4R81A

Nad(p)h:quinone oxidoreductase from methanothermobacter marburgensis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
199
Chain Sequence
ASMHVYILFAHPSRKSFSREVLEAFTEGLSEAGHTYEVGDLYRMNFRSELSQEEYLREISQEAGSPLPEDVMEEHERIGRADALAFIYPLWWSDCPAKLKGWFDRVWTYGYAYFGTRIDIEKAVVLCSAGHTEEDLEGTGIAESMRSVMLGDRLLGVGVKNVTMEILGGMVPGDDSCREINLMRARRAGRNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel cytosolic NADH:quinone oxidoreductase from Methanothermobacter marburgensis.
pubmed doi rcsb
source organism Methanothermobacter marburgensis
molecule tags Oxidoreductase
molecule keywords NADH dehydrogenase
total genus 75
structure length 199
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r81A00
1H69A 2Z98A 1RCFA 3KLBA 4NLLA 1AHNA 3KAPA 3NHRA 4QOHA 4J8PA 2N1MA 4YQEA 1CZKA 1OFVA 4XDGA 4FGJA 3S2YA 2WC1A 3LT5A 3NHJA 2FOXA 3NHPA 4ZVNA 2M6SA 4CETA 3W77A 1YCGA 1T0IA 2XODA 5B3LA 1AKRA 2QX6A 3KEGA 4DIKA 3HA2A 1XYYA 1RLJA 1DXOA 3D7NA 3N39C 3NLLA 4C14A 2Z9DA 1AKWA 1FX1A 1QBGA 1YCFA 2FVXA 1WSWA 2QX9A 3UXEA 3OWXA 5LJLA 4QOFA 4NULA 1BVYF 1QR2A 4YALA 3NHYA 3EYWA 3W7AA 3GFQA 2Q62A 2OHIA 1B1CA 4YAWA 1QHEA 4XDHA 4GR9A 3HLYA 4LTDA 4CF6A 1FTGA 2R96A 5B3KA 3ESXA 3TE7A 1CZRA 2KLBA 4U7GA 1CZLA 4HS4A 3B6IA 3ESYA 2F1OA 2FDXA 2X2PA 5TGZA 1D04A 2OHHA 3GAMA 1FUEA 2BN4A 1I1OA 3F6SA 3GFSA 1OBOA 1J9EA 1XI2A 1AZLA 3OJWA 3NHKA 1DX9A 4YAFA 3TZBA 1OBVA 1CZHA 3F90A 1YRHA 1AMOA 1ZWKA 2AMJA 4Y7CA 4D02A 3FJOA 3G5MA 4HEQA 1SQSA 1C7FA 4ZVMA 3ZHOA 1J8QA 1FVXA 4DILA 2HPVA 3B6JA 4U7FA 4ESEA 5LLDA 4ICIA 2QX8A 5A4KA 2MTBA 4FGKA 4QOEA 5NLLA 3OX1A 1ZWLA 1BU5A 3OWHA 3QE2A 1C7EA 1CZUA 2KQUA 5EMNA 3TEMA 2QR2A 3B6MA 4FX2A 4LAFA 1X77A 3NFRA 2V9CA 4ZVKA 4DY4A 3O2NA 3OVMA 2V5VA 5F4BA 4LA4A 3FNIA 3JSXA 1RLIA 3NHFA 3FW1A 4N9QA 1FLAA 2ARKA 5FUQA 1YCHA 1TLLA 3HR4A 2RG1A 1SG0A 1WSBA 3ES9A 1YDGA 5LBTA 4QOGA 2HNAA 4GQIA 5EAIA 3U7IA 2QWXA 3EDOA 3NHLA 5LBUA 1YKGA 2MWMA 4QOIA 3LCMA 3R6WA 1TIKA 3K20A 4PTZA 2Z9CA 3N3BC 3NHUA 2Z9BA 2BMVA 3OX2A 2MOKA 2XOEA 1J9GA 1GG5A 3P0RA 4QOJA 5F51A 3B6KA 3W78A 4BMPB 2V5UA 4YAOA 1J9ZA 3F2VA 3UXHA 1CZOA 3L9WA 3NHSA 1AKUA 1KBQA 3W79A 1AKTA 2A5LA 5FX2A 6NULA 2Q9UA 4PTYA 1XYVA 2FAXA 3F6RA 4PU0A 1D4AA 2HNBA 1D03A 5EA2A 1AKVA 3QFCA 3OX3A 4N82A 1F4PA 3ESZA 1T5BA 2QX4A 3NHWA 1CZNA 1FLVA 4M0CA 3N3AC 4S24A 4U7HA 4Y9RA 4BMOB 3KAQA 4C0XA 2FCRA 1E5DA 4N65A 3O73A 3SVLA 3U7RA 5LJIA 1NNI1 1V4BA 4YAUA 5LVAA 5LMCA 1FLNA 1ZX1A 3RPEA 1JA1A 2M6RA 2BF4A 2BZSA 2FZVA 3QFRA 4QODA 5FA6A 4FGLA 1JA0A 4F8YA 2QMYA 4ZVLA 4H2DA 3OJXA 4Y9UA 5F12A 5BUCA 1FLDA 2FX2A 2OHJA 2R97A 3FVWA 1DXQA 4H6PA 1QRDA 1VMEA 1AG9A 1H66A 1XT6A 2BPOA 2X2OA 5NULA 4C0WA 4GI5A 1YOBA 2OYSA 2D5IA 2MT9A 2GSWA 3FX2A 3L9XA 2FLVA 2QMZA 2W5UA 5ULLA 2FZ5A 4R81A 4OXXA 2ZKIA 4C76A 2B3DA 3GFRA 4LTNA 1RTTA 1KBOA 1AKQA 5JROA 3K1YA 4LTMA
chains in the Genus database with same CATH superfamily
2I4RA 2JG3A 1NKVA 4S35A 3AR8A 5EI5A 5KYWB 1XZ8A 3C2QA 5T4BA 1Y6ZA 2MSLA 1OX6A 3EQ8A 4NFYA 1PG5A 5BNTA 4WLNA 3KD3A 1SAYA 3BD8A 1U7ZA 2P77A 4OHOA 4L78A 4DBZA 3ZK7A 1PLLA 1WMFA 2VK4A 5IABA 3C6KA 4PCUA 3SYRA 4GPTA 5CYPA 2X76A 4WKPA 1GL9B 5AW9A 1TDJA 4FYJA 1WSWA 1NTOA 4MRPA 2NZXA 1IBLB 1XZEA 1FRFS 2UZIR 5BQOA 3EEYA 2J0UA 3MT7A 4O4HA 1QUEA 5IVHA 3O75A 2D8MA 5IBCA 2CXOA 3HCEA 4TSFD 3AL2A 1U7PA 4Y6SA 6AT1A 1R2QA 3CJRA 1J09A 3S4YA 3IPXA 1M5RA 2WJZB 4ZI7F 4AX4A 1TK3A 3CPJB 5FUBA 3X1XA 5I7RA 2Q45A 3BJIC 4HAWA 4A3SA 3NWBA 1CQPA 4O4IF 4PHFA 5AVKA 3VBEA 4C0AC 3HVHA 3T5BA 2R62A 4FKBA 1NP7A 3FOZA 4LCEA 4O1IA 4Q19A 2MCFA 1GZ4A 2P1ZA 4YXFA 3QHPA 4Y0AA 4UOZA 2GKOA 2G7ZA 4LGVA 4ZVMA 2Y0BA 2I7TA 2PEYA 1FXSA 2VJAA 3L7IA 3SX2A 5H68A 1ADCA 2AB0A 3WNZA 5K0GA 4CIBA 1DO0A 5DRTA 4O1HA 3LYHA 4CF4A 4MYTA 1UZNA 4IJMA 2O8BB 2D2EA 4WACA 5JS2A 2KQUA 1FVHA 1VB5A 3KSZO 3BMNA 3REOA 4JR0A 5DRYA 5DCUA 2PHZA 3R44A 4BGIA 4KFCA 3OHPA 1TW3A 1K6XA 2JCBA 2ZUBA 5BWBA 1SOVA 3GJ4A 5JRDS 4BGDA 4ROSA 1DRVA 2CSUA 2RARA 3UHFA 1CDDA 2V7EA 3H8WA 1FNMA 1IBMB 3OKCA 3TRHA 2R5FA 1G20A 2OY0A 3E0XA 4Z0TA 4LPSA 2VCHA 1A5AB 1PR3A 2Z8XA 3O7WA 4V0NA 4RKFA 3HP1A 3RFXA 3TNYA 2D5AA 3I1FA 3F7TA 3FR8A 4ND8B 1A7JA 1PNQA 3NKVA 4GAEA 1V35A 4J29A 1C9YA 1Q0SA 3I53A 2VTBA 4JQOA 1E2HA 2JFWA 4MH0R 2QAIA 3GJ5A 1C0LA 1NUHA 1LLDA 2ETXA 2JJ8A 2QRQA 4RVCA 3S70A 4B6SA 1KEVA 1XAGA 2AJTA 1NY6A 1TZBA 5B1SA 3IUEA 1KRXA 3HJAA 5DBGA 4J0EA 2D59A 1FP6A 1NLMA 3EHEA 2EJVA 4S3MA 1B0AA 3SS7X 3T5PA 4Z9FA 3BRCA 4I5GA 1RQXA 3C5WP 4TLLB 2IWRA 1GQFA 2Q1WA 1EI9A 3GJ8A 1TQ2A 3L49A 1NNI1 1KQNA 4F2HA 4HNQA 1FYDA 4HWKA 3G23A 4OLHA 1ENYA 3KHTA 2ECQA 1JA0A 5A4AA 5DEIA 1Z5PA 3FR7A 3D54D 4R8SA 4KYIB 3RJ9A 4OEHA 2P6NA 3AB3A 2XWSA 2HUNA 3HEBA 5H3HA 4J16C 3S40A 4MO2A 1JT2A 2W6ID 4BNWA 4HDOB 3CG0A 3HGMA 1XVUA 3D7KA 3GGJA 4PE5B 3VM6A 4ECAA 4ENPA 1JWLA 2IZ5A 2DYKA 2EJTA 2YQ5A 3H16A 1EHCA 2B3DA 3E18A 4CHGA 2EARA 3OFNA 5BSMA 3K1YA 1Z15A 1OLOA 3SU8A 5K6AA 3O2JA 2FMTA 2J5KA 2ZUDA 2NLOA 2FKAA 5B6PA 1HNXB 3RC8A 3IL2A 1EUZA 4MQ4A 3GHHA 1KP2A 1ZS9A 1B6GA 4UBKA 4I7EA 1SXPA 3BWVA 1QPBA 3DSRA 4JBNA 5DN6D 3RBAA 4F4HA 3A6DA 3P5BA 1T3HA 2QX6A 4CKZA 3CVWA 1I0ZA 1Z8HA 4D8VA 4PC1A 4XM1A 1E79D 3HBMA 1KXJA 4NBWA 3FKSA 4C0BA 2G4LA 3O74A 1SHUX 3AF1A 4GH5A 2OKGA 4NULA 1J21A 4BLWA 4UPVA 4UHBA 1UC9A 2VYFA 3UK7A 1O5OA 1L1QA 2RHCA 3DMDA 4LF8B 1YHZA 1BS9A 1R64A 2V9ZA 1DQYA 4HVTA 3KYCB 1BH6A 3M4NA 5JW6A 1WMSA 2YICA 4UUBA 2H52A 3LA6A 3CRNA 4GSLA 4P1ZA 3ACBA 4S0XA 2IXGA 1M3SA 4ZT6A 2P5YA 1Y5MA 2ZWVA 5BNIA 4OHCA 4KN6A 4OP1A 3C48A 3NT4A 3KVVA 4DHEA 2HSZA 1ZQ9A 4C5CA 5JRZA 5LQJA 4UVGA 4FIDA 5DHAA 2C7QA 3PC7A 3Q3GE 3QV2A 4M1SA 2HMWA 2P4HX 5ECDA 3RTDA 4E31A 3R7FA 2ABWA 1Z3CA 5D2CA 3RJZA 1EMDA 3BXXA 2MYPA 2LIPA 3TD6A 1K7FB 1ZSYA 5JDCA 4DLAA 4CMBA 5K0BA 1XA3A 2C03A 4WADA 1EWYA 2XNDA 3IB3A 3LFUA 5CB0A 2E4XA 3IKVA 4KU4A 3WK7A 1EFVB 2BGUA 3ZYZA 3MK31 3NEPX 4URVR 2RE8A 1HM5A 1XK7A 2R87A 4XWTA 3VRHA 2PV0A 3G82C 8ABPA 3DBRB 1A5BB 1B6RA 1DBVO 5E9QA 4E94A 2FHSA 3C98A 1WPGA 3PUZA 3FYHA 3TSWA 3LVBA 3WQSB 2Q5JA 5EAIA 4F1JA 1SEVA 3LPLA 3HI6A 3GJQA 1P2DA 3EDCA 3GDWA 3OT1B 4PAWA 5IF9A 2O7NA 2QUBA 4UOQA 1K6JA 1X7XA 3I83A 4GXQA 1WXDA 3MCTA 1Z38A 1KQOA 4NARA 5ALUA 4EQ6A 2AK2A 4FYVA 2FJ0A 4JLAA 3JD4A 3WLAA 1HFEL 1KWGA 2DCUA 3JQ6A 3PGXA 1N9GB 1Y4SA 4OQQA 3RVOA 2V74B 1OAAA 1KEPA 2FWMX 2VG8A 5ALFA 1ZONA 2NUAA 1JW9B 4P0TA 4F9EA 5KNCA 3K9FC 2G80A 5JEDA 1NJ5A 1M33A 1GV1A 3JQFA 1PFUA 3GROA 2GAJA 3KZNA 1HLPA 1ZMXA 3AI7A 3O4JA 4IQ0A 3PUWA 4MV9A 3MJEA 4ZAYA 1QC5A 3LLMA 3GLTA 2PLWA 3OOYA 5ETJA 1ZQ1A 2XWBF 4AY5A 3HWX1 5IKOA 5J5CA 1X2BA 4B33A 2AV6A 4BPBA 2Q2WA 2IHYA 3G1WA 4JLWA 3F4BA 3WB2A 2XMDA 2OFFA 1K75A 1NVVQ 5DYWA 1IB6A 1SD1A 1HDIA 2DY1A 4BBPA 4WECA 4NCNA 4QQRA 4OI4A 3UF0A 5MGBA 4WNAB 4LW8A 3NOOA 3TCKA 1WL8A 3T9AA 3K2BA 1LPBB 4OJQA 5IJ9A 4MWTA 1Y3HA 2TMYA 3QZUA 1ZMRA 2C8JA 2HSGA 1N2GA 3IERA 3EPHA 5CA0B 3RS2A 1IVSA 2XAAA 2C2BA 4ZAZA 5AM1A 5F9HA 3DMRA 4JS0A 2D74A 4M1KA 1F8GA 2UZ1B 2AC7A 2NP7A 1CUFA 3I6QA 3W05A 3OIWA 3LGXA 3R5HA 1DX6A 5AFSA 3GEBA 2CHQA 3ET5A 1VZ2A 4OJKA 4MIKA 3V7UA 1KPGA 4KR9A 2C77A 3U4GA 3CE6A 5FV4A 2CKDA 3QEMB 4L9AA 4NEQA 3T4UA 2H51A 4DIBA 3VVMA 1J5PA 3CUSA 1Q0PA 1WSDA 5B4VA 1OHHD 3HB9A 3AV0B 5K0NA 1CU1A 4QJIA 4DV6B 1WXFA 4K1XA 3WRWA 5BVGB 2IY9A 1T9GR 1NI4A 4NZNA 2JH9A 3EMVA 4QPJC 4WERA 3GNTA 3M3DA 1ZJ5A 2AWOA 4DRXA 2G1JA 1IVYA 3IFSA 2PQMA 5CHYA 5EWJB 1E59A 4CCSA 1XPJA 3E8SA 3QLVC 1I5OA 1WJGA 4J07A 4J1SA 2ZJ8A 1PJ8A 4YTEA 5CFQA 3EUEA 2X0KA 3L8YA 4AN0A 4B3RB 4CMAA 1SKMA 1PL7A 3WFZA 2WMNB 3AOGA 3AHGA 5KINB 4FCVA 1FQJA 5HZKA 4HAXA 3CNOA 1SBTA 4LWQA 3ZDXB 4M1QA 5EZYB 1LK0A 5KNCD 1G8MA 1X94A 1B6TA 4BC1A 4I5FA 1GYQA 3RUPA 5K99A 4JU9A 4BLUA 1DIGA 2V7UA 2G9NA 1HKUA 4OATA 2COUA 1TJ3A 2CSXA 1J2EA 3Q0TA 3FRHA 1SOAA 2PWYA 5IJ0B 3R9WA 3C3BA 3DKVA 3ORRA 1R8XA 4GQIA 4JB8A 4W1SA 5DTQA 1U7DA 2HO4A 1CF4A 3EDQA 2R4QA 4EA9A 3ZKWA 2QQ5A 3R6WA 2Z8ZA 4N49A 4NS4A 4QXPA 1YV9A 1ORTA 3CUUA 3OI7A 4P3PA 4X1IB 3FJ1A 2IKSA 1QONA 2PNJA 2G9QA 4Y30A 4DL9A 4G8JA 2ZPTX 4ZRNA 1WMDA 1M1XB 1O96B 2BT4A 3F5MA 3MD9A 4K28A 1FPQA 2Z1NA 3U4CA 3GH1A 1LC0A 3I1IA 3VOSA 4NXNB 3CO0S 3IR7A 1S2NA 3DAPA 4HH0A 4RY2A 5ALLA 4PLTA 3QVTA 4PQFA 1CHNA 3AT1A 3OQIB 1ZI6A 3HNOA 4QYIA 3V8NA 3IQHX 4Y2RA 3HVJA 4HB4A 2E2WA 1P39A 3GVHA 2FSHA 4XM2A 3DAGA 4JUBA 1RZRD 1AF4A 1M6HA 2W22A 4N65A 3WNCA 1PGPA 4DCOA 4I4LA 1IN6A 1XLTC 1UMCB 3HZRA 5IKMA 3AXSA 4FBGA 4JJZA 1R6XA 1UM8A 2ZCVA 1CIJA 2AG6A 3S5JA 4RD0A 2CNOA 2R9VA 2ZVQX 4IG4A 4CT0A 1TYAE 3DYBA 4E5PA 1L3BA 2PUVA 4CMJA 2DH5A 3DNPA 2H8KA 3H2ZA 2CHEA 3LC0A 2AR7A 2CNKA 4E2XA 1W59A 1XZPA 3R4VA 1NRIA 1FPMA 4WOBA 5DI3B 3SXJA 1MC5A 2ZREA 5FNZA 3T7AA 5JDIA 3S27A 1A7AA 2XMQA 4EB6B 3NOQA 1KL7A 1MB4A 2QOEA 2VHZA 2FWPA 5CVDA 1FFWA 3O8BA 1YOVB 2X86A 4LHSA 1CDOA 2QTNA 3AJDA 1C81A 3DLIA 4NFHA 1SCIA 4OOFA 4EUFA 3I04A 3HDYA 3REGA 4H0CA 3Q7QA 1C41A 2ZG6A 2XYPA 1S8FA 3X1JA 4EMUA 1YWGO 2PFGA 1GGEA 3F8SA 4PO8A 1UMBA 4YQYA 1DKPA 2B34A 2PGLA 3FDJA 3AEQB 3L7LA 5FBHA 4B3DA 1T0IA 4YK7A 1W0KD 3I92A 4BO1A 5FADA 1KIMA 3LBIA 3RWBA 2Z9DA 3G0HA 3E8XA 3U26A 5MFZA 2WF9A 1H0HA 4HZUB 2IU4A 3VDNB 2FP3A 1G291 1IAVA 121PA 1L7BA 1KZ4A 4RQUA 2HN9A 3TO5A 5JMWA 3W5BA 4UNPA 2Z2IA 1RT9A 2NYUA 5A4IS 2G0AA 3IP7A 5L6MB 4R51A 2EJWA 5LKAA 621PA 1OAOC 1QV9A 2DQSA 4PYKA 5EHQA 5A3QA 5AKXA 1LPMA 1VLHA 2C5SA 1ZSNA 3IVAA 3KKEA 4IQFA 4JEUA 1RKXA 2JFOA 4NYMQ 2VF2A 1BH2A 3K1AA 4GPEA 4GZ6A 2W6JA 4LOJA 2QMEA 5D84A 1CW2B 3LWNA 2O3UA 5ITZB 3PC6A 5JMOA 2Z83A 2HA5A 4CI0B 4D9NA 2XT9A 1AS2A 4IWNA 4UTNA 4E14A 1GEGA 4JYPA 1PUJA 1T4CB 3JWJA 5IW8A 4EATA 5I4BA 3B48A 1H3FA 2GCOA 4CG0A 1VOTA 1Q1EA 2AFRA 3PS9A 1A9ZA 1RPAA 1O6BA 3KCQA 4TTRA 4BLVA 1WDTA 5BT8A 2BDEA 2FSGA 2XA1A 1MCZA 3NWJA 1EBUA 3H9QA 1R74A 1TKBA 4PAMA 2QVZX 4N3AA 1RWXA 4LSGA 4YCCA 4MV7A 2QJRA 5AKGA 1Z17A 1SVMA 4PAOA 2BFWA 1AK9A 3RUAA 2O8FA 2VDWB 2Y1FA 2PUHA 2C7PA 3EXEB 2JLWA 4Q4AB 4RTPA 3B82A 1DHRA 1POXA 1WXXA 3L8ZA 4HDRB 3Q7EA 4RHXA 2E5LB 3C0KA 3MG9A 7YASA 5L3VA 4RQAA 1NXTA 1A2QA 2C92A 2HQ1A 2ZTUA 1E2EA 1Q22A 4ZTUB 4Q4AA 2XZOA 2D1SA 3TGWA 1G3QA 6ADHA 4IUYA 2DBVO 2HA4A 4KO2S 5K3FA 2Z6UA 3L4SO 1P80A 2OAGA 3A37A 4HN2A 4LMPA 3ZDZB 2ADOA 3RFUA 3W79A 1TJ4A 1CE8A 3ND9A 3WP0A 3P9NA 1TEHA 1RRCA 1LVUA 3AR5A 1JJBA 3DVLA 3MGBA 1EAMA 2CUTA 3E2PA 2FGKA 2Q4TA 1YF3A 2OLKA 3FVQA 3HACA 3NANA 1G59A 4ZIRB 3NM4A 4NFLA 4OQMA 3EMDA 4YAUA 1N2ZA 2DPHA 1RAHA 3P71T 2GPNA 1MAHA 1Z5OA 1MD9A 4MX8A 4MQUA 5CT9A 4D25A 1RKVA 2TSYB 4B35A 1CIPA 1OH7A 3QE0A 2RAFA 1KI8A 3K73O 4DFDA 1E1LA 1V7PC 1OLXA 4UZSA 1AC5A 2H92A 1XQVA 3D31A 4G5RA 3RH0A 3U3JA 3G1UA 2IVZA 5C80A 1OVGA 4QFCA 3ONEA 1Z62A 3QW4B 4TWRA 1F9AA 2FZ5A 1JR4A 1PFVA 2C5FA 3FXAA 1K5DA 3I5UA 3N8DA 2BMWA 5IJ9B 2GBIA 2OFWA 4GNRA 5ESDA 1QMGA 5C4IA 3NHRA 5AW0A 2FXVA 4UNNA 2IHUA 1VBFA 4P92A 3DBLB 3V8VA 3H13A 1HA3A 2QY6A 3H1TA 2ZS7A 4ARUA 1R3DA 4HL6A 1QNLA 4A0GA 3F9CA 5AOAA 1UZMA 2Q1SA 3ZK8A 1DAFA 3SX0A 1RR6A 2QW1A 4BKRA 2FUG1 4V3CA 2WK1A 3R0VA 1YR1A 2AJLI 1CERA 2FSPA 4WJKB 3WTBA 4QBFA 3WIDA 1UXHA 2VHYA 2O20A 3Q41A 3L0CA 4UULA 2Q07A 4A0FA 3K0SA 2CF5A 1T29A 3Q9LA 2A1UA 4XAQA 5EEHA 3NGLA 5LLSA 4QBKA 1FS6A 1GA4A 3DUFB 3D3WA 4IHJF 1WBDA 4CIWA 5C8YB 2PGDA 1G9SA 2QSYA 1FQWA 2CMHA 4BNTA 3WICA 3PD1A 3GFSA 1XXHB 4NJOA 1V9CA 1GN8A 1ZHOA 4QG7A 2HSWA 3A4MA 3D3WB 3IMKA 2WWFA 1FYVA 2AC4A 3A0RB 1WZUA 1U0JA 2GHRA 3OLXA 3V80A 3W8NA 1KEUA 3F90A 4CTMA 4QKQA 2I91A 1EFUA 3GARA 2G1AA 3CO5A 2HMAA 5K4GA 5E4TA 3H2BA 2QZSA 1H5QA 1NV9A 2NIPA 2WD7B 3LLVA 2NQ2C 1I4WA 1Z0JA 2Q21A 3IURA 3HKEB 3O8QA 3VDXA 5HKBA 1T26A 3QYFA 2Y6VA 2WFLB 2XWPA 1IWOA 3QUAA 4BKOA 5TLSA 3VZDA 1YR6A 4DV4B 1XPUA 1A04A 1D6MA 2LRHA 2YJGA 4N4AA 4RORA 2OZPA 3GU3A 3IV6A 1Y1QA 1NVEA 2IEYA 4OH1A 5EJMA 2AJCA 3A1DA 3LCJA 4WZBA 4UHFA 3ITNA 1RLMA 4DC0A 1BE8A 1SKBA 1DBWA 3TIVA 1TMOA 3QPWA 4EKYA 1O97C 2EKQA 1H1LA 4LXYA 4M8LA 3WSWA 4G85A 4N0PA 3EPKA 3Q85A 4A0RA 3FDZA 2EZUA 2GM5A 1ZRMA 5AQ1A 2AOUA 3R3HA 4Q7EA 5TEVA 3D7RA 2XVYA 3IP3A 1GN9A 3OLYA 4MS3B 4NMXB 5DTRA 1CJKC 5E3JA 2ST1A 2F62A 2EXXA 3D4BA 5COAA 5AKJA 1NW6A 1SUBA 5LOVB 4YACA 5TT1A 4MQFA 1N6KA 6NULA 3BEDA 4BX8A 4RXMA 2VR1A 1RJGA 4NBRA 1MHTA 2JI4A 3UC5A 3ZJVA 3KEQA 3UMJA 3OFSA 4CEIB 5AW1A 2J87A 3NHAA 2QUZA 2WHRA 2OXTA 1DC7A 3WSVA 4OA5A 4HG2A 3QGMA 1Y7HA 3GEDA 2CXTA 2XCTB 2QD1A 5AICA 2IXAA 1ACLA 2FUEA 3NGMA 3Q10A 1NR1A 2VIIA 4LVOA 4I1VA 2ID7A 3UHAA 2ZVPX 2O8CA 1EU1A 1YVUA 2QF7A 4L8YA 4F04A 5B2EA 4CBVA 1YNSA 2VHEA 2Q5FA 1Z6QA 4BNXA 2QE7D 2WB4A 4QRDA 4HEA6 3JQ7B 4N6GA 4PBTA 4K46A 1XZGA 5IT0A 3WB1A 5JCXA 1ZBDA 2PX3A 2O8CB 1KYZA 4HYQA 4CL0A 4H3VA 1NN0A 5LZ2A 3HJNA 2CV1A 2EEPA 3MOSA 4B4DA 4Y2YA 2BMFA 4OKNA 3EC1A 3PBKA 4PFQA 2W0MA 4UNRA 2C78A 5GY7A 2O59A 2RBGA 4B48A 4AQ7A 1SKYB 2V7TA 2YQZA 1AN9A 1IXSB 3P9KA 3ZJ4A 3WKCA 1BWQA 1V8PA 5FLKA 4PIPA 4Q1EA 2VLBA 3O84A 4B2LA 4Y0NA 1Y8RA 4OV6B 3KETA 1R4ZA 1A3CA 1E2FA 4R41A 2M6LA 4WUVA 2CYAA 3MWEA 1ZUD1 4MUKA 2BAGA 4G86A 4J90A 4UXHA 2FEMA 1JAHA 3IEXA 3N39C 1OLSA 1HEUA 2ZRGA 1AKWA 2CDAA 4MYDA 3RV3A 3DL4A 1GOTA 1XNHA 2PK3A 3UXEA 3VYUB 4C4OA 5KHLB 3AETB 4ILEA 5G3YA 3VU0A 4P4LA 4GSYA 2BFCA 3TPFA 4Z1OA 4EG5A 1KBZA 4ITRC 2XUHA 3EGXB 4S1VA 5IZCA 2KBFA 4RNDB 3GZJA 2X7XA 1GLVA 3RK4A 3BG5A 3GGCA 4DADA 2G83A 5ED4A 4G81A 5FBRB 5EZQA 1XTSA 3EOAI 4UPEA 5AK6A 5HWSA 5GONA 4K8OA 5A5DA 3ILHA 4TV8B 4F7DA 2PS9A 4COOA 1Q7EA 3TLXA 4RTNA 5GJBA 3ZCUA 1VL8A 5EP4A 5IK2D 3EQ2A 2FMKA 2NZJA 1PVDA 1CR6A 2XLBA 1EFTA 4IIHA 1RRMA 2ZAGA 1OBFO 4HWPA 5L4NA 3ENKA 4OA8A 4J43A 4X44A 3RC2A 1OY1A 3KELA 1XZLA 4V02A 2VRWA 3RLIA 3VJLA 1LW7A 3A6KA 4KR7A 5I3CA 4RD2A 1RQ7A 3QXJA 4BX3A 4L4XA 3O03A 5G1NA 5KSWB 5I8WA 2X5NA 5E0KB 4MR7A 4YMSA 3TN7A 3U9LA 2DWUA 1GU1A 1OXXK 2AZDA 5DO9A 4OK6A 4DJEC 3O92A 3B2EA 4MW0A 3DOEA 3KL2A 3K31A 4AZWA 5GINE 4WAUA 4Y2SA 5DNVA 4BEWA 3OH8A 10MHA 2QYSA 1XEXB 3CLHA 2ZETA 1PIWA 4EA6A 4OHUA 4NZZA 4Y1FA 3T35A 1T5HX 5KSYA 3PNVA 3U1BA 1KTVA 5DCWA 2A5JA 2RG7A 4YR7A 3O4RA 2ZJYA 3C7AA 3OLWA 4WCFA 3UK0A 5JQGA 4C30A 5KSZA 4G5OA 4JYMA 2IQIA 1VPLA 2CUKA 3A25A 1U3FA 3QWBA 1T5LA 4DUPA 3K70D 4I66A 5CA1A 1JR2A 2DPLA 2P9YA 2FRDC 3N70A 3DMTA 3PFNA 3K92A 4H7FA 4U2EA 3TTWA 4A4DA 5BWNA 1WBBA 2NZUG 4PHCA 5ALHA 3KYDB 5A05A 3OCVA 1F9EA 4ZPXA 4R2KA 3HA5A 1I3LA 4KOEC 2HF8A 1XL1A 2IW3A 2VJMA 4BLRA 1J1IA 1P73A 3BGOS 5AW4A 3DE6X 3NZEA 4UM5A 4Q82A 4F85A 4N82A 4UREA 4BNLA 3NV7A 3UH1A 4C76A 3RVDA 1SUFA 1YFJA 1A2KC 3KAQA 3FNEA 2AA3A 3GVCA 1ZNXA 4LRXA 1TEVA 3ZHTA 3DE1X 1HZZC 4EHDA 3E9MA 4BYGA 2ODBA 3FETA 4XVUA 5MF6A 2QAGA 2RK3A 1JH9A 1HE5A 1SB8A 1YI1A 2I87A 4M99A 4LYAA 4CEIA 5A5FA 3D4PA 1SXQA 2WG2A 1ZSVA 2XQVA 3MQ4A 3NBMA 1H9BA 1VLQA 3UMFA 1OLXB 4G24A 2QG9A 2YHIB 1KMCA 2BPOA 2E4YA 2O2XA 3TR5A 2OCKA 2VJBA 1YULA 4RVSA 1FFDA 1MQAA 3VPSA 5DULA 1QF7A 4AJIA 4TXLA 2IF2A 4OL9A 4ITVA 1QH0A 1LI7A 4EAAA 2J0SA 2WOOA 4OLJA 4JEMA 1N75A 3RVKA 2QT0A 2ZDGA 1CUVA 2EGUA 3R3WA 4PXSA 4FS3A 1Q16A 1YMUA 3A1UA 3ABRB 3AHIA 3LC1O 2B0JA 2XEDA 1J0DA 1E2UA 2H63A 2HBYA 4IIXA 1JJIA 1PYDA 2HD4A 4ZI7A 5JJKA 4M0PA 1ZVJA 2J32A 1ZGGA 3RANA 3BMNB 4HSGA 4LI0A 1UANA 4Q66C 1LH0A 4QNMA 4MQEA 3OSUA 4L07A 3OEEA 3UAVA 4UD2A 1D1PA 1A4RA 4CV3A 4PFJA 3CGGA 5F23A 3W9SA 2KX7A 5B7PA 4K6KA 5BN5A 1YQXA 3LO5A 1CJBA 1EEHA 1PX2A 1M2HA 3ZJUA 3DFUA 1B16A 1P2GA 2VTVA 3HCRA 2Y99A 5KYYA 4CF6A 3HLYA 1OF1A 2AXQA 2GAFA 4CR6A 3EVZA 1XJWA 3UJCA 2QZ9A 3NONA 3LG2A 4AY2A 2XIJA 8ADHA 1GCUA 1XBTA 3QOYA 5EMMA 3OUZA 4CKBB 2R48A 2A5DA 2ZPUA 1XCGB 4E30A 4KI0A 4YASA 1NXXA 2B69A 2RH9B 5F98A 1MAAA 2F9FA 1FP4A 4GECA 3O8RA 3NM5A 1LDMA 1XFDA 3U17A 4B2PA 1QVWA 4AKIA 3RSOA 4KREA 2FUNB 3KHSA 4JJ7A 5CCXA 1SC9A 1OOEA 5EFOA 1QHXA 1NW8A 2FPWA 2ICAA 3M6XA 4HFRA 4ZVPA 3TL6A 3ZLVA 4B7XA 2CV2A 4PS0A 2B92A 1U81A 1PK8A 4CEHB 1S01A 1OYYA 4C1NA 3GXOA 4O5OA 5TS3A 5JCJD 2YX1A 3P9IA 3PDIB 4QNRA 2PDAA 5TPZD 4LPKA 2R7KA 3Q5GA 1ORWA 3CFYA 4UPDA 1I9CA 5CA0A 5EJ6A 1IOZA 1EEXB 2OAQ1 1TC1A 5IK2A 2GJ8A 3H4VA 1Q1NA 3HUEA 5U4XA 1IN4A 3PQ7A 1WTAA 3BSFA 1QCYA 3ZI0A 5BNZA 4L74A 1X8JA 3LNTA 1RHUA 2JA1A 4BFSA 1JEQA 2AOUB 1D1TA 1T9AA 2ZYTX 4QL3A 4YHBA 2Y8EA 3MWLA 2CNDA 4FUTA 5D01A 5EPOA 3NHUA 3E0QA 1KDVA 3L05A 4JI1B 3WWYA 4CV2A 1MV5A 3HCBA 4DDTA 3UICA 3FPLA 4GXRA 4MHSA 4C3OB 3FRIA 5B6JA 2QXTA 3H0EA 3HUDA 1U0FA 4MWCA 4DBVO 5EYPB 1LNSA 3ENQA 2BFFB 2QT9A 1V4VA 4EMSA 1F6DA 3CX6A 1DP4A 1O1YA 5D1HA 2FP4A 1A8SA 3C70A 4J0CA 3DE4X 4JGGA 1DLJA 5LCXA 3DZHA 4ZT2A 5BV8A 1JA1A 1WEHA 1EQ2A 3NBKA 4X91A 4YXWD 3IHTA 3L43A 4FB5A 5L3QA 2YINC 3K2EA 2O8DA 2FUKA 2INGX 3IVCA 4GMXA 5DGIA 3HADA 4JELA 2Q3LA 1EGMB 1A5SB 4H3HB 3EFBA 4MWBA 4CL8A 2FZGA 1RI1A 4O8ZA 4ZOBA 1K66A 2CVZA 3U9TA 3UWKA 2VEDA 5E9AA 1T1GA 3B78A 1GJRA 1T5DX 1ZAKA 1N2EA 1VPTA 4H0NA 2B83A 5FKJA 4A2CA 4FHGA 1JFFA 1CNEA 1H22A 1GLNA 1L1RA 2C2GA 2L2QA 1ZKDA 3DBRA 2WYVA 3KTDA 3BWYA 3M5PA 2P4EA 3QUTA 1XU7A 4ZCMA 3P32A 5DLDA 1EDEA 2DG2A 1ECLA 1OJLA 1LD3A 3ANNA 3RS9A 1FIUA 4LBYA 2ZSKA 4OXYA 1EX7A 1TM2A 4JEHA 4R3NA 4RZ3A 3TTUA 4F84A 1MC8A 2JBAB 3E70C 1MAUA 2FH5B 5ALJA 4QYTA 3S7TA 4CQJA 4NRDA 1RKUA 3FSEA 2UV8A 3EY9A 1HQCA 3R3ZA 3AERA 2C97A 4JT4A 4UJ5A 5CT5A 1PR5A 2J9RA 4ZYTA 1NYTA 3CSDA 5HJEA 4K2HA 5AJZA 1Y3IA 4RZUA 3RRJA 4CFZA 4U7DA 1E2JA 1MQ9A 1SY7A 2DH6A 1YJ8A 3IUQA 3LZCA 1E9EA 4XWOA 3H2KA 3IAM1 2XCLA 3UYKA 5E8JA 5A0VA 2OGUA 3ZE0B 3ICCA 1TT5B 4NHEA 4KI7A 4DCGA 1AE1A 5TIIA 4P4SB 4KNWA 2EP5A 1ZL2A 3WKDA 4F11A 1IM2A 1P5HA 4OFWA 1OT5A 2PX8A 2SNIE 4TVKA 5A9TA 5PNTA 5P8WA 1W19A 3SSOA 4O4IB 1KEZA 4E15A 4I81A 2AHRA 4RDHA 3VNRA 3V7WA 1OWLA 4FMDB 4PWYA 1Q83A 1CC1S 1N9KA 2VHJA 2QTMA 1YJQA 2EERA 3U3RA 1JZQA 1F8UA 1U0RA 4IQ4A 3LCCA 4AY6A 1B8VA 1CUWA 3EHDA 1P1HA 1WXWA 1RCTE 5LDGA 3DJYA 3SM3A 1DSSG 1IU9A 5CVEA 4FB4A 2GKSA 2G1UA 1SR8A 1VHTA 3PHIA 3AFGA 1T4GA 3AESA 4D3SA 1LX7A 1WULS 3GJ3A 1RLIA 2NYAA 4WL0A 4EKGA 2W8BB 2DKNA 1HE4A 4FGUA 1HQDA 4YJ2B 3OEHD 1SXHA 5MDHA 2ZE7A 4GW3A 4MKHA 1WW2A 2BIFA 4FYMA 4B3CA 1FU4A 1EFAA 2NP6A 2ZRFA 5JNVA 1W9HA 2D1FA 3C8DA 1W5TA 4ZVQA 3B6KA 3C3MA 5HIKA 3PT5A 1JEQB 2BKVA 1ZXXA 2YZNA 3I1YA 4KQIA 2SICE 4WCVA 3OD1A 1K5HA 4PG4A 3FDIA 3B53X 1PW5A 1CUUA 2OOKA 4OYLA 4D0GA 2VNSA 4R8RA 1PFKA 2UYCA 3LUBA 4K86A 2P4QA 4QZVA 2R60A 4ZYZA 3X2SA 2ECKA 1X1EA 1TU0A 4AG6A 3FFTA 5IT4A 4BJ3A 1KZ7B 1IZ0A 3KSDO 4S24A 1KZHA 4C0XA 4EJSA 4F6CA 1ZVKA 2J08A 3DKPA 4D9HA 4U2KA 1PEAA 1EGAA 1AU9A 1CY2A 1S7CA 2QSJA 4MVJG 3CQ9A 3E9NA 4R2JA 5T57A 5JAUA 4M9QA 4PWZA 2ZCJA 5AKKA 4IS2A 5L3RA 2BE7A 5IXSA 3SS9X 2HRQA 1IUOA 3UGJA 2PUTA 2IIVA 3NWOA 4NCJA 5LA6A 2YYZA 1QQBA 3SQXA 4ND1A 5AVJA 2OZLB 1OFIA 1LLFA 1YHYA 2AG5A 4QTTB 1QLHA 3LXXA 5BN4B 4DTCA 1AXRA 3BWDD 3DCYA 4XSGA 4XASA 4G2NA 2DXIA 2FW9A 4D44A 2UYOA 3MGAA 5K09A 1X3LA 2AJ8A 2E87A 3MOGA 1Q0HA 4WVFA 3ACDA 1E79A 1VE1A 4RLFA 1MG0A 2IOYA 1WPRA 1Z26A 3KLMX 4JOCA 4MGZR 4FC7A 3PF8A 1N9GA 1Z12A 1Z5GA 4XWYA 1P9NA 4TXNA 3H4MA 2PGOA 2GRUA 1VLMA 3F47A 2P90A 3KZCA 2G88A 1T9ZA 4IDEA 5CX4A 1EWRA 3RKUA 3T0FA 1NBME 4EIWA 4NZ9A 1WZCA 4EI9A 1UAYA 3EXFB 4JJKA 2CDNA 3TNJA 1UOOA 1ZNWA 3GFBA 1QBKC 2MU1A 3ZZ0A 4JYZA 1RVV1 2RI0A 2Z09A 1U8UA 3BRSA 1U28A 1R0ZA 2C3PA 2G28A 3IHWA 1DV1A 1TCBA 3PQCA 4YLYA 1A8QA 1K9SA 3P9PA 3UENA 3WMXA 4MNTA 5EJAA 3QX3A 1E9DA 4MUGA 1XD2A 3TRJA 4QNNA 1XFAA 4JGBA 2ZJ0A 1DAOA 1FOEB 4REQA 1KU6A 2IEBA 3VR5D 5GZ6A 4D42A 5KTRA 2C9ZA 1H6BA 1OPXA 3ETJA 2VS1A 3AHDA 1PL6A 2P5SA 1SBNE 4CEJB 3LL7A 3E35A 4ARCA 2WNHA 1BXGA 5IVPA 4ZMSA 5ARBA 2NV6A 4FHCA 5JNSA 1S2GA 3U5ZB 4OK3A 4LYJA 1QVRA 2FG5A 2GEJA 2YNMC 3DTNA 5AW5A 3FNQA 1TLFA 3VR5A 5BWCA 1B42A 1F2TB 4R7TA 2FHPA 4Y2UA 5ADVA 5K7SA 4QYXA 1JLLA 1IUKA 2PLNA 4IXNA 1BXGB 4GOJA 2QTHA 2AZTA 3BE4A 4WBNA 3FUWA 3ROKA 1Z18A 3CH4B 2QP3A 4TMFA 2Q27A 2PGNA 1WR8A 1JEOA 3BK7A 3FAZA 1QOQB 3K9HA 4X8LA 4M21A 5AVZA 1ESCA 4MW6A 5CG2A 1W85B 4XFKA 1IXYA 3RABA 4QEKA 3GRCA 1Q7RA 3GA0A 4Z49A 1UZAA 4OBBA 3B5IA 3HJHA 1M76A 4RADA 2XXAB 4O2LA 2QK4A 3E61A 1AD2A 3KVOA 2FU5C 1GSAA 2HDHA 2DE0X 2WJWA 3KXDA 1YONA 5EE0A 4IDQA 3H17A 2V0NA 1MIHA 1NIJA 1T0JB 3HYCA 3F5FA 4XUCA 4EJMA 3T9EA 4X93A 2C20A 1AB6A 4K9QA 5EKSA 1EHYA 1QRSA 5BQPA 4MVJA 1KNXA 2PX2A 3KDSE 4AB1A 3N07A 4DW8A 2ANBA 1EFLA 1EUDB 1VPVA 1OV4A 1AKVA 4BLQA 3OX3A 3DWGA 5JVDB 3KQNA 5C34B 4HD8A 2QRZA 1QGAA 2HF2A 2X42A 3MCUA 4L6AA 3QWAA 4QD3A 3A3KA 3JVUA 1Q0QA 2IX9A 1JAXA 4D9FA 5I3ZA 3IV7A 5LQSA 3HFGA 3C7CB 3IELA 1E1QD 1VI6A 4LNAA 4OMCA 1E64A 2IS1A 2PKRA 4HQ0A 3I34X 1OXUA 4IY1A 5BUCA 2I7VA 2VJDA 3G68A 4TKUB 5AVOA 3SC4A 5JAMA 1LLQA 4JVNA 4CUZA 2CLKB 3CZ9A 4PYIA 1DLIA 5BN3B 3D3EA 3FYDA 3E6AA 2SECE 3BXEA 3S8EA 1MT3A 1QDUA 2XX3A 1ZJ6A 1D3AA 4JOSA 4C4YA 1G8SA 4ZQEA 2GHIA 5ERXA 2NQTA 4X1IA 5HE9A 1E98A 2JI7A 1E5VA 2CVQA 4Y6RA 4JI5B 3I32A 4D1YA 1P8AA 3HSSA 3PVCA 2OD9A 1JSCA 3HLKA 4IVPA 2VUIB 2X0IA 5CM9C 3DD5A 1CS0A 4LJ6A 1Q7CA 4DQLA 4O2AF 2P40A 3G2NA 4JLKA 3TM4A 4NIMA 1JDUA 4JP5A 2AXPA 1HDRA 1O4VA 1GSOA 5EP1A 1SVSA 2GHTA 4R8LA 4GIBA 4RV4A 4Y1RB 4BX2A 3ISTA 4DMRA 1UJ4A 2V0GA 2J5QA 1ZK2A 4RSRA 3SP1A 3RVQA 3U37A 5AVXA 5JIBA 2ZYDA 3QM1A 3ZNQA 3S2UA 4PBRA 1AKMA 1UBOS 1P2BA 1QZUA 2AYZA 3AXTA 2I6QA 3L1JA 2PKYX 3TW4A 3V1YA 2FG6C 5HYVA 1M6VA 5EG5A 3NWEA 2PRJA 1J0BA 1PWHA 4Q3OA 221PA 3A1FA 3ZN2A 3ZLTA 3EIOA 1T0PA 1TCAA 4PO1A 4JI0B 2NAFA 4PX9A 4K9KA 3CE9A 4TSFA 1CUDA 1T1RA 4LXQA 1N3LA 3SVZA 4G5YA 3RM3A 4YT4A 2OCBA 1CDEA 3ETDA 1XTKA 1SKYE 1CULC 1NI3A 1O5TA 4GI7A 1X7YB 4MR7B 3OQ1A 1ZDMA 4BBJA 1I7NA 4QRHA 5AQEA 2GGSA 4AS2A 3HP7A 3AINA 1NQXA 4V38A 1O0SA 1FFSA 1SHJA 2YIDA 3A3YA 2HHJA 3BQMB 2YTZA 3PSHA 1Q0UA 5JZOA 5IDQA 4J91A 4E4YA 4ENUA 1NY5A 3THSA 4EAQA 5KDDA 2YOHA 1VM6A 2YNMD 1U1GA 1FS4A 3EBPA 2CYBA 1E3WA 2QR2A 4MVWA 3JQ9C 2OTCA 5D51S 4ZU1X 4LAFA 1TKAA 1XHLA 4UFNA 3KQQA 2JIMA 5JNTA 2OUKA 4NONA 1MC4A 3E5RA 1QVZA 2V7VA 2YS7A 3Q5DA 3UWSA 2KMLA 2VQDA 3GMTA 4BN4A 4INZA 5KYNA 5JTTA 2BKUA 1A95A 1WU8A 2YHAA 4Q1VA 5FOXA 5J4HA 1EVKA 5KC8A 2ZXUA 1Y6JA 4ATNA 1NKSA 5HRUA 4LBWA 4JSRA 5C0OE 1OI7A 3AJ9A 3GVIA 1HYBA 1OC2A 2ZB2A 3FF4A 3GZNB 4LZAA 1TIPA 1GGMA 2XJ9A 3EA5A 1JECA 3KB2A 4JT8A 4R98A 1DINA 1ZH2A 4C4XA 1X80B 3ZNOA 2BTQA 1JLRA 3OPYB 3FDZB 1Z4NA 3TQOA 1QO7A 2AWNA 2NXCA 3T54A 1P60A 5L45A 2ZJ5A 3KR2A 5TGTA 1YA8A 2P6PA 5IULC 4MCAA 1KMHB 2OBFA 2HK8A 2OG2A 4O2RA 3S6JA 5JSKA 4PR0A 4CMIB 3P4YA 3K5HA 4IJVA 4F60A 1RJDA 1AQUA 5LJIA 1ZX1A 3NP9A 1PZNA 2L0XA 3I61A 3IQGX 1DDGA 3ZVLA 4HB0A 2IUYA 3G8CA 1E20A 1BWPA 1EH5A 3KLNA 4DGQA 1MXHA 2G3YA 1SBIA 2VYND 3HS3A 3CUEF 3VV2A 4CPDA 2C4TA 4C0WA 2O2ZA 3S2FA 4DCMA 1BX3A 1T5SA 2FEAA 2K7FA 3JQBC 4QEDA 1T91A 3DEHA 3ZVMA 4D2IA 3BGDA 4PN3A 5JSQA 2DJIA 4X92A 5JCPA 1RTTA 2VNKA 4F4DA 1UBTS 1UMKA 3LUCA 3LW8A 2XNHA 2ZDQA 1QGDA 1DJPA 1G20B 3FFXA 4OL0A 1H1DA 2P1RA 2QTVA 1KR5A 4FOPA 1OILA 1E5LA 3A3OA 3BWCA 4TN5A 3V2HA 3PIDA 2B2CA 3CLTC 2HWXA 3IA7A 4CMGA 2AF3C 1JHVA 4KGVA 1V1MA 1BMFA 1VMAA 2Y1OA 1BGVA 3NALA 1ADBA 2V45A 3PWZA 4JYBA 3E1KA 1FX1A 1QBGA 4QSHA 4FQ8A 5A6SA 2VHXA 3GX1A 2H65A 3AUKA 2H17A 5BR1A 1HE3A 4P53A 4G36A 5AD1A 4DEYA 1NW5A 4UXIA 4WV3A 1M10A 4X3CA 1W6UA 5JI2E 2LCFA 1YT5A 5JNLA 1K6EA 5DX0A 1YA6A 2HV8A 3E8MA 2DPGA 1BWSA 3V1MA 2O7QA 3F6SA 2O19A 2PUEA 1N5JA 3N5CA 3FTFA 3CVOA 1SBHA 3ANMA 1SZJG 1ZOIA 3UQYS 5A2GA 4KMRA 4G1MB 5M04A 2EU8A 5E6SB 1OBVA 4KUEA 1CUJA 1Z7WA 5BV1A 1IQPA 1ZWKA 4LUCA 2AMJA 3GLHB 4ONEA 5F33A 4B6RA 3PUKA 5JD6A 2XXBA 2GFHA 1GU0A 2BP7B 3NBYC 4M8IA 1M2OA 2GJAA 1R6VA 2GAOA 2WUEA 2Y0CA 3DZGA 3I1JA 4FLMA 2OEPA 5HMMA 5LXTF 2F8SA 2W42A 2C9CA 3WGQA 3JX9A 3QE2A 4K9MA 2Q4OA 2K6GA 3HU5A 1VA5A 3IBSA 1VLJA 3I76A 5FBKA 3IS3A 5DHQA 4ARVA 3RC7A 3QU7A 5I9LA 4E1AA 5DBOA 3QEOA 4J7AA 3NR2A 2EHJA 4H6WA 4Y3UA 1T25A 1FMTA 4R8MA 1XO1A 3A9VA 3HMKA 1D1QA 1RCUA 3D4LA 3O5AA 4HGYA 1OFTA 2Q5LA 4BVFA 4GLFA 1P7YA 2H1IA 3HXPA 1U5BA 2R6DA 3K5PA 3PXUA 5AXAA 2FR1A 1NHWA 4Q4DA 4TKMA 1YTLA 2O2SA 2JRCA 2N3ZA 4JI8B 4OJYA 2IHKA 1QF9A 1WEKA 3I6ZA 4GZLA 4DPKA 5C3MA 5JARA 421PA 3BORA 4KFRA 1EP2B 2QL6A 1U7HA 1P5ZB 3DGEC 4R1PA 2OO7A 3WRXC 4BO7A 3AVUA 1D2RA 4D0SA 1ISJA 2BTQB 2O2JA 3OPYA 3WI7A 4A2QA 4EKIA 5BURA 5C9ZA 5L8VA 2G1PA 2FMFA 3C8HA 1RIFA 5E4JA 4YGXB 2H54A 3OLVA 3QH4A 4GUDA 4RD1A 2BZGA 3M82A 1IJFA 3FAKA 5L3SA 4F9FA 3Q72A 4JODA 4M2LA 4NX2A 1GPNA 3PI7A 3T5GA 2Q3DA 3Q6IA 1H2HA 2DCMA 4DT1B 3P2JA 2R97A 1MEOA 2VT7A 2AD5A 5SZHB 3ROPA 2CCGA 5EJ5A 1JXQA 5EEGA 4GR4A 2CL0X 1XT6A 1IMJA 1Y8ZA 4LC0A 1QYXA 4JLMA 1G5IA 3ZDFA 1IHUA 1S89A 3OTHA 3TK1A 4CM6A 4P98A 4YMTA 1ZD1A 1MBZA 3OJFA 4RV9A 3T3IA 4CTKA 1H2WA 2VDQB 3R3UA 5ABPA 3P8ZA 3RWOA 4HVCA 2HCBA 4EPXA 1II8A 4KQ2A 4QM7A 1UXOA 1A8UA 2O0JA 1HT2E 3LRTA 3QIVA 1YR8A 2RHTA 2QU7A 8GPBA 3MFYA 5F1KA 2XUQA 2Q2OA 1Z35A 4F1KA 3NO4A 2O3RA 4FFMA 2UZ1A 2TECE 1ZM9A 4CQMA 3RC9A 5G53C 3JARB 3I2GA 1GGNA 1CY8A 2VPWA 4EYKA 2FRXA 2C1EA 4ZOEA 4EY8A 4ZVSA 2GEUA 4FNMA 4NV3A 4G41A 1V4NA 1RZ3A 2QMHA 1P1JA 1YO6A 1HMPA 3R9KA 3HCNA 4MWGA 5KTNA 4Q05A 1IOVA 4M37A 1IYZA 4X6XA 3PLNA 1CHDA 1M0WA 1Q95A 3WJ2A 1LJ8A 4ZXPA 2B8EA 3IDAA 3IPLA 4AJ2A 1E60A 3E82A 1NXWA 1X3SA 3M5DA 3MJRA 3SHVA 1TVKA 5DWVA 3HA7A 5F7XA 4TLEA 4WESB 2W4IA 3MTIA 5C7OO 3GJ6A 5JS6A 1I5EA 1N4DA 2XECA 1TZKA 4MA5A 2M1XA 2P3OA 3BSSA 1J6UA 2R8XA 2XYVA 1ODTC 1YQUA 3QOWA 4TL6A 5IBPA 3FYUB 2W6CX 2D00A 3BGIA 2ZRCA 3JQDA 3LHIA 4FD3A 3KB1A 4I99A 3VR1A 5DE3A 3MLAA 1P2UA 3OM9A 3D59A 2NZWA 1GTSA 3NDIA 1I4DD 3EB9A 1OAOA 3C6MA 2Q7OE 3UJNA 2OD7A 1C0KA 2B30A 3HN6A 1AGNA 1SHTX 3HNRA 1HE2A 4W5HA 5ALIA 5FAXA 4GEGA 1L4KA 2NV0A 1BHJA 2B1IA 3U0BA 1F6BA 1VBNA 4HT3B 5EIBC 2VF7A 1Q44A 2C0PA 3BF7A 2MMGA 3JYQA 3MMPA 4O4JB 1QYRA 3GFGA 2QZZA 2YJ6A 1COZA 5IAAA 4ZEMA 3URKA 2H1VA 3B8HA 3FWNA 3LW7A 3E48A 3O1HB 4ND2A 4H3KB 1E2MA 4PGHA 4PF1A 4WXYB 1JEJA 3SHFA 3RHZA 4F2PA 3ABOB 2GN2A 4GHWA 2X6TA 3TNDA 1XRSB 4ZQBA 3LZ6A 2NUPB 2Z57A 2DHRA 1X1RA 2CXSA 1E3SA 3AEZA 5G4KB 3ORFA 4PZAA 3C5CA 4BV2A 3NDPA 1YE3A 2I33A 3OSZA 2C5BA 3IDFA 3ZVNA 5L7YA 5AJTA 1KMHA 5KI6A 1RWBA 2WUVA 4IWYA 2AJBA 5T8KC 1P29A 3A1WA 1XTBA 3PHJA 1HI9A 4HZIA 3TCXB 5JANA 2HA3A 2O06A 4CM8B 2RHHA 5JDIC 1NM5A 2OB1A 2P62A 2PV7A 2QRMA 1PV4A 4LVUA 5LYJA 2E49A 2Q0XA 5B1IA 2IT1A 3ZWCA 1TQ4A 4F2GA 1UCFA 5HTKA 5IX8A 1VIYA 2HLPA 1GGKA 4HAYA 3QWFA 2QL9A 1PF7E 2H00A 2QLFA 4RKQA 1PJ2A 2DQYA 4D3ZA 2KYRA 1DKOA 1YRAA 3DE0X 3Q5EA 2O5VA 2VWHA 4KQ1A 3HFRA 2NO5A 4BATA 3ZQUA 1D5WA 2OBLA 3NIBA 2GZHA 3KO8A 4RZXA 2YJ3A 4Q02A 3UUGA 3JY6A 1XZFA 1CY7A 4KDRA 1DQZA 4LOLA 2HM7A 5AI5A 1UADA 4RSHA 4KUHA 1E58A 2NO0A 2X3FA 1KH1A 1DCFA 1NZDA 2XPCA 4ND3A 4POAA 5LB2A 3GUZA 3D2CA 5F1YA 1NGSA 3RR2A 3W5HA 4CQLA 5JPCA 2D0IA 3ESCA 4KC0A 5K3OA 1AO0A 5HJ2A 1KWKA 1QVAA 2X7HA 1WB9A 2R7NA 3C87A 3TJRA 4JCCA 5JAOA 1DQRA 3K1ZA 2FMUA 2UYGA 2ZJ3A 3OA2A 1YB4A 4HUTA 2Q8PA 1G6HA 2XYRA 1KH3A 4IKEA 5EYPA 3F49S 3V8RA 4DNXA 4ADSG 4C2BA 2LD4A 2OHIA 4KAFA 3VNAA 3GJRA 3TGPA 2VXOA 3MINB 4FKZA 1TKRA 3A11A 5KVAA 1HNNA 3V4PB 1S6YA 5BMVA 1NXVA 5B7GA 4V24A 3U56A 1WKBA 3HC7A 3OJEA 3VFDA 3OLZA 4J75A 4LJ8A 4UM8B 1ZP6A 3TLAA 4CMIA 5BW6B 3SY8A 2P7HA 4U6QA 3UCEA 3QEAZ 3TBHA 3A04A 1IULA 1Y1RA 3H5RA 3K6JA 3JTEA 4E13A 3MBOA 1U0BB 3F3MA 3NJ4A 2BR4A 3EVCA 2QYTA 1BWRA 1SXJE 2ATVA 3UJDA 5H9WA 2JLRA 5KQPA 1PJTA 2WE7A 3GJSA 4UVIA 1VHJA 2IZ0A 4CDMA 2GESA 2QRUA 4DXHA 5JLAA 2DBQA 2C2MA 3AHFA 1CSEE 4ER3A 3WV5A 1LTQA 1KDPA 1NVAA 1G9TA 2IYAA 3BJMA 5F21A 3FJYA 1X77A 5AK0A 3PUXA 3IQIX 1NQTA 1WHSB 2ONZA 2YMLA 4ND8A 3VKVA 4EKDA 2VJPA 2GZDA 3R09A 5F1PA 2DBYA 5HDBB 3S2SA 4R71A 2YWEA 1Q1AA 2R47A 3HSKA 4Q93A 4CLDA 2V6MA 3NT2A 3UTCA 3AESB 1GILA 2XBUA 3WV4A 1NLUA 3ILXA 2GM9A 4BO6A 3HCFA 4JROA 4ASUA 3K4QA 5J3JA 1BMDA 3P0RA 5LZ4A 5FQOA 2J7PD 2WP8J 4QGBA 5FULA 4NJMA 3E3NA 2WHYA 3IC5A 1GRCA 1DJLA 1XGKA 2SCUB 1TMGE 3U31A 8ATCA 4D6PA 2QJTA 2QV0A 1KBQA 1MJGA 4B3IA 3GFTA 1MO3A 4YCLA 4F2WA 4D9CA 1KZGB 3KOYA 3W34A 1O8BA 4GBJA 4YV7A 4V1CI 3BMOB 3QUSA 2JJQA 2W6OA 4OSPA 4XD7A 3U09A 5IMSA 2BFOA 2QZ4A 4BHTA 5T5QA 1T5BA 3H8VA 1EXDA 2YV2A 1DKQA 2D7JA 5IDVA 1Q74A 3THWB 2Z6QA 2NACA 3BULA 4XJXA 1P61B 2IP2A 3R1IA 2ZRKA 4MQ5A 5JJCA 3NEAA 3W9BA 3DM9B 3WGLA 3UAWA 2H4WA 1M6NA 4TGLA 2F1KA 2GRAA 2MINB 3PRKE 2V7WA 1YRQA 3FVWA 2OHJA 1T3GA 5HUHA 3VAAA 2WKRA 3BD7A 5E2IA 4S1TA 1AG9A 3S1AA 5FR2A 2AYYA 2EFGA 4JLSA 2Z2XA 3ZU6A 4RZSA 5F5NA 4HFMA 3ZHVA 3OOEA 3D0QA 2OUIA 3M6FA 5IDXA 3UKDA 1L7OA 1BAPA 1I10A 3CLUC 3Q87B 1X42A 1X1CA 1UL1X 1BDIA 3DDNA 2HWKA 3G0IA 3HDVA 5FWYA 1KMNA 3NMUF 1DRKA 2PXCA 3VHXB 2PX6A 2N1MA 3T6KA 4OPMA 5DK6A 4BEVA 5DNCA 1OXKB 5HZMA 1RHMA 1XEAA 1KO8A 1U2QA 4QWWA 1Z2PX 3F74A 4I1PA 3TQIA 5CW2A 3O6VA 3VH4A 5KYWA 1EK2A 3HA2A 5TPWB 1VL5A 3THYA 2PSFA 4OHBA 4Z53A 3VR2A 1QS0B 5KX5F 1W1IA 2J3DA 3QXXA 1KH2A 1L5MA 1MA0A 2HA6A 2Q49A 3DBHB 3OQ6A 4QUKA 1D9XA 2ZRHA 3O26A 5C1DA 1JJ7A 1SK8A 4DM3A 1WUYA 4K88A 5FD8A 2XEXA 4LJ4A 1FDRA 1UDRA 5C31A 1QIFA 1ZNZA 1VXOA 2LWIA 4U0KA 1C0IA 2XE4A 1PX0A 4RXUA 3F9RA 2YFKA 1U4OA 2A94A 3EDMA 5CCEA 5FWXB 4DLLA 4L4YA 4YRFA 4RVUA 5E6UB 2VYVD 1YKSA 3AVOA 4Q3BA 2G09A 5CGQB 4ZCSA 2O23A 4FYWA 4ZRMA 3H19A 1N2OA 3CZAA 4MS1B 4QUIA 3PKIA 2R1VB 1BZYA 4FFLA 4WX2B 3H11B 4MW4A 1V8DA 4MYSA 3AY0A 4FFBA 3VHQA 3WLPA 5K2OA 4BMCA 3AILA 3IBFA 4GM1A 4IKPA 2LPMA 1NW4A 2GBLC 3O8OA 4HN9A 4I1SA 3RARA 3VZBA 3HU1A 4OU4A 3UUEA 1H2BA 3DUWA 5JH7B 1CZUA 3ASUA 4BJHB 5ENZA 3FOCA 2Q46A 1KE1A 3VPHA 2B5WA 4UVDA 1C1XB 2FOLA 2V9CA 1GG9A 4E6PA 3HK2A 1MX3A 2N47A 4WN9B 3F1LA 3DE2X 3LIPA 4PINA 5BW8A 5HKOA 3FW1A 2NSYA 1YNOA 3ZCVA 1BA3A 1DUSA 1WMEA 3V2GA 2PRYA 1U0LA 4Q7KA 4DSUA 1GA6A 1AKYA 3R0JA 1YB5A 3QMWA 1GKYA 4K9LA 3GUUA 4ML3A 4LISA 2ZYVX 3G8AA 1YKGA 1ICEA 4FFRA 4TT3D 3K20A 3I2KA 2ZIXA 3S44A 3RBVA 3W9UA 1N36B 2BJVA 1CEQA 4BCCA 3JWHA 5TMEA 4EG7A 3GZTB 2NUPA 5E7QA 1JV2B 3GD5A 3F2VA 4FZVA 2CE7A 1OWNA 1RE0A 3KXLA 2GLTA 4HYTA 5FNVB 4CCYA 1UC8A 4E5VA 4ZC1A 5KYYB 4ZDKA 2D0DA 1GPYA 4X71A 5JZVA 3AVTA 4GMKA 2A84A 1C2YA 3FHOA 3GRFA 5IARA 4E51A 2AFVA 2Y76A 1L7DA 2X5KO 2PX4A 1RAAA 4MB2A 4NBNA 1U2RA 3K94A 3RRBA 1KPHA 1L8QA 1YAHA 4ZANA 2HK7A 2J1LA 3Q6MA 2W58A 4C6TA 1V48A 3ND8A 4L08A 1V5IA 2ZJFA 3SR4A 2WBLC 1FP1D 4D3YA 4BNFA 3VUEA 5B58T 2O3JA 5LP6C 3BZWA 4URHA 1BKYA 2A86A 2X2OA 5EKTA 4GLJA 5AOBA 4IIJB 4XYBA 3GD7A 2GTHA 4B40A 2VF5X 2Z6AA 2IBSA 1HDGO 2D2FA 3EIUA 5KKAA 3HJBA 1V1RA 1XCMA 2WSYB 5TS2A 1TTQB 2Z3WA 3TLBA 2ECPA 3OTQA 3TEJA 4DQ0A 5KOJB 3RAEC 1Q0TA 3KYBA 1Y7PA 5ER9A 2CDBA 3QKSA 1TLTA 2FK8A 5AJVB 3UMVA 4C3UA 1RXVA 1EXVA 1QQ5A 3PHHA 1U9IC 2NWQA 5K4HA 3WWZA 4Q21A 4P82A 1PYGA 4B4VA 1VBKA 5AKZA 1B8UA 1W0KA 3OE4A 2WE8A 3KTFA 4GFDA 3RNOA 3EX7C 1QU3A 3R76A 1XPRA 3UOWA 3KWFA 4CRWB 2GXSA 3NLLA 3WB0A 5M3BA 4DR7B 1IWBB 1R66A 1NULA 1W46A 2RGDA 3WK5A 2HDWA 2Q5QA 2ZI4A 4DA0A 1ZC4A 1ZGZA 4MJXA 4ZEWA 4FEAA 3TLGA 3V9PA 3BKWA 3KK0A 4TWJA 1JJVA 4UDYX 4XVQA 2IX3A 5SZIA 3I5AA 7ABPA 2ATEA 1QS0A 5J40A 1NIPA 2YHUA 3PDUA 4GMGA 1QP8A 2UUCB 2G67A 2G9RA 3IAEA 1RP1A 1SUAA 1UZLA 2FEOA 4YIHA 4RTLA 1ODFA 1DUVG 2QIPA 1R12A 2D7DA 1NF3A 4GMDA 4EJSB 3INNA 1MVOA 2VHQA 1Q2UA 1E4YA 2GDJA 2NSJA 3EE6A 5HKKD 5D3ZA 4AF7A 1G20E 4HEQA 5FAKA 3AYZB 4PG7A 2OZVA 1KU0A 3A7EA 2I8LA 3ASYA 4WNCA 1HY3A 4FMCB 1Q50A 1AHPA 4ZI5A 2PBLA 3U4IA 1XTPA 3FUTA 2I54A 3KUUA 4C0KA 4OKIA 4IRXA 3FTDA 4WCFC 4BMNA 1GY8A 1P2FA 3QU9A 5EE1A 4F38A 1AS0A 2CLHB 1KVQA 2X0FA 2CLLB 4PSVA 1YKFA 3UW1A 1JFFB 3EXFA 4O4JA 4DV5B 2QBYA 2QHXA 1CJTC 2C58A 1MU0A 5BN3A 1A4IA 2BISA 2FEWB 3K0HA 1W5BA 2V6FA 3YASA 3KQYA 2I22A 2IV2X 1XELA 4GVPA 1P9RA 3PEEA 1MB3A 3OT1A 4E4TA 3VR0A 3IXMA 2HMTA 2I55A 2J31A 3BRWD 3HZZA 4HGPA 2FZLA 1D0SA 3P97A 1Z88A 4ID3A 4C4ZA 4F3CA 1KI1A 1R8JA 2X23A 3N8HA 1RP7A 1W36D 1GQQA 5CIWA 4ZA2A 1X7DA 4D80A 4H7EA 2C5EA 1AUVA 1G2QA 5BXQC 4M49A 5LYJF 2WTEA 3IMGA 3JD2A 4L7VA 3V4RA 3EQ7A 3EULA 3HCCA 3I45A 3LD9A 1JF8A 5ADWA 1L5VA 3M5CA 5B30A 2DETA 1ZVMA 2WJAA 1KI6B 3SVLA 1W2HA 4IVNA 4RPCA 3C7KA 2OPHA 5KJFA 3WGOA 3ZR4B 2P41A 2IHTA 3H8SA 3WADA 1V96A 2QQEA 4BE9A 1WZ2A 4ZVLA 2OBYA 1SC1A 4CJXA 2ZWMA 2C29D 5ALXA 1FDTA 4GT1A 2F00A 4Q3KA 3DEZA 2UXDB 1ACMA 5JC8A 4EARA 1L5HA 2EJCA 2UXCB 4DE5A 1P4SA 3K15A 5I7WA 3P0IA 1ID8A 1PGJA 3LKDA 1G3UA 4Q9AA 4ZO9A 2Q4RA 3ONVA 1YD7A 3KXIA 4KUGA 4R1TA 5C7YA 1Y37A 4MZDA 4LJ5A 1WZIA 4WBNB 4PC3A 3UATA 2GT1A 5EN4A 2P7IA 1N33B 4W8GA 4N3BA 2CWWA 4XQEA 1A7KA 1YC5A 3W8RA 4JXKA 3ETHA 1K5GA 4NZPA 1RZRA 2Q4DA 1RJEA 3VHRA 3FHCB 3WJAA 2XQKA 4GXTA 1NN1A 2JRLA 4Q1AA 1TTHA 1WAMA 1ZM3A 2VDJA 3SMVA 5B3LA 1QK5A 1RLJA 4UCWA 3HRHA 1WVMA 4YJ3F 2NV2B 3BREA 5KDLA 2XVXA 4N7BA 3AKZA 2AFIE 5EKDA 1ZIDA 3OZCA 3R9XA 3FYSA 2EIHA 4S1WA 3T1TA 3DOHA 3JQRA 1N6IA 1TCCA 3QLJA 3FPHA 5DXJA 5LZ9A 1WPXA 3OEED 3U2QA 1DAIA 1P8JA 4YRKA 2WKPA 4PXAA 5ALPA 4DMHA 3U61B 1JDVA 1NKTA 4BO9A 4MDEA 4PLWA 1AK1A 3RO7A 3UGTA 3DEYX 5E6RB 3SOPA 5LM3A 1LZKA 4M9UA 3OZRA 1ZJJA 5REQA 2IYRA 3UMGA 1QH1B 3VPCA 1FJXA 3EH2A 3AUUA 3FTCA 3PGVA 3T15A 5KUTA 2WRZA 1BJKA 1VG9B 2Z58A 2CK3A 1ZGAA 1PU2A 2B21A 5EQDA 5KVVA 1RXSA 2BKXA 1YBHA 2PKEA 3RJMA 2V59A 2PO7A 4TKVA 2XQJA 1J20A 1NMSA 1F4LA 3ONDA 4PS1A 1NOIA 1Z0IA 4OXQA 5E1OA 2JCVA 1L6RA 1LS1A 1PEYA 3R8XA 3UA3A 2OHVA 4XB6B 1TYEB 2BI7A 3BYZA 3EXG2 4IP0A 3ADKA 3PUIA 3IEIA 1JKIA 3L8FA 5DN9A 1EM8B 3T8YA 2RHWA 3GLFA 2J4FA 1FLAA 1YCHA 3CLSC 2HHLA 3PX2A 1Y98A 3CH5A 3L77A 2XHZA 3OBBA 4R2HA 1EYZA 3I52A 4PNHA 3USZA 3A8TA 3KQHA 1Q6YA 4JVMA 4URZR 3V46A 1NPDA 2A0KA 1MAWA 3RGGA 5CLLA 2CLCX 1W36B 3AOEA 4L8GA 4QDJA 1JE0A 1F1BA 4HLQB 2IHBA 3X1DA 1OXTA 4TTTS 1U90A 2QA5A 3N0VA 5DBEX 1Z82A 2BDTA 5AIBA 2E4WA 3CPEA 1NUUA 5DZSA 3JZFA 3MFQA 2D3WA 1WBJB 1H8HD 2FAXA 3TMAA 1Y5NA 2OZEA 2WJ6A 1PJ4A 1A72A 3G7SA 2Y1GA 5IH3A 1VE6A 1XTTA 4WEOA 2CJWB 3B7PA 4M60A 1RVDA 5IKXA 2PUCA 1LZLA 1ZEMA 4EX7A 1XD2B 3EIHA 1XCJA 2PMDA 3QVJA 3WHIA 2DQ4A 5L53A 3RSHA 2PMKA 3ROXA 2PX0A 3RUCA 3I9JA 2H1WA 2OSVA 4TL8A 4B8YA 1PS9A 3LS2A 2H2AA 3AI2A 1OZFA 2FFJA 5ILQA 2J3JA 5NULA 4NCBA 1R0RE 4FTWA 3WFJA 2H1RA 1Y82A 2XIQA 3H6KA 4UZFA 3FKSD 4Q24A 2XRZA 3VVBA 5HQTA 5F5XA 4RK5A 4ZTZB 1BHQ1 5DLEA 3R41A 1TYCA 2WLSA 1ZEJA 3EFHA 3LOUA 2BBTA 1COWA 2DPYA 1FK8A 5FH9A 1UKEA 1G66A 3KPWA 5P21A 5CD9A 1YUNA 2ZM6B 1U8AA 2QUAA 2IPNA 1GCAA 1OPRA 3O8LA 3EFOB 3H1FA 3N76A 3MMNA 3A58B 5FLYA 1NQOA 2X5OA 2GPYA 4N5HX 5HJ5A 3ABSB 3VR6A 1A69A 3DBIA 3BERA 1TYZA 1GZ7A 4QHTA 1O54A 4XJTA 4YMWA 4RS4A 1WUKS 1HMYA 2V7PA 2X8AA 4QAQA 5C8YA 1XL0A 1TO6A 3M4ZA 2ZUCA 1A9OA 2M9MA 4WKCA 1IHOA 2SKCA 4QU8A 1C2TA 4B74A 1PDWA 2R8OA 4MI1A 4O0MA 4AECA 4RA9A 4IDAA 4MINA 5EFZA 1DPFA 4Y18A 2JAHA 4FJ2A 3RNLA 1OYOA 3NKFA 5KHAA 1SU8A 1I1OA 3PCRB 4QDZA 5LQMA 3EJWA 4RA6A 3SM9A 5GP1A 3P0JA 3TS1A 1W87A 5HF5A 2O8VA 5BXYA 1ENOA 4W5JA 4LJ9A 1YJXA 1CKEA 3R0ZA 4Q18A 1A9TA 3AONB 4Z4HA 2GNOA 5C8YF 1MIOB 1IN1A 3CRMA 3D8HA 3JYPA 1JFLA 4X5OA 4DBLE 3SEZA 2XRYA 5M2QA 4M0LA 1RM4A 1GL7A 2HMUA 3AVVA 3ZD8A 4MTLA 5L3SB 2CL7X 2FSIA 3CH7A 4BO2A 1HKHA 2LW7A 3TMKA 2F7SA 3L0YA 1PYOA 4DLPA 1DT3A 1KYYA 3R9IA 2X0EA 1TX4B 3PJFA 4UMEA 3I37X 4IH4A 1U7WA 1W29A 1G2OA 4UBJA 4GWLA 1XZIA 1OASA 4HDCA 4IAOA 4OXRA 3W6OA 4DARA 4D9BA 4DM7A 5LBTA 1KOLA 3UJBA 2ZB3A 4JLPA 3MELA 4JH0A 4RTQA 2PAFA 3LP8A 1JHXA 1EPUA 1RQGA 4A0SA 5E3HA 1RWQA 3DTVA 2JH8A 1T9DA 1UF9A 3OM1A 3RK0A 3UFBA 2FW7A 4XWKA 1ORRA 3SX4A 1P1FA 5T4FA 4YPVA 5CTJA 3ZK9A 4QDXA 1CE8B 3Q7TA 5CK4A 5AUPB 4XTCS 1N8NA 5H80A 2JLYA 4P0QB 4IDDA 3NTOA 1VKNA 3MWYW 1P9OA 1CFJA 1YJAA 3BB1A 1W4ZA 4MW7A 5K3FB 5JS7A 3V33A 3QE4A 1F0PA 3PFGA 4F5ZA 2P35A 1R9JA 1TF7A 1QO0A 1BD3A 1E5DA 1GXSB 1QZTA 2VBFA 1OXVA 3ECSA 1GUFA 3J7TA 3EZ2A 4YI3A 1P75A 2ENWA 1ETUA 1T24A 1YGYA 2I1LA 5FFNA 3TYXA 4FEGA 2O57A 2QQ0A 5CM2Z 5CPFA 4H4DA 4IXDA 3TDKA 1EB8A 1IZZA 4JOQA 4H7KA 4HTFA 2RONA 4CU5A 4BDSA 4A6XA 3WZLA 3KHKA 1A7UA 3X0DA 4KX5A 2CBGA 2P9CA 2PKQO 1F51E 5DF1A 2Q0HA 1G6OA 1NAHA 2W11A 4J0FA 1GQYA 3DBOB 4V0MA 1RU3A 4L50A 3V1LA 1RE1A 3S1LA 4CDNA 1QV6A 3CSSA 4AYXA 1WUJS 3FOFC 5CCBA 5DM70 1AKQA 2NN3C 3N8IA 2XYHA 2VP0A 4KQJA 4H15A 2ZBEA 4NLLA 4C03A 4P08A 1BEEA 4I4IA 3RQIA 3TIFA 3DF9A 1ZO8A 4I4TB 1Y9DA 4YUZA 1R0BA 4QRIA 3G5TA 2RAPA 3SC3A 3ZQJA 4RFSB 4U8GA 5AESA 2P2NA 3GUCA 4EA8A 1GTMA 1D7AA 1AHIA 1T34A 2I03A 3IKLA 4KDEA 4KGDA 4OXIA 1A1VA 4FDMA 2FX3A 4WDRA 4RGQA 4BRZA 1W5SA 2QTBA 3ZG6A 4NQRA 3IOBA 1GGJA 1QR6A 4YT8A 2Y71A 3BHMA 4PG8A 2AOWA 3QIAA 2HGZA 1ZHFA 2DJ5A 2HCTA 2OYRA 3QPDA 5GJVC 4Q7MB 4G0YA 1X7GA 1I8TA 3GZ4A 2OO3A 2X4GA 5JDCC 4X63A 3N86A 2JJ2D 4MRSA 4UHCA 3PJRA 2P9JA 1CZHA 1EX9A 2BFFA 1ADFA 4R1QA 3VISA 2JK0A 4KQHA 7GPBA 2IS6A 1L4EA 2I1VB 3I6BA 1CJSA 3QQ5A 4UCXA 3W06A 4BGUA 5LIRA 3ZJTA 2FMXA 4DILA 3BHJA 1R00A 2HPVA 1IM5A 3F7MA 4QYWA 5JCJA 3IAM6 5K20A 3GB9A 2QX8A 3AM1A 3I6YA 5FPQA 1SU6A 3NU1A 5LXTB 2JFPA 3RROA 4L8VA 3LOPA 3CRRA 4K3UA 2I9KA 2ILVA 4MVJH 1N7HA 5HE8A 2F8LA 5LYJB 3I9MA 4HPWA 4N1AA 2JAPA 2C0QA 3EY4A 5DHUA 4UC0A 3RUIA 3K71B 1S8AA 4YCJA 3OM0A 5B6IA 5IAOA 3OKFA 1YS4A 1VPEA 1O58A 3W7BA 6CHYA 1AV7A 3M4XA 1WRBA 4OGFA 4Y2HA 3LPCA 5ICGA 5HTOA 4DA8A 4TTPA 4EG0A 4PX3A 3K0BA 1U6JA 3D02A 4CQMB 1ABBA 4P32A 4BIIA 5A1TA 1NXQA 1KYXA 4MUHA 3U19A 1R5JA 3IRVA 1EJ2A 4YJGB 4ZCQA 4ZKDA 5KOHA 3N59A 4KRGA 2D13A 1OREA 1JIKA 2JD0A 1SULA 5G0WA 3H5OA 5LP6B 3RIMA 4B3MB 4IGAA 4IS3A 4UW9A 4PV7A 5HMLA 1CV2A 1SUWA 1NTRA 5LC1A 2P2LA 3Q3IA 2P3SA 1H3NA 5HRCA 5KWJA 4KV7A 2HNBA 1IOLA 2OLJA 2V58A 1M1ZA 3E2IA 3I2JA 5EA2A 4E88A 4EUSA 4W99A 4CF5A 4PGFA 4Q3EA 1ZUNB 2M1ZA 2V7XA 2XKAA 5IC6A 1PJCA 4NE9A 4TVBA 1KMMA 1KI6A 2QKYA 3COPA 4Y1GA 2D7CA 1ZIOA 1N2JA 3K8YA 1RQRA 2BL4A 4IOMA 4M9CA 3G3EA 4AWXA 3T9DA 1TRKA 4D81A 2BF4A 2FPIA 4IDFA 4ZPJA 1G18A 2JANA 1QJ4A 5K8CA 4BXOB 4A10A 3LV8A 1SCAA 4CV1A 4DLTA 5L40A 2O8EA 1V5GA 2IWHA 2AEFA 3ACCA 2ZJAA 1E2NA 1JDBC 1K8YB 3CR7A 3L0SA 4F3YA 4S2UA 5JZ9A 4RE5A 1KE2A 3TDNA 4GDMA 4K9SA 4D9IA 1YOBA 2C94A 3BE6A 1VB3A 4YJ3B 1TU3A 2PD6A 4BVLA 4EFMA 2H4FA 2QN7A 1IJEA 1AXGA 4RCZA 3I9V6 1XQ6A 3SMQA 2BMEA 3D6FA 4EFLA 3IKTA 3ZU2A 1F1JA 1GUBA 3ESDA 3PPIA 4U3JA 1FFYA 1QH8B 4K7JA 3VPFA 4TXHA 3MJ4A 1K1EA 2OLEA 2PN1A 2Q3EA 2YMMA 3PDHA 2YWBA 5DLYA 3ZY3A 2HIMA 2DU8A 1NV8A 2V98A 2VSFA 5KKNB 2HU7A 2SCUA 1OFVA 5CIYA 1NUPA 1J49A 3S2YA 2IEAA 4G6ZA 4UTVA 3LHFA 2I6TA 2FZCA 4H17A 1KY5A 4R68A 3JAKB 1X70A 2G71A 3PVSA 5EXEA 1IBCA 3WKEA 2JLXA 2ZT7A 1G63A 1HBJA 4ZCRA 3COWA 3FWYA 3LGSA 4A2WA 1BS2A 2VPQA 3I8SA 4NHOA 4ZWNA 3WGIA 1UMDA 4IRMA 3W04A 1LPNA 3VYSB 1T5OA 4ZCIA 4CMKA 4YRLA 4EUNA 1QIGA 1JIUA 1R0LA 3QX9A 5K0CA 5TSDA 4X61A 4QU9A 5GOTA 4U9IS 1FDUA 2WF8A 3DZIA 4B46A 1CZRA 2F90A 2XTZA 4KIFA 3ZOZA 3AIKA 2DFVA 1IWPB 1FTNA 3ESYA 2BELA 3NJRA 1OV6A 3FZGA 4PGMA 4URUR 5DCLA 2WFZA 1HXHA 3R0IA 2HHCA 2JFXA 5EUQB 2RHGB 2WQ6A 4LHEA 1VL2A 1E1CA 2O0MA 3E27A 1JHPA 1UBUS 2YN0A 4DUYB 1VKJA 1AURA 3GLUA 3FPAA 3UJAA 4JYAB 5C32A 5F2KA 4ETMA 2DTEA 1U3WA 1OC4A 2R6CA 2V4UA 3OQHA 1KPIA 3ULKA 1H2RS 1G7TA 4RWEA 4IF4A 4DUGA 3QSYA 2PMWB 1FE8A 2VSOA 3G9UA 3DTTA 3DWIA 1QE0A 1Y8RB 2ROQA 2ATIA 2IPOA 3FB1A 5JQWA 2HJ9A 1G0NA 2R5NA 2FN8A 3TRKA 4XJSA 2W2LD 3H5NA 2IZOA 3HY6A 3FYTA 1JHZA 1Z13A 5LUAA 3IR5A 3NFRA 4HDSB 3B70A 4MUYA 4WDQA 2RD2A 2Y0EA 4L0CA 4PQRA 5JH7A 1M0SA 3WLFA 5HR5A 3V3TA 1MN6A 1JVBA 4WHMA 3DL2A 4AZSA 3I3OA 5BWLA 1I94B 1RJWA 1YZ3A 2ODPA 4D79A 2NAPA 1EE9A 2WWHA 2GBGA 4EABA 1HYHA 4IMPA 3AY3A 1FX0A 4FFNA 4WOKA 5CAEA 4D0RA 2XSZA 5BUQA 3TM5A 4RCVA 2Z9BA 9ATCA 3NKLA 2GJ9A 2XVAA 1D2EA 3MGGA 3BX1A 5JALA 1PQWA 3P0HA 3TUIC 4AG5A 3REFA 1PKXA 3W90A 5THXA 2HJHA 3QVSA 3G2PA 4OJTA 2XRMA 4RMHA 4U6SA 2NQ8A 3CF6R 2IYFA 1LV7A 1KJ8A 2GS9A 2W6IA 3VNSA 3G9XA 3N3AC 4Y9RA 4BQSA 5B36A 4ANFA 2XNJA 3F73A 3LTNC 1BCRA 2J6IA 4Q1DA 4REOA 3KKLA 2X9QA 3ONFA 4IMRA 1KKLA 3COYA 4G0XA 1C30A 5CFLA 4UCFA 3WL8A 2X0RA 3AIIA 3C5VA 5IJAA 2O3TA 2ANCA 4MWOA 1KRWA 3CX3A 1TUIA 1GARA 4FJ0A 4B71A 1EFPB 2YXNA 3R7LA 4F6RA 5BNFA 2J3HA 5TNXA 1DELA 3UV3A 1FSZA 4A15A 1NNEA 2HT1A 1QNFA 2Q50A 2PM8A 2X1VA 3DLHA 3BFPA 4FYPA 5KTTA 4GBMA 2FV8A 3NXKA 4NE7A 5HIIA 1T8UA 4LTNA 3F3SA 1XJQA 1ZH8A 5CA1B 2FPOA 2JBAA 3FOAA 1XMIA 1HF3A 2HY7A 4LZNA 1H2FA 2HRRA 5FHQA 4DCJA 2Q8NA 4ZOQI 4F91B 4AUEA 2Z8YA 1T2EA 4G9GA 4QUEA 3UXMA 3GZNA 3QLTA 5ALMA 3NTVA 1W4CA 3OG9A 3GLFE 3H9JA 2JJ1A 3MUNA 3STHA 1TJYA 3SZUA 1AUPA 4KXMA 4CLXA 4KRYA 1ST3A 4M3NA 2H7CA 2P6RA 1PGQA 4KHZA 4NPHA 3HCOA 3CTMA 1PSZA 4WZAB 4C6TB 5B64A 2JBWA 1KJQA 2QS9A 3KSBC 1SQGA 2GCIA 3ZDYB 3TD2A 3ZLBA 3UC9A 1LB1B 3GCWA 2E85A 2WM3A 4YAKA 2AMFA 2PZEA 1QWSA 5A3SA 4FDLA 4YRSA 4TZ6A 1AV6A 4G2TA 3QEMA 3RT7A 1XCBA 2FPGB 2HV9A 2HF7A 4OQNA 2VPXA 4WGGA 2BHSA 2XZTA 3V4OA 2DUMA 4ALKA 2Z3ZA 1N0VC 2XUIA 5D1NA 1PUIA 5TGDA 4H18A 5KMGA 4UMFA 1EVZA 3OZFA 3AWDA 3OY7A 2IEIA 2ETVA 5KOJA 2B9EA 5LN1A 4MYCA 3C4JA 3ZE6A 4N3CA 1ZD4A 2XMGA 3MCVA 1H0KA 1W73A 4J94A 4ZDIA 4PAQA 1VSTA 5DHTA 3VJMA 3DHYA 5G0UA 5IASA 2UVDA 5EVCA 1W36C 3RS8A 3WR5A 4XOUA 1J00A 3P9CA 4UFOA 5K4AA 3SNKA 2ACWA 2Q7DA 4INPA 2YHSA 4BS9A 3JSAA 5J47A 2X1HA 2AFIA 5EERA 1Z6PA 5AM5A 4U2FA 5FI1B 5KNDD 2NPOA 3QUCA 1I24A 3GBPA 3CUKA 4FEEA 4LFBB 4A9AA 1WV1A 3KQVA 1H4VB 3M49A 4AF8A 3AK4A 1BN7A 4MDYA 4R9NA 2ERXA 4MR8A 5IUNC 2CCKA 1DIHA 4JN6B 4MUAA 3I58A 4BNDB 5HHTA 2XITA 5J1SB 2GXUA 3CZ4A 3MJTA 1VIAA 4YFVA 1OJ7A 4B6GA 3PNPA 3I6MA 1MG5A 2WAXA 3MWEB 3O7MA 2DT5A 4ALIA 1FU7A 1H4TA 1D2GA 5AI0A 3SFZA 4B3FX 4BPRA 1UJ6A 3DTVD 1T2VA 1PTJA 1HOXA 2FFQA 1Z7YA 2RHRA 4QELA 4JDUA 1KK3A 4POOA 1EDDA 1FMLA 4Z9AA 3MB5A 2ZIUB 1OBHA 2QQGA 4NICA 2Z4TA 3ZWNA 1TF5A 1BGXT 2EGHA 1G8KA 1K68A 2PCJA 4MEJA 3P9XA 2AOVA 1TO1E 1WP9A 1DEHA 1E9CA 4EP1A 1GXSA 4E5MA 3THRA 3E7PA 3B85A 4HQ6A 5FXMA 2VATA 3LGAA 3VUFA 1I33A 5SY4A 4ENRA 5DM2A 1NJ8A 1PT9A 3R5SA 1P3DA 3MPUA 2Q9BA 4I8XA 3QLEA 2PSDA 3AKYA 1UT5A 4JY7A 4LNUB 3WBFA 5BVGA 5KTPA 3OA0A 4Z4QA 4A73A 3T3EA