4R81A

Nad(p)h:quinone oxidoreductase from methanothermobacter marburgensis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
199
Chain Sequence
b'ASMHVYILFAHPSRKSFSREVLEAFTEGLSEAGHTYEVGDLYRMNFRSELSQEEYLREISQEAGSPLPEDVMEEHERIGRADALAFIYPLWWSDCPAKLKGWFDRVWTYGYAYFGTRIDIEKAVVLCSAGHTEEDLEGTGIAESMRSVMLGDRLLGVGVKNVTMEILGGMVPGDDSCREINLMRARRAGRNLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH dehydrogenase
publication title A novel cytosolic NADH:quinone oxidoreductase from Methanothermobacter marburgensis.
pubmed doi rcsb
source organism Methanothermobacter marburgensis
molecule tags Oxidoreductase
total genus 75
structure length 199
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r81A00
4BMOB 1AKTA 1AG9A 1CZNA 4NULA 2Z98A 2XODA 3QFRA 2MOKA 3NHLA 1D04A 5B3LA 3GFRA 4C0WA 1AKRA 1RLJA 4D02A 1E5DA 3GAMA 2HPVA 3HLYA 5LBTA 4U7HA 5EMNA 4YQEA 2Q62A 1DXQA 3K20A 1OBVA 1YOBA 1RCFA 4CF6A 1AMOA 3F90A 3FVWA 4LTDA 4QOGA 3OJXA 1AKQA 3N3BC 4HS4A 3N3AC 1QR2A 2QR2A 2QX6A 1XI2A 5FUQA 4R81A 1WSWA 1H69A 4XDHA 4YAUA 1FLNA 4M0CA 1XYYA 1H66A 3ESXA 4HEQA 3OX2A 5F12A 1YCHA 4DILA 3FNIA 3UXEA 3NHRA 3U7IA 2MWMA 5LJLA 2BN4A 3W79A 4J8PA 3NHFA 4Y9RA 3FJOA 5EA2A 3HA2A 5LBUA 2OYSA 2FVXA 3TZBA 1D4AA 1T5BA 4PTZA 1CZRA 5NULA 4H6PA 3N39C 1RTTA 2M6SA 2QMZA 3QFCA 3HR4A 1CZLA 1FX1A 4Y9UA 3O73A 3OVMA 2QX8A 2BF4A 3B6JA 1J9GA 4FGKA 4YALA 2KQUA 2QX9A 4DY4A 3NHYA 5NLLA 4CETA 1FLAA 1CZKA 1YDGA 1NNI1 2V5VA 4Y7CA 3B6KA 1J9EA 2QMYA 3NFRA 3NHKA 2BZSA 4ZVMA 1SQSA 3W7AA 2QWXA 3NHWA 4GR9A 4N65A 2OHHA 4FGJA 3B6MA 1FVXA 3O2NA 2R96A 2Z9BA 3L9XA 3W78A 2MT9A 3KEGA 4ZVLA 5F51A 3TEMA 2V9CA 5F4BA 4LTNA 1F4PA 1CZHA 5LMCA 1B1CA 3S2YA 5BUCA 1WSBA 3F6RA 3D7NA 2FX2A 1J9ZA 2D5IA 4XDGA 1GG5A 4S24A 4QOHA 3OJWA 4QODA 3ESZA 1JA1A 4LTMA 3NLLA 3KAQA 3F6SA 4U7GA 3R6WA 3LT5A 3UXHA 5B3KA 2MTBA 3SVLA 4QOJA 1QBGA 1X77A 5FA6A 1I1OA 1SG0A 1BVYF 3EDOA 2X2PA 2BPOA 3P0RA 2A5LA 1CZOA 3ESYA 3QE2A 3GFSA 4ZVNA 4H2DA 1ZWKA 1FLVA 3B6IA 1DXOA 3OX3A 4U7FA 4N9QA 5FX2A 4N82A 3L9WA 4YAFA 1J8QA 1OBOA 1AKUA 3OX1A 4ZVKA 1YCGA 2FLVA 2HNBA 1C7EA 3JSXA 4F8YA 4QOFA 2B3DA 2FDXA 4DIKA 2QX4A 2Z9CA 3LCMA 1QRDA 4YAOA 1ZWLA 3OWHA 1FUEA 5A4KA 5JROA 3NHSA 4YAWA 3RPEA 3OWXA 4OXXA 5TGZA 2X2OA 2M6RA 4FX2A 2N1MA 2ARKA 4NLLA 2GSWA 1XT6A 1DX9A 2OHJA 1BU5A 2F1OA 1YKGA 2WC1A 3GFQA 1XYVA 1V4BA 4LAFA 1AKWA 4GI5A 1FTGA 1AHNA 2Z9DA 4QOEA 2R97A 2HNAA 2BMVA 2OHIA 2ZKIA 5EAIA 1QHEA 1TLLA 2FZVA 2KLBA 2FCRA 4ESEA 5LLDA 5ULLA 4BMPB 1D03A 2V5UA 2RG1A 1KBQA 1RLIA 1T0IA 4C0XA 2FAXA 1CZUA 4LA4A 4PTYA 1AKVA 3EYWA 2FZ5A 1TIKA 3KAPA 3F2VA 1OFVA 5LVAA 1ZX1A 4C76A 1AZLA 3KLBA 3FX2A 2W5UA 1FLDA 3W77A 4C14A 1C7FA 1JA0A 3NHJA 1VMEA 4FGLA 3K1YA 3ZHOA 2FOXA 3G5MA 3U7RA 4PU0A 3TE7A 3NHPA 3FW1A 4GQIA 1YCFA 2AMJA 5LJIA 3NHUA 4ICIA 2XOEA 4QOIA 6NULA 2Q9UA 3ES9A 1YRHA 1KBOA
chains in the Genus database with same CATH superfamily
4II2A 3WK4A 4IO1A 4BMOB 3I39X 4J94A 1B73A 2XTJA 5IJXA 2ODAA 5CCDA 1P7CA 4NULA 2F43A 1ORTA 1DCMA 3WYDA 4EG8A 1J70A 1RQ2A 1XTQA 1QC5A 1QHIA 1YR2A 2HK8A 5IAJA 2JC3A 4B9AA 1EJ6A 2WJWA 3MLAA 5IABA 1X7XB 1K7XB 4TRMA 1SHKA 2C9YA 3G2IA 2V6MA 1JALA 1Z62A 4HV4A 5KTRA 2ZAMA 4OQ4A 1F06A 1YZNA 1LTKA 3BD6A 2OCKA 3GFRA 3V55A 4B3DA 4BLTA 2ZAOA 4KR6A 2GAAA 2C7OA 4YAIA 4OUKX 3QUSA 2W2XA 1A77A 4ENRA 4XYGA 3PF9A 4WNCA 2W93A 3V3TA 4D9BA 1Z83A 1JG2A 5JSZB 4B2IA 5K8LA 3HJRA 3NQ41 3QQ5A 1GZ4A 1P2GA 1YMQA 2ZRBA 3DEYX 4RIIA 4Z7OB 3CVXA 5CTAA 1XVLA 2VJDA 5KWJA 5CCXA 2JAHA 1A8UA 2PUTA 1ZW6A 3EN0A 4RIFA 4WDRA 5AO9A 3ZGYA 1R0LA 1OV6A 1DAIA 5K3OA 4B4UA 2A9KA 2DERA 3HKBA 2DU8A 2XQGA 3IEIA 3K3PA 4IYRA 3IHWA 1PGNA 4ARIA 4FW9A 3KYJB 4OEHA 3CQ9A 2OHOA 4XZ3A 5AKLA 3PQ3A 1X9IA 3LA8A 3FWPA 3M89A 1ODIA 1Z3CA 5EUMA 5EIOA 3ONEA 4X66B 1CY2A 4LK3A 2OBMA 3FBGA 4QU5A 4HX5A 4G0MA 4MRNA 3STHA 3TL2A 2F67A 4TKVA 4R1MA 4PCLA 4I66A 3SEZA 3HWWA 1Z36A 3FFWA 2ADMA 1CJBA 2DUMA 3DR5A 3RNOA 5FLYA 1C7JA 3J7TA 2PKEA 4I4NA 3TAXA 3WDLA 3A9CA 3X0DA 4X93A 2E4XA 1CCWA 1COZA 1GYRA 2QX6A 3TEJA 3FYDA 2JGAA 3UTDA 1YQXA 1WTAA 1NW9B 4TMFA 4Z7NB 3NGMA 2CHUA 2WTNA 4EATA 4S04A 1TPZA 1YB5A 3ORYA 3KSDO 3UCFA 5BWCA 1H69A 3I6ZA 5KYGA 1RWVA 2GYYA 2OUKA 2BEVB 4G1MB 2H2DA 1FLNA 3P0FA 221PA 1J4AA 3NU1A 3C3DA 4N8EA 4YT8A 5BV7A 4RCVA 5IZ4A 1YCDA 1JPNA 1MKYA 1R64A 2C77A 3ECSA 4L02A 4OOEA 4IFIA 1IJEA 5KQMA 2VP2A 3B1ZA 4B6OA 5BQ5A 4OFZA 2HUNA 5FV4A 3EXFA 2D7DA 1B3BA 1CG6A 3OLQA 4BC0A 1P9WA 1PFQA 4DM7A 4Q21A 2VSOA 2OBXA 3C8DA 4JEMA 1U5CA 2B99A 2WIGA 5EVJA 4B8WA 4F2GA 2VYQA 2P8SA 1EBBA 3ADDA 4ZT6A 1R5BA 3M82A 1A9PA 2OFXA 4DL9A 4EYKA 4LZOA 1Z7EA 4PO3X 4OMUA 5F5LA 2GMWA 3QYAA 5LJLA 3C3YA 2CV0A 2Z3WA 4JJEA 5SZIA 4HNAB 4CLRA 4ZYTA 5IAKA 3AT1A 4DA6A 1TNDA 1K4MA 3BTOA 1GL9B 4CKBB 3IQDB 2EDAA 1TC1A 1Z0IA 1MQSA 5FO1A 5FWXB 3EQ2A 2PZLA 1PD1A 2FN3A 2EJTA 2FVXA 3E35A 3NV7A 2GPSA 2QI9C 3AI2A 3DUFA 3IBTA 3LWZA 1MABA 3BZBA 3Q9NA 1J0XO 2P40A 1GTJ1 1GWNA 1I2ZA 1PJQA 2DGDA 3S1AB 1OFUX 1XZKA 5DBHX 1OTXA 3OE1A 3LTNC 2GWRA 1DAKA 3OPNA 4RESA 3A31A 3WMRA 3WRYA 4DJFC 3B2NA 3DTTA 2TYSB 2YZ2A 1R4MB 3KCQA 3KE8A 3UJHA 1DG9A 1KI6A 2PYDA 3LBHA 3N2KB 5DLEA 1T25A 1WO8A 2R8ZA 2ROQA 4AWAA 4J1NA 1LPNA 3QYPA 3T8YA 1IJFA 4KQXA 4ZCRA 2GZ2A 2VF7A 1URPA 4JLPA 5LDDC 4NXNB 5JCXA 2B5OA 3AP2A 3OKAA 1V6AA 1UM8A 5D85A 2P67A 1R00A 4YQZA 3OM0A 1MF7A 1XQXA 3KL2A 1T13A 2AL7A 2L0XA 1Z0DA 3E3NA 4MYRA 2WWHA 4CQMA 4IQ8A 1E4VA 1PDVA 3L7AA 4CF7A 2OBNA 1IN5A 4KBGA 2J07A 3KKMA 5L3ZA 1QQTA 4HNQA 2JJ1A 2RK6A 1WS6A 5DPMA 3R7NA 2EGUA 4LOLA 3LP6A 3DEZA 4MROA 2FZCA 3CH5A 4XWWA 3SQLA 5P8WA 3B52X 3IEXA 2D5BA 2PS9A 3GVPA 5I8ZA 3VYUB 1H6DA 4E7PA 2RI0A 3WTCA 4ENWA 3G59A 2WG0A 1ONBA 2ILVA 3KFLA 3KR0A 4Q9KA 5IJ0A 1U0BB 3HUDA 5HM8A 3T7EA 3AOEC 1XEXB 1H05A 5HE9A 1XO1A 2ZVDA 4GGOA 4F72A 5AJVB 4IUCS 4L4XA 2DCUA 3E70C 4NCIA 5TGDA 1A3CA 1CS0B 2PBRA 3ABQB 3PEFA 3QI2A 1M8JA 4K2AA 4Q4HB 4HATA 1FUUA 4RYLA 3V00A 4EHLA 4ER5A 1PSDA 2IE0A 1N6RA 4EW2A 3CS3A 2GQ0A 2IOFA 3KR9A 1CE8A 4Z0HO 3S28A 3L06A 4LF6B 2J9YB 1PZGA 4GXTA 5MHTA 3PHHA 3MTJA 3N8KA 4NBKA 4OFBA 3B9RA 3BEOA 3ENNA 4C9BA 2GBFA 2EDCA 3L8CA 4X3OA 4JOCA 1GRNA 2GCIA 3R23A 1GFWA 3IQZA 4R2WA 4CLXA 1QVWA 1NMSA 5FPHA 1REQA 3U62A 3LBIA 1Q95A 2WKPA 2QLTA 3B5JA 3EVNA 3OMLA 1NN3A 4N18A 2QX7A 4CMKA 5CFQA 5KNLA 2W6PA 3D7MA 4JC4A 2ZZMA 1OROA 5BPFA 3HVIA 4KAFA 4EF4A 2R6JA 1NNLA 2VDJA 2ZRMA 5IJWA 5ELXA 2C4VA 3O47A 1NMYA 2Q8NA 4X61A 1I94B 4NMXB 4OBWA 1OBCA 2Z9BA 3CLTD 3UOGA 4AG5A 2NVUB 2WWFA 1XCJA 4Y2VA 4LWZA 4HDMA 4KDFA 1W44A 1TA4A 4II7A 3O8RA 1JYEA 2D6FA 1H1LB 2R6ZA 4N8DA 5ICMA 3NKFA 4KFSA 1ZNYA 2FR8C 2XUFA 1QIFA 2AYZA 2BTOA 1E8DA 2L2QA 2XIQA 3CH7A 3HB0A 1JFTA 2ZBVA 1RMTA 4U6NA 4YP0A 3RRMA 1VGQA 1BHJA 3R7WA 4QLOA 1A96A 4JBIA 4XX0A 1SIUA 4W1RA 5EWMB 1S8NA 4RY0A 5E1MA 5CDFE 5C1PA 2XR1A 5BUCA 3I5UA 4ZKEA 4JK3A 2ZSKA 1I3LA 4YP6A 1WZIA 3F7TA 5K45A 3HM9A 4XAQA 2BDTA 3K0CC 3L8YA 4RTLA 4CU5A 3NEPX 3OJOA 1K92A 2WQZA 3TDNA 1ND6A 4EHHA 2VVTA 1LSOA 3LI2A 1FE8A 3CNEA 4OI4A 2AN4A 4B3XA 9MHTA 4B6QA 4F4HA 3TQTA 4C4ZA 1T36B 3OJWA 4M53A 3KB8A 1OFIA 4CZ2A 1XQ6A 1LK7A 4IEEA 3UPDA 1JTFA 3GLTA 1KORA 2AN3A 1AN0A 1EVJA 1KFKB 1MU0A 3LO8A 4LDAA 4C4PA 1PGJA 3AGQA 1UKCA 2EARA 1O5IA 2C3MA 4BNLA 4QO8A 5FL7D 1KEKA 2M6LA 4R41A 2JHPA 4XGNA 3HJTA 1M8GA 1TVMA 1OXUA 2FUKA 4JA2A 1MMFB 1ZGHA 1EJBA 1Z5UA 1WB4A 3MGCA 3D7RA 1K8YB 2HLNA 1HBJA 4F45A 3G2KA 2B3TA 4IM7A 3VZQA 4CM8A 2YXDA 1SXJC 2PNJA 1YDWA 2GXSA 1EHYA 3P19A 3LG2A 4FQ8A 4V2UA 2BPOA 3WVNA 3EF0A 4YK7A 1KZ9A 1QLWA 1SH7A 1XZCA 2WWRA 3EZYA 4HF7A 5TPZA 1CZOA 4TTJA 1A72A 1JEOA 1W2GA 2O19A 1MGPA 3BT7A 2CB0A 4B8YA 2VJBA 1ZWKA 2ZCUA 3AEYA 4Q1VA 5A1TA 5JXIA 3FZYA 1NHWA 4TXLA 3SHTA 3U3DA 1PTKA 1CNEA 1YJQA 3HJBA 3OX3A 2QRUA 3ESBA 4UPEA 3QF7A 3QUBA 2RAVA 3RSGA 3DTYA 4IIJB 4LN1A 1KOGA 2PUWA 3A2LA 3L1HA 3N59A 3TLGA 4ZVKA 4G1EB 4BFTA 3UMSA 4K6MA 1VCHA 4J0GA 4KV7A 5CVJA 1VG8A 1GLVA 3MA0A 4COKA 2AQKA 3HB5X 5CB4B 1J0EA 4PNHA 2W8BB 2WSIA 4NV0A 4J6EA 1I7DA 1ETUA 3CCBA 1IWPB 5EZ6B 4YMUA 4MINA 3TFQA 4X20A 4AJOA 5T6BA 1YC2A 3KWLA 4BMDA 1TIPA 2C31A 2ZUUA 1QTRA 3M1YA 1WUIS 3R3UA 4N7BA 5B36A 4GGPA 1CJTC 1UANA 3AZQA 5HSGA 2OV2A 3PICA 4QFMA 3RE1A 2YQ5A 1SRRA 3R3XA 4MHOA 1ZL0A 1M7HA 1MEJA 2J1LA 3BF8A 3LDHA 2WV9A 3R6DA 2C4MA 1JQLB 3DZBA 4N5NA 3RUFA 2EF0A 3JQFC 3UMVA 2AOUB 2ALJA 4IG4A 3SG0A 3IB3A 3UMJA 4PIVA 3WAJA 4TZKA 2VDOB 2WM2A 2J08A 4GF5A 2RD2A 3F47A 4L5AA 2PT5A 3F7MA 2QVZX 4MYSA 4OHFA 1HNNA 3MNFA 4I1SA 4UNPA 5EP4A 3SNKA 4AP5A 4G0YA 4UOEA 4WN9A 5ALZA 1UBNA 1Y1QA 2VUTA 3ZW8A 2WWYA 4QTTB 3AB8A 3M6UA 4U1RA 3R3YA 2XRZA 1GN8A 5C1IA 4S0XA 3RKSA 1C8LA 4MQ5A 4R1SA 1Q14A 4E1BA 4P08A 2NG1A 4CUKA 4Z4HA 2AKYA 5KX5B 1F6BA 2PZFA 1FUKA 1ZH6A 3AHIA 3OCYA 5B6JA 3RC2A 5TMPA 1TYAE 4UEKA 3SGLA 3PUKA 3FPCA 5TC4A 5MN5A 3B89A 3LHIA 1YVDA 1VI5A 1ZOOA 5CDGA 1TQ2A 1B0PA 3OZEA 2FKNA 3OLWA 4OPMA 1IZ8A 4F5EA 1V4BA 1YBAA 4E2YA 3FUTA 1MO6A 1F2TB 1LFDB 5CT6A 4WGGA 2QR3A 2AOVA 4TLDA 4Z9FA 3GGCA 3VYWA 4NU6A 4P22A 2RJ3A 4V0ME 2ONZA 3NXSA 1O6GA 4ZO6A 4PC3A 3RFXA 1SULA 1YE8A 4GX1A 4KE9A 1LC3A 2YN0A 4XJTA 3STXA 3LPMA 2X3UA 4EHFA 3CPHA 3QNUA 3D7KA 1GQQA 3KVOA 1JFFA 4MW5A 2ZW9A 3WLOA 2IQIA 4X3PA 2FJUA 2Q3HA 4AP9A 1TAGA 1J20A 1KMHB 4ETNA 3PNKA 3R4CA 1HQDA 3JU3A 3O90A 3OZTA 1R6BX 1AUXA 4OHVA 4PNPA 1TOAA 2YICA 1HA3A 5JAQA 3G79A 3FMGA 3TQHA 3TLMA 4A6XA 3FOFC 2ZBGA 1ZQ9A 1G20A 3O9MA 2PUBA 4CI0B 1H1TA 4XB6B 2P9ZA 4QTYA 4OMCA 1SVOA 1WDMA 5LNK1 2Q7XA 4IVPA 2LD4A 1P5HA 2GO1A 3PDIB 2PX8A 3RSLA 2IY8A 3S70A 3FYUB 3QBEA 5C8VA 3CVJA 1OFVA 3EIHA 4PINA 3WB1A 5KQGA 1DEXA 1NU8A 3OQIA 3WIDA 3OEHA 4I8DA 2DWOA 4LCEA 5LVAA 3PGVA 3IEPA 3AUAA 1W7AA 1KJQA 1UJ2A 2O8BA 4DA8A 3NFYA 1YK0A 1ZBQA 1CUXA 4NPCA 2X5NA 5IWAB 2CV2A 4MYDA 3U81A 1EPUA 5AW5A 1TD9A 5JNWA 3HBNA 2I34A 3IVAA 5JAMA 1E63A 1CUDA 3JYNA 5IF3A 1V41E 4YV1A 1PJ4A 3GT7A 3QLEA 1TMYA 2X58A 4MWDA 3I9KA 4N01A 4BNVA 1F7UA 3GJQA 2VJPA 3O0DA 4F5YA 1TAHA 4OK5A 3G5MA 3UJBA 5ALXA 3NI2A 4Q6WA 4D46A 2J0UB 3CNNA 3R0JA 5MFZA 2UZ1B 1Q74A 1OOEA 1Z56C 2ZT8A 3X1MA 1N78A 3G2MA 5EUCA 4MVXA 2FPLA 4RTKA 1P18A 3KZNA 3DF7A 2RMKA 1EP2B 5LBIA 1KMQA 5H59A 4Z1MD 4E6EA 2BFOA 3C74A 3MWDA 5G4KB 2K5UA 4FDMA 5JS8A 3RUDA 7ADHA 3IR7A 2QZJA 2DSTA 3GRCA 2VO1A 4NR0A 1W0CA 4GPZA 2P35A 2Z2IA 4R8SA 4ZAYA 5K4GA 1QG0A 5JXWA 4MB0A 1ZOLA 3A4IA 3P2JA 4JMLA 5KSYA 3OU2A 4OJKA 2EZ9A 2J5BA 2WT8A 3LK6A 5B4UA 3IAEA 1DARA 1H2AS 4KO8A 2VHUA 1Z4KA 4FSXA 1V45E 4UBOA 2KBEA 3LSTA 2PVPA 2KE5A 1EFLA 3GU3A 1HKHA 3K1JA 5BPHA 5F2EA 3PL5A 1JXAA 5F5NA 3ORHA 2NZVG 3O92A 1NG1A 3TLYA 5B3LA 2W6JD 3ZV5A 3E9RA 1CP2A 3ZCPA 1FJGB 5DX1A 5FL3A 1V11A 3AERB 1S5PA 2CBGA 1BJKA 4FYHA 1MEOA 5M2QA 1TE2A 1XAIA 1PBTA 3I04M 2QG6A 1J21A 5EERA 4G2TA 1EUYA 4MQUA 2ENUA 1DAHA 3G6KA 5FULA 4LNAA 3WRXC 4OM8A 2O0MA 4TTVA 1QK5A 1H2YA 1KJ8A 3C6YA 1PTJC 3BXPA 3LPLA 4GVLA 4CEHA 2HPVA 3DMHA 3K4QA 1N2GA 1ECJA 1IZ9A 5M5BA 3T1HB 2AI1A 3T0GA 2ISCA 4PXYA 1OIWA 5FI3A 4IGEA 2E82A 2CVFA 2J3HA 2UZ4A 1OVGA 2CVQA 3IP8A 4LV5B 3QU2A 2F1HA 1SUPA 5E2IA 1BGVA 5IDYA 1T3ZA 2C5FA 2QD4A 4NYJR 3E1GA 5EMNA 4ZT2A 1GSOA 3A2KA 3B3FA 3QTBA 3DBOB 1SVUA 1KMNA 3Q1LA 3QVGB 3EW7A 4ZMRA 3SX4A 3OQVA 2YMPA 3AI3A 3L3BA 3R9KA 1CR0A 1I3KA 2QUKA 1NXQA 1PL6A 3HV2A 2E4VA 4TQ9A 1NQ5A 4UXIA 1LEHA 1F8YA 3EPLA 3SMVA 5JAUA 3RS2A 1Y9EA 2DSNA 1YQTA 3O5AA 5AT1A 4MWOA 2XKKA 3DAPA 1FFXA 3X1YA 1LF5A 1UBSB 2UYGA 1SEVA 3DHNA 2YV2A 3WICA 2Z5LA 4YACA 1USVA 1HY3A 4RAQA 4GO1A 4RMNA 2GPJA 1PG2A 4BVKA 1KMMA 1FFDA 1YJ8A 1VL8A 1OU0A 4DADA 1ISHA 5EJ4A 4TTSA 3K15A 5AOAA 3SOZA 3PNOA 4FYWA 1EDEA 2Z04A 4RDHA 4JXKA 4UNNA 5FUVA 4YCSA 4RV9A 1M2NA 3BYZA 3VNQA 4F9GA 2JCGA 4GP9A 4MUXA 4X1IA 1B2LA 4CTJA 4NSNA 4E5DA 2GXUA 5HF6A 4KWEA 3AB7A 2YMMA 1HYQA 3BCSA 2O7VA 2Q5OA 1XF9A 4UOZA 3WLRA 2IS4A 1N6NA 4MQEA 1GG9A 3JV7A 4BQIA 3WYBA 4AWBA 4N41A 1BVUA 2H2AA 1VBMA 2TMKA 3JRNA 4AZWA 1I5OA 1PV1A 3E3OA 3BL5A 4I81A 4D79A 4UMEA 4PZDA 4QDUA 4JROA 4KDRA 4HAZA 3ESXA 2XUIA 2YRFA 5M3BA 3RVRA 2GCOA 2ZJ8A 3VU8A 5BN1A 5LD2C 2RGGA 4K6HA 3HCNA 4MVJM 1L4FA 1G8FA 1A4UA 1IEXA 3H2KA 3OTWA 1VMKA 4PRYA 4U02A 1O94A 1AM4D 2F9MA 2G8NA 1K9SA 4UBNA 4LGVA 4NBWA 3TR6A 3VPBA 4B6PA 2YQ4A 2DQKA 4EAQA 4HUJA 4HDSA 3F4KA 1HDCA 5A3VA 2YHIA 4MV4A 5KVSA 3R9WA 2D1TA 4G4SO 4HI0E 4LVUA 2APJA 1FDOA 3EVCA 3IAS6 2DHEA 3TAUA 5LPNA 4LXYA 1TYDE 2V7VA 5FOQA 3UH1A 3D6AA 3FPBA 4FLEA 4OAOA 4I6EA 4L5JA 1AK1A 5EI5A 4N8SA 5CNIA 1YVRA 4XSVA 3AKZA 3NHFA 4MRPA 3TLZA 5I7RA 2HLDD 3VR4A 2DULA 3OA0A 1X19A 1OLUB 1M6YA 2QI9F 4CPDA 2CJWB 2WMDA 2FZLA 1KH3A 3FSJX 3HA2A 4Z4GA 3WNDA 1U7ZA 2VYNA 3Q6NA 3VH4A 1ODFA 2PYZA 2H1RA 3U37A 2XD9A 4PZAA 4MS4A 3FCEA 1DB3A 3HKEA 1U98A 1U3UA 4LC0A 3GPCA 3K4HA 3N9IA 1JJVA 4M1ZA 5GY7A 4YRKA 1OASA 3FRIA 4WADA 2P6MA 2SCUA 4Y2RA 4A1FA 3OOSA 1EX7A 2WFMA 3GAFA 4WXMA 2JBAA 4LSWA 4LYGA 3ZIUA 4OLHA 3M6VA 3D6NB 3WL7A 3H1GA 3WHLA 3HR4A 4EQ6B 1KTIA 1O1YA 3ONFA 5H1YA 3MUFA 3UN1A 3HSKA 4DA7A 1CRLA 1ZA2A 3WA7A 5IS2A 1PNOA 4R9VA 3UT5A 3PQDA 2M32A 3C4QA 3FCSB 4HPJB 4Y9UA 2PRYA 3L2OB 1SBZA 2G5PA 1E3QA 3N7TA 4LC1A 1M54A 4PVDA 3SLKA 3F9IA 1BXRA 1UDCA 2V4MA 1L7OA 1AUPA 2OV4A 2WHYA 3CN7A 3E7PA 3G2HA 3PGA1 4YQFA 4ZO9A 2QX8A 3V1UA 1OFHA 3BMXA 3LCUA 4MQFA 3BMNA 4HQOA 3I2HA 4ACBA 4EMUA 2OY0A 2C2WA 3U1BA 1LBHA 1FSPA 3IUYA 2GERA 3H83A 1KO1A 4K28A 4DPMA 3THYB 3KOYA 4WK0B 4YMTA 4PLZA 5CD1A 1MDFA 3QIVA 4IIDA 4RD3A 1YDGA 1K3FA 3TPZA 2B30A 1CIPA 3UUFA 4INJA 5AW1A 1VL6A 2C2OA 1O5OA 3A9WA 3BL8A 1ZJ4A 3HUTA 3F1KA 4L9AA 3V7UA 2A0WA 5HQTA 2JLWA 4AAYA 5TQ0B 2EYUA 3W6ZA 2HWWA 1E1QA 3E7XA 4MR7B 3FMIA 3L4SO 3VYVA 3N07A 4C08A 3VC1A 3WJAA 3RWOA 4P38A 4UPVA 4IDGA 1GITA 1E9VA 2EJBA 2WPNA 1EDOA 5SYMA 4KEAA 3TW6A 1H6BA 2HAEA 1PCXA 2QSYA 4BZXA 4LDPA 1FFEA 1ZNZA 3PR3A 2QSJA 3TOVA 2BFWA 2ZSIA 4JR1A 1SQSA 3OPMA 4IIEA 4G6ZA 2ZJ3A 4XFKA 4D74A 3GLGE 1SXGA 4GEKA 4RGQA 1U8YA 2B83A 2ZUBA 4JVMA 2C3UA 2JG3A 4L5IA 4MS3A 1T0HB 2A1UB 3ZDFA 2IEDA 4TLCA 5AVKA 4I1PA 2CXSA 1NFFA 5D1HA 2RB5A 1I3OA 1JG1A 1FVXA 2YJTD 3KUUA 3ND9A 3QEOA 3ELYA 1YZVA 4HQLA 1KETA 4LBYA 1UEJA 5G0WA 3ZOKA 4PTLA 5JMWA 5ISMA 3TTYA 5BSHA 2FGJA 1DRKA 1QB7A 1KAHA 3GLUA 1ONSA 2MSCB 1XZPA 4ZVLA 2AMFA 3ZWCA 5BVHA 1NBHA 5JS6A 4MK4A 3LBYA 3C6MA 3D02A 3V9PA 4R54A 2YXNA 4ZHQA 4RFVA 1ZHOA 3EEFA 5AOBA 3PQ6A 5AICA 3ZKAA 2BFDA 2G83A 3W1WA 4P7FA 1IHPA 4B2PA 2BE9A 4FXOA 5K03A 1U63A 1N0WA 1BE6A 1G3RA 1DE0A 4LYFA 2VSXA 5IN5A 3UMRA 3AVUA 1GTRA 5EZYF 1JQ5A 2R4UA 4J0IA 1YC5A 3T1YB 3IQIX 1WSBA 1HDIA 3CLSC 4BO0A 1ZZEA 4PG8A 4LJSA 2EERA 3CKMA 2Q99A 4OYLA 1JZTA 4LJ9A 5HX7A 4QQKA 1RXWA 5I7EA 1J9ZA 3MCAA 4P98A 1U2RA 3H6HA 4FK8A 1NAHA 2UKDA 1W36C 1XK7A 5DB4A 1NYRA 2HU2A 2YY5A 3CLSD 4BHTA 1ND5A 3RASA 1F6DA 3N75A 3RBVA 3W6PA 4B4VA 1E9AA 3HNOA 5EYPB 2W6OA 2VG8A 4Z99A 3RAPR 5TY0A 3IMCA 4AN1A 2OD9A 2RGEA 3GLIB 1Y5RA 3LHKA 1JA1A 2X2EA 4EAAA 1WBJB 3W6OA 2HIHA 2V7WA 5ALUA 4YDQA 4DMKA 3N5KA 5DX8A 5JC8A 6YASA 2RIPA 3RS0A 2NAFA 4L3VA 5IYZF 3AL3A 1EE9A 3X1WA 1DBWA 1HOXA 1ES9A 1W73A 4L6CA 2J45A 3QUQA 3IAM1 1QH1B 4R2MA 2AE1A 2XQJA 3LQFA 5H70A 2CB9A 2TMYA 3E22A 3IHTA 4I3FA 2JLXA 1ZUNA 1Y6QA 3KPYA 4L8WB 1OZFA 3FDIA 4IJVA 5E9WA 1P7YA 4CUJA 2XEXA 5IT5A 3LUGA 4O4JF 3GK3A 5GONF 1YZFA 4ZT5A 1G6KA 3TINA 1XRSB 3EVFA 3H16A 4HFJA 4F11A 4UW9A 4BGEA 3L8ZA 3P0RA 1A9XB 2NXNA 5ALSA 1E1LA 1LS6A 3O8NA 3AY7A 4BVBA 2GRUA 3E4CA 4J90A 3QE2A 4NNOA 5H3CA 2CXOA 3LU1A 4AMVA 1XNJA 1TCVA 1NE2A 4HSGA 4URXR 5ELLA 2XZTA 4M8NE 3LVQE 1NJ8A 4A0QA 4BO8A 3FVTA 1WBBA 1J33A 1RFLA 3MHPA 5AW2A 1JFSA 1JMYA 2OR3A 3GRVA 4KK4A 4E5YA 1FZQA 4Q00A 1QMPA 3P9CA 2V7XA 3LC0A 2GBLC 2C4NA 4Y2JA 4BDSA 3ENWA 4DMHA 2ZWPA 1YIDA 4OHZA 4LBVA 4ZQIA 1NVFA 3BE4A 3JSXA 3IULA 1IQ0A 4F8YA 1E5TA 1DQZA 3CRW1 3WQSB 3UKOA 4FGWA 3SAJA 2H1FA 3LCMA 4N3CA 4GOKA 3EC1A 2GTHA 4KOAA 4M98A 3VC2A 4OIFA 3TL3A 3AMVA 2R6DA 3B3AA 2P2CA 3E61A 4Q9JA 4BXOB 3ITKA 3QVVA 1L7AA 4PFJA 3BMQB 2IP4A 4MRVA 1QDUA 2E37A 4PCAA 2PL3A 3H8VA 1WHTB 2AQIA 2IPLA 4KC0A 1IOVA 4WV3A 1G21E 5K0BA 4IDNA 1SO8A 2RH9B 4XVCA 3V8VA 4L95C 5I5GA 1LLQA 2ZIUB 3S2GA 5M04A 4K6KA 5J2TA 3K0FA 4NCJA 3V97A 3T5CA 4DJAA 3BRSA 3BHIA 3K9BA 2MCFA 5DNYB 3HSSA 2QT9A 3LLMA 3EXHC 3R1IA 1TJ3A 4XLZA 1DEHA 4NAHA 4I4LA 1R0ZA 4FFBA 1IXYA 3AFIA 1JAYA 4TMVA 1QCZA 1M8KA 3A0RB 4ZAXA 1E7QA 2YMLA 3B13B 4KYVA 3WL4A 5HRUA 3U44B 1OYYA 3AIOA 5FNVB 3E3MA 4JBHA 1K7SN 3DA8A 4EG1A 2P1DA 3R6LA 3FTDA 4TL9A 2GILA 5EQFA 3IEVA 3TWOA 4RSGA 1QWSA 1GUAA 1VZ2A 4XSGA 4DUGA 1AZSC 4KODA 4BUZA 2IHJA 5F7OA 2CKMA 2O8EA 1WR8A 1G2IA 3OG9A 4AJKA 3DJYA 3HKCA 4F2DA 2H00A 1ODSA 1X1DA 2N47A 1Z9BA 2ZYVX 2IZ0A 5D8DA 4OQPA 3DWIA 1ISPA 1PS9A 1T4BA 3JQEA 1H4QA 4WWHA 4YCMA 3CRQA 3HN6A 5FHQA 4W4TA 2X14A 3ZJ4A 2NP6A 1YQGA 4ECAA 3HEBA 4P4GA 2QG4A 3K0BA 4I6GA 4M9CA 2R97A 1NC3A 2XKAA 4F8EA 3G8YA 1QCDA 4E5SA 1E7MA 1GDDA 2ZKIA 10MHA 4BNXA 4MTCA 4DARA 4F6CA 2WAAA 5DGDA 1XVIA 4D99A 2VZ9A 4EHNA 3N6VA 4JQSA 3QX9A 3RK4A 1CHNA 4KI7A 3KTFA 1OAKA 1XEFA 4Q3CA 1GGVA 2HWXA 4TKLA 4BMPB 5LQDA 1N33B 2WSBA 2JJ2A 4AF6A 3IDAA 2PL9A 2IOHA 5KTPA 4IEIA 1EZ1A 3SEQA 4KIJA 3ENQA 3UH0A 3GI1A 1K7FB 2BISA 2IL1A 3EWIA 4HH1A 3VVMA 3RS5A 1RXVA 4KQHA 3ISJA 1XL1A 1ZK0A 3UJNA 2HR1A 4NIMA 4D3DA 2HDNB 3CC8A 3IT3A 2FAXA 1ZIXA 1Z45A 3D3NA 2QN3A 4LX8A 4RMGA 3UEOA 3NH6A 4HPWA 2CXRA 2Z43A 4O1IA 3SX2A 4Z4EA 3B82A 3LOQA 5L4LA 1L5OA 3WX0A 2FPUA 4D8UA 2AFHE 2BEUA 5JNRA 1M67A 2HSWA 1NJFA 3EXAA 4F1KA 4GM1A 2X2FA 4HDRB 3UXMA 3BSYA 3C98A 2E3JA 1NLZA 3FHJA 3IUJA 4HG2A 3SS7X 1H4VB 4EK9A 1I4LD 1FJHA 1NLYA 3KXIA 3MJSA 1JN0A 3K05A 5KOHB 2Y9PB 4HEA1 3T54A 1Y37A 1KJYA 4WKPA 4NOKA 3ZE9A 5HZMA 3BFJA 1Z4MA 2BONA 3JYHA 5A6SB 3T7CA 4ZOLA 2BYTA 2CV1A 2QTCA 1RPJA 5EHXA 2FN7A 2H5EA 4HQ6A 4KXNA 1KQGA 1EVKA 2GBGA 3EULA 3W1VA 3ZDCA 1PWYE 3H11B 4MUJA 1SEPA 1C8KA 2FOXA 2CXHA 3H2YA 2RIRA 4NFYA 1L5NA 5CEEA 3DVAB 1H2FA 1QHHA 2RKWA 4PU0A 5CJJA 4QUAA 2R25B 3D3WB 3Q88A 3T7TA 5TNXA 5A0FA 5G1PA 4Y6RA 1QX3A 1SCBA 1LSJA 5AK6A 4BIIA 5AKIA 3W6UA 2LPMA 1Q12A 2AHRA 2FRXA 3JW8A 1YFLA 1WPGA 2RBGA 3PWKA 1J2TA 1E98A 2GN8A 1PIWA 5LL6P 3CEJA 1H0RA 1Z0ZA 2Q0SA 3CR3C 3GJ4A 2VDVE 2H11A 2ATIA 4L2IB 4LRWA 4C7VA 2O5EA 5HRCA 1C30A 2PCLA 1QZTA 2QQEA 3DMTA 2R6GA 3P9XA 3UHJA 5ALTA 4D4MA 3KS9A 3QTLA 1GQOA 1G63A 1U90A 2PQMA 5HZHA 2VTEA 2IOYA 4EDFA 1FFGA 5JD4A 4JSRA 2JJ1D 4B35A 1I3NA 1ZRMA 2GPWA 3BHNA 3DNFA 3BFKA 1PFUA 1PT5A 3RVMA 2EV9A 4PAQA 4ZZ1A 2R8YA 1DP4A 4CLOB 4X92A 3GCZA 2K7FA 2XTNA 4COOA 1T1IA 4XIYA 1ZMRA 1Z2DA 4YRJA 2OHGA 4YRZA 1EP1B 3RUAA 5JE8A 4FUTA 1P91A 1T8PA 4N03A 3D5EA 1RRVA 3E3AA 2WAOA 4HH0A 1OW3B 2I6GA 4JB8A 1L4HA 1XGKA 2QDKA 2QROA 5KJ1A 1EQUA 2J09A 1Q0UA 3PPYA 1V5IA 4J2OA 3DV0B 3UMCA 5K3FA 3FMVA 4MVJH 1M34E 1ZC3A 4JVNA 3IFSA 3OZ7A 2F3SA 1K3TA 2O2EA 4ZYWA 2JVIA 2YYYA 5JFGA 4GSLA 1BROA 5CURA 4AJ9A 1UR5A 5ARBA 2WK1A 1YJBA 4MPPA 4E30A 2WTAA 1LNZA 2DTEA 1SWVA 1B42A 1DLJA 1QYCA 2C4TA 2NSDA 3CKLA 2ZIWB 2OORC 3KKEA 4PY2A 2IQ5A 4I46A 4GYWA 2P4SA 1NBIA 4HTFA 3G2QA 4WVFA 5FR2A 1K8ZB 1SN7A 1XZIA 4M54A 4QLAA 1U2GA 4JMPA 5AW9A 1OH7A 4E3WA 4M1EA 1UDBA 1DTSA 2YVLA 4XGKA 4U0KA 1E9SA 3T3OA 3AUSA 5L9AA 5D5PA 4ARAA 3RVOA 4OMDA 3EB9A 3ZWOA 4B75A 3RT7A 1I4WA 2HYDA 3SCZA 4LYDA 4P4NA 1YZKA 4RE6A 3CWQA 5IMBA 2PSDA 1Z5VA 2CHFA 5AJYA 3A1VA 2PKQP 3GDFA 4RA9A 1T8RA 4XJVA 3U3KA 2IP2A 4UCFA 4OJYA 1AV6A 1RJWA 1V26A 4JJGA 2Q4TA 5EKSA 1I13A 1NBWB 4HS4A 1YXMA 1XFAA 3N3AC 2Q9AA 5CB4F 4JOBA 5C8ZA 3PXCX 3NTUA 1N0UA 1YB1A 5DYNA 1OC2A 4GQBA 3G02A 3MMXA 3SLGA 1Z38A 1D2AA 2ZTLA 3KC2A 4MVJI 3ZKWA 1NXXA 3VUEA 4X8OA 4R2IA 1VHWA 1TQ6A 2O57A 5KYVA 4DG5A 4LPSA 1BJRE 4YAUA 3NP9A 3TTSA 1K1EA 3DOHA 3K09C 4D97A 3M9WA 4F4IA 5JH7F 1A4IA 5AJZA 3T3EA 2VJMA 1EFHA 4FMBB 4RM2A 2DB3A 1NUPA 2AYYA 3L8DA 1WB5A 4MI9A 4Q93A 3O8BA 4NS1A 2H51A 2ID4A 2O1WA 2BL4A 2YIMA 1C29B 4ML3A 4WK2B 3AW9A 1GVNB 2HBRA 4HGNA 2QJWA 3BRCA 4LRSB 5DHFA 4M0LA 1E20A 4YJGB 1U0RA 4I14A 4RD0A 4DJJA 4AS1A 2D1SA 2PQ0A 3ZH2A 4KNWA 5KYXA 3UAWA 3DE1X 5JNUA 5ALNA 5IVHA 4XTRA 5DJ5A 2I4LA 3IJEB 2AB0A 2R87A 3TZHA 3K0HA 1TKCA 2W2PA 4KVZA 4AMUA 2VQFB 5JAPA 2YVAA 2CUNA 3PHGA 3QYJA 4OG2A 4IHJA 4Q3EA 2ZBQA 4Y9RA 1R6VA 5F23A 2XEDA 3FJOA 4JD5A 2QTNA 2VN8A 3SJ7A 1NT4A 2ECPA 4PXAA 1JQAA 4V0LA 2VHXA 3D4NA 1NE7A 4CG1A 5LBUA 2GB4A 1FVOA 1YOVB 1KVTA 4I2NA 4XGIA 3V7NA 5TPZD 5BORA 4TKMA 4O29A 3GN2A 1PE0A 4LSZA 1E0KA 1GUFA 1XHEA 1RD4A 1FDTA 1X7HA 2RHRA 4WBSA 4ZJUA 5JJBA 1GAJA 3G2OA 4DHEA 3BMOB 2ZG6A 3IPYA 3RU7A 1DHTA 1HEIA 3LP5A 2CFSA 4DCOA 2XRFA 5HQJA 3JQRA 3T1TA 3JYOA 1L7PA 2M6SA 1ZQ1A 2R1VB 3II6X 1HLPA 2B4QA 1SBTA 3VR2D 2UUCB 2B78A 1MJ5A 2GZ1A 5I4KA 4F92B 2IHYA 3CF6R 1USKA 16PKA 1FFAA 1MT0A 2BFCB 3GCDA 4QXAA 2Y8EA 4V0QA 1VHTA 5U1PA 4D7AA 1C9KA 4B7ZA 1L7EA 1W5BA 4AM8A 4B8ZA 2FJPA 3AKCA 5KYYB 3VSAA 5KOYA 1X8XA 3J81A 5F98A 4JFAA 3E2IA 1J8FA 3MWJA 4AJEA 4ARBA 2G8LA 1FRVA 3IOMA 2ZDGA 2BC9A 2W2OA 3B5EA 1EG7A 2BIFA 4KP7A 4A6DA 3SICE 1S8AA 3B6JA 5DK4A 2PO5A 4P7KA 2VK4A 5JISA 3GJZA 4I1IA 1RT9A 4KJXA 5I6DA 1RFGE 4ZGWA 5CA1B 4EEZA 5AHRA 4ZVQA 2UVQA 4TV9B 3TB6A 3VC3A 3ER8A 4W1PA 1KU6A 2XV1A 1U3GA 1G8KA 3DHYA 4EKYA 1KAGA 5I5EA 1PQWA 3UJAA 4UBKA 4QRDA 3AF6A 1WU7A 2F59A 2HCBA 4AX4A 4G25A 1BU8A 2EW8A 1B8VA 2AN9A 3FYHA 4IQGA 4TX1A 2ZJ6A 2YWBA 1W93A 4Q37A 1NW4A 3WKBA 2B0CA 4NJEA 1SCUA 2RAPA 4TWJA 3ROFA 2BZSA 2WD8A 3SIXA 4F46A 5FTJA 5TQJA 1H2HA 4NHEA 1M2VB 1RBQA 1XTBA 4QQRA 4CMAA 5BMVA 3C2QA 2NZWA 1L7QA 2E5WA 2B4YA 1NJGA 2EFYA 4PS1A 1H2WA 3CRVA 2FN4A 2XMDA 3AHDA 3OA2A 3SZUA 4BFLA 4F04A 2RHMA 2CEKA 1FDVA 4CMHA 1I6KA 4LY0A 1K8XB 1VQ1A 2A4MA 2V98A 5B37A 5CFOA 1X80B 2QWXA 2QYOA 1WEKA 2MR5A 3LRXA 1I32A 2A33A 1EB9A 4RLHA 1OYOA 4U2BA 1JLHA 1N3BA 3QEMB 4ZVVA 9GPBA 3FLBA 3TZLA 1FX0A 5KKCA 3V7WA 1UBGA 1GRCA 1UZUA 2EXXA 4LNUA 3BFPA 2X1MA 2I66A 4DGQA 2AMVA 2VNHA 1MO2A 1ZXXA 3LX4A 3MTDA 4NOMA 2XSZD 1DO2A 3DQQA 3FF4A 4I8IA 3WGLA 5M7EA 2YV4A 4L73A 4I1OA 2IIVA 3HJCA 2C59A 4UE3S 1NTOA 1QGED 4WPGA 3LT2A 2ZETA 1NVEA 5LYJB 2YNMC 4RH0A 2CNLA 2G1KA 4A3SA 4YT5A 3D4OA 5GM2A 1RKXA 1KYVA 2W00A 3BULA 3LC2O 3ZXYA 4ER0A 3BTVA 2YNMD 1BMTA 1QOPB 4QU0A 3JAKA 3BWXA 3FB4A 3RBAA 1W48A 2ISQA 5CEJA 2RSLA 5DNUA 1E59A 4P7GA 5E3HA 3PDCA 1XNGA 1EG2A 2MMCA 4BV3A 1OIXA 4OYHA 2R6FA 3FWNA 2H1CA 3ZU5A 1PEKE 2IUFA 5DT9A 1GG5A 3LM8A 2AX4A 1HYGA 2O2SA 3GCGA 3PUHA 1XXHA 3ELWA 3EG9A 4FZJA 3KR1A 1DOAA 4HLNA 4O4IF 1BDBA 5EMHA 2OO7A 1XDZA 4QODA 3OEHD 2HF8A 4QGGA 3RHFA 3RYFB 1K9VF 2DECA 4RL6A 4ZU3A 5JZVA 1IXZA 2F9FA 2R6HA 2XVYA 4MMXB 1Q21A 3SJCA 1US8B 1Z0UA 3B53X 1Q16A 3DCIA 3KBBA 3U26A 1WKBA 4JA0A 4K81B 1XTZA 3VR6A 1F60A 1CUBA 4LOJA 2O7SA 3L0CA 1FNBA 1MH1A 4OHPA 1KY3A 3MUOA 5PGMA 7ABPA 5KINB 2G6BA 3JR7A 3M7IA 1B23P 4AFNA 3QBJA 1RAEA 4WZZA 4TYNA 4JLBA 1DKNA 4GDMA 2GYWA 3CB2A 1T0JB 1T3LA 3F4BA 3N8IA 4GPD1 3TK1A 5KTNA 1SC1A 3ECAA 4OL0A 1EBUA 4OKNA 2DWQA 1YQDA 2JLSA 3LKVA 3UWPA 3VJKA 1XVVA 5E9JA 1KDPA 3SDBA 4RLSA 1Y7TA 4DSZA 2QNRA 3L7NA 1YZUA 1HSZA 1ZUIA 3N2LA 3P7MA 2MINA 4M9RA 2B4RO 4RZQA 1U2QA 5KYUA 1CY1A 1KYQA 4UFOA 3VU0A 3WADA 3KSMA 5EZQA 4CT4B 2KS6A 2PO7A 1G8JA 1H85A 1Y5LA 3LPAA 4RPCA 5KWIA 4WCDA 3ZLTA 1Q3KA 3B6IA 3E05A 2DUJA 4YRPA 4ECEA 1P7PA 2JKZA 2Q3EA 4FW8A 3LC1O 1BQ4A 3LH5A 4YBZA 3VXKA 1Z6XA 3HCPA 4P82A 2FZWA 1YR7A 3EZGA 2HU8A 4G8BA 5LXTA 2O7NA 3JQ8A 2I4NA 2HQ1A 1YDFA 3C8HA 4RHFA 4YRRA 3V8QA 3A3KA 1EFVB 5AKKA 2WUFA 1XAHA 5JJIA 2FSUA 2NZ8A 1WOYA 5LMZA 1GNLA 1Y8CA 3KOWA 1ESDA 1JVSA 3K70D 3VDRA 2QAIA 2OL4A 1T8TA 1M1NB 3NIWA 1QP0A 4FINA 1Y3CE 5F2KA 2H18A 4F93B 1T9KA 4IDPA 1V5WA 2QVGA 2XI4A 3L0OA 4MAMA 4JI0B 1L3CA 3A7DA 3C3XA 3Q7EA 4K6CA 3OM9A 3C1AA 3L4BA 4KH0A 2BHSA 3CUKA 3G8BA 5E1OA 1P9LA 5IM4A 4EVRA 4IX1A 4P3PA 4BFXA 4GOOD 3W4IA 3EOBI 3ME5A 3LT4A 2HJHA 4HYTA 3CH6A 2H4JA 5JQGF 1SRQA 2A5JA 3L8GA 5P21A 1KGSA 4YJFA 4OXXA 3WAKA 2ZPUA 4EDHA 1JIQA 1Q92A 2YJ3A 1Q17A 1I14A 4UHDA 3S8YA 1JDBC 4JB2A 4U9UA 4YJ3A 1T4GA 1P3JA 1TJYA 3GXOA 3QP9A 2TRSB 2XUJA 1HM5A 2ZYHA 4FT2A 1V1JA 4A2WA 4ZI7B 1EUQA 5KPDA 5F35A 4FFRA 4IS3A 1FFBA 3Q8KA 4EYSA 1TT7A 1KP2A 4HWRA 5CW2A 2GSWA 4PW0A 2V7QA 4DIOA 4RY8A 4F96A 2JDIA 3BB3A 2O1XA 4UUMA 4Y2XA 3BWVA 3VJLA 2Z8YM 3C3CA 3I5MA 4NZ9A 1PUXA 2BGGA 2W2KB 2FPIB 2WV7A 2FWJA 3DOOA 1V7ZA 4JQZA 3LNCA 3PGKA 4ND8A 4FHZA 3TOXA 4BP8A 2WG2A 4UTOA 2G1AA 1SQ5A 2HA3A 3M2TA 4KR9A 3EIFA 5H9WA 3OM1A 1CJUC 3N1UA 1WCWA 2A9VA 1U28C 2BTQB 2GYUA 4RVGA 2P9YA 3AHHA 2WQ7A 4QXRA 2IIQA 1SKYE 1L5GB 2NU6B 4GRIA 2NO4A 3P9KA 1NRXA 4N5IX 1I2CA 4H4CA 1DAPA 2XRYA 1G3MA 3JVEA 4ROTA 1Y98A 2ATEA 3SBOA 1LX6A 2IYTA 3VHRA 4FLMA 1I4TD 2IPXA 5ECGC 2XAUA 2MU1A 3QRWA 1G5PA 1N6HA 5AKZA 4BQSA 1ATIA 1Q1AA 1T6YA 3FGOA 5A0TA 4V3BA 5BYAA 2VPYA 1AQ6A 4RUKA 2B5WA 2FCRA 4QC2A 3RAGA 4UU7A 4BX3A 3LK7A 4PPFA 4DG9A 3KB6A 4GWLA 4CM9A 2PZAA 4BMSA 4WNAA 1WQ4A 2ZYAA 3RC7A 2B8EA 2ZJZA 4AMGA 4EOGA 2HB6A 4G23A 4HVAA 4DRZA 1S89A 3N2EA 2BR4A 3TRIA 3RJ9A 1GXSB 1W5SA 3RAFC 3HVKA 3MWGA 1O94D 2KWIA 1UQTA 4FYVA 3DE2X 3LE8A 4GZMA 4PLFA 1XELA 4DABA 4BX8A 1Y9ZA 1AKVA 2VAPA 3UG6A 4FZ5A 1XCPA 2UZ0A 3UPUA 5BQXA 2GUWA 1L7BA 5IVDA 1VKJA 3T7AA 5BN3B 1V39A 5ALYA 3WGKA 3IPAA 2ODQA 4QPNA 1D3AA 4CEIB 1W1WA 3B48A 4HNGA 5TT0A 2PT6A 3Q10A 2P0YA 3DBRA 4CF3A 4OUDA 3UMBA 2B35A 1EVLA 3HDJA 4GDFA 4IMJB 1UKEA 2VFAA 3VR4D 5B3JC 3HK2A 1NBAA 1ECGA 3BH0A 3CX3A 5DHSA 3JWGA 2OENG 4C7JA 4TWBA 1AQLA 1UEIA 2AFIA 5CXXA 2VYND 3WMEA 1SY7A 4QEZA 5FAKA 5HNKA 1YU9A 4XYEA 1G0NA 2WMNB 1L7RA 3DMPA 4LF9B 3GEGA 1R6AA 4FEEA 1PJZA 3LYHA 4CEJA 4I50B 5HMMA 4Q6BA 3EZ9A 4CFSA 5IZCC 2QJFA 2A0XA 3QKSB 3W7VA 3Q87B 1P8AA 5HF5A 2R44A 2ZWVA 1S9DA 2XUQA 5KKNB 5JJLA 4G37A 3OLXA 5HIAA 2B61A 5AJTA 1EFRA 1V47A 4DUPA 4RTMA 1YCFA 4IZOA 1IBCA 2AMJA 1CHDA 5LJIA 3KHKA 1ZLXA 3FR7A 4CM5A 2RGWA 1QK4A 1SCJA 2QXTA 2JH3A 3HDTA 4G0QA 1OXXK 1NM5A 4CMEA 2C7PA 4K9DA 3LLUA 4PYIA 1R88A 4ZTBA 5ALOA 1VLVA 1WCIB 2AK3A 2EWVA 3RH0A 4Q1CA 4ER7A 3ON5A 1RPZA 4US0R 1BH6A 1XPRA 1OREA 2ONCA 1MXFA 3PNPA 1P33A 2CLLB 5KAMA 3JASB 4C6TB 1AKTA 5IUKC 4CM4A 1CZNA 4BP1A 1KYIA 4E09A 2C4WA 2ZZNA 5EGNA 3NC0C 1S2LA 2Z5GA 3IT2A 2PY6A 4M8SA 1W6UA 1TYZA 2JD0A 2ZRIA 3CLVA 5C53B 4KNYA 2WVJA 3Q5EA 1KI7A 4N7RA 4Z5XA 4GKKB 2PCJA 5I9IA 1BNCA 5AVTA 3SYRA 1F20A 3NEJA 1K98A 1T4CA 2RGXA 4ZQGA 1O96B 2HU7A 2J3LA 1FTYA 1KI2A 3DXXA 3EVGA 1PGQA 1EEHA 4H27A 4BWFB 1E1QD 5KUTA 4LUCA 4B4KA 4MUEA 1E5DA 2JI8A 1PU2A 4GBMA 4D4KA 4QNMA 2C82A 1EM8A 3HLTA 1AS0A 3A9SA 3I2FA 3AO0B 3MS2A 4J0FA 4PYOA 5DW0A 3RVSA 4DT1B 4K2HA 3JPYA 1WOMA 4QXQA 8ATCA 4X7RA 3DBHA 1XRQA 2IYXA 5FBZA 3ZNOA 3KD2A 4HDNB 5AW6A 4S2UA 1QTQA 3QPDA 3G2PA 4WZBA 1X7ZB 2XUZA 1ZU5A 3ZS9A 4D42A 3DFUA 3NJ4A 3PC4A 3R3JA 4X6XA 3P0HA 2VHCA 4LVOA 1XZJA 5KQLA 1OWMA 2Q62A 4Z9XA 3KKNA 3KLMX 2QMOA 3I9NA 4FSHA 3K6SA 2WKSA 2PVCA 3IE1A 1CY6A 4S12A 4ZALA 2PH7A 2DPMA 2QN1A 1OBVA 3PE3A 5J1TB 4C30A 1U0GA 4KNVA 2EKLA 1XP5A 3SC4A 2D5CA 4H9GA 4BO6A 5IC4A 3CVVA 1P5FA 4K0KB 3E9CA 3F90A 3KKLA 3PQ7A 1M0EA 4GYKA 3IVGA 3B1KA 5A02A 1A76A 3ZVNA 2AW3A 3IIEA 3U3MA 4DC0A 3SIRA 3LY8A 4NNJA 1LFAA 4KDEA 3ORRA 1AXRA 3OJXA 1GR0A 3FLAA 1UP7A 4M37A 4MDYA 4CJXA 3FFTA 4RJIA 1USGA 2W4QA 4QUEA 4OHWA 3CYFA 2BSQA 1PRYA 2GGSA 5L8VA 3DZIA 1T1GA 4EWLA 5FWXA 2QR2A 3AUXA 3SJUA 3VU9A 1ZVQA 2BF7A 4HH4A 4N7JA 4XYLA 3I34X 3RG2A 3W06A 1ZRSA 3H2SA 5BR4A 2WM8A 2BW0A 2QAGA 1IBMB 2A92A 2ZSBA 4WD3A 2JF0A 1LV7A 3KU1A 4X1YA 3Q2IA 2FEAA 2P4HX 2H7CA 3EA4A 4REMA 2I6FA 3QVOA 3IBYA 3S2FA 3S1AA 2FSVC 5BRAA 3L4JA 2I80A 3MXTA 3U7EB 5CBPB 5JEDA 2BLNA 2C2XA 4M88A 1K5GA 2OC4A 1H66A 2VEDA 4JNCA 4I6JA 4MRMB 4UTXA 3A6DA 3MTBA 4GX5A 5JCOA 1Y33E 3TB4A 4M2LA 3EHEA 4FTWA 4MQBA 5AXAA 1QHFA 4DILA 4O3MA 4IXNA 1R0CA 2PS3A 2XNCA 3ZIAA 1GTG1 3BIFA 2FSGA 2WD7B 1CETA 1GNVA 4FZ3A 2GKOA 5TS2A 5BYJA 5EIWA 2FQ1A 3ZE1B 1F2UA 2HCJB 3WJ2A 5C3MA 5IBPA 3HCWA 2XA1A 1T1SA 3RSQA 3EGOA 4GI7A 4N6OA 3QE4A 1ZIPA 3N8HA 3R5FA 4ZI3A 2LE0A 2ZFUA 1PJTA 2VZEA 3PE6A 4I4IA 4PONA 4AY3A 1VKRA 1IULA 1YBVA 3H9QA 4KN9S 4MKXA 2WY2D 5JALA 3DBLA 4QTZA 3TRJA 5IXSA 2CZQA 5DCUA 2VNIA 2J85A 1Z2NX 4L85A 1Z63A 1F2VA 4RLFA 3RS3A 1YR9A 4JL6A 3KOZA 4YP7A 1XEXA 5EP2A 3KQKA 3VPHA 3DD1A 1Q84A 1Z8FA 3LUFA 3IV6A 2QNIA 1D4AA 2AVNA 3NDIA 1OTHA 3HCDA 3IR5A 4C6HA 1LF0A 4H4DA 1T5BA 2LV8A 1C4OA 3KVRA 5FJIA 1CS0A 1UJCA 4E4YA 3MWYW 5DV9A 4N76A 1XV5A 3OCWA 1YRQA 3X1JA 5A3QA 4LK2A 3V4SA 4XFJA 2Z2YA 4EO4A 4QBTA 1UZAA 1IEVA 1FS6A 2C54A 1O2DA 2MIIA 3LV8A 5G4LA 1ZPDA 2HYIC 1CSEE 4UDNA 3IE2A 5HRAA 2Q5HA 1XTTA 1FQJA 1HRKA 3EEOA 1I7QB 4IMIB 4MR8B 2FP4B 1SKAA 1LBSA 1R6UA 3FMOB 3NHMA 4MCJA 1WF6A 4ER3A 1YMVA 2QE7A 2GCEA 4OOFA 4U6SA 2GAFA 1GGEA 2HIMA 2FMHA 4JZYA 4KVAA 4RDCA 4EARA 2WLSA 2IDZA 5IJ9A 2IH5A 5GOTA 1KGDA 4JJ7A 1VSQA 2QUBA 5REQB 3T4UA 3T34A 3DWFA 5GZ1A 5F21A 3R9XA 2SKDA 2N0SA 3L6RA 1PJSA 1DJLA 2B8NA 4YX9A 1B8UA 2QK4A 4R8LA 1QIHA 3DL2A 3W04A 3UMGA 2C2KA 2HEIA 5BRNA 4MV0A 2D7JA 1TFRA 2JZCA 3NHKA 4MKHA 1O87A 1TZMA 4O2BF 3SEAA 1KSJA 2B25A 1K89A 4X94A 5DYGA 4QU9A 2I8AA 2WT4A 3HH8A 2AMYA 2QLFA 3D8UA 3U56A 2O8FB 3JZIA 4KXXA 1NQOA 4BCDA 4A27A 1YACA 3AG5A 2VT7A 2WLTA 3AEUB 4IWYA 5FRDA 3SIWA 4AJ4A 1M2OA 1YUNA 4ROSA 1MJHA 1QRTA 2D1RA 4TZ6A 1P60A 2A9FA 2XXAB 4B80A 4AQYB 2PEYA 3AUFA 3CKKA 4RPGA 4JLUA 4CNBA 5JJCA 3ZLUA 5JI2E 1LVHA 1Z4OA 1YAHA 1NONA 5FAXA 4N47A 5JDIC 1KOFA 3QWAA 4K9LA 1N3IA 4DUGD 5AFSA 5ICGA 1KFCB 3H4IA 3VJRA 4ZYUA 5EWJB 1T9GR 2A3NA 2KBFA 4OSPA 3TRFA 2FW1A 3GJ3A 3Q9UA 5E6SB 1T36A 1KEVA 4RHCA 2EGGA 1OB5A 4UCQA 1E0AA 2FKAA 2VHQA 3ZHTA 4C22A 5SZKB 2CFOA 2O3RA 3A4VA 3KP1A 1AJEA 2DPXA 4Y1GA 4EKIA 2HLPA 2HX1A 1BS9A 1JSRA 2IYLD 1FS4A 3BK7A 2CNWD 1VLMA 3M81A 1MZVA 4QXOA 3RJ5A 3DOIA 4RPJA 3MJRA 4B3CA 3GGPA 5GGXA 4O4HB 2OCXA 2UZAA 4YUZA 2V59A 5BVGA 3C4VA 5T4EA 3D31A 2PGLA 3GP8A 1P1KA 4NY1A 3ESDA 1YZHA 4A2CA 1J90A 3BGOS 1N2ZA 1RWWA 1X39A 3VZRA 2ZYRA 1IB0A 1WSAA 2CHGA 2XADA 1U5AA 4HRXA 5CYGA 2QTMA 5EMMA 1X13A 3LCJA 4FQ7A 2FG7C 3LHSA 1G64A 2JJ2D 5DP2A 3T9BA 1IZZA 2R5NA 1BA3A 4H3KB 4KX3A 1KNQA 3W3ZB 1HMYA 4BLQA 3AUJB 3MJVA 3TJMA 1P1JA 1PYOA 2FX2A 4EJ2A 1M2GA 1FFSA 3WA6A 2AYXA 4XDGA 4XVQA 5JAHA 2PRIA 1WE2A 1U99A 2BI7A 5AQ1A 4M36A 4DZTA 1GT6A 1Q22A 3GJRA 2Z2KA 4ED9A 3REQB 3GRZA 2QMUA 1JU9A 3IELA 5IW8A 1OE0A 2GN4A 3UWKA 1PK9A 3E9MA 5JV5A 1JSLA 1TB4A 4PANA 3H8WA 1C7IA 2YS7A 3NWBA 2IOFK 3OJFA 4RENA 3PCXA 1R50A 4RIHA 3ZQ4A 4B87A 4PBSA 1FTSA 5TF0A 3UJ7A 4DNQA 1P17A 5CAEA 1RYYA 1K6IA 4RV4A 2W8BA 4E6PA 2IVZA 5K0TA 3MG9A 4O8ZA 2XYHA 2AEEA 4JBYA 1ZM9A 3G8DA 1IUKA 1K7EB 1BD4A 4QAJA 1DKMA 3ZHYA 4MLCA 4GBED 2Q4BA 5BV2P 1UWLA 2A9PA 5CH8A 2QM7A 1BMDA 4MYUA 3UJCA 1BKSB 1VHQA 3RIEA 3WYEA 1SG0A 3L02A 1KVRA 1ODJA 3WKAA 4WFIA 3T5GA 2ZM6B 3T95A 4YRIA 3MJDA 2OP0A 1BHO1 1BVRA 2WMYA 3OF2A 3QF4A 3B3GA 1ZG3A 2AOUA 4FDUA 3RFVA 5J4LA 3TDMA 1KI3A 3UHPA 1IE3A 4DMFA 2J30A 2QNBA 1Q0LA 1XALA 3INNA 1E32A 5AI4A 3L0PA 1FSSA 2DUUA 5AJUA 5DWQA 4QUGA 4H1TA 3JWIA 1V9CA 1PFKA 2D1YA 1TK9A 2ODBA 3IIJA 2OFFA 5A5EA 3OO1A 1FK8A 3IKTA 5KS2A 3QXCA 2XAAA 3L9WA 4QKQA 2H1HA 1Q7CA 1QKKA 1RSZA 4RIEA 3K0SA 1MV5A 1JKJB 2WF7A 2CJXA 1T35A 3ZZTA 3O4FA 4B7UA 3IPXA 4AO6A 1SQ6A 3KEMA 5HKLA 3R7SA 3SOPA 1T8WA 2QYTA 5CPFA 4OGGA 4M0MA 2HQOA 2W37A 3WSVA 2DQYA 3RC1A 4QQNA 3W5BA 2REXB 3LF1A 4XVHA 3E1SA 4MW9A 5DFAA 4G09A 1G41A 1A4XA 1TI7A 1QV6A 5CVUA 5LZ4A 3NANA 3BH7A 1W9MA 1P74A 2HA7A 1D9XA 1RXUA 4MCIA 3OIVA 4RGVA 1E2EA 3A4NA 4UKDA 1A0OA 4JWTA 4RTOA 1RZRD 4OB7A 4Y7DA 4DTIA 5L7WA 1WVMA 3VUFA 4TQGA 2H4WA 4MUGA 3ZQJA 1AB6A 1PT6A 2C96A 3CR7A 1XU4A 4PRZA 4RMJA 1YB7A 4F3NA 3IAFA 3ZCTA 3R09A 5TGZA 4ZU1X 3SC3A 2QMQA 2FXVA 3AC0A 3KCNA 1WPQA 3G2JA 5AIAA 4TUYB 2BMAA 4P3KA 4X5OA 4CLHA 1UADA 4KL8S 4POOA 1STOA 2O3TA 5T64A 2WYHA 1F0PA 1Q3HA 1LDEA 3STYA 2P4QA 4QJ3A 1PR1A 2IPMA 4A6EA 3OP1A 3WP0A 4Q3DA 4XPIB 5HIJA 4C0SA 5CDYA 2H0RA 1NMEA 2J9ZB 4KXMA 1V16B 2RGRA 4JI8B 4FFMA 4POAA 4XB1A 4XVRA 5DTJA 1QFZA 1XL0A 1ZHHA 3B1YA 1E3SA 4J3FA 1JSZA 1TL7C 3NGXA 5EXPA 1YRYE 4C05A 4JJ4A 1LGYA 2WWXA 3Q72A 3I42A 3N87A 3L7MA 1EH5A 3OCCA 4BRUA 3J7AC 2F64A 4BU1A 2ZXUA 1N8SA 3O84A 2QG9A 4ZV4A 1P0MA 2V0CA 2BR5A 4PAOA 3DFFA 5G40A 1SVNA 4EKDA 2D0IA 1IY1A 4HCJA 2WHPB 1JIXA 4PQYA 2Y0CA 1NZFA 4RZSA 4PN7A 4MUYA 4OV6B 3GFQA 1V8FA 2FQYA 3E4DA 3TCKA 2WSLA 2ZZKA 3VNSA 3SD7A 1NLFA 1ZH0A 3I6YA 4BMXA 3ICVA 5F1OA 2C9ZA 3E6AA 3K2IA 1A50B 2EIHA 1L1RA 4KXLA 3QX8A 1GZDA 5EHIA 5ETJA 2HNAA 1ZN2A 3EGDA 3GNSA 3IESA 3OEWA 4GX2A 2Q21A 1VYHA 1PL7A 2OHIA 4XDZA 3EIUA 4MPRA 3WNQA 1BDIA 1LBTA 1N5IA 4F3TA 3GFGA 3VTZA 1TLLA 2X8AA 4DBVO 2PZJA 2J0UA 1KNXA 2JI4A 3AUTA 3AWIA 1PR5A 2QLBA 4HUTA 3U7FB 4ILEA 3R24A 2Q4DA 3D0KA 5AHKA 1AIPA 1W8DA 2UVDA 4CG0A 5A4AA 5I45A 2R2GA 1HL7A 1TU3A 3ABZA 3K6JA 1W9HA 1WW2A 2HHJA 2HPAA 3A6ZA 1ENZA 1UAYA 3HNRA 5F1YA 4GC5A 4FCWA 3GHYA 3V4PB 2BLLA 2HPZA 4UM5A 5HFNA 1RRKA 3QVTA 4LYHA 4BV2A 5G4KA 1X8KA 3DOCA 4AKHA 4KPGA 2W70A 3JR3A 3FHCB 3UFXA 4I4TB 1TYBE 1C3JA 1NFRA 2ZWOA 3PC8C 2XQFA 2D4AA 1X1BA 2EFCB 3KDSE 4B45A 4D81A 3G7UA 3GMSA 5J5CA 2HF9A 4OFWA 2O8VA 3SJAA 3DG9A 1EB8A 1QNLA 2ZR8A 3I6MA 1R0KA 2GX6A 3FYTA 3TLEA 3FYCA 1JJIA 4PZZA 1NBME 1JG3A 4MZDA 3W9SA 3BIJA 5A9SA 4R7GA 1T3HA 2I2FA 3RF7A 3SLRA 5DGIA 2C9DA 3PSHA 4RWZA 1LJ8A 1J09A 3AERA 3ZVLA 1Y82A 1K2VN 1S9HA 2WA1A 4LC9A 4A6PA 4I9NA 3AEZA 2O2ZA 3TBKA 4YP9A 3TZQA 4QPCA 1NWHA 2REQA 1T5HX 4P34A 1AUVA 4JDUA 2ZROA 2DWPA 5EC8A 1OAOA 4FM9A 1GPKA 2VXCA 2FPKA 3C8ZA 4O2AA 1OPXA 1OSNA 4ZOQI 3O8LA 4D6XA 4ZOCA 3MHTA 3DKRA 2Q5CA 1VFNA 4JVSB 1QSGA 3FNFA 3NHPA 1H5NA 2VWHA 2FK8A 3GWGA 3IYLW 4UHEA 1IN4A 2QD3A 2WKRA 1U0TA 1BJTA 3DPIA 1SZPA 1J25A 1WP9A 2YFHA 2BGTA 1F0KA 2QD2A 3O9ZA 2WWWA 3O75A 3LHFA 2D8MA 1ZEJA 5C8YB 1BC5A 3WZ2A 5C1DA 1LK5A 4LGYA 5D3QA 3CUVA 3A6EA 2GZDA 2VNJA 3PIDA 2GEFA 4QYXA 3TD9A 4H0FA 1HE8B 3OP4A 1WF3A 4RK0A 5AVVA 1RTKA 4D9IA 2MOKA 2ZUVA 4JNKA 1CIJA 2AS0A 3LDUA 3TKYA 4KBFA 1CTQA 1E9DA 4QBGB 2BBSA 2QN6A 5DM0A 1M75A 2BRUC 1TQDA 1ZA1A 2BMDA 2CXPA 2WIDA 3NRBA 5FR1A 3WQHA 4F4UA 5IN4A 2BDEA 2JIMA 1T3SA 2VJQA 2P6RA 2XUKA 4LQLA 5J2UF 3HA3A 2E6UX 5GJVC 2VT6A 4CLRB 2XGSA 3T61A 2O9JA 2DXIA 3AONB 4R6WA 4D02A 4TLAA 1DZIA 1WZCA 1T6ZA 1ZU4A 5IEBA 2OHXA 2W2LA 1Q0ZA 2YJNA 3FHLA 1IOZA 3K0EA 4FR5A 5ERXA 5JC1A 5ECWA 4IDQA 3HL4A 1M7BA 4E1VA 1KDOA 1V4NA 3DUFB 1UIRA 1MABB 1A7KA 5D7BA 2AZMA 1IUPA 3AFMA 1X1QA 5SYNA 2D00A 3PENA 1XDDA 1VL0A 2HBQA 1XZFA 2QRNA 3BQ9A 2PIAA 3DHVA 4RVFA 1FIUA 5JMOA 2GPTA 2R60A 1RJEA 3PWTA 2L42A 4D9NA 1SAYA 1WXQA 4PZPA 1KI6B 3AY0A 5MGNA 4GLBA 2DKNA 1NX6A 2NUAA 2YASA 2WIFA 4M22A 4PZUA 3TUIC 4BNDA 3BQMB 5CMLA 1MQAA 2W58A 3GP3A 4HZGA 4OP2A 4ND5A 5TDHA 3LX5A 4BVJA 3JWJA 4YO7A 5H82A 1ESEA 4RXUA 1TTQB 3FSGA 3HYCA 1MX3A 2O0HA 5AI0A 1KJWA 4IWXA 5LC1A 2EBUA 1NQTA 1G291 4LW8A 2BHTA 4DQ0A 5BNIA 2ZBEA 4QM7A 1FL9A 4Q1EA 1D0IA 3U4CA 3VX4A 1ELOA 1NF2A 1SK9A 1XMIA 4C4AA 4F9EA 4DDKA 1CR4A 1DTWA 1L9KA 1GNRA 4F2HA 2VDNB 5ED4A 3IBCA 4M7WA 3T3NA 2B2NA 5BP7A 1RQ7A 1A82A 1N25A 1UUFA 2H48A 2CJWA 4KQ2A 1F2DA 3D2AA 3RVDA 4B3SB 5BNZA 3HFRA 5I7OA 3IDZA 3TGWA 5LCXA 1W4LA 1WCYA 4B76A 4QICA 2CBZA 3R0XA 1T0PA 3A6LA 4TSKA 4YR7A 5A4JA 4I36A 5ENVA 1VDZA 5IJ0B 4BV8A 1KI4A 5FI1B 1RXSA 1Q2UA 1N2CE 2O3QA 3UF0A 3OUTA 1RQNA 1QZXA 3RIGA 4B3MB 3ITDA 3I64A 3WZMA 3ZI7A 4QT4A 4DUYB 3LDFA 2REBA 3GGGA 3Q98A 1HQCA 3NOQA 3HEAA 2I4MA 3E0QA 3OX2A 4EQ6A 4WXEA 2JVKA 2QHXA 3EEQA 3RUIA 1CE8B 2V1XA 3H5IA 1J6UA 3IQEA 1MVOA 2X42A 1Y7PA 4WE3A 1LWNA 1I80A 3P8ZA 8ADHA 1YR8A 4EUHA 3ZJUA 5DWDA 1A2OA 2CNBA 4NBSA 3ETHA 1R4ZA 3UV7A 3H7IA 5ERYA 2O06A 3EPPA 2RGNC 1BCRA 2F62A 5G0UA 4C43A 1G8MA 3QEJA 3VPDA 4E33A 3M4JA 3EC7A 1ZJ6A 2BFBB 3L8EA 1FDIA 2ZT7A 3UBMA 2PLRA 3QTTA 3UNXA 3W79A 3TIXB 4BEJA 3ZDBA 2O2XA 4J8PA 3EZ6A 3THYA 1UFVA 1JEDA 2I91A 2J7PA 1V7QA 3N2IA 4S1VA 3L01A 2NVOA 3TN7A 3TXXA 3DPSA 1ONNA 1A95A 2J9FA 2PRSA 2VYVD 3L0YA 4HDMB 1I0LA 4KJZA 4OKSA 1G3IA 3HRHA 1P80A 1NOIA 4XQ0A 1QPBA 3UHFA 1DU4A 3FOCA 4QREA 4B3BA 1GG2A 4QPPA 1SCQA 4HLCA 4EW1A 4NOJA 2XCSB 3GLVA 2P0EA 4HMOA 4AZTA 1FFWA 1JXMA 1ZLYA 5B4VA 1GTMA 1JPVA 4EJFA 3R7WB 2UUBB 2Z3ZA 1ZD8A 4LMAA 4XX0B 3C87A 4BL5A 1CZRA 2JHGA 1YZYA 2X9NA 2ZSFA 4B46A 2QMZA 1Q1BA 4B17A 2D0PB 3DHWC 1CZLA 4OI2A 2ZATA 5CHEA 1NQUA 4CIDA 4PF1A 1X6VA 4V02A 4UJ3A 4AZ0A 4NCBA 4D0SA 3HY6A 3ZBQA 1GEGA 2F3UA 4KBYA 5HBGA 1IHDA 4DQKA 3ADBA 2BT4A 3BX1A 5MN6A 3HS3A 4JVOA 2W6QA 1A8HA 4G97A 4J16A 3CUYA 2OESA 3AY3A 1AU9A 1WU8A 2Z8XA 1E3LA 3GH3A 3HDGA 1ECCA 4X8HA 2P3SA 4YRCA 5EN4A 4ZZIA 3I61A 4E15A 1BDHA 3I72A 4FGKA 5TMEA 1T8UA 1KRWA 3KYDA 2KQUA 5DCYA 3WLAA 1P0FA 2RH5A 4L0QA 4M38A 4MVWA 3PDHA 3GMDA 1PW7A 5FFMA 5TQVA 3HHPA 5TEVA 1FLAA 5IT9A 3BJEA 1CYDA 1T34A 2IU4A 3C5VA 4LVCA 4RGBA 2VP3A 4WCVA 1M7GA 2QTTA 3AQIA 4H1HA 4FB5A 3RHZA 1RI5A 1F14A 2HT6A 1O6ZA 4H7HA 4TT8A 4W9NC 3WFZA 5M29A 2M1XA 5A04A 1HT3A 5IG2A 3KAJA 4Q4CA 2O2IA 4OGWA 1N2IA 4H7EA 1XAGA 5ADHA 3OMWA 1OGJA 4TMXA 5BW4A 2XBUA 1TAQA 4Z3KA 3S81A 1D5CA 4PRLA 4H3SA 2VLIA 2GPBA 1CJCA 1SPBS 2CEAA 3W8FA 2X0NA 4Q9NA 4ZAFA 1NJ2A 4DEYA 1E5XA 2HK6A 4BECA 5ALWA 4X3CA 4O4LF 4REOA 4FU0A 1FEZA 2XWQA 3WR5A 4BGIA 4PSKA 4HGYA 4U2KA 1YQUA 2JDID 3DONA 2EBHX 3IV9A 3MMSA 4EIWA 1TRKA 9LDBA 2WR8A 3JZFA 4FBGA 1ZGGA 1ULUA 4GPAA 1P81A 4X85A 4BNJA 1J06A 1L8QA 4ETIA 2H1VA 3ZI0A 2OHHA 4DV5B 3FOAA 2XQKA 5GWXA 1XA4A 3GLIA 4IVQA 4EUFA 2PKCA 5H81A 4HO1X 2R8RA 1G5TA 2Q1XA 1QAOA 1M5TA 4LPKA 3O2NA 2QTVB 2I3DA 5GIPE 2I4TA 4UFPA 5ESWA 2Q7DA 4HKTA 2CYAA 1A9QA 5FLXA 3CTMA 3O3CA 1MVNA 3B1WA 5PNTA 1QH1A 1C41A 2WSYB 3OEEA 4S1WA 4X20B 3MINA 2VWGA 5JSKA 4DBZA 4CN9A 1NTRA 2C9OA 2QT0A 1DFHA 1CZHA 4PQGA 3A7EA 3V46A 5JNSA 1T26A 2EBWA 4JQCA 1B8OA 1IHYA 2VXBA 3HR7A 4QZVA 4KX5A 3KVVA 3ZX4A 3PFGA 4BLWA 1G6Q1 1QH0A 1W49A 2EQAA 2PAFA 1DQRA 4IRMA 3EWAA 1WVGA 3EQ9A 3PT5A 4WH0A 3F6RA 4FIDA 1HLDA 4XYMA 1I2MA 4E4TA 2H7XA 2O20A 3C3BA 4JFRA 2YOHA 3LHDA 4J4TA 4MSUA 2QN7A 2P9GA 3HFGA 1T2VA 1QHNA 3PEUA 1WM1A 3NOXA 3M5PA 1E7RA 3FNBA 1XZGA 3PHLA 4JI1B 5IMSA 1TCCA 4U3JA 1RW4A 3F8SA 4WJZA 4RIGA 4QJIA 1NP3A 1M6HA 1QANA 2RAFA 4X54A 4Y6OA 3FGPA 2I7XA 3G23A 5CX4A 3WNBA 2E18A 4A7PA 4D44A 3GC6A 3TLJA 4AS3A 1E1RA 3KFVA 1IBLB 3MCVA 2GN9A 5CTJA 4R5MA 1Z4JA 5C8XA 4CV0A 3CZPA 5IWCA 4U2CA 3EXIB 5FUMA 2HNKA 2PUHA 3QHQA 4GS5A 4KSYA 4U39A 3X44A 1GKIA 1H22A 1DC8A 5I4BA 4HXFB 1TCAA 3JYPA 2L19A 1VBNA 1PJLA 3DKPA 3I0NA 5SY6A 3USCS 4A8JA 3FXAA 1E6WA 3SFZA 4G56A 2J6HA 1CF9A 3DOJA 3K5PA 3KQPA 3N2GB 4ZD6A 1Y1TA 2G4LA 2PLWA 4UTPA 1RABA 5LYYA 1AZTA 1GSIA 4B82A 4O59O 4FPXA 1ONPA 4PIPA 3OJ0A 4PPNA 4XWAA 1WP4A 4MEAA 1UZLA 4GRDA 2AXEA 4QVGA 3IP6A 5THKA 4CKEB 1XTIA 2A5LA 3V8MA 4DLZA 4XQCA 1QFSA 3QXGA 4M6WA 4Y2PA 2HREA 5IP5A 2Q50A 3FF1A 1JFFB 2HK7A 1E1KA 1IBSA 1Q7EA 1IHOA 1Y3HA 1ZD3A 2PSHA 1WD5A 1E9EA 1N2XA 1X0XA 3D4PA 3ODGA 4FKMA 2DWCA 2YZGA 2VR1A 3B38A 3URKA 2I1VB 1X1AA 3U44A 1GFSA 3R76A 1ESZA 2GZ3A 1KFBB 1PL0A 1W35A 1U8ZA 3AVQA 4ZRMA 1B26A 3PLRA 4H59A 2OXIA 2HCRA 2OB1A 1G20B 3VI4B 3AEQA 3IEMA 1YHYA 4NBVA 5C7LO 4PZYA 2NXEA 2GD6A 4EF6A 4R2XA 2DFTA 2R47A 3SK0A 3DL0A 2W2TA 1O97C 4P1ZA 1M6EX 4QYMA 3UJ3X 1Y5MA 1L3BA 1BKDR 3OQIB 4EX6A 1CF2O 1BVHA 3VRHA 2PS0A 4ALLA 1SUSA 2O8BB 4R9UC 2H9YA 4QG3A 4DLUA 4DLAA 2YHUA 4FYPA 4RO0A 3I01A 1N5MA 3EZ2A 3EDYA 4MB2A 4B4WA 4CT5A 1ORRA 1TEVA 4AY4A 2X8JA 4GRAA 1ZSVA 3H04A 4QD3A 1KDZA 5JQWA 3CH4B 3W2EA 2F3TA 4BVEA 2BGRA 5IAAA 4XUDA 4XM2A 2IV3A 3DVLA 5JD3A 1N9GA 3DZFA 2BGUA 1VGVA 2BGNA 4OD0A 5DHRA 3UMFA 6AT1A 3WLNA 2NO9A 1MC1A 4Y1RA 1JQEA 1F48A 2JVJA 3H2ZA 4ZAGA 1KSGA 2C1XA 1HDZA 1Z0KA 2JJMA 2SHKA 3TM5A 5JYEA 2Q28A 1D1SA 3IOEA 4H31A 1YU6A 3K0AA 4KGZA 3T38A 1EXWA 3MAGA 3KT3A 5CFZA 3QEAZ 1U1CA 4MDFA 5JD6A 3FDZB 3OFND 3KXDA 1D1TA 2C29D 5T57A 7AT1A 3SYNA 3MCUA 1L7VC 1F1BA 2W6IA 1E4OA 4PR0A 1U8TA 1Z29A 3I4FA 4AG3A 2WZBA 5L4SA 2QP3A 4UAVA 1JWAB 2I33A 5I3CA 5IUJC 1XMVA 1HRDA 1WV0A 1RWQA 2HRCA 4FOPA 1DX9A 4FFVA 1FUYB 2GJ9A 2G9RA 2OHJA 4M1WA 4TRJA 3VDNB 2UYYA 1K5DA 3QX3A 4JYBA 4JLKA 1YHNA 2WZCA 3I6IA 2IS2A 2JAPA 3G1WA 3CKYA 2C95A 1A4RA 3DH0A 3LNTA 2A5GA 4NS4A 5IXYA 4HDOB 5JMPA 1ZSYA 3KB2A 3SFVA 4ZFNA 1IQUA 3K70B 1E6EA 2Q3BA 2YWEA 2P27A 3COYA 5LLTA 1JX6A 5K0CA 1FTGA 1HNZB 1Q7TA 2YJ5A 1M1YB 5EG5A 2Q3FA 1V11B 3JQGA 5JZOA 4JP2A 4PQEA 4WBNB 4V0NA 1JDPA 2G08A 4LBZA 3A36A 1BIFA 1FNCA 1MJNA 4QHTA 5LA6F 4DLNA 4UXJA 3H1PA 5BN4B 4KB5A 4DCNA 1JR3A 4A82A 4E3ZA 5BSVA 3ESQA 4NQZA 1MH9A 1RYZA 3K0KA 3QVSA 3D3WA 1H3FA 2GYVA 4UUOA 5FBWB 2DH6A 4R9RA 4C0LA 4LDJA 2CE2X 1RP7A 3D2LA 5CCEA 2YJZA 3GH1A 3RFFA 4YROA 3GXBA 2GAJA 4D82A 1KSFX 2AC7A 2ZSEA 5D84A 4YT2A 3WK9A 4BLSA 4UTVA 4P0QB 2QA5A 1VRVA 5JSQA 1TJ4A 4HFMA 3MUNA 3PLNA 4PYNA 3RK1A 4QM6A 2B5VA 4H18A 1DDOA 3Q41A 3WLTA 1GLGA 3OKPA 3ULKA 3BK1A 5B1IA 3DGEC 4YI3A 3PQCA 3TMKA 2VAMA 2PJRA 1NVDA 4PLGA 3UOWA 3DAFA 1ZX1A 1X2EA 1M1UA 2R8XA 2DYKA 5KNBA 3FX2A 5H83A 3SF0A 1CVLA 3KJHA 4YNBA 3ZHBA 4XSHA 7REQA 4JASB 2XE7A 2DBZA 4KZPA 3UKJA 3QZUA 5D00A 3QE3A 4E5PA 2A5DA 2QL6A 4QWWA 4AWXA 2BHNA 5GZ3A 4DIBA 1LPSA 3FTQA 3PJDA 2C2YA 2EHJA 3LFTA 3MAAC 4FGLA 4XW2A 4OA5A 4G0ZA 3LGSA 1PR0A 3UAYA 3K1AB 1FS5A 1V8ZA 1ZVMA 3FDXA 2ACWA 2LGJA 3PPIA 2F8LA 4MEJA 4MW4A 4X1IB 5C8DA 5ITVA 3N7AA 5EE9A 1C9MA 1E6MA 3A2MA 1GGJA 3N74A 3NTRA 2OZVA 4PLPA 4M76B 2C78A 4MQEB 3ND5A 2PX2A 3MS4A 2OGWA 1V7PC 3NHAA 4OQNA 4FFPA 4CDGA 4I9FA 2G77B 1M1XB 3JVVA 3W2GA 1G8GA 1Z8NA 5F76A 4RBNA 1E6UA 3JD3A 4HGZA 2R0QC 4RAOA 3OD5A 3PRKE 1LSSA 2FUNB 1Z5ZA 2XMRA 4CGZA 1KOLA 3CZ4A 4ESVA 1E3MA 1F17A 1IOLA 2HO4A 3VR4H 2XNKA 5IH3A 5DNWA 3OFKA 4RH3A 4R2KA 3W3AH 2QE7D 3ND6A 3REFA 3ZE8A 1ZK2A 2O14A 2ZRQA 2ZYWX 1L5WA 3WKEA 5EIBC 4Q3KA 3A28A 1RDFA 4W99A 2YHIB 1RC8A 3L0IB 4Q82A 4D9MA 1Z6ZA 4L74A 4ZYYA 2GPNA 4J76A 1H5QA 3D8RA 1JXOA 3BCUA 1FYVA 3QKWA