3CXRA

Crystal structure of gluconate 5-dehydrogase from streptococcus suis type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
260
Chain Sequence
QFSLDQFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase with different specificities
publication title Structural insight into the catalytic mechanism of gluconate 5-dehydrogenase from Streptococcus suis: Crystal structures of the substrate-free and quaternary complex enzymes.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Oxidoreductase
total genus 101
structure length 260
sequence length 266
ec nomenclature ec 1.1.1.69: Gluconate 5-dehydrogenase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3cxrA00
4PLHA 1P33A 1GU7A 3DTTA 3LK7A 2ZCVA 5COAA 3T7CA 5JMWA 2GO1A 2YHUA 3GEDA 3GZ4A 5AVOA 1W73A 4Z0PA 1PJ2A 1F17A 4IDAA 3FNHA 3GA0A 2FR1A 1OFGA 4B7UA 1PWZA 1UXGA 4FDAA 3RCBA 3GMDA 1XKQA 2V6FA 5ER9A 3C1AA 4NIMA 5DP1A 4XDZA 1HSOA 1VI2A 1E92A 4E2XA 1E6UA 4D7AA 2DBZA 3H5AA 2CDCA 1CDOA 3WIDA 2VZ9A 4GLLA 1H9BA 3HQ4O 1HDCA 1AHHA 3K96A 2Z1NA 4I9NA 1DLJA 3HFSA 3IUPA 2GR9A 2VRCA 4YTEA 2Q50A 1ZK3A 4EDFA 3CIFA 5C7IO 3TNLA 3JTMA 3GVCA 1WMAA 1EVIA 1LSUA 1FDUA 2Q45A 5CP8A 1WDKA 5B12A 4LN1A 1NHWA 4HXYA 1NVMB 3SC6A 5KVVA 3EVNA 4E6PA 1K2WA 1ULUA 2W2LD 2ZTMA 3ENNA 1P3DA 1UDCA 3P7MA 1PTJA 3PRJA 1MUUA 2DFDA 4A03A 2XPCA 2AQHA 2NQ8A 2YV3A 2BI7A 4FC6A 4JNKA 2AHRA 1SB8A 1V3UA 2JHGA 3RWBA 4AG3A 3OH8A 4GX5A 2C5AA 3ASUA 4IZIA 3UW3A 4RO0A 4S3MA 4XCVA 3U49A 1JN0A 4E0BA 2AE2A 3VTFA 3W6ZA 4AICA 3TOZA 3A14A 4IMRA 4BNLA 3MJSA 1FXSA 1GZ4A 1ZUD1 3KRTA 1BRMA 3WQSB 3ZWMA 1EDZA 2P5UA 2RHCA 3FTPA 1U5AA 3TL2A 1UH5A 2HMTA 5TRTA 3NEPX 4M55A 1LDYA 1FF9A 1X0VA 4ID9A 5JO0A 4IY1A 2EW8A 5F1PA 4JIGA 2IXBA 1RWBA 3U4IA 1A71A 5L7YA 5IF3A 1VSUA 1IZ9A 2FPPA 2TMGA 4IJUA 3D4PA 4WKGA 4J91A 4YWJA 4Z0TA 4R41A 3ZGYA 2Y66A 2JFHA 1P74A 3DBHA 3H9QA 3ZWXA 4YYZA 2GZ3A 3AOEC 2WMDA 1HDXA 2GSDA 3B20A 4FSHA 4OSOA 2PKRA 2FZWA 4TKLA 4TVOA 4YXFA 3ZNNA 3QLJA 1C1XA 2NU9A 4DL9A 1PS9A 5I9NA 1V6AA 4MIOA 4PVCA 3P19A 3H3JA 3ZNQA 7MDHA 4C7JA 3L77A 1QSGA 3CINA 3ZWCA 1GYRA 1ENPA 3DMTC 3FI9A 4E2WA 2DBRA 4UUMA 5LDHA 3TZKA 4G81A 3ZH2A 2GN8A 3QVSA 1MXFA 3VZQA 2X4GA 3JQ9A 3WMWA 3C3XA 3ZW8A 4EJMA 3DTYA 3UCFA 4ZN6A 2HK7A 2H63A 3UN1A 1HETA 4BNHA 1FDSA 1I5RA 3DAPA 3L07A 3DFZA 3U4DA 1KY4A 1I2BA 4J90A 5CDGA 1RM0A 1EFKA 5G4LA 4FN4A 2GN4A 4IGFA 5GMOA 2FOIA 4IJVA 4KMSA 2B69A 2X0JA 1NTOA 3L9WA 2BD0A 4L73A 1T1RA 1SC6A 4BMVA 3DBRB 2JD2A 1FJHA 4NR0A 3VVBA 4BGIA 2Q2QA 1V0JA 3AK4A 3PQEA 3OJFA 1EE2A 4P22A 5CG1A 2VWHA 1YRLA 2Y1EA 3F4LA 1QYCA 3INGA 3TJRA 1DDOA 1PJTA 2DUUA 3I23A 1PJ3A 2A4KA 3M6IA 1A4IA 3KO8A 3MZ0A 4J3FA 4XR4A 4PN3A 1U7HA 3G1TA 2NTNA 4MIEA 3QP9A 4IINA 4OXYA 4BNMA 3JQFC 4J7UA 4RVSA 4L76A 3BTOA 3CH6A 2PKQO 5T6BA 2WD7B 5EQDA 3VHRA 3B1KA 3MEQA 4P4NA 4M8SA 4CMKA 3BMNB 2RCYA 2X9VA 1B7GO 3ROQA 4BS9A 4NJOA 4EUFA 1OAAA 1PIWA 1DIAA 1LRKA 1ZXBA 4XIJA 2BHLA 2JFGA 3ZNPA 1E6EA 3PJEA 4G2NA 1GR0A 2I76A 4QEDA 3WGIA 1HDGO 1LLUA 4YDRA 2HU2A 3UFXA 3QW2A 4GX1A 4IJWA 4E5KA 4PLTA 2CF6A 2WEKA 3AOEA 3JQDA 4MKZA 1GAEO 5B1YA 4ESOA 4A10A 1LQUA 2HKIA 1XWFA 4PRLA 2WJPA 1O9BA 4DRYA 1DIBA 1Q0QA 1YQXA 1KIFA 4BNUA 3O4RA 3LT1A 1FMCA 1G0NA 4QFCA 3ADOA 4MVJI 3AI3A 4RVGA 1YL7A 2AEJA 1O6ZA 1RKXA 1YVEI 2CVOA 4RPLA 2DKNA 1ISJA 1RYDA 4C7KA 3KUXA 4E3ZA 3VKVA 1GFSA 1V9LA 1QKIA 3MJTA 1PQUA 5DCUA 1YH3A 4WLNA 2HLPA 3BMCB 4IIUA 4Y6SA 2DM6A 4MKRA 2C20A 1T4DA 4CM3A 4I9UA 5KWEA 1R15A 1U2DA 3PZBA 3WYEA 5HRUA 3ZI0A 2V6BA 4MJLA 3IKTA 1FDTA 1XCBA 3PEFA 2QX7A 1VJ0A 2EKLA 1LSOA 1ZK0A 5BSEA 3TDKA 1E3JA 2CSUA 5A5FA 4CM4A 2FPGA 3PPIA 1Y1PA 3OIGA 1YBAA 4WCFC 3PDJA 3ADPA 4O6VA 1EUZA 4BNYA 5KJCA 3P2OA 4K28A 5IDWA 2YDYA 4WLFA 1NPTO 5KKCA 4RDHA 1A9YA 1HDZA 2HCTA 4M86A 1ZZEA 3DBRA 1C1DB 1U4OA 5F3RA 3H5RA 4QQRA 3P2YA 2PR2A 1DAOA 4RF4A 4E4YA 2HO5A 3K73O 4NQZA 2PWZA 5KJ6A 4NNJA 2BMAA 5B4TA 1BXKA 2VYND 3JQFA 4BIIA 3KB6A 4JX8A 1U3VA 1R12A 3G79A 3JQAD 4AJ1A 4HV4A 4B4VA 1IUKA 1WW8A 1UZNA 4J2OA 5T67A 3ROPA 3ANMA 4FFPA 4XRRA 2ZYDA 1K0UA 5KJ1A 5CDSA 3UHAA 2PK3A 1YOVB 1PQWA 4QO8A 1WVGA 4LGVA 1J5PA 5G4KB 4CV1A 4E2YA 4RGBA 1HE5A 3UF0A 1E7SA 1AE1A 5KTKA 2X86A 5KNLA 5TF4A 1ONPA 3VOSA 3IIEA 2VHWA 4OYRA 2H5LA 3I3OA 4U7WA 3RIHA 3VZRA 4IQGA 1H6AA 1A7AA 2UAGA 4WLOA 5CEEA 3NJ8A 2Y1OA 2EGHA 3JQ6A 4WK6A 4EITA 1XYGA 1TB4A 1HTBA 2Y99A 1DJQA 1LC0A 3KEQA 1T25A 3WTBA 4J0FA 4MVJP 1K89A 2I3AA 4NK5A 3NTOA 2B36A 2NWQA 4PG7A 1K6XA 3LDHA 2G5CA 1MB4A 3E9NA 3OIDA 4NMHA 5TIIA 1T26A 1E1KA 3JQEA 2GYYA 3NDIA 4RVUA 1SEVA 1M75A 4JBGA 1LLQA 1UAGA 3PHGA 1DEHA 1NFFA 3A4VA 4U0JA 5L9AA 3E6AA 4JQCA 3U62A 4WPGA 4L75A 4W82A 2O3JA 1I2ZA 2BGLA 4EJ0A 1DRWA 2V6GA 3JCZA 3PP8A 1XG5A 3BMCA 4MVJG 4ZQHA 5JDIC 2QZZA 4FJ2A 2G76A 1I3NA 3BAZA 4FQ8A 4KTTE 4CJXA 1P45A 1Y7TA 1DFIA 4G65A 1I3LA 2WDZA 3W4KA 3WJ7A 3V2GA 3TZ6A 4YQZA 2AG5A 5A1TA 4E33A 1B14A 3EZLA 3CZMA 1Q0LA 5KIAA 4GX0A 4J4BA 3UICA 1CRWG 3ETGA 2BFMA 2VQ3A 8ADHA 5JY1A 2X0IA 2IYOA 4GL4A 1ADGA 2C7GA 3ZU5A 3S55A 1LEHA 3RJ9A 3RFVA 4NU5A 3C85A 4FC7A 2BFOA 5A05A 2VUSA 3LSYA 1WZIA 1QYXA 4Q3DA 1O5IA 1ARZA 3G49A 4WEOA 3V8BA 3M2TA 4RLHA 4KDEA 4RVDA 1ZSYA 2J6IA 2ZTVA 4NBRA 4CM5A 3QRWA 1ZCJA 2AEFA 3GR6A 4KTVE 1XGKA 2X7HA 5AOVA 4YRAA 2J3IA 5T57A 2PA3A 5THKA 2TMDA 4F3YA 1T2EA 2IEDA 4XX0A 4W99A 1PEDA 1YOVA 3BMQB 3DHNA 1HYHA 4Q9NA 4HFNA 2QRJA 4YCAA 5G0SA 5H81A 5JAZA 3JQCA 4I5GA 2DBQA 2O4UX 3OA2A 4UEKA 1U8FO 1G6KA 2IEBA 3ZWBA 3E82A 3MJVA 1H5QA 4AJPA 2ZQYA 1N2SA 5CEFA 2RH4A 2C5EA 4UVHA 1DLIA 2GLXA 3VDQA 3QVTA 5K6AC 4LW8A 1IZ0A 4MIYA 4U5QA 5DBGA 4BGUA 3MWDB 2B35A 5I7EA 5DP2A 2NU6A 4OSPA 1Z45A 2YYYA 2WYUA 2GASA 1Q0HA 2DT5A 2X58A 3EDMA 2OO5A 1XSEA 4RDIA 1RM5A 5JY6A 2WSBA 4B4WA 1ZW1A 1EEHA 3OM9A 1B15A 2W98A 3W4JA 4YQYA 4MVJH 1J6UA 1Q1NA 1GDHA 2GDZA 3ZU2A 1HKUA 2G17A 3NYWA 5JDIA 3R0IA 3OA0A 3RU7A 1XDWA 4R3NA 3SBOA 4ITUA 3KM0A 1P1HA 1DFHA 1LDGA 3K8ZA 3RBXA 4RZHA 3DR3A 5H82A 2DTXA 3B1FA 3JQ8B 1JVSA 3PLNA 5CPFA 2EIHA 4TRRA 5EL0A 1E5LA 4UUPA 5B4UA 2NVUB 1E7WA 4QXMA 4LK3A 1ZJZA 4QT0A 3RKRA 4CODB 2WWRA 1XEAA 4E12A 4P4GA 2P2SA 4R5MA 5H83A 2PGDA 3D4OA 1FK8A 1BVUA 1NASA 1TT5A 4FGSA 2AQ8A 5I8WA 1Y8RB 3DEYX 1ZXLA 3RUHA 1YJ8A 1ISGA 2FP4A 4OJNA 2H6EA 1VC2A 3CEAA 5T5QA 4WCDA 4DIOA 4CV3A 2DBVO 2NLOA 1UP7A 3AI1A 5MDHA 2HK8A 4BKOA 1XIVA 1HZZA 1I24A 5CFZA 1U1IA 1ENOA 2LDXA 2HMSA 4N18A 3CTMA 3N7UA 1DO8A 1CJCA 5CEJA 3T7EA 4OGWA 1U7TA 2B83A 4IDEA 5L3ZA 3GY0A 3QWIA 2YUTA 3Q1LA 3IL2A 5DOZA 2P68A 1EQUA 3DWFA 2O3RA 3JQBA 2DAPA 3WGTA 1DOHA 1WMBA 4R16A 3SJ7A 2VHZA 2V65A 3Q2IA 5DBIA 4KUHA 4ND2A 1MG5A 3GVIA 2JD0A 3R6DA 3PHLA 2W4QA 3FCOA 4YT2A 4R1TA 2EHDA 4Y6PA 1ZEMA 3K31A 2NU7A 4E13A 2AQKA 3RUCA 5L7TA 1DC5A 4NFYA 4R1SA 4GH5A 3I9JA 4JK3A 4OOFA 1HXHA 1JAYA 1EMDA 3VVCA 1UXIA 3E5MA 3HN2A 1P1RA 4FPXA 1Y8QA 1LQTA 4LMRA 3EHEA 4AJJA 1SAYA 4Y9DA 1A9ZA 2NTVA 3PWZA 1QR6A 4J4TA 4WEQA 3KYDA 3UAGA 3VPGA 5ICSA 2GGSA 2ZJ0A 5J23A 3PJFA 1YB5A 2PNFA 4CMEC 2EGGA 3M2PA 1WDLA 2EEZA 4R01A 4EJ6A 4D0SA 3GGOA 4XKJA 4XEHA 4B8WA 5BNIA 1H93A 2DU8A 4UVEA 1Y9EA 2X0RA 2P9CA 4YAIA 3QY9A 5HTOA 4IZHA 3I52A 3GEGA 4J7XA 4CQMA 3PWSA 4BNIA 2GUGA 5I8ZA 4J1SA 4BGEA 3D4NA 1BGVA 4ILKA 3FWNA 1LSSA 2NVUA 5JDCC 2VRCD 1DJNA 1LTHR 3E03A 5JE8A 5BNFA 3UCXA 3HUDA 1EK5A 4BNKA 1OMOA 2FWMX 4ND5A 4YRDA 5IFLA 1XELA 2A92A 5CDUA 1Q7CA 1V3TA 2B5WA 1R0LA 2PD4A 1LRJA 1Q2XA 3LT4A 3NT2A 3P5SA 4I5DA 4LISA 5L53A 3AI2A 1HZJA 3B1JA 4BNJA 1LLDA 2I66A 2IXAA 3VH1A 3DZIA 4FR5A 1IL0A 1YDEA 3DHEA 2Y1FA 4YJHB 1VL6A 1SPXA 1NAHA 2C2XA 3K92A 3NKLA 4B7XA 3OQ1A 5JPIA 1NFRA 3BTVA 1NQ5A 1RYEA 3IMFA 4RLSA 3HB5X 5BT9A 4A2CA 2Y05A 4N5NA 2Q49A 1I8TA 2CD9A 1QMGA 1ZJYA 3F47A 1CETA 4TQGA 1W6UA 1AHIA 3I83A 4NJMB 3ZV5A 5DULA 3KXDA 4A73A 4DBVO 4F6CA 2D3TA 4GKVA 3WYCA 4YAKA 3MJEA 3TZHA 3GQVA 1ISIA 3PJGA 1B0AA 4IXTA 4NK4A 2VOJA 3E9MA 5JW6A 1OC2A 5KJEA 4FFRA 2Q3EA 4CM8B 4YEDA 5A06A 3HDJA 2ZTLA 2E37A 2YFHA 1JWBB 5GZ1A 4XJSA 2O7SA 3QSGA 1Y5MA 3ICCA 3NGXA 4ZGWA 1M76A 1T24A 4U6QA 3V2UA 4Q3CA 4WLEA 1NP3A 1ISMA 3WLFA 1CQIA 4OIMA 5I7VA 4DIBA 3S2FA 2X22A 4DYDA 3CUKA 4EGFA 1H6CA 4BB6A 2X9NA 1LBEA 4CR6A 2XAAA 1DIRA 2R2GA 3AUSA 3BHIA 3FPCA 3ZWWA 2P4HX 5LCXA 1ENZA 4CMEA 1GTMA 4L4RA 2HUNA 3TFOA 2D8AA 1EVYA 5T8KC 3O8QA 5K0ZA 1LC3A 5I9LA 4MDHA 1GV1A 4NBTA 4ALLA 3H7AA 3NGLA 2W8ZA 2G1UA 3DHYA 1CYDA 3E18A 3IKVA 1XA0A 1NQTA 5IZCA 4DPLA 4L4XA 1X15A 4O5OA 3SXPA 4PLYA 1ZSVA 3QVOA 4R5HA 4DQXA 2EJVA 3VTZA 2X6TA 2EJWA 3V1UA 5FI3A 4KWHA 2XOXA 3JYOA 3MOGA 1G0OA 1P1IA 1JAXA 1JKFA 3EGOA 2B4RO 3QWHA 3NDRA 4GGOA 1ZFNA 5BSGA 1O8CA 3EK2A 1M2WA 1QV6A 4Z3DA 4H15A 3KVOA 4Z3KA 2BF7A 3PXXA 1B8VA 2ZIZA 2QRKA 2WE8A 3EMKA 4WNIA 4DYVA 1KYQA 5L4NA 1SBYA 1BXZA 3F5QA 3QIVA 4XRGA 4INAA 1KERA 4DTIA 3O26A 1PJQA 4YJHA 1JQBA 3GRPA 1GPJA 2FR0A 4DBZA 4BHTA 1S7CA 4LRTB 5COQA 5F1KA 4MVJA 1D4FA 4OQZA 5JO9A 2GPTA 4MVJE 2E4AA 4IM7A 2XF8A 2O2YA 2EKQA 4U8GA 2A35A 2WD8A 3I6QA 3ZWYA 4BNGA 1NYTA 1AN9A 4PLVA 5EIOA 5JMPA 3VPSA 1HEUA 4R54A 2J3HA 3Q2KA 4NJMA 3H2ZA 2C59A 4RF2A 3IJPA 4H16A 3NT5A 4KWIA 1C0PA 3D7LA 4M89A 4YAGA 4ZD6A 3EVTA 5JC1A 2I65A 4YJDA 1U4SA 3BYZA 3BA1A 3ZHBA 4EW6A 2DUWA 2IZ0A 4O1MA 4CM8A 3E1KA 2RBEA 5B37A 3X2EA 1H94A 3C1TA 3WSVA 5LC1A 4WE3A 3KYCA 4GPD1 4XYLA 3PGXA 4N5LA 1WDMA 2Q2VA 1W0CA 4LSMA 2NVWA 1KVRA 4CM4B 3JQ7A 1E7QA 4DC1A 4I5FA 4Y8VA 1U5CA 4DXHA 3AY3A 5IJZA 4URFA 3ST7A 1TI7A 2OP1A 1B26A 1Y81A 3DO5A 3Q3CA 3EAGA 3MJ4A 3GPDG 3JYLA 4E5NA 4N7RA 4DQVA 2W2LA 1RPNA 2GCGA 2Y68A 2ZB4A 4BMSA 1YGYA 1U8XX 3GGGA 5IDYA 3NDJA 5FFFA 4B3HA 3KZVA 1V35A 5KVSA 4CM6A 1QV7A 4BNVA 1WLYA 2RIRA 3K5PA 5HS6A 4DPKA 1DB3A 3GMSA 3VH3A 4FB5A 4NDNE 2Q1TA 4TMFA 3RUAA 1HLDA 1YWGO 3PZRA 5TJHA 1E0DA 2POQX 4ZICA 5L95A 4KUGA 3D5QA 4DLBA 2A9FA 2JL1A 5I9MA 4RVHA 2GZ1A 5AXDA 4GLOA 2QIOA 1AXGA 1SB9A 1VSVA 1Z75A 1DAPA 4Z9YA 1PJ4A 4UULA 1YS4A 3AJRA 1KS9A 2CDBA 3SLGA 2O3QA 2PV7A 3ZV6A 1F14A 3E9QA 5CDYA 3L6EA 3DOJA 3TZQA 4C4OA 3LT0A 5IDXA 4R1NA 1AXEA 1X14A 4UUOA 3PGJA 2C2YA 2NQTA 4M49A 2AQIA 3JD3A 1MGOA 3GT0A 1I33A 4OAQA 3OETA 1X1EA 3JV7A 1A4UA 3FD8A 3FNEA 5DZSA 5JCJD 1M67A 1HE3A 1EVJA 2GN6A 2Q2WA 5F5LA 4MP6A 4CM9A 1QP8A 1NXQA 1Z7EA 3D3EA 4GSLA 5C7LO 5L7WA 4BVAA 3S1LA 4CL3A 1T1SA 3DMTA 3I6IA 1DXYA 1ADCA 4WNCA 3WGZA 3ZN2A 2CZCA 3GNQA 1GYPA 2P9EA 2Q99A 2IYPA 5CPBA 3BZUA 4XGNA 4ZRNA 3GLQA 3M1AA 1ZBQA 3AFMA 4Y98A 2VHXA 2CY0A 3H65A 5U1PA 2Z95A 5JLAA 4WCFB 3HHPA 3C24A 4GWKA 3FNFA 2R00C 1YL6A 5EMHA 4E5PA 3QJ5A 4NBUA 4J43A 1GADO 4NHEA 3UOGA 2P5YA 5JCXA 2EXXA 2OOSA 3ORFA 4Z9FA 3OJEA 1LUAA 3IP1A 3WNVA 3WXBA 4CUKA 3QQPA 1DBVO 4FJ0A 3JSAA 4UEOA 4ZQEA 2AMFA 3EZYA 1LXCA 3V1YA 4ALMA 4CMJA 2JCYA 3VAZA 3LC1O 2OBNA 4WOKA 3LLVA 4NI5A 1PJBA 2C82A 2X5OA 2NU8A 4CMHA 2Q1WA 2WTBA 1SNYA 1EBFA 8LDHA 2ZB8A 3E48A 4CM1A 2PZKA 3OIFA 4CLOB 2Y0DA 4W9NC 5L40A 3DBLA 3BHMA 2I9PA 4I08A 3DZBA 4EYEA 4Y6RA 4ZQFA 3RUEA 3CKYA 4E5MA 1ZO8A 3FWZA 9LDBA 1ZK2A 3QHAA 4FFLA 2VNAA 2HAEA 1T2CA 1IPEA 3DOOA 5EN4A 4X54A 2NUAA 4LCJA 4B4OA 3IUSA 5HS4A 3WMXA 1NR7A 1Z82A 5FI5A 1DSSG 2X0NA 2Z1MA 4JBIA 4BNTA 4IIVA 4D41A 5IXYA 4LCEA 4A26A 5FEUA 1LLCA 5EESA 2JAHA 4GBJA 3RU9A 3UCEA 1YKFA 4E21A 1EFLA 3N74A 2ZYAA 5ITVA 4PFJA 4AL4A 3EW7A 4FFOA 1HRDA 1Y5RA 1J0XO 3DOCA 3FF4A 2FSSA 3KSZO 3CMMA 4ND3A 4PZCA 3RAJA 4BKUA 4RPJA 1EZ4A 4YJFB 4HFMA 2NNLD 5TSDA 2I99A 1QRRA 4KP7A 3TL3A 1PR3A 3ASVA 4AJHA 1F8FA 2YY7A 2D1YA 4PLPA 5AYVA 3KETA 3JYQA 1VPDA 2CMDA 3WYBA 1NNUA 4F6LA 4WOJA 3ANNA 1LDMA 3OFSA 2DPGA 4JP2A 4DQUA 1UUFA 2OBYA 4KQXA 3ITDA 1UXKA 2Y93A 2VN8A 4TRNA 4AJ4A 2C7VA 1SMKA 1Y6JA 1YL5A 3DZFA 2EW2A 5TC4A 4XQ9A 1NR1A 1U3WA 4W7HA 3S2EA 3DDNA 3GG2A 2EF1A 1R4NA 2RH8A 4HWKA 3K2BA 1WZEA 3LC7O 2UYYA 4Q3BA 3W8EA 2QYSA 4J4HA 3R1IA 3HDQA 4WCFA 1ZH8A 3Q6IA 5K9ZA 1I01A 1Z73A 1F12A 4K6CA 2GZ2A 2HRZA 3HJAA 1E7MA 4CMGA 2VOEA 1M6HA 4BQPA 4LSWA 4RQTA 5G0VA 1OI7A 1IB6A 1TT5B 2I67A 3OEYA 4I9HA 4TSKA 1B16A 1E1LA 3ONEA 3WJAA 5CDTA 2O3TA 2X9GA 3GHHA 4MVJM 2SCUA 4Q3EA 4ZVVA 2EERA 4HP8A 4IDBA 4HNGA 9LDTA 3PFWO 4D42A 3HB4X 3UXYA 3DC2A 4EZBA 4CQLA 2Y1GA 5GY7A 3JQAA 4BO5A 4CLOA 4TRJA 3VH4A 1PGQA 3JYPA 3DFUA 4YR9A 2PZJA 1HYGA 3KOUA 4YBZA 1LX6A 4XB1A 1DFGA 3ZNOA 3GHYA 4J2HA 2ZKLA 2AEMA 3C1OA 2I3GA 1IYZA 3WGGA 3RC2A 3MWEB 3SVTA 2OHXA 4JCOA 4LMPA 1P0FA 3PYLA 4I5EA 4WLVA 4J1TA 2YW9A 3EUWA 1FDVA 3PLRA 4BNZA 1MC4A 4PCVA 2ZYGA 5L4SA 1OBFO 1UJMA 1CEQA 2IODA 1HDOA 2X1HA 1LDEA 2WM3A 2BKAA 1GZ6A 1XQ1A 3C7CB 1A72A 1GD1O 4IQ0A 2FPIA 3RD5A 1KC3A 3GOHA 4YT4A 4O59O 4PG4A 4E32A 2ZATA 5GZ3A 3LC2O 2D4AA 1I10A 4QUKA 4WUVA 1LA2A 4IDFA 2YV2A 4YJFA 3G0OA 1PL6A 1Q7BA 1Y8QB 1K6JA 3NJ4A 3L0DA 2QG4A 1PL7A 4ZRMA 1JDJA 2BLLA 4E2ZA 3GH3A 5A3VA 3L9XA 1IULA 2C0CA 2FHSA 2O7QA 2OP0A 1OZAA 4RV9A 3KYDB 5KVQA 2V6MA 4ZHSA 1Q7GA 2FN7A 3GG9A 3ZHZA 2J8ZA 3PI7A 4HNHA 3ICPA 1TT7A 1KETA 5JYDA 4D43A 3OJ0A 3DAGA 3QE3A 5ADHA 4XQEA 1HSZA 1PJSA 4IPTA 4Y67A 3RUIA 5HWSA 2UUPA 3KLMX 1KOLA 3WICA 4IUYA 5C3MA 4CQMB 5JYEA 3DB2A 3LVFO 1X1TA 3G3EA 2W2KB 2JFFA 3GRKA 2G82A 2PFGA 3D3WA 3UUWA 2JCVA 1I3MA 2PKQP 4B79A 4Z6KA 3H3FA 2YDXA 1T2DA 4S1VA 2QW8A 5GZ6A 4EBFA 3FBGA 1H6DA 1PJCA 3Q11A 4TZKA 4XGIA 3H2SA 3W8DA 5U9CA 5JBIA 1F8GA 4UVIA 1A27A 1EVZA 4XB2A 5EINA 2QQ5A 1PR9A 5DF1A 1MA0A 3ITKA 2IDZA 4RL6A 4OKIA 4O63O 1ONNA 4CQMD 2E48A 3HDHA 2CNBA 1GQYA 3GDFA 5CAEA 4XD2A 1EUCA 1ZSNA 3U3XA 4XZ3A 4JJGA 1VRWA 1KEVA 2JJYA 1KEWA 2E82A 1LDNA 4D3DA 2Q1SA 1LJ8A 2IRWA 3L4SO 2GRAA 1GQQA 1DC6A 1X7DA 2PLAA 5CG2A 3G17A 4PZEA 3ZU3A 4CUZA 2O50A 3TF5A 1ISHA 5ER6A 2ZQZA 4YA6A 2PGLA 4GQAA 5ITWA 3INRA 2HRBA 4TROA 4XYBA 4CPDA 3C7AA 1RM3A 2FSVA 3A28A 3GUYA 4EI2A 2UDPA 4FFMA 2BGMA 2HDHA 4OOEA 5K6AA 4IDDA 3ZHXA 2O3SA 3GC6A 3HNPA 4B4UA 3GAZA 1KEPA 3VZSA 2VYVD 3QV1A 3O03A 4ZQBA 3MTGA 4BNWA 5A5EA 4ND1A 4NBWA 2PGJA 3NAQA 4AJOA 1B8UA 1XU9A 3VPXA 3KYBA 1ADFA 3WBBA 1MXHA 1XLTA 3VPFA 4BO7A 2CUKA 1LDBA 4B7CA 4IXWA 2OUIA 1E3LA 1E6WA 4OXNA 1CWUA 1LU9A 1NM5A 4OKNA 4U0KA 2DQ4A 3RSHA 4E31A 5TT1A 3O8QB 3AY7A 1DC4A 4L74A 2QHXA 4R3WA 5TNXA 5JAMA 5L4LA 1ML3A 3LZ6A 4DIFA 3AWDA 4YVFA 4F45A 3H5NA 1PGNA 4WASA 3UVEA 1NWHA 2PD3A 4OXKA 4CR8A 3ZWVA 4XYEA 3GVHA 3R3SA 2ZB3A 1B8PA 3B70A 1GCOA 3FSRA 3HWRA 5TLSA 3PDUA 4JGBA 4CMIA 4UREA 3LU1A 4W4TA 1JKIA 3NV9A 2W2KA 2FZEA 4AJKA 3U09A 2CVZA 2E6UX 1H6BA 1RJWA 3UH1A 5KJFA 1D8AA 1ONOA 1PL8A 1UP6A 2J5QA 3AOGA 2EP5A 5IZ4A 1ORRA 3HFGA 5TGDA 1PQPA 1LI4A 1ZK4A 4FIZA 5COBA 1P44A 4IS2A 2QRLA 5JS6A 3PJDA 1KVTA 3QVXA 1GL3A 5AQ1A 1ISFA 3PYXA 4WGGA 3RKUA 4DVJA 1DRVA 4OH1A 4D79A 1YONA 4CM7A 1P9LA 3EYWA 3WFJA 4M54A 4XYGA 3U4HA 1PS0A 1IHYA 1ZNQO 2B37A 2BFPA 3ETEA 4GWGA 4L0QA 4MP3A 5ILGA 3WLEA 1YXMA 4ALNA 3FNGA 2JCXA 1L7EA 3CPSA 3S8MA 4P38A 4HY3A 1JU9A 3ULKA 1EQ2A 1TLTA 4F46A 1C0IA 1R4MB 4ZQGA 4H3VA 4J1NA 1E3EA 1YBVA 1V3VA 4Z9XA 1SOVA 2B4QA 3BTSA 3OSUA 1H2HA 1E7RA 1JWAB 3W4IA 3OJOA 1DIHA 3BTUA 3GF4A 3GUCA 5KKAA 5DBFA 2ET6A 2BI8A 4FFNA 3KSUA 3GDGA 3KYCB 4CLRB 3GK3A 1LNQA 2QYTA 4MVJD 1HF3A 2BH9A 3NTQA 3FR8A 3OHSX 3JQ7B 4XQCA 2RHRA 1H9AA 3AY6A 3NRCA 3B6ZA 3V1TC 3GGPA 1JLLA 1UDBA 3G1UA 3PQDA 3Q0EA 4RZIA 4BB5A 2YHIA 3FHLA 2YJZA 4K26A 4D3SA 3OJLA 4YT8A 2HMUA 3LYLA 3PTZA 3STHA 1DPGA 2CDAA 2FY8A 1EUDA 2BGKA 2Z5LA 4IMPA 3E5RA 3S2GA 1XHLA 3ZZNA 2PH3A 3ZWPA 4DMLA 4AJEA 4IJKA 3HZZA 3JQ9C 2I6TA 1QLHA 3I9LA 2X5JO 4RPGA 3H9GA 1NVGA 3WG9A 4BL5A 3FTNA 2ILTA 4QSMA 3NTRA 5KOIA 5JFOA 3TWOA 3I9OA 3RC9A 5DDIP 5JDCA 1NFQA 2AXQA 3OEWA 4L4SA 5JXWA 5G0TA 1R0KA 1QXSA 1HT0A 2XXBA 3TQHA 1X13A 3H4VA 1HL3A 1NHGA 3UKOA 1PZFA 4BO9A 3T4XA 3TZCA 3M1LA 1I3KA 3OF2A 3DONA 4Q39A 1BWSA 1WP4A 2DTDA 1YB1A 3HE3A 4OM8A 3WWZA 4KUEA 5HM8A 3AFNA 3OICA 2WYVA 4BO8A 3GNTA 4OMUA 1BW9A 2VWGA 3OMLA 4FOOA 5ENDA 5A4DA 1OOEA 2UV8A 4RPKA 4TWRA 1DHRA 1D7OA 3VZPA 4A0SA 4J1QA 4PGFA 4IDGA 4QFDA 1T2FA 4LVUA 4CMCA 4AVYA 5LDGA 3K30A 3RASA 1ZEJA 2CVQA 1YB4A 3DXFA 4MP8A 1GYQA 4TRMA 2E49A 4NPCA 4CR7A 1PSDA 1ADBA 1CQJA 3ROKA 4Q3AA 1NX6A 4XQGA 2OZPA 2VHVA 2A94A 3BHJA 1ZMTA 4JJFA 4H7PA 4TKMA 1R4MA 2D2IA 2H1SA 5DT9A 4YT5A 4FD3A 3F46A 4BQRA 4K9DA 4IBOA 2NTJA 5A9RA 1E77A 4NG5A 3OP4A 2JD1A 2Q1UA 4GSKA 4DC0A 3COSA 2NV6A 3HG7A 1BG6A 1R0SA 4CLRA 5F5NA 4IDCA 1KEUA 2O23A 1MX3A 3RBZA 1WNTA 3ZU4A 4CM9D 4PIVA 1UZLA 3WGYA 3D0OA 3SX2A 4GGPA 4DLAA 1D3AA 5C5IA 3WDSA 1E3IA 3ANLA 3CZRA 4HFRA 3VKUA 4B3JA 1F0YA 1HE4A 4NH4A 5T8KA 5G0WA 2HMVA 1IHXA 3IQDB 4DWVA 3U9LA 5TX7A 4CUJA 2D5AA 1VJTA 3N58A 3E8XA 4HFJA 1H0KA 1V8BA 5ES3A 3RUDA 2ZJ1A 4DREA 3DBLB 3QWAA 4ALKA 1GZ3A 1BDBA 1GEEA 1GEGA 1R37A 2NADA 4MPDA 2Q4EA 1P1KA 5IN5A 3AM3A 4CLEA 3FPLA 3DL2A 3RFXA 3IDSA 5FYDA 2BFAA 3IS3A 3NUGA 1XU7A 1YJQA 1UDAA 3H6KA 3HSKA 3ZWNA 4BGVA 2C29D 4K6FA 3I5MA 2HQ1A 3WNQA 2NACA 4YAEA 1YBMA 3CE6A 4II2A 1FDWA 3X2FA 1BHSA 5TJ9A 4O0LA 3ZV3A 1E3SA 1SO8A 3F9IA 3RC1A 1MFZA 2C54A 3DZGA 1MLDA 1N1EA 4BV8A 4JP3A 2VRBA 4UAGA 3IOYA 1E3WB 1E5QA 2BRUA 2AE1A 1MC5A 3AUAA 3RFTA 3W8FA 3DZKA 4PLZA 4TVBA 4A5OA 3PIDA 1MFPA 4OO3A 1HDYA 4W6ZA 1O95A 4E5YA 3AUTA 3S2IA 2D0IA 2Q46A 3CMCO 3C8MA 4R69A 1A7KA 3F1LA 2ZTUA 3IP3A 3QA9A 2VWQA 3GN1A 1U2GA 4M87A 3KV3O 4PZDA 4WLUA 5IG2A 5TQVA 4RPHA 4R9SA 3OQBA 4UUNA 1KBZA 1Y9AA 3GAFA 4ZU3A 1WWKA 2D59A 1R4NB 4EUEA 3KLPX 4DUPA 4J49A 3IAHA 2VZ8A 2EG9A 3ZW9A 1I30A 2ZB7A 1N7HA 2UVDA 4ZJUA 4GMGA 2Y1CA 4PG8A 3RC7A 1N1GA 1VLLA 4DA9A 1P77A 4YRBA 1QG6A 2B5VA 2Y0CA 1UAYA 2GD1O 3AUUA 3JD4A 1J49A 3K9QO 2YFQA 4KOAA 3AW9A 3BMOB 3RVDA 4PG5A 5IDQA 2YQ4A 4Q3NA 3AU9A 3GEMA 3I4CA 4JXKA 4WJZA 3JD1A 3WBFA 2J5RA 4XIYA 4CQLB 3JD2A 1E1NA 3JQAB 4NU6A 1A5ZA 1GUFA 2LDBA 2AA3A 4II3A 1NPYA 4CMAA 4D45A 1DC3A 4MOWA 1JKJA 4PLCA 3ABIA 4ND4A 3KBOA 1DIGA 1R66A 3WWYA 4L8VA 2HK9A 1X7GA 4N54A 4EEZA 3JD0A 7ADHA 5JC8A 1M6WA 3FN4A 3JQGB 3FR7A 5G2OA 1ID1A 4XDYA 3WSWA 3U4CA 2VZ0A 1I32A 4JJIA 3TRIA 1JA9A 4XA8A 2C07A 1QORA 4BKRA 3VPHA 2HJSA 3KHUA 4JN6B 3PVZA 4BO3A 6ADHA 5TS3A 5THQA 4AJIA 3WGOA 1UXHA 4N5MA 1B3RA 3WX0A 1U9JA 3GFBA 4D44A 1VKNA 3HADA 4YACA 1N5DA 1PU2A 1YDWA 1KVQA 4AJLA 3DBVO 3T4EA 3I1JA 4OL9A 3FRJA 1TVEA 4QO7A 5EERA 3ONFA 5JCJA 3ZHYA 1NAIA 2P9GA 2PH5A 1VM6A 3D1LA 3LT2A 2WD7A 3KEOA 4A7PA 2PY6A 2PZLA 2D5CA 1Z6ZA 4DPMA 1BSVA 1E3WA 1CF2O 2Y67A 3ON5A 4CLXA 3PFFA 4KDFA 3BMNA 1O94A 4P4LA 3WGHA 2P4QA 1GUYA 3W1VA 3WTCA 1DHTA 1N9GB 1P1FA 5AXBA 4ALJA 4DGSA 2WE7A 2QZ9A 3AU8A 1BMDA 5C7OO 2YZ7A 2I5PO 5L51A 4BKQA 2R6JA 1JVBA 4BOYA 4BV9A 4BO1A 2YV1A 4GVLA 1L1FA 3PHIA 4ROSA 3DZHA 5JAIA 1VKOA 1MG0A 2X23A 3IC5A 1I2CA 2DFVA 4NFHA 1XQ6A 3HDYA 1KC1A 1U28A 2VWPA 2R00A 1UR5A 4R51A 3PHJA 1NQAO 1QYVA 2GN9A 2J5KA 2Q4BA 3D3WB 3SEFA 2JHFA 2X8LA 2NSDA 1UXJA 4J9UE 4I1IA 1KVUA 1O0SA 2XXJA 2HJRA 3I9NA 4PRKA 2ZK7A 1GUZA 3GVXA 1EBUA 5I7SA 1CERA 1PZGA 3I4FA 2CF5A 3K2EA 5AXCA 1NVTA 3UGKA 3NX4A 1NBOA 3TSCA 2VHYA 3H9EO 3BMOA 4AJ2A 3WFIA 1HYEA 4NBVA 3ZWAA 3F4BA 3Q9UA 4W9NA 3OBBA 1PWXA 4BO6A 2VYNA 1P31A 5JNLA 4JROA 3ENKA 3BXXA 4P8RA 5F21A 3SLKA 1IE3A 2IZ1A 3L6DA 5C37A 2FR8A 3ETDA 5AXAA 4I8XA 1R6DA 1C0KA 3GZNB 3MJCA 4XWYA 4U6SA 1GQ2A 1MV8A 2PD6A 3JQGA 3WIEA 1C0LA 1T4BA 1C14A 1SEPA 4RF3A 4BNNA 1EE9A 1K3TA 3TPCA 4AFNA 4A27A 4CV2A 4CV0A 2G0TA 2VNSA 4UEJA 4XGKA 1VL0A 3V5NA 1C1DA 4OHUA 4ZA2A 1LRLA 3WQRA 2YQ5A 5A3JA 4Z0HO 1SCUA 1U3UA 2EV9A 1X7HA 5KVCA 3WB9A 1WAMA 4FGWA 1X0XA 2OL4A 2DLDA 1VE9A 4KZPA 3VH2A 1G1AA 3GVPA 1AGNA 1GV0A 4J9VA 3I9MA 4MVJF 3RQSA 4BMNA 5U4QA 3INTA 4G5HA 1GCUA 5A9SB 5JAQA 2NM0A 3W6UA 5I7FA 5ICMA 4AJNA 1W4ZA 4E30A 3WOHA 3IJRA 4UVGA 1WXDA 4HUJA 4J16A 3EC7A 3RROA 2O2SA 3GNSA 3R3JA 5G4KA 3ZDFA 1DRUA 1P1JA 3LF2A 2VUTA 4ONEA 4YJGB 4ALIA 1BXGB 5FF9A 3JQBC 1N9GA 3F6YA 1GY8A 3WS7A 4FCCA 1I0ZA 3SJUA 2DTEA 4D0RA 3A9WA 2ZCUA 1KY5A 4EUHA 2VTDA 5A04A 2EWMA 3EY4A 4NFSA 3ZCXA 2JAPA 1PGJA 1IY8A 4CMIB 4D3FA 1C3VA 1U3TA 4BUCA 4YPOA 4PLFA 5L45A 3TOXA 4BO4A 3PQFA 2GERA 2PTGA 2CFCA 3LLSA 4WECA 1ULSA 4GI2A 1ZKMA 2HSDA 3LF1A 1D1SA 2JKVA 5DNAA 4R1UA 4BO2A 4JLWA 3HN7A 4R68A 4R4JA 1YQGA 5MGBA 2VUUA 5IXSA 2OMEA 1W8DA 1Z7BA 1M66A 3L6OO 1UP4A 2OORA 2GF2A 5T64A 1BVRA 5HA5A 1YO6A 4GVXA 2J3KA 4LRSB 3RJ5A 1NQOA 4RJTA 3I9KA 5F1OA 3F1KA 2FMUA 2UUOA 5EPOA 1E7YA 2FRDA 4DLLA 1YQDA 1RM4A 4MKXA 2B4TO 3Q9NA 4BO0A 4RQUA 1B2LA 3AM4A 3GZNA 5BNTA 3A1NA 1N92A 1PZEA 1K5HA 1ZIDA 5HBRA 4QTZA 3U0BA 3L4BC 3O38A 4FOSA 1K6IA 3QWFA 4RCVA 4CMBA 4MO2A 1T2AA 3AM5A 1WPQA 1PGOA 1PZHA 2VCYA 1E1MA 5BQFA 4FW8A 1TA4A 1J4AA 4PVDA 1N8KA 3OQ6A 3PYMA 4UVDA 2X5KO 4HBGA 5DCWA 2Y1DA 3MCVA 2GNAA 5BSFA 1HWYA 1UZMA 2P91A 2VTEA 1PX0A 4FS3A 5A9SA 3GN2A 4B8ZA 3H8VA 2NVBA 4FJ1A 4GMFA 3FBTA 4EEXA 3U5TA 1BDMA 1PS8A 4L9RA 2YHIB 2BELA 3PHHA 3DQPA 2WYWA 1VJ1A 4HX5A 4LVCA 5A02A 5BSHA 3BMQA 1Z74A 1SZJG 1EDOA 2OFPA 2W90A 4GKBA 1GPDG 2O48X 1ZMOA 5ILOA 4RVFA 1VL8A 3LQFA 4YJGA 4FBGA 4IQ8A 3WR5A 4BNXA 1BXGA 4PLGA 3WGQA 3ZV4A 1BTOA 3MOIA 3GFGA 1NWCA 1NPDA 2EP7A 3RI3A 4GX2A 1JTVA 3O9ZA 4XR9A 1H2BA 2OGUA 2EKPA 3VC7A 1JW9B 1L7DA 5DCYA 5EQFA 4JBHA 4CLHA 4XJTA 3K6JA 1IOLA 4J7CA 4IGEA 5A9TA 1IPFA 2RAFA 3KSDO 1ZK1A 4QX6A 3D64A 4M1QA 4J0EA 4GAEA 3D5TA 4XYMA 3BIOA 5G0UA 5IN4A 3H9UA 4NZ9A 3QVWA 1HLPA 2H9IA 1S6YA 2IE0A 3MTJA 4W7IA 2PZMA 5DOVA 5BR7A 1CIVA 1ENYA 1PJLA 3JYNA 4IS3A 4YAJA 1ZVMA 4RORA 2DPHA 1N7GA 1F06A 3RUFA 4PG6A 3F3SA 3DZJA 5DN9A 4B3IA 3ONDA 1BW9B 6LDHA 3SC4A 4BNFA 1TEHA 2O3UA 3DAFA 5IZCC 1D1TA 5EJ2A 3JQ8A 2DVMA 2AG8A 3RBVA 1AUPA 2AW5A 1QYDA 4QECA 3TN7A 4KQWA 1LSJA 4TZTA 2IZZA 3VDRA 2V7PA 1TXGA 4CLDA 1SOWA 4D46A 3OECA 2DC1A 2VT3A 5ENVA 4CL8A 5A03A 1KVSA 1EK6A 3PK0A 1PGPA 3TFQA 4DMMA 4PLWA 2VT2A 4BKPA 3L4BA 5CHEA 3WQQA 2O4CA 4R9RA 3DMYA 3V2HA 1Y8RA 4YB8A 1O89A 2HMWA 3NT4A 1P0CA 5JSFA 1OC4A 1QLJA 2Y0EA 3GDOA 4J6FA 3PWKA 3CSDA 2F00A 1MP0A 5IAAA 3H9JA 5FWNA 1HDRA 3GPIA 3KTDA 4HADA 3CXRA 3DBHB 1R16A 2F1KA 2VYVA 3F5SA 3PIIA 4HKTA 4OQYA 3C7DB 2J3JA 4MINA 5B4VA 1C1XB 5KCZA 1XR3A 2OXIA 1B3BA 1HE2A 4RF5A 3ZWOA 1I36A 4K1LA 3QWBA 1YE3A 1QYWA 2B0JA 3ROMA 5TT0A 3A06A
chains in the Genus database with same CATH superfamily
2EBFX 1A2KC 3O7MA 4UHHA 5COAA 2ZCVA 3ZLJA 2FAXA 2GO1A 2YHUA 3GEDA 3GZ4A 4MW7A 1QIHA 2WU4A 3CCCA 3QVKA 1TOAA 1NW7A 4FUQA 2DXIA 1F17A 2XB8A 1MZPA 4IDQA 3GA0A 4QPCA 5GOZA 1WU8A 3ZE6A 2ETVA 3CZQA 3SNHA 1V41E 4FDAA 4X00A 4G24A 3RCBA 1Y9DA 1HSOA 2YJ5A 1VI2A 3GAAA 3VNAA 3DVSX 3L0OA 3A3PA 3G5LA 2HNAA 1U11A 1BFDA 4GLLA 1VXRA 1H9BA 1ODJA 4B80A 1CVIA 4W5TA 1RLOA 2BM8A 4P6VF 2ZCJA 3HFSA 3IUPA 1ZMRA 3HYLA 3QV2A 4UM5A 5DISB 5BN4B 5CDFA 4G1FA 4FZVA 3CIFA 3LCRA 4DBLE 2WKPA 4XOIA 1I6LA 1ZI9A 1F3OA 1Y80A 4LKOA 3TNLA 5LP6A 1H3EA 2HQOA 2WIDA 5HVNA 1V45E 3HR4A 5EIBD 3L7DA 1UKYA 2ZTMA 3RVPA 2GMWA 3IEVA 3UBTA 2FLWA 2NXWA 4IGIA 2PFKA 2XPCA 2NQ8A 3B6JA 4FC6A 3TM4A 1T8YA 3UMJA 4K81B 5K3FB 1GCIA 5LIRA 1KEEA 4Z1OA 4HQNA 2ZYRA 1OWMA 2JLWA 4PCAA 5KAPA 4DLRA 4RW0A 4GX5A 2C5AA 2F90A 2VT6A 2DQZA 1JIJA 1X39A 3ASUA 3KTAA 4RO0A 2G9NA 4UMDA 4E0BA 4EK9A 4BFWA 2AE2A 4ABTA 1I13A 3S40A 1C7EA 1VIYA 5HKAA 5AVYA 4QAJA 5ITZB 3A31A 4BNLA 3MJSA 4AI6A 3WE7A 1ZUD1 3KRTA 1BRMA 2RHTA 3PGVA 2P5UA 1SQSA 2RHCA 3E7XA 1WLSA 1I7QB 4Z2AA 4KRYA 3O1LA 5TRTA 4E4RA 2CKDA 2V9CA 1PR1A 2XVXA 3E3OA 3FB4A 4ID9A 3TTYA 3TUZC 1XP8A 5F1PA 1G66A 5HFJA 1NF2A 3MJFA 3BXFA 1VSUA 1IZ9A 2FPPA 2TMGA 4RJLA 4Y1FA 3TBFA 1V5FA 3VA7A 4WKGA 4J91A 3Q72A 1G7RA 4EG1A 3ZLTA 3BGIA 1QAOA 4JUAA 3ZGYA 1FYXA 1RCTE 4X64B 3DBHA 1GSAA 1E1RA 1IFXA 4YYZA 3B20A 2WMDA 5ES4B 4HZIA 4OSOA 4TKLA 5JZ9A 1DPFA 1HA3A 2FZWA 4TMZA 1L4BA 4LF5B 1EXMA 3BE4A 3U26A 2JC3A 4M6WA 1PS9A 2VYQA 3PENA 1V71A 1TZJA 3RSFA 3TRDA 4QICA 3ZNQA 5I47A 1AKTA 1AUOA 4KIUA 4C7JA 4IH4A 3NV7A 1QSGA 1T3ZA 2PM8A 4AZVA 2PQMA 3HB1A 4HB4A 1S8OA 1FTWA 2R751 2GN8A 3ZY5A 2HSWA 2XWSA 3L5OA 2X4GA 2EFEB 3BCSA 4EJMA 3TSWA 3DR5A 3DTYA 4YIKA 4ZN6A 5ELXA 1Z22A 4L4YA 2NYVA 3SGLA 2HK7A 4DAEA 3IXQA 1V37A 3O6VA 4RKQA 4FYYA 2BY4A 3Q7PA 4BNHA 3ZY4A 4D9GA 1FDSA 3QVVA 5KTNA 3B1ZA 4F1KA 4BMXA 1FFBA 4IZ6A 1U7OA 1RM0A 2LCIA 3PNLA 4FN4A 2Y0PA 5GMOA 3IUMA 4N65A 1QCYA 2EWVA 1KXZA 4PIPA 5DM70 1KAGA 3C5WP 3NIDB 4AZ3A 4BRSA 1T3SA 3L7LA 2VXOA 4B6PA 3T1OA 4XQ0A 2QD4A 1JU3A 2VRWA 4QWMA 4FOLA 1N8SA 2JRLA 4ZU1X 4AP5A 4DSZA 4NR0A 5TMBA 3VVBA 1FYFA 3FX2A 3GGSA 3RJTA 1N25A 4MNTA 5FL7A 3V6MA 2C7BA 4DCCA 5CG1A 1QF9A 1HRKA 4JLOA 1QYCA 1CUGA 4KRXA 3RHFA 3ZEAA 4HNQA 2GJ4A 5K3FA 2QI9F 7REQB 4HUTA 2A4KA 4J3FA 1A4IA 3KO8A 8ADHA 4BAGA 4MIEA 5LNK6 1W36D 1R9JA 3ELUA 1XLUA 4RVSA 4LX8A 1IJFA 2A14A 2II6A 2WD7B 4GYKA 4O2RA 3VPCA 1WMSA 5ITZA 3VUFA 3QU2A 1A4XA 3ZVKA 5EJ7A 2Q7OE 3RSZA 4MLPA 4B48A 4CQJA 2ZULA 3FUUA 3P9YA 5FD8A 1E3QA 3I09A 3ZK9A 2QNIA 3ZNPA 2AKEA 4IH1A 1E6KA 1HGXA 1LY1A 2EX0A 2E89A 1YZVA 1UBEA 2FPRA 1CUVA 4N6GA 4EA6A 3NHWA 5HRCA 2I2FA 3UFXA 2HU2A 1AQNA 2XB2A 3SXJA 3W5UA 1HTWA 4E5KA 1FTQA 4IWYA 4PLTA 3GZTB 3P52A 3QFSA 1K8RA 3WL8A 4LJYA 4IIGA 4MRMB 5KYVA 4MKZA 2WPDA 1OKKA 2XI4A 3Q40A 2HJGA 2X41A 2G9ZA 2QVGA 4UPVA 3LW8A 5HMMA 4BBAA 3E8MA 4ID3A 1IIBA 1KIFA 3GFOA 3LL7A 4BNUA 4K2HA 4CKZA 4G0WA 5AVQA 2I6GA 3LT1A 3OZFA 1FMCA 4QYIB 1CUEA 4L9AA 4PAGA 4PANA 3ADOA 4O2AF 3EH1A 3AI3A 4RVGA 5T4HA 3SSNA 3ZIDA 5LVAA 4EAQA 4H7DA 1RKXA 2CVOA 4MTLA 3REGA 3ZKAA 1XAHA 3E5HA 2PRKA 1X1AA 4X0EA 3F8SA 4I0WB 4E3ZA 3VKVA 3MJTA 3ONWA 1QKIA 4QVGA 1TF2A 2FE1A 2ZRLA 3WAGA 5DCUA 1TKAA 1QIKA 2OCAA 1QGUB 1YH3A 1Q17A 2J3EA 1SXGA 4GMDA 3DWEX 1SUFA 2HLPA 4WLNA 2DM6A 1SUCA 1FX0B 4G36A 2EZ8A 1QG4A 4I9UA 1U2DA 3VZBA 1UDWA 3WYEA 3ZI0A 5AJZA 1R0YA 3T0GA 3HVKA 1AVTA 2XNDA 3PEFA 4GXTA 1E62A 1ZK0A 1FNMA 5JWHA 3TDKA 3O5AA 2PUTA 2CFSA 2DHCA 1OT5A 2AJBA 2WT9A 3OIGA 1TQHA 1XEWY 2R2AA 2W0SA 3IB3A 3ADPA 2Q6OA 3ZQ4A 4HQRA 4H3SA 3LX4A 4K28A 1U2QA 5HE8A 2Z2IA 1J56A 4HNTA 3MHTA 2R44A 4L1KA 1VIDA 1FBTA 1SKMA 1YNOA 7MHTA 3WSTA 4DR1B 1HDZA 3SZLA 4C89A 1CZHA 4V0RA 4S0ZA 4KR3A 5JJIA 3NHKA 2LE0A 2YYZA 2V55B 4Y9SA 1UM8A 4N3BA 3ZLUA 4FM9A 2V7BA 1UBKS 2QTWB 2PR2A 1Q74A 4JOSA 3TTVA 3AG6A 5J1TB 3QU9A 2V6IA 1U8ZA 4JI1B 3NONA 4OK6A 3FVRA 3UHFA 3EW9A 3VXKA 4FWTA 2O8EB 2BUAA 4BIIA 3KB6A 4JX8A 3V80A 3EBOA 1U3VA 3QBVA 7REQA 1YC2A 1UPCA 3NVMB 2IP4A 2JGJA 5FUYA 4AJ1A 3TCKA 1AX9A 3ROPA 2JCSA 3RODA 2H07A 4QM7A 4H7HA 3SKYA 1I6WA 1QK4A 3IRVA 5CH3A 2Y4OA 2WVGA 3NWBA 5IJAA 1Z4NA 1X1SA 2ZAGA 1N3IA 1CIJA 2RHOA 4V2IA 4WKNA 3E4CA 3LY9A 3UXEA 1D7AA 3INYA 1E7SA 3P9IA 1AE1A 3L7MA 4QYWA 3SYMA 4GKKB 2YNMC 1NSYA 2VKQA 3EUFA 3FNIA 5KNLA 1Y1SA 4J1TC 1NSFA 1VI6A 3ZQKA 2FK8A 4REOA 3TR0A 3VOSA 2VHWA 4U7WA 3HMQA 1Q7RA 1A7AA 4M7WA 5CEEA 2WMNB 1M0TA 3R40A 4GG1A 4F97A 3H1EA 3JQ6A 1R00A 1W2HA 1SIWA 1ORVA 4X1YA 5F33A 2XE8A 5AJUA 4C05A 4EITA 4G85A 3TG8A 421PA 2C4HA 4MRMA 1TB4A 4IG9A 4UKDA 1PDOA 5JADA 3PX7A 2Y99A 5NULA 3A6KA 3KEQA 3QUAA 2VDNB 3WTBA 2FOLA 3R9XB 4MVJP 3WIBA 3IAS6 2P27A 1EVQA 3LGAA 3QMWA 5AK3A 4Q9AA 4D9EA 1R4AA 4FKMA 1R6BX 2SHKA 3CKLA 1A5SB 4QUGA 1KO7A 5KNDH 4UFNA 1MB4A 1ZMBA 2BFCA 2XD4A 5K3DA 3ZDXB 4KREA 2HB6A 1JAIA 2HQBA 3FRIA 3JQEA 4QYIA 3T1QA 2R65A 3NDIA 2ZFUA 1M75A 3GEBA 4H7JA 1T91A 1UAGA 1E98A 3PHGA 1BIFA 1NFFA 4GRDA 1NTRA 4U0JA 3K2IA 1D2EA 1ZX1A 4MYDA 4YONB 3VJLA 3TR5A 2WJGA 2JIBA 2O3JA 3GLTA 1XCPA 1IEWA 2BGLA 1Q5PA 3IVGA 2BBTA 1QGUA 4OXIA 3PUJA 1DRWA 1ZL0A 2V6GA 2YZKA 4MVJG 1A8IA 2J0QA 1NVXQ 3GJSA 5EP4A 2QZZA 3N8DA 1FX0A 1I3NA 2V7GA 3CT6A 3CY6A 4WD3A 4CI0B 5HKKA 4CJXA 3SZOA 1E5DA 1P45A 3AF3A 3T99A 4K46A 3USZA 1J1UA 1DFIA 2WDZA 3SC3A 3ZY6A 2V59A 4QHYA 3TZ6A 4ZHQF 2AG5A 2DPMA 3H4TA 3MD0A 3O4FA 3P0IA 5A1TA 5DNCA 1RJEA 1NE2A 1FSGA 1Q0LA 3ECSA 1NRWA 2DWQA 3O0TA 4GX0A 4KW7A 4Q82A 3VHLB 3UICA 1X7XA 3OSZA 2AFIB 3VV2A 1PEAA 1RKBA 2HHLA 2ID8A 2PMWB 3DE3X 3CUTA 3H5IA 2IYOA 3WGNA 1TJ5A 2VJYA 2C7GA 3U7HB 2HZBA 5ESXA 5ALFA 4M99A 4M83A 4QE3A 1XF9A 2ZRHA 1IJEA 3RFVA 3U4GA 3BRWD 5CX1A 1WHSA 4FINA 3TH5A 1CKEA 1ECBA 4C5BA 5A05A 4ZCIA 2WBLC 3KALA 3C7TA 3LSYA 1P4RA 2FEAA 3T41A 2FRXA 2YJGA 1ARZA 3KQKA 4RIFA 4RLHA 3BWXA 4NONA 3V4FA 4RVDA 2EZ9A 2WP8J 3EZFA 1DEXA 2ZTVA 3ICOA 3NPMA 3O83A 4XVQA 5FQOA 4CM5A 3CO5A 2AEFA 1FFXB 1VLMA 5CD1A 2NT3A 4E94A 4QG3A 5JJKA 1POXA 4EG8A 1TAHA 5DB4A 1QZZA 4N7MA 8OHMA 3CE9A 1HZZC 1IY2A 3DD1A 3MTQA 1QIMA 4NCKA 3OCVA 5EEGA 2QR2A 4NYMQ 2Z09A 1T3HA 1J33A 1JEYA 3FKSA 3HXKA 4W99A 3WYGA 4UTRA 3EXHC 4MW9A 1FFWA 2WU0A 4KKXB 4I6EA 4HFNA 5K3OA 2XKKA 3SG0A 2QRJA 1XTSA 4YCAA 3IPYA 1RABA 1RI5A 5H81A 4TS1A 5ANRB 1L5OA 5KQMA 4TXNA 3GDHA 2DBQA 1OV6A 4KAJA 1PYDA 4UEKA 5K0JA 1G6KA 4D4GA 2IEBA 4WT7A 1ND6A 5BT8A 4GICA 2JHCA 1Y89A 1J42A 2PRYA 2B9VA 3MTIA 4EVQA 4PXYA 3BCRA 3DGFC 3TIGA 1WW2A 2PLWA 1XRLA 3I73A 3KVNA 4O4IA 1E2PA 1IZ7A 2RH4A 4LYJA 4UVHA 5CVEA 1RPJA 3CCFA 4HVAA 2AYZA 3NANA 3QVTA 1OYOA 4HDKA 5FI0B 4KVZA 2VPQA 4YI3A 3W9SA 4U5QA 3LCCA 2EYUA 3M9XA 2BGRA 5EIFA 5J2UF 3FGZA 1ILEA 1I2AA 1PLKA 2RG7A 5DP2A 4MVWA 2WYUA 3R9XA 5TMPA 2DT5A 1WZNA 4RDIA 3SE0A 1JSRA 1RM5A 3G88A 4LXGA 4TMTA 3HI4A 4KKVA 2C2HA 1TMGE 2FMXA 1WG8A 1VHQA 2NZUG 1ODKA 3G2IA 4CIYA 1H9CA 3ESCA 1J8YF 2OAGA 2R6DA 1NM5C 4YQYA 4HLUA 4HG2A 4L5CA 1J6UA 4B17A 2OHOA 1ZUNA 2IHUA 2IEIA 3F6CA 2GDZA 2G17A 3T5PA 1U6IA 4NXNB 1GAQA 3EIQA 3GP3A 2IBMA 1J2RA 2BFNA 1DL5A 1E2QA 1CLUA 1XDWA 2FPLA 3L7BA 4ITUA 1U02A 5D3ZA 3O1IC 4WDQA 3K8ZA 3RBXA 3U3JA 4D3YA 2EX4A 5H82A 4O4JF 1M2HA 1XDSA 2XE6A 4XDGA 3PLNA 2HF9A 1CCWA 1DT3A 4EF6A 1EPUA 1VGQA 2EIHA 2TS1A 4RJKA 4TRRA 1S96A 5D2CA 5FL3A 5B2EA 5B4UA 5JR3A 1BVYF 5I5EA 2P2LA 4URHA 1OXXK 3SJAA 3KB1A 4WGFA 1C3OB 4FYKA 4QXMA 4A6EA 2VO1A 3LDUA 1ZJZA 1WUKS 2G08A 1W1UA 2Y77A 4CODB 3OZTA 5F7JA 4P4GA 4E12A 4LI0A 1M6EX 1C7FA 4RVCA 3D6MA 3D4OA 4ON9A 1FK8A 3LUPA 3G2LA 4OQEA 4OHOA 2AFIA 1DKPA 1YCHA 4FGSA 3L0YA 3DEYX 2W2TA 2Y1XA 1RRFA 5JNTA 1VC2A 1R0WA 2PGNA 3BERA 3K8YA 3VR2A 2P2CA 5JAPA 4JXJA 4CE6A 2FWBA 3CHYA 4EPXA 3PB3A 1LK0A 2AYXA 4B6JA 1USWA 3T3DA 2JIMA 2Z6VA 4BU1A 3RYCA 3QYJA 1YJCA 1U2PA 4NKRA 4GZMA 5ALWA 1B76A 2EFYA 1CS0B 2HK8A 3CNOA 5AOBA 1E6CA 1T4CB 2IYEA 2V4UA 4MS3B 1DQRA 5AK5A 5EHNA 3WNBA 3P71T 2WU8A 4E3WA 1HZZA 1ZVVA 3M70A 4NATA 4DMHA 4O33A 3Q7TA 3S29A 1OJ7A 1XD9A 3CTMA 1GVNB 3N7UA 4QVIA 1FFDA 1CJCA 3T7EA 3WL7A 1E9BA 3EXHA 1JQDA 5DTQA 4HMQA 2B6NA 2YUTA 4P35A 1XCGB 4F9EA 3MCAA 3V8EA 5DOZA 4EHIA 3IL2A 4LJ6A 2O3RA 4QD3A 3WGTA 3SJ7A 3SLRA 1S2DA 1XCJA 4ETMA 4F7DA 1DOAA 5JISA 1T0JB 3OCYA 3GVIA 4LYHA 3OAAD 5IM5A 1H23A 1PFKA 3ROTA 3R6DA 2WYOA 7AT1A 4YALA 4E7OA 1U8YA 1KBOA 4X71A 1UADA 3F9CA 1XRPA 4ZVSA 5I7UA 1IRIA 2H1CA 2BMJA 4FEYA 4NU8X 2CLIB 4CDMA 8ATCA 2F55A 3TXAA 1CQIB 5J2TF 3TAUA 1NF3A 2AC2A 3AQ4A 5D51S 1SHZA 4EKEA 1PNQA 1QH1B 3JWPA 1TA0A 1MAAA 2AL7A 2I1LA 1M0EA 4GH5A 3M1YA 3I2IA 3RB8A 3UAWA 2PCLA 2LUOA 2OKGA 2ZIXB 3O0DA 1SAYA 3I39X 4Y9DA 2VC2B 5CNKA 1KY3A 2X4DA 2FJPA 2NTVA 1UMCA 1TYZA 3UAGA 3IT3A 4OA8A 2ZJ0A 2C2BA 3FYUC 3OOYA 4GEKA 3A6LA 1YB5A 2PNFA 5AOCA 2EGGA 3M2PA 1AUVA 1P2FA 1WDLA 2G6TA 1XZGA 2WQZA 4OI4A 1PK8A 3H8JA 4B8WA 1E2GA 5BV0A 5C2JB 2DU8A 3N39C 1Y9EA 3ZV7A 3CN7A 2P9TA 3X1MA 5KZMB 2QN7A 4IZHA 4QODA 3S3TA 1V25A 2EBUA 3SHWA 4ADSG 1T0HB 1JRLA 1N1DA 2C5BA 2W93A 4BNIA 1KS2A 2OR3A 5LUBA 1C4KA 4BGEA 1BGVA 1E9RA 3CLVA 3EGEA 1FRFS 4H2DA 5CTJA 4NCAA 3BGSA 3SOZA 4B3RB 3P2JA 2XNJA 2QTAA 3GGCA 3HUDA 1EK5A 4M1SA 3TOCA 1C3OA 1OBHA 2YCBA 3L1HA 4J07A 4RNDB 4EL0A 4BPRA 4PNHA 1UJCA 1XELA 2A92A 2F48A 4QUBA 3VBCA 2PL5A 4R9NA 3V9PA 1JU4A 3P5SA 1LRJA 1MO6A 1FXWA 3ZS8A 2OD7A 1W7AA 1CUJA 1X9GA 3CPHA 3I2GA 4ML3A 3V4PB 4BNJA 2I66A 2IXAA 3VH1A 4A8HA 1Z63A 2HRDA 1EUQA 4X8HA 1QKJA 1FCJA 3CUYA 1GQRA 4W1PA 1YDEA 3A0UA 5BQ3A 1G3RA 3FIJA 2VSYA 4HPXB 1ZM2A 3R41A 2X4LA 4ANFA 2ZVQX 3CLKA 5KNDA 3LUGA 1NAHA 2C3YA 4IH9A 4ZMRA 1NFRA 5JTTA 1NQ5A 1EM6A 2O1WA 3D54D 5BT9A 1U0EA 1CS0A 2VDQB 3G8YA 4MKGA 1CE8A 4N5NA 4B84A 1O0CA 4M60A 4G0VA 4IZOA 2CD9A 1ZC4A 2LTAA 2ZB2A 1QMGA 3D3QA 3DH0A 2MMGA 1GU0A 1J00A 1W6UA 4WSOA 3I83A 4NJMB 2BP7B 5DW3A 1DKNA 1EX7A 3AP2A 4WBNF 4JJEA 1TZ2A 3EFOB 2NV2B 3DF9A 4HVLA 4YAKA 3N6RA 5K0NA 2ERXA 4TKZA 2BOVA 4RPCA 4AKTA 2FCRA 2FFAA 2Z3ZA 4DSNA 3O8OB 3C3AA 3Q8XB 4TS3A 4NK4A 1NF9A 2F1IA 3MIIA 3N6VA 4PRZA 1XRSB 4CIAA 2HWXA 2BFWA 4JVMA 4FFRA 2Q3EA 1O0BA 4YEDA 2UUAB 1QRTA 3B9QA 4N7BA 3RAFC 3HXMA 1D4OA 5H16A 1F48A 1M1UA 1T9ZA 2R4QA 5DNWA 5GZ1A 3NGXA 4U2EA 2IITA 5SV2A 2PUVA 2ZXUA 4K9LA 4MW5A 3Q3JB 2F3SA 4U6QA 4KGXA 1CV2A 1G9XA 2IDMA 4H27A 4Q3CA 4KAAA 1ISMA 4WLEA 1CQIA 2IOFA 3PDWA 4JL8A 4OIMA 3UUEA 4F04A 2GPWA 2JIZA 2X22A 3A1CA 3HBNA 1ZNZA 3CUKA 3LS2A 3LWNA 3RV3A 2A86A 2D62A 1TNDA 1WEKA 4CR6A 3TGLA 3PR1A 3BQNB 1U7ZA 4M0MA 1C9YA 1I4WA 1DBPA 3BHIA 4JHLA 2ZIXA 2VQ6A 2P4HX 4NV3A 1VGVA 5LCXA 1GTMA 2HUNA 3KOOA 4B8YA 2G72A 4EZEA 1EVYA 3LA8A 1H4VB 3AZOA 3HLTA 1FZTA 5I4CA 2V7EA 5HJ5A 4ALLA 1T8SA 4DWOA 4COOA 2GK7A 3ED1A 2JBWA 2G1UA 221PA 2J48A 2W8ZA 2Q5HA 4IIHA 4Q1CA 1M8PA 4I4TF 3G8CA 1NQTA 4OHFA 4DNQA 1FU4A 2K2QB 4O4HF 1ZSVA 4R5HA 2IBTA 3NEAA 4E31A 2QUZA 2QT1A 2EJWA 1QJCA 2WMOB 2X6TA 4MQBA 4PYLA 3WWCA 5BV7A 2ESRA 4LYYA 2XOXA 4RACA 1RLMA 2BC9A 3MOGA 1G0OA 1R0RE 2V5UA 2VPTA 1P1IA 2HLNA 1JAXA 2YZGA 3K9BA 1EA5A 4TUYF 4TYQA 5BUZA 2IIVA 2NPOA 3GW8A 3FETA 3NOQA 3PNBA 3QWHA 3JWGA 3PQ5A 4W9RA 4NC9A 4GGOA 1XF1A 2FFHA 3SHVA 2QV0A 4UATA 3GCGA 1E2EA 3U16A 3SS9X 3JZFA 1QV6A 2BFBB 3N0TA 3WI7A 2BF7A 3USCS 4MQMA 4PGMA 1A76A 2WE8A 1F4PA 4V3CA 3W2FA 3ZE9A 5DYYA 4LOLA 3RTGA 1SBYA 1CHNA 3F5QA 4XRGA 1UJ5A 4INAA 4UU1A 3WXMA 5EQTA 3C3YA 4PR3A 5HIMA 1UWVA 1CF9A 1OASA 3DEFA 3GRPA 4HH3C 4RADA 5SZKB 4BHTA 4YUYA 5COQA 2Q5OA 2Y0BA 1RMQA 3C5HA 3PX3A 1BN6A 2BZ1A 3JR3A 5CXXA 3D4LA 2R47A 2EZTA 4MVJE 4BFTA 1JXOA 1XZDA 2WD8A 3LQKA 1BCSA 4ZARA 3RVKA 3T38A 4CNBA 4UDYX 1U0OC 4PLVA 3VPSA 1SBZA 5EJ4A 4CKEB 3DV0B 2X19A 4FMPA 3WOVA 4NJMA 5HZHA 2BP7A 5IAOA 1WUTA 3GX1A 4H16A 4JDPA 1NVAA 3EFOA 4BVBA 3WK6A 5LZ7A 5I9SA 1JX6A 1AB6A 2WR8A 4YJDA 4RS4A 3GROA 1JHMA 1ZD8A 3W79A 3O8OA 3PITA 5EMJA 3UA4A 5GJVC 1ESNA 1CRPA 1AOXA 3TS1A 4GI5A 1VFPA 4EW6A 2QRGA 1SUSA 2KMLA 2IZ0A 2NG1A 2YASA 3B7WA 2P9BA 1H94A 3IQWA 3C1TA 3WSVA 3NOVA 3KYCA 1E9FA 1TM5E 3DMDA 1T5DX 2ZKIA 3BORA 1MRNA 1JFRA 3BSFA 2PVPA 4HQFA 1N33B 3QUBA 4XPIB 3F6PA 1TLFA 1KVRA 5K8IA 1E7QA 4HDSB 4EATA 3V32A 1FY2A 2WIAA 1N6LA 3IVXA 1EESA 1QC5B 3LYUA 3ST7A 4R9VA 4PF1A 4ZMSA 3FFTA 1B26A 1XN1A 1L5MA 3KD2A 3MPUA 2HRCA 3EAGA 3JYLA 3HU3A 4Y9RA 5GM1A 4DQVA 1X8LA 3WLKX 2I6UA 2W2LA 2IQ5A 1CJTC 3FNRA 4OLJA 4TLLB 1R4ZA 5FI1B 1RPNA 3U31A 1T0BA 4FWIB 1CQZA 1G5QA 3D6NB 2Q8QA 1WDTA 3BDAA 4G0UA 3GGGA 1ECJA 4M9CA 4Y2QA 4B3HA 3L46A 1PV2A 3KZVA 3ZTYA 5KVSA 2QJFA 4PZZA 3A1EA 4YNBA 1GTVA 5ENZA 1A8SA 2F3RA 4P32A 3GCDA 5H3CA 3WZ2A 4BNVA 4FVTA 1PJRA 3AWIA 1XZAA 5CK5A 4X65B 3QE2A 5AHWA 4FB5A 1JG1A 2AVNA 2OZVA 2YW2A 1J0CA 1ORWA 3ZK7A 3RUAA 4CG3A 5IWAB 4DV4B 5FAXA 3OE7A 5TJHA 1XL0A 1KFCB 2Q0QA 3LO8A 3D7MA 4YPVA 5L95A 4DLBA 4F71A 4TMYA 5EJAA 1QHNA 1RLIA 5CJJA 2P40A 2ADFA 4RVHA 3WA7A 1BH2A 4A2WA 5AXDA 3ZHSA 1EA7A 3UB4A 5H80A 3WGJA 1AXGA 1QRUA 4IFEA 5F77A 2ZE6A 2WLSA 3OCUA 3QNWA 3PXBA 4GOKA 2WNIA 2YICA 2PWAA 4LOKA 1JNXX 2VJMA 2ZBQA 2X2FA 1M33A 3AJRA 4OV6B 3LBFA 2DQYA 2I7CA 1N75A 1Z08A 2CDBA 4YFYA 1RE1A 2PV7A 5D84A 3E9QA 3FA2A 3T12A 5CDYA 3L6EA 3DOJA 4U9IS 3TZQA 4DANA 3U6BA 2V3CC 3IPAA 3GUHA 2AG6A 3NOXA 4RHUA 1DKRA 4UUOA 4GPEA 5C5CA 2XQIA 3U3KA 1AHNA 1XLVA 4D5EA 3ZS9A 1I33A 3N2IA 2A5YB 2ZSBA 2VAPA 4GGMX 5DHTA 4UM8B 5C34B 3TIFA 3WNZA 4DEYA 2EJCA 5GP1A 1L6RA 1W47A 1XB2A 2WP0A 1A4UA 1T5SA 3EZ7A 3NZEA 3NNNA 5A5VA 4CKBA 3OESA 4CM9A 4GMHA 4CIBA 2VCEA 3ZU6A 3OUTA 1XCMA 4AF8A 1Z7EA 1K86A 1QHFA 2OVFA 3DV0A 4I6GA 3B1VA 3LM8A 4JITA 1PT6A 4KV7A 3NATA 4CL3A 1DZ3A 3I6IA 1DAFA 2NZVG 5L6MB 4CU5A 2G4VA 1YQWA 1F2DA 2G9QA 4OHPA 4WNCA 2MYPA 2I4LA 4YCJA 4A1OA 3IYLW 2ECOA 3F3YA 5BRAA 2HBYA 3AVWA 2P9EA 1J0DA 1RI3A 3UNXA 1OLSB 1Q95A 2BF4A 4YCCA 1HQYE 1Z0SA 1E59A 4MR7B 3Q98A 1OX4B 2NO9A 2XTAA 3DMFA 4Y98A 2FSGA 1TMYA 2VHXA 3SD7A 3H65A 3SBDA 1R6AA 4GM0A 4JGIA 3BKWA 3KQQA 3PFHA 2K6GA 2Z95A 4G5SA 1Y4ZA 4WCFB 2J6CA 1TFUA 3PC3A 4LE2A 4JYPA 2R00C 1C80A 3QJ5A 2GLTA 2FP3A 4XPIA 2XRZA 3KEFA 3UOGA 1RJ9A 2QMYA 1Z6AA 3QYFA 4HDSA 2P5YA 2A9QA 3AETB 1WO8A 4FZJA 3DNPA 3KUCA 3CF6R 3GXOA 1AUQA 1UBGA 4NWIA 4Z9FA 2AJDA 3ZX5A 3LY7A 3KSRA 1B0PA 5T41A 2W2QA 3QQPA 3UV3A 1WB5A 4RMJA 2B8NA 1W25A 4UEOA 4CMJA 4DS3A 4FFSA 2SCUB 4LZAA 2HWKA 3UATA 2JCYA 3ZK8A 2P7HA 1M0SA 2ZE5A 5D3QA 2M1ZA 1W88B 4Q19A 1PJBA 2C82A 4JYAB 3ZHCA 2WTBA 2NO0A 1EBFA 3OOEA 8LDHA 4CM1A 2PKCA 3E48A 2BGGA 3A32A 3L7CA 2JLZA 3C6BA 4W9NC 5G1OA 5JXJA 5L40A 4LQ4A 3VMFA 2QXTA 4H18A 2AI3A 2ZWPA 4RTNA 1DEAA 2DUJA 4ZQFA 2Z4TA 3GLIB 3RUEA 2ASEA 1QB7A 2C9ZA 5JNRA 4BMOB 3QHAA 2VNAA 2J87A 4Q4AB 3QU4A 3O8CA 3WK8A 1IPEA 5EN4A 2XMSA 1J24A 3CLUD 2PJUA 3F49S 5M34A 1HOTA 4X54A 3NIFB 3Q1KA 1H42A 2GO7A 4OG2A 3M4YA 4XX0B 1NR7A 4XVHA 2MSKA 1Z82A 4G9EA 4Z49A 5BV1A 2Z1MA 1CR4A 3A37A 5KYKA 3SKVA 1RDFA 2AFHE 4G63A 3J80A 4M8KA 1CUXA 2FSPA 3S4YA 2JAHA 4B0PA 1N32B 3B3QA 4GOLD 1V8DA 2VHJA 1IUOA 5ITVA 5CB6A 4PFJA 2JFXA 2WB4A 5DWVA 1QHSA 5TPZD 4TWBA 4H9GA 4Q4LA 3VNVA 5J4HA 2YJ3A 1J0XO 3RAJA 3KB2A 3W2HA 5CFOA 5KSYA 3THXA 2QNBA 3SBXA 3VKHA 4C29A 4MCAA 3KT8A 4POOA 2I99A 4C0AC 4QFBA 4CF7A 4KP7A 4AJHA 2MSCB 4BJ5A 1ESZA 3H5OA 3ZCSA 3OMWA 3ZBUA 1FLNA 1EWYA 4U2DA 3ZCVA 3P2MA 5DHPA 4C0SA 3WYBA 1XXHB 1JL3A 1NNUA 4V38A 4QSHA 5FADA 2OV6A 4WOJA 4F6LA 1BC5A 3OPMA 2YMPA 1EWQA 3N59A 4IRUB 4K03A 4OQNA 3X1JA 4BQIA 3THWA 5DM4A 2DPGA 4JP2A 5HDQA 1OY1A 1WXQA 3UJCA 2Q1XA 4S04A 1JFFB 3RSCA 1NJSA 1AU9A 1ECPA 3ITDA 4JZKA 5TXGA 2ZI5A 2VN8A 4AJ4A 3I2JA 1NOIA 1ODFA 1Y6JA 1T9CA 1YL5A 3MINA 5ICEA 4NEGA 3DZFA 3KNZA 4ZVNA 4HAOA 1U3WA 1F2UB 2Q0HA 1NN5A 1U0TA 4I3FA 1JDVA 1UDXA 1FTGA 5CTAA 2X8JA 3QPAA 4MR7A 4B5LA 1OX4A 2WNSA 3C0KA 4D3XA 3GG2A 2ENWA 2CV2A 2FSUA 5KNCD 3QE9Y 1OFIA 2VATA 1A50B 1JEQB 3LC7O 5HCIA 4ZAXA 4M36A 4B4DA 4EB8A 2QYSA 2EBWA 4WCFA 3TNYA 1BWRA 4PBSA 3EF1A 1RWQA 3F2VA 3GFQA 2Z6AA 3B2QA 1FVXA 5ARBA 4GYWA 3D8NA 2Q5JA 5LP6F 2V7UA 2OBLA 1FQOA 1E7MA 4LXYA 2AOVA 2ETXA 1QP4A 3GRZA 1M6HA 2IP1A 2PX2A 4RVOA 3TW0A 3I0NA 3AETA 1TT5B 4LRUA 3OEYA 3MMZA 4FGKA 4I9HA 3H19A 4CTNA 3BX1A 5HQJA 1VE6A 2FP4B 3UV7A 3WADA 4PFKA 3C45A 3LBYA 2PEYA 3OQOA 1NQWA 2X9GA 4KK3A 3GHHA 4MVJM 3RHSA 2SCUA 1Z37A 2VH2A 5C8XA 4HP8A 1V96A 1R5OA 3NBKA 1WF6A 2D7JA 2JZOA 1EXNA 4KB5A 2OORC 3N2ZB 1CEXA 4X9XA 4EZBA 4PQYA 1TAGA 3PQ3A 1ZH4A 2VPIA 4HDOB 3JQAA 3HA7A 1QS0B 5GY7A 1MD9A 4TRJA 1WXEA 4NRDA 5EQJB 4F4UA 2WKQA 3G2MA 1OTYA 3HO6A 2YWCA 1ZJ4A 3AUJB 1HYGA 3OF5A 5DX8A 1OBOA 3FOBA 1ZCAA 4P7BA 2REQB 3O75A 1L1RA 4QAQA 2HJ9A 2W2NA 2DRIA 5FYQA 4XB1A 1DFGA 3ZNOA 3GHYA 2G70A 4EARA 5K8VA 1DKUA 3OEEA 1EDBA 4Q4AA 3F73A 2I3GA 3WGGA 4KPEC 1CJKC 3ILVA 3FGNA 4DZRA 5CVUA 4I5EA 5A4MS 3KHTA 1QGDA 4DV2B 3AJ8A 2J0UB 2R97A 3EUWA 4BNZA 1Y4UA 4RJIA 4PX3A 4H6VA 5L4SA 3PRYA 1UJMA 4ZT6A 3AF1A 1CEQA 4KGVA 4QATA 3DE1X 1LDEA 2VK4A 2W43A 4Q00A 1RAAA 2XMGA 2PWPA 3GUVA 3C7CB 1U2TA 4IQ0A 2FFJA 3RD5A 1KC3A 1MAVA 3RFUA 3O8LA 1LPSA 3AONB 1CC1S 1C9DB 1TYCA 2CFIA 3T9CA 3KVRA 4B1FA 3S8EA 1H85A 2X2EA 1NI5A 1ZYUA 3A2NA 4RLFA 1UWKA 1I10A 1UPUA 5IAEA 1LA2A 3EEQA 3D6UA 2BCJQ 3EODA 2QPLA 1K6JA 2WG2A 3L0DA 4LZOA 3BG5A 2V7WA 3HB0A 2R7KA 4RYDA 5KAMA 4ZRMA 4ZDWA 5EKSA 4E2ZA 3PHCA 4LJ8A 4ESVA 1IULA 1DWQA 2I3BA 2OP0A 2V6JA 3CZ9A 1V11B 2W6NA 5BR1A 5KVQA 1SA0A 1YE8A 3E23A 3FCEA 3UZUA 4B82A 1NN0A 4KCGA 2FN7A 4JYCA 4IGKA 3ZHZA 2J8ZA 4EW2A 3PI7A 2XXAB 1JFFA 1KO4A 4FHGA 4JR1A 4U1RA 3R7LA 4ZI2A 1SCDA 5BWNA 5JYDA 4L2IA 3F9RA 4IFIA 3NAZA 3QVUA 1QO9A 3G1WA 4YDQA 4PU0A 4XQEA 1HSZA 1RC8A 4Y67A 3RUIA 3V6LA 3EXG2 2UUPA 3KLMX 4ODIA 4GXNA 4IUYA 3WICA 2I1VB 3LVFO 1UJBA 5C1IA 4QKQA 1GN8A 1XA4A 5DHSA 1KPGA 5DMXA 2R1UA 2WZCA 5BMOA 1QRSA 4WZZA 4RIHA 1YUNA 3BILA 3K53A 4PC6A 3VAAA 5EXTA 4ETWA 4HN4B 2CB9A 3D3WA 2ACVA 3TKLA 5I48A 4YP6A 3I1FA 3PUWA 5BUSA 5HOEA 1N57A 2GPAA 3BULA 1T2DA 3H3FA 4IQ4A 3QY0A 5MFPA 5EPUA 4B71A 1UPAA 5A6SB 5H68A 4C4XA 3FBGA 1GQFA 2IKQA 1Z28A 4JLJA 3MAJA 5LMZA 2VP0A 1GNQA 1DCFA 5U9CA 5JBIA 1OLOA 1Z0IA 4M21A 1F8GA 5AT1A 4UVIA 1A27A 2RGYA 5EINA 3F3MA 3UFBA 2GVDC 2OHVA 4YX9A 3LWBA 1UPBA 3ES9A 4K3VA 3VKFA 2IC5A 2P2DA 3ITKA 3FYCA 3CLHA 1G98A 1E2KA 2IIQA 3GT3A 4X45A 3WRYA 4QOJA 3R7NA 4FCWA 4YAUA 1L8QA 4YJ2A 3R8FA 1GGVA 3EEFA 2JFQA 2E48A 3WKCA 3MGAA 2OYCA 5JS8A 2CNBA 3AP1A 2WK1A 4QPJC 4WFJA 3ZYCA 1SHJA 4XD2A 3RC3A 1QS0A 5HX7A 2OZEA 3W7BA 3IR7A 2OHHA 2QJRA 5SZIA 2BEWB 3VU3A 1ZSNA 4S1TA 1YJ5A 3BFPA 4G0PA 1UQUA 4XWAA 4LF7B 3AYXB 3HB7A 1KEVA 4GYYA 4EHBA 2E82A 5A0VA 1OIVA 3Q3HA 1SC1A 2YWHA 4L5IA 5DMHA 3WMEA 4D3DA 1SCKA 4DCMA 4IUDS 1RC1A 4NECA 1LJ8A 5EMMA 2GRAA 3IHLA 1X7DA 5JH7B 1MX1A 3JPYA 5E38A 2FPKA 5CG2A 1ZGGA 2XRMA 2O50A 5KYUB 3SMVA 4D1YA 1ISHA 1IVNA 3NFRA 4RCYA 4YUZA 1AZWA 2WF8A 2PGLA 1YZ3A 3INRA 2HRBA 3AR9A 3X1KA 3E27A 5DHRA 4XAQA 5J43A 1RM3A 2FSVA 3A28A 5ALRA 5K6AA 2O3SA 5CA0B 4B4UA 4TX1A 3GAZA 5ALPA 3IE1A 1R2QA 3V1NA 2FWIA 1KEPA 4KYIB 4LSZA 4B5KA 1YA8A 4ND1A 1TUBB 2C03A 4G9GA 3NAQA 1NBMD 1JLLB 1XU9A 2XB9A 3VPXA 2HY7A 1ADFA 3KYBA 2QROA 1JE1A 2ZJ3A 2OA0A 5FV4A 1BXRB 2IIPA 1XC7A 2Z9CA 3KU4A 2HPAA 1AKQA 4LWPA 3EGWA 1T34A 1E3LA 3EVZA 4G9BA 5CXSA 1E6WA 3HU5A 4R1LA 3LUJA 5FEMA 2IYVA 3RSOA 3E1SA 1OHHA 3DJFA 3F6EX 4OUDB 4FONA 4RY2A 1RWWA 2XZTA 1NC1A 4Y18A 3SIRA 1DC4A 5L4LA 2Q6IA 5JAMA 1DCMA 3CB4A 3DJYA 2V1UA 4DIFA 1WXIA 4NOMA 3WYAA 2PUAA 2QMUA 3HBFA 3OM1A 2JIOA 3LUFA 3SS8A 2NZ2A 2ZYVX 2ERYA 5ALDA 2H2DA 2GAJA 1XRMA 2PD3A 4GE0A 4KQ6A 1A9TA 4YMSA 4B31A 3L04A 5AKHA 1B8PA 2QPTA 4KR9A 3H6HA 1G5PA 2WQ7A 4BATA 4OHRA 4CMIA 1U9ZA 4I9FA 4X60A 3V8RA 2Q41A 4E7PA 1JKIA 3NV9A 4Q47A 3W5HA 1FS4A 2QRQA 3IR6A 1IN1A 2OHIA 2VNHA 2CVZA 3MD9A 4OFWA 2XRFA 3NPAA 4P53A 1UQRA 3RABA 2O7NA 3MWYW 2JASA 1GRVA 3PGLA