3CXRA

Crystal structure of gluconate 5-dehydrogase from streptococcus suis type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
260
Chain Sequence
QFSLDQFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase with different specificities
publication title Structural insight into the catalytic mechanism of gluconate 5-dehydrogenase from Streptococcus suis: Crystal structures of the substrate-free and quaternary complex enzymes.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Oxidoreductase
total genus 101
structure length 260
sequence length 266
ec nomenclature ec 1.1.1.69: Gluconate 5-dehydrogenase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3cxrA00
1V0JA 4YAEA 4J4HA 3U5TA 2H9IA 3LYLA 2GUGA 5JPIA 4XB2A 1LDEA 4YAIA 3PZRA 3VDRA 3JQ9A 1ZCJA 3I4FA 2ZB8A 4E2WA 1L7DA 2NNLD 1NVMB 5U1PA 4JBIA 3PHHA 3ZV6A 4D41A 4RL6A 3P5SA 4DPKA 2RBEA 2G76A 2V6FA 2B4RO 3R1IA 5DF1A 4YA6A 5G0UA 1OC2A 2HK7A 1HE3A 5ER6A 3IOYA 1T2AA 1ZVMA 1U28A 3AK4A 4E3ZA 2OORA 2ZYDA 4FJ0A 3RUEA 4DLLA 2YYYA 1GDHA 3GHHA 4WECA 6LDHA 2CF6A 1RWBA 4HV4A 2BGLA 4FJ2A 4J43A 3RUIA 2X86A 2P9GA 5CG1A 3QHAA 1LDYA 2AE1A 1HDZA 4DL9A 3FWNA 4ND5A 2ZIZA 5GZ1A 4L74A 3P2YA 1A27A 4NU5A 2PWZA 3DQPA 1C1XB 2VCYA 4IM7A 4DREA 4AJ1A 4FS3A 1XG5A 1E6WA 1F12A 5MGBA 3D3EA 4CM4A 4HP8A 2O4UX 1B8UA 1VJ0A 4JNKA 3T4EA 4BIIA 5HRUA 1JU9A 3KB6A 2QYTA 5JBIA 2NWQA 1E1MA 5DULA 1C0IA 4U8GA 1DC4A 1F8FA 1QR6A 3OJ0A 4JLWA 2X7HA 1AHHA 4WK6A 2BI8A 3CXRA 3I9NA 1DJNA 4CLRB 5ADHA 2G1UA 3RASA 3HWRA 3ETGA 2AE2A 3GG2A 2HMUA 2R00A 3EK2A 3IAHA 4PG8A 5CPFA 5T5QA 3QRWA 1QORA 2Q4EA 4J0FA 4OMUA 1H6CA 5FF9A 3GAFA 4ZU3A 3GZNB 5JAQA 4XQGA 2OFPA 1J4AA 1T2FA 1LJ8A 5CEFA 3OMLA 5TLSA 1U2DA 2EG9A 4CV0A 1JVBA 5U9CA 4NH4A 1MXHA 4FGWA 3U0BA 4DRYA 5I9NA 4HBGA 2FR8A 2I66A 4DPLA 2O4CA 1C1XA 2VNAA 3AUAA 3CIFA 3MJEA 1U1IA 3IKTA 5KVVA 4Y9DA 2EKPA 3LLVA 3BHMA 2JD2A 4FOSA 4BS9A 4JIGA 3ZWBA 3PVZA 4KP7A 1HLDA 1UP4A 4AJKA 1ZO8A 2GLXA 2Q46A 3E5RA 1I24A 4BUCA 3VC7A 1IYZA 3PFFA 1YL6A 3W8DA 3JQCA 4JJFA 4ZQGA 1ORRA 3VVBA 9LDBA 1EQ2A 1SEPA 4IS2A 4CLRA 4CQMB 1T4DA 1E3IA 1FMCA 1LSJA 4AJHA 1LSUA 1MB4A 5KWEA 3PIDA 4MO2A 4NMHA 1E3JA 1Y8QB 1CRWG 5T8KA 5A9SB 1YWGO 4O63O 1HL3A 3DBRA 3FBTA 5ER9A 3GZNA 4J1SA 3S1LA 1NFQA 4E0BA 1TEHA 2IZZA 3EUWA 3OA2A 3UKOA 4C7JA 2HMSA 1UP7A 4O6VA 3JYQA 3MJSA 4TROA 2CFCA 3SC4A 2J3KA 3W4IA 4N54A 5CDUA 5DOVA 4IXWA 3QVXA 1YB5A 2IODA 4BO1A 1FDSA 2NM0A 3ANLA 4MP3A 4P8RA 4WLOA 3FWZA 1Y7TA 3H2SA 5C3MA 1B26A 5FWNA 5EIOA 3CKYA 1RPNA 2V6MA 1IZ9A 2CNBA 1GU7A 2OUIA 4CM9A 3GPDG 3N74A 1PJ3A 3CSDA 1ZUD1 4RVFA 1YONA 3AY6A 2YV3A 4CQMA 1TLTA 5AOVA 4CL3A 5KVSA 4R5HA 3MJVA 2DKNA 3VPFA 4OXKA 3H4VA 5A9SA 3VZSA 2VWHA 1I32A 4LISA 5DZSA 3AOEA 2DUWA 3HE3A 3I9LA 4WUVA 4Y67A 5CEEA 3MCVA 4YB8A 2Y1EA 3AY7A 1EVJA 1V6AA 1BGVA 4RPHA 2PD3A 3DOJA 2GD1O 3JD0A 5EMHA 4BGUA 1E7QA 2OBYA 4UVHA 3DWFA 2HO5A 1XKQA 5JDCA 3RIHA 2HQ1A 2E49A 3WLFA 4UUNA 4PLGA 1XU7A 4P4NA 3UOGA 3C7CB 4JCOA 2HKIA 4IDAA 3DAGA 1IUKA 5I7EA 3W4JA 1X7HA 3ZWYA 2QQ5A 3IMFA 1YDEA 3PLNA 4UVDA 3ZI0A 5JY6A 1GEGA 5EINA 1C0PA 5AXCA 2SCUA 1E7WA 3L0DA 1PEDA 2WJPA 3DXFA 1O95A 3MJCA 2GYYA 4AJLA 3FNFA 2OGUA 2Q2VA 1KC1A 4RDHA 1HT0A 4JP2A 4PLCA 3KEOA 4ND4A 3CPSA 2JFGA 1KETA 4YTEA 4A2CA 1AXEA 1UXJA 2J3IA 3B1FA 3GDFA 2OP1A 5IDYA 4XR9A 1R66A 2DT5A 5L3ZA 5B4UA 1BVUA 3JV7A 5IXYA 4J2OA 4E33A 5BSFA 4YT5A 1AGNA 4WGGA 1Z6ZA 1T2EA 4IMPA 4CM8B 1Q7GA 3MTGA 4LVCA 2HLPA 3H5RA 4PLWA 3RJ9A 4CR6A 4IIVA 3E9NA 2W2LD 3R0IA 4CV2A 2BHLA 3LU1A 4E2ZA 1YBAA 3NDRA 1P44A 2C5AA 1E6EA 4GX5A 1OFGA 1XQ6A 4CLOB 4RJTA 2X5JO 4UEKA 2PH3A 1D1TA 4XKJA 5DBIA 3FPCA 5F1PA 2EKQA 1GUYA 4I5DA 1ISJA 3TOZA 4CMEC 5FEUA 4GX1A 4YRBA 2FR1A 4ONEA 1DSSG 3WTCA 4RQTA 2O2SA 2IYPA 3P7MA 3TOXA 4DYDA 4M89A 2X8LA 1XHLA 1CYDA 2JL1A 1EUZA 4NNJA 1P74A 4E5NA 1S6YA 1EQUA 2QHXA 1EE2A 1WW8A 3NAQA 5AQ1A 3FF4A 3W6UA 3IUSA 3DBLA 3F3SA 3KOUA 4WCFB 2UAGA 2FSSA 4CM8A 4AG3A 5CP8A 4MIOA 1A7KA 3NTRA 3PXXA 3CZRA 1ULSA 1H93A 2F00A 2AMFA 4CLOA 3HDHA 3OEYA 4R68A 2XXJA 3GMSA 1P1KA 1LDMA 4BGIA 3ZU2A 5ILGA 1ZK4A 2NADA 5H83A 3V2UA 3KYBA 3ZNOA 1W73A 2PV7A 3ZWXA 3PYLA 1Y6JA 1PQUA 4UUOA 3VHRA 1FDUA 2FPGA 4OSOA 1F0YA 3I23A 1Z75A 4NFYA 1M75A 3WLEA 3WMWA 1SNYA 3JD4A 3BMCA 4FFPA 3GA0A 4GGPA 2ZYAA 1J5PA 4BO2A 5JCJA 1ZXBA 2JFFA 1N7HA 2YV1A 1ZSYA 5JS6A 3RUHA 1MUUA 4J1NA 3RWBA 1DPGA 1YE3A 4E6PA 2YFQA 1K3TA 4ZRMA 2Z95A 3VPSA 2VHWA 1QV6A 1H2HA 3FNGA 3GUYA 3KVOA 4ZA2A 3SLGA 3I1JA 3C85A 5CFZA 3PLRA 2NU7A 1QSGA 3WIEA 1NPDA 5THKA 4GI2A 4WCFA 4D43A 4CM5A 1UDAA 4XZ3A 5AXDA 1HE2A 4NBRA 1JA9A 1W4ZA 2PKRA 4GQAA 1CERA 2X58A 1D4FA 2ZJ0A 4ND2A 4ND1A 4XQCA 4DA9A 4DTIA 4ZQEA 4Z9XA 3RFXA 1V35A 4L75A 1QYXA 1DIAA 2CVQA 3IJRA 3JQBA 5L7YA 5DOZA 3WS7A 3EDMA 4MVJM 5JNLA 1Z82A 4L76A 5T6BA 5DP2A 5KKAA 5L45A 3RBZA 2H63A 3DZBA 3TL2A 5HS4A 1Q1NA 4EJ0A 5B4TA 3RBXA 2TMGA 3EC7A 4K28A 1NXQA 4U7WA 4TRJA 2YHIA 4I9NA 1M67A 4XGKA 4LRTB 3ZU5A 4B4OA 4DQXA 2EKLA 5G0TA 5KTKA 5KIAA 3KBOA 1DHTA 4RPKA 2JCXA 2DFDA 2J6IA 4TQGA 2DTDA 1FF9A 4JGBA 4KQXA 3MOIA 3F4BA 3I9KA 3ZWPA 5GMOA 2NU6A 1XGKA 2BFPA 3NYWA 4RDIA 1WAMA 4XDYA 3LC1O 4A73A 1N9GB 3AM3A 2D2IA 3WGOA 1SOWA 4E21A 1PJCA 1PWZA 1FDVA 1DRVA 1WZIA 3EHEA 4DWVA 4YJDA 1PJLA 5LDGA 1I36A 2D3TA 1P3DA 3QA9A 4YBZA 2BKAA 2LDBA 2X0JA 3JQGA 3KYDA 5BT9A 2YJZA 4NK4A 1ADBA 3JQDA 5KJ6A 2D5AA 3KETA 5K6AC 3C7DB 3PRJA 1ZNQO 2PGLA 3K30A 4R01A 4B3IA 1KEVA 4MVJH 4AVYA 1GR0A 4NHEA 4OAQA 3WR5A 1WMAA 2ZB4A 3AUUA 3ANNA 1P1HA 3AFMA 4Y8VA 1MLDA 3DONA 1OI7A 4TKLA 4WLVA 1T24A 2EP5A 1NQTA 1YOVB 1NAHA 1XIVA 5CDGA 1GPJA 2HMTA 1EFLA 2Q1WA 1BSVA 3WQSB 4ALKA 3JYOA 2HCTA 4IY1A 1PS9A 3NRCA 1CQJA 1MGOA 1P1IA 3U09A 4AJ4A 3OIFA 1BXZA 2X4GA 1OZAA 4YCAA 5I7FA 2J5QA 2XPCA 4WOJA 1U4SA 2GO1A 1O8CA 3EZLA 3BXXA 2QRJA 4O59O 2DUUA 4PVCA 3B1JA 3DFUA 4NZ9A 3T7CA 4J7CA 1AUPA 4FOOA 1KYQA 4GWKA 1NFRA 1I3NA 2HUNA 2EERA 1R16A 1Y9AA 3E6AA 2DBRA 1CEQA 4CLHA 2CZCA 1WPQA 3VZPA 3FNEA 3UW3A 1DC3A 2W8ZA 3F6YA 2JD0A 4UEOA 5JFOA 4FFMA 3TFQA 4OQYA 4AJIA 2X6TA 3ANMA 4EZBA 2ZCUA 4HNGA 1HYEA 4BL5A 3DZKA 1KY4A 4II3A 2B69A 1P1RA 1J49A 1PQWA 3Q11A 1ZK2A 2QRKA 5EJ2A 3FNHA 3BTUA 4WLNA 2JHFA 4FFOA 4W4TA 3KLMX 1M2WA 2DPGA 1HYGA 3BTOA 3ZH2A 3CE6A 1PJTA 4HX5A 3ABIA 4RPLA 4XQEA 4H3VA 2GF2A 1CIVA 3IJPA 4R9RA 4CV3A 4YJHB 1PR9A 3RUDA 1QXSA 3GN1A 5TT0A 3NT5A 1NPYA 1CWUA 5DCYA 3GHYA 4CM1A 3ZZNA 1K6JA 5L53A 3PQDA 2BLLA 1LC0A 3ZWMA 4XD2A 1HZJA 4CL8A 1G0OA 2EF1A 3ZCXA 3JQFA 3E8XA 2CSUA 3DMTC 3D64A 5L4SA 2X5OA 1EUDA 4OL9A 4IZHA 2P9EA 3QVWA 1DAPA 3TJRA 4GMFA 3JQAA 2AXQA 4DMMA 2G17A 5DDIP 2OOSA 3RKUA 1CETA 1SCUA 3LLSA 4FC7A 1Z45A 4AFNA 1E7RA 3JQ6A 1H2BA 1PTJA 3QSGA 1MG0A 4OHUA 1ID1A 2Y1OA 1H9AA 2RH4A 4LW8A 2FN7A 3WMXA 5A02A 2FOIA 3L4SO 2IDZA 1X0VA 3DL2A 1U3VA 4M1QA 4IDDA 2ZYGA 4WE3A 4B8ZA 4R9SA 1NR1A 4YJHA 2ZATA 4CMHA 5F5LA 4DLBA 3HDJA 2VHXA 4E30A 5FYDA 3LSYA 3PWSA 3OQBA 4CQMD 4BQPA 3X2FA 3D5QA 4CLXA 1DJQA 4R41A 4W7HA 4OM8A 2O3SA 2DQ4A 3M1AA 1JLLA 1GPDG 1VKOA 3WGQA 1QLJA 3OEWA 3PHJA 5DNAA 1V3UA 3O4RA 2GPTA 3BMQA 1K0UA 3FD8A 3GLQA 1KEWA 5G4KB 1BXGA 3FBGA 3H7AA 1ZJZA 4CR7A 8ADHA 2EJWA 4PG6A 3EGOA 4J4TA 3VPHA 4DBZA 4WJZA 4NPCA 1ZH8A 2Q49A 4YQYA 5G0WA 2VZ8A 6ADHA 1IOLA 2J5RA 4D3SA 5COAA 1LLQA 2XOXA 2VN8A 4WKGA 1TVEA 5L40A 1DOHA 1B8VA 1UDBA 3R3SA 5HA5A 3WGGA 5IDQA 4W9NC 2VHZA 1I30A 4P22A 4AL4A 3S2FA 2VRCA 1GUFA 2VOJA 3S2EA 4R69A 4YJFB 4IPTA 2HMVA 3RU9A 3AJRA 1U8XX 4L4RA 2I3GA 3DBHB 4I9UA 4I9HA 5J23A 3D4NA 4EGFA 1GD1O 2A9FA 1UJMA 4QO7A 4QX6A 3AW9A 3DC2A 1X1EA 3ADPA 3DOOA 2B4TO 1BTOA 4IGFA 1GUZA 5G4KA 3BMNA 4B7UA 5A04A 3H5AA 2PKQP 3QLJA 2Z1NA 1ISMA 1KERA 1MFPA 2W98A 2WWRA 3K5PA 2E6UX 4R1SA 1SEVA 2PFGA 2CDBA 4J16A 4D44A 2ZB7A 1E1NA 2AEJA 3PDJA 5IZCC 3HG7A 4Q3CA 5EERA 3NKLA 1M66A 4XRRA 3WGIA 4O0LA 3CMCO 2JAHA 2V65A 4M86A 4Q3NA 1Q0QA 1QYWA 4PLVA 5KJCA 1HDYA 1F14A 3WBBA 2ZTLA 4LCJA 4QTZA 2ZKLA 3LT1A 3OIGA 3AUSA 4MP8A 4XX0A 5CDYA 3GNTA 1LLCA 2O50A 4LK3A 5I7VA 5JXWA 1ISFA 4G65A 1QYDA 3ICPA 2A35A 1G0NA 2VUTA 3G17A 3WQRA 4FB5A 3QVOA 4Q39A 3ULKA 1GL3A 1K6XA 1NP3A 4Y6RA 3UUWA 5BQFA 3HZZA 3P2OA 4DIFA 2G5CA 1CDOA 2VZ0A 3RC7A 4J7UA 2CMDA 2NVBA 3QVSA 1WP4A 2PZJA 1P45A 1PS0A 1WMBA 4XYMA 4WNIA 1NVGA 3INRA 4YVFA 2WE7A 3HDQA 3HN7A 2C20A 1XYGA 1JKIA 1I8TA 4AJ2A 3UFXA 4J1TA 4PLZA 4PGFA 1DB3A 2PTGA 3Q1LA 1KVSA 3D3WB 5F5NA 3U4DA 4B7XA 4MVJA 1VJ1A 2X9NA 1KVUA 3LF1A 4M8SA 2GZ3A 2BGKA 2AG8A 4KUGA 2BELA 2PGDA 4FDAA 4BV9A 1FDTA 3H6KA 3ICCA 4J7XA 1U7HA 1RJWA 1UZNA 3QVTA 4UVIA 5B4VA 3UGKA 1C1DB 2QZZA 3G79A 3LC7O 1QKIA 5JCJD 5IN5A 4IDFA 1X7DA 1KVTA 4HFMA 2Y1CA 4G5HA 5EPOA 2IXBA 1E7SA 4BKPA 3ZHBA 1QMGA 2GZ2A 3U3XA 4ALJA 3SJUA 4L4SA 4PLHA 3OECA 2HK8A 1BMDA 2HDHA 1JTVA 2P2SA 2FZEA 3S2GA 3GDOA 3RU7A 1IULA 2P68A 2IEBA 3PJGA 2VHVA 4ROSA 4UREA 2I67A 4BB6A 4N5NA 4QEDA 4QO8A 4GBJA 3IDSA 1ZSNA 1A9ZA 1JN0A 1PWXA 2R2GA 4YAJA 2RHRA 1H6DA 1EK6A 1OC4A 3D3WA 4CLEA 1Z73A 4IXTA 4O1MA 3IIEA 4BNMA 1PJBA 2ZQYA 3ZNPA 4CQLB 4BHTA 2HK9A 1JKFA 1Y1PA 2BMAA 3PZBA 4RQUA 3W1VA 1K5HA 2VRBA 3RSHA 3F47A 3FR8A 4D0RA 4OXNA 1WWKA 3F5SA 4FD3A 1C1DA 3EAGA 4IGEA 3V5NA 4L9RA 1VM6A 3WBFA 1DRUA 4M54A 1NQ5A 2DBQA 1ZK3A 1LRJA 3JQ9C 3WGYA 3HHPA 4ILKA 1C0LA 3WICA 5AXAA 4I5EA 4B79A 4E32A 1HDOA 3VOSA 4L73A 3VDQA 3UAGA 4IJUA 1T2CA 3NT4A 3ENKA 3AU8A 4OO3A 2WYUA 5KNLA 1NQOA 5BSEA 2NSDA 3ZGYA 4TSKA 1RYDA 1DC6A 4UULA 3KV3O 4WLUA 4YPOA 5ENVA 5LDHA 4XA8A 3HADA 1NX6A 3O26A 1OAAA 1NAIA 3IP3A 3I52A 2I3AA 2NV6A 4NR0A 2VZ9A 4B3JA 4PLYA 1MG5A 1I2ZA 4P4LA 3EVTA 4GWGA 3WTBA 2JCYA 2HAEA 1IPEA 3ZWNA 3PQEA 2YFHA 4NBVA 1UAGA 4DQVA 4RLSA 3TFOA 3U49A 1NWHA 1HEUA 1YO6A 2OHXA 2B35A 3LT4A 4I1IA 3SVTA 1YRLA 4GX0A 5BSHA 1LDGA 3DO5A 3QIVA 1U5AA 4E13A 5IAAA 3QP9A 2XXBA 1BDBA 1GZ6A 3V2HA 4OH1A 2A94A 4GGOA 1Y8QA 5FI3A 4CMEA 2P9CA 2G82A 1ZFNA 1PGNA 2DPHA 2GN8A 3ONFA 1EVYA 2AW5A 4WNCA 3H3JA 5K9ZA 4PFJA 5JDIC 1YL7A 2EGGA 4FFRA 3K6JA 3OQ6A 1BHSA 1R4MB 2DLDA 4BO6A 5IFLA 3JTMA 3VVCA 1G6KA 1O5IA 3GG9A 4YT2A 2PLAA 4OQZA 1ML3A 4BNYA 1LDNA 4Z3DA 3WNVA 2B5VA 1B14A 1ENYA 2J3HA 1QV7A 3ZU4A 5A5EA 5DBGA 1OMOA 1KVRA 5L7TA 3F1KA 3OF2A 4MVJG 3CH6A 1NFFA 3GFGA 2D5CA 3DBVO 1ZK0A 1T1SA 2IRWA 4PVDA 4P4GA 5HS6A 2E82A 1WXDA 1ZMOA 5I9MA 4CMJA 1V9LA 1IPFA 3DHYA 3Q2IA 4QFCA 1E3SA 1CF2O 1I2CA 3RC1A 4EUEA 4IINA 3C3XA 4KQWA 3ONDA 2VYVD 5GZ3A 5A06A 5I9LA 2GNAA 3AY3A 1VKNA 3WDSA 3BMOB 4WLEA 4Q9NA 5TS3A 2VWQA 3E03A 3JD2A 4EBFA 4YJGB 2TMDA 4Z0TA 1I0ZA 2PNFA 4R1NA 1IB6A 4QT0A 2O48X 2PA3A 1LXCA 1R4MA 4RVGA 4Y98A 5HWSA 3JD3A 5JW6A 1UZLA 3DMYA 4R54A 3RD5A 3H5NA 3KLPX 3KSZO 4M87A 4EEXA 1WZEA 1B3BA 2X23A 4QECA 3FPLA 1T4BA 1WLYA 3A1NA 2BFMA 3NDJA 4XR4A 3TZKA 1XWFA 2XF8A 2Y1DA 4XEHA 4BMVA 1QYVA 3EW7A 3EYWA 4YWJA 4CMAA 3D7LA 3JQAD 3PHGA 4HUJA 3C7AA 1C3VA 2Y93A 4BNHA 4O5OA 4XYBA 3QWHA 1PZFA 1WDLA 1UZMA 2W2KB 2Y1FA 5B1YA 3QY9A 4ND3A 5KVQA 3VH3A 3W6ZA 4Y6SA 5FFFA 1E3EA 3RUAA 4IDBA 4CMCA 2P4QA 3FHLA 3UCFA 4E5PA 5IN4A 4UEJA 3OBBA 2B5WA 3K96A 3M6IA 3UN1A 4E2YA 3GY0A 2EW8A 3H65A 5A3JA 1XLTA 3TZQA 4IJKA 4EW6A 3BMOA 3GN2A 5KJEA 5IDWA 1ARZA 3FR7A 1A7AA 3NJ4A 3UHAA 3FTPA 3NTQA 4HNHA 4FFLA 4JN6B 4U0JA 1AXGA 1IHYA 3OJLA 4PLTA 3OA0A 1R15A 3WWYA 5JAMA 4F6LA 1TT5B 1A4UA 3O03A 1AE1A 4A03A 2EW2A 4BNIA 3ZNNA 2YQ4A 4PIVA 3W8FA 3RQSA 1GQQA 3VZRA 1HZZA 1K2WA 3H9QA 5BNTA 5JO0A 1IE3A 1LQUA 1AN9A 1FDWA 4D79A 5I7SA 3F5QA 2I65A 2W2KA 1JQBA 4LGVA 4B4UA 2BRUA 4J91A 4B3HA 3I9OA 4D0SA 3GC6A 5K6AA 2Z1MA 1BG6A 5JLAA 3ROMA 1D1SA 3H9UA 5K0ZA 3K2BA 3GVIA 2B0JA 3GOHA 3AWDA 2P4HX 4ZICA 4DIBA 3Q3CA 3DZHA 3Q0EA 1NQAO 2CY0A 1D7OA 2H5LA 3AFNA 3I6IA 4NJMB 2POQX 2I76A 2VRCD 1E0DA 2FY8A 3E1KA 3WGHA 1N92A 1W0CA 1PU2A 1DBVO 4M55A 3S55A 1KEPA 3TZHA 4CMKA 1HDRA 4IUYA 4YDRA 1H5QA 3CZMA 1LQTA 4DBVO 1JAYA 4XWYA 3OHSX 1A71A 1BDMA 1GV1A 3B1KA 4ZQHA 3W8EA 3WNQA 3ITDA 3PHLA 4GAEA 1VJTA 3PK0A 3UCXA 3F1LA 4P38A 4Z3KA 1T26A 3ETDA 1K6IA 1KS9A 2BFAA 1I2BA 3PGXA 1R37A 3MOGA 3HJAA 1EMDA 1BXKA 1ONPA 2R6JA 2YV2A 1ADGA 3L4BC 2FR0A 4NI5A 5CG2A 1HE5A 2NU9A 3GDGA 3B6ZA 1B7GO 1PQPA 5LCXA 1GQ2A 3OFSA 2UYYA 3DB2A 3PJEA 1O89A 4N5MA 4U6QA 3A4VA 5EESA 1WDMA 4TZKA 4BO9A 1TT7A 1OBFO 2PGJA 3JYNA 4CM7A 3K8ZA 1QP8A 1VC2A 4WCDA 3GF4A 3MTJA 2Q2QA 2C07A 2UVDA 5AXBA 1E7YA 3ZWCA 4W99A 1RYEA 1VL8A 1PL8A 4QUKA 1RKXA 4CV1A 1Q0HA 3UCEA 3DZJA 1Z7EA 1YB4A 5A4DA 3DTTA 1YQGA 3LDHA 3WWZA 4JQCA 2QIOA 4AICA 4XYEA 1JWAB 5L51A 4J49A 3ROPA 4MKRA 2OZPA 3B70A 1IY8A 3PI7A 4IQ8A 4XCVA 1UAYA 3QE3A 1GCUA 2AQHA 1SZJG 3TL3A 3L6DA 4PLPA 3QWFA 4Z9FA 3RROA 4BKQA 4CUKA 1YDWA 2D4AA 2YQ5A 4GKBA 3COSA 2PZKA 2NVUB 2O7QA 4K9DA 1H0KA 1U8FO 3K31A 2JCVA 4U6SA 3LT2A 5ICSA 4GVLA 4A7PA 3JCZA 4NFSA 3JQ8B 1E3LA 1UH5A 3BAZA 4ZJUA 2X9VA 1E92A 3EZYA 1KVQA 1N9GA 4R3WA 3MEQA 2W4QA 3E9QA 1FK8A 4WEOA 1U9JA 4ZD6A 3PDUA 1U3TA 3DZGA 4CMIB 5DBFA 5IXSA 4RLHA 1SAYA 3O8QB 2I9PA 2RHCA 2O23A 2Z5LA 3OH8A 4MOWA 4A10A 4BO0A 1ZK1A 4XIYA 4JX8A 5C5IA 2BD0A 4E2XA 5BR7A 3HB5X 4DXHA 1HSZA 2VTDA 4XIJA 4DLAA 2Y1GA 5GY7A 4MVJP 1Y8RB 3LF2A 5JYEA 3DHNA 1E77A 4GL4A 4Q3EA 4DC0A 3IKVA 1X0XA 2HRZA 1GQYA 5JSFA 3JQEA 4IDCA 1B3RA 1U3UA 4R1TA 1NHWA 1KBZA 3Q9UA 4UVGA 3PFWO 4BB5A 4NFHA 3UXYA 2O3TA 3E48A 4ALMA 4YXFA 4W7IA 3IP1A 5DCWA 1SB8A 1YOVA 5C7LO 2RIRA 2VQ3A 2NQTA 2CD9A 3A06A 5GZ6A 3PYXA 4IIUA 3UH1A 4CJXA 1YKFA 4LSWA 4Q3BA 3ZW8A 2VT3A 4EUHA 1YH3A 4DYVA 3FRJA 4CUJA 4FJ1A 3T4XA 4J6FA 2DTEA 5MDHA 3C8MA 3ROKA 1S7CA 3GH3A 1TI7A 5KJFA 2QG4A 4BKRA 1IZ0A 1B16A 5TIIA 3L07A 3TQHA 3O8QA 1ADFA 4W9NA 4KWHA 4ESOA 1D8AA 1U4OA 2P91A 5I8ZA 4DC1A 1Y5MA 4UVEA 5ITVA 1E1KA 3G1UA 4G2NA 3NEPX 4L4XA 3ON5A 1GAEO 3VAZA 4FN4A 3WJ7A 5AVOA 2ZJ1A 3D5TA 2GN9A 2Q45A 2B37A 3AI1A 4R16A 1A9YA 3F46A 3GEGA 3QJ5A 4G81A 5A3VA 3KM0A 4B7CA 3DFZA 3ZWVA 1Q2XA 2WYWA 2FHSA 4MVJE 4F3YA 1P9LA 1E7MA 1O0SA 3HSKA 4QFDA 5A03A 2WDZA 3Q2KA 5H82A 4BVAA 1PJ2A 4XJTA 5F21A 3CTMA 1TXGA 3NJ8A 3ASVA 5IZCA 1PX0A 4OXYA 4B8WA 1ONNA 1O94A 4W6ZA 2NTVA 2WEKA 1HE4A 3ZW9A 3JSAA 4BGEA 3WQQA 1ZXLA 4BGVA 5JYDA 4CM9D 3WOHA 3BHJA 1YBVA 4CR8A 2OO5A 2ZB3A 2PZLA 2ZCVA 3BA1A 4FCCA 3KHUA 4ZN6A 5KKCA 4X54A 1XDWA 2GN4A 1GCOA 3LK7A 2O7SA 4QSMA 5U4QA 2EP7A 2CVZA 5B12A 5T67A 2GCGA 2BFOA 1FJHA 3L6EA 3M2PA 4C7KA 4K6FA 2HJRA 1X1TA 3T7EA 5IG2A 1HETA 3G0OA 3TRIA 3OP4A 4Z6KA 3H2ZA 1PJQA 4LMPA 4GKVA 1K89A 3L77A 1EZ4A 4RVHA 4NDNE 3KSUA 1XQ1A 2NACA 1LLDA 1GZ4A 3SC6A 5JCXA 3H3FA 3OSUA 4GLLA 5DP1A 4RF3A 4XQ9A 2QRLA 5DN9A 5ILOA 1LI4A 2PR2A 1I33A 1X13A 3GNQA 2WD7B 2IXAA 4N18A 3IL2A 1UP6A 1N8KA 2D1YA 4XB1A 2EWMA 4EEZA 4J2HA 2C54A 4PZEA 3PGJA 2GSDA 4D45A 1QRRA 2WMDA 2NUAA 2AQKA 2CDCA 4BO5A 4OSPA 3KYCB 4GH5A 3QW2A 1DDOA 2P5UA 4NG5A 5C37A 1MP0A 1PIWA 4FR5A 3ZWWA 1NWCA 3GAZA 4J1QA 2PZMA 2DBVO 1ISIA 2GERA 3WSWA 3QV1A 1ZKMA 1P0CA 5T57A 4BNXA 2NLOA 4YEDA 5TC4A 3WGZA 2NU8A 5H81A 3E18A 3ZU3A 4TMFA 2Y0CA 3WFJA 3JYPA 1GYRA 3KO8A 4GSKA 3GNSA 2ET6A 1NHGA 3OJEA 3TF5A 5BSGA 4L0QA 1P0FA 2C82A 4PG5A 4TZTA 3GZ4A 3I9MA 4A26A 3D0OA 4RVSA 2WD7A 1TB4A 2OBNA 4H15A 4EI2A 1PJSA 3A9WA 4MP6A 5BNIA 1BW9B 1R0KA 3WYEA 1LDBA 2HU2A 1P77A 2DBZA 5JE8A 1ISGA 3A14A 2Y67A 4HFRA 4MPDA 4Z0PA 4URFA 4YJFA 3G49A 2J3JA 5KOIA 3TSCA 1ADCA 1BRMA 3DBHA 2X0IA 3KRTA 1J0XO 3U62A 4BNVA 2A92A 1MV8A 1X7GA 4FC6A 4IDEA 5FI5A 3OM9A 1EVIA 4PRLA 1U5CA 5HBRA 4PRKA 4XGIA 2PD6A 3ZWOA 3ZHZA 4CM4B 4BNTA 4MDHA 1LUAA 2FZWA 4R3NA 1FXSA 5TF4A 1J6UA 3I5MA 3RBVA 2DAPA 2EHDA 4KTTE 3INGA 3TNLA 1DC5A 2Q3EA 4C4OA 3IQDB 1ZEMA 3GVHA 2P5YA 3D4PA 3VKVA 1ULUA 4XDZA 3QWBA 1A5ZA 1YQDA 3ZV3A 1PJ4A 3VH2A 4EJ6A 3KSDO 3DZFA 4YAKA 2GN6A 4Z9YA 3BZUA 4J9VA 4XGNA 2O3UA 3PTZA 1BW9A 1UDCA 2A4KA 1Y81A 2C2YA 4I08A 3TZ6A 2Y66A 1LRLA 4MKZA 3B20A 3VKUA 3R3JA 1NASA 4Q3AA 1M6HA 4TVOA 2E4AA 4MJLA 2H6EA 3KZVA 2VHYA 3HB4X 1Q0LA 3H8VA 3Q6IA 2VUSA 5TQVA 4HFJA 3V8BA 5TRTA 1NYTA 4BO8A 1R0SA 3VH1A 5TNXA 2G0TA 3STHA 4B4VA 4E5YA 3LC2O 5G0SA 3U4CA 1YXMA 5CEJA 2HMWA 1U2GA 1V8BA 2CUKA 3DAPA 2X1HA 3ROQA 3PYMA 4BNKA 1N1EA 3C24A 2BGMA 3I4CA 1AHIA 3HDYA 5KVCA 4A5OA 4E4YA 2JFHA 2QYSA 1ZZEA 5A5FA 4DVJA 4GPD1 1GYQA 3E5MA 5F1OA 2GDZA 3ZHYA 3PQFA 4FGSA 2C7VA 5JDIA 4OKIA 2DC1A 4JJGA 3TN7A 3DBRB 2YDYA 3D4OA 4JBGA 3V2GA 2C2XA 2FWMX 1M6WA 3Q9NA 2VTEA 4PN3A 2IYOA 1VRWA 4RVDA 4NBTA 4DQUA 1PSDA 4A0SA 4RPJA 2JD1A 1LBEA 1H6AA 3R6DA 3UVEA 3C1OA 3GVPA 5DCUA 4NK5A 1NVTA 5A9TA 4LMRA 2FMUA 4EJMA 1PGPA 2VWPA 4GMGA 2Y0EA 3M2TA 4TVBA 3VTZA 3UICA 3JQ7B 2W90A 1YB1A 1DO8A 1SOVA 4FSHA 3VPGA 4BKOA 1MXFA 3AOGA 4XYLA 1Z7BA 1ZEJA 3L9WA 5COQA 1YVEI 4H7PA 3RKRA 1DHRA 4DGSA 1DFHA 1JVSA 2WM3A 3RC2A 4CPDA 3U9LA 3PP8A 1HLPA 3ZN2A 1C14A 4YACA 3MJTA 4OOEA 1I3KA 2J5KA 1ZJYA 3RJ5A 3TWOA 3CEAA 3TPCA 1O6ZA 5JMWA 1UR5A 5L9AA 3MZ0A 1ENOA 4PG7A 4DUPA 4PG4A 2O2YA 2CDAA 2PK3A 3QQPA 4CUZA 3BTSA 1DIHA 1DLIA 4CQLA 4GLOA 4N5LA 3WSVA 2O3JA 1JAXA 3A28A 4GX2A 3MWDB 3ZNQA 4D46A 3I3OA 3K9QO 3HFSA 3DAFA 3C1TA 3EVNA 2Y68A 4ZQBA 2GASA 4IDGA 3DTYA 3IC5A 4BMSA 5CDTA 1R6DA 3GR6A 3G1TA 3WB9A 1WVGA 4HY3A 1I10A 2YZ7A 4D3DA 1YGYA 4AJPA 1A72A 2WSBA 4BNNA 5C7IO 3JQ7A 7MDHA 7ADHA 2FSVA 1DEHA 1P33A 1GEEA 5IJZA 3HUDA 2GZ1A 2X0RA 3W4KA 2IZ1A 4FQ8A 2R00C 3DEYX 3GVXA 4JP3A 3GGOA 3GEMA 3E82A 4BMNA 2C7GA 1CQIA 2X22A 3FN4A 3O9ZA 3WYBA 1DIGA 1E5LA 1X15A 3ENNA 3KTDA 2DM6A 2DVMA 4WPGA 1W8DA 1HDGO 2C29D 4NBUA 1BVRA 2RCYA 4F46A 4TRMA 2NTJA 1RM4A 3GGGA 3H9JA 3AUTA 3FSRA 3WGTA 3ORFA 1F8GA 4CMGA 5IZ4A 5TJ9A 4XJSA 2OP0A 2PKQO 4JK3A 2AQ8A 3BTVA 2D59A 3E9MA 3PHIA 5CHEA 2YW9A 1V3TA 1VL0A 3I6QA 2HSDA 3WX0A 1ISHA 4UUMA 4HXYA 2Y05A 3OIDA 4JBHA 4RCVA 2LDXA 4AJNA 3AI3A 4BNFA 4K1LA 2UDPA 2VYNA 3RI3A 5IF3A 3L9XA 1PGQA 3CUKA 5HTOA 2RAFA 3GGPA 3GRKA 4MIYA 1GYPA 3QWAA 4IQ0A 4K26A 5T8KC 4DPMA 1MX3A 4ZGWA 1KY5A 4RZIA 3RUFA 1LEHA 4E31A 4J9UE 1GFSA 1NNUA 1E5QA 2IE0A 4S1VA 4BQRA 3GQVA 1L7EA 1HYHA 5L7WA 1GV0A 4KMSA 1PR3A 2Q1TA 4D7AA 1MC4A 5TGDA 2Q4BA 5JMPA 5DT9A 3DBLB 5EN4A 5I8WA 1C0KA 3ZHXA 3ONEA 3AM4A 3VTFA 4YRAA 4J90A 1R0LA 2BF7A 3WJAA 5KJ1A 4IJWA 1MA0A 5CPBA 5JC1A 1JWBB 4J4BA 2Q1SA 3L4BA 2AG5A 4KWIA 2ZTMA 1HTBA 3K92A 1DAOA 1NM5A 1SBYA 3ETEA 2V6BA 1RM5A 3U4IA 1VE9A 2UUOA 1F06A 3I83A 3RAJA 1X14A 1H9BA 3N7UA 4PZCA 3TDKA 5ENDA 1KIFA 4YJGA 1T1RA 4FPXA 1E3WB 4WLFA 4BO7A 3AOEC 3BMCB 4DIOA 4H16A 4U0KA 2H1SA 3PWKA 3NT2A 4HADA 5G0VA 3EMKA 1V3VA 1KEUA 4FW8A 5CAEA 1DIBA 1B8PA 1E6UA 1EFKA 4II2A 1GY8A 1HDCA 2C59A 5JDCC 1MFZA 1R12A 1N2SA 3NTOA 1GZ3A 4IMRA 5CDSA 5LC1A 3LT0A 5COBA 4ZVVA 3ZV4A 2F1KA 1DFGA 4OIMA 1QLHA 1LSOA 1B15A 4OYRA 5A1TA 1VI2A 2GRAA 2C5EA 4INAA 4LSMA 1VLLA 5EQDA 3JYLA 5JAIA 1P1FA 2B36A 4EITA 4RF4A 5AYVA 1H6BA 3GT0A 4HWKA 1KOLA 3SJ7A 5ITWA 4FIZA 3RCBA 4QQRA 4DMLA 3GMDA 3RFVA 2B83A 4R5MA 1E3WA 2YHIB 2EEZA 1PS8A 4BKUA 1Q7BA 2ILTA 4LVUA 2EIHA 1TT5A 1B2LA 2CVOA 4CM6A 3ZWAA 1PL7A 3O38A 4ALLA 4R4JA 2Q2WA 3ZV5A 2I6TA 3INTA 1R4NB 4BV8A 1WDKA 2Y99A 5JC8A 4M49A 2IEDA 1E1LA 3BYZA 3IUPA 2GR9A 4NIMA 5EL0A 3VPXA 4U5QA 4YRDA 5TJHA 4LCEA 4BNWA 4LN1A 4PZDA 2O3RA 1UXKA 1LTHR 1U7TA 3HFGA 3AU9A 3JQGB 2WTBA 3HNPA 4E12A 4FBGA 1PZEA 3KYDB 4J0EA 4F6CA 2FRDA 2ZTUA 3NX4A 1XSEA 4YQZA 4OKNA 3IS3A 1QYCA 1UXHA 3AI2A 4OJNA 1PL6A 2YDXA 3OICA 4NJMA 2DTXA 4S3MA 2X9GA 2WD8A 1HRDA 3DHEA 3VH4A 2E48A 4BNLA 4BNUA 3BIOA 3F4LA 1JW9B 5L95A 1HF3A 1VSVA 2VT2A 4RO0A 4YAGA 1PGOA 4I5GA 3WG9A 1LLUA 3PEFA 4RF5A 4TKMA 2J8ZA 1EDOA 3P19A 3S2IA 2EV9A 2EXXA 3NV9A 1OOEA 2VUUA 5A05A 1NTOA 1R4NA 4JJIA 3WXBA 2IZ0A 2E37A 2FP4A 3TZCA 2OMEA 4F45A 5TSDA 2YUTA 1EVZA 3LVFO 1ENZA 2JAPA 4UUPA 3WIDA 1DXYA 1L1FA 3DMTA 1F17A 1DFIA 5JY1A 4CLDA 1I3MA 1PZHA 5BNFA 2QZ9A 4ZQFA 3I9JA 4MVJD 3KXDA 4JXKA 3SBOA 2WE8A 1RM0A 2D8AA 4I8XA 3GRPA 4K6CA 2PY6A 4NU6A 4E5MA 2AEMA 3NGLA 3GUCA 4A27A 3CMMA 3LZ6A 4EDFA 4OOFA 3SLKA 2JHGA 1PGJA 3ASUA 1KC3A 4ZHSA 1ONOA 1G1AA 3PJFA 1I3LA 2AQIA 1EE9A 4MVJF 3DOCA 4RVUA 4WCFC 8LDHA 2NTNA 2DU8A 5A9RA 1HWYA 3NDIA 4WEQA 2JJYA 1NR7A 3AM5A 2Q1UA 4MIEA 3V1TC 4W82A 3GPIA 3OETA 3JQBC 4RPGA 4PCVA 4WOKA 4BNGA 1M76A 1XEAA 1IHXA 2NVUA 1MC5A 4HFNA 4RGBA 5KCZA 2Q99A 4AJEA 1YBMA 3PWZA 1I01A 1SMKA 2VNSA 1N7GA 3BHIA 3LQFA 1DIRA 3M1LA 3SEFA 3X2EA 2O3QA 2CF5A 3JQ8A 4BNJA 4IBOA 4GVXA 2PD4A 2AEFA 2D0IA 4RZHA 2X0NA 1P31A 1DRWA 4RF2A 2WYVA 2FPPA 3JQAB 3MJ4A 5G2OA 9LDTA 1SC6A 1Y9EA 1YJ8A 1ENPA 3FCOA 2EJVA 1LSSA 3FI9A 2X5KO 1D3AA 4ITUA 4IZIA 1RM3A 3GVCA 4CMIA 1PZGA 4ID9A 3F9IA 1VL6A 3U4HA 1I5RA 3RVDA 5L4NA 3GFBA 1EEHA 1LU9A 5TT1A 1GADO 1ZMTA 1JDJA 1Q7CA 1N1GA 2QW8A 4FFNA 4OGWA 2PH5A 3ADOA 3UF0A 1Y8RA 3GK3A 1ZW1A 4R1UA 3K73O 4UAGA 2QX7A 2VYVA 2ZQZA 2RH8A 1DLJA 1O9BA 1TA4A 1EDZA 4WASA 4YT8A 4KTVE 2ZTVA 4KUHA 5TX7A 1YQXA 3H9EO 3V1YA 1UXGA 4MINA 4GSLA 2YY7A 1H94A 5L4LA 1HXHA 3MWEB 4NQZA 2W2LA 5ES3A 4KOAA 3BMQB 1SB9A 3JD1A 2BH9A 3VZQA 3ZDFA 1BWSA 1LNQA 4HKTA 4LRSB 1BXGB 4R51A 5C7OO 2OL4A 4BO3A 5HM8A 1LA2A 4Z0HO 1T2DA 4JROA 3GEDA 3SXPA 1YL5A 4TRNA 3K2EA 1JKJA 1EK5A 1LX6A 1ZIDA 2AHRA 2XAAA 4BOYA 1CJCA 4KDFA 4KUEA 4RV9A 4YT4A 5JAZA 1LC3A 2UV8A 4BO4A 3PPIA 4D3FA 1EBFA 1U3WA 3N58A 2VWGA 3DZIA 4N7RA 2GGSA 3ST7A 1VPDA 4NBWA 3DR3A 3KUXA 1XU9A 5IDXA 1SO8A 2FPIA 1IL0A 1HKUA 1HDXA 4NJOA 2UUPA 4ZRNA 3V1UA 1NPTO 1XELA 1XR3A 5B37A 4CODB 4XRGA 4KZPA 3ITKA 4J3FA 1ZBQA 1A4IA 4YR9A 3QWIA 3OJOA 5EQFA 5ICMA 3L6OO 2YHUA 3FTNA 2BI7A 4AJJA 5JO9A 3WYCA 2NVWA 2I5PO 1XA0A 3OQ1A 1EBUA 3BMNB 2Q50A 1QG6A 1B0AA 1YJQA 3NGXA 3RC9A 3KEQA 2OXIA 4D42A 2EGHA 4ALNA 2ZK7A 1EUCA 4EYEA 2C0CA 4AJOA 4KDEA 3G3EA 4PLFA 3S8MA 3C1AA 2VOEA 3HN2A 1UXIA 4Q3DA 3RFTA 2NQ8A 1YS4A 5THQA 2VYND 5F1KA 3WFIA 3DDNA 4B4WA 1Z74A 1SPXA 4CM3A 2Y0DA 4CMBA 4YYZA 4IS3A 2I99A 1T25A 5G4LA 1P1JA 4IQGA 4BNZA 4IJVA 3JQFC 3EY4A 4L8VA 3HQ4O 2AA3A 2DFVA 1Y5RA 4MKXA 3OJFA 2B4QA 4RORA 4ALIA 1VSUA 5T64A 2HJSA 1N5DA 4I5FA 4EUFA 1NBOA 1WNTA 3H9GA 3SX2A 1W6UA 3D1LA 1UUFA 4Y6PA 1GTMA 1HSOA 1ZSVA 4XYGA 4E5KA 4TWRA 4TRRA 3RUCA 4QXMA 3NUGA 3PIIA 2JKVA 5F3RA 1XCBA 3KYCA 4MVJI 2V6GA 2V7PA 2HRBA 3PJDA 3CINA 1LRKA
chains in the Genus database with same CATH superfamily
3UJ9A 2F3UA 4YJ2B 3GJ4A 4YAEA 1CUVA 1W9HA 3QU5A 3LSTA 3FOCA 4J0KA 2GUGA 4KAAA 1CJMA 4KQFA 1TYEB 3I72A 4LX8A 3FWHA 4YAIA 5BVHB 4IKEA 1H8EA 3P0EA 4BN0A 1JSCA 1KNQA 3QKUA 2IH4A 4IIJA 3VDRA 1VG9B 1Z34A 2MTBA 1ZISA 4QULA 4RMHA 4TMTA 1IQ0A 2OXEA 4BZXA 3KOWA 4QG7A 1TL7C 5U1PA 1JIVA 2QM8A 3E1SA 3N8IA 3QELB 4F3NA 2R79A 2Z9CA 4RL6A 1CHDA 4WV3A 3P5SA 5BVGB 1GU0A 2ASVA 4E51A 5DF1A 5FA5A 1AMUA 2ZE8A 3SDSA 5LVAA 1ISRA 1U0TA 4OYLA 3S2UA 1MO5A 2H92A 4TV9F 4XCQA 5DHAA 2NZ8A 1S2GA 5E3JA 1N4AA 4AZ0B 4FOLA 3LO8A 1XTKA 2OORA 3PEYA 5J58A 4RLFA 2BFBA 5MN5A 4WECA 5D6OA 3AHIA 1BE6A 4EA9A 4ARCA 4BU1A 1RWBA 4HV4A 2QUBA 3BKWA 2CNNA 4JUDX 2K4MA 2WSSA 3CWZA 3DOIA 2P9GA 4DNOA 2AE1A 1I3OA 1HDZA 3CCCA 4EQ6A 1C4XA 4DL9A 1YUMA 4DLUA 4ND5A 4F2WA 7YASA 2Q0XA 4HEJA 1N8NA 5D86A 3UT6A 3GRRA 1SVNA 5IX8A 1W47A 2A86A 3DQPA 4YJ2A 3V7FA 5CXQA 1T1JA 1WUKS 4L7QA 2PQ0A 4N7MA 3SE7A 1QFSA 1LV8A 2A58A 3DL7A 3FMVA 4LXTA 4RNCA 4AJ1A 4CU5A 3PA6A 2IU0A 4OLAA 2BMFA 3D7KA 3SXUB 5MGBA 3D3EA 2UZAA 4CM4A 1JP7A 1TM1E 1VJ0A 4JNKA 5HRUA 3STUA 1JU9A 3CRMA 1CLEA 3KJNA 3NOOA 1AO0A 1W36B 5JBIA 1DEAA 1L5QA 4U8GA 5L3RA 3OJ0A 3M6LA 2X7HA 1AHHA 4YLGA 3VSCA 5CLJA 4KR6A 2LIPA 2G1UA 1Q83A 2G83A 2OHOA 3OJXA 1ZOLA 3HWRA 2AE2A 3P9NA 1AUVA 3PDWA 4I14A 4YRPA 3H1AA 3JRXA 4DAOA 4B0PA 3WMRA 2A0WA 5DHSA 4GKAA 1FSGA 4J0FA 2ZIXB 5E3IA 5FF9A 5K2MA 2QLTA 4N47A 1JX6A 4JSYA 4K87A 2YC4C 3M6MD 2I4OA 5F7JA 3N5KA 2GBGA 2JAWA 2NSHA 1LJ8A 1X8JA 3TIXB 4C0XA 3AEYA 3DM5A 1Z56C 4NOMA 4QAQA 3GLFA 1DJLA 4CBVA 1EFPB 1JYEA 2I3DA 2IYTA 2KMLA 3R9XB 2RHTA 4NH4A 5F7XA 1GGNA 2JH9A 4DRYA 2Z5VA 1C8KA 2HHJA 3LKBA 4HBGA 4HT3B 2FR8A 2C5LA 2H48A 1SVKA 3LPNA 4DPLA 3CIFA 2PRJA 5LKAA 2WVHA 1RLMA 4C0BA 2XB9A 4MS4B 2BF4A 2NO7A 3PITA 3LRTA 5H3LA 2YIJA 2FKAA 2YY5A 1FY2A 4BVHA 4HNUA 4BUCA 4DBLE 2R7LA 2YZMA 3SS8A 3WLTA 3KJIA 3BGIA 4DRXB 3IB3A 4NPHA 3ZHRA 1HMYA 1LSJA 2O1EA 4LSZA 3UZUA 1G55A 1LSUA 1VRCA 3P9PA 2B1QA 1OX4B 4H35A 1XAJA 4NZOA 4P9NA 2AI3A 3VU9B 4FT2A 1OY1A 5T8KA 5AWFC 1M34A 3AO0B 2ZIXA 2W2MA 2WIBA 4O63O 3DBRA 5ER9A 3V7YA 1F2TA 2ZOSA 4KEAA 1NFQA 5AJWA 4E5UA 1UKVY 2CMGA 3L8EA 1SXGA 3SHVA 4E0BA 1JG2A 1P1CA 4IO0A 5E6RB 5G3YA 2XYVA 3G9QA 3UKOA 4UNNA 5BRAA 5JEDA 3DDSA 1QHNA 1ZVKA 3FJ1A 3MXTA 4KC0A 3SC4A 1Z13A 3SHOA 3R9XA 4N54A 3WDMA 5DOVA 2P62A 4QNRA 1DKMA 2R4UA 3F0TA 4IXWA 4GL2A 1YB5A 5EOVA 1QGDA 2PGNA 2R96A 4BO1A 4ZDKA 5BN1A 1JYSA 3PUYA 2XEXA 2CCGA 2NM0A 3BK7A 3NFRA 2BM1A 4PQFA 3SBEA 2AX4A 4FLEA 4WLOA 2G06A 2DPYA 2ZBEA 3FKSD 5E6UA 5EKDA 4QZVA 1QGZA 3K9NA 5C3MA 4COKA 1KFBB 1QE0A 1KXJA 5EIOA 1SN7A 3A37A 2W11A 1JSRA 4BUJA 3KDAA 4QDZA 2V1UA 1NG9A 2HLDD 2VDQB 1UC8A 2V6MA 3T0IA 2B2NA 1GU7A 2BKLA 1TLFA 2GWHA 2DPMA 4XPIB 5K20A 1ZUD1 3AEQA 3RS9A 2FMHA 5FTMA 1YONA 3QOFA 4D9MA 2F3RA 2YV3A 3RJZA 1X7WB 4DRXA 1KO8A 1B6SA 4GI1A 1PF7E 4CL3A 1VIMA 1V2HE 2OCLA 1QB8A 3VU9A 4ETMA 2QBYB 1I94B 4OXKA 1ZN7A 3OTQA 4F5DA 4HLCA 4FCVA 2VO1A 3W7AA 5F5XA 4YRRA 2G80A 2PO7A 1NATA 3USZA 3AOEA 2DUWA 3HE3A 1SVSA 3MCVA 1N0VC 4YB8A 3TNJA 3KYJB 2FN8A 2AJCA 3T4UA 2V4UA 3FJOA 1PLLA 4RPHA 5E6RA 5FTNA 3K8YA 3BD9A 1GPNA 2QE7A 2NAFA 3G2QA 1MAVA 1IN7A 5KNDH 1E7QA 1RCFA 1FRQA 1OI4A 2OBYA 2OEPA 3AIKA 3KU1A 4K5QA 4UVHA 1L5NA 3UFBA 1XKQA 4B6OA 5I01A 4QU0A 1WB4A 2FSHA 2E49A 3H99A 1II0A 4KL8S 4UUNA 2CNOA 2PS3A 5LZ7A 2X4LA 1UC4B 5SZJA 2R8YA 2V6IA 4IDAA 3DAGA 1ZWKA 5I7EA 1MABB 4U2FA 3ZWYA 3PLNA 2KHZA 1SXJA 1WBJB 1RMQA 5CVVA 4W7SA 2ZRAA 2BEWA 1CULC 4HC4A 4HDAA 1ZR2A 5AXCA 3MBKA 4EJMA 1ZVQA 1VGRA 2F1HA 2SICE 4BWYA 5ALXA 2OGUA 2P90A 2BR4A 3U7QB 4RDHA 5ERYA 1HT0A 1ZA1A 4N6OA 1CUZA 2O5CA 1QVAA 4PLCA 3UJAA 3QXHA 3VZDA 3UM9A 3KEOA 4IIYA 3OZWA 2JKZA 1DUVG 4US1R 1KETA 3AUFA 4YTEA 4A2CA 2CBXA 4LHYA 1SU8A 1UXJA 2J3IA 3B1FA 1VYHA 1KKUA 1GWNA 1SRRA 1RRGA 2OP1A 1D8TA 2PZEA 4XR9A 3IMGA 5K4HA 3GJSA 1U5BB 2DT5A 2JGDB 2NZUG 2Y4NA 1YZLA 2ZEJA 3A6EA 1U99A 2PVCA 3JV7A 4KVZA 4RFVA 2H5EA 1K88A 4C3UA 4YT5A 1AGNA 4HAIA 1UEXC 1RBQA 3C74A 1UDXA 2WWHA 5E4TA 1T2EA 1X9HA 5BXQC 4NYMR 4JUCA 3ILHA 5GONA 1G38A 4JASB 5BQPA 2HLPA 3RJ9A 3ZGLA 1NYRA 3PNQA 3E9NA 3BRQA 3R0IA 3UJHA 3LU1A 4E2ZA 3C15C 1ZUHA 4OJYA 1E6EA 2ERCA 3SWWA 4JB0A 1FDOA 5JAZA 1O94D 4HAOA 1N2JA 4OHCA 3QMMA 4UEKA 4DM4A 3M1IA 2PH3A 5AQEA 4F8JA 1EUYA 3FPCA 5LA6F 7AT1A 3DQQA 1XI2A 2BGTA 3P32A 4BQOA 2OQRA 1YI0A 2EKQA 3VUFA 2FGJA 4M8LA 1O54A 1SY7A 1T5SA 1ISJA 2OLEA 3FPHA 3G0CA 4CMEC 4KITB 2XMCA 3IAS1 2XRYA 3OZVA 2FSVC 3U7QA 5FEUA 3WRYC 4ONEA 2QUZA 1TJNA 1YKSA 1UM9B 2YMPA 3O1HB 2CMHA 4RQTA 3ZJ4A 4C1NA 1T9HA 4Q01A 2IYPA 2DP4E 5DLPA 2ZVPX 5KC8A 3UOAB 4BXOB 1JQKA 1IK6A 2O2JA 4L51A 1T4GA 2DF8A 4EP1A 4FW9A 1CYDA 4ZEMA 2VDOB 1I80A 1EUZA 1XTTA 1FW8A 1P74A 2CLIB 2YWDA 4NNJA 1Z17A 2V7TA 4E5NA 5B7QA 1KI1A 1JIUA 1U5BA 2JGDA 3NAQA 5CM9C 3ZTWA 4FZ3A 4DJ5X 5JQGA 4O3MA 3W6UA 3DBLA 4WCFB 1GTJ1 4QQ8A 5I8PA 2WSIA 2QXYA 4ZPXA 2OM2A 3NNSA 3OPVA 4AG3A 3KL2A 5DFAA 2HF7A 2F1OA 2HQSA 1IXZA 2B30A 3EC1A 4IDPA 3VFDA 4ESHA 3G0HA 2FP3A 1WZUA 1N5MA 3CZRA 2IGBA 3LNTA 5C31A 2OGSA 3ZHSA 4B48A 4R9NA 1VHDA 1H93A 2HYDA 3DCJA 3HDHA 3OEYA 4YV0A 1F8UA 3GMSA 1OH8A 3PVSA 5HF5A 1USGA 2QR5A 1KTVA 1BD4A 1L4EA 2I7DA 2XTZA 3HI6A 1UJ5A 4LOLA 4RACA 3ZWXA 5CFRA 1U0GA 1YDGA 3KWFA 5EVJA 2G5GX 3IR6A 1TE2A 3VHRA 2HA6A 3LUAA 4NFYA 3GUUA 1SNYA 2WM8A 3GRVA 3WI7A 5J1SB 4HD8A 3KQKA 1W0KD 2Q0SA 3BMCA 4FFPA 1J00A 2XYHA 4F3KA 1E2BA 1GKUB 5JCJA 3GXOA 4MKIA 1BCSA 2YV1A 3K6KA 1KE1A 4BXOA 2PU7A 4FHZA 1GN8A 4D57A 5J2TB 1MX5A 4ZRMA 2ZLBA 3WBKA 2Z95A 3CUVA 2VHWA 1EX9A 1H2HA 3ISVA 4YIHA 1SCNE 1IWPB 3IT0A 1P9OA 4S0XA 2NU7A 1QSGA 3WIEA 4CTJA 3IULA 4WCFA 3K0FA 3ZDRA 6ABPA 3WL4A 5FCDA 3U3DA 1KA9H 5ED0A 5K09A 2RKBA 2BHSA 1Z5VA 4G0MA 3HY6A 2PKRA 4XEUA 4AKIA 3TQTA 4ND2A 4ND1A 2J48A 3HO8A 1M10A 2CJYA 2EU8A 1L8LA 3ILXA 4JC4A 4JR0A 5DGHA 4ZQEA 5EJAA 3R8XA 3UMSA 1QHEA 4X62B 2QN7A 4GPBA 4MPTA 5DOZA 3EDMA 1Z82A 1ZUNA 2ZJ3A 1NV8A 2VP9A 5I7RA 3IDZA 1B42A 3L7AA 4YP7A 5B2FA 1Q1NA 5L6MB 2B2XA 1V26A 3QJYA 4HDCA 2FMTA 3HUEA 3IXMA 2VDPB 2E1RA 4R84A 3RBXA 3PE4A 4DAEA 2XA1A 1TM5E 1HEYA 2Z8XA 3KDSE 3OZCA 3WLNA 3AUXA 4L16A 3TCKA 1J23A 1M67A 3ZU5A 2XV1A 1XLTC 2EKLA 1VHTA 5HX7A 2F43A 3IV9A 1UINA 4HZGA 4LNHA 4DFDA 3INNA 2DFDA 3SJBA 3OE5A 2DY0A 1FF9A 1IM2A 3TAXA 3KXKA 3R0XA 4FONA 421PA 2LVBA 3FNIA 4HVLA 1THTA 3CF0A 2QQ0A 5DW3A 4AZ3B 1RYYA 5A62A 2WUEA 3EEQA 4A73A 1RI3A 3NBKA 2W42A 2Q3JA 1N9GB 4GOXA 5JJLA 5TXGA 4BVLA 2D2IA 2G4VA 3Q98A 1TCVA 2EWVA 1D2HA 3WZLA 1FDVA 4KN5A 5A6SB 3LTEA 4EYGA 3EHEA 1I36A 1XLUA 3A6DA 3H8WA 3RGWS 3TXYA 2B8WA 5DM70 4MQEA 1FTQA 5HYVA 2C77A 4RH0A 2WKRA 2B98A 2VTBB 3KJXA 3O75A 1DG1G 1OWMA 1YA8A 3CLSC 3KPUA 2D5AA 4BVJA 3KETA 3HNRA 4L5BA 4Y0NA 1X38A 3WC4A 3TEFA 4IIJF 4RU1A 1H85A 2AFHB 1XQWA 2DKOA 4NE2A 2Q27A 1GR0A 3T9FA 4OAQA 5J4KA 4TLCA 1XRLA 3LP5A 1ZOIA 3ZY6A 5CVTA 4UHHA 4PAGA 5TY0A 4GS5A 2H29A 2XCOA 4WZAA 4Y8VA 2QR2A 1C4KA 1NC1A 1NN5A 1OGYA 3ED1A 1LPOA 3DONA 1OI7A 4MW0A 4N12A 3ZVMA 4I4TB 4B3XA 3HRKA 5E4JA 3GFFA 1N2BA 1YOVB 2O6HA 4EHNA 4KREA 2XQFA 1TO1E 2GKOA 4EO7A 4L5JA 5K3FA 3LCJA 4YS6A 4W8GA 4AY2A 4XB6B 2HCTA 1HQKA 4EPWA 5AD1A 4GP7A 1MZPA 4AZ3A 4YCAA 2X4GA 1OZAA 3RSGA 2P2ZA 2F62A 3H6GA 3I09A 2G9VA 1Z8FA 1O6BA 4OGLA 3EZLA 3BXXA 3UQZA 2QRJA 1U2QA 3N2KB 1BA2A 2WKSA 3P9SA 4O59O 1SUCA 4BQFA 5A6SA 2FYTA 1V41E 3T7CA 3LMKA 1AUPA 4FOOA 5FL3A 4Y6GB 4GWKA 5KQPA 4C0QC 5JIBA 3ZVLA 2FG6C 4B6FA 1T6XA 2JHPA 3E6AA 4RV4A 4ZT3A 5F2NA 3PDCA 3I12A 4BRZA 4CLHA 2CZCA 1EUDB 1V1MA 1OIWA 1P0QA 3W2IA 1BH2A 1NBWB 1BC5A 1J9GA 3F6YA 4EJSC 2YVAA 4G0OA 4N03A 2C9MA 1V37A 5D01A 5JFOA 2UUAB 2C3UA 1QZUA 3TFQA 4ZOBA 1AGRA 1MC1A 4AJIA 1CUSA 2VJKA 4HNGA 1V45E 1NVXQ 3DZKA 2XXAA 3L7MA 5CGZA 1GARA 3LWDA 3Q8KA 3I62A 1MH9A 2IPLA 3LS2A 3WV5A 3GP5A 1L8XA 1QHIA 5EMJA 2FOLA 1DWOA 4ZEWA 3DDCA 2QLMA 2CWDA 1M2WA 1TW3A 1HYGA 1PL0A 1RAEA 1O9HA 3BTOA 4BTVA 2F59A 3CE6A 4HX5A 1JLSA 4O4HB 4RD0A 4RPLA 1ZNYA 2JGKA 3GLKA 3QEOA 3R7WB 3TD6A 3HR7A 2FDXA 3E3OA 2HFKA 2H52A 5E1OA 4IXNA 4EYOA 1IXKA 4I6EA 4YQEA 3NM4A 4D2IA 1KZ6A 1NPYA 4OP2A 3CT6A 3T3HA 3QPCA 1K6JA 3ZZNA 4B40A 1G5QA 3DXZA 4PO1A 2WQZA 3RU2A 4HTAA 3PFHA 2JIOA 3Q7QA 4P93A 4AIIA 5IWCA 3A6ZA 3DULA 5JEEA 1YZFA 4K03A 4KB5A 4FBLA 4A0RA 2CSUA 3TUZC 3D64A 2R6CA 1OXKB 4C76A 1CUYA 1Z0ZA 1ADJA 1EUDA 2B1JA 1ZYUA 3HCFA 2P9EA 4E22A 4FZJA 2AGVA 1GTVA 4LJ5A 4LY3A 1UKEA 5CNKA 2JF0A 3U3KA 5G1OA 2ONJA 4XUGB 3JQAA 2A59A 4AG5A 4DMMA 1DWPA 2JEYA 2SHKA 5D84A 3ZQKA 2UYGA 1Z12A 2OOSA 3RKUA 3LLSA 4LYDA 2Y77A 4FC7A 2QMHA 4P3KA 4EB6B 1NRJB 3JQ6A 1GAQA 4S1OA 4OGFA 3AYXB 1MG0A 4Q4DA 3BIWA 1H9AA 2RH4A 3IQEA 1Z08A 2ODEA 5T4FA 1T1GA 2DKFA 2ODAA 4QYSA 3WMXA 1GU1A 2VJAA 2ZRIA 3I4LA 1YZUA 3L0OA 4KCGA 4F9EA 1X0VA 4Q4JA 3D6MA 1APBA 2V3WA 3EVGA 3R7WA 4EG8A 4K9KA 4ZEVA 4YRIA 3VTKA 2CUZA 4B35A 2Q3BA 5EP2A 4B8ZA 3T5MA 5ICSA 4E30A 5FQOA 5IUKC 3PWSA 3X1JA 2E7ZA 3B13B 1KDYA 2H31A 2CXPA 1DJQA 2PLWA 4WJKB 5B58T 3X2FA 4GPTA 2DQ4A 3M1AA 1FXWA 4CG2A 3NALA 1GPDG 3BDIA 4DNFA 2F8TA 4JLMA 3C6YA 1QLJA 3PHJA 5DNAA 3L6BA 3U7RA 4AUEA 4C3VA 3O4RA 4EBBA 2GPTA 2BEUB 2IIVA 3BMQA 3L8MA 4IYRA 4M1MA 4BDTA 5G4KB 1Y1RA 2HK6A 1OLSB 2X9QA 1RYNA 2PUGA 3VR0A 3I28A 4NOJA 2WJWA 4ZI5A 1QIFA 4DEYA 1BXGA 2KJQA 2I4TA 3QTLA 1PV2A 1ZJZA 3JVIA 4O2LA 3EZ7A 4KSCA 5GJBA 1U9CA 1PR2A 1H9CA 3DJFA 3C4JA 2HPHA 2IVZA 1U0RA 2JFVA 1NDHA 4PG6A 2C61A 1H3FA 1ODKA 1TRHA 1VHWA 1VPTA 2RMKA 1C0EA 3NHMA 4X3CA 5CCDA 3VPHA 4DBZA 2Q8QA 1W87A 4EI9A 2A7QA 4YQYA 5E8RA 3P2JA 4BN5A 1Z5GA 2BTOA 3C2QA 3V7WA 2J5RA 2PL9A 4RFLA 3ZXXA 2PPLA 4D3SA 4EL5A 5KYYB 3L8GA 1V1JA 2XOXA 3OPXA 3BL6A 2QUJA 4EVIA 1Y5NA 2AG6A 4JEHA 4JI3B 3B6EA 1QHGA 1JHDA 1PP4A 3JVEA 1B8VA 2QGFA 3AR8A 1GGHA 1MH1A 3HBAA 5IDQA 5B7GA 4AX8A 1G8HA 3MA0A 1ESMA 2EKZA 3IHKA 3F98A 1OXBB 3AKZA 2VOJA 4OB6A 1KP3A 3TCNA 3S2EA 4R69A 4WXHA 3VPBA 4IPTA 4RSHA 1U8XX 1EI9A 3OQIB 3NI2A 2I3GA 1M7HA 3DBHB 4I9HA 4MLPA 4CKCB 5J23A 1L5FA 2FFQA 3K8OE 1TM4E 1UJMA 4M1ZA 1SC4A 4QO7A 4YDSA 2LTAA 1B6TA 1XKLA 2VQ6A 4QX6A 3W5BA 2ECOA 1YACA 5J5CA 5CYPA 4C7OB 5KSYA 3G8AA 4J29A 2FPRA 4I81A 5G4KA 4G36A 4TMXA 2PKQP 2JLZA 2G77B 1MFPA 2E6UX 3N59A 4R1SA 2Y1KA 3D4IA 4Q7JB 5JXHA 3G2PA 1G2QA 5EHIA 5B1DA 3P2MA 1V47A 3DP9A 3HG7A 1WP9A 1CIPA 1O94C 4PQYA 4O0LA 2FSUA 1GSHA 4D3YA 4P81A 4Q3NA 2V65A 3ZPXA 4DWOA 3GEPA 4YHBA 1Q0QA 3ZE9A 5LQDA 4RGYA 3O90A 4AO6A 4TT3A 1HDYA 2I2CA 5AK5A 1WEHA 2GN0A 3PGA1 5H5JA 3SAJA 4AIRA 1HH4A 2OHJA 4LCJA 1I1OA 4HZIA 3Q15C 4MPJA 3ZBUA 3PJRA 3AUSA 1XP8A 1KMMA 1Q0ZA 1LLCA 3O74A 2O50A 2O52A 4C08A 5JXWA 1FNDA 1O97C 1ISFA 1LI5A 1VG8A 2FWJA 3SFVA 1I0IA 3L7DA 1QYDA 3F97A 5KUTA 2ZRNA 3EEBA 1KZ1A 2I33A 4M88A 3ULKA 2H1WA 3OQIA 5LSAA 3SIWA 3WHPA 2ZT8A 4AP9A 1MOSA 1N1MA 4I50A 3RC7A 4J7UA 3KOOA 2HIAA 1CS0B 3M9XA 3NBUA 4RVCA 4UC0A 2NVBA 3WP0A 3RANA 2W0MA 1ETHA 3GJ5A 3QVUA 3WISA 5KJ1A 4C7OA 2PZJA 4ZAYA 3FVRA 2DR3A 4LKRA 4Z2YA 4Z51A 4B3DA 3INRA 1Z6XA 4QOEA 4DYHA 1SUPA 3GFPA 3TD2A 1J39A 4NJEA 1CY6A 1OHHA 4N0EA 2C20A 1X19A 4Z2AA 1EKXA 1JKIA 5B7NA 1PJAA 4Y3UA 3ZE7A 2MSDB 2F8MA 4PLZA 3Q1LA 4TKZA 5CB4A 2R7KA 2WWFA 1KVSA 4B71A 2N9UA 1QMPA 1SXJE 1LVUA 3NP7A 4CDGA 3IA7A 3OPYB 2X9NA 2QN3A 1KVUA 4F3CA 3ZCVA 5HJ7A 3TIFA 3ELDA 2C8VA 2WYOA 3K1YA 5K05A 4NMLA 3V8EA 4W9MC 1FDTA 3MELA 2J6HA 4DT1B 1XTQA 3QVTA 2J4CA 3O2NA 4PYLA 4UVIA 4G0WA 5B4VA 1XVAA 1T3ZA 3B52X 1PYGA 2QZZA 3ILVA 3G79A 4KR9A 1EDEA 3SYLA 4HFMA 5A5DA 1AF4A 2J0VA 3IVCA 5TARA 3VM6A 3P4XA 2OMKA 1VCIA 4L4SA 4PLHA 5FPSA 2P0AA 1O9GA 3OECA 1XHEA 5DYIA 3N87A 5TF0A 5BWCA 5B3JA 2VAPA 4KLAA 4LJ7A 5DBOA 3TKAA 2RAPA 3WRWA 5BMOA 3K9LA 4FWTA 1J5EB 1Q5PA 4JWKA 4BEWA 4D6YA 2XE8A 4FLFA 2IEBA 1P7YA 2DECA 4WK2B 2QRVB 2RH5A 1B00A 2C95A 5J5AA 3PXGA 4J7AA 1OKKD 1SCQA 1DMRA 3GL9A 4MQUA 5JECA 5B6JA 3NXSA 2IYFA 1Q95A 2YCBA 1FNNA 4FFDA 4YGXB 3VU3A 3DD5A 1A9ZA 1JN0A 4HUTA 4OXIA 2WIGA 4E88A 4CLEA 3OE4A 4Z1MD 4RTNA 2ZAIA 1Z83A 3ZJVA 4AKGA 1Z73A 3O4GA 1CZUA 4M83A 1PJBA 2BFDB 2OK8A 2WV7A 3Q41A 4XTRA 5JT1A 2IBTA 4FHGA 1GAXA 1JDBC 1JKFA 2BMAA 3W1VA 1AQJA 3ZVKA 2XGJA 3VU0A 2J1LA 3KBBA 2OV4A 2QTAA 1OSNA 2P2DA 3LUDA 3ZX4A 4EHDA 4FD3A 3M4ZA 3MMSA 4LTMA 8ATCA 4AMGA 3UYKA 1UXOA 2I1VB 4INOA 1ZD1A 1MTOA 1ZGGA 3ASYA 4U02A 2A4MA 3V5NA 3LG2A 4M9UA 3ZW7A 1M2OB 3JQ9C 1XMXA 2GETA 2QLNA 1C0LA 1NUTA 2HWYA 4LZOA 1UQTA 4LVOA 4WY8A 4QXPA 1OV6A 4E32A 1MB0A 4NG4A 2D1TA 3VDQA 3UAGA 3OTOB 2M2IA 5A3RA 2XHEA 2Z8ZA 3RF6A 2HWXA 3KZ1E 4M60A 4DXAA 3N6XA 2CXOA 3PDIA 1B6RA 3UEOA 2HEIA 4RTOA 4FKBA 1H8HD 1N3BA 2QRVA 1UBMS 2NSDA 2RGUA 3ZGYA 4TSKA 1RYDA 4K6KA 2V03A 2WU0A 2GPSA 1HG1A 5ENVA 4FKZA 5EMKA 1V1RB 3K09A 5LDHA 5AHOA 1NX6A 2C3MA 5DNWA 4ZAGA 1J0CA 3MBIA 4EF6A 4AG6A 5LQJA 4FQ7A 1ZIXA 2F3PA 5DKFA 1X3LA 4CEHB 4P7JA 4ETIA 3H5VA 2I3AA 1H66A 2J7PD 2NV6A 1U9YA 4DDHA 1MG5A 1I2ZA 2X15A 4P4LA 4GWGA 1BU5A 2JCYA 1KZ4A 2HAEA 2JIZA 1T13A 2WUGA 3MVEA 3NHFA 2D54A 4G5GA 4RY8A 1AK2A 2YFHA 3TQSA 5AESA 5G3ZA 2OGWA 4OYHA 5J59A 5JASA 3TFOA 4RE5A 4X63A 3CKMA 1HEUA 4N8DA 2XSZA 1E2EA 5C2JB 1JBQA 1XPUA 5AKZA 1Z2CA 1M2OA 1RXSA 3QIVA 4QQNA 3D6AA 1Q1AA 3S3TA 1N57A 3IH5A 3ORYA 2C3OA 1JUDA 5FNZA 1R5NA 3O8BA 2A94A 4PC3A 4PCUA 3V2HA 2VFAA 3KU4A 1IHUA 4JT4A 4M9ZA 5GGXA 5LQAA 2R5NA 1F7VA 2HUPA 4TWIA 3ERCA 2JGIA 1K4MA 2GN8A 1UJ2A 4G24A 4KXUA 3OO0A 2AW5A 3IBCA 4N3NA 3H3JA 5K9ZA 3KQPA 1NN3A 1ODSA 4PFJA 3OURA 3N2GB 3SQXA 1YL7A 2EGGA 3OEHA 1GLNA 4KE9A 4P5DA 4FFRA 4X8LA 4TMKA 1P2DA 4W63A 1USVA 3GMTA 2DLDA 3UANA 4O0MA 5IFLA 4H7HA 1AZTA 3GEHA 4ZZ2A 4BLTA 1JBEA 3GG9A 4G9BA 4BPRA 1DAMA 4OQZA 1Z88A 3SQDA 4CEHA 1XMVA 3DGEC 3AG5A 4BNYA 4B1FA 3IP9A 5SY9A 3AHHA 4M1TA 4MWSA 4QAJA 2EF0A 2J3HA 4KFRA 1GPYA 1XK7A 3TLMA 2XVMA 4RX1A 4MYCA 2WB4A 1TYCA 4WVFA 5JVDF 5CFMA 1AQLA 1AKTA 1T9KA 3ECSA 4G85A 3DBVO 1E9AA 1ZK0A 1T1SA 2P4EA 3H8SA 2PLFA 3KUDA 3MQ4A 5AW8A 3KUKA 1M74A 1KQNA 2OAEA 3OUZA 1EDBA 3BRWA 3KK0A 2IPNA 4KXLA 4LDPA 1IWBB 4QQKA 1N5JA 5J3JA 3LXUX 1I2CA 1SULA 1FFGA 4C7XA 3TB6A 1UMCB 1TM3E 4BZWA 4IINA 3MRXA 4CWAA 4EKGA 1EXMA 2XRFA 2Q3FA 1QIMA 2FW7A 5A06A 3MTBA 4FE7A 3ZZ0A 1WUIS 4Q9NA 4RK0A 4BEJA 5TS3A 3BGOS 4F85A 1YI1A 2CHVA 5IARA 3N2GA 4EMUA 4YJGB 4BY9E 3NWEA 1I0ZA 2PNFA 3TRHA 1A69A 2H1IA 3T9BA 2NO9A 5PNTA 4QT0A 1VKZA 1LXCA 4RVGA 4V3BA 4Y98A 1Y0BA 3JD3A 3THSA 1NVDA 1QAMA 2MINB 3C5CA 4R54A 3GPLA 2NYUA 1A9XB 3KSZO 1JJIA 5H81A 3JVUA 4MXDA 2FX5A 3P9RA 5ALUA 1UAAA 4QECA 3ROGA 3T5PA 3E61A 1TZ2A 1T4BA 4L27A 1ZD2P 2FLVA 1XRJA 2Y1DA 4XEHA 1VJRA 1QYVA 1X9GA 3EW7A 4PEVA 1NUSA 4NLLA 4MVYA 2VKTA 3E2PA 3W2TA 2X3UA 1S2MA 2PANA 4BJ6A 1WDLA 2MWMA 1UZMA 2Y1FA 1J06A 4OQMA 5EE0A 5SZIA 3PT5A 3SZMA 1B73A 4CF5A 4G0UA 5DNCA 3ET4A 1CVLA 3W6ZA 4L78A 3BEDA 5EAIA 4BE4A 1X8KA 2GBLC 3D43A 4IDBA 4MW5A 2P4QA 2WHRA 2X2FA 3FHLA 3F8SA 1H2AS 3PFNA 4QBIA 3UCFA 3WLKX 6Q21A 4IZ6A 2KPOA 1UMCA 2B5WA 2QXTA 3PUKA 3DWEX 3IOEA 4DV2B 3R3VA 3GI1A 2EW8A 3TZQA 1BEUB 3AQIA 1HLFA 4P4TA 4EW6A 3GN2A 5IDWA 4CEIB 1ARZA 1E1DA 2GTHA 2P27A 1W5EA 3FR7A 5EHGA 3CNNA 3UHAA 3FTPA 3CLUD 4HNHA 3FSEA 3ANXA 4JN6B 2DQKA 1IHYA 4HN2A 4PLTA 3OA0A 4JH0A 3WWYA 1XX6A 5JAMA 4LDZA 2KM1A 2QGZA 1A4UA 3KSBC 4AYXA 1COWD 2EW2A 2QMOA 1RT9A 3IMKA 2AFHE 2C8KA 4PNZA 2HDOA 2PSEA 4B5KA 4PIVA 3O9MA 1CRZA 4C4AA 3A0RB 1R0RE 3ND8A 5GGYA 1TYBE 4N7JA 5LP6C 1DKPA 1OF1A 1GNLA 4OU5A 2VTVA 4PSAA 4RENA 3QKRA 4CDRA 1LQUA 4TXMA 2RGDA 3EQ9A 1T1EA 3DCIA 4KSBA 4G5OA 3F5QA 2R7AA 3QEKA 2TRSB 1PFQA 4B3HA 3GC6A 5K6AA 2AC2A 1BG6A 2OO7A 3AESB 4LRXA 2HZ7A 1Q7EA 3NDPA 3H9UA 2FPLA 5HEKA 3RW9A 5K0ZA 4FDVA 3GOHA 2P4HX 4R2HA 5C3UA 3VBCA 4K9PA 3PE6A 1E61A 4QXAA 3Q0EA 1QTQA 1AKWA 5B5SA 1SUSA 3W3ZB 1NQAO 5LQNA 5EQTA 3AFNA 3NHJA 4GI3A 5BYKA 1TJ4A 4MPPA 4FXOA 5JYBA 1DJMA 4EZIA 1U9IC 3UXHA 3HJCA 3WGHA 3E1KA 5IC6A 4CEIA 1PU2A 4L85A 3S8YA 1DBVO 5JI2E 1G5PA 3ICQB 4YDRA 1LTQA 4WNAB 3CZMA 1YR2A 1M33A 2XUDA 3E84A 4BMXA 4DBVO 5LDDC 4NNOA 1Z15A 1KAGA 3T9DA 1A71A 4PSVA 3SNHA 1P4SA 5I9BA 3ITDA 2Z9BA 2FSGA 3PHLA 1SUIA 4FYVA 4GAEA 2D1FA 4IRMA 3OLWA 2PKYX 5AI4A 4BDSA 5HUHA 2VSYA 3B36A 5AKKA 2V97A 2AC7A 1AKNA 3OZIA 4Q1VA 1U2TA 2FUCA 1Z0KA 2DUNA 3FHCB 3D7SA 1R37A 3MOGA 5E8JA 1EMDA 4TWJA 1BXKA 2R6JA 1B0ZA 3L4BC 3N0WA 3HYLA 2FR0A 2O2DA 4ZV9A 1OAOA 2VNHA 2QM7A 3UK1A 4CTNA 2CBGA 5BP7A 3NOVA 3GDGA 1L5RA 1NM5C 1T8UA 1GNRA 4PCLA 1GQ2A 5LCXA 2QD5A 2UYYA 4F9TA 3CX3A 1BGWA 1CUDA 2AN5A 3PJEA 1UEJA 1Q0PA 3PI6A 5DIFA 3CR7A 3KX2A 4DIDA 4NCBA 2O5EA 1S4MA 3CZPA 3I30X 4LYFA 4TZKA 1Z6TA 2RIPA 3RV4A 4BO9A 3WJ1A 3MD9A 5EJ9A 4XCXA 1M2VA 2N46A 1CEYA 4CM7A 2J31A 3B89A 3EFHA 3HYRA 4JMLA 1KK1A 4DBLC 3GF4A 3GJ6A 3G2IA 4KBGA 4EK9A 2W37A 3MM4A 2C07A 1W88A 3HJGA 1JG4A 3F74A 5DPMA 2IOQA 1DV2A 4G07A 4QA9A 1PL8A 4WL0A 3EAFA 1RKXA 2PL1A 3ZIDA 4JLJA 1EJBA 3S7ZA 2ZUEA 3DTVD 3GLHB 1YB4A 5A4DA 4CIYA 1YRHA 3X1MA 2WWXA 1TF7A 5IAEA 5MN6A 1ZN2A 1DXOA 4CIDA 3LC0A 3M70A 1XAIA 4FYYA 2VRNA 2PFSA 4HTFB 2BKEA 3PI7A 3N0XA 1UAYA 3QE3A 4HRVA 3AY0A 4D98A 1GCUA 1ZIOA 2ZWOA 5FBKA 4B43A 3LY8A 5REQA 2BLNA 3A6GA 4Z9FA 5EE5B 1EWQA 1Z3IX 3AKCA 3RROA 5FKJA 3N6VA 5JD4A 4EVSA 1WXXA 2D4AA 4WFJA 5SY4A 3AIOA 1ZP6A 5EUBA 3R7LA 5KX5B 4B85A 2O7QA 2ZBFA 1TVMA 1D4AA 3HKBB 3I61A 1G4AE 3RVBA 3CJTA 3NBQA 3ACBA 4RMIA 5HOEA 3K31A 3IHWA 3WYNA 2CCJA 1NULA 5DRYA 2WF5A 2WJJA 2C98A 4B3BA 2J6BA 2C4TA 1L4KA 5F2KA 4CIWA 3JCZA 4BZQA 3JQ8B 1LJLA 2YIVX 3Q10A 3T9EA 1UH5A 3NEJA 5CH5A 1E9FA 3U1VA 5I3ZA 4K9RA 1V9CA 3VO9A 1NUAA 3PUJA 4R3WA 3NHWA 1XZBA 5E3HA 5KQRA 5K0SA 1FK8A 3VISA 4BX9A 1U9JA 2X7XA 1TNDA 3DAHA 2WYIA 3DZGA 2UYOA 3QOWA 4UOQA 1WQ1R 3QXCA 1JI3A 2WAYA 5JWHA 3NMUF 4BMPB 3OH8A 1M1UA 4MOWA 5FYQA 3IELA 3QLVA 1ZQ1A 1XZIA 1RC8A 2BCJQ 4E2XA 5BR7A 4CF7A 3S40A 4DXHA 2HSGA 2VTDA 2AJBA 2XYQA 4HTFA 1KSGA 4UE3S 4ZYVA 1J2UA 4MVJP 3H2IA 2PUTA 1RYMA 3BD6A 1WSDA 1H69A 2AUTA 3LF2A 3SIPA 1DU4A 5JYEA 2XTMA 4Q3EA 3D8NA 1D0IA 3DE0X 1GQYA 9ATCA 4AKSA 2FRDC 1N2CB 1U3UA 4NAUA 2XGOA 3Q9UA 4UTOA 4O8ZA 3E15A 4M1EA 4MITA 1N2GA 4UXIA 2NO6A 4BB5A 2PRKA 4KBFA 1TA9A 4ALMA 3AP1A 3EA4A 3IP1A 2RE8A 3MUEA 5ADUS 5JRJA 2ZUBA 5C7LO 4H2DA 1LB1B 1G66A 4K9LA 1TECE 1W29A 1P2TA 3A06A 3LZDA 4WNYA 3S99A 1DT5A 5FWXA 1EZZA 1RHUA 4IIUA 2VLIA 3QYFA 4RHTA 1T29A 5EZ5A 1W36D 1DCMA 2VT3A 2Y0PA 3BJEA 3ZK9A 3H1GA 3KD2A 4G1MB 3VZCA 4CUJA 2WJ6A 1GIAA 3HPRA 3IMEA 4L8LA 4G5FA 2ADMA 4J6FA 5H1YA 4P53A 3ROKA 2I2WA 1V2GA 2P9FA 3TEJA 2MYNA 5KJFA 1TI7A 2QG4A 1ZG3A 4OJKA 2PE5A 1B16A 1UMKA 1VL2A 1KGSA 1U7WA 2YFYA 3K9WA 2LW7A 5E1DA 3ZCTA 4V1CI 5C7YA 1P62B 3ML1A 4PZLA 4ZYXA 1D8AA 4QDJA 1ODTC 1MNQA 3PEWA 5HKOA 4MUGA 1E1KA 2CB9A 3A04A 1DEKA 1VBFA 4L4XA 4MLCA 1WB9A 2HDNB 4N8SA 4I36A 2V7EA 4FN4A 1B23P 2CZGA 2HHLA 1SM4A 4YECA 1D6JA 1F6DA 4NYIQ 2Q7DA 4UPVA 3VO8A 2B37A 4R16A 2XCIA 4A6XA 1YAJA 3GEGA 4O4IF 2VQDA 4LS3A 1HURA 1T8WA 1QH1A 1MZVA 3HXLA 3IIMA 3OZUA 4ZT2A 1XPOA 2E89A 4L07A 3VC2A 4F3YA 2R6R1 1O0SA 2ZR9A 3JQRA 2ZSEA 3Q2KA 4M9CA 4OH7A 5H82A 4BVAA 1QWSA 4YRQA 3CTMA 3ASVA 2XUHA 4K9MA 4X60A 2ETXA 3QHPA 2HL6A 4UJ3A 4X0EA 5CNJA 2NTVA 3U4QB 1TMGE 4CFZA 3SNKA 3TPZA 1WO8A 3ZJ5A 4BGVA 5EFZA 3WQQA 2IPAB 5FBRB 1Z4IA 2CEAA 4K40A 4CR8A 5BWOA 1ZDMA 3BA1A 3BH7A 3DE4X 4QPDA 4ZN6A 1AGPA 1M8GA 5B1IA 3SSNA 3Q8WA 4L28A 4X54A 1YBHA 2OCYC 4G09A 5KKCA 2QDKA 3HK2A 1BMFA 4FFBA 4OHWA 1Y8AA 3KQQA 3J80A 4JT9A 5D7NA 3MQ2A 5ELMA 2EZTA 2W0SA 5AKYA 1S3SA 3B5EA 2GCGA 4ND8B 3ZHUA 5B12A 5IT4A 5EWMB 1FJHA 4Z7QB 1OLXB 2ZR7A 2HJ9A 2ID9A 4K6FA 4UPDA 4C7KA 3KQWA 1NUQA 4DHWA 4EI8A 3P9ZA 4KRGA 2IXEA 1HNNA 1PJQA 1S0UA 2ZI7A 1SHJA 4YFVA 3SU8A 4WN9B 5EJMA 1EZ4A 5GIPE 3BD7A 1L4YA 5GP1A 2IV2X 3KSUA 1LLDA 2YCLA 4LBVA 1W2GA 3SC6A 3FMFA 2GA9A 3H3FA 3W1EA 2IV3A 2QRLA 4YUVA 3SQOA 1VL5A