3CXRA

Crystal structure of gluconate 5-dehydrogase from streptococcus suis type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
260
Chain Sequence
QFSLDQFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the catalytic mechanism of gluconate 5-dehydrogenase from Streptococcus suis: Crystal structures of the substrate-free and quaternary complex enzymes.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Oxidoreductase
molecule keywords Dehydrogenase with different specificities
total genus 101
structure length 260
sequence length 266
ec nomenclature ec 1.1.1.69: Gluconate 5-dehydrogenase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3cxrA00
4KUGA 5IDQA 3GG2A 1I36A 1DC4A 1M6HA 3WGOA 2OP0A 3JQBC 4TRMA 3DZIA 3RFXA 2PKRA 4BNFA 1L7EA 3WYCA 3C3XA 5L7WA 4NU6A 2EKPA 3G1TA 2VZ9A 4KUHA 4XQ9A 5TF4A 1D3AA 2OOSA 1O89A 4FJ0A 4J9UE 1NFQA 1KVQA 4XRRA 2EKQA 3WJ7A 4JLWA 5LDHA 4GLOA 1XHLA 4WOKA 4ND4A 1A7AA 5JC1A 1EZ4A 3EDMA 3INRA 1GEEA 3ABIA 4BNMA 3QVTA 1M76A 2AEJA 3JD2A 1QORA 4GGOA 1R4NB 1GPJA 4N18A 5U9CA 3DDNA 1NQAO 1MG5A 3ZWYA 3AY6A 3BMNA 5LCXA 3EZLA 4NBWA 4L74A 3MEQA 2QRJA 3F6YA 5G0TA 4B3HA 2GDZA 3DMTA 2QRKA 3OJFA 4PIVA 3ZWCA 4Z3DA 4WCFA 3E18A 3WGHA 5EERA 3WBFA 3DMYA 1PJBA 4OAQA 2Q45A 3LDHA 3HADA 1EEHA 4MDHA 2P9GA 1EVZA 2WTBA 4IPTA 3SEFA 2R2GA 1V9LA 1F06A 1YB4A 3VHRA 1XEAA 1CEQA 5EQFA 4HWKA 4Y6RA 3O8QA 2CSUA 2DTDA 3ZWMA 1IOLA 1DSSG 3ROPA 2J8ZA 9LDTA 3PFWO 1NAHA 1AXEA 5ICSA 1ADGA 2GN4A 2X5JO 1EVJA 1CJCA 2VZ8A 3C85A 4IQGA 3CEAA 4KQWA 5J23A 3U0BA 2GNAA 3RBVA 5DZSA 3BMNB 3H6KA 1ZJZA 4KWHA 3V1UA 5DDIP 3RUIA 1EQUA 1EK5A 4XR9A 3I9OA 1UP6A 4ZQEA 4FFLA 5ES3A 4XB1A 1HDCA 1D8AA 2WJPA 4BKPA 4CMIB 4WEQA 1PS9A 3AUAA 2AQ8A 1B8UA 4NBTA 1E3SA 4XQCA 3RUAA 1OOEA 3U62A 1F8FA 4U5QA 1YB1A 2OBYA 3WIEA 4XDZA 1IHYA 2ZQZA 1C1DB 2X9NA 4BO0A 4CQMD 5TRTA 6LDHA 2G17A 3QV1A 5G0UA 4AJJA 3U5TA 2ZTVA 1PR3A 4JCOA 4JBIA 4O63O 3PIIA 3WGTA 4GX5A 1YBVA 4PVCA 1IE3A 3T7CA 3GHHA 3KSUA 3WMWA 4TZTA 5ADHA 2OP1A 5L40A 4FSHA 5JW6A 1A9YA 2B69A 1ADCA 3EMKA 4NBRA 3TZCA 1H6DA 2VZ0A 4XIYA 1YKFA 4A7PA 1OBFO 1IL0A 2QQ5A 2V7PA 2W98A 2W90A 2PD4A 1HTBA 3AW9A 1HKUA 1U4SA 4UAGA 1FJHA 4CQLA 2CY0A 3F1LA 4WECA 2PKQO 3U4DA 1ULUA 4GAEA 4GL4A 2FN7A 4XD2A 4CMEA 4JP3A 4IDEA 3VPSA 1R12A 1NVMB 4J1NA 3INGA 5CPFA 1BXZA 4F3YA 4CQMB 2O3QA 3O03A 5JCXA 4Z0TA 5C7IO 4A5OA 4RVUA 1NNUA 2VQ3A 2W2LA 2X22A 2JD0A 3X2EA 1XU9A 2W2LD 2E82A 3DZGA 3GVPA 1C1XA 1MC4A 2B83A 3NT4A 3TFQA 4HADA 3VZPA 2Z1MA 2X9VA 4L76A 2PD6A 1D7OA 3HN7A 3NJ4A 1GYRA 3OFSA 5ILGA 3KYCB 2AA3A 5KVVA 3WTCA 3H5NA 2VWGA 1I10A 2VTDA 4IQ8A 4PLWA 4C7KA 3HHPA 1P44A 4RVHA 2JAPA 2HMWA 2E49A 4NNJA 1N2SA 5HWSA 4Y9DA 1RWBA 3KRTA 4WLUA 2Q49A 3FCOA 4NHEA 5G2OA 4RLHA 1HE4A 5DOVA 3JD3A 2XAAA 3LT1A 3V8BA 5EESA 1EFLA 3EY4A 2CF6A 3KYDB 5CEEA 1GV1A 2JFHA 4HX5A 1FDWA 1K2WA 1P1HA 3CMCO 5JBIA 3OETA 4LRTB 2PWZA 4R16A 1O8CA 4YT2A 2WSBA 3JQ8B 1J0XO 3D3EA 2NV6A 3FRJA 1RYEA 3W4IA 5TS3A 2X0IA 2O3JA 5CEFA 2UAGA 2AW5A 4EUFA 1ENZA 1QYCA 3KBOA 3ASVA 1TT7A 3HFSA 4OH1A 4NFYA 4AJIA 3TZ6A 3OF2A 4D41A 2RHCA 5TQVA 3MTJA 3IJRA 3AUUA 3H2ZA 4J91A 3MOIA 1KETA 1SAYA 3B1JA 3ORFA 3EVTA 4J1TA 4RPKA 1ZUD1 1F12A 3F1KA 4YA6A 3ETGA 3HE3A 2X5OA 4E21A 4OQZA 4DBVO 3K9QO 5FFFA 3L4BC 3PQDA 3RROA 4CM8A 1PGNA 4DPLA 1JKJA 4BQRA 2WD7A 2D59A 2F1KA 1DO8A 1P33A 4CM4B 4LRSB 2G1UA 4LN1A 4F45A 1LDGA 1LSSA 4XEHA 4ID9A 3P19A 3BZUA 4Y6PA 2GPTA 4B3JA 3ZNOA 2Z1NA 1U8XX 3IP1A 3GFGA 3UHAA 3JQAA 4YWJA 1CQIA 2I9PA 4WGGA 2W4QA 3Q2IA 3NTOA 1Q1NA 3BA1A 4TQGA 2NQTA 4TKLA 3IQDB 5HTOA 4IS3A 2P9CA 2YZ7A 5JAIA 2VYNA 1KERA 1W8DA 1PJ2A 2AXQA 1E7WA 3KOUA 3RVDA 4GKVA 4KMSA 4GKBA 3GRKA 4DIBA 4MVJG 2WD8A 3JQ6A 1ONPA 3ZU5A 3RKRA 4BNZA 2P5UA 1PZFA 4PLZA 1YQGA 3OIGA 3ZV3A 2Y1EA 3T4XA 1OZAA 5FI3A 2VWPA 2BGMA 2P9EA 4QX6A 2NTNA 5DCYA 3TN7A 2E48A 3JSAA 5HS6A 1E7QA 2ZB7A 1HDGO 2ZYGA 3MWDB 3UOGA 4MPDA 4MIOA 2P5YA 5B1YA 2Q1UA 4R68A 1Z73A 1NFFA 3DHYA 4KUEA 5EIOA 1RM0A 1DRUA 3AFNA 3D0OA 5F3RA 4YACA 4URFA 4UEOA 1TLTA 5AYVA 4J4BA 4C4OA 3Q9NA 1OI7A 1LDBA 4I1IA 3JYPA 4KQXA 3V5NA 1LNQA 1YH3A 2IZ1A 1GUFA 5COBA 5L9AA 1XYGA 4DMMA 3DBHB 5F1OA 3NDIA 1NQ5A 2PFGA 1PWXA 3DBVO 5K6AA 1QYDA 2ZQYA 2FHSA 4BNWA 1D1SA 3PYLA 4YJFB 5L51A 5IN4A 1U1IA 3VZQA 1YRLA 4JIGA 3QWAA 2GSDA 4PFJA 1SOWA 2BFMA 4YB8A 1HEUA 5EMHA 2JAHA 3E9QA 9LDBA 4LSWA 4BO4A 1GTMA 1E1LA 3GGOA 4ZGWA 1YE3A 3C24A 5LC1A 4E5MA 1WW8A 4WPGA 4CR6A 1QYVA 3DFUA 3VKVA 3GDOA 2IZZA 2BFAA 3PWSA 3WB9A 4PG8A 1HDOA 1WDLA 3VPXA 1UH5A 5THKA 4BMNA 4J7XA 1M67A 1GZ4A 3G79A 4IINA 1QG6A 5L4NA 1DDOA 1RPNA 2V6GA 2PZKA 3OMLA 1DB3A 1E5QA 4PG5A 4W9NA 4OMUA 2IE0A 3VKUA 4TWRA 4HBGA 4RL6A 2PKQP 1YDEA 2JCXA 3PJEA 1HL3A 2BMAA 2AE2A 2ZCVA 4YJDA 4BO1A 4BOYA 1G0NA 3RC7A 4K6CA 4XGKA 1DC3A 1DIGA 1UP4A 1SB9A 3JQAD 3P2OA 4YT8A 1NR7A 5ENVA 1LRJA 4K6FA 5A9SA 2YHIB 1ZMOA 4W4TA 3PHJA 3PTZA 5BQFA 3L9WA 4DMLA 1QRRA 1XG5A 1HXHA 2ZIZA 4EITA 4R9SA 2CNBA 2HO5A 4Z0HO 4KDFA 1YL7A 3VOSA 1B8PA 1JQBA 5C37A 3HNPA 1U28A 2G5CA 4E2WA 2NTJA 3FNGA 3BTOA 1A7KA 1VPDA 2O2SA 4BQPA 5B4UA 2RH4A 4BNKA 1Z75A 2OGUA 3L6OO 4RF4A 1JKFA 3LU1A 5DCUA 4CV2A 5JO0A 4GMGA 4J2OA 3ZV6A 1AXGA 2B0JA 5L4SA 2FPGA 2WWRA 4BV8A 1MUUA 3D7LA 4E2XA 1YJQA 4XB2A 5A1TA 3DAFA 3GPDG 4YJFA 1XCBA 5IZ4A 5IN5A 1LDNA 5DCWA 4YTEA 3CXRA 4CL3A 2CVOA 3JQFA 5F1PA 1GR0A 2CDBA 3L07A 1H6AA 3JCZA 4QFCA 4H7PA 1ID1A 1GFSA 3Q1LA 4I9HA 4B7CA 5BSEA 2ZTMA 2W8ZA 4Q39A 3X2FA 2HMUA 3ROKA 3W4KA 1B0AA 4UUMA 3UXYA 5TJ9A 4RV9A 2O3TA 3I83A 1EE2A 1T1RA 4ZQHA 3V1YA 5KWEA 1H5QA 4G5HA 3D5QA 3ONEA 1LLUA 2G82A 4WEOA 2EERA 4JJIA 1TI7A 2PY6A 5JY6A 1HYEA 4MVJH 3UCEA 1BGVA 1E77A 4B7UA 3KTDA 2LDXA 3CINA 2A92A 4DVJA 3K73O 4BGUA 4QEDA 5A03A 5ER6A 4B8WA 3S2IA 3KEQA 1I32A 2PH5A 4JGBA 4JN6B 3G49A 1FXSA 3GFBA 1P3DA 4L75A 1X7HA 1LSJA 2GERA 1GADO 3GPIA 3LLVA 4LCJA 4M55A 2OBNA 4CM4A 2NTVA 4TRNA 4A03A 1HF3A 3HQ4O 3RUDA 4D42A 4D45A 5IF3A 2A4KA 1E92A 3DMTC 2NWQA 5AVOA 1ORRA 2NU6A 4YXFA 3U3XA 1HYHA 1VKNA 5G4LA 5CFZA 4DREA 3OQ1A 4IMPA 3GK3A 2YV2A 1QYXA 2CDCA 3JQ8A 4MINA 4RPJA 1DIHA 5IJZA 5DULA 3JQAB 3K6JA 2CMDA 1JWAB 3DWFA 3JV7A 4PRKA 4E31A 1JTVA 2P2SA 4AJ1A 4CMJA 1IZ0A 1N1GA 3U9LA 1BVUA 3T4EA 1PJ4A 3PLNA 3OQBA 3RJ9A 1DLJA 1R15A 2I65A 1A4UA 4NJMB 5COQA 1E6EA 1PL7A 2J3JA 1U8FO 5EPOA 5IXYA 1XLTA 3KB6A 4JX8A 3KSDO 1J4AA 3F4LA 1UDBA 4XGNA 1U4OA 2JHGA 3PHGA 4RORA 4BB6A 4XYMA 3WNVA 1TVEA 4LMPA 1DIBA 5GZ6A 5BSGA 4FC7A 1C0LA 3WSWA 2YV3A 1PU2A 5MDHA 3ASUA 1LTHR 2NU7A 1A5ZA 2VRCA 3GT0A 2DU8A 2HJRA 3ZV5A 1UDCA 4BUCA 3H9JA 2CF5A 4II2A 3MJ4A 4XRGA 3K31A 2F00A 1ZCJA 3I9LA 3SC4A 5C3MA 2HCTA 3EUWA 1WAMA 1FK8A 2Y67A 4DL9A 3HWRA 4FFNA 4R5MA 2DPGA 3UKOA 4JP2A 4O59O 1UZMA 1U3TA 4CMCA 3VPGA 3OEWA 5DBGA 3HB5X 4NMHA 4A10A 3ZDFA 3Q11A 4K26A 4C7JA 4XQGA 2BLLA 4AFNA 1VSVA 4GMFA 3VAZA 1MLDA 3VDQA 1V3VA 3LF2A 3GAFA 1FDSA 3NAQA 4E3ZA 1PS0A 4WCDA 3R6DA 3RI3A 1ULSA 4PLYA 1ZH8A 4IY1A 4R1SA 4YJHA 3VTZA 3NT5A 4J7CA 5BNIA 2QRLA 3EW7A 3F5SA 2JKVA 3BMCA 4KOAA 3DB2A 1XU7A 3GR6A 2E4AA 4ND3A 3OM9A 3AY3A 4BNJA 2QIOA 4IJUA 4BNYA 5DBFA 1PJTA 4EDFA 4DC1A 4ZHSA 5HS4A 1Y8QB 4WOJA 2GZ3A 1DJNA 3GLQA 4ND2A 3GZ4A 3R3JA 4CLDA 5TX7A 2I99A 7ADHA 2UV8A 4EZBA 1ONOA 4Q3CA 3IUPA 3WSVA 4ZD6A 2EF1A 4XQEA 2YFHA 1XQ1A 3NV9A 2GUGA 2Y93A 3C7CB 3JD0A 4J9VA 4AICA 4DA9A 4EGFA 2C07A 4J2HA 4OYRA 5A9TA 1NWCA 4CM3A 2VT3A 4RO0A 3VH2A 2X86A 3DHEA 3LVFO 2HK7A 3GNTA 3SJ7A 3I4CA 4ILKA 5GZ3A 3I9KA 3BIOA 1A71A 1Q2XA 2C82A 4NBVA 4D7AA 1ZO8A 5ITWA 4E5YA 2BH9A 2OL4A 1G6KA 4O5OA 4WLVA 3W4JA 2X8LA 3LT0A 1N92A 4RVGA 1D4FA 3H3FA 3DXFA 2NUAA 4DUPA 1DRWA 3JQCA 5H82A 1B3BA 1UXJA 2ZB3A 2X6TA 1LDEA 5CG1A 3HB4X 1GL3A 2AMFA 1T24A 4RVFA 2B5VA 4XDYA 3ZHBA 1LUAA 1NX6A 2CUKA 4XCVA 3ZWBA 3TZHA 2O50A 3PEFA 3BMOA 3JD1A 4R41A 4CUZA 2WEKA 3DC2A 3GG9A 1PZHA 1C1DA 3Q9UA 1P74A 4WCFB 5T57A 4B4VA 5ILOA 3B1KA 4E5NA 4J16A 1Q0QA 3K2EA 3LC1O 4HP8A 4WKGA 1ZMTA 5KJEA 1Y5RA 4N5NA 2NU9A 4B4OA 8ADHA 2IYPA 1K89A 3PXXA 1V8BA 1NPDA 1U9JA 2OORA 4E32A 4W99A 1WP4A 2VHVA 3S1LA 4YJHB 3ZNPA 2C2YA 2VWHA 3FNEA 3ENKA 4IBOA 4PLHA 1JA9A 3VH3A 3IDSA 3H9QA 2E6UX 4CM8B 2C54A 4LSMA 2EJWA 3MJSA 1PL8A 3ZV4A 2VNSA 1UZNA 2WE7A 3RC9A 3DAPA 2BFOA 4HFMA 1PIWA 2UDPA 3TZKA 1H93A 1LBEA 2YHUA 2YFQA 1YVEI 1TT5A 4FN4A 4MP8A 1NQOA 3RFTA 4BGIA 4BNIA 3RWBA 4CJXA 1ZXBA 4CM5A 5FWNA 1UAGA 3FBTA 4JJFA 1T2FA 1Z7EA 2H1SA 4IGEA 1OC4A 4QSMA 1GPDG 3PZBA 3EVNA 3GF4A 1IYZA 3WWZA 1GAEO 2B4RO 3L77A 2ZTLA 4XJSA 3WFIA 1F14A 2NVUB 1H6CA 4FDAA 1BTOA 4IS2A 4JBHA 3HZZA 1R66A 3KZVA 1I33A 1O6ZA 1NHGA 3DEYX 1JVSA 3KYCA 3GNQA 2DC1A 2B5WA 1F8GA 4HUJA 2LDBA 3NGXA 1EDZA 3G1UA 1GEGA 5EINA 5TIIA 1SZJG 3KLPX 2D2IA 5CDUA 5DT9A 1KYQA 3C1OA 1IUKA 4PLVA 3RASA 4IQ0A 2VHWA 5GZ1A 4GX0A 3AJRA 4GPD1 3WMXA 1A4IA 1QMGA 1KY4A 3OSUA 1OFGA 4RPGA 1YBMA 1P0CA 4MOWA 3ZGYA 5B37A 5HBRA 2JJYA 2C29D 1LEHA 1B14A 4L0QA 4CM9A 3RKUA 2Q99A 2EWMA 1P1KA 4Q3BA 1ENPA 5I9MA 3GDFA 3LSYA 4HKTA 3MJVA 5DF1A 2Y05A 3DTTA 3NEPX 4Q3NA 2FZEA 3G0OA 2GCGA 5JAZA 6ADHA 4E4YA 2EHDA 1TXGA 5ITVA 3AUSA 2J6IA 4FFRA 3GH3A 5JS6A 2Y0EA 3ZNNA 1LQUA 2BRUA 2XOXA 3LF1A 3D5TA 4QO8A 4LW8A 4E6PA 3IC5A 1I3LA 3NTRA 4TMFA 4N5MA 3GRPA 1BW9B 1ENYA 3KSZO 5L3ZA 2J3HA 1I24A 1PGPA 4U0KA 1V0JA 4K28A 2NVUA 3DHNA 3OP4A 3ZU3A 8LDHA 5HA5A 1X1TA 1PJQA 2WYWA 4PLTA 3B6ZA 3QQPA 3WGYA 4R51A 4IDAA 4BKQA 3PRJA 1YOVB 3JQEA 4ZQGA 2O7SA 1U2GA 2UUOA 4P38A 5U1PA 3TZQA 1E7SA 2BGKA 2W2KA 1AUPA 2HRBA 2DFVA 1X14A 1AGNA 1Y8RB 5HRUA 4MIEA 4WJZA 4YRDA 4UREA 1WDMA 2DTXA 2AQHA 1GU7A 4OKNA 2VCYA 3AM4A 4CMHA 2Q1SA 4XYLA 4RPLA 4BO6A 2CD9A 5JNLA 1U3WA 4R1NA 1P77A 3H65A 4JXKA 5CDGA 1KEUA 2PA3A 3IL2A 1NM5A 1Q7GA 4I9UA 5IFLA 2C0CA 3O8QB 4DBZA 1QYWA 3ADOA 1YL5A 3RC1A 1ENOA 4MVJA 1W0CA 2BI8A 2IDZA 3QLJA 3MJCA 3PWKA 3UGKA 3K92A 1SO8A 1IPEA 2VNAA 2X23A 3ZWWA 3TOZA 3L6EA 1GQ2A 1P1RA 1W73A 1E0DA 1ZK1A 1EFKA 4NIMA 1KVTA 4AJHA 4BB5A 1I30A 1C14A 2BHLA 1F17A 3PLRA 1DC6A 2A9FA 5CP8A 5H81A 4BNXA 4DYDA 3CPSA 1JAYA 1WWKA 5JDCA 1R4NA 4BIIA 2VYND 4CUJA 2FR8A 4YAKA 1DJQA 4R54A 4H15A 5I7SA 1NR1A 3UW3A 1CF2O 3MOGA 1GUYA 4M54A 4OQYA 3ANMA 1DAOA 1KEWA 4N7RA 3JQFC 4ESOA 2H63A 4BMSA 3M1AA 3HDYA 4OKIA 1CERA 5K0ZA 4S1VA 4AJNA 3E6AA 3DFZA 5KVCA 3JQDA 3HFGA 4G65A 1N8KA 3OA2A 5T8KA 1IULA 5A04A 1LSOA 1Z74A 2YV1A 4J3FA 5L45A 5DBIA 5JYEA 1EE9A 4D43A 2HJSA 2YQ5A 3I3OA 1HDZA 3GDGA 1EUCA 1XSEA 3PFFA 4KZPA 5CDTA 3WTBA 4NZ9A 4XIJA 4DC0A 2P68A 4B8ZA 5IAAA 4EW6A 3ULKA 1DAPA 4Z3KA 1N9GA 3DBRA 4AJPA 1O9BA 2WE8A 1V3UA 1LLCA 2O3UA 3O9ZA 4XR4A 1E3EA 3DBHA 1NXQA 3S8MA 1E7MA 4J7UA 4BS9A 4XWYA 2PH3A 1V35A 1RM3A 5GMOA 3W8EA 2NSDA 4CLXA 2NM0A 1QLJA 1VM6A 1Z82A 3PYXA 4P8RA 1N1EA 5JO9A 3C8MA 3F46A 3RC2A 3CZMA 2GN9A 3VH1A 4NFHA 3GC6A 2PK3A 3EHEA 3KETA 4QECA 5HM8A 1ZSYA 2VHZA 4D3SA 4BGVA 3FSRA 5CHEA 4FPXA 4DPMA 1QKIA 3HSKA 3OIDA 4JJGA 2C7VA 2QZ9A 3LT2A 3AOEA 3ITDA 4HNHA 2QW8A 2GZ1A 1F0YA 4CMAA 2Y0CA 2GLXA 1GYQA 2Z5LA 4O6VA 3S2GA 2DAPA 3I9NA 1ZK4A 3OIFA 4EUHA 1NWHA 1QP8A 5BSHA 1LC0A 3OQ6A 3A9WA 5DN9A 3TL2A 4DWVA 1JDJA 2C5EA 3BHMA 4OGWA 4W82A 2P91A 1QXSA 3FR7A 2RHRA 4DRYA 3H2SA 3DZJA 1NVGA 1HYGA 3UH1A 4GSKA 3L9XA 1GYPA 3JQGA 3E5RA 2D4AA 4OXKA 4A73A 3BTSA 1HLPA 1I2BA 4ZVVA 3AU9A 2O23A 5A5EA 5U4QA 4MVJI 1CQJA 5JC8A 1RJWA 4NJMA 1O95A 1H2HA 3PJFA 1RKXA 1K0UA 3PHIA 3T7EA 3R0IA 1YGYA 5KJ1A 1PS8A 1PGJA 1PQUA 4EBFA 4CMBA 4A0SA 4TSKA 4AG3A 1YONA 1HSOA 2YW9A 2ZK7A 1B8VA 2DLDA 4P4LA 3ZHXA 1CWUA 2DQ4A 4ALIA 1QLHA 3QVWA 3W8DA 4AJEA 4MP3A 4M89A 5JDIA 3TOXA 3WYEA 1GZ6A 4QUKA 2FRDA 3I1JA 1BDMA 1EK6A 4FOSA 2BI7A 1M66A 3GOHA 3W6ZA 4Z9XA 4PLFA 4OSOA 3GGPA 3OEYA 4RF2A 5CPBA 5EL0A 2NU8A 1I2ZA 3RAJA 3ZW8A 3OA0A 5A9RA 3TJRA 5B12A 4TRJA 2X58A 3L6DA 3UAGA 1X7GA 1ISHA 4Q3AA 4CMEC 1R37A 1SNYA 5THQA 3F9IA 3U09A 4MVJP 4HV4A 5G0SA 4WNCA 3FI9A 2W2KB 1GCOA 4IM7A 4CODB 4FBGA 3RBXA 4TVBA 2XF8A 1FDUA 4PLCA 3RSHA 4J4HA 3RCBA 1M75A 5AXCA 4BO9A 5KVSA 4HXYA 5KKAA 4J43A 4NK4A 3IS3A 4QTZA 3WQSB 1JN0A 1E1NA 1ISFA 2RCYA 3DBLB 4HNGA 2DUUA 1BHSA 2FP4A 5KOIA 2A94A 1LLDA 2DBZA 2FY8A 3WX0A 4BNNA 1LJ8A 3CMMA 3DO5A 3I9JA 4GWKA 4W9NC 5L53A 1MXFA 4NJOA 4AJ2A 1MV8A 1PQPA 3DZFA 4RQTA 4RZIA 3L0DA 4WUVA 5G4KA 3FN4A 3RFVA 3V2HA 3MWEB 4YT4A 3KXDA 4UULA 3TSCA 2DT5A 3ZHYA 5IDXA 2NADA 1UUFA 3WG9A 4QO7A 1PSDA 3I5MA 5B4TA 1I3NA 3WYBA 1T4DA 2CFCA 3BYZA 1E1MA 1LRKA 1P45A 1C3VA 4R5HA 3WFJA 4EJ0A 3H3JA 1U3UA 1MX3A 1ZNQO 5L4LA 4G81A 1E3IA 1VL8A 4PRLA 1ISJA 3N74A 2EIHA 3GUYA 5T6BA 2O48X 1KY5A 4BV9A 3FR8A 2DVMA 4ALJA 2EXXA 4TVOA 2JCVA 2FPIA 1KC3A 3JQ7B 5AQ1A 5CDYA 2FR0A 2HK9A 2V65A 3G17A 5IG2A 4CLHA 2VWQA 1K3TA 4WASA 5G4KB 3NRCA 2CDAA 5BNFA 1XKQA 4IIVA 3ZWAA 4IZHA 4FJ2A 1ZEJA 4OOFA 3ZZNA 4L4XA 2NQ8A 3CE6A 4MVJF 2A35A 5DOZA 3A4VA 1CIVA 3TL3A 2GASA 2CZCA 3WICA 1QSGA 1E6WA 2BF7A 2D3TA 4CR7A 1XR3A 1R16A 1NHWA 1T2EA 4I5EA 4XJTA 1U5CA 4D46A 2D0IA 3GN2A 3UF0A 4YRBA 3ETEA 5A06A 1KVSA 4WCFC 2HMVA 4YYZA 3RU9A 2AG5A 3FTPA 4M87A 3I9MA 1T25A 2FR1A 2H6EA 1LDMA 1NBOA 3GNSA 1ISIA 3PP8A 5A3VA 1YO6A 3BHIA 5C7OO 4CV3A 1KEPA 3GEGA 4FJ1A 3GQVA 2D1YA 3H5AA 1PR9A 4K1LA 2DBRA 3CTMA 4A2CA 3INTA 3BMQB 4AJOA 4X54A 3KLMX 1D1TA 1E7RA 2GR9A 4BVAA 4PG6A 3KVOA 2BELA 5BT9A 4CM7A 1SEPA 1YQDA 3WJAA 4QXMA 1I01A 3DZHA 5F1KA 1DEHA 4R69A 2Q4BA 4BHTA 3S2EA 1W6UA 4DTIA 2WM3A 1ZSNA 3IKTA 3TQHA 4BKUA 2EKLA 4U7WA 1VC2A 2HDHA 1X15A 5JXWA 1KBZA 4M49A 4FIZA 5AOVA 1VRWA 3TPCA 4FOOA 3WQQA 3M2PA 3C7AA 2G76A 4R3WA 2PZLA 2IODA 3LT4A 2FZWA 5H83A 4LGVA 1NVTA 1VL6A 4A27A 3F5QA 1E1KA 3O38A 1YWGO 1XELA 2POQX 3E1KA 2BD0A 1DXYA 2DBVO 3PIDA 3WIDA 2VHXA 4CMGA 4FQ8A 4RJTA 1X7DA 1Y9EA 2B37A 4JNKA 3BMOB 3QP9A 4KWIA 2C7GA 1E3WB 4RPHA 4YAEA 4EYEA 5KIAA 3D4OA 3EC7A 4P22A 4IDFA 1HSZA 1LXCA 3SVTA 3N7UA 4DIFA 1ZFNA 2R00C 2Y1FA 3JQ9C 3EAGA 4FB5A 3QSGA 4FGSA 1P31A 3RUEA 1O5IA 4WLOA 4CM9D 3GZNA 1PGOA 1SBYA 3RUFA 3Q6IA 1ADFA 3RUCA 1I5RA 2DFDA 4E5KA 1A72A 3PQEA 5AXBA 4K9DA 3COSA 2RAFA 2FSSA 5T64A 3UCFA 2I3GA 3GVHA 2I3AA 3HUDA 3U4CA 4IXWA 2UYYA 1CRWG 3ENNA 5G0VA 1MFPA 1Y8RA 1RYDA 3K30A 5TT0A 2IEBA 1Y81A 1SB8A 4NDNE 1HE5A 1ZBQA 4DQXA 1EMDA 1T2DA 3FTNA 3DAGA 4MVJM 2JD1A 1WZEA 3AOGA 1H9BA 4XZ3A 3KUXA 4HFJA 4CLOB 4P4NA 2X1HA 1ML3A 3P5SA 4NI5A 3FNHA 2ZJ1A 3K96A 4W7IA 3OH8A 3ICCA 4NR0A 1DHTA 4XYEA 2BFPA 3DL2A 2YQ4A 3DQPA 2AG8A 5MGBA 4MO2A 4O0LA 5KNLA 1FDTA 1DPGA 3IIEA 3M2TA 1SMKA 4U6SA 1CETA 1GZ3A 2JHFA 3I23A 4Q9NA 2C20A 3NTQA 3PJGA 4DIOA 2DPHA 2Q2VA 3BTVA 3QVXA 2VOJA 5A5FA 1U5AA 1ADBA 2GGSA 4ZRMA 3MZ0A 4E0BA 1MA0A 2VRBA 3I4FA 3S2FA 1JWBB 4YEDA 1X1EA 4ZQBA 2VUSA 3GVXA 2WDZA 4MJLA 4DQVA 3PK0A 2NVBA 4FFMA 1Y7TA 2Y0DA 4FC6A 1VJTA 5CEJA 3ZWXA 4BL5A 4Q3EA 3SLGA 3KYDA 3H5RA 5ENDA 3ZWPA 5I7FA 1X0XA 5KTKA 4BO7A 5I7EA 5A3JA 4D0SA 1CYDA 3E9MA 5JPIA 1R4MB 4OL9A 2HMTA 1P1IA 4L73A 3N58A 4Y67A 3QVOA 1PJ3A 3NX4A 5CDSA 5T8KC 3VDRA 1MFZA 1TT5B 4GWGA 4DYVA 3IOYA 1BXGA 5AXDA 4D0RA 2EV9A 1UXIA 1ZIDA 2IRWA 1HETA 2Q3EA 3PDJA 4YBZA 2PZJA 1BG6A 3EGOA 1GUZA 4RCVA 3DTYA 1V6AA 4PN3A 4L4RA 1B2LA 2EP5A 3K5PA 2UVDA 4M86A 4OIMA 5GY7A 4R4JA 2XXBA 1N7HA 2VYVD 1AHIA 1E6UA 4XYBA 1R0LA 2FSVA 1HWYA 4UVIA 4OSPA 4D44A 1LRLA 4F6LA 4JROA 1NP3A 5TJHA 1MB4A 4IIUA 2YYYA 1X13A 1NQTA 3TDKA 3A14A 1R6DA 4J90A 4PZDA 4WLNA 4NG5A 2Y1CA 4RQUA 1IPFA 1UZLA 1T4BA 2HSDA 1BXKA 3M6IA 2NACA 1C0PA 4TROA 2O2YA 3WLEA 1QR6A 3QWIA 1VE9A 1ZEMA 5TNXA 2YDXA 4HY3A 3QJ5A 1ONNA 3ONDA 1VKOA 4WE3A 3D1LA 3VPHA 5C5IA 2OZPA 1BRMA 4LISA 1PWZA 1WNTA 4CM1A 1HE2A 2V6MA 5A02A 2AEMA 3PDUA 1DOHA 1LU9A 4Y6SA 4OXNA 2Q1TA 2HQ1A 2JFFA 4D3FA 1U7HA 3I52A 4U0JA 1UR5A 3SXPA 1LC3A 5JAMA 4CMKA 4WLFA 4PG7A 4Z9YA 1NFRA 3VVBA 4DLBA 2Q46A 4PZCA 3QWHA 3OJLA 4DPKA 3HDJA 3ZN2A 4GX2A 3ZU2A 2AE1A 2G0TA 2OMEA 3AI3A 4JQCA 3GZNB 2JCYA 5A4DA 2HUNA 1LSUA 1ISGA 4E12A 3FNFA 3PPIA 1GY8A 3TRIA 1YJ8A 3UCXA 4L8VA 4J1SA 4GX1A 1B7GO 4M1QA 2HMSA 2HLPA 3U4HA 3KM0A 3RBZA 4E13A 2Q2QA 1SEVA 3PZRA 1Z45A 2QYTA 3OICA 1I3KA 3RQSA 5C7LO 3RU7A 5KJCA 2JD2A 1LX6A 5IZCA 4I5DA 2VTEA 1LQTA 1M2WA 4XX0A 5DP1A 1U2DA 3FBGA 1B26A 3VZRA 3WS7A 3QY9A 1NPTO 1Y6JA 2AQIA 2ZKLA 1ISMA 3CZRA 4TRRA 2FOIA 1Q7BA 3M1LA 3NYWA 4YPOA 2XXJA 5JAQA 4YR9A 4R1UA 4NFSA 1Y8QA 4UUNA 2QZZA 4IXTA 1X0VA 1DHRA 4U8GA 3BMCB 1WMBA 4ONEA 3NUGA 2X4GA 5BR7A 3V2UA 2IXAA 2PNFA 2VN8A 1KVRA 1ZXLA 1HE3A 5A05A 3LK7A 3QE3A 4R1TA 1RM4A 1KS9A 2Q50A 3NJ8A 4CL8A 7MDHA 2NLOA 4P4GA 4IJWA 5CG2A 4XA8A 4R01A 1DFGA 3RUHA 3U49A 5JCJA 3A28A 4N5LA 5TGDA 1NTOA 2PV7A 3H9UA 5JMWA 4E2ZA 3AU8A 1JKIA 1FMCA 4E2YA 2ZYDA 2D5CA 4OHUA 3UFXA 4RVSA 4Y8VA 5JLAA 2ZATA 3OJEA 1DC5A 3F47A 4F46A 1R4MA 2X0JA 2AEFA 3GVIA 2ILTA 3PGXA 1BWSA 1VJ0A 1HZJA 4CLRB 2YUTA 1ZSVA 3PJDA 4IZIA 1L7DA 3O26A 4R9RA 4EUEA 2X9GA 4JK3A 4ALLA 3E8XA 5EJ2A 2PR2A 1UXHA 1E3JA 1YBAA 1MXHA 3GMSA 2ZB8A 4DLAA 2WYUA 4YVFA 2V6BA 1WXDA 2Q2WA 3RJ5A 4FGWA 1LDYA 1T1SA 3QHAA 3HDQA 1JU9A 3ZW9A 4BKOA 1DLIA 4N54A 4B4WA 4YAGA 1UDAA 1Y1PA 2B36A 4YCAA 1K6IA 4FR5A 3JYLA 4YJGB 2JL1A 4CPDA 5ICMA 5DP2A 2ZCUA 1VJ1A 2EP7A 2AQKA 4GBJA 4BNLA 2OHXA 2RBEA 2B35A 3AK4A 2C2XA 3ZCXA 4UEJA 1JAXA 3FD8A 1DIRA 1I3MA 3ONFA 2PGLA 2C59A 1SC6A 1XDWA 3ZWVA 2QHXA 3V2GA 1KC1A 1UP7A 4GI2A 2Y66A 3R3SA 4E30A 1XWFA 1C0IA 3JQBA 4RF5A 3FF4A 1JW9B 2GO1A 1I0ZA 2I66A 4TZKA 4UVGA 4E5PA 5JMPA 3UUWA 1H6BA 2CVZA 2GZ2A 3RIHA 4PG4A 1M6WA 4AJKA 3TFOA 1KOLA 1PTJA 3ZNQA 5F21A 4IDDA 4BNHA 4YAJA 4IUYA 2WD7B 1YQXA 2ZYAA 2J5KA 5T67A 2ZJ0A 2HK8A 4W6ZA 5L7YA 1TA4A 3LC2O 3MJTA 3GY0A 4ALKA 1WDKA 4GQAA 1SCUA 3S55A 4ZQFA 3LC7O 4U6QA 1YXMA 1PX0A 3P2YA 3B70A 4XKJA 1EUZA 1DIAA 5COAA 4II3A 1EBUA 2FPPA 4PGFA 3TNLA 1MG0A 3PGJA 5JDCC 4IMRA 5I7VA 1K6XA 2OUIA 4IJVA 4MVJE 4FCCA 1C0KA 3GUCA 2HKIA 3LQFA 2GYYA 4RF3A 4S3MA 3E5MA 4RZHA 3PVZA 3U4IA 1IY8A 4J1QA 3NKLA 2QYSA 5K6AC 3BMQA 5F5NA 1O0SA 4CUKA 4Z6KA 2D8AA 2Q1WA 1HZZA 3LLSA 4XYGA 2H9IA 3VC7A 2TMDA 4R3NA 5K9ZA 5JCJD 3UVEA 1OAAA 4B79A 3HDHA 4AVYA 5T5QA 2EGHA 3AI1A 1RM5A 1JLLA 1LA2A 3WNQA 2GN8A 3OECA 1DFIA 1HDRA 1BXGB 5BSFA 2VHYA 3JQGB 2P4QA 5A9SB 3GHYA 4J4TA 4ROSA 4DXHA 3GAZA 3WWYA 3AUTA 4CM6A 2Z95A 1E3LA 3CH6A 1Z7BA 4FFOA 5DNAA 4GVXA 4QFDA 1ZZEA 1P1FA 4RDIA 4W7HA 1P9LA 4GGPA 3MTGA 4JBGA 5IZCC 4YQZA 2Y1OA 4EI2A 1VI2A 3WGZA 3A1NA 2J3IA 3GVCA 4BNGA 3PYMA 2ZTUA 4WK6A 4F6CA 1P0FA 2EGGA 5KJFA 1EBFA 1G1AA 3QWFA 1EDOA 2NNLD 1MGOA 5IDWA 2PGDA 2SCUA 2VRCD 3BHJA 3H9GA 4J6FA 3VVCA 4PZEA 2Y1GA 4E33A 5L7TA 1NPYA 4CLEA 1HRDA 2Y1DA 3KV3O 3KEOA 3QIVA 5KVQA 3HN2A 4CQMA 2C5AA 3IUSA 4Y98A 2QG4A 3GA0A 3EYWA 2ZB4A 4ITUA 4LCEA 3CUKA 3VH4A 1B3RA 3ADPA 3L4SO 2HRZA 3SBOA 3GEMA 1GDHA 4QQRA 3WR5A 3WGIA 1Q0LA 4UEKA 4OM8A 2O7QA 3ON5A 3FWZA 2X7HA 3MJEA 1WZIA 4IJKA 3VZSA 1SPXA 1J6UA 3JTMA 4DQUA 3IP3A 4GH5A 2EG9A 3HG7A 1YS4A 2IXBA 2J3KA 1ZK3A 3WLFA 4AL4A 3ETDA 3WQRA 4MVJD 4ND5A 1A9ZA 1O94A 3B1FA 1HDYA 4DGSA 4B7XA 1K5HA 1WLYA 4KDEA 3OJOA 1E3WA 4WNIA 3SJUA 1YB5A 3ANLA 4HFNA 2JFGA 1LI4A 2EW8A 3TWOA 1CDOA 2GF2A 1MC5A 3LYLA 5I9NA 4EJ6A 3ROMA 3IJPA 1VSUA 2CVQA 4MP6A 4FW8A 1B16A 1Y5MA 3H4VA 1SOVA 2EW2A 5G0WA 3TF5A 3DZBA 1W4ZA 1UXKA 2EEZA 4MIYA 4EEXA 2FMUA 1VLLA 3W8FA 1EVYA 1N5DA 3JQ9A 1BVRA 1HLDA 1QV7A 2I76A 4YJGA 2OXIA 3DOOA 4DLLA 4NU5A 3AY7A 4I5GA 3BAZA 5TLSA 5KJ6A 3AI2A 3GMDA 4H16A 4BNTA 1R0KA 1ZKMA 2YHIA 1AN9A 2P4HX 3ICPA 4MKXA 5JY1A 2IYOA 2GD1O 2IEDA 4D3DA 4YT5A 3FPCA 2X0RA 1ZJYA 1BMDA 4UUPA 2PGJA 1JVBA 3GN1A 3ROQA 3D64A 5KKCA 2I5PO 2YJZA 4YAIA 1NASA 1PZEA 5JE8A 4GLLA 1A27A 1K6JA 1NYTA 3NDRA 1L1FA 1UAYA 4RLSA 1I2CA 1DBVO 4FD3A 4YQYA 1YDWA 3E82A 2TMGA 3PHLA 1H94A 3EZYA 1PZGA 2BGLA 3KYBA 4LVUA 1IB6A 4LMRA 4BNVA 1C1XB 4BO5A 3SX2A 1YOVA 4O1MA 1VL0A 4NH4A 5JSFA 1PJLA 3UICA 2WYVA 3H8VA 4RGBA 3D3WA 1P1JA 1HDXA 1WVGA 2RH8A 1DRVA 5FI5A 1J5PA 1G0OA 4HFRA 3RD5A 4ZA2A 1H2BA 1H0KA 1E7YA 2ET6A 3ZWNA 4OXYA 2Q4EA 3WOHA 4J0EA 1BSVA 3BXXA 4RVDA 4MKZA 3W6UA 4D79A 1LLQA 3JYOA 5TC4A 4J49A 2HU2A 1BDBA 4IDGA 3JQ7A 1ZVMA 3AM5A 4UVHA 2WMDA 4BO2A 4FS3A 2VUTA 3DONA 2GN6A 4CV0A 4IDCA 3CSDA 1PL6A 1XIVA 2QX7A 4NQZA 3DOJA 4L9RA 3WGQA 3K2BA 3Q0EA 1PGQA 2OO5A 3DZKA 1NAIA 4KP7A 1TEHA 1N9GB 3PI7A 4ZN6A 5LDGA 3WXBA 4I08A 3CIFA 5L95A 4GSLA 4PLPA 3BTUA 3F3SA 3AM3A 2VOEA 4ND1A 2J5RA 3SLKA 4EJMA 3C7DB 4LVCA 3KHUA 2V6FA 4B4UA 4OJNA 2DTEA 2Y68A 4AJ4A 3AOEC 3V1TC 1U3VA 1EVIA 1T2AA 4UVDA 4MKRA 3LZ6A 3R1IA 3DBRB 3STHA 4Z0PA 3WDSA 4CR8A 3HJAA 5B4VA 2VT2A 5EN4A 3IAHA 3QA9A 3UN1A 2I6TA 5TT1A 1Y9AA 1AE1A 2R6JA 4ZICA 2DUWA 3NDJA 4ZJUA 4WLEA 1XQ6A 3FWNA 4QT0A 1PJCA 3FHLA 1T2CA 3D3WB 1UXGA 4I9NA 1R0SA 3O4RA 4OOEA 5FEUA 3P7MA 1UJMA 1YL6A 4ZRNA 5KCZA 4BNUA 3NGLA 2PZMA 4BO3A 2RIRA 4BO8A 5FF9A 4KTVE 2DM6A 5EQDA 3C1TA 2BKAA 2VYVA 3DR3A 5AXAA 3E03A 3GGGA 5FYDA 2DBQA 5TSDA 4J0FA 2I67A 2XPCA 3AFMA 4CV1A 2O3SA 1H9AA 1Z6ZA 3JD4A 1GV0A 3OBBA 1I8TA 3JYQA 1OC2A 3QRWA 3QVSA 2Y99A 5CAEA 1DFHA 3H9EO 4UVEA 5JYDA 1B15A 1Q7CA 2HAEA 4CMIA 2PD3A 1XGKA 5BNTA 3IKVA 4BKRA 3ITKA 4L4SA 3SC6A 4NPCA 4YRAA 3ANNA 3ZWOA 1PJSA 2O3RA 3QWBA 3VPFA 3GEDA 1PQWA 3I6IA 5JDIC 2OFPA 3ZI0A 4ALNA 2B4TO 2PLAA 3IMFA 4OO3A 4BMVA 4PLGA 5ER9A 3ZU4A 3D4PA 1EQ2A 5F5LA 4I5FA 5I8ZA 3ZH2A 4A26A 3L4BA 1OMOA 4XGIA 3PWZA 2VUUA 3PQFA 3A06A 3QW2A 3CKYA 3VTFA 1E5LA 3ST7A 3KO8A 1KVUA 5JFOA 1GQQA 3D4NA 2X5KO 3Q2KA 4IGFA 4NK5A 4M8SA 1J49A 4PVDA 1ZW1A 3AWDA 5I8WA 2DKNA 1T26A 1GD1O 1QV6A 4Q3DA 3FPLA 2IZ0A 1IZ9A 4ZU3A 3ZHZA 4B3IA 2O4CA 4RDHA 1BW9A 2X0NA 1S7CA 1WMAA 3K8ZA 1WPQA 4KTTE 3H7AA 1ZK2A 2E37A 4Z9FA 2D5AA 3C1AA 1Q0HA 3F4BA 2FWMX 1XA0A 2O4UX 4NBUA 5IXSA 1KEVA 1PEDA 2YY7A 2J5QA 3E9NA 4UUOA 1KIFA 4YDRA 3NT2A 4IDBA 1S6YA 1HT0A 3EK2A 4LK3A 2B4QA 3B20A 1GCUA 3W1VA 2UUPA 1V3TA 3G3EA 3I6QA 4AJLA 1ARZA 3WGGA 4BGEA 1GQYA 4PCVA 1TB4A 1AHHA 3E48A 4GVLA 2R00A 4H3VA 1ZK0A 3OHSX 4G2NA 2YDYA 1MP0A 4EEZA 4I8XA 1U7TA 3WBBA 4FFPA 4CQLB 4INAA 2AHRA 5IDYA 1FDVA 3JYNA 2PTGA 3DOCA 3OJ0A 3PHHA 2GRAA 1EUDA 1FF9A 3MCVA 2EJVA 2NVWA 4CLRA 1IHXA 5I9LA 3DBLA 3Q3CA 4ALMA 4CLOA 1N7GA 4TKMA 2H5LA
chains in the Genus database with same CATH superfamily
4RZ2A 1Q15A 1DC4A 1M6HA 2FZKA 2P5TB 5SYMA 2R79A 1Q20A 1DBIA 3AJEA 1EU1A 1F1BA 2A30A 3JQBC 1G7RA 5ILQA 1L7EA 3AO0B 5L7WA 1YQUA 3WRWA 1KDRA 4NU6A 1UZAA 2XYQA 4LZPA 3UJDA 3EDYA 4J9UE 1ZVJA 1U0TA 2NXEA 2XDYA 3QU2A 2FRXA 4MRMB 5BN5B 4CBVA 2EKQA 4OB8A 4ETIA 5BN1A 4QHYA 3WJ7A 2JASA 5EY5B 4JLWA 4G0NA 4JKOA 3T7AA 2BFFB 3PDIA 1M2KA 3FROA 1NOIA 1THTA 2RONA 5DWDA 5H16A 1A7AA 1E9DA 2F3RA 4AWBA 1AKVA 5BV1A 4FMDF 3INRA 3ABIA 1MHPA 4XUGB 5K1ZA 4AYTA 1NF2A 1V2GA 2AEJA 3JD2A 3QVTA 4I4NA 4QUIA 1KNQA 4DWOA 1VYTA 2XDAA 4N18A 1Z4KA 5BW5A 1JHAA 3TW8A 3KQHA 2PBRA 2YFYA 1USIA 1XFDA 1E3MA 1MG5A 2GRJA 1Y33E 3NAZA 2BI4A 4ZAFA 4L74A 3ZCQA 5KTSA 1DAMA 1XTVA 1KAQA 1Y9JA 3LP8A 3MEQA 5G0TA 3ZS9A 4B3HA 2GDZA 4G26A 2YY6A 3ZWCA 3L8MA 3WGHA 1KARA 4GQIA 5DTEA 3ND9A 3BD9A 5HCUA 3DMYA 1PJBA 1SVNA 2HHJA 2Q45A 3HADA 5LOVA 4MDHA 2EKDA 1EVZA 1ZOIA 2AH5A 1V47A 2R2GA 4H1VA 4YJ2F 4ZJZA 3E22A 1YB4A 4YP9A 2CCJA 3WGLA 3VHRA 2BKLA 1M34A 5MFZA 4Q00A 4MW1A 4CF4A 3P5BA 2Q5LA 3ZWMA 3TOVA 2QGNA 3UXHA 1EUYA 1IXKA 2QMOA 2Z6VA 1YUNA 3SJBA 3T4UA 3TMYA 2D74A 5C32A 1AXEA 2CEKA 3WA6A 2NYUA 1U0GA 2X5JO 2VC2B 3C85A 2ALJA 2AYXA 3I1IA 3UPUA 2X2PA 4LJ8A 4EKDA 2GNAA 5FUBA 2HWUA 3NU1A 1G9SA 2RK4A 1YDGA 2IKSA 3LBIA 4UTOA 5DZSA 3RTEA 4TS9A 3CONA 3WAKA 4ZGGA 3DNMA 3U39A 2RHWA 3BGIA 4C07A 1B23P 1YA8A 4XTRA 1HDCA 3NMUF 2D3WA 1AT1A 2VNIA 4CMIB 1A9TA 5HKKD 1QG0A 4TL7A 3R7LA 5K4GA 1B8UA 1EINA 1TX4B 2QTNA 3U4GA 1E3SA 4XQCA 3HXQA 1KE1A 3U62A 1WQ4A 3VR4A 4YLYA 3ZWKA 4JBLA 2D54A 3STWA 4DKJA 4PQGA 1GL6A 1CQZA 3FPFA 1YVDA 2XHEA 5EJ8A 3OO0A 2X9NA 6LDHA 3QX3A 1YZHA 2BBTA 5G0UA 1IUPA 2PL9A 2P2NA 4AJJA 2ZTVA 1U6KA 4O63O 5K0SA 2W6JD 1C7QA 1C4KA 3IKMB 2ZJ7A 3NXSA 3EXAA 2ZG6A 3OQVA 1KWKA 3KSUA 1N75A 4TZTA 3T5BA 3DE1X 3LYHA 2OP1A 1EA5A 4G5XA 4F7DA 2X1VA 5JW6A 1A9YA 4DTCA 2W22A 4EGCB 2B69A 1NXXA 3EMKA 3DW3X 4B43A 1H6DA 3EC2A 4E46A 5GONF 4JYAB 3I12A 3I8OA 3DSRA 3NVMB 4A7PA 1L3BA 1OBFO 4DR1B 3HCRA 3KAKA 5F9FA 3EXG1 1U8AA 4XFJA 4QYIB 2I80A 4HT3B 3W5DA 4K6MA 5CM8B 3S7ZA 4R9VA 1UFVA 4CEIA 1V1RA 3QFSA 2CY0A 2G06A 3VHLB 4OPMA 3WNBA 4POOA 3B7GA 4G0QA 3U4DA 4JI1B 1QTIA 4LC0A 5B1EA 1OILA 4GL4A 3AEUA 4E5SA 2W48A 4JP3A 2WMYA 3H19A 4YCJA 4N41A 2VJBA 1LS6A 1EUCB 3REFA 3V33A 4F3YA 4O8ZA 2HT6A 3DCIA 5I4KA 4Z0TA 5C7IO 5JCXA 3L7AA 4O3MA 4EH1A 3HJRA 2WUFA 3N7AA 2X22A 1AV6A 3F97A 1XU9A 2E82A 2W2LD 4BN0A 5BN3A 4A92A 3NT4A 4NAUA 4Q7EA 3U6KA 3HP7A 2WVGA 1OCEA 2ZBFA 3UZUA 3WXMA 3IBYA 4CWAA 4EZEA 4PC6A 4L76A 2H2AA 2PD6A 3FNIA 3HN7A 3MCWA 4PS0A 3VR0A 3P94A 4BBAA 5ILGA 3KYCB 3L7IA 5A0VA 1H23A 4TS1A 1BFDA 1JKXA 3H5NA 4MQEB 1I10A 4LSGA 3GPLA 3M7IA 4PLWA 5DHSA 3T12A 1OH5A 3FTEA 4JJAA 1BD3A 4GR4A 2HMWA 2PAFA 4F8JA 1KO4A 1N2SA 1YR3A 4OV6B 3KVRA 4JLPA 4WLUA 5D6OA 3W78A 2H54A 4F6RA 4RCZA 1UFQA 4RLHA 5B1SA 3KL4A 4CF6A 1E0AA 1N32B 2JAUA 2J9GA 1W5SA 4WESB 4ZJYA 2JLCA 2GPWA 3V8BA 4KGDA 1DWQA 3VNRA 1M83A 1QR2A 1FYFA 5CEEA 2QD3A 1GSIA 2JFHA 4W5OA 1OYYA 3DEJA 3KCNA 5JBIA 1XZIA 5IU6A 4KO3S 2B30A 4YC7A 2PWZA 4PX2A 2QVXX 3SR3A 3QVLA 3OIYA 5EE5B 1VBKA 2I3BA 2PCLA 2NPOA 3QVKA 1N0HA 1ZNYA 4U7DA 1ZQ9A 4CL0A 2WSBA 5F35A 1J0XO 2ZAMA 3L18A 2O59A 1RYEA 4IXNA 2X0IA 2FSIA 2O3JA 5CEFA 5HRAA 1ENZA 4QBIA 5FTNA 4CF7A 4JSRA 3IKLA 3F6BX 1T34A 4NFYA 4AJIA 3Q3VA 5JCPA 3B5IA 5EVJA 4F91B 5EIBC 3AONB 5DX0A 4D41A 1Y98A 3IJRA 2LNDA 1P2SA 3EH2A 3GPCA 1IUNA 1SAYA 1Z8NA 3B1JA 3IODA 3MT8A 4K9QA 1DQNA 3DEKA 3TSYA 3CA8A 4PZAA 3F1KA 3H83A 3CF4G 3HE3A 4C4ZA 4R3UC 3EF1A 5FFFA 5G2OA 1K5DA 5ALVA 1TGYA 2XVMA 3QFTA 4D5GA 3MNFA 3PITA 4UBIA 2UYOA 1VKRA 1V6SA 5CA1B 3R4CA 4MWTA 1KI3A 3AFOA 3QOWA 3ZQJA 3DVLA 3D2CA 4BQNA 4CW7A 3IAM6 4QZVA 4G89A 5JNTA 4LN1A 4F45A 4PZZA 4KIGA 4GRDA 1VKJA 2OHGA 1R00A 1C7IA 4PAMA 2BT4A 3IALA 16PKA 2HGSA 3BZUA 2BUCA 3CIOA 3NHZA 4YJ2B 4TYWA 3S68A 4AF7A 4B87A 1U8XX 1DKLA 3V32A 3IP1A 2V98A 1G5RA 4JITA 2IU3A 3C2QA 2BEWA 4K1XA 1G2QA 1RLUA 1CQJB 4K3UA 1H3NA 1OIXA 4QUAA 3BL8A 1KJZA 2B5OA 3BA1A 3L0OA 4TKLA 3RO7A 2JGRA 3GFOA 5CVDA 4US2R 2AKEA 4JI7B 2HRQA 2P9CA 3PXGA 5TMDA 2IY8A 2YZ7A 2ICAA 2VYNA 4FZRA 3C5WP 4MJ7A 1MJFA 2AXQA 3KOUA 1E7WA 3O7MA 2O14A 2NOAA 4XCXA 3ER9A 4H35A 2WFMA 3G8AA 4GKVA 4GKBA 5AESA 2XNDD 4J0HA 2WD8A 4B3RB 1ONPA 3WWOA 2IELA 3BD8A 4NZNA 3ZU5A 2P5UA 4GKAA 1E59A 3W3AD 1PZFA 2CHEA 5D85A 1YQGA 3O4JA 4CIAA 5JJBA 1TZCA 1OZAA 4RTOA 5EE9A 2VDKB 1OFUX 2J3QA 1PW7A 4MTCA 3NBFA 1G3RA 3R5HA 1HQCA 4RQBA 4R8RA 3RS5A 5GWXA 4YV1A 2EFEB 2ZYGA 2BLNA 2V45A 5E9JA 2P5YA 3ACDA 3FLMA 4QU5A 2ZSIA 1CQIB 4YXWD 4PHHA 5KBYA 3E9ZA 3DMHA 2FJUA 1FEZA 1UOOA 2YNMD 4LZWA 4P35A 4AXBA 4F72A 1ZCZA 3EODA 5EIOA 4FD2A 3AFNA 4Y6QA 3D0OA 1IWPB 2HWKA 3FPAA 2OENG 4YACA 3W1WA 3KJHA 4B35A 4EYGA 2RKOA 4DQKA 3IE2A 1NVFA 3VZCA 1KAOA 5JSYA 3PPVA 5TPZD 2WJ3A 1MEJA 1JU3A 2GAJA 2C2ZA 1JKJB 1VIYA 3QNMA 4NYJR 3WL5A 2MR5A 1NLUA 3TYXA 3D8TA 3Q3GE 5I3ZA 1UJ5A 1K8YB 3TX6A 3ORQA 3DBHB 5F1OA 4MVCA 1RKUA 2YXLA 1WCYA 2ZQYA 3OEHD 2XYGA 4DB2A 3GCDA 2WHRA 3O7WA 1V45E 3PNYA 4N39A 1LW7A 2CHUA 4B82A 5CX4A 1OROA 1LCIA 3AL3A 2VBIA 2ZDQA 1YRLA 3B6MA 2QUIA 1J07A 3FLBA 3K8QA 1OI3A 3PNMA 3QWAA 4JIGA 3WK5A 5KTYA 4HWSA 4PFJA 1ORIA 1OWLA 2EYQA 3A37A 3IUMA 3B6JA 4YB8A 4PONA 2P0YA 4F84A 2JAHA 2WI8A 4Q12A 5CYPA 4BC0A 2JFVA 5FOSA 2ISSD 4EHJA 1GTMA 4BX9A 1Z5ZA 3Q12A 5EEHA 1MJHA 2X2EA 3C24A 5SZIA 1DQYA 2FZ5A 3RV4A 4AB1A 5EXXA 1NUSA 4CR6A 1V4VA 1OH8A 2GOYA 3FCCA 4C1BA 1IY9A 1E4YA 5CCEA 4PG8A 5THKA 3TEJA 1SVSA 3FM9A 4JB8A 5DLYA 2PBFA 2VHUA 1GZ4A 1EGAA 2P6UA 2Q6VA 3LO5A 4LBVA 4RSGA 2IXDA 3HYNA 4FFWA 4ZYZA 5JIBA 1A5TA 1QG6A 3VHQA 2O2XA 1YS7A 2BY4A 2PZKA 4KFRA 3P0FA 1DB3A 1XC7A 1E5QA 2IKQA 5K5EA 2B2XA 1UQUA 3VKUA 4HBGA 1C9MA 2CBGA 5T3UA 2X19A 2A58A 3VMFA 5K09A 2CLSA 1P7VA 5ESWA 3RVMA 3M49A 2E4WA 5HQ3B 3JQAD 2IS1A 1WQ1R 3OZUA 1AUXA 1JDBC 1RI2A 3BH7A 4OQLA 4K6FA 5AVRA 3LUGA 4X97A 2R7KA 3PTZA 1SJ9A 2WQ6A 3L9WA 4DMLA 3IP7A 2X2FA 2WB2A 2XOKA 4R1QA 1FCJA 4HB4A 1T3SA 3IPXA 4Z0HO 2GSWA 1B8PA 3I30X 3NNNA 3MXOA 3HNPA 1RBYA 2F64A 4MV6A 5CA1F 4DZRA 2HJVA 4QPJC 1A7KA 3L0IB 3GEIA 4L7QA 2V4UA 1VZ2A 1XLTC 3LHDA 4OJTA 2FSFA 4NECA 4PS1A 4BNKA 1Z75A 1KDTA 2OGUA 3L6OO 5IANA 5JO0A 5DCUA 3I9V6 4GMGA 4J2OA 4M9XA 3UYLA 3QKTA 3JVUA 3CYFA 2DCMA 4OA8A 4BJHB 2FPGA 3MQ2A 5L4SA 1JHZA 1C9YA 2YWBA 3D1JA 3UOAB 3RRYA 1I6KA 1Z17A 3GPDG 9GPBA 3TGPA 2Y1LA 3CF4A 1T2NA 1TFUA 2Z6QA 3OPNA 2PT5A 5IN5A 4EG4A 2AD1A 4G1EB 2XUAA 4UCXA 3IBGA 4P34A 4LV6A 3TQIA 1UMCA 4CL3A 4EW3A 2W5UA 3B9BA 4FM9A 2K5UA 4BMYA 1NI5A 3N6XA 1AKNA 3L07A 4PBRA 4TKVB 4V0QA 3A05A 3FZGA 2WFZA 3Q1LA 4I9HA 3OWXA 2ACKA 1WBJB 3QVVA 5BSEA 1YRYE 4IWNA 1MB2A 3DB1A 2W8ZA 1E98A 4Q39A 3RFUA 4UUMA 1QIGA 4CZ2A 3BXEA 5I8PA 4RV9A 1VMKA 2PS3A 1T1RA 4ZQHA 3I5AA 2H1HA 3GEEA 4GPZA 5FI1B 4G5HA 4Q18A 2GESA 3D5QA 1L5ZA 2ZIGA 3TAUA 1UINA 3GA5A 4N6GA 2AFHE 4R1OA 3SY8A 1TI7A 2YN0A 2O8BA 4Z7JA 1HYEA 1ZJ6A 3IHWA 1G18A 3QW4B 5KVAA 2OE2A 5J5AA 3KTDA 3RVNA 4B3CA 1H9CA 1D1PA 2P40A 4UHBA 3RADC 1B8NA 2XCIA 4RZ3A 3TBFA 5JXIA 5ABPA 1DQPA 3KEQA 2JLXA 4RHXA 4C6TA 3EVBA 1G4AE 3ZJVA 2EKBA 2PH5A 1SCKA 2HJWA 1IK4A 2QE7A 4Y18A 5AO9A 5FIUA 3WL4A 5JPDA 1U0FA 1CF4A 1SXQA 1J0EA 1JPVA 4FCVA 1W59A 3SFVA 1NKVA 1NVBA 4CM4A 3UJAA 4TRNA 3E8SA 4LOLA 4E5UA 3HQ4O 1DE0A 2VP2A 3BGSA 3K4PA 4Y9RA 4D8TA 3OQNA 2OC9A 4LFAB 3PJRA 4BC1A 3KBBA 1C9DB 2NWQA 5J2TB 4H4EA 2VTKA 2NU6A 2EAUA 4LJKA 4UDOA 4RKEA 2H65A 1FVXA 1E69A 1WG8A 5ELLA 4YXFA 2JIOA 2OCYC 3RARA 3OQ1A 1MQSA 2CMGA 1QYXA 2GBGA 4LDZA 3TE7A 1AO3A 1QP7A 5ALKA 3BQMB 2V55B 5DULA 1JHVA 4IUCS 1P7WA 3DWFA 4GI5A 4GS5A 4AJ1A 1YFJA 1DEKA 4F06A 1MB3A 1XQ9A 1IZ0A 4MUYA 1U2GC 1XJWA 3E22B 2RMKA 3FRHA 2UXBB 4NS4A 3PLNA 1IBRA 2IIQA 3OQBA 3UANA 3IUEA 3RJ9A 4ZMSA 5KDOA 1DLJA 2ZUSA 5EJ7A 2I65A 1PKXA 2Y92A 3H5IA 2HIMA 4NJMB 2OCXA 2VJDA 1E6EA 1QOZA 5COQA 3ZBQA 5KHOC 1P80A 5MGBA 3BCRA 5EPOA 1BNCA 4PPYA 1A04A 421PA 3DT6A 3ENQA 3E61A 1J4AA 1UKYA 3PQ3A 3CH4B 5DXJA 3A6KA 4YUYA 1PFYA 1DQRA 1OASA 2YN2A 3OJWA 4RSRA 4X91A 5GONB 5T4HA 4P1ZA 2I62A 4FNGA 1OZ0A 3MMXA 4WY5A 4UU1A 3N2KA 5KNCD 1Q0TA 1X8LA 1GZ7A 3LWDA 3TQCA 3ENZA 4MKHA 1PU2A 4G1CA 3N2EA 1HI9A 1LTHR 1ZCBA 2VRCA 3GT0A 3MMSA 1ZIYA 4YGXB 3RYTC 3GLIA 3E2IA 4TMTA 4KR3A 3PTAA 4AM8A 2FB9A 3VHXB 2XQVA 1U0LA 5SV2A 2PMEA 4BJ1A 3THXA 3SZOA 3K31A 3MGKA 4PV7A 3SC4A 3D0QA 2ZDHA 1PJAA 3EB9A 3VPAA 3EUWA 1R9NA 2YS6A 1WAMA 3QBJA 2YHBA 1T6BY 3WE7A 1FZQA 4IEEA 2YV4A 2PRKA 4FFNA 4JB3A 4R5MA 3SDBA 3UKOA 4QDTA 3EWNA 4O59O 4Z5XA 4YI3A 2P9QA 1U3TA 1SIWA 2NTYC 2ZYHA 1CXZA 1SD2A 3QVGA 3VPGA 4CMCA 1SHKA 5DBGA 2YN4A 5BWCA 3Q11A 1VFPA 4K26A 4C7JA 5K3OA 1YJ5A 1YQQA 2XQJA 5HX7A 5JNVA 3BIWA 1MN6A 5CU7A 4OX9Y 3VDQA 4HJXA 1FDSA 2HOQA 3WLMA 4ARZA 4E3ZA 1WIWA 2OZVA 4BFXA 3R6DA 2A9OA 3RI3A 5LA6B 4PLYA 2F8MA 4R1SA 3ZCTA 2HLDA 1GNVA 1XTPA 3VTZA 5BNIA 4OX9B 3IB6A 4HMQA 2GAOA 4KOAA 5I45A 2IFTA 3GJ0A 3GR6A 2CBZA 3AY3A 3HBLA 4DIUA 4F9FA 3EZ6A 2QIOA 4IJUA 3URKA 1PJTA 2PXHA 4DC1A 5EE3A 4ZHSA 2YWRA 2WJIA 5CFRA 1P2BA 2AUMA 4CF3A 1CZKA 5HS4A 3GZ4A 5HIKA 2GEKA 2HHHB 4JLUA 5TX7A 1JIJA 2R6FA 4OK3A 4EZBA 5L8VA 5K3FB 1L5OA 3IUPA 3HB9A 2II6A 3PHCA 3WSVA 3RVOA 2YFHA 3KJXA 3C7CB 1G98A 4DA9A 3MTAA 1VMEA 1CT9A 1N3BA 1NY6A 1V6CA 1OA0A 4OYRA 2GZHA 4CM3A 2M9MA 2QX6A 4O4HB 3MBKA 3VH2A 4HB3A 2HK7A 2W37A 3EMDA 3I4CA 2OBFA 1CJBA 1B00A 1T8YA 3VXKA 3IEKA 1E63A 3I58A 4D7AA 4J75A 1GA4A 5FLKA 5KX5A 2WIDA 2IK8A 1CS0A 4R2HA 1WXFA 1RPTA 1U0RA 2O8FA 5JI2E 4YX9A 2J08A 3H3FA 3DXFA 4DUPA 5H82A 1J2YA 3IHLA 1B3BA 4ER0A 4FMCF 2QUZA 5CG1A 3CU5A 1NXWA 2WK1A 1NKSA 3HB4X 3A9VA 4I4LA 4M1SA 4GC5A 3SYTA 2J07A 1FL9A 4RVFA 4OQPA 1V9SA 3IHTA 4KR9A 1MPTA 3GO4A 5KCMA 2BZSA 4LOHA 3AR7A 4YDHB 5J59A 4TYNA 2ZZMA 4O2RA 5IVHA 2FQQA 2IPXA 2NO6A 2PE5A 3N70A 2CUKA 2EJBA 3FPSA 4KPUB 5EJMA 1QOQB 2N1BA 3TZHA 3ZXUB 4B2IA 5H3HA 3THSA 2NZJA 3LRXA 5DI9A 1SY7A 2FN9A 2G0AA 3DC2A 2UVQA 3GG9A 3Q9UA 1NOJA 4HBZA 5T57A 3O8NA 4X3PA 4J16A 4B4OA 2ZQ5A 5BSWA 3KR2A 5EGNA 3AXSA 4L9AA 3H9CA 2JFNA 4R0VA 4DIDA 6GPBA 2C0PA 1OFVA 2Q9UA 3K4QA 1L5HA 2MSNA 3RWOA 1YCGA 3DOUA 3L8HA 3BJRA 1R3DA 1GCAA 3GFSA 2OHIA 5E8RA 3TTYA 1IEXA 4W99A 3F78A 5FLXA 4I2NA 3IURA 1Z2PX 4YJHB 3S1LA 2AR7A 3HXOA 4RULA 2H1OA 3FNEA 3ENKA 4ND8B 2AL7A 4JJZA 3SZGA 2AOXA 2OFFA 5D84A 1RJ9B 2PPLA 3NB0A 2E6UX 4WZBA 3SS9X 2EJWA 2JF0A 4YCCA 3KE9A 2KI5A 3LCMA 2XRFA 4Q05A 2WHQA 2OD7A 3QYJA 5LQUA 1AURA 2BFOA 1Z34A 1C1HA 4AXXA 4CF5A 1PIWA 4KRXA 1UOPA 2PKXA 4DJTA 1SG0A 4NZMA 1C8KA 4BFLA 4CM5A 3G8YA 2GZSA 1ZXBA 1XWWA 2HU7A 1Z6QA 3U4QB 2ZULA 1T2FA 4TLEA 3JZAA 2H1SA 3NHUA 3GLSA 1RLIA 3MILA 4MV1A 2R8OA 1M1XB 1KMNA 1F2UA 2QROA 3H2YA 3P4YA 4CT4B 5IJ0A 3UHPA 1T0HB 1C7FA 2I1LA 1GPDG 4JT8A 4QSMA 5DNEA 1WE2A 4UAUA 4IHJF 1GAEO 4I1SA 3L77A 3OZ7A 2ZTLA 4PPFA 1RZ3A 2BMEA 3WFIA 4DG5A 2G9VA 4B7AA 1DNPA 1PR5A 3VFDA 1M0WA 1I9CA 1PHRA 4MW7A 4MI6A 3SGLA 2I2AA 1HG1A 3KZVA 1R0YA 1RC1A 3NEAA 1I33A 5EG5A 4HDKA 1T5SA 3FHOA 5IULC 2DC1A 1G59A 1H1TA 2XE6A 3TH5A 3G1UA 3AZPA 4DY6A 2YVUA 5EMKA 4C0LA 1BCSB 1A95A 2GTPA 3KLPX 4WZZA 5EXSA 4D0LB 5CDUA 5D6NA 5FL3A 3SZLA 3TUJC 1IUKA 2EQAA 2L0XA 3P9KA 4PLVA 4F56A 1DAFA 1FNSA 2QRVB 3JAKB 4DSOA 4PGMA 3SE7A 4CQJA 4NMMA 4GPD1 4L3WA 1KY4A 1IY0A 1S9HA 1CHDA 3DD5A 3WLTA 4R9NA 2Z3ZA 3B2EA 3K4HA 4FYXA 4F8EA 4I6EA 5GIPE 1FFSA 4L0QA 1L3IA 2I2BA 2AJTA 3C8DA 4LHEA 1S7GA 1XZLA 1KJNA 2QTBA 2EWMA 1P1KA 2W0SA 3BDAA 5LZ5A 1ENPA 5DF1A 1KDVA 3DTTA 3QELA 2AFHB 2FZEA 4ZOBA 2GCGA 5JAZA 3N8HA 1CB0A 1R7RA 2QLMA 3II6X 3MUNA 6ADHA 5CH5A 1T2VA 1TXGA 3B48A 4LYGA 5ESDA 1SKMA 2IYLD 3AUSA 3RJZA 3G7SA 4LAFA 2HPVA 3GH3A 1Z2CA 1IHPA 3JS5A 4ZAZA 5LZ7A 4CTMA 1QGYA 1N2ZA 2EDCA 5TS2A 1KNXA 3EVCA 4X3OA 1P9RA 2XSZA 1LQUA 4ZU1X 5LR6A 2HO4A 4QO8A 4R7TA 1CP2A 4M36A 3KLOA 2Z2ZA 4WK2B 3W06A 1I3LA 1BW9B 4QSHA 3KSZO 4H7JA 1LQ2A 1WCV1 2F1JA 2R1UA 4UFNA 4V0LA 2WJWA 2YZKA 4MMXB 2A3NA 4BFWA 2NVUA 4U7JA 5HA5A 4PLTA 2WYHA 1L5KA 2CJWA 5E9AA 4XXHA 3QQPA 3L8GA 4W5QA 4R51A 3HI4A 4IDAA 2R48A 2ANBA 3HDVA 5JJLA 1E79D 5HFNA 5A1JA 1BU5A 4QHSA 5U1PA 2RGCA 1U2GA 2UUOA 3BE4A 3EN0A 4U9IS 3DEIA 4B5LA 2AUTA 3TQSA 1AUPA 3V4VB 5LD2C 4G0PA 1WUKS 1Y8RB 1ULZA 4MUKA 1MX9A 5INTA 1JFSA 3G9ZA 2HFJA 2Z2YA 4MS4A 3RGWS 3TQTA 4EJSA 4JP1A 3OY7A 1ZRSA 4JBNA 2BAGA 2F7SA 3U3KA 2NZ8A 1QTRA 1R18A 2P1RA 3HMQA 4JLSA 5HIMA 3DOIA 1CY8A 1NN0A 3AM4A 2Q1SA 3HXTA 4EQ6A 3JAWA 1L1QA 4BO6A 1E3QA 4MS3B 4LRYA 3FPHA 3FZEA 4NICA 3ABSB 5IT4A 5JNLA 4MK4A 2HU5A 3D4IA 1B6TA 4YMIA 2YYAA 5AHKA 3BWMA 3VR2D 3AR6A 5CDGA 4RGQA 3R3YA 3U40A 2O0KA 2CFRA 2GEDA 4L8GA 3I5YA 3ECAA 1ECPA 5H9WA 1QHXA 3UTCA 3RSCA 3QE4A 2VO1A 1IMJA 3I5XA 1KDZA 1RTTA 3OZVA 4TN1A 4TOIA 1H2RS 4KFTA 2VDNB 2H1CA 1X8XA 3K70D 1SO8A 2VJYA 4K87A 1N3LA 1YMVA 4URVR 1OV4A 5KMGB 3TOZA 4JI6B 1A77A 3BSFA 1JLMA 2GM5A 2HA3A 4CG0A 1A4XA 1OQAA 1NT4A 1P1RA 4BB5A 1EFKA 2ZSFA 4DV5B 4N65A 4RPIA 1I30A 3I45A 3PCRB 3LLMA 4Y9UA 1W1IA 3TAXA 3PLRA 1DC6A 4UQPA 1FP4A 2XNKA 1FRVA 3BJZA 3HYCA 5CP8A 3CPSA 5H81A 1WWKA 1TF7A 1N5KA 3NHYA 1EJ2A 1S4QA 2FI1A 2HMYB 4U2GA 2BSXA 4QQ8A 5JDCA 2PL3A 3KXPA 2VYND 4CUJA 2FR8A 2PUTA 4R54A 4MEBA 2ZYIA 4GIBA 4H15A 1NR1A 4PAOA 1REQA 3TW4A 3N75A 4N7RA 3PE3A 3SE0A 4I19A 4LHVA 1SXIA 3G2NA 2BR4A 5IAEA 2H63A 1E4OA 1A9QA 1Y89A 2QTHA 3DMNA 3M1AA 3UWDA 2Q4DA 4ECEA 1TJPB 4DV1B 3RUPA 4EOGA 1I6MA 1Z7GA 1QH0A 4S1VA 4CDGA 4IV5A 3ROZA 5J2TF 1MKYA 1N6IA 3I2IA 3M8KA 1XEXA 2VUHB 1L5MA 5HF5A 4HWTA 5C5IA 4URXR 5ICEA 1GTZA 2HEGA 1LSOA 2PWAA 3DNFA 4HSGA 2Z3VA 4KLCA 4O2BB 3SF0A 2P27A 1NMEA 2OORC 5I7RA 2JA2A 4DRZA 1JHXA 4E3WA 3LUAA 3SHWA 4PIMA 1W29A 3SS7X 3LQQA 3UJ9A 2L82A 1EUCA 1XTQA 4KZPA 5KQLA 4HLUC 2OGSA 2X0FA 3LGSA 3LY8A 4XIJA 4DJAA 1LBIA 4UHHA 4KQHA 1M8PA 3NFRA 4P53A 1LBSA 4GZ6A 4J3NA 1IZYA 2VSOA 4LJ9A 4V0ME 4RK5A 2IXGA 5HK9A 4CKZA 1W93A 1LLCA 4JOSA 3TVTA 3TTWA 1Y34E 1E3EA 4ATNA 3DBHA 3JASB 3S8MA 1SPBS 5DBHX 3S40A 4EHIA 4G07A 4J7UA 3NWOA 1U7ZA 2HZ7A 3LOQA 4BS9A 3VNBA 4DSNA 2PH3A 5K01A 1V35A 4W8OA 2FUEA 4PAWA 1RM3A 2NAPA 3W8EA 2FN3A 4U7PB 2NSDA 1GAQA 2J45A 4CLXA 4KXLA 1QLJA 1Z82A 3G88A 2AJDA 3PKIA 4HDSA 4UBOA 4XEUA 5HFAA 3C8MA 5JO9A 5A5GA 2I29A 1ZRMA 2V1XA 4CNBA 2VH1A 2DKOA 5I4IA 4NFHA 3GC6A 2PK3A 3EHEA 3HVJA 3OPYB 4WY8A 5HM8A 4G0XA 1ZGGA 1ZITA 3H2JA 4RX1A 4D3SA 1R9GA 4UDNA 4DPMA 5AW2A 3G0BA 4BLOA 2GM9A 2QZ9A 5IYZB 3WHLA 1Z2AA 3L7LA 1SUFA 4D3YA 4LX8A 2NYRA 1PSWA 3MWKA 4CMAA 2PO7A 2QXYA 2Y0CA 2VLIA 4MAMA 1G20E 1PDOA 3TQRA 5FT9A 3MYRA 4PO9A 3OIFA 1XV5A 1ZK4A 3TQFA 5BSHA 1DUSA 4B44A 1VXOA 3IP5A 3B52X 3OQ6A 4ZAVA 2GKOA 1NI4A 5EMLA 3DUFA 2C5EA 2ZBEA 4IQ4A 1SUEA 4OGWA 3D5EA 4W82A 3FR7A 3RKSA 1QP0A 3H2SA 2B8EA 2W6PA 2D0DA 3HA2A 4YO8A 4IRXA 5A7FA 3BL5A 1HTWA 4GSKA 2VDUE 4WZAE 4C4TA 2NSHA 1FS6A 2WNSA 5CLHA 5LQCA 5JCOC 4JZKA 1UF9A 1YR6A 1YR8A 2YVAA 4TYPA 4U9UA 4MWEA 2XWSA 4A73A 4B17A 4X92A 2JH3A 4JL6A 3VZDA 1O6BA 4S05A 4IOKA 2FPOA 2IIPA 1GG2A 2GJ4A 1RJWA 5JSHA 3T7KA 5A4IS 4OVKA 5JBNA 2F90A 1RYZA 4FYKA 2WA2A 3SZMA 2P2ZA 3HBNA 2HSGA 3T7EA 3R0IA 5DRYA 3R8FA 1MZPA 1V37A 4KV7A 2B6HA 3G2QA 4ZOQI 1YS2X 4LKOA 4MS1A 1EZ1A 1S02A 3C3CA 1G2IA 1TA9A 3W2TA 4GKJB 1FZTA 1GIAA 3KJIA 1WV1A 4A0SA 5IHPA 1XALA 5FLEX 3QY0A 4AG3A 1DMSA 1HSOA 2YW9A 2OGZA 3PGLA 3PX3A 3UXEA 4B31A 3PF9A 5EZSA 3PC4A 3RQIA 2XUPA 4UW9A 4GT1A 1UC4B 4ZCIA 3LSTA 1GL9B 1K7EB 4KE7A 3FKQA 4ALIA 1ULBA 3RRZA 1IDOA 1N2CB 3ND7A 1RWWA 2NG1A 2HN9A 4UZFA 3WLOA 1LWOA 4C14A 3TOXA 3WYEA 2VHQA 4QBTA 4QUKA 4TYMA 1TADA 2BZ0A 3C6XA 3N39C 2GAFA 3EIHA 1BDMA 1NQUA 2OV2A 3I1JA 4GR5A 1IQRA 3JRNA 1JJ7A 1YC2A 2AN3A 4U2CA 4BAUA 2IV2X 1BAPA 2AOUB 2XNCA 1V11A 4TRJA 4R6WA 1OWNA 1X2EA 3VYWA 4EPTA 2GF0A 5B12A 4A0FA 5LJLA 3UMVA 1FA9A 4JEIA 4RY2A 1Z18A 4CMEC 3UHFA 2B9VA 3PEVA 1FTYA 1SRQA 3RV3A 1XZPA 3EUEA 1SNYA 3AL0C 3EA4A 5ALPA 4EJSB 4U3JB 3VO9A 4V2UA 4HV4A 5F23A 1RD4A 5CH8A 1G6OA 3INNA 4MI3A 4UU0A 2HLHA 5EUQB 1GCOA 1PK8A 2JFWA 3P9NA 1WNFA 4LGYA 3RJTA 1U8ZA 3T0FA 4EG6A 2ZREA 5E1DA 4TVBA 3RBXA 3UUFA 1G21B 4BO9A 4KWTA 3U3RA 1GFWA 4H7KA 2JW5A 5KVSA 2ZIEA 4WK0B 5KKAA 5MFPA 5DE3A 4RD0A 1JN0A 5CA0B 3LVBA 5DHTA 1Z06A 4QYMA 2DUUA 1BHSA 3DLAA 1EFHA 1B93A 2R47A 3T5MA 3EQ2A 4MSUA 3LPMA 1LLDA 3OFNA 2P67A 4HEQA 5BUSA 3I9JA 4B4DA 4TGLA 5L53A 1JNXX 4NJOA 3WLPA 3DZFA 4RZIA 4D8WA 2JLZA 1KOFA 2NXNA 4KRYA 1QHYA 3SXJA 4A0GA 4FINA 4R2JA 3SBDA 2DT5A 2P75A 3H11B 3ORRA 1IK6A 2NADA 4G0ZA 3J80A 1AKMA 1PSDA 1V4NA 3I5MA 1I3NA 1XZ8A 2VJLA 2WJGA 1T4DA 4R7ZA 5E7MA 3WFJA 4DT1B 1C3VA 2GBCA 3KQOA 2YJTD 2WZBA 5C0OE 1EFVA 1F6BA 1MX3A 3CVYA 4PYNA 1MX5A 2YICA 5REQB 1DI0A 8GPBA 1ISJA 1DU4A 3N8IA 3N74A 4K2AA 1O2DA 2CFIA 1RADA 1UT8A 4RNCA 1VHLA 2I8AA 1FLDA 3F67A 2SCUB 2BMVA 2EXXA 3CY6A 4TVOA 3OZXA 1NC1A 3EPRA 1G8PA 2JCVA 4QUHA 1K66A 1EHIA 1HO3A 5AQ1A 2QTVB 4DANA 4O1HA 5IG2A 1Q0UA 4C3OB 3R44A 2OV6A 1YZNA 3CNNA 1QB7A 3JALA 5B53A 1XBTA 2I7XA 2CYBA 4I50F 4LGCA 1KH2A 2CDAA 5G4KB 5BNFA 1I7DA 1ZEJA 4OOFA 3UT0A 3N2GA 1JYSA 1T10A 5DOZA 1D2NA 3A4VA 3MJDA 2QZJA 3CW2A 1EG2A 2FW6A 2ZVDA 3KUDA 3O1HB 3KZMA 3Q7IA 3TL3A 2CZCA 3NOXA 3DOHA 2JFQA 2H4ZA 3HZRA 2BFEB 3R09A 1R16A 3TIVA 1NHWA 1DEAA 2FHPA 2D1QA 1U5CA 2GS9A 3OD5A 4A8HA 1S2IA 3BMXA 2KS6A 3NBZC 4PTYA 2FUKA 3ETEA 2FPMA 3P2KA 2XX3A 1ZL0A 2YJ4A 4WCFC 3FYSA 4L5YA 1FJXA 2BZ1A 4M8LA 2GHIA 3M33A 3FTPA 3DL7A 3WB1A 4B7ZA 5BMVB 1P5ZB 1TNDA 2IA5A 4RD2A 5HXAA 3NATA 4EG7A 1WSBA 3BVPA 4XTCS 3GNSA 1MJGM 1ISIA 4UHJA 3VMMA 2CXTA 2IQIA 5L3VA 1YO6A 4ZZ2A 1U9IA 3G2JA 3TR0A 5AVSA 4IIJA 4FJ1A 4HGZA 4RH0A 4FUQA 3UGTA 1U28C 4K1LA 5JYBA 4I55B 2W6ID 4GXRA 3ZDCA 1D1TA 1E7RA 4C0AC 4Q4JB 5ULLA 4BVAA 4NG4A 4PG6A 4DSTA 2ZETA 1P8AA 2CHQA 2FMXA 1U3CA 3LAWA 1YCDA 5EP4A 1MX1A 3DV2A 3Q7TA 5F1KA 4R69A 3OPYI 2MOKA 5E0KB 1FLVA 3EXFB 3WGUA 3HR4A 3PCXA 1Q19A 4XJVA 1XMOB 2VH2A 3USCS 4P81A 4WK4B 5KTMA 3K9HA 4U7WA 1DVRA 3U1BA 5JXWA 5JD3A 3SM9A 2CMHA 3DW1X 3UYKA 5ECWA 1VRWA 3NZEA 4S12A 1QCDA 1BOOA 2B3DA 4TKUA 3EYAA 4O2LA 3IDFA 1ZHHA 5EQTA 3SZ3A 3EEIA 1HRKA 4X1KA 1IY1A 5DGIA 2IODA 1EM6A 2FZWA 5AVQA 3EUAA 3KFXA 1CE8A 4EHAA 4D0NA 3LLCA 2OT3B 3R9KA 3KV1A 1E1KA 1V8OA 1M3SA 3O38A 2POQX 4ES6A 1TQ4A 1J1ZA 4N3NA 4NONA 1Y8AA 1DXYA 3HY4A 3KQPA 3TSWA 3WIDA 4DQLA 5ENZA 4FBMA 4A2PA 4CMGA 3VR4D 1X7DA 4BYMA 1Y9EA 3RK4A 1K9SA 3K71B 2QUBA 2F55A 4YAEA 2E21A 1FFDA 5HF8A 5KIAA 4CKEB 1G291 2N9UA 1BJTA 4JB0A 4BWYA 1W9MA 5DSTA 1QVAA 3KL2A 3SVTA 3QX7A 4ZHQF 2R00C 2K4MA 3OZFA 1BRTA 4QXAA 5AM2A 4U2EA 3TIXB 4M37A 2BGIA 3B3QA 3OTOB 3AVUA 1FYWA 3MYYA 4L5BA 2ECQA 3EUFA 5CT6A 3PQEA 4Y2JA 3EGWA 5AXBA 1EGQA 2RAFA 2FSSA 2B3TA 2PHZA 5JXGA 1NQVA 2NUPA 2ZI6A 1XD8A 1DX6A 1YOBA 2I3AA 3NC4A 3P1JA 4IIXA 3U4CA 5EIBD 2YBDA 1SKQA 3KK0A 4F11A 1JSCA 3PUKA 1CRWG 5LLSA 3ENNA 5G0VA 1G8FA 2XTMA 2FMTA 3JW8A 4ZI7A 1QHEA 1RYDA 1RABA 2VYQA 5TT0A 2IEBA 1Y81A 4A0HA 5CB4B 4JLNA 2WLTA 1A2KC 2ZBGA 3W5HA 3K6RA 1ZMXA 1MMFB 2ZRDA 3A1UA 3T4PA 4A6XA 2WUVA 3FTNA 3R7WA 4MVJM 4TTRA 1RDFA 1VA5A 5JWRA 3L7DA 3AOGA 2XQKA 1VLZA 3IXMA 4QOSA 4BFSA 3KUXA 1U99A 3P20A 3DP7A 3GFVA 3AUYA 1BROA 3LHKA 1PKEA 4HRVA 3E0QA 3A6DA 1XDUA 3GPBA 2QXUA 1Q3KA 2JGIA 2WAMA 1ST2A 3A6HA 3E23A 1K92A 4ZO9A 5JADA 3QELB 2OGWA 5I4BA 1SXJB 3DQPA 3W6PA 1FS4A 2IOYA 5EZ6B 4OHKA 5FNZA 4BNDB 1S1CA 1FDTA 1VB5A 4B3BA 1Z5UA 2WWXA 1GZ3A 5EOVA 3T94A 3AJ8A 4B9AA 4Q9NA 3H1BA 1Z5OA 2NSYA 3KTAB 3NTQA 3O31A 4M1KA 4Q4LA 1VFNA 1TEZA 1G2OA 2CL5A 4JEUA 2QJFA 3KB1A 3QVXA 1ODLA 1UQRA 5SYNA 2IITA 1QGUA 3M4ZA 2GGSA 3O8DA 3T1NA 2HA7A 4L1KA 4ENUA 1D0VA 2VRBA 3I4FA 3QFFA 5LYYA 1RI3A 4YEDA 4YRNA 4XFDA 1OT5A 2I6XA 3ORSA 3A8TA 1X1EA 3BL6A 3IQZA 1USUA 2GI4A 3GVXA 4EMSA 3PK0A 1BX1A 3LUKA 2UYCA 1FDIA 2LGJA 3AIIA 3ESRA 5J1TB 4FC6A 3LQKA 2FFQA 4RA6B