA 1OAKA 5E9QA 1K63A 1D03A 1QM5A 2RGYA 1RJWA 4ZGBA 2ODAA 4RU1A 5DI3B 1UBEA 2O3UA 3JQPA 4AT1A 4XYEA 1WA5A 5CFNA 2JI6A 5CGZA 3GYBA 5ILQA 3Q7EA 1DCMA 5DTJA 1V5EA 2QD3A 4PWYA 1XKXA 3W06A 1D2MA 1DCFA 1H66A 1RAGA 2C98A 2NSDA 2QGZA 1CCWA 3HLYA 3L0CA 4KAAA 2A5FA 1U3UA 1J09A 1E8NA 2C7BA 3PT5A 4XQ9A 2JLYA 2AFRA 2C4WA 1E1CA 1YXMA 3TSZA 1GA4A 3UHFA 1MAHA 1ODKA 1Z7GA 5KPDA 1CEQA 4LKOA 4TTTS 4AKIA 2QXYA 2Q45A 5J47A 2G1AA 4TKMA 2GCPA 1GIAA 4W9NA 3O2JA 1GCGA 4ITVA 3LL7A 2ZRLA 3PKJA 2IYUA 1H94A 1YC2A 1F1JA 2QVZX 1BJRE 1NI3A 1N6PA 4PTLA 4Y2TA 3QFHA 1GTJ1 3O1HB 4U8HA 4QREA 1DU4A 5AHWA 3AVYA 1E6MA 4RZIA 1O97C 5HPYB 3FMIA 4DN6A 1JSRA 2W2TA 5L3SA 5ARCA 4ZIRA 1KIAA 4ALLA 2WYIA 1D2NA 3PQ3A 4DV2B 2GRAA 1QO9A 4KP7A 1NKSA 4U00A 4LYHA 4CTOA 1L9XA 2EJCA 4NDAA 3LKDA 1QWSA 3H5OA 2I22A 1TU3A 1V3UA 1PFYA 1BVRA 3AZOA 4YDQA 4TWBA 2WHYA 3GPLA 4Q66C 3R3YA 2E4WA 4FJ1A 5SZIA 2IEBA 3O8QB 2O8EB 1R7RA 3CWCA 4MUFA 4R6WA 3W5JA 3OFKA 4OIMA 4AY5A 4CLEA 4HLUC 1O95A 1PHPA 1GTMA 1VSBA 2VEDA 3OQHA 3VR0A 3G49A 5JEEA 2FB9A 1SC4A 3NO4A 5A5EA 2VXCA 1QGUB 3HU5A 1DJQA 4KPEC 3CBQA 5AK6A 4JBHA 2WSYB 3AU9A 5JD5A 2XCUA 5H4HA 3L1UA 3CTMA 4PFQA 1D2GA 1GKYA 3CH7A 2IZ6A 4TGLA 1ZVVA 4RVDA 1P75A 4XSGA 2WP8J 4ZDIA 1PG0A 3TSOA 2XGJA 5L3QA 4Q3EA 5TVGA 3QY9A 2JRCA 4DA7A 1G19A 4DB4A 3ESQA 3JALB 3RBVA 2HRCA 2GILA 3P27A 3JAWB 4U9HS 1GXSB 2JB9A 3CSUA 4D0GA 2DH5A 1ECCA 2PWZA 3FWKA 5IUJC 1DBSA 4ZARA 1BH2A 1LX7A 3OC0A 3GUVA 1E77A 1AXGA 3PGJA 4CLDA 5C1BA 3WNVA 5JDCA 3FR7A 1QAOA 1U3FA 4A8PA 3PQ8A 2E21A 5DHUA 4A36A 2J48A 1ZMBA 1NYLA 3ZY3A 4IZHA 2B4AA 4TYQA 3JQ7A 3DBIA 1K06A 3CH6A 5GP1A 1YFKA 2GPWA 3GJ4A 3GLHE 4AZ0B 1KDYA 2XDQA 5B12A 3FSGD 5DBOA 1PI3A 1WZ2A 2EHDA 1IK4A 1AS3A 4PSAA 5F78A 3VISA 4C7VA 1E9FA 1S5PA 2FPPA 5GV8A 6PFKA 3SPXA 1N6LA 2DBRA 2PIAA 1JHOA 3RVSA 2QMHA 5JXHA 3ZBPA 1PJLA 1P61B 4URUR 5AESA 3DXZA 4L4XA 5JO9A 5LU8A 2QBYA 1SOAA 2RGGA 2ZIXA 2Y3IA 3X1DA 2VWGA 3TQQA 2ZZMA 4KX5A 1JG1A 1CJMA 2JBWA 3BC1A 3EDCA 4I5FA 3PGA1 3UYKA 2XBMA 2WJAA 3A32A 3L8GA 4PPYA 1FQWA 5LNK6 2VLIA 2Q6LA 3CX8A 4FNGA 4BJ5A 5JR3A 3SBEA 3KOMA 5FBQB 1E1MA 2ZI4A 3Q6NA 4JMPA 1A27A 4TTPA 2FMKA 3UWDA 5K8CA 1KETA 5KTSA 5F9MA 3ZJUA 2D8MA 4UBJA 2H52A 1JIJA 5CDTA 1G7CA 3EUFA 4PZLA 1R50A 2JJYA 4QRIA 3C3XA 2CE7A 3IXLA 4EJSA 5HXAA 4OLHA 3GGCA 4IHJF 4DR4B 2Z5GA 1PF7E 4K86A 4GSKA 3IUMA 3E3OA 4TSFD 3HKDB 1VIVA 1EP2B 2JLSA 5IBRA 4REQB 4CIAA 1PJCA 1DHTA 3UQZA 4F2GA 4JJGA 1N4DA 4FTWA 1XAIA 3WISA 3GJ8A 3HNOA 4NCHA 2FF5A 3F8TA 4RYDA 5LQSA 4IMJB 3QTTA 1FDIA 3EUEA 3IUJA 4DUGA 3EMDA 2FGKA 5I9MA 2X5XA 2BFFA 2FWBA 3JYLA 3LAWA 3KZVA 4IHJA 4UTZA 4ACBA 1QHIA 4FHFA 3H84A 1U3GA 5H8WA 5CTAA 4YI5A 1BD3A 3AYXB 4MPJA 4QUIA 2YXBA 1QWOA 1VRVA 4RNCA 4HVAA 1K2VN 1CY2A 2I9PA 1VLLA 5C8YB 1N2CE 2P6UA 1PP4A 1OILA 2Q3LA 1KJ9A 2UYOA 3HP1A 2A7QA 4R9VA 5K3OA 1RWQA 4HDSB 4TXHA 1FFGA 4M7RA 5DHPA 3ITKA 3IPXA 2JLBA 3MAGA 3FWZA 3GGDA 2AFIB 3L18A 2V7BA 3GRAA 2ZUBA 5CPFA 4WSOA 1GN9A 1JQDA 1OV4A 5B37A 5J63A 1ZK1A 4FE7A 1R9JA 3NUZA 1LBSA 3VPSA 3I9NA 5ITSA 4AYTA 4BLOA 2ECQA 4DA0A 2G6TA 3VTKA 3PF9A 1BGXT 1KI6B 1X2EA 2I03A 5KAPA 4E5VA 2RJOA 2DH6A 1T3SA 1LK5A 4IJMA 2JBAA 1E2EA 2RC5A 2RG7A 2W6JA 2YWGA 5IYZF 3VNBA 4J16A 1UK8A 1GZSA 4M8IA 3UAOA 5GPBA 1EP1B 4P53A 4CMHA 1HT3A 2I6SA 4HDAA 5BYBA 2VQ6A 3AFMA 5BN1A 1XI2A 4CF4A 2R48A 1T5HX 4IDCA 4GQAA 5THKA 4NWIA 4TWAA 4H3VA 1U2DC 4YDSA 5F64A 4FR2A 4JFAA 3OF5A 1GDHA 4NYJQ 4US2R 3ECSA 3THWB 3L0DA 1YQQA 5FPHA 1O1YA 1R6XA 5I5GA 4B8WA 4Y18A 3UOWA 4DCNA 3T35A 3HU3A 4WZBE 2JIQA 4ZT2A 2RGEA 3VV2A 2A5DA 3MHPA 4LRYA 4WCFA 5IYZA 1O9GA 2BFBB 4N8SA 5AKIA 1NM5C 2D1RA 5KVCA 2FPWA 4DR7B 1NURA 1II9A 1XWIA 2H1SA 2IXEA 2RKBA 4KLZA 3TO5A 2RG1A 1R8XA 3JQGA 1E7QA 2DAPA 1E2JA 1PVDA 3FTNA 2Q0QA 2VJOA 4OY3A 2VL7A 3CGGA 1I3KA 5E9AA 1DDGA 4PCLA 4RWEA 3A4MA 2B4YA 2O4CA 3HO6A 5EIBD 1OX5A 4CLRA 4OOFA 4MUAA 4DKXA 2V6BA 2E82A 2J1LA 2MSWA 4ZD6A 3IVAA 2NG1A 5BQPA 4URWR 4WK4B 4P31A 1EBFA 5AI0A 1FU8A 2DECA 5EVCA 1XZEA 3U1TA 2G76A 3VPHA 1F2UA 3D0KA 3DEAA 3ELYA 2IZ5A 2XCQA 1HI9A 1FMFA 2XTAA 3NNNA 3QLVC 1O7JA 4RVGA 3NTXA 2OFWA 3IA7A 3KJZA 3B6EA 5CA1B 2V59A 3A9TA 1CIPA 9MHTA 3JV7A 5FOWA 1FTQA 5FOXA 3QVLA 5DNYB 2RKOA 4MZXA 4NCJA 4Q7JB 1XEAA 2PGXA 3H11B 1ZHHA 4P4SA 5CLGA 5DBGA 4CT0A 2P9YA 4NMMA 4M0UA 1E59A 3I3SR 1T2UA 3UK6A 3H9BA 5DNWA 5HCNA 5BXYA 1HO3A 1XD2B 2QA5A 3LGSA 1BDBA 3DHYA 4GQBA 4X7RA 4O08A 3ZI4A 4OMCA 1P2UA 4QGAA 4OX9B 1XZKA 2VLBA 1HQYE 2BGJA 1Y1QA 1ZSNA 3JRWA 3ONVA 2BWJA 2W8BB 2X15A 2FKNA 2VQDA 1COZA 4PV7A 5SYMA 2RGNA 3RHSA 4NULA 3UIEA 4Q34A 4FGJA 2QU8A 4LW8A 3SS9X 3EGCA 2I1WA 3TTSA 4RA9A 4K26A 2P1DA 3SE0A 3PLAE 4LJKA 1ZOOA 1V8FA 4G4SP 4MQEB 3V4FA 4GEKA 4RK7A 5J58A 3LTEA 3HYLA 2PO5A 3U62A 2PUVA 4KWCA 1I1HA 2ZI6A 3IIIA 5K0EA 4YWHA 3C3CA 1YJQA 4L85A 3UK7A 5AUPB 3WHIA 5BR7A 3FXAA 1EK0A 1Q3KA 2QK4A 3Q4GA 1G5HA 2EGHA 1EB9A 1E5TA 1KI2A 1SOWA 3QLEA 3BFPA 1SU8A 1TM5E 2PRKA 3VGJA 5JFGA 5HBRA 2ZJ5A 1JFFB 2CXXA 4PQGA 1HNNA 2RI6A 1YHZA 1F2TA 2WJPA 4FZ5A 1P4SA 2P4EA 4E3ZA 1D7OA 1JJAA 1W4AA 2C2OA 3VH2A 4RTRA 1ENZA 4WH0A 1I4WA 1A88A 3U3OA 1E1QA 3GWZA 1KVQA 1T9GR 4YIHA 2VAWA 2NSHA 2X0EA 4TOIA 3QE4A 1M2WA 4BVAA 2FPGB 4R0VA 1N2OA 5BSMA 5F9FA 4BE4A 5FWYB 3ZOKA 5CIYA 3Q7RA 3QEBZ 3GVIA 3G7NA 4HXEB 1YTUA 1PV1A 3VSCA 3KJFA 4TXMA 1RQXA 4JL5A 4YJGB 2FN8A 1WSBA 1DBWA 1Z26A 3OKPA 4G5YA 1EH5A 4GMHA 4WZAE 3SIXA 2OR3A 5CYPA 4R7GA 4RHEA 3TD9A 4C22A 2JD2A 3G0GA 1CZOA 4Y1FA 4II3A 3EXAA 1RQRA 1XF9A 3ZV3A 3FBWA 3L7KA 5LJLA 1FB5A 1AK2A 3NR2A 5AKLA 1VL5A 3DNPA 1VL0A 4QVGA 1X7YA 4ZRMA 2QKYA 4RZSA 1WD5A 2QZZA 3QITA 4F5DA 4KYIB 3PENA 3T1TA 4Y6RA 5GZ1A 5DH9A 1EFRD 2HN9A 3O7WA 1W6RA 1GL3A 1CVIA 4LWZA 2FRDC 4X8OA 4IUYA 9ATCA 4NDNE 1U5BB 3EVAA 3IHKA 5ALKA 5JSKA 3B89A 3F3KA 4L72A 2WA1A 3H7IA 2UZ0A 3M5WA 3V7WA 3UN1A 5D3MA 3AFOA 3GJYA 2CJWB 5GM2A 4LGYA 2UUBB 3RE1A 3K8ZA 1Z8FA 4LV5B 2W90A 7REQB 4GP9A 4F38A 1KAHA 5EIBC 5IFKA 3U7JA 6REQA 2P5UA 1DIRA 2RHJA 2GBLC 3SZGA 3R0QA 3W5SA 1N1DA 1TLFA 2ODEA 3ZV7A 4EMBA 2DQ4A 3NC0C 1ZVMA 2G9RA 1TK3A 3NJ8A 3A9WA 3H2YA 1NATA 1TAQA 3NB0A 3O38A 3W3ZB 3PPIA 3TRDA 1X74A 1A5ZA 4IFBA 4K8RB 4IQ8A 2IU3A 3AY0A 4Z0NA 5C4MA 1GL6A 2PYIA 2X23A 2W2LA 4ODIA 2UUCB 3BH7A 1FY2A 3ETCA 4B0OA 2WJJA 3ZCXA 1ZY2A 3UM9A 3CJTA 4QPJC 1UDRA 4A10A 1DG9A 1Y82A 3UOAB 1HZZC 2J4CA 3ZUGA 1VL6A 4RF3A 3Q5GA 2YY5A 4RVHA 4GEGA 3BB3A 1E0SA 4OU5A 2W6OA 3MILA 4Q5IA 1RI4A 2ZIGA 3AKCA 3OT1B 4OJNA 2BRUC 4BNGA 3IPCA 5AJZA 5F21A 3PUYA 1Q91A 1XG5A 4YV2A 4E2WA 5FFMA 1UDWA 1RQGA 3JVVA 5D3ZA 1UFKA 4H7IA 3TK1A 3KTDA 4BAUA 2HBQA 7YASA 3P9IA 1YVUA 3C3DA 5A7HA 2EP8A 1M0WA 4KUHA 1ZHOA 1PWXA 1V96A 4HO1X 1X77A 2BDTA 1GZVA 5FLKA 1U5CA 3U44B 1P5RA 3UICA 4LRUA 1XZCA 2EKLA 3LPMA 4YO7A 4I4TB 3WI7A 1UBTS 3H83A 5F7OA 1YIAA 3AHHA 3N2KB 2P27A 5JS8A 3AIKA 4DG5A 3R8XA 1AX9A 4KZKA 2VDOB 1TK9A 2XTJA 1ZDMA 3ACDA 4OL9A 5A7FA 1PNOA 4F3NA 1AMUA 1SVKA 5D84A 1CWUA 2N75A 5FPKA 4Z99A 5LLDA 1PWHA 1W52X 3W2HA 4DZRA 5JRZA 1M5TA 5EJ6A 1ZH6A 3FMFA 1SKAA 3RVPA 2C1XA 3MVEA 3E4DA 3D9QX 4H1TA 5AI6A 5LDDC 3PC8A 3W79A 4ZYLA 2JARA 1QK3A 3DZ8A 4JJEA 3RRYA 5CB4B 3B6JA 3AFNA 5HTOA 1OD6A 1EVKA 3QKSB 3LOQA 3ZNNA 3O21A 1MT3A 3R44A 4P7BA 2CBGA 2PQ2A 4BB0A 2CK3A 4F92B 4BS9A 3A11A 1SA0A 4Q1CA 4B48A 2I76A 4L0CA 1GNPA 4ECAA 4K3VA 5LQJA 2XYRA 3IP6A 1CUHA 1J8YF 1U28C 1U7XA 1RKQA 2FP4B 3BMXA 3I8SA 4QDJA 3UQYS 1TT7A 1P45A 2VUUA 4FI3F 4M37A 5TPZA 4YYZA 5DISB 1S8NA 2F4VB 2C9OA 2AOWA 5KYUB 4L5CA 5A5VA 4GOKA 3C0KA 3Q3CA 5DE3A 3N75A 4EJ2A 1AF7A 1R3DA 1YK0A 1XZFA 5HZGA 2Z6QA 3WLPA 2C9ZA 2QE6A 4OXKA 3Q5EA 3RAFC 3AJDA 2X8JA 5JXJA 4KKVA 1P6QA 3FSEA 5EY5B 1S89A 2FPUA 1VI2A 4L75A 1PWYE 3VUEA 1ABBA 3DXFA 4YX9A 4PZ9A 3GT3A 1K27A 2BGKA 1CYDA 1N6KA 3TZEA 4MPPA 3DAYA 3WK4A 1LPAB 3WGIA 2YZNA 1ID8A 4GLLA 3GGJA 4ZOLB 2OL4A 3OOYA 4BE9A 3EIEA 2IPXA 1R8JA 3BN3A 3DB2A 3SEAA 2EW1A 4JENA 1CE8A 2ECPA 4D8WA 2ZAYA 4YJ2F 2QTTA 1KZ1A 3FE2A 1NZFA 3FROA 4E03A 1NGSA 3K6JA 4XDGA 1VMKA 1VG1A 1XKTA 3IH5A 3T5MA 1NC1A 3IJPA 1GA1A 4CGZA 2WTEA 4BBJA 3V8MA 4RS4A 2O05A 4CMAA 3KXKA 2FLWA 3RFUA 2IUEA 3STXA 3R5HA 3HA7A 3ZLUA 1XE3A 4KQ2A 2Q4TA 3DVLA 4LSGA 3WJ2A 2ZRFA 4TRNA 4RYLA 1J5PA 2QNBA 4MQBA 4NBVA 4N6OA 1S8AA 4CKWA 2JIBA 4YJ2A 5KJFA 1Z08A 1SBTA 2OYCA 4J0QA 4CKEB 1NVMB 2A33A 1FSSA 3AR8A 3C6KA 2I78A 3M6IA 3FOCA 3N2GA 4U7HA 4BV2A 1Y98A 2QZSA 4PPNA 1L7NA 1TRKA 1WQ1R 3O9VA 4RD3A 5TDHA 2P3OA 3LV8A 4MI3A 4BN4A 4PYOA 2GTIA 3O3OB 1KOLA 3F67A 3CN9A 3DZJA 4YC7A 1EQ2A 4AWBA 4ED9A 2R6ZA 3GDFA 1JMKC 4HVLA 4N7MA 2GKOA 2HLPA 2QQEA 2GH1A 4HAVA 4K9MA 2WOJA 4UDXX 4YQEA 4B6SA 3V8NA 2AYZA 3EMVA 3R5JA 4DVGA 1GZHB 2FWAA 1OH6A 1LDYA 3ZCPA 5HILA 1ATIA 1AGXA 1H4TA 1K8QA 1PLKA 3E15A 1GKUB 3CJQA 3O0DA 4IS2A 1UKVY 2TMKA 4JBGA 3NYIA 3T7DA 1OC4A 3LK7A 5C1IA 1IZYA 1JT9A 1HT1E 3I4LA 4PO8A 1LX6A 3MD9A 5K0FA 1Z0JA 2PWPA 3DO5A 5FBRB 3VU3A 5KYYB 1JMVA 1ES9A 2AFHE 5LM3A 2AR0A 4G1UC 3RANA 2LE0A 2J46A 3JQBA 3EIWA 1JI3A 4PC2A 3UJDA 3L0PA 2AF4C 2R00C 5EXPA 2XLBA 4L2IA 5ALRA 4Y2UA 2TSYB 2WKPA 3RNOA 1OFVA 1EXMA 1P7CA 2EJVA 1ZN7A 3V4RA 2B2NA 5EP4A 4DLRA 3MTQA 4M9CA 1T36A 4U63A 4NC9A 1UBCA 2PPVA 3R5KA 1WW2A 3GQBB 3OOJA 2OFFA 4CTKA 4JV5B 3W90A 1OH7A 1U7WA 5KREA 2JI7A 3DH0A 3NTQA 2ENWA 3HB5X 4UFPA 2P2LA 2O52A 2ZPUA 2AQ8A 4RABA 1EJ2A 3GVXA 5AICA 4PHGA 5DGDA 3KT0A 1TX4B 1L4GA 1YBVA 3QF4B 4OL0A 1A7KA 4EKEA 1Z4LA 5ENZA 3PUVA 1Z5OA 3UB2A 2VSXA 2Q07A 1XXLA 3BWCA 3D6MA 2VPQA 2ZRNA 4XPZA 1NQ5A 1UEIA 4DCGA 3LG2A 5HIAA 3T41A 3SZUA 3WQHA 3LC0A 4UNPA 1NBAA 1EWVA 1SVMA 1KVUA 1R12A 4O29A 1YR8A 3GRKA 2F1RA 2JFBA 5ALZA 3WWCA 3IHLA 1ECGA 2GD6A 5HOEA 2V1UA 4KRFA 4DBZA 2G1UA 5B64A 4ZT3A 3RG2A 4RTLA 1B0PA 1TU4A 2A0XA 3EH1A 4KR6A 2IDKA 1HY3A 3QX8A 2JGKA 3I05A 5EJMA 2CV1A 5ICEA 2ZRJA 5JHHB 3FAZA 2KLBA 5KTPA 2HD4A 4B7XA 2WUFA 2X42A 4UU0A 2OQVA 4ZAZA 4BATA 1C9EA 1MC5A 4HQ0A 3TDNA 5LIRA 3LT2A 3W8EA 1GG8A 2NU7B 1V7QA 1C29B 3P4UA 4IILA 2PKEA 3T9DA 4N5LA 2IXFA 1JVBA 521PA 2QG4A 2Y93A 1HDRA 3MS4A 1I2ZA 4RLSA 1PQUA 3MF4A 4QBKA 1F6DA 2IHUA 4DNQA 3EYAA 4BMXA 1RTTA 2GVNA 4MWGA 1U6IA 1OT5A 1RPJA 2YXEA 4B3FX 4OHBA 2G4LA 2WIDA 4DLPA 1GQQA 1E6CA 3IBCA 4A0HA 2GRUA 3W34A 4BKUA 3AFGA 3IKMB 5C3MA 1N1GA 2BONA 5CFLA 1SXIA 5EPUA 1Z5PA 3GD7A 1KXZA 4UMEA 3W0LB 1XNRB 4F3YA 3N7UA 4LCEA 4X92A 5KKNB 1E61A 1OI7A 3IDZA 2N0SA 2Q9BA 2NV6A 1C9NA 2Q6TA 3GROA 2JCBA 2O2IA 4NJEB 4FZRA 2O48X 1N9GA 4LQLA 4LS3A 4K6CA 5GOTA 5EHIA 1U81A 2FSGA 2TYSB 4M8LA 5LQDA 4HB3A 1W4LA 3H42B 3ZG6A 3MGGA 1LS6A 4GWGA 3A70A 1H1LA 1NHWA 3LGXA 2I3BA 3GNLA 3L6RA 3PNBA 4I50B 4ZU6X 1NI4A 3QE2A 5ICFA 3MB8A 4A0QA 4AP9A 4C03A 1VKRA 5A06A 4P35A 5DTMA 1QMGA 4GD3Q 4J43A 3QBDA 3HK2A 5ILOA 3PUHA 1PNRA 1SD2A 2JZNA 4KXYA 5BUSA 2L82A 4ISCA 5KB3A 2ZQ5A 1EP3B 3HDGA 3KELA 4K6GA 4UU7A 1FLNA 2Y9MB 2MCFA 4A8HA 5LOVA 1HKHA 1QDLB 3D3QA 4N7JA 1UBFA 4U6QA 1N2CB 3R40A 3PFKA 3KQLA 3VVMA 1I7QB 3NIWA 2HK7A 1RXVA 2JEYA 3FN4A 1N6OA 1TT5A 1ZIPA 2Z3VA 3M6LA 4DPLA 4XRRA 4JGBA 3ADOA 3JQQA 4GMFA 1N3BA 3PPXA 3NATA 2GF0A 3FNRA 5AW2A 5FUYA 4XE5A 4DMGA 1BMFA 3C7TA 3U4HA 1RWBA 2ZRGA 3BBLA 3AJRA 1OVMA 1XTUA 1EHYA 3D64A 5EP3A 3SWWA 4R1TA 5HUJA 3OFSA 1I4EB 4JKOA 2A9KA 4GGPA 3ZCRA 2ZS9A 2BFOA 1Z4PX 2PMCA 1B0UA 2BZ0A 3CURA 2E5WA 3THYB 4RZQA 2EARA 4TMYA 1IEVA 1OASA 3KPUA 4AJHA 4HZIA 3BIJA 3C14C 4TV8F 3R9WA 2QVBA 2O2JA 1D5CA 1O3YA 1XZHA 3HGQA 3I2IA 4AMVA 4G1CA 1ZNWA 4AWXA 2DUMA 5DLQC 5I01A 4XYBA 1WUIS 3RFXA 2GUGA 1SIBE 1VYTA 3S3TA 2QP3A 4HH0A 1Y89A 4I66A 4UTVA 4FHDA 1ZMRA 4JX9A 1WMEA 3ENZA 1PGOA 3LFUA 4MXDA 1JEOA 2VSNA 3HVIA 1WCIA 4R5MA 2QXUA 4BLRA 4TV8A 3DKKA 2F3TA 4QXOA 3RH0A 1TCBA 2HLNA 2VDWB 1GTSA 3HWRA 1GZUA 1W19A 2AFVA 2VTVA 4EG3A 1N3YA 1HLPA 5ALDA 5G0UA 4O3MA 2ZBDA 3G17A 3ODPA 4Z4HA 1H6CA 4DMKA 2CHFA 2OESA 5FFFA 3VR3D 1TQ2A 3DCJA 3LVRE 1RWMA 2J3HA 5KTKA 4UNSA 3H9EO 4JQOA 3W1EA 2ON6A 4BX3A 3A31A 3NNSA 1FFBA 2JZOA 4OXQA 2ZIFA 3OMWA 3TNDA 2AB0A 5KX5F 3ISVA 1QFZA 3T3EA 1V71A 2EW2A 2VQSA 3FPCA 5EKTA 3UMGA 1JKMA 5LNK1 3B9RA 2QNRA 2P0EA 4JNKA 4DMCA 2O8FB 3QBJA 3SXJA 4BRZA 1GNSA 1G5TA 3FGZA 2DPMA 1D6SA 2NV0A 1FS6A 1SAYA 4NE2A 5KQPA 4TM8A 5BPHA 1FYFA 5LLSA 4EHIA 3NP9A 1N2EA 1VYVA 1ZI8A 3PDUA 3PUWA 2DTXA 4IPTA 1LBIA 4NS1A 4Z9AA 3X1YA 4OGKA 1F6WA 5FH9A 1LA2A 2UVDA 2V97A 2JVKA 4NYMQ 1YE5A 3NEJA 3JQFC 5KX5A 5I7UA 3K53A 4M38A 1QRSA 3JQDA 2ZJ7A 3EGWA 2Q21A 3QIAA 2DU8A 2ZFUA 3S70A 2F3PA 2Y77A 1AGNA 3MMXA 1ZSVA 4JASB 1C9MA 2DFDA 2O3TA 3V7FA 5JYDA 4LE2A 4TRMA 3FZNA 1IMJA 1MVOA 2ZYDA 3GLVA 2N1MA 5JPDA 2P75A 4ZA2A 3AOEC 1UXKA 2FH5B 1NX6A 4WY2A 3Q3GE 3Q2KA 3TQFA 1ONNA 5GJCA 1P0MA 2UUPA 2WVAA 5B7PA 1G8HA 5CUQA 1U2SA 1G6KA 3M83A 5AKZA 3MG9A 3R41A 2WJYA 4YMUA 1MABA 1NR7A 2ID8A 1P1KA 4GR4A 4RHFA 4X65B 2D5IA 3WO0A 1BRMA 4CNBA 1N25A 3E8SA 3L6BA 3QXJA 3R6WA 1I13A 5BWOA 2CSXA 1MX9A 3S5UA 1SGWA 2WLSA 3OCCA 2LUOA 2QTAA 3N86A 3WTCA 1TQ4A 3F9CA 5JNTA 1C7ZA 3AIOA 3WL5A 3CBGA 1J0CA 2E4ZA 2JIPA 3P5SA 4PYKA 3PWSA 4J0FA 4BKOA 2YQZA 3BXGA 1Q15A 1XHEA 1TTPB 1G9TA 2YWBA 3K35A 4J0HA 4OHVA 3WGQA 2C2YA 2ZBRA 5IZCA 5KNBH 2YJGA 1L7AA 4KLCA 2CYBA 3BWVA 1TE2A 1RXIA 5FORA 1F0NA 4L5YA 3ZWKA 5CXQA 2X0IA 3GAAA 4MV1A 1I9GA 3VR4H 1KI4A 1HRDA 2CLKB 4F8JA 1H9BA 4KI0A 1W48A 3B2NA 1C2TA 1D04A 2XOXA 2H18A 4JA0A 2QTFA 4AJJA 3NM5A 4OVKA 4OHYA 2QSYA 3U3RA 3VNVA 3PC7A 3FDXA 3AV0B 2WVJA 3EPPA 2HL6A 4ND8A 3CG4A 2QD1A 4HC4A 1KH2A 1JEQB 2E55A 3Q2IA 4WZAB 5CJPA 4F60A 3BRQA 2KS6A 2IYFA 3WDSA 1PIWA 1MH1A 4C7XA 3B1ZA 1TAUA 4KDCA 1SU7A 4Q93A 3KZCA 4Y2JA 3BRWD 1NQTA 1V6SA 5DB4A 721PA 4MVJF 4PRLA 3GEDA 1SQSA 1HK7A 3QOXA 1KYXA 1RLMA 2ZSFA 4FLFA 1U1CA 1XHLA 5DM1A 1J0AA 1QHFA 4MUGA 1P8AA 4EW1A 1CNEA 4KQIA 2MIIA 2OXRA 1A1SA 3ZZ1A 4OHUA 2X5KO 2WWWA 4JJ4A 3E9ZA 3BA6A 2ZUUA 5H70A 1BVHA 2JLCA 1L5QA 3GEHA 1ZK3A 3NTOA 5T7BA 3UV6A 2BTQB 3O8CA 4MVJA 3E2MA 2PR2A 3QSGA 3S44A 4E12A 4IYJA 1FP2A 1R0ZA 2OBYA 2WUVA 3FGNA 3NIFB 4M60A 3ESCA 3RTDA 1IBRA 5CNKA 1Z82A 3IQZA 4RMIA 2KE5A 1PFWA 3GHHA 1TB4A 1TPYA 1NN5A 2J3JA 3NC4A 3KKQA 4BC0A 2IH4A 1TJNA 1V2GA 4UZFA 1ZNZA 5CPBA 3LWDA 3JQ9A 4OQZA 1LDNA 1JHPA 1F2DA 1E1KA 1H42A 2IYVA 3GC6A 3GXBA 1DKQA 4Y6SA 2GK7A 3SFVA 1PEDA 4D1YA 2RGBA 3K2EA 2PV7A 1ZGCA 1YHYA 1D1PA 3CKLA 1HM5A 4D74A 5IKEA 3E0QA 4PGHA 4CM1A 3H86A 2RHRA 3K1TA 5EQFA 4FVTA 2W2VA 4XSHA 1F9AA 2BFPA 4YCBA 1A9XA 2ZS7A 5HF6A 5BYJA 2OLKA 4Q3DA 2GJSA 4MULA 4YQZA 1UMCA 4COOA 2DFTA 4IHQA 3C1UA 3S1SA 3LBIA 1Z63A 2MMCA 4QTXA 1KFEB 4XCVA 1I4TD 2OAEA 3DCIA 4RK4A 3R8FA 3BG5A 4YJ3F 4ETIA 4DB2A 1NOKA 1WUYA 2ZATA 3ZU4A 2AG1A 2L17A 2B4RO 1L4UA 1ORVA 3A9UA 3BJEA 5KNCD 1J23A 3AILA 4HF7A 4HNTA 3JD2A 4O02B 1NLZA 1EGQA 1NXXA 3WGUA 1FDRA 1VKNA 3CE9A 5KDDA 1EB8A 3RTCA 3CVJA 1AZWA 1VRCA 3MJSA 4XZ3A 5L8VA 3E2IA 1N4AA 1ILEA 2WYHA 4EO9A 4LF7B 3DBRB 4YJ3A 3F9RA 1XGKA 3D1LA 4UDNA 2O5RA 3DE3X 3H8VA 4E5KA 3HLTA 2C78A 4TM7A 3SC2B 4HKTA 4MPTA 4DZZA 5CBPB 4MHTA 1FUUA 5HSGA 3BMQB 4JT2A 5K1ZA 3W77A 3ZCVA 3R3ZA 1EFKA 3FD8A 1QF7A 1S2DA 2FWNA 2VCEA 4M9XA 3QEAZ 3M2PA 4GI3A 3DMTC 2F59A 2PBZA 4C01A 2BIFA 3NETA 3I0MA 2ACKA 3AY3A 5E1MA 5HP4A 1V1RA 3A1TA 2DUUA 2GN4A 4JYPA 4WNIA 4YACA 4MR7A 2WDPA 2D0DA 3VBCA 2EQAA 3FFBA 4ASUA 1R4NA 1T3HA 2AXQA 2JAWA 1M6NA 2A67A 1IY2A 2CYAA 2WHRA 2XNCA 4NENB 1QE3A 4R8SA 5DLEA 1Z4QA 1GGNA 4KVFA 3CU5A 4Q4HB 2AMLA 4Z54A 4MEBA 3EGVA 4P98A 2BCGY 3W2TA 2ZQYA 3Q98A 3G5UA 4A5OA 2IFTA 1YZTA 2CLMB 3DEJA 1DC6A 1MQ8B 3CX4A 3TD2A 1JJFA 4BVHA 4EX7A 4RTOA 1NMEA 3B78A 5F3WB 1GL9B 2NTYC 4J4HA 4AQDA 5I9SA 4KQCA 1PX2A 4HSEA 4YJHA 1L7XA 1RQ2A 1PL0A 1EFHA 3WNZA 2EC5A 4KQJA 2R11A 5EUMA 2IXTA 5TS3A 1PFGA 1A9TA 3L4EA 5IRCD 4F06A 2YVQA 3L46A 2Z43A 4X6LA 3H2BA 3QE3A 3TTTA 1I3OA 2B6NA 5EVJA 1EBBA 2H2WA 4KFRA 4QDTA 3V2HA 3ZZTA 2ATXA 1NW5A 2W71A 3OM8A 1CP3A 3OZBA 4QEKA 1JBQA 3I6MA 4PO3X 1NP3A 1QZTA 1DC4A 3IQXA 2O54A 1ATZA 3E7PA 3ROKA 5IX8A 3EPLA 3AKEA 3EDRA 4P0QB 3U7QA 4K9KA 1S4MA 3RYFA 1SC3A 2YWFA 2IHJA 2Z3ZA 3CR3C 5FUQA 3I61A 3I12A 1CS4C 4UOZA 4F04A 3EAQA 4ER7A 3FUVA 2PXAA 4YMVA 1X1DA 2I99A 3HFRA 4IIHA 4PWZA 2XZPA 1K3TA 4U0KA 3TOCA 5TVKA 1NBME 1XWFA 4TXJA 4D5GA 2IITA 1R10A 1VJCA 5FOUA 3LWBA 4CEIB 4O4LA 4GYJA 1DXOA 2PX3A 4E5PA 4LZAA 4Q1VA 1SPXA 1YI0A 3DAHA 4ZVMA 1WXIA 3LI2A 4GLJA 4NCAA 4I46A 3CY6A 2LVBA 3EVBA 1BHSA 5IT5A 3G5AA 5KYXB 3Q8KA 1E89A 2FMIA 2I62A 2OQ2A 2CD9A 3BFVA 4WCVA 2ZJ8A 3WV4A 1CZNA 2QDXA 1V1MB 1OHHA 3AMVA 2OLEA 3E22B 2D4HA 1EFPA 4IS3A 3DD5A 4W4TA 5AXAA 2ZPAA 3V4SA 1F8FA 3F3MA 4RPIA 4AUNA 3NASA 4L9WA 1X7HA 2VDUE 3AF0A 4N0PA 5CTJA 1JIIA 3P9KA 4EF5A 4UTPA 4XM1A 4HUQA 4EBBA 1Z56C 4MMYB 1H93A 2IV3A 3AETB 1USUA 1SQ6A 2J9FA 4NTZA 4C3VA 5CLJA 3ROFA 5I5EA 1R8SA 2JLAA 4G5HA 4ZVQA 3CNEA 3E6AA 1U8ZA 3G1TA 3MRSA 4GXNA 5LYJB 4CQMB 3CXRA 4M9UA 3DVQX 4D92A 2KPOA 1BRTA 3RRXA 2PTHA 3SMQA 3D0OA 2GO7A 3FDZB 1C7EA 1UJ2A 1BIFA 1DKNA 4UEOA 4AJKA 4OHXA 3HVJA 3PFCA 2D13A 1Q22A 3OQVA 5FB3A 4ETWA 1FFSA 2CXTA 3LY9A 3WMGA 1PK8A 2NWQA 3P96A 2PMWB 1BWSA 1RE0A 5E7IA 1ZFNA 4FJ2A 1CTQA 2EP7A 3AB3A 4L1KA 2JJQA 3OOSA 4KN8A 2P4QA 2MDTA 2K87A 2BZGA 4X54A 4C7JA 5K8TA 2IVZA 3RFCA 1B15A 4B4KA 3UENA 4TLEA 2WTNA 4R5HA 4ZP1A 3WWOA 2KLHA 3Q7PA 1HFKA 2HMYB 3KKZA 3OZSA 4MHSA 4L9RA 4QXRA 3T3IA 3WLOA 1MBZA 1V1JA 4TT3A 5E7JA 2QRGA 3A9SA 4EA6A 4KW7A 1Q0LA 1XFAA 1JEDA 1NOIA 1RSZA 1DMRA 4LXGA 4WXMA 5CIWA 3ZR4B 1GG9A 2JCYA 1BXGB 3I0ZA 3EEIA 1X39A 1E2BA 2DCMA 2WSBA 4KQKA 1S8FA 4OV6B 1E9VA 1L9KA 3IAUA 4IOKA 4BQQA 3R7WA 4PM4A 4R98A 1XCOA 2XXJA 1BHO1 1FTGA 4Y2YA 2JH3A 3NHSA 3M3HA 4CG2A 4YGXB 2ZANA 2IYOA 5LC1A 3ZH9B 1HDOA 5BUZA 3CR8A 3AUYA 2WSIA 2GSDA 2OFXA 2QE7A 2XXBA 1PTJA 2H1RA 1IDOA 1ZL2A 4PC1A 3JZDA 4GM4A 5J2TA 4IIYA 1CUUA 5FJIA 3N87A 3R7LA 1AB6A 1G21A 1XZAA 3HG7A 3OWOA 3ZHOA 3FTFA 4TL7A 2WDZA 3H5IA 1JN0A 1C0LA 3FETA 4QTZA 7MDHA 1W4ZA 3IMKA 5B4TA 4QX6A 3LA6A 3GFBA 2HKIA 4C3UA 3UGTA 1GGFA 1QNFA 1UXOA 3P71T 4HNHA 5GVSA 2W2PA 4DR1B 3DDSA 3JATB 1SBYA 5ELLA 5K8IA 2VTBB 4Z4EA 4LYYA 1GAEO 2JATA 2R47A 3LBNA 4B83A 4Y1EA 1A9PA 4AS3A 2PGOA 5LN1A 3D02A 2JGNA 3GT7A 4IVQA 4NCIA 4Y6QA 1ETUA 2I3DA 5D7BA 4FYMA 3RUIA 1H2HA 1Y3FE 1FDTA 5IVPA 3CT4A 2YMQA 4YYEA 3G6WA 1XKQA 4LK3A 5JY1A 4HAXA 5C3UA 1W94A 1V9LA 4Y6GB 3RRNA 1N7IA 4IIFA 3Q3EA 3EXIA 5E8RA 1ESNA 1DPGA 2CDAA 4PPQA 4QQKA 2ZUTA 3RC2A 4TSRA 3EIFA 5DIZA 4B32A 2WPNA 1SUBA 3GGGA 3OZ7A 3ESXA 5KJ6A 2E49A 5IAJA 4RY9A 4XSVA 3SJAA 1CY6A 5LKRA 1B76A 2PTGA 1WDWB 4N5DA 2X0JA 4KO8A 1KPHA 4YQFA 4HFJA 4BJHB 3NBAA 1VPDA 5TQ0B 4BQPA 2MTBA 4D79A 5FA8A 1CBUA 1BMQA 2CHUA 4N01A 4BZQA 2PPLA 4C0LA 4CLHA 4UVDA 1J9GA 3E82A 1ZGZA 3D4PA 4URHA 4HXYA 3BF8A 2JJ1D 3MTJA 1QIHA 3R7AA 2CUKA 2A84A 3QVKA 3RSCA 2WSSA 2NMVA 4EQZA 2YHBA 3QV1A 2ZRMA 4B2IA 4DRXB 4R71A 1MOSA 1OAAA 1FMLA 2YJ3A 1YV9A 5B2EA 3OTOB 3BB1A 1HE1C 3DW3X 4TLCA 5CXUA 2C07A 3HGMA 3PJGA 4BWGA 4A2QA 1H0HA 5CH5A 2B34A 4GHWA 4CWAA 4RHCA 2FI1A 3SG0A 4MYUA 4BO4A 4D0RA 4GI2A 3ZXIA 4D4MA 4DQ0A 3MM4A 1XJ0A 3OQ1A 4TS9A 1V37A 3KYIB 2O5EA 1ZIYA 1H3FA 2IOFK 4DYVA 3UMFA 3OIFA 4CQMD 2A9OA 2LBPA 2OG2A 4Q24A 3TSAA 4IYRA 2YV3A 5GTDA 3HB0A 3ZBQA 4N12A 3N8NA 1TYCA 4CMEA 3B1JA 3GXOA 4MARA 4H4CA 5B53A 4XAQA 4JVMA 2PWAA 5FA6A 2J7PA 3GA5A 4MCHA 5IHXA 1QCZA 3H2HA 2H85A 2X4DA 4E09A 4XVCA 1V2HE 2OO3A 3HYRA 3GJXC 2HR1A 4E4YA 2HF7A 4AURA 4BVGA 1NLMA 5TT1A 5F4BA 4YI3A 4D9IA 1EM8A 4P0PB 4LJSA 1V11B 1SBIA 4NNOA 4CM4A 5TXGA 5EINA 3PQDA 5JI2E 3JU3A 1K08A 3IVRA 5EL0A 3RS2A 4FYKA 4FCWA 1ZITA 1YHNA 1ZKMA 3U40A 3JSXA 3H6GA 3UO8B 1EGAA 2QL9A 4BVFA 1NFFA 4EENA 4X6XA 1JG4A 2H4JA 3BQNB 4OD0A 1RCTE 2W6CX 4XTCS 2BPOA 2HHLA 3IQIX 4DLVA 2XT6A 3UJBA 1KI7A 4QPCA 1TUEA 3AR5A 2ZWAA 1JHVA 2ZDGA 3FBGA 5LWQA 2ZBGA 1PS9A 1VRWA 5M2QA 3HCBA 2PR7A 2NSYA 1Z0IA 4I6EA 3VKGA 3HCPA 4JU8A 4A4DA 1DBVO 3N39C 3FG9A 4INZA 4Z4IA 3GZNA 1M6WA 1ZAKA 4P7JA 4TMKA 4D6YA 4FEEA 3IOMA 4DANA 5H4GA 2PA3A 5JQGF 3I64A 4RJKA 3EISA 4A0FA 4IQFA 2CNLA 1UKEA 2QORA 3CYFA 3I5UA 5IJAA 8ADHA 4DR2B 1DUVG 1RXYA 1SHLA 5J40A 2OOKA 1MC8A 3HJFA 3OQOA 3IQHX 1E2DA 4XWAA 5FR1A 1YJXA 1Y3AA 3IELA 3P4YA 5B1IA 3RFTA 4AKEA 4BGVA 1ZOLA 1YBAA 4AJ2A 4BLTA 2VDRB 1DRVA 2X19A 4KE8A 4L3OA 2GPYA 3UJ3X 4HG2A 4L78A 3PGMA 3AF5A 1JIXA 3F0TA 1T2DA 1FFXB 3RUFA 2C4VA 4XVHA 3B6MA 5ALEA 4BMDA 3CX3A 3CSDA 3OJOA 3EQ7A 3V8BA 4OKSA 4R1UA 4OQEA 2IV2X 1HORA 2QSJA 4TLDA 2BHSA 2K2WA 5KUTA 1C3LA 2FPRA 4RKRA 1P31A 4OQ4A 1RC1A 1GTVA 2GF2A 1QYVA 3GBPA 1P3DA 2IE0A 2OCIA 3KTAB 1U9JA 5T4EA 3NV9A 3WL4A 3WLEA 5A62A 3OX1A 4GGOA 5FUBA 5FUXA 3VKFA 3W4KA 1OLSB 1LNZA 2AWNA 4U7JA 2G70A 1LK7A 1TPZA 1BCRA 1A8HA 1UK7A 4OH7A 1EKXA 4JLDA 1A2BA 5TIIA 4ARZB 3ORQA 1M8JA 3MOSA 1PX0A 4K6HA 4LTNA 5AH0A 1K6IA 2D2XA 4MRAA 4Z3KA 4OYRA 2JLUA 3L1KA 3VR1A 3H5WA 3X2EA 4EHBA 1LRLA 3KJXA 4HWTA 3KKPA 4JYCA 5EQTA 4MRMB 2G7ZA 4ENQA 3HV0A 4TQUS 2CUNA 1WAMA 1XEWY 2C96A 4O0LA 1FNMA 3T52A 1GYQA 4DA9A 3EFOA 1RHUA 2HSZA 3I53A 4RWZA 3MGCA 4M4SA 1JP7A 3DAFA 2FW0A 3LYAA 4R8VA 5LP6B 3E9MA 3UFXB 1XT6A 2Y0CA 3O2SB 3G0IA 1EWQA 3RD5A 5CVTA 3H87A 1G2IA 5CDUA 2PL5A 1QKIA 3CTPA 5CIQA 3B5JA 4FZ3A 5EE1A 3EZGA 5E9JA 1EE2A 2IEAA 1R74A 5CXXA 2AEFA 3ESBA 1EHCA 2JHPA 4Y1GA 3EQ9A 2VF4X 4FFOA 2XNDA 4L4ZA 1BJKA 3GPCA 3VPGA 1G8PA 1XTTA 2F9LA 2F48A 4WN9A 2G8NA 4N0DA 2QV0A 3UJPA 5I9LA 3EC1A 1BE1A 2NU8B 1X70A 2Q29A 2C94A 3G59A 3NLLA 5DBIA 3IUEA 5KJCA 2CMGA 3TDKA 1EJBA 1SG9A 2BFAA 1IU9A 2JFOA 4HJXA 5FPSA 4MK4A 2DVMA 4Z4QA 2PX5A 3K20A 2E0IA 1NVVR 2K6GA 1DC7A 3U13A 4C1NA 4ZZ0A 2PT9A 3KVOA 5I9BA 3UXMA 4F0JA 4ZGWA 5H83A 2Z6UA 1YQTA 3E8XA 3Q10A 3UPTA 4KR0A 5CCDA 3L77A 5BV8A 1RYBA 1FLAA 1X86B 3QBTA 4JWKA 1DJLA 4WY5A 4NKRA 5KVVA 4QUHA 3PCRB 4CM9D 3PPVA 3WKAA 3AHEA 5KDOA 2BH2A 1QQAA 2XYHA 4NQZA 4ENUA 1Q2UA 2Q7XA 4QO8A 2K4MA 3AUSA 5ADUS 4HWKA 3GD5A 2XE6A 1ESZA 2CXOA 3N5CA 5EZQA 1JZSA 4OBWA 2G1PA 3T3NA 4GLBA 4BNVA 1PDVA 3D2AA 2B2XA 3DZIA 3LUDA 5TX7A 2IH5A 3EH2A 1I0LA 4U9IS 1YS4A 5P8WA 2JFWA 3TW8B 4YT4A 1TIBA 4JC0A 1H05A 3GLGE 3DZGA 4QSHA 5JADA 1I3MA 1K0FA 2ZSBA 1MIOA 3ANLA 5DSTA 2H48A 3ZXXA 1QKKA 2QRMA 4ZJYA 3ZWNA 2EEZA 3IRVA 1QYIA 4A3SA 4W5RA 1RW4A 3TVTA 1DTWB 4C6SA 5FO0A 2WMOB 2EGUA 3FTEA 3UEOA 2Q2NA 1XEXA 5COBA 3ZHYA 4DSTA 5B7GA 2LD4A 4GPEA 3S7ZA 2AIRA 3KEGA 4MO9A 3L7BA 3WHKA 1G98A 4PZUA 2QROA 1LF5A 3D2LA 3M4NA 1P1RA 4UEQA 4CXMA 1JV2B 3LO8A 4BOYA 4DV4B 4JLBA 3KAQA 2JANA 2EERA 2P67A 3D8BA 3DKVA 5JS1A 3GLKA 4NABA 3L1VA 5ALIA 5KNBA 1JQBA 2DGDA 4RELA 4UOQA 3AW8A 2BM1A 3WBBA 4J7AA 3LVQE 1OMOA 3GRYA 3SFTA 3VPAA 5ES4B 1X7WA 2C2ZA 2QL7A 2O2CA 3OZFA 2BEUA 1SJ9A 4YMTA 1ZQ9A 5I7OA 1CIJA 3AJ8A 3I4FA 2LCQA 4EFNA 1R6UA 4YMHA 4EEZA 1PL8A 1KKLA 4QTYA 4DV5B 4MWSA 4EABA 1BKYA 4A6DA 3TZCA 2XDWA 1I94B 4UXIA 3KLNA 4MWDA 3H5RA 3JAKA 3WZLA 2O2SA 2Z95A 5CLIA 3L6OO 2OY0A 2IX3A 2XMCA 1Y6GA 4LQDA 4CEJB 1R0WA 4I2NA 3OD1A 4AUMA 5HS4A 5JAUA 1C1HA 1WEHA 2AOVA 5CFQA 5GQSA 2IUTA 2LXNA 4BXOB 4H18A 5JJIA 4DJTA 1A7AA 1AIPA 4G9BA 3CLVA 5CH3A 1H23A 2ZUFA 2BGRA 1QQBA 2BSAA 1GGJA 2N42A 3RVOA 2GPJA 5EJ9A 4U3JB 2IY7A 1LU9A 1G2QA 1J24A 2CVFA 1NSFA 2XB4A 3ICCA 1ZJ6A 5AKXA 1YWGO 5BRAA 3QI2A 3RYCB 5H3HA 3F6BX 3PUIA 1Z18A 4Z0HO 1BXRA 2IU0A 3U48A 3WKDA 2QW1A 3SVLA 1MW8X 3P2MA 3LY7A 4BVBA 1UH5A 4RFSA 1V8ZA 3J81k 4LV8B 4ZICA 2PS3A 3BGVA 4MX8A 3JWJA 3G6KA 4MOWA 1MH9A 1DWOA 2C5AA 3HWSA 5BSTA 1FVOA 3I1FA 3GLTA 3AHGA 3NGMA 4EATA 1WY7A 2HA2A 1RPTA 1L5SA 1S3SA 2AI3A 4J1SA 3NG1A 1UZAA 2JZCA 4AL4A 5J3JA 3DBLB 2W7TA 2WWIA 4IJKA 2GXAA 3F2VA 4B3IA 3FCXA 2ZU6A 4MGKR 3OOEA 3LQYA 1PGQA 3CWQA 5IXSA 3IUPA 2P35A 1ZGGA 5EJ8A 1F3LA 2H1WA 4EB6B 1EK2A 2Q5QA 3K0CA 3UT6A 4YRNA 2IEYA 4PLTA 3EXHA 2MR6A 3G1UA 4IIJA 4OMFG 1QHYA 2XT9A 4OHOA 1P7WA 1C8VB 2GFIA 4MDEA 2LRHA 5TLSA 1HT0A 2X6RA 3LMKA 9LDTA 3ETLA 2HJVA 2RCYA 2O8CB 5DCWA 1BXKA 2FMUA 4QUAA 3RK0A 2R5NA 5JCXA 1RHQA 1W76A 1OTXA 4UAUA 4QNMA 1JF8A 1PFKA 1VECA 3MJDA 3UAWA 3WRXC 1G3UA 3NCHA 4QFDA 3FW1A 4B3HA 3CPHA 5T4HA 1CRLA 2WWYA 2VHTA 2WPDA 1ZD5A 4K9DA 1ZRHA 1CXZA 3G85A 1O6BA 3ON5A 5DHRA 4CI0B 3E5RA 1EIWA 1KEEA 3RSSA 4H7JA 4D6PA 1XRRA 1MO2A 2WWXA 2VBIA 2UYCA 1M72A 1VCNA 3HC7A 2K2QB 1IHOA 4U7GA 2A0KA 4OHMA 1KQFA 1Q0TA 3QKTA 4XUEA 3K8QA 1Y81A 2VP6A 2ZM5A 4ZV9A 2WHEA 4YCCA 1RWWA 2YZGA 2ZB7A 2H1IA 2X5JO 4J91A 4UHEA 4ENPA 1CK4A 2H4XA 4PYIA 4WADA 1FQOA 4RXTA 5C7LO 2Y1LA 2FSFA 3HY4A 4DQKA 1E32A 2TECE 1N5OX 1NJ1A 2HZBA 1JPUA 2AMYA 1LWNA 1PU2A 1JIVA 1PKXA 1WNTA 4GECA 3M82A 3U6BA 2YRXA 4O1MA 3T94A 4EOGA 1PV2A 4K6FA 3TZHA 3KQNA 1JH8A 3L7NA 2OLJA 3B6KA 3L41A 5A4AA 4GM0A 4EG7A 1DO8A 2I3ZA 2ZRQA 1AUQA 1N5KA 3R0VA 4IDBA 4NS4A 4OXYA 5DHFA 4XOUA 3TLMA 1NBWB 3C6XA 3K0KA 3RU9A 4EUFA 2R4UA 2XHEA 1Y5IA 2QUJA 3MOGA 3OZDA 5AUQA 1PZMA 1QB8A 1NUTA 1RRPA 2JI4A 3C4QA 2A9QA 3DEZA 1EXWA 1V5GA 1F14A 2DWCA 3B60A 3BE8A 3LRPA 2OMKA 3R5XA 3OIYA 1I14A 1NQVA 1PN3A 4NFLA 4RL4A 1DARA 3BX1A 1GOTA 1R8YA 3JYOA 3KKKA 4QXAA 1ECPA 5D1HA 3OIVA 4Z1MA 3T5BA 3PEYA 2B8JA 3GRVA 3LFTA 2UVQA 2WWHA 2FPKA 5CDFA 4B17A 2ZOSA 5HFAA 4EGFA 3KSZO 4EJ6A 4BB6A 5K0TA 1T1IA 4AKSA 1E1CB 1Q1BA 1NWHA 1UKBA 1Y80A 2EIHA 2UZAA 3KO8A 5DSXA 5EGSA 4J0CA 3G5TA 4D44A 3H9GA 4JODA 3P0IA 4ZT7A 1NL3A 5JCJD 4R8RA 3RYTC 3KAKA 3QTBA 4LTMA 1B43A 1XQ6A 4PC6A 4XRGA 1K75A 2JHGA 2F3QA 1R4MA 2H1HA 3VPXA 3CLHA 4O8ZA 1D5WA 4BNUA 3AP1A 4FFPA 4EX6A 1QOQB 4S0XA 1P9WA 2QRVA 4S12A 5L3SB 3R9IA 1K8ZB 1KHTA 3VH4A 3GELA 4MDYA 4ZIRB 2BBWA 2M1XA 3ZOZA 2GKGA 3JZIA 1AMNA 3DFZA 1KYIA 3FVWA 1FW8A 2AX3A 5LP6C 4DLAA 5B7NA 2Q3MA 3BK1A 1PT9A 1U3WA 1CEXA 2C2MA 1SFRA 3AT1A 4QQRA 1PD1A 4Q4JB 4L95C 5FQNA 5G3ZA 1BW9A 5GMOA 4A26A 1KS2A 2VCHA 3L4SO 5IDXA 2H00A 3OPYA 2F43A 4MKZA 4OHZA 4FX2A 4EJMA 1NVWQ 1N0WA 1U98A 4OK6A 1U9IC 2J3EA 3G8BA 5LCXA 4PCUA 3TXXA 2YV4A 5DNVA 3P0FA 4EL5A 1QZXA 5YASA 2ZR0A 1IWOA 3TAUA 3QSYA 3E53A 1AQIA 2FFAA 3EZ7A 4XPIA 4LFBB 3W5CA 3ROEA 3ETDA 2G1JA 5IT4A 4QBHA 1U7TA 2VJMA 2YW2A 3U0BA 4WECA 1AUPA 3I6IA 3TRJA 2IS4A 2OUIA 4P58A 5A0FA 5KNDD 4D2IA 4LWQA 2HMWA 1W9HA 4HYQA 1ECFA 3ECCA 3EIHA 4UCXA 3CUKA 1I2AA 3K5HA 4GVPA 4DM3A 1CUYA 1JHXA 1N7HA 4BFXA 5G4LA 3OAAA 4EUKA 2VOEA 4ZO4A 1MX5A 3ETHA 5JT1A 4GX0A 1SVWA 5HKAA 5L3QB 1QANA 3EEOA 1OLUA 4DNXA 4YCDA 1L4BA 1XU9A 2QM3A 2VZLA 5A5DA 5IU6A 1KYZA