3CXRA

Crystal structure of gluconate 5-dehydrogase from streptococcus suis type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
260
Chain Sequence
QFSLDQFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dehydrogenase with different specificities
publication title Structural insight into the catalytic mechanism of gluconate 5-dehydrogenase from Streptococcus suis: Crystal structures of the substrate-free and quaternary complex enzymes.
pubmed doi rcsb
source organism Streptococcus suis
total genus 101
structure length 260
sequence length 266
ec nomenclature ec 1.1.1.69: Gluconate 5-dehydrogenase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3cxrA00
2O23A 4JQCA 4YBZA 3C1AA 3WGTA 1MUUA 3BIOA 5EL0A 1BW9B 5JC1A 1AN9A 1M66A 1X1EA 3LU1A 2PGJA 1HF3A 3GZ4A 1DHRA 1HDOA 1ARZA 1BVUA 4JK3A 4LVCA 5ADHA 5CDYA 4NHEA 1GUFA 2GD1O 4NBWA 4OL9A 1NAHA 3LLSA 1GYQA 5CG1A 3OSUA 1P45A 1D8AA 2C29D 3ASUA 2BI7A 4EDFA 4MP8A 1QR6A 2NTNA 4R54A 5TNXA 3KO8A 2J8ZA 1ONNA 4JP3A 4U6QA 1PGPA 3CMMA 4FDAA 2RIRA 4R3WA 4BKRA 4CLDA 3MJTA 4KTTE 5IAAA 3OEYA 4D0RA 1GZ3A 1P77A 2EJVA 2JD0A 1E1KA 2P9EA 3R3SA 4QFDA 3H8VA 4UREA 4XKJA 3U9LA 2VOEA 4XDYA 4F3YA 3JYNA 5A03A 1LQTA 1NR7A 4D3DA 4B8WA 4KTVE 3EDMA 4BV9A 3CSDA 3AFNA 4ZQGA 3DBHA 2O4UX 1VLLA 4GL4A 2A92A 3F9IA 3WGZA 1WW8A 4QQRA 1LEHA 4Z0TA 4WUVA 2Y99A 4J43A 5I9NA 1NNUA 3SVTA 3F47A 4J9VA 1H6AA 1LLCA 3RC1A 5KJEA 2O48X 3OJOA 1K3TA 5JMPA 3RUEA 4PLYA 2I5PO 3JQFC 4OSPA 1EMDA 1H93A 1PSDA 3IJRA 4B8ZA 2DT5A 2VUTA 1EK5A 1S6YA 3PZRA 4TRRA 4G81A 3G3EA 1PX0A 3TZHA 1YXMA 4MO2A 4PLTA 5IN4A 3DTYA 2WTBA 2VN8A 5U9CA 5DN9A 5B37A 1EQ2A 2X9GA 4J2HA 4ALJA 5TGDA 5COAA 2YQ5A 2P9CA 2V65A 4FJ1A 4AJJA 3AY3A 3S2EA 1U4OA 1M75A 3L4BC 4O6VA 4FJ0A 4NBRA 4CM5A 5CDSA 2I3GA 1JWAB 1UDBA 4E21A 2EKPA 4EJMA 3FHLA 1XA0A 3ZV5A 1XWFA 3H9GA 3L4SO 3PQDA 4Y67A 1T4BA 3M2PA 3JYLA 3H9QA 5TJHA 1ENZA 3E6AA 3JD0A 3NTRA 5AXDA 4W99A 3WGHA 4D43A 1I3LA 3MCVA 1BXGB 3ZWCA 4BUCA 3FRJA 4Y98A 4E3ZA 1R4NB 3AFMA 4CQLB 3AUAA 2QQ5A 2OORA 1TA4A 1SB8A 1N9GB 5EQFA 4WNCA 4AJKA 4QO7A 4GSKA 2EP7A 3F6YA 3KLPX 2D8AA 3M2TA 3QRWA 4UVEA 2UDPA 3T4EA 4PLVA 2Y68A 2AE2A 2QZZA 3F5QA 2NACA 2QRJA 3GN2A 3KBOA 1G0NA 3ETEA 1MXHA 4OH1A 3VTZA 3ZGYA 4M49A 4BNHA 2X0IA 1HLDA 1OFGA 4PN3A 1A72A 2PKRA 1IPFA 4X54A 3MEQA 2EG9A 3QV1A 1GYRA 3E9QA 1H2HA 1RM4A 1LJ8A 2C20A 4GLLA 1I2CA 4FGSA 4E2ZA 4AJNA 5L7TA 1UR5A 1D1SA 2X22A 4TZTA 2EP5A 4MOWA 1EUDA 2O3QA 3RUFA 1PGJA 1GADO 2AEMA 1XHLA 4E5YA 1YDWA 3OICA 4M86A 4MPDA 4OQYA 1QSGA 3EC7A 4E5MA 4E2WA 2C7GA 3RC2A 3UUWA 1EUCA 4H7PA 1B8PA 4CMBA 1AHIA 3G1UA 5FWNA 4RGBA 4DLAA 5GZ1A 4ALLA 1IUKA 5AXAA 2DPGA 2H5LA 1N8KA 2IXBA 3V1YA 3JQ7B 4BO5A 1X7HA 1NTOA 3G17A 4YTEA 3QVSA 4II3A 1EVYA 1PJQA 2P5UA 3GF4A 1QYWA 5JBIA 3H9EO 3B70A 2HK9A 1HDXA 5DCYA 4EUEA 3PP8A 3RIHA 3I4CA 1ISMA 1HZZA 1V6AA 1MFPA 3DHNA 1K6XA 2CFCA 3ZU5A 3JQGA 4D45A 2FR0A 4D44A 3QVOA 4FW8A 3UICA 1GV1A 1Y1PA 1HE2A 3HFSA 2E37A 1ZH8A 2EW8A 4FIZA 1DHTA 2JCVA 4J1TA 5DP1A 2HMVA 3NDJA 1P0CA 4ZQFA 3ITKA 4Z3DA 1M76A 4BO0A 4ZQBA 3GPIA 4RDIA 5ER9A 5IDQA 4MVJP 2JKVA 4WLFA 4I5FA 4HY3A 4OQZA 4W82A 3G49A 4NI5A 3VZPA 1K0UA 3JQCA 1WNTA 2PK3A 5A3VA 1LNQA 1KC3A 1R0SA 2VYVD 3ADOA 5EJ2A 5K0ZA 2Y1CA 1VL0A 1ONOA 3RC9A 1V35A 3O9ZA 4CM3A 5JDCC 4ZN6A 1Y8RA 4F45A 4ZQHA 2RBEA 4HFJA 3NUGA 2GN6A 3ZW8A 3GH3A 3PGXA 4A10A 1UH5A 4RLSA 3ZHZA 1IYZA 4YEDA 4YAKA 1P33A 3FTPA 1F17A 1CJCA 2WM3A 4CV0A 3V5NA 3INGA 4CUJA 4DPMA 3D4OA 4DVJA 2GCGA 4RPHA 3VKUA 3HSKA 5T6BA 1R4MB 1NFQA 5I8WA 2GASA 4CMIB 4YRAA 5CHEA 5DBIA 2VTDA 2DUUA 5TC4A 4MVJE 2NNLD 4O1MA 5T5QA 1TT5B 4B3HA 4BKPA 3C7DB 4I9NA 3E48A 1XG5A 3E9MA 4U6SA 1ZKMA 5HS6A 1H94A 1O9BA 3P2OA 1ISGA 3PFWO 4ZHSA 1NYTA 1KC1A 1E3SA 3HB5X 4QECA 2BFAA 4OSOA 2PR2A 4A5OA 3DZIA 2GZ1A 1UZLA 1TXGA 5LDHA 2Y0EA 5LDGA 1Q7GA 4B4VA 1U28A 1P44A 3PWKA 4OAQA 4J90A 3CH6A 3FPCA 3OQ6A 3UOGA 4M55A 2VUSA 4A2CA 4IMPA 5A5FA 3KOUA 4FSHA 4RVSA 1HDGO 5EERA 1C1DA 3SLGA 1ZK3A 3K5PA 5JC8A 1NQ5A 2ET6A 3R0IA 4AG3A 4A7PA 3I9JA 1DIHA 1BWSA 3BMOB 1P3DA 3KEQA 2Y0DA 4N7RA 4ZVVA 2PZMA 3EMKA 4QXMA 3RUDA 1H2BA 1G1AA 1ZK0A 1JA9A 3OH8A 1LA2A 4UUNA 1CWUA 2NWQA 2Q2VA 1ONPA 1Z45A 4MVJM 4BVAA 5KVCA 1QP8A 3IIEA 4YCAA 3QLJA 4FGWA 1OMOA 2FZEA 2FPGA 4RPJA 3GNQA 1W73A 2V6BA 5A5EA 2UYYA 4LCJA 2V7PA 1BRMA 3DAGA 3C1TA 4BNXA 1ZVMA 2UAGA 5JMWA 4UUOA 5L9AA 1JVSA 4P8RA 3COSA 2DAPA 5F5LA 4ND5A 3PYXA 5DULA 3AUSA 3OA0A 1PQPA 4DYDA 1T2EA 3RD5A 4PLFA 1IPEA 3GDGA 5ES3A 3CXRA 1I8TA 2WYUA 1QLHA 3GRPA 1KIFA 3RU7A 3ZDFA 3CZRA 1B15A 1I3KA 4ESOA 3V2UA 2HMTA 4URFA 1YB5A 1O6ZA 3GVCA 3IQDB 3KHUA 1V0JA 2PTGA 3E1KA 4LMPA 1ADFA 2YV3A 1YO6A 2VHWA 2AQIA 3Q11A 2EJWA 4W6ZA 4E2YA 4CM7A 4OXYA 4Z9XA 3JQ8B 3RJ5A 3WGQA 1SEVA 2P4HX 3ULKA 2OOSA 1AXGA 2D0IA 2E4AA 3M1LA 1C0LA 1B8VA 1PS8A 3PDUA 2DPHA 2V6GA 1DC4A 2G76A 5DCWA 1K6JA 3STHA 1GEGA 4CL8A 1E3WA 3FN4A 1U2GA 4A73A 2NVWA 3W4IA 1G0OA 1HYGA 3WBBA 1T2DA 2X5KO 2ZCUA 2ZTMA 4RORA 4BNWA 3X2FA 1XSEA 2NQTA 1WP4A 2FP4A 1CRWG 1LDGA 1P1JA 3ONDA 3QWIA 4IDDA 1A7KA 1KOLA 3S2GA 5BR7A 4N5MA 5L40A 4WECA 1ZCJA 2Y66A 2HK8A 2HCTA 3DBRA 1F8FA 1PGOA 1V3VA 4Y6RA 2X8LA 9LDTA 3ZWVA 5L45A 3CIFA 3GG9A 3I5MA 3FR8A 5A9SB 3F4BA 1YL6A 1KVQA 4NU6A 4W7HA 1PJ2A 5THQA 3WG9A 1PZEA 2BFPA 4J7XA 4UVHA 3ZNNA 2XXBA 1B26A 3O8QB 4INAA 2B4RO 3ZWWA 3PJEA 3VZSA 3UAGA 4BNUA 4YRBA 2B4QA 1HT0A 3GK3A 4GI2A 4WCFA 2HRBA 4XIJA 3DZKA 3ZWMA 2AHRA 1LSSA 4BNVA 4E33A 3AUTA 4JBHA 3ZI0A 3K2BA 3IP1A 5BSEA 1B0AA 2B5VA 3I3OA 1QKIA 5DDIP 5MGBA 2WEKA 5LC1A 4WOJA 2FY8A 5TS3A 3BHMA 2BD0A 4EYEA 4CL3A 4PG4A 3WSVA 4YJHB 4PG8A 3F46A 2RCYA 4PRLA 1I36A 3LK7A 3TL3A 3B1JA 5JAMA 4YAIA 2GN8A 1BDBA 4K28A 1ZBQA 3TZ6A 4Q3BA 1IULA 2CVQA 4DYVA 1O89A 3H65A 4YR9A 1ZMTA 1Q1NA 5L51A 4BNMA 4TMFA 3PK0A 4R1UA 3IL2A 1VL8A 1EZ4A 1SB9A 4HFMA 1JWBB 2P9GA 3BMCA 3DZGA 4Z3KA 3PHHA 5IDXA 3V2GA 2CD9A 2JHGA 1EFLA 3I4FA 3PXXA 5A06A 3MWDB 2CZCA 3T7CA 2DTEA 4XD2A 3IUPA 4MKXA 4IDAA 1TB4A 3QQPA 4D79A 4DQUA 3DDNA 4UAGA 2CDAA 1HTBA 1UXJA 2DBVO 3WMWA 1NFRA 4CMHA 1BMDA 1NHGA 5TJ9A 4CLOA 2Y05A 1YONA 1Y9AA 4RQTA 3BMQA 1IHYA 2JFHA 3Q9NA 3ZH2A 4Z6KA 2QZ9A 3L77A 2B4TO 3E03A 3GUYA 2NSDA 4NFHA 3TN7A 4BV8A 5B4VA 4RVHA 5KJFA 2WD7A 4J49A 2C54A 3PHGA 3GT0A 1B3BA 3A28A 4BNTA 1LBEA 1SAYA 1F06A 5TT0A 1NVTA 3GDOA 4IY1A 4YVFA 1MFZA 3PEFA 2YDXA 2V6FA 2ZJ1A 4JNKA 3OIDA 3K6JA 1E5LA 4MIYA 2VWGA 5ILGA 1NVMB 1MXFA 4EZBA 2Q99A 3OQ1A 3GC6A 2C0CA 3GHYA 3RVDA 3WTCA 4AJ2A 3AU9A 3RI3A 2OO5A 1JN0A 3RUCA 3HDYA 4CMJA 3MOIA 4GMFA 2VCYA 2D4AA 3C8MA 4IS2A 4AFNA 1DXYA 3F5SA 4GWKA 4XA8A 1HE5A 2J3JA 4LRTB 1EVIA 3GG2A 2A4KA 2PGLA 4WK6A 3QIVA 4DQVA 4LSWA 1HLPA 5DOVA 1UDAA 1JKFA 1ENYA 2C2XA 1GUZA 1HKUA 1A4IA 2BHLA 1MX3A 1UP4A 3PRJA 2FZWA 2BFMA 3UHAA 3DEYX 4IJWA 2P68A 3EZYA 4TRJA 5BNFA 1PEDA 1PGNA 3EW7A 2NQ8A 3AI2A 3WLEA 2NVBA 4RQUA 3FR7A 4YACA 3GAZA 1L7EA 3UFXA 3WJ7A 2GGSA 3CEAA 1A9ZA 1T24A 2VWQA 2HUNA 3QWBA 5DT9A 1GTMA 1QV6A 3DBHB 1T25A 3U4IA 4CLRA 3RUAA 1GU7A 3QA9A 4MIEA 4E32A 2OGUA 1R37A 2HRZA 3DQPA 1CF2O 1EEHA 1WPQA 2JL1A 3HDQA 3R1IA 2J5KA 1HEUA 3OETA 1FXSA 4HWKA 4Y6PA 4NJMA 1TT7A 4S3MA 5KJ6A 3DR3A 3I6IA 3K2EA 5KTKA 2GN9A 4RF5A 2VYND 1JVBA 2O4CA 2NTJA 3VTFA 3WGYA 1TEHA 1D1TA 1DRUA 2CDBA 2XF8A 3IP3A 4RJTA 4FFPA 2X7HA 4LRSB 2EGGA 1HE4A 3JQFA 1HXHA 5BSGA 2Q49A 2OFPA 4IGFA 3IOYA 2GERA 1ZK4A 4J4TA 1K2WA 2W2LA 4BO3A 4BO8A 3I52A 4LGVA 1Y81A 1P1FA 1DOHA 5KWEA 3KRTA 2WYVA 1P0FA 2QYSA 5TSDA 2OXIA 4YJGA 3FNEA 2Z95A 3L4BA 2DFVA 5JPIA 2DKNA 3Q0EA 3I23A 3KXDA 3V8BA 3RKRA 3VDRA 4D3FA 1H6BA 1PR3A 1YL7A 3ETDA 1Q2XA 1BSVA 2O3TA 3HDHA 4R51A 4KDEA 3NYWA 3LC7O 1VSVA 2CNBA 3GHHA 3GVXA 2I65A 5AYVA 3ZNOA 4BB6A 5JNLA 1Q0QA 4R9RA 5ITWA 5B12A 4CM8A 4ONEA 2JFFA 3DXFA 4A03A 1Z75A 4II2A 4IDBA 2WJPA 5CPBA 5JAQA 2B37A 2ZQYA 2EERA 2Q2WA 2AQHA 1YDEA 1LC3A 4FBGA 1QYCA 2HMWA 3WGGA 4GX5A 4MINA 4GBJA 1ISFA 4Z9YA 3TDKA 2HK7A 4XQGA 4PZDA 4G65A 3MJCA 2Z5LA 1R16A 1E1LA 2CUKA 3HFGA 1FDWA 4BIIA 2DFDA 4MVJA 4RVUA 3AM3A 1UXIA 2JD2A 5T8KC 3UGKA 1NVGA 4OXNA 3JCZA 2WE8A 1H6DA 2Z1NA 3Q6IA 4Y6SA 4M87A 3GGPA 2PY6A 5G0WA 1E3JA 4NQZA 1WAMA 1Z74A 1HZJA 3SEFA 2WMDA 2BGMA 1N1GA 2VQ3A 3PHLA 3LZ6A 1Y9EA 3ROQA 3VZQA 4DXHA 5CG2A 3L6DA 4ALMA 2VRBA 3H5AA 4XR9A 2EWMA 3DBVO 4FOOA 3MJ4A 3KSZO 4IJKA 1BGVA 1ZIDA 2ZB8A 4H15A 4RPKA 5EIOA 4E5NA 1VJ0A 2VNAA 3BA1A 3BHIA 1OZAA 3UXYA 1BDMA 4RF4A 3NT2A 3X2EA 2I99A 1ZSNA 3JQGB 1WZIA 4ZJUA 2BF7A 1OC2A 6LDHA 5THKA 2IDZA 1ID1A 4G2NA 3AM4A 4R1TA 2WDZA 4YDRA 1D4FA 1IZ0A 4J9UE 3HZZA 4NH4A 4YB8A 4BO1A 2I66A 1E0DA 2H1SA 2ILTA 4XDZA 3G1TA 5JO9A 2JAPA 1OI7A 1E1NA 2GDZA 4NBVA 3EUWA 4YJDA 1XLTA 1U8XX 2TMGA 1U3WA 1RM0A 4CQMA 1DIRA 4CMGA 3H9JA 3GDFA 3ICCA 4ID9A 1XIVA 3UH1A 5C5IA 3NT4A 1Y8RB 4ROSA 3QHAA 1EDOA 2A9FA 1ADCA 2CVZA 3H7AA 1PQWA 5JDCA 2X9VA 4I5GA 5BNTA 2QRLA 5CPFA 3DZHA 5DF1A 3MZ0A 2VRCA 3OJ0A 4IZHA 2WE7A 1YBVA 4YT5A 3TWOA 1HSZA 1A9YA 1PTJA 1ZXLA 2EF1A 3LLVA 4HNHA 4HXYA 3TZKA 4JJIA 3ZHYA 4BNFA 2ZATA 2J3IA 3VH4A 3L9XA 3K9QO 1QRRA 2NU6A 2G17A 4BGIA 4XQCA 4BMNA 1RM3A 1QXSA 3BTOA 5JE8A 1NPYA 4H3VA 1FK8A 2FSSA 2JCXA 4U5QA 4L73A 3ZWBA 4R1NA 3OMLA 1B2LA 3WYCA 1JAXA 5TX7A 3JD2A 3TRIA 1D3AA 4MJLA 3TSCA 3WQQA 3P7MA 4GAEA 4BNJA 3NGXA 4AICA 3VAZA 2OUIA 3JTMA 3QW2A 8LDHA 1KS9A 3NTOA 1FDUA 1DEHA 3AU8A 4CM6A 4RVDA 1C1XA 4NNJA 4AJ1A 4DRYA 2O2SA 3H4VA 3ZWYA 1MC4A 4EUFA 5BQFA 5AXBA 3PQFA 5G0SA 3VC7A 4UVDA 4B3IA 1Z82A 2J3KA 4JXKA 4O0LA 3SLKA 2C82A 3PI7A 3TL2A 3LF2A 4B7XA 2CVOA 1O0SA 1W0CA 4E13A 4J1SA 1C1DB 1DIBA 4LW8A 3KLMX 3UCEA 2NM0A 2DQ4A 4BGVA 1HETA 2POQX 1I32A 3JQDA 2ZTUA 1LQUA 4DUPA 3NJ4A 2OZPA 1Y5RA 5JDIC 2X23A 2GNAA 1PZFA 3ZU3A 2WD8A 5ICSA 4NPCA 3K30A 1CYDA 1GFSA 3TF5A 3BHJA 3OF2A 3ENNA 1QG6A 2DBRA 2EKLA 3TOZA 5COBA 1HDZA 2YDYA 3MJSA 2AMFA 4J3FA 1TI7A 4K26A 2IRWA 4R5HA 1DFHA 4BOYA 2AG8A 3SBOA 4GQAA 1I2ZA 2QRKA 2FSVA 1CQIA 3ANNA 3A9WA 3GPDG 4NG5A 1ORRA 1E92A 1Z7BA 1UXKA 4K1LA 1NQAO 2F00A 3KETA 1U7HA 3KV3O 4GMGA 1U8FO 4NJOA 1LLDA 4IS3A 5AVOA 3RU9A 3KYCA 3WWZA 3F1KA 3PPIA 1GDHA 1XU9A 1HDYA 1LX6A 4NK4A 2W2KA 3ANMA 3DONA 1N1EA 1X15A 5KNLA 1ADBA 2HSDA 2YHIA 1ML3A 1Q7BA 4PIVA 1N7GA 4W7IA 5KJCA 1DAOA 3W4KA 2YY7A 3W8DA 3OA2A 4NDNE 3F1LA 3O26A 4BL5A 1P74A 5HS4A 4HX5A 1DRWA 3PLRA 1KEVA 3AW9A 4CM9A 3E9NA 1T26A 1JW9B 1PGQA 5KVQA 1SNYA 2P91A 1PZGA 2FWMX 1E3WB 4XGIA 3CINA 4DIFA 5C7OO 1Q7CA 3P5SA 2SCUA 1DDOA 3B20A 4WASA 2HMUA 4XCVA 1NHWA 4RPGA 4Q3EA 1JLLA 5KKAA 1ENOA 4HFNA 2XXJA 3FBGA 2GZ3A 2Q1WA 4UUMA 3W4JA 2PV7A 4B7UA 2FR8A 3MJVA 4IBOA 3ZWOA 4DQXA 5IFLA 4BMVA 3DBRB 5AQ1A 1I30A 1LTHR 1PJTA 4IIVA 1YQGA 3RFVA 1C0IA 3WQSB 1YS4A 3CZMA 2DC1A 4IQ0A 1ZEMA 4HV4A 1XCBA 4ZGWA 1NFFA 5C3MA 2FMUA 2XOXA 2J5QA 3AOEC 4CV2A 1RYEA 1PJ3A 3DMTC 3FPLA 4WCFB 4UULA 4KP7A 1NQTA 3I6QA 4Q3NA 4U0JA 4WPGA 5KVVA 2EIHA 1O94A 1QMGA 1KERA 1VC2A 4ITUA 1Y5MA 1XDWA 4RVGA 4PLZA 3A4VA 3IDSA 2JFGA 2ZK7A 3N74A 3E5MA 4TSKA 3TJRA 3TFOA 3ENKA 2BGKA 3M1AA 1ISIA 1CERA 4B4WA 3TQHA 2E48A 4I5EA 4UEKA 2W90A 1JKIA 2BKAA 3AK4A 2IYOA 3A1NA 2Y1GA 4MP6A 5JCJA 5G4LA 1R4NA 2FPIA 5IZCC 1N92A 2Z1MA 4OYRA 2PZKA 4CQLA 5HTOA 1PJBA 1YOVA 4J0EA 5KCZA 3BMCB 4IDGA 2O50A 1F8GA 1JAYA 4PLWA 1NR1A 2CF5A 2RHCA 3HADA 3PJFA 3DWFA 1YQXA 1KEUA 4BS9A 1JU9A 1SOWA 2GR9A 1WZEA 4TRMA 2Y67A 1ZXBA 1H9BA 1HYHA 1YVEI 3T4XA 3E8XA 4BQPA 3BMNA 3ABIA 4OOFA 5FI5A 3GVPA 4CLOB 1LDEA 3VPXA 1XGKA 2X58A 5FYDA 3EY4A 1ZZEA 3BMQB 1P1KA 1E77A 2VT3A 3DOOA 5HBRA 3TOXA 2I3AA 3OJEA 1VJTA 3MTGA 3A14A 2WD7B 3GN1A 4IXTA 4DTIA 1GQQA 1MB4A 1GY8A 4DPLA 3NEPX 5FFFA 4DC1A 3RAJA 1LRKA 3C1OA 4XRRA 1ZUD1 3B6ZA 4DA9A 1DIGA 4O5OA 2PD4A 4PZCA 3WWYA 4R41A 1J49A 4OIMA 3HN2A 2C5EA 2ZJ0A 5EPOA 5CDGA 1PJSA 1A7AA 2YYYA 3L0DA 3C85A 4TRNA 4A0SA 2EXXA 3EHEA 5CAEA 1XQ1A 5FEUA 3RBVA 4ALIA 3HHPA 4F6LA 4XQEA 1XKQA 4GVXA 3H6KA 3UKOA 4L4RA 1I01A 1QYDA 2PD3A 3JQ9A 4U8GA 1N5DA 1J5PA 5TT1A 4Q3CA 2RAFA 2YUTA 2E82A 1NX6A 4N5LA 4L9RA 4ILKA 4RO0A 3HWRA 1I5RA 4WEOA 4CMCA 4NBTA 4KQWA 4WNIA 3Q9UA 3ZV3A 4EEZA 2Y1FA 2QX7A 1E3LA 5L4LA 1DLJA 2FOIA 1E3IA 3W6UA 4DPKA 5ITVA 4E4YA 1XEAA 4BNNA 2Y1OA 2PH3A 3JQAA 4PVCA 4IMRA 3SJUA 4Z9FA 5EMHA 3JD4A 3P2YA 4CLRB 4FC7A 2QHXA 2HQ1A 3CE6A 1PU2A 4NK5A 3MOGA 3ON5A 3VPFA 1A71A 3QE3A 1Y8QB 4B4OA 2ZYDA 4WLNA 3W8EA 3GOHA 1YGYA 1Q0LA 5ENVA 1AHHA 5I7FA 4AJHA 4S1VA 1M2WA 2ZQZA 1X13A 4NJMB 1UAGA 4ND3A 2VHXA 4I9HA 3JD3A 4RL6A 1LU9A 4TROA 5G4KB 3NRCA 5KJ1A 4Q3AA 5A1TA 1I3MA 4XEHA 4FFLA 4AJPA 1WLYA 1E7RA 1DFIA 2PFGA 3NKLA 1CETA 1MG5A 3B1KA 5C37A 5JS6A 4ALKA 4J16A 2ZYGA 3F4LA 4FOSA 1YL5A 3WJAA 2X1HA 3DBLA 3WYEA 2B5WA 2Q4BA 5LCXA 1O5IA 2GZ2A 1YBAA 1BVRA 4CLHA 1DLIA 2B35A 3RBXA 3AWDA 5B4UA 4C7KA 1UAYA 2HU2A 1GV0A 4L4SA 2OBYA 4YJGB 4K6CA 1V3TA 5I9MA 3RSHA 1U5AA 2YV2A 4RPLA 2G5CA 2QG4A 1QYVA 3QY9A 4PG6A 2BFOA 2DBQA 3VPHA 1V3UA 4OXKA 1KY4A 4B3JA 1WDLA 1V8BA 3O03A 2C59A 4Q39A 2GO1A 1BTOA 4FFOA 4Y8VA 3GGGA 4DL9A 4J91A 4NMHA 3FNHA 2EKQA 3CUKA 3WR5A 1NPDA 5IZ4A 1Z73A 1UP7A 3V2HA 4PCVA 4CM8B 3I1JA 4MIOA 3JQBC 3QVTA 4IZIA 5JXWA 4L8VA 1H9AA 4KUEA 1EDZA 3GQVA 4M8SA 5EQDA 4J4BA 2IEBA 1B7GO 3L07A 1RYDA 2PNFA 2R00C 3W1VA 2WYWA 1EE2A 2I76A 2PLAA 1DC3A 4YAEA 4OGWA 1RKXA 4WE3A 5U4QA 5L7YA 2FPPA 2IZ0A 3KYBA 3RUIA 1DJNA 4IDFA 4QEDA 4AL4A 1X1TA 3D3WA 1LDYA 2H6EA 5IG2A 5F1OA 4YWJA 4J0FA 5HRUA 3LYLA 2D5AA 3Q2KA 4CMKA 1LSOA 2LDXA 5EN4A 1DBVO 4YJFA 1R6DA 3D4PA 2JAHA 3KYDA 1QYXA 4FFMA 4TVOA 2BLLA 3D7LA 1ULSA 3KM0A 5CP8A 1M6HA 3FD8A 1M67A 5T8KA 4RZHA 3ZV6A 2FRDA 2DM6A 3JQ9C 4D3SA 1T1RA 2RH4A 4J7CA 3PQEA 4PG5A 3ZZNA 5BT9A 4OO3A 5JO0A 2EHDA 1P1IA 5ILOA 3INRA 1DAPA 2QW8A 4XQ9A 5I9LA 2CDCA 1ZSYA 2OBNA 4YAJA 4D46A 1RPNA 3VVBA 3D1LA 3EGOA 1PL6A 2Y0CA 4CLEA 2O3SA 5IXYA 4I8XA 3C7CB 3LSYA 4XR4A 4JP2A 4A26A 1UZMA 4GX2A 1P9LA 4CMEC 4FS3A 2EW2A 1IHXA 4AVYA 4DLLA 2Q2QA 1C14A 2YHUA 3BTSA 3H9UA 1T2CA 4RVFA 3VOSA 2JJYA 4UVGA 4K6FA 2W2LD 5BSHA 1T2FA 1AXEA 1ZK1A 1MLDA 3I83A 2Q1SA 1TVEA 4IINA 1EVZA 3ZHXA 4BB5A 1PWXA 5JFOA 5IDWA 4JJGA 1X0VA 3OIFA 4N5NA 4BO9A 3V1UA 2BI8A 4QSMA 1SPXA 4W4TA 4QT0A 1SEPA 2O7SA 3QP9A 2C5AA 5CFZA 5G0VA 4CQMB 3L9WA 4U7WA 3B1FA 1GPDG 4TKLA 5I7SA 4CJXA 1WXDA 1LDMA 2OMEA 3EZLA 2IXAA 1NWCA 1Y7TA 3WTBA 4XRGA 1IY8A 1DC5A 3V1TC 3WSWA 2X5JO 4CR7A 3DZJA 1FF9A 4EITA 1I33A 1XELA 4NZ9A 4J1NA 4ZA2A 3D5TA 1GR0A 3CKYA 6ADHA 4L4XA 3ZWNA 1ENPA 1H6CA 3AOGA 3GEGA 4EGFA 4JGBA 5A02A 1R66A 2HDHA 5CDTA 4RDHA 1C0PA 3GAFA 3I9OA 4E6PA 4J4HA 5F1PA 2XPCA 2Y93A 3GNSA 3UCXA 3VDQA 5EESA 4E0BA 2C7VA 5KOIA 3ZNPA 3GGOA 4MVJD 4MKZA 1HL3A 4RZIA 4FQ8A 3DFZA 4XGNA 4UVIA 4KOAA 1GPJA 1T4DA 2Q46A 1LSJA 2I9PA 2GYYA 3TZCA 5C7IO 4M1QA 4CV3A 2EGHA 2YQ4A 1JKJA 4M89A 4YT2A 3VHRA 1C1XB 2VZ0A 1LLUA 3UF0A 5L4SA 3QVXA 4ND1A 3ORFA 2O2YA 2DUWA 2HJRA 2Q1UA 2B36A 5JCXA 2ZCVA 4OM8A 3H5RA 1PJCA 1KEWA 3DAFA 4BO6A 2E6UX 4BKUA 3EAGA 3WNQA 2P4QA 3VPGA 2R2GA 3HQ4O 4R5MA 1E6EA 1IL0A 4L0QA 4XYGA 5F21A 4DLBA 5K6AA 3DMYA 4EJ6A 4OOEA 3PFFA 4ND4A 4IXWA 2X9NA 5B1YA 1R15A 4FFRA 4KWIA 5GZ3A 4BKQA 3AUUA 4E31A 4F46A 2GUGA 3U09A 1HYEA 1XR3A 3HDJA 3KUXA 4CM4A 5TRTA 1ISJA 4JIGA 5JAZA 4EI2A 1KEPA 1AGNA 1GQ2A 1YBMA 1PWZA 2PZLA 2HMSA 3Q1LA 3VH3A 4DGSA 5COQA 4XWYA 5JDIA 4XX0A 2VTEA 2Y1DA 4ND2A 1AE1A 3RQSA 3U3XA 3JSAA 4IDEA 2BGLA 1B14A 4XJSA 5DBGA 1E7MA 4NBUA 3RFTA 1BG6A 3D4NA 1E6WA 3PJGA 1KY5A 2IE0A 3HG7A 4XYMA 3S1LA 7MDHA 1YB1A 3BTVA 3KYCB 4CQMD 1DPGA 4C7JA 2P5YA 3BAZA 4PGFA 1C0KA 4PLPA 5TF4A 3WNVA 2W2KB 4WJZA 3S2IA 3IMFA 1UZNA 4D0SA 3NDRA 5T67A 4ZD6A 1OC4A 4XB2A 2YFHA 2YHIB 3IAHA 3IS3A 3LT1A 4R16A 4W9NC 4GGOA 4RLHA 2A35A 1IB6A 2FHSA 1SC6A 2E49A 2HJSA 2J3HA 3TPCA 2VRCD 1G6KA 3H2SA 1YH3A 2AA3A 3TNLA 4EUHA 4FB5A 3ST7A 1N7HA 4BGUA 3W6ZA 4GX1A 4PZEA 2JD1A 2HO5A 4DMMA 4LISA 3LT0A 1AUPA 3SXPA 4RCVA 3ZHBA 2JCYA 4AJOA 3GZNA 3I9MA 4PVDA 1NM5A 4J6FA 1KBZA 2H63A 3LC1O 1DRVA 5CEFA 2GF2A 4FPXA 1E7SA 2NTVA 2DBZA 4IDCA 2NVUA 5BSFA 4J2OA 1UJMA 3OJLA 1LRLA 1PQUA 1Q0HA 2OP1A 3JQEA 1P1RA 4EW6A 1EFKA 5J23A 1E3EA 5IN5A 3L6EA 1C3VA 2JHFA 4GKVA 4AJ4A 3EYWA 3S8MA 4BKOA 3AOEA 4XGKA 1ISHA 3FWZA 5KVSA 3ZW9A 5L95A 5L3ZA 3DMTA 3GMSA 3ONEA 2C2YA 2CF6A 1GAEO 2UVDA 3D0OA 4N54A 4Z0HO 2AW5A 3BXXA 4BNZA 2O3RA 1GCOA 2VOJA 1FJHA 3WIEA 4L75A 4DBVO 4YT4A 2UV8A 1DO8A 2IYPA 1CQJA 4JROA 1ZNQO 2I6TA 2VUUA 3ONFA 3AY7A 4KDFA 3MWEB 4FR5A 4YPOA 3O38A 3UCFA 3PDJA 3WFJA 1I2BA 3NAQA 2OHXA 3C24A 3K31A 3RJ9A 3GEMA 1A5ZA 1U2DA 5K6AC 1YOVB 1PS0A 4BO7A 3ZU2A 1P31A 2BRUA 3MJEA 1QORA 3KB6A 5IZCA 3U4CA 3GLQA 4DWVA 1M6WA 3KEOA 5F3RA 5KKCA 1MG0A 1X7DA 5ENDA 1GCUA 2AQ8A 3BMNB 1MC5A 1W6UA 3IKVA 3JD1A 5CDUA 3PIIA 5H82A 4O63O 3H3FA 1SMKA 2Q1TA 3DOJA 4HKTA 4LK3A 1WDKA 2VHVA 5FF9A 5T57A 3ROKA 4K9DA 1GD1O 4IQGA 3KSUA 1FDSA 2X4GA 4CODB 1BXZA 5C7LO 3CTMA 4PRKA 2X0NA 1FDTA 4MVJI 4A27A 3DC2A 4WLUA 3DAPA 3WBFA 4CR6A 2NUAA 1K89A 2VNSA 3NTQA 3PGJA 1WWKA 4CM9D 4UUPA 1UP6A 3Q2IA 5A3JA 1NWHA 2CSUA 3BYZA 1MGOA 1BHSA 3FSRA 3JQ6A 4OMUA 1PZHA 3C7AA 4E2XA 1BW9A 3LC2O 3ZWPA 1EBUA 4N18A 3FNFA 4B79A 4WLEA 4NFSA 3P19A 2J6IA 4L76A 4UEOA 5A9TA 2G0TA 1CEQA 3NX4A 2PD6A 2TMDA 1GZ6A 2R6JA 3PIDA 5F1KA 3GMDA 3WMXA 2PGDA 3DOCA 4FFNA 4HADA 4L74A 2BMAA 5CEJA 4EEXA 2O3UA 1ZFNA 2YV1A 2ZB3A 2ZIZA 1B8UA 2NADA 2HAEA 3R3JA 1WMAA 4TKMA 2OL4A 3WOHA 4YAGA 1V9LA 5K9ZA 1VPDA 1ZJZA 5L4NA 1U3TA 4R01A 4CV1A 1F14A 1ZSVA 3WXBA 1NXQA 3L6OO 4LVUA 2LDBA 2GN4A 4BO4A 3I9LA 5AXCA 1KVUA 3JQAB 4KZPA 1RJWA 4ZRMA 2EV9A 2YFQA 5U1PA 1HDCA 3SC4A 2D1YA 1PJ4A 5G0UA 5IXSA 2CMDA 2DTXA 3PWZA 3WDSA 3ZNQA 4Q3DA 4KUHA 1DFGA 3C3XA 2NU7A 4NU5A 4QUKA 1NPTO 4BMSA 1T1SA 2NLOA 4JBGA 5JCJD 1Y6JA 3WIDA 4CUZA 1SO8A 4JN6B 4XYBA 1EUZA 3M6IA 4R9SA 4XJTA 1HSOA 4LN1A 3VPSA 3VZRA 5JAIA 3D64A 1D7OA 3PYMA 4BNKA 1U4SA 3D5QA 1T2AA 2ZB4A 1L1FA 3VVCA 4P38A 3AI3A 1ZK2A 3WLFA 4AJEA 1JDJA 3TFQA 5H81A 3DBLB 2PZJA 3FTNA 3QWAA 3AJRA 4KMSA 4BNIA 5JYDA 1PJLA 3R6DA 4WEQA 4XYEA 4IPTA 4I5DA 1MV8A 2WSBA 4F6CA 1EVJA 3H5NA 2VT2A 3U49A 2AXQA 1BXGA 1FDVA 1QLJA 2Y1EA 2A94A 3IUSA 3DZBA 1R0LA 4JJFA 5DOZA 3FBTA 3HE3A 2H9IA 5IDYA 2VYVA 4GGPA 3DTTA 1NAIA 1J6UA 1E7WA 1WMBA 3S55A 1N9GA 1GZ4A 1R0KA 5TQVA 3AM5A 5KIAA 1NASA 1LDNA 4IIUA 1GYPA 4WLOA 1LRJA 1ZEJA 1I3NA 4XB1A 2NU8A 3FNGA 1VJ1A 5I8ZA 1ZW1A 1KVSA 3K8ZA 4CPDA 5ER6A 5ICMA 1YE3A 9LDBA 2DTDA 3WS7A 2AE1A 3ROPA 3OFSA 3ZU4A 4I9UA 4EBFA 3CPSA 4OKIA 4GX0A 1VKOA 3RFXA 3GRKA 3O4RA 4YQYA 2GSDA 1DSSG 2F1KA 3UVEA 2V6MA 3JQBA 2J5RA 3S2FA 4FD3A 4FJ2A 3HN7A 1W8DA 2IZZA 2VWHA 4H16A 3QVWA 4U0KA 3WICA 5CEEA 4I1IA 2R00A 2HLPA 1UXHA 3D3WB 3DZFA 1XU7A 3E5RA 1P1HA 4FC6A 1NP3A 2ZB7A 5L7WA 4MDHA 1JQBA 2FR1A 4MVJF 3WGOA 4BHTA 2Q3EA 4YJFB 3OM9A 3KYDB 1KVTA 1W4ZA 3PHIA 4QO8A 3NT5A 4P4GA 3JQAD 1ULUA 4DBZA 4KWHA 3RCBA 2B69A 4ALNA 3AI1A 4I08A 4D41A 3RKUA 1Z7EA 5DP2A 1WDMA 5JSFA 3QSGA 3JQ7A 4LCEA 4MP3A 4YYZA 1VRWA 3ZWAA 4RF3A 3U62A 1XQ6A 1H5QA 3HUDA 1LXCA 1KETA 5JLAA 4HNGA 3PHJA 1X7GA 4MKRA 5EINA 1B16A 2ZYAA 1DJQA 3VH2A 2VHZA 1ZMOA 3OEWA 3U4DA 4CLXA 1GL3A 4BQRA 2I67A 2NU9A 2AEFA 4FN4A 2G1UA 2D59A 4CMEA 1OOEA 2GPTA 4JX8A 2B83A 3PJDA 4QX6A 4YT8A 4R4JA 4AJIA 1DC6A 3FCOA 1YB4A 2X5OA 3PLNA 1A27A 2IZ1A 1I10A 2XAAA 2YZ7A 2YW9A 3AY6A 3IC5A 4OKNA 5A9RA 1N2SA 2PA3A 1O8CA 4R1SA 1U3VA 4D42A 1LI4A 1LSUA 4GWGA 5JW6A 3GVIA 2PKQP 4HBGA 3RC7A 4CMAA 1LDBA 3GR6A 3U4HA 4XYLA 1TLTA 4Z0PA 3GFBA 3GUCA 4GH5A 5B4TA 4LSMA 5I7EA 2PKQO 1OAAA 1K6IA 2GRAA 3PWSA 2VWPA 1PL8A 2GLXA 3EVNA 3RASA 2CY0A 1NQOA 3FWNA 2ZTLA 4BNLA 2VZ8A 1BXKA 3QWFA 3WQRA 2DLDA 4WCDA 1R4MA 4GSLA 5DNAA 4J7UA 1EBFA 4CMIA 3G0OA 1EK6A 4MVJH 3LT2A 1KYQA 5JY6A 4MVJG 4E30A 4E5PA 1WVGA 1TT5A 2W98A 1A4UA 4ZRNA 1PIWA 2G82A 4R3NA 1UDCA 1YJQA 3DFUA 1VE9A 1DIAA 1Z6ZA 4GVLA 1R12A 1QV7A 2W4QA 3LQFA 3WYBA 3GA0A 5GY7A 3SC6A 5DZSA 3ICPA 4YRDA 1ZJYA 3PZBA 1MA0A 4J1QA 3N7UA 5H83A 2DU8A 1ZO8A 3KVOA 2FN7A 4TWRA 1U9JA 5MDHA 1LLQA 2Q50A 3OECA 3U0BA 1LUAA 3DHYA 4CR8A 4PLCA 3T7EA 3ZWXA 2X6TA 3G79A 3ZV4A 2B0JA 1VI2A 5F5NA 3VH1A 2D3TA 4BNGA 3DO5A 3ANLA 4PLGA 3BMOA 4IJUA 2QYTA 1O95A 1YRLA 3HJAA 4JCOA 5A05A 1SCUA 3QWHA 3ZCXA 3JYQA 4HFRA 3RROA 3PTZA 4D7AA 3N58A 4DMLA 1F0YA 4C4OA 3OIGA 3E82A 4TVBA 1I24A 4CM4B 3JYOA 7ADHA 1NBOA 4JBIA 4B4UA 1SBYA 2ZKLA 1GQYA 2O3JA 4IUYA 3ASVA 3I9KA 5AOVA 4P22A 3EVTA 2D2IA 3DB2A 1F12A 1U1IA 1CDOA 3UW3A 1B3RA 3RUHA 5A4DA 4JLWA 4UEJA 1RWBA 4R69A 3GEDA 3WX0A 3LT4A 1YKFA 4WGGA 5HM8A 2BELA 4O59O 4QTZA 4KQXA 4R68A 2IEDA 1LC0A 1J4AA 4FCCA 4OJNA 2PWZA 1J0XO 4TQGA 4ZQEA 1UUFA 2RH8A 1IE3A 4CM1A 2W8ZA 3WFIA 2Q45A 5JY1A 1UXGA 3NJ8A 1DB3A 3QJ5A 2BH9A 3JQ8A 1EQUA 4P4NA 4NFYA 3D3EA 5IJZA 1YWGO 2YJZA 4IJVA 4NR0A 3ETGA 1FMCA 3K73O 4KUGA 3NDIA 1GUYA 2X0RA 5I7VA 2X86A 4W9NA 5GZ6A 3W8FA 1K5HA 3GVHA 1PR9A 3NV9A 3IJPA 3KSDO 3HNPA 3I9NA 3GNTA 4ZICA 4TZKA 1HRDA 3MTJA 1IOLA 3SJ7A 1SZJG 2IODA 3GZNB 2VHYA 1EE9A 1YJ8A 3IKTA 1E1MA 3KTDA 2WWRA 4ZU3A 3LDHA 1Y8QA 5A9SA 2NVUB 2HKIA 1X0XA 2C07A 4WCFC 4E5KA 2AG5A 3EK2A 3GY0A 2Q4EA 3O8QA 4GLOA 4RV9A 4AJLA 4DIOA 3FI9A 3UN1A 5G4KA 1H0KA 4PLHA 3E18A 3VKVA 1VM6A 5BNIA 4B7CA 4WOKA 5DBFA 3OHSX 2NV6A 4XZ3A 4YXFA 3HB4X 3ITDA 5GMOA 4XIYA 4M54A 3ROMA 2ZTVA 4QFCA 3H3JA 4DIBA 1OBFO 1E7YA 5JYEA 3ADPA 3INTA 3WB9A 1JTVA 1U3UA 3RBZA 1U7TA 8ADHA 3KZVA 2UUPA 1VSUA 1HDRA 3Q3CA 4YJHA 4Y9DA 1L7DA 3JV7A 5HWSA 1IZ9A 3LF1A 4DC0A 2DVMA 3OJFA 5T64A 4BO2A 1GEEA 5G2OA 3K92A 4BGEA 3PVZA 1KVRA 3F3SA 1CIVA 2EEZA 2X0JA 1MP0A 1PL7A 5TLSA 4YQZA 2AQKA 4WKGA 4RF2A 1U5CA 2QIOA 2VYNA 1S7CA 3ZN2A 1SOVA 1HE3A 1E5QA 3BTUA 3LVFO 4PFJA 2VZ9A 1VL6A 4NIMA 3H2ZA 4E12A 3CMCO 4LMRA 4WLVA 3NGLA 3JYPA 4P4LA 3DHEA 3K96A 3PYLA 5IF3A 2D5CA 3WGIA 5TIIA 4OHUA 4GPD1 3RWBA 1VKNA 1E7QA 5A04A 4GKBA 2PH5A 4YA6A 5G0TA 1I0ZA 1RM5A 3OP4A 4IGEA 5HA5A 2UUOA 3FF4A 2OP0A 4PG7A 4IQ8A 3A06A 3GFGA 3DL2A 1X14A 2RHRA 5DCUA 5L53A 1PS9A 3BZUA 3OQBA 4EJ0A 1E6UA 1ADGA 4HUJA 2P2SA 1YQDA 1XYGA 2AEJA 4BNYA 4HP8A 4IM7A 3OBBA 1HWYA 3SX2A 3TZQA 4CUKA 4G5HA 4Q9NA 5FI3A 2O7QA 3U5TA 4DREA
chains in the Genus database with same CATH superfamily
1YVUA 1BAPA 3D81A 3EGVA 2I62A 3WGTA 2FW9A 1KZ1A 1V5IA 1T15A 1RXVA 2DPYA 3LU1A 1X1EA 4HWTA 1GFIA 1UODA 2PGXA 4UD6A 1HF3A 2REOA 3GZ4A 4Y1EA 3WGJA 5JMOA 1CHDA 1TAUA 1G8AA 1K7YA 3CURA 3NIFB 3K0EA 2Q62A 2XJ9A 1QO0A 2ZBFA 4JK3A 4LUCA 4ZAWA 1JJIA 5ADHA 5THXA 5CDYA 2C7OA 1L5KA 2GD1O 3BCRA 1WPRA 1FRQA 4OL9A 4PPYA 3RUPA 2JIBA 1GYQA 3LLSA 4QBFA 3SOPA 1E2BA 1D5WA 3ASUA 1F6DA 3L79A 2BI7A 1NYRA 1NQXA 4LC9A 2Q4TA 4EGJA 2NTNA 5EJ8A 2JLUA 1X70A 2WJHA 3PF9A 4F1WA 3PKIA 1U9IA 2OG1A 2PQ0A 2PXCA 1ONNA 2AYZA 1F2UA 4KFTA 4PPGA 5HUJA 2RI0A 1QP0A 1S7GA 5K2MA 4M99A 1XE3A 4NBLA 4HMPA 4HNTA 1GXSA 4FIDA 3MJTA 4KVAA 4MPPA 3DVQX 4NV1A 4QOEA 4RHTA 1KI9A 2IHNA 1T3GA 1TVCA 3WGVA 2JD0A 1ZXXA 1V1JA 4G0UA 1X8KA 4UREA 4XKJA 2FX5A 3ELWA 4DNOA 2GEDA 3JYNA 4D3DA 1SUAA 2BW0A 4GECA 4IYRA 4J07A 3CSDA 4CKCB 3B8EA 2E4VA 4OFWA 1QK5A 1VRVA 3OJXA 1J21A 3F9IA 4WH0A 1WW8A 1HFEL 4QQRA 3HV0A 4HEJA 5I9NA 2AMJA 3UA3A 4WFQA 5IXJA 1DARA 3H1AA 4MIKA 4QU9A 3W9BA 2ADMA 1TM5E 2MT9A 4K9RA 5FOTA 1LKZA 2C7BA 4J9VA 4QOSA 5EJEA 1P2DA 1E94E 5HNKA 2CE2X 1DCFA 2WFLA 1LPPA 1U2RA 2IYSA 3B9RA 3OJOA 5KJEA 1X39A 5GM2A 1Z17A 1MR3F 2EZ9A 2HF7A 2M6LA 1Y82A 1PSDA 3SXUB 1H3NA 2P79A 4B0PA 4NDZA 4XW2A 1ZONA 2BFWA 1R8SA 3UAXA 2DT5A 4OY3A 1S6YA 4G81A 4KN6A 4PLTA 5A3SA 3DTYA 3BN3A 4U4AA 1EVLA 2PSSA 5REQB 3OE1A 1Z22A 2X9GA 2FQQA 5TGDA 3IBTA 5COAA 1FTGA 2P9CA 4FJ1A 3AY3A 3BH6A 1KYYA 3DBOB 2XE7A 1M75A 1T9CA 1GPUA 5HE9A 4BLWA 3SC2A 2ATVA 3CLTC 4NBRA 1DDGA 3M4NA 2EKPA 4L5IA 4C0BA 2FB9A 3NC1C 1XA0A 5C5CA 3H9GA 3NP7A 1J90A 1ORIA 3M2PA 4QDKA 3W6PA 4LECA 2I3DA 3E6AA 4QU0A 5EKSA 4C6SA 5BV7A 1OHHA 2B21A 4R6WA 1BXGB 4IWNA 4Y3UA 2CK3D 4HDKA 3WWOA 3GLHA 9GPBA 1CHNA 3TECE 5C8XA 4OQPA 4LOHA 2RCNA 2IHJA 3DSRA 3JQRA 2FLWA 2GPSA 2H1CA 5LWHA 5DT2A 1UFRA 3TQQA 4REQB 1B42A 1U2ZA 2OORA 1TA4A 3H9BA 3E0QA 1N9GB 4P3XA 2QN6A 3GJ8A 3I05A 5K4AA 1YB7A 4QO7A 4GSKA 4UFPA 2EP7A 1AHPA 1QCZA 1QRTA 3F6YA 3KLPX 2GLUA 3QRWA 2DEUA 4O4IF 3VC1A 3P0RA 4MPJA 3T4EA 1JHQA 1K2VN 2WLTA 2Y68A 4NS1A 2AE2A 3D1JA 3F5QA 3U26A 3PUVA 2NACA 4MUXA 3ETEA 1MXHA 4B3FX 4M49A 3IVRA 3OZEA 2MHCA 1T35A 5HIIA 1A8HA 1U7DA 3QG5A 2JLZA 4X54A 4G8DA 2XE4A 3H05A 4HCJA 2IQIA 4IXDA 4J0GA 4OGGA 4QASA 5D84A 2XYVA 2D5BA 2QT0A 4LJLA 3E9QA 4G1CA 3LCMA 4KYVA 4YDHB 5FO1A 1TA9A 3RW9A 1TW2A 2FUNB 2WINI 3P9PA 1JXAA 3FPHA 4RLQA 4X93A 2O8CA 4YLGA 2Z8ZA 2J45A 1U63A 4AULA 3CLHA 1IWBB 2ID8A 4ZT3A 2RG1A 4OGFA 2BGGA 2EATA 3RUFA 3N8KA 4KC0A 4Q3KA 3R7WA 4XE5A 1XHLA 5TVKA 1YDWA 2PRJA 1NXSA 3UUGA 4CTJA 5CYGA 4G8BA 3LI2A 1PJZA 1W1UA 2HV9A 2RAPA 1CZLA 1Z4PX 2OXRA 2SECE 2V5UA 3TG2A 3TRJA 3D7NA 2PVPA 5AKLA 2HRRA 5IKEA 3AZQA 1SPBS 1JQ3A 4U63A 4D6PA 3LO5A 1W52X 4HTFB 4C5CA 1TCUA 4DLAA 5BV8A 4G84A 2Z6UA 1ZGCA 5JCZA 2H5LA 2Z9DA 4R8RA 1Q7EA 4BP3A 3PX3A 4BAGA 1YS7A 4LA4A 4OB6A 3G17A 4Z4EA 1WD7A 2PLNA 3DLCA 1E98A 4RHFA 4YTEA 2CVPA 5JJ5A 1PJQA 1WULS 2P5UA 3ZLBA 1S02A 5C7YA 2I6FA 3PDCA 3KTAA 1FNBA 4OQDA 1HDXA 3TVYA 4EUEA 3R5XA 1Z2NX 1EFDN 3RIHA 1ISMA 1HZZA 2UZIR 1V6AA 1MFPA 3CZQA 1C80A 1BEEA 4LJKA 5AK3A 4D5GA 3N28A 3MGBA 1G3RA 3JQGA 4D45A 1G8YA 3A1WA 1AX9A 2XADA 5JWHA 2OA0A 1VDMA 4FW8A 3UMSA 4D44A 3EWNA 1J9EA 2B99A 3G89A 3HZRA 3RM3A 3HFSA 4QVKA 1ZH8A 2EW8A 3OFVA 3BBPA 4FIZA 2XMDA 4WY5A 2JFWA 1T8WA 2OM6A 5CJ2A 3MCUA 4B6GA 4J1TA 3B2QA 5A7FA 2LGJA 2D1QA 3BXPA 2HMVA 5EKTA 2W2TA 3SQWA 1P0CA 2XRYA 1QX4A 1V4NA 2ID9A 2FK8A 3ITKA 4Z3DA 4H60A 3OCUA 1M76A 1VECA 4P58A 4XXHA 4ZQBA 4RDIA 2OPBA 2JKVA 3CVXA 3LL7A 2ZRAA 1I94B 3CUYA 3FUTA 3D2AA 3IDQA 3HLKA 4UTRA 1WNTA 4PZ0A 821PA 3WGMA 1C7QA 2C88A 3O9ZA 3WWDA 4RJJA 5CITA 1YCGA 4QPCA 4MICA 2ZAGA 1UT8A 2WD9A 2FFJA 2ESRA 2XE8A 5SY9A 3TLGA 4BP1A 1OH6A 1E2IA 1VZ3A 4FCVA 2QS9A 4ZQHA 5MFPA 4UDYX 2JFPA 3BD7A 1VLHA 2FZCA 3PGXA 4GG1A 3K0SA 3O6VA 1UH5A 3BJZA 2XA1A 1HYBA 3P94A 4RTJA 4RCYA 1OKKA 4OQEA 3LRXA 5TF0A 3X1ZA 1P3Y1 2KI5A 1I2DA 3IIMA 4CUJA 4QJ3A 1N2XA 2HWXA 3P2IA 3RIXA 4CWAA 1TMYA 4DVJA 4M1EA 2GASA 4CMIB 2PBLA 3VGJA 4TPKA 5CHEA 1CJBA 1FFCA 1FRZA 1QH1B 2GQ0A 2OORC 3BVPA 1F3LA 4GXTA 4M22A 2DUUA 4R8MA 1C3XA 4IDOA 5H5JA 3GLGB 3AHDA 4O1MA 2YZKA 5T5QA 4D4JA 3PIRA 5HIAA 4D3YA 3UMMA 2IVZA 4M7RA 1IUOA 4AMZA 1N6KA 4HDNA 2O54A 3ROZA 3M5WA 4H7JA 1WBJB 4QOIA 5HS6A 4CIBA 2VXCA 3NBZC 5CRIA 1GNRA 5BT8A 1NVXQ 2O8DA 4HQLA 1PQ4A 3PPWA 4Q16A 3LH5A 3V4OA 4N1AA 1M1NA 2K87A 2RJOA 4WZBA 1QFZA 4G8CA 3HB5X 1E3SA 4LHEA 5C1PA 2IX3A 3W7BA 1AQUA 1SU8A 1W30A 2PR2A 4KG7A 4LJ7A 5I9SA 1C81A 2O20A 3CC8A 4LY6A 1L3CA 1H1TA 2JI6A 3GRUA 1XPJA 2EL9A 2Y0EA 1G8JA 3KQPA 1UKYA 1W88A 2J67A 4FYWA 4B4VA 1ZM3A 4BFSA 4HG2A 1PK9A 1QQAA 2VUSA 3NC0C 1PEAA 2VTBA 1PV2A 2PWBA 1M2FA 4I0WB 4DNQA 4ZI7F 4MYTA 4MGHA 3WJ1A 4FSHA 4YHHB 3AEUA 1TFRA 3SLGA 1BGXT 1E6KA 3K5PA 2JATA 1G4HA 2A7XA 2ET6A 3R0IA 1CZOA 1TTHA 2B98A 2GZSA 3F7MA 4MS4A 4QWMA 4RJ2A 3ZXUB 1UBMS 4N7RA 5EUQB 7ABPA 1IH8A 2PZMA 1H2BA 2J7KA 1G1AA 4GM4A 2HGSA 1QH8B 1K9SA 1JHOA 1EJBA 1AUOA 1BE6A 3OH8A 4PINA 4TT8A 3W6OA 4XVRA 1ZGZA 2NWQA 3PC2A 4BVAA 6CHYA 3IIEA 2J3DA 2J9FA 2CNLA 4FGWA 3A6LA 4D3ZA 2FZEA 2VSYA 5IJ9B 3WRYC 1CR1A 2UYYA 4C2TA 5I47A 1BRMA 3ZY4A 4EPXA 4CIXA 2XW6A 2DUMA 5EA2A 2UAGA 3P4UA 2XB8A 3BKXA 3JWIA 2CYAA 3VHXB 2HJHA 4F5ZA 1UMCA 2QROA 3COSA 4F06A 3V42A 3UAVA 1KPIA 4ND5A 2ZI5A 4GOND 4EL5A 1V95A 4XTCS 4IRUB 2CFRA 3AVTA 2WPDD 3R23A 3RD5A 2BISA 4PLFA 2PSFA 3SFVA 1U6IA 3I5YA 4C0QC 1QLHA 1W85B 3GRPA 4PHHA 3MW8A 4NC9A 3ZH9B 1UKAA 5A6VA 5IC5A 5AFSA 4A0HA 2OEPA 3OPYB 2BZSA 4URFA 5F12A 1O6ZA 2QPLA 3IQDB 5MFZA 2CE7A 1G19A 2E89A 1ADFA 1J2YA 2N1BA 4J1TC 1KKUA 1XA3A 2EJWA 3ADBA 3W7VA 1A1VA 4FR2A 5J2UB 4GWLA 1DTSA 4E2YA 5JRDS 1D9ZA 4KNYA 2H18A 4MWZA 3H16A 4B17A 5A62A 2H54A 1J8VA 2X8JB 1U9CA 3ULKA 1AXGA 1L9XA 2YMPA 1M1YB 4MQ4A 4C07A 2ORVA 1DC4A 2V6GA 3ES9A 4UU0A 2BI4A 4HYQA 4R7TA 4CL8A 3FN4A 3MIIA 1OPRA 3PPYA 4IMJB 4A2QA 5J2TA 4CR8A 5LDDC 2D06A 1M74A 1G0OA 4HWGA 1HYGA 2FR8C 1T2DA 1UKZA 2DSTA 2JCSA 3RSFA 4PHCA 4DFDA 1CRWG 5BR7A 1A7KA 4MGIR 3H1PA 3KPWA 1HQKA 2EC5A 4OHPA 2GK4A 5AKJA 3UJAA 4FNOA 4WECA 3R7DA 1X7YA 1PE0A 2EJTA 2WWTA 2Y66A 4Y2RA 2A5YB 4AM8A 4E5UA 2ZIXB 1PGOA 4R1MA 4Y6RA 4R83A 3A2LA 2Q4OA 3NNSA 1I5EA 4AURA 3IHKA 2VXBA 4MCAA 5JCPA 4FNAA 1FDOA 4OMFG 2GEUA 1YL6A 3V80A 4NU6A 4EA7A 1PJ2A 2YNMC 3W4IA 1JSXA 1V16B 2DQZA 3QI2A 3UWDA 1A50B 2ODNA 5CLGA 3O8QB 1O94C 4NTZA 3R8CA 1Z28A 1Y42X 2PUAA 1B74A 2NUPB 5ITSA 1NZJA 2FSGA 3GJXC 3UMGA 4DWJA 1M2EA 1V6CA 2HRBA 3HKEB 4LF7B 2D4HA 3EF0A 1OGIA 2G1AA 3KU1A 1LSSA 1SC1A 4E33A 4PYRA 4JBHA 1TEZA 3TB6A 3BK7A 2IP2A 4D8YA 1B0AA 4N8SA 1QKIA 4ZQCB 1K66A 5DDIP 5B7GA 5CFOA 3GCWA 2DERA 1Z25A 1O95D 1QWSA 4OATA 3MYYA 5EE9A 1DBIA 5B64A 1OR8A 1BCSA 3BHMA 4A3SA 2I7VA 2A88A 1ZH4A 1CVLA 4QGBA 4LS3A 1IRIA 4GDFA 1G7CA 2WPNA 2WIBA 1I36A 3B1JA 4J0HA 1KQPA 3QE9Y 5CVVA 2LZ0A 4A8JB 4Q3BA 4RD0A 4HT3B 5FV4A 1O89A 4KV7A 3ZI7A 5A3QA 3KJFA 4MW2A 5K2OA 1E1CA 1H1LB 2LCFA 1RHRA 4TMFA 1Y1SA 3KQSA 4L0DA 2P2NA 2HBZA 1Q2UA 1EZ4A 1TD1A 3AC0A 2BTEA 3BMCA 2C2WA 2W11A 3DTVA 3DZGA 1KDPA 2X2EA 5IDXA 3VR5A 5A06A 2CZCA 1UC5B 3EXFA 1DKOA 1CULC 1FQWA 1VPTA 4XD2A 4YUAA 4IDAA 5EPEA 3ZIAD 3QQPA 3T7IA 3PFHA 4A8TA 3KR1A 1HTBA 1UBHS 1QX3A 1UXJA 1J8MF 3C7TA 4RM2A 2VAMA 1BA3A 4D1YA 1Q1BA 1N2CB 4P3KA 3ANYB 4FWTA 5EWMA 5F1YA 4GO1A 1C5KA 2LTAA 1F8UA 1G21B 3QE0A 1RFLA 4KXVA 4O2AA 4Y30A 4Q7JB 3BA6A 3QG1A 4MV0A 1TO6A 1YAHA 3E03A 3GUYA 5EEHA 4QHYA 4CFZA 2DXIA 2Z8YA 2AI1A 4RVHA 2WD7A 1P62B 5A5GA 1ZINA 2C54A 1P5FA 3L7AA 5DHAA 1SAYA 4XX0B 2P3SA 1UWLA 5T3UA 4Z7QB 1NVTA 5LP1A 2QV7A 4YVFA 3ET4A 3LPDA 2YDXA 2V6FA 4P4UA 2P8JA 4AUNA 3OIDA 3K6JA 1E5LA 2F1OA 2AWNA 4D4IA 3EZGA 4MQEA 1XMSA 1TUIA 2E85A 5F77A 4KMOA 3U4AA 2WIAA 5DV9A 4HDAA 3QVJA 2SHKA 3P0HA 2GDJA 3UV3A 5KNBH 4HGRA 3RUCA 1JN0A 5EZYF 3WLKX 2DG2A 4N3NA 3W1WA 2OQRA 2D4AA 2QVXX 1C8LA 3MTAA 1DXYA 3EXHA 4XJXA 5F9FA 4FFDA 4WI1A 4GWKA 1KK1A 4EF6A 2HCFA 1N2GA 2J3JA 1WSDA 5LZ7A 4K8OA 4S0ZA 4EJFA 1M2OA 2GAAA 1QQBA 2FG6C 2E7ZA 4UM9B 4HDSA 2H1HA 2R11A 3KDSE 3HKCB 4WK6A 5SYAA 2GH1A 5GJCA 5JAHA 3AHFA 4QYTA 5CVDA 5AK6A 5DOVA 1R6TA 1KARA 1JKFA 3P9NA 3DVRX 3ESCA 1PTKA 1Z9BA 2BDTA 1VZ2A 4DAEA 1GUZA 2ZUVA 4DLYA 1UP4A 2BFEB 5IDVA 3RB8A 4YLYA 5ITZA 1VE3A 2P68A 5BNFA 1QZUA 3LD9A 2ZETA 2WIDA 3SHQA 5BQ3A 1PEDA 5E6RB 4BIMA 3X2SA 2NVBA 3I9FA 3ER6A 3K9FC 4Q66C 4FSXA 3VNRA 3WLAA 1JHXA 5CVEA 2W6ID 3FZNA 2I6SA 3WJ7A 3UB4A 1QIHA 2HUNA 3NR2A 5DK4A 1GM5A 4ZYWA 1T25A 4CLRA 4EM6A 2E5LB 3RUAA 1GU7A 3MMNA 3P8ZA 3QA9A 3TBFA 1U2EA 1OZHA 5IKMA 2OGUA 5CCXA 2VF7A 2HRZA 2EFYA 2QKYA 1CF2O 3DQPA 1DL5A 2VHJA 4KXMA 3AFOA 2IHTA 4S0XA 4B3SB 1Q17A 2E21A 1WEHA 3K70D 3CLRC 4MUFA 2DWCA 4NJMA 3PRKE 5AVJA 2CLFB 3P4XA 3WVNA 2XSZA 4JYBA 2NO1A 1X42A 4WZAE 4ZPXA 4RTMA 1ZUNA 5FNVF 3BZBA 4RF5A 5T3YA 3AF4A 1X1QA 2NIPA 1JVBA 2O4CA 3EVGA 4UQPA 1ETHA 1WTCA 2QYOA 3R76A 4ZKDA 2JKYA 4OF4A 2ZJ5A 2RGYA 3D31A 3HHEA 2CDBA 3K1TA 4K3VA 3R9XB 4CIVA 1EAYA 3KJIA 2OGZA 1JDBC 1KBOA 2X7HA 1HE4A 1S96A 2OCXA 1HXHA 3LCUA 1Z8NA 1G18A 5EP2A 1Z38A 1E5DA 2Q49A 2RHBA 4IGFA 1GL6A 1D6SA 1FZTA 1YU9A 4I4TB 1G6Q1 1K2WA 2EFJA 3C14C 5KYYA 3BRWD 4YCNA 2AC7A 1I2AA 1N0HA 2GCIA 1Y81A 4U3JB 3VBCA 1NLUA 1QAMA 3FYDA 5KWEA 3KRTA 1QRUA 3I1FA 1P0FA 5TSDA 2I34A 2OXIA 3RTAA 3E9ZA 4QUDA 3FNEA 1IK6A 2Z95A 3OZDA 2DFVA 4U7GA 1DJOA 4ZOCA 5FBKA 5H3CA 4BEBA 4JJAA 3DMDA 3ZHCA 3ZIDA 4E1AA 3EZ7A 1TZMA 3I23A 3KT0A 3FDJA 3KXDA 4FYIA 2IKQA 4MKHA 4O2BF 2IHYA 4EG0A 2DWPA 1PG5A 2A1UA 5HXAA 1AB6A 4UAUA 3C3WA 4P31A 1X6VA 1YL7A 1IZZA 1KJ9A 3HDHA 1YI8A 4R51A 4ZT6A 4RV5A 1ISRA 3EQ9A 3KVYA 5ECGC 4K6GA 2J6HA 3GHHA 5AYVA 3ZNOA 2AKEA 3ANSA 3WWPA 1XRNA 4XDHA 5SZIA 3SF8A 1M1ZA 4YX9A 5ITWA 4C2UA 1CR4A 2QMQA 3SVLA 4II2A 4AXBA 4P2BA 4Y6OA 5LZ4A 3OF3A 1L7RA 1QO0D 5KOJB 2B8EA 2ZQYA 4FYVA 3QE4A 2EERA 2NZXA 4ZO8A 3ZE7A 4MW0A 1LC3A 1ZAKA 4HNSA 3RF7A 4A9AA 4E3WA 5JRZA 4I3FA 5M7EA 2YICA 1QHIA 2H92A 4GBJA 4MINA 5DI9A 5L3QA 3TDKA 2HK7A 1FLNA 5IC6A 4LF4B 2X0KA 1HTWA 2Q5EA 2Z5LA 2JBWA 1R16A 5EJ7A 2BBSA 4G3XA 4BIIA 3QU5A 2N46A 1TJYA 1Z15A 3NTUA 4MVJA 5HKLA 1S0UA 2XUPA 3OY2A 2JD2A 3C48A 1KO7A 3L8EA 4GPTA 3UGKA 4DUZB 2CV2A 2FRDC 3CEHA 1U3CA 1AK2A 3ZE9A 4CYMA 2ATCA 2R1VB 4IH9A 3A32A 3TKYA 5HX7A 1W2WB 3FUWA 1IN1A 1R3UA 3AKCA 1OILA 1KI8A 2ZFUA 1DQPA 2RHOA 2BONA 4OBBA 1RYBA 1WAMA 1W93A 1TECE 1ID8A 3Q6NA 5E3HA 1HT2E 4RX1A 2A5DA 2Q4DA 1Y9EA 4Q4HA 4LVOA 3QH4A 2CWDA 3OAAA 4Q7KA 4D8WA 3S27A 4LXIA 2HDNB 1EFVA 1KH3A 4HLUC 2EKBA 4XR9A 4D8VA 4QUAA 2W2VA 4M8LA 4DBLC 4ZHQA 1TF2A 1U3DA 2AL7A 1Q83A 2OECA 2VPPA 3MRVA 3NHRA 3PNYA 4FOOA 1ZG3A 1TNDA 4IKOA 2OCDA 2X13A 3KSZO 3T3PB 1BGVA 1D9XA 2I4LA 1ONBA 5CD9A 4CRWB 3WFZA 1KTVA 3G0BA 5AJXA 4CVNA 4Q4CA 4YRFA 1SUFA 4LVNA 4OLFA 3FROA 5FWYB 1CQZA 2VNAA 3BA1A 4P1ZA 4U2GA 1BWRA 3UXYA 1XNHA 4RF4A 3QPAA 4BJ5A 3X2EA 2VEOA 3O31A 2BF7A 3JASA 4J0DA 6LDHA 2E4XA 2IDZA 1AGXA 2OCKA 4G2NA 4TZ0A 3C5WP 1D4FA 4YMWA 4J9UE 3DEAA 3OURA 2JLWA 4NYJR 4YB8A 1CLUA 1WA5A 4GEKA 5FR2A 4D25A 2H1SA 1VMIA 2ILTA 3C45A 4DCTA 4F4JA 3IE1A 4LRXA 2FZ4A 1OI7A 4CFYA 2D0PB 3L0BA 2HEGA 2QSJA 2JAXA 4L5CA 3BF8A 3EUWA 4YCLA 3OHPA 3E35A 1CF9A 1F6BA 2H5EA 3SSMA 3EA4A 2IS4A 1U8XX 1UQRA 2TMGA 3TB4A 1O58A 3IBCA 5T7BA 3GAAA 3NETA 2DB3A 3QW4B 1DIRA 3ACBA 3L7IA 3NAZA 3H9JA 3AHCA 3GDFA 3OLCX 1Y3FE 3TS1A 4B0OA 3UH1A 5C5IA 3B60A 5TQ0B 2Z56A 5EWLB 1POWA 2N3ZA 3M6AA 1VIVA 2O8EA 3V32A 5JD3A 2DECA 3ZJYA 3C3AA 4PF1A 4I5GA 3QEOA 5IAJA 3C43A 1T3HA 3E4CA 5CPFA 2QMUA 2GEKA 2VH1A 3BFKA 3KZ1E 5K0GA 2VRCA 3KQVA 4OQXA 2YWGA 3OJ0A 5TXGA 1YBVA 2ICAA 2ZR9A 4AKHA 1A9YA 1PTJA 1ZXLA 2QUJA 3LLVA 1SJ9A 2Z6VA 4HXYA 3NWJA 4JJIA 3Q8LA 1WSBA 4UEWA 2J3IA 3CLUD 4MI9A 4Y2GA 3VH4A 1IN5A 3VO2A 2HWYA 2OG2A 1D6NA 4WFKA 1R74A 3TRHA 4QJBA 3B9BA 4EGQA 1NNSA 1RFGE 1RM3A 2JB9A 4DDMA 2BEJA 2W2MA 2HCBA 2JCXA 3F9CA 3ZWBA 7REQA 4DMKA 2WWYA 2WF5A 3DLBA 1JAXA 5TX7A 4NAUA 3TSCA 3WQQA 1KRWA 1QUEA 5EJFA 4N5IX 4BJHB 3DV0B 5BN4A 4Y7DA 3G8BA 3R3HA 4M1KA 2PBFA 3D0KA 2OUIA 2HRDA 3L02A 4I1RA 3LWBA 3KWLA 5A71A 3QIAA 3AX6A 1GNSA 3NTOA 2YC2C 1DEHA 2QG6A 3AU8A 4CM6A 4RMNA 4X60A 4RVDA 1C1XA 3UATA 2O2SA 4Y1RA 1XC7A 1MC4A 4RVOA 1VYVA 4TS9A 3VC7A 1MQSA 4JYCA 1Z82A 1CCWA 2J3KA 2WFAA 3UKDA 4HQNA 2C82A 1MOQA 3AESA 5NLLA 4AZ0B 3L4JA 3TL2A 3LF2A 2CVOA 4GYYA 2EDCA 1YR8A 1FJXA 1RLUA 3O3CA 3GDWA 2XMCA 2JANA 2QRPA 3ETJA 1A96A 2ZSHA 3MA0A 4LW8A 4UE3S 3KLMX 2J5BA 4BGVA 3PDIB 2FFRA 1X9GA 1HETA 3IIIA 3ODPA 4JT2A 1TRKA 2POQX 4OP2A 3JQDA 3DOHA 2G6BA 3NAGA 3OPVA 5HJEA 3P4YA 5ALRA 1QQTA 1GTL1 4HQ6A 2EBWA 5DW0A 5JDIC 1JSLA 3ZU3A 5ICSA 3ZQJA 2GAFA 4MUBA 2DY1A 3IBGA 4FBLA 3CONA 5JAOA 2VPZA 1U6KA 4EENA 2FPGB 3NHKA 1AVTA 3BPSA 4QA9A 3K0KA 3SVZA 2ZUSA 4OHOA 5COBA 1GTZA 2QJOA 4IJQA 1UOQA 4K9NA 4RV4A 5BV1A 2IRWA 2A1TR 3II6X 3NM6B 1DFHA 3H2GA 1XROA 3W5IA 3MWYW 1U1EA 2AG1A 2NG1A 3AT1A 1OVMA 4GQAA 2FVXA 1UADA 2QRKA 3ANNA 1CQIA 1RP7A 1Z4OA 4NG5A 1E92A 1Z7BA 2PMFA 2YR0A 3KAJA 1J00A 4K1LA 5JAPA 1FW6A 2AJ8A 3EXG2 4GMGA 3LYAA 1U8FO 2UUCB 3RU9A 1SVLA 1RAHA 4I8IA 5IJWA 2J0EA 3GJZA 3NB0A 1G1MA 3ZHTA 3PNQA 1F2TA 1GDHA 2I2BA 3AL0C 1HDYA 1LX6A 4R2MA 1E4EA 1KIAA 1QK3A 3D0RA 4UTOA 3REGA 5K3OA 1Q0RA 2W2KA 3QKWA 4V24A 4G07A 4BBJA 4OB7A 4BUJA 1HDEA 5ETJA 1W29A 5IYZB 3A05A 5KNLA 4FZJA 1JIQA 1DQYA 3DP7A 4JBLA 4YJ3B 3HVJA 1GQFA 3R5KA 1RHMA 1OKKD 4CKBB 1Q7BA 4FS8A 1LJLA 2YY7A 3W8DA 2WJ3A 5B58T 2NO6A 3GO4A 4NDNE 3ILSA 2D74A 1TJNA 2IF2A 2WUDA 2VKQA 4JJZA 2A1IA 2ZE6A 4RHYA 5HS4A 3LNCA 3PLRA 4CM9A 3TM5A 2BY4A 1PGQA 4R0NA 3T9AA 1SNYA 4Y2PA 2P91A 2ENUA 1IU9A 3BG5A 1RRGA 3TTWA 2XMPA 1JR3A 3P5SA 2QUHA 3NANA 1S1MA 4XCVA 5IVIA 1RQPA 3IIKA 4RPGA 2QTBA 2FP4B 3R7FA 3U81A 3VV2A 1RCUA 1DKRA 1W5TA 2JFOA 4IIHA 4DLKA 2CWWA 2Q1WA 4OAPA 1W19A 3W4JA 2PV7A 2R6DA 3A6EA 3ZWOA 1GKYA 4LV6A 3SS9X 5IFLA 1NONA 5SICE 4B3MB 2ZBRA 3A3YA 3D4LA 3WK8A 4MJXA 2FW7A 5AQ1A 5DIZA 1I30A 4YQEA 2BWJA 3HKDB 4M60A 3NHPA 3LX6A 3K9WA 1EG2A 4ICIA 2DHRA 3C3EA 1SZCA 1PTJC 1ZEMA 2QTGA 1OREA 4FN5A 1EJ6A 2ZSDA 4NP6A 4P81A 1UMDA 2H0RA 5E9WA 2KHZA 1JFSA 5C3MA 1N0UA 4GU5A 3C5VA 1LW7A 2J5QA 3AOEC 3MGAA 1A3CA 2YV4A 3EHDA 4RANA 4YCBA 3OT1B 1IHOA 1GRQA 4KQFA 5IKPA 1U2SA 1PJ3A 1C8KA 1Z4JA 1AD2A 3CNNA 3HYCA 3DMTC 4NOMA 1U9YA 1UKVY 1ZU5A 4N6NA 4P7FA 4UULA 4Q1CA 1NQTA 4Q3NA 1Y6RA 4R1OA 2BHNA 5D3QA 2PHZA 3VR6H 3L8MA 1J2JA 5GM1A 2GK6A 2BEWA 3MBKA 1QMGA 2V5VA 4WVLA 1LF5A 1L4FA 2R8PA 3HP7A 2YZMA 3HPRA 2EZUA 3CGGA 5D87A 3RAGA 4AO6A 2CXOA 2UZ1A 4BY9E 4ZZ2A 5FUQA 5JARA 1B2RA 3QENA 4RVGA 3ROEA 2BMJA 2IDKA 4JT9A 2JFGA 2ZK7A 1A9RA 3L40A 3OZUA 1KXJA 2DCUA 2IYFA 2BFDB 2L2QA 5ESXA 4V0QA 3TJRA 3TFOA 1WQ4A 2XUDA 3K09C 1Z2EA 2BGKA 3M1AA 1E8MA 4WZ6A 3TQHA 1IIBA 2E48A 2GZRA 4I55B 4UEKA 1J0AA 3NAMA 4DHWA 1JKIA 2VDVE 2IIVA 3GOQA 2QMZA 2Y1GA 1IVYA 2JGDA 1J24A 1YRBA 4MP6A 1H2RS 1E9SA 3I1IA 4EQZA 2Z1MA 2CHQA 3ZDXB 5HTOA 3IRUA 1SC9A 1YOVA 1S2GA 2VDRB 3LP6A 1CFZA 1X7XA 1F8GA 3FIUA 3L7DA 3PJFA 4V02A 5J58A 4KR6A 1XRJA 4NYMQ 1YQXA 2KBFA 1KEUA 2XI4A 4ARAA 1K7EB 1Q1EA 2Z9CA 2P78A 4PZ9A 1ZXBA 3UGQA 2PLFA 1OFUX 4LSZA 4U8HA 2JAWA 3T4XA 5AKYA 4BQPA 4OOFA 2Z2ZA 4EI8A 4CLOB 2B94A 4L27A 5DGHA 1JBQA 3QLEA 4G1BA 1RC0A 4Y2JA 1EWVA 1E77A 1MJNA 1GGJA 5FLEX 3NDBB 4ENWA 3RAEC 1GQOA 1IG0A 2C2KA 4L4ZA 4A2PA 3LLUA 1Q20A 3NZEA 4IXTA 5CVTA 2YXBA 3LUJA 3U3RA 4U02A 3FYHA 4N6GA 4DPLA 3AERA 5DXJA 4MWSA 1ODKA 4LXGA 4LKOA 5JSZB 5LOVA 1OH5A 4QOFA 3PQ7A 3ISJA 4TWZA 2NUTB 4XIGS 4EHFA 4RTLA 2JIQA 3ZHVA 5HVNA 5LZ9A 4TTRA 3N53A 2IX9A 1LRKA 5AW5A 4MQFB 3WLHA 4N4AA 1XDZA 1J8YF 3U61B 1X94A 4L4UA 1QDLB 1CZNA 10MHA 2DUNA 3QKTA 1XMIA 1DIGA 1NVWQ 2QZ4A 3ZWQA 4IWYA 3KQKA 1QHNA 4A36A 1MF7A 1V3QE 2ZIWB 4O5OA 4QULA 5D86A 1E69A 5KWVA 3CNBA 2EYQA 3HN2A 1IBCA 4L5JA 3CCFA 5B53A 5EC8A 3L0DA 5BN5B 1NI4A 4XLLA 2O8BB 2YVLA 4YGYA 3EHEA 4Z1OA 2ZYTX 1DWOA 1XQ1A 2AFHE 1I4DD 2FKNA 2QY6A 4CDMA 2GM4A 4Y2TA 3PNLA 3MRSA 3QPUA 2NZYA 5PNTA 2P9JA 4MYSA 4L4RA 4PZAA 3RG8A 3RAPR 1I01A 1QYDA 2PD3A 3Q40A 4LEIA 1J5PA 4AP9A 1AKEA 1DAGA 5KC8A 1AOXA 3NUZA 5BMVB 2DLCX 3H75A 5BN3A 3QJGA 1TMKA 4E5SA 2Q5IA 4Q15A 2NVOA 1A9XA 3K71B 4X41A 2CNOA 4RO0A 1MT0A 1QFMA 2C57A 2ODWA 1OFIA 2VQSA 3GEEA 3L7OA 5LQNA 4O2RA 2Q4RA 3AV0B 2OFOA 2GNOA 4KNWA 4GPIB 1MDBA 2FOIA 5JI2E 5CH8A 1SG9A 3IERA 3UFXB 5CVJA 1ZHHA 1XEAA 1CJUC 1E60A 3K0FA 2ZRHA 4EF5A 1Y5LA 1PK8A 2NXNA 4Z9FA 4YRSA 3DV9A 3V4RA 3JD4A 2JLQA 2Q8NA 3P2YA 2Z2JA 2HQ1A 2GXSA 3IELA 4JLJA 4YI3A 5ALLA 3DE7X 3N59A 3O3NB 5GJBA 3ON5A 3VSBA 2ZAIA 1ZUHA 2FFHA 3AINA 1QFYA 2GVZC 2P2DA 1YGYA 3V7YA 1Q0LA 4FZRA 2AJDA 5I7FA 2CL6X 4V0RA 4Z49A 4D6XA 2XVYA 4ND3A 2BJVA 2H4WA 2JHPA 4I9HA 4RL6A 1X9IA 3U6BA 3C5EA 3NRCA 1CZRA 2GYWA 5ADVA 5A1TA 2WJIA 4AY3A 4JNCA 5EHZA 1XNJA 3NKLA 2CXHA 2MYUA 4HWPA 1CETA 2EQAA 1MG5A 2XQJA 3A4IA 3IOEA 4JP1A 4NS4A 3VR5D 4BLTA 4HWOA 5JS6A 3IEMA 3T95A 4J16A 3LUDA 5DTRA 4JXJA 1SC3A 2C94A 3QITA 2G70A 1QVZA 2Q4BA 3RS9A 1Z83A 4BVJA 3GPLA 3UWOA 2D54A 3DNPA 4KQMA 1UZUA 3A6DA 2JZCA 3H87A 2GWRA 1ZESA 3KPYA 2AKYA 1FTQA 1WUIS 3BQNB 3GCGA 4ZP1A 1UAYA 1C4XA 3TLKA 4DF3A 4R9VA 3D6HA 5DYTA 3OEEA 3ZJ4A 2GF0A 1V3TA 3LY7A 2NGRA 1U5AA 3OKFA 1GILA 1R0CA 4PG6A 1TZJA 4XUEA 1B76A 2A2ZA 3DYIA 2HDOA 3IB3A 2B3TA 4OXKA 1K4KA 2ECFA 3NCTA 2BFFB 3LNTA 4L08A 4ZALA 2UZ4A 1KY4A 2VJQA 1D2MA 1XZPA 3OKAA 1WCIA 3H5TA 5J4LA 4LQLA 4WOBA 1ZVJA 4Q39A 1XWWA 1WXXA 3CF6R 4O4IA 3SDZA 2A14A 3GLFA 3T7SA 4DL9A 1PT8A 3CUKA 4MQUA 4OBXA 1G8PA 3O91A 4RVNA 5AIAA 4ZPJA 3RNOA 4FLFA 4YRJA 5CBKA 1EUQA 2XXAB 5AVKA 2X7JA 4CM8B 4NMLA 3I1JA 3E7PA 3WL5A 1KZYC 5JXWA 1TOAA 5HFAA 4L8VA 3BIFA 3TPFA 1L5WA 4TKZA 4C4XA 3TTVA 2FEKA 2R8OA 4KUEA 1EDZA 5MHTA 5EQDA 3G9UA 4QDXA 4F2HA 5BUSA 2IEBA 2XUKA 1B7GO 1E1QD 4P5EA 1C9EA 5KU7A 1X86B 3L8ZA 1MAVA 3D1VA 4B3XA 4YAEA 2D1RA 5BVHB 1QHEA 4OI4A 521PA 1D6JA 3EODA 4JASB 4M2LA 1NW6A 3HU2A 4H18A 2DPXA 1H3EA 4LBYA 4AL4A 2YX1A 1P6UA 2HZBA 1L4NA 5CXQA 1LDYA 5B7NA 4ZT5A 4MRMB 4BWGA 2CUNA 3LDFA 4OFZA 3OLQA 3NASA 5LBUA 2ODQA 3X0DA 4QYMA 4CNQA 3Q2KA 4CMKA 3LDAA 1HYQA 5H59A 2VP9A 3O82A 4O29A 2JLAA 4YJFA 2PX0A 3UC5A 3D4PA 4FFMA 3A2MA 3JY6A 4FXOA 3KKQA 1M7HA 5F52A 3K0AA 4MQ5A 5CP8A 1M67A 2XNSA 2YINC 3LPLA 3ZV6A 1YVDA 1ZR2A 2VT6A 2VJDA 1YZGA 3GLSA 2OCYC 3EGDB 4D3SA 2CXRA 1T1RA 1DV2A 4B44A 3PQEA 1Q1GA 3AJ9A 2CCGA 4XM1A 4DR4B 4HQ0A 3U7QA 1II0A 1VE6A 3WL4A 4INZA 5LJLA 5ECYA 1ZJWA 1P9RA 2OR3A 2J6BA 3N8HA 3Q7PA 3PU6A 2BE7A 3BFJA 3DH0A 2OBNA 2H2IA 4YAJA 4I50F 1RPNA 2XSZD 3PUIA 4LJAA 3ILXA 4AY5A 2BTQB 4EABA 1IHUA 1E4VA 1OPXA 1ZRMA 3D8NA 4FP9A 4NX2A 5KAPA 3P97A 5IXYA 3UGJA 3C7CB 1WMEA 3LSYA 3TUIC 1XEWY 2FN8A 4AO7A 4GX2A 1M5TA 3WE7A 5FTJA 3WA6A 4D4HA 1IHXA 1KKMA 3MUOA 1MNQA 1SULA 1C14A 2P75A 3H2YA 2R0QC 2NW6A 1S2DA 1XQYA 2VH2A 4H1UA 4MWGA 4UVGA 5BSHA 1OLXB 2PKCA 1T2FA 3EVCA 2FZKA 4JMLA 2PIDA 1AXEA 1D04A 1EG7A 4HZGA 2FEWB 1TVEA 4RMHA 1AKYA 4BB5A 4C14A 4FB4A 1FJGB 3KE9A 1QC5A 2I71A 4N5NA 2VP4A 3M3DA 3BJMA 3FSGA 3Q7RA 4BO9A 5JJCA 1YZHA 1SPXA 4NZNA 2XCRB 4QT0A 1SEPA 1CEXA 3C7KA 4JP5A 3LCCA 3COVA 5DGIA 3CLSC 4LHSA 1GZSA 4EPRA 1NC3A 4F9EA 4OXQA 2P40A 3LBFA 3DPIA 4JBNA 1O54A 4CQMB 4UOQA 4HL6A 3R5SA 3A3NA 5IBQA 2XTNA 4C7OA 4E14A 3CFYA 2Q7OE 2XIQA 2JLXA 1E2JA 3T8YA 1L7VC 4PYLA 4HXEB 1E8NA 4G6ZA 4D9HA 2WSLA 4YCJA 3DS8A 3WTBA 4HVLA 5JWOA 1IPHA 1CTQA 2ZRIA 4UQOA 2PV0A 3DZJA 1V25A 3NNDA 5ALYA 1CJVC 2IF0A 2WABA 2RARA 3LG2A 4JUCA 1RACA 4G5GA 4J1NA 4X64B 4DXAA 1X9HA 1D09A 1VLJA 3HJRA 2VDUE 4U2CA 3VNQA 5J40A 2D2XA 3PUYA 1R64A 3IQXA 2X0DA 4JGBA 5A02A 5DFAA 4ZU6X 1IXRC 1TK3A 4KQ2A 3R7AA 3QYPA 5CDTA 1XVLA 4WFIA 4FMBB 2B6HA 4ARSA 4E6PA 2PWAA 3ETCA 4J4HA 2NU6B 3LS2A 2Y93A 5AOAA 3PD0A 2HXYA 5EESA 3K5WA