3CXRA

Crystal structure of gluconate 5-dehydrogase from streptococcus suis type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
260
Chain Sequence
QFSLDQFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the catalytic mechanism of gluconate 5-dehydrogenase from Streptococcus suis: Crystal structures of the substrate-free and quaternary complex enzymes.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Oxidoreductase
molecule keywords Dehydrogenase with different specificities
total genus 101
structure length 260
sequence length 266
ec nomenclature ec 1.1.1.69: Gluconate 5-dehydrogenase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3cxrA00
4J1SA 3UKOA 2X0NA 2OZPA 3NGLA 4HY3A 3HDJA 4YEDA 3ETGA 4EUFA 5C7OO 5ITVA 4CLOA 1D1TA 5CEEA 2OFPA 2EKLA 4MDHA 5TJHA 4B8ZA 1OOEA 4DQXA 4PG5A 1P31A 2Y68A 3DXFA 1DLIA 4I8XA 1RJWA 4B4VA 1I36A 1SEPA 3FF4A 4GVLA 4J3FA 4PFJA 2E49A 5I8ZA 1YBVA 1IOLA 3FTNA 5ILGA 3BMOB 3AFNA 3PQDA 2GYYA 4BMSA 1PS9A 2YHUA 4YB8A 1N5DA 5AXAA 1UXIA 4YA6A 2O3UA 4PRKA 2Y67A 2QRLA 3GMDA 1RM0A 2ZCVA 3FN4A 2FZWA 2FR8A 1NFFA 2HUNA 4YT5A 2Q4BA 5IF3A 1GUYA 3UCEA 3IMFA 3E5RA 3DHYA 3ONDA 2HK7A 3KSDO 5JNLA 4RO0A 3KYBA 4FFPA 3RC1A 4CM9D 3X2EA 4M55A 2Y66A 5JFOA 1R0LA 2VOJA 3JSAA 1E3SA 1KVRA 5F1KA 3F1LA 1ZUD1 4IY1A 3SC6A 4JCOA 4D44A 4WCFC 4JGBA 4BNVA 4GWKA 1Y6JA 2TMGA 5A06A 1SB8A 4CM1A 4J1NA 2JL1A 4YJHA 4YTEA 4J0EA 1UJMA 1EK6A 1LA2A 4FCCA 1B3BA 4CM4A 2PZMA 3GOHA 4D0SA 3ZWYA 2RH4A 3S2GA 3WNQA 1ZFNA 4EUEA 4N54A 3AUUA 3WMXA 5L4NA 3VTFA 4E32A 5DOZA 1D8AA 1Y5RA 1MGOA 4PN3A 3DFZA 3EGOA 4K6FA 5EQDA 3JYLA 2A92A 1M76A 3DAPA 3O38A 4IIVA 2B83A 3D3WB 1PL6A 3QVWA 1ZKMA 3PZBA 2X23A 1UXKA 3D0OA 4QXMA 4BS9A 3QE3A 4IMPA 1DOHA 4DL9A 1RKXA 3D1LA 4CMIA 3A1NA 2VCYA 4IM7A 4NU6A 1LRLA 4K26A 4KWIA 3MJ4A 4XR4A 1T2CA 2YW9A 1HWYA 2EW8A 3OIDA 1I3KA 2BH9A 2V6GA 3GDGA 3SLGA 4ZVVA 1E5LA 2PZLA 3KM0A 5HA5A 5JC8A 1E6EA 4XQCA 3DZFA 2OORA 2Q3EA 4UUOA 3UCFA 3RUHA 3I9LA 4BUCA 4FC6A 5HS4A 2JAHA 1ARZA 3W8FA 3VH1A 5A9SA 1VJTA 5ICSA 3HHPA 5G0VA 1N9GA 1BXGB 3G79A 4RDHA 4CMAA 2GZ3A 4ND2A 5BNIA 3QQPA 3EVTA 4II3A 4AJLA 2WYVA 5JXWA 4YRBA 4B3IA 1FDSA 1LSUA 1T25A 4UVDA 4CUJA 3QRWA 3JD4A 4IGEA 4LGVA 4JIGA 1J5PA 2H63A 3GRPA 4DIOA 5KJ6A 4I5EA 4F6CA 5I7VA 1QYWA 3PHLA 3KLMX 3UGKA 3FNGA 3MTJA 3NTQA 3LVFO 5AYVA 4OM8A 2DU8A 4KQXA 3BTUA 2J3JA 1H6CA 4MP6A 4B8WA 3E03A 4A7PA 1QYDA 3W4KA 2C54A 1GCOA 3PWKA 1QV7A 2C29D 4GKVA 5EJ2A 1BXKA 1E3JA 2AEMA 3GPIA 1I2ZA 3F46A 1HF3A 4GX5A 2IZZA 1A27A 2BMAA 2NACA 4HFRA 3FTPA 5BSGA 3PEFA 4PLZA 1C0LA 1EZ4A 4XRGA 2I66A 1DIRA 3GG2A 3ZWCA 4E5NA 5CDSA 1G0NA 4XEHA 3S1LA 3TWOA 2EERA 4O0LA 1UXHA 3CSDA 4UVHA 5KTKA 3G3EA 5A02A 3OIFA 1BWSA 1KBZA 1CRWG 2XXBA 3CMMA 3C24A 4KWHA 4WOKA 1XGKA 1Y8RB 4RVHA 4QEDA 3PVZA 5EERA 1R4NA 4L74A 5AVOA 3GNQA 5C7IO 4GI2A 5JCXA 3OHSX 1IY8A 1WZIA 4XJTA 4YR9A 1I24A 4CLRA 1GTMA 3F9IA 3D4OA 1CF2O 2I3AA 2YY7A 5L3ZA 3WG9A 4TMFA 3BTSA 2GSDA 1PZEA 1P33A 4GLLA 1DJNA 3VPHA 3UAGA 1N9GB 1R6DA 2HLPA 2VZ8A 4WKGA 3AU9A 2RHRA 3KRTA 1KIFA 1SB9A 4LN1A 3EZLA 4IDCA 3KSUA 2JKVA 1ZK3A 5L7TA 3I4FA 3KO8A 4J4BA 1PEDA 1SPXA 1YGYA 3UCXA 1SC6A 1B15A 3NDIA 1R37A 3ULKA 3IUSA 1HSOA 1FJHA 3DC2A 3NGXA 5DULA 3E5MA 1FDUA 3QVSA 3S2IA 4OL9A 1NPYA 1U1IA 3BHJA 4XQGA 3ROKA 4Z6KA 1LQUA 1NQAO 5A9TA 4QSMA 5GZ1A 1HDXA 1G0OA 5EPOA 1ADCA 1EVYA 4YYZA 3VKVA 1NR7A 1U7HA 1ISHA 3SBOA 5LCXA 4YPOA 1E7QA 1L7DA 2DPHA 3OSUA 1DFHA 4XDZA 3WJ7A 5DBIA 3ZHYA 3OH8A 3ZH2A 4IBOA 2CD9A 1ML3A 2ZB3A 3VAZA 3OEYA 2W98A 4HNGA 1MFPA 4KMSA 4CM4B 1IZ0A 1PJTA 1ONPA 1K5HA 3QWBA 1HDOA 2V6FA 3FHLA 3DL2A 1EEHA 4XCVA 2W2LD 3BMCA 3M1LA 3AI2A 2J3HA 1NAIA 4YBZA 5CDUA 1R66A 3N7UA 1DHTA 4D45A 4L73A 4R51A 1JTVA 2PZJA 1K0UA 4NBVA 1N92A 5TJ9A 1NWHA 2R00A 3O4RA 1QYVA 3GEMA 4XA8A 3OJ0A 2H1SA 2NM0A 2R2GA 4R1UA 2X0JA 1E1KA 2D3TA 3AK4A 4FR5A 3NT4A 2QYTA 2OOSA 1ENYA 3RJ5A 5A1TA 3ASUA 1MUUA 5DP1A 4ZHSA 3OJFA 2V6MA 3E9NA 1ZSNA 2RIRA 3A9WA 4ND5A 4O59O 3PJEA 3NX4A 1M66A 4TQGA 4BO8A 1H6DA 2PTGA 3AI1A 4Z0HO 3ANMA 4TRNA 1ZMTA 4CPDA 3WBFA 3C1AA 3DTTA 3TFOA 2OP0A 3OA0A 5KKCA 5ILOA 2W90A 4QECA 4IDFA 1LTHR 3MJTA 3RFVA 2W2LA 2VYNA 3H3FA 4XYBA 3B1FA 3UUWA 4IINA 9LDTA 1T2EA 1WDMA 1YQDA 1BMDA 1LRKA 3ZWXA 1A4IA 3HDHA 4MKXA 2QRKA 1UR5A 1B3RA 1E6UA 4QX6A 1LDMA 1XHLA 3AJRA 4U6SA 4IZIA 4FOOA 5L9AA 4AL4A 2H6EA 3HJAA 2XPCA 1UP7A 2EKQA 5I7FA 4Y6RA 3E8XA 1IZ9A 3H2SA 1ZSYA 2Z1MA 3QWAA 4MVJD 3I23A 1J49A 1OZAA 1X7GA 4LMRA 4EJMA 4M8SA 4U6QA 4CL8A 2ZB8A 3MJCA 3FNEA 4L4SA 4BNZA 2ZIZA 3PWZA 2PFGA 3OQBA 3SEFA 4CMBA 1QP8A 4ONEA 4PLHA 4L8VA 2PD4A 1BSVA 2GR9A 3LU1A 2C2YA 1P1KA 4BVAA 3PHGA 1A9YA 2X5OA 3ZHBA 4EDFA 5CEJA 2HMTA 4KUHA 2HCTA 1CQIA 1SO8A 3DONA 1B16A 2ZB4A 3ONEA 1LLUA 5L95A 3JQ8B 1SMKA 2WJPA 1VKNA 4G5HA 4MVJA 3JYNA 4YRDA 1ZJYA 4BNXA 4U5QA 2D8AA 4KDFA 2G17A 2GDZA 5FEUA 5K0ZA 4RF4A 3EMKA 4OXNA 1K6XA 4BGEA 4CLDA 4DUPA 3FRJA 2P68A 3DZHA 1PL7A 3PQFA 3WGTA 1XG5A 2DVMA 1BGVA 1HYGA 1EFKA 2CDCA 4FOSA 4L75A 1I01A 2Y1OA 5HTOA 4J90A 2EKPA 1W4ZA 3PHIA 2AE2A 5IZCA 1E6WA 1DB3A 3BMNB 3ZNQA 4DBVO 3HFSA 1X0VA 2E82A 2XAAA 3NDJA 1PR3A 4CV0A 2WE8A 3GRKA 3WYEA 4CR8A 5JYDA 1NFQA 4XJSA 4E3ZA 1NPDA 5FI3A 3IAHA 5I9LA 4BNLA 1PJQA 4CM6A 3BZUA 2YHIA 4UVGA 5ER9A 5IAAA 5BQFA 3LK7A 4IS3A 2UUOA 2D1YA 4IDBA 4R9RA 3DBLA 3L9WA 3WWZA 3RKRA 1NPTO 3JQAA 3INTA 2O2YA 2YV3A 4OOEA 3H4VA 5A3VA 3PYLA 1ONNA 4DRYA 4BB6A 2X5KO 1E7SA 3QIVA 3DMYA 1ADGA 4PG7A 4D46A 5U4QA 1ISIA 4YXFA 1DRVA 1RM3A 5JO9A 1XEAA 3NV9A 3RBZA 4AJ2A 1HDYA 1ISFA 3A06A 1O0SA 4Z3DA 3ABIA 3TZQA 1MG5A 3M1AA 3Q11A 1CERA 4R69A 2NQ8A 1NVGA 1GR0A 1O8CA 1PJBA 3KYCB 5AXBA 5JDCC 1Q7GA 1HKUA 3ITKA 1J4AA 3TDKA 5KOIA 3WYCA 2Y0EA 5G0WA 4ZRMA 3HSKA 3IDSA 3L4BC 1IUKA 3IJRA 1GUZA 4TVBA 5A03A 1PJSA 3PDUA 3VC7A 4Z0TA 3L6EA 5KJEA 4D3FA 4OSOA 3ZWOA 2OXIA 1YL6A 2FP4A 5THQA 5C7LO 1NTOA 3FPLA 5JAIA 1I33A 1GV0A 3GN1A 4GMFA 4DXHA 1OBFO 1PX0A 2D0IA 2Q46A 1VL6A 5T5QA 4CV3A 4D79A 1LC0A 2FMUA 5ICMA 2PH5A 5KKAA 1G6KA 4W6ZA 3T4XA 2CF6A 5CG2A 2CF5A 4R68A 1JW9B 3VZSA 1YVEI 3OJOA 3WIDA 1H93A 3IKTA 4O6VA 1W8DA 2LDBA 4LW8A 4D41A 2AEFA 2PKQO 3EUWA 4K9DA 2UAGA 4E2XA 1KERA 1DIHA 3Q0EA 1U2DA 1ENOA 1QYXA 2RH8A 4RVSA 2BRUA 4N5NA 4IXTA 3RWBA 3ZDFA 3PLRA 2JHGA 4CMJA 4W7IA 3TSCA 3WDSA 3ZU2A 3CZRA 1EUZA 4WNIA 5KJ1A 4KDEA 4R1NA 1Q2XA 2OMEA 1WVGA 1LNQA 4ND4A 1YOVA 3FCOA 3TPCA 4YRAA 1C1XB 4ALLA 4MP8A 4BV9A 2BFPA 1VE9A 4BO0A 1H2BA 3BTOA 1ADFA 1AE1A 1P1RA 2PD6A 2B36A 2HRZA 1T24A 2Q2WA 4W9NC 5F3RA 4OO3A 1A5ZA 5TF4A 4B3JA 5CHEA 2X4GA 2Z1NA 1IL0A 2AE1A 2D5CA 1SCUA 2O48X 4Q39A 3Q1LA 4FGWA 3EK2A 5T57A 3DBRB 1XSEA 1R4MA 4MPDA 2VWQA 3GDOA 4LCEA 2E6UX 1VRWA 3I3OA 1BDMA 4CM5A 4TSKA 3O03A 1SAYA 3G1TA 3PLNA 5G4KB 1LC3A 4MIYA 5B4UA 2NU9A 3HN2A 1F0YA 1DLJA 2ZK7A 5H83A 1Y5MA 4HUJA 4TZTA 1LXCA 1X7DA 1TEHA 4PG4A 3W6UA 3OMLA 2A35A 1IHYA 4NZ9A 3K96A 2DM6A 4IJKA 1XQ6A 5J23A 3ICPA 1QRRA 2FWMX 4NNJA 1KVUA 3V5NA 4ZD6A 1N8KA 3W4IA 4J16A 1T4BA 3O8QB 4WJZA 1KEWA 3UF0A 1JVBA 3PWSA 5ITWA 2J5QA 1UZMA 4YDRA 1KY4A 1U5CA 5JE8A 1K6JA 1DAOA 5TT0A 1GYPA 3N58A 4RLHA 5EQFA 5CPFA 4R4JA 3D3EA 1K2WA 2NTJA 2GN9A 2RCYA 1ENZA 4N5MA 2Q45A 1QSGA 4GH5A 2GN6A 2OUIA 4WLVA 5JW6A 3RC7A 3LYLA 2X5JO 2GRAA 4LSMA 3WNVA 4M86A 5COQA 4YJDA 3KB6A 1A7AA 2YUTA 1JQBA 4D0RA 1KC3A 3K9QO 4CQLA 1GQYA 2G5CA 4Z9FA 3E9QA 4U0JA 3BMQA 3Q9UA 3QVTA 2NUAA 5BSFA 5JDIC 3M6IA 3R1IA 1YS4A 1AN9A 2DQ4A 4LSWA 1QLJA 4OGWA 1NXQA 1U3VA 9LDBA 4Z0PA 4MIEA 1EBFA 3H65A 2YDYA 3HZZA 3V2GA 4AJHA 2LDXA 2BGKA 1YB1A 1YDEA 1GAEO 1S7CA 1E3WA 1Z6ZA 3DDNA 4GSKA 5KVCA 1E1MA 3PGJA 4MKRA 4YJHB 5CDTA 2PY6A 4BO3A 1V35A 2O7SA 2VOEA 4I5GA 3FI9A 3U4IA 3JD0A 4XDYA 4CQMB 4WLUA 4BO9A 1JU9A 2FSSA 2Q1WA 3F1KA 2BHLA 4FFNA 4KOAA 5L7YA 3EZYA 4I9UA 5LDGA 1TI7A 3HWRA 2EP5A 1PJLA 4UEKA 4UREA 3RASA 4DWVA 7MDHA 1GUFA 5GZ6A 1LEHA 1I30A 2FY8A 4JP3A 4HFNA 4CJXA 1KEVA 3RU7A 1MLDA 5T8KA 1JAXA 4NMHA 1ZK1A 2HMWA 2J5RA 3WGHA 1P9LA 5LDHA 1F8GA 1YOVB 2EP7A 2IE0A 3WSVA 1I8TA 4O1MA 5TQVA 2AG5A 3BMOA 5T67A 1F14A 1WPQA 3PHHA 1LSSA 1XQ1A 3DOOA 2HDHA 3LLSA 2VRBA 2O4CA 1UZNA 4WGGA 4E5MA 5JMPA 3H9JA 1H5QA 1DEHA 4H16A 4GLOA 4NPCA 1J6UA 4R16A 5TT1A 8LDHA 1OMOA 2ZYDA 3DFUA 4I1IA 4TRJA 3DOCA 4ZQFA 4RQTA 3GVHA 1LLCA 4LVUA 1GU7A 3WXBA 2DT5A 3IOYA 4XKJA 3UVEA 3LT0A 1HLDA 3QSGA 4WLFA 4DYVA 1LQTA 4M89A 3KZVA 1ZVMA 1VSUA 4BO6A 4FC7A 4F46A 1MC4A 3ST7A 1PGQA 3CEAA 1YB5A 1Z74A 1ZZEA 3Q2KA 1RYDA 1AGNA 3NKLA 1ZXLA 1NASA 1PTJA 3AUSA 4RORA 2X9VA 3ZCXA 1NM5A 3UFXA 1DJQA 1GL3A 2UDPA 4FFMA 4NFHA 4NIMA 4BO2A 4R9SA 4YWJA 4EUHA 3RC9A 1UUFA 2Q1SA 3ITDA 2GGSA 4KZPA 4FB5A 5DF1A 2D2IA 2DBRA 2UYYA 2VYVD 3S55A 3ONFA 2W2KA 3PI7A 4JJIA 4XYMA 2B4TO 3PPIA 4FW8A 1HTBA 3LZ6A 5AQ1A 2GZ2A 2EGHA 4UULA 1O94A 2CVZA 3GMSA 1DDOA 1JVSA 3VZQA 2EJVA 3C1TA 4DBZA 4MIOA 2FOIA 4EITA 1UXJA 4DC0A 4B7CA 3GUCA 1GQQA 2YHIB 4HWKA 2BLLA 1V8BA 2JAPA 3R3JA 2O3RA 3PYMA 1XA0A 3ZWBA 4WCFB 3I9MA 1M6WA 2OBNA 4GGOA 1LDYA 1U3TA 1U3UA 2VYVA 3L6DA 4NDNE 3MOGA 4U7WA 4XWYA 5CDYA 1E3LA 1C1DB 2PD3A 2OP1A 3B6ZA 4A27A 3TJRA 3OETA 4GWGA 3P19A 4Q3NA 1PSDA 4IDAA 2ZCUA 4WCFA 1N1EA 3LSYA 2G76A 3M2PA 2HJRA 1ZEJA 4J49A 2YJZA 3JQFA 2HMVA 4IIUA 3ETEA 4P4NA 5DBGA 1Y1PA 4HNHA 5IFLA 4HP8A 3RFXA 2PZKA 4NI5A 3DEYX 4M1QA 1M6HA 1PQWA 3BIOA 1XCBA 5BSEA 1WW8A 3E1KA 3VKUA 4BNNA 4L4RA 1T2DA 1ZIDA 4J2HA 3X2FA 5A05A 4UEOA 2NADA 4DVJA 2VRCD 3TOXA 2PGJA 3TRIA 4EBFA 1K6IA 3TNLA 4R3WA 3ICCA 1EK5A 1NHWA 1PJCA 4ALIA 1MFZA 3I52A 3NDRA 4RF3A 4BKOA 4J4HA 1PGOA 3GZNA 2VUTA 4HX5A 1LX6A 2OGUA 5T64A 2A9FA 2YV1A 3JQ6A 1EE2A 1KVQA 4FFOA 5CDGA 1H94A 2WE7A 1SZJG 1MC5A 3H3JA 2O3QA 4BV8A 2HSDA 5KNLA 1JWBB 3GA0A 1HE2A 4RPJA 2E4AA 1DFIA 2Z5LA 3I6IA 4I5FA 2OL4A 4OH1A 1EDZA 2Y99A 1PWZA 1Z7EA 5JAZA 4BOYA 3DOJA 2SCUA 4X54A 1C0IA 3COSA 3HQ4O 3RD5A 1E3EA 3D4NA 2IXBA 4NK4A 5MGBA 4RGBA 1C14A 1PS0A 3NUGA 3WFIA 1FDVA 3WTCA 1ENPA 2C2XA 3K8ZA 1VM6A 1X1EA 2IODA 3H5NA 3OF2A 2PGLA 3PJDA 4FQ8A 4MVJP 2VT3A 3CIFA 4Y9DA 4YT2A 3HFGA 4HV4A 3W1VA 1YQXA 3R6DA 4LMPA 1XU7A 4XYLA 4YQZA 1QR6A 3MWEB 4XYGA 3PDJA 2Q99A 4Y67A 4MINA 4XQ9A 2AHRA 3KLPX 2Y0DA 1S6YA 2AG8A 4MVJI 4OXYA 3PJFA 1LSJA 2EF1A 3LF1A 3JYPA 1P44A 2Q2QA 5H82A 1C3VA 1DSSG 3H9QA 2Y1GA 4GAEA 1ZK2A 4UUMA 1HE5A 3TFQA 4CMHA 4AJKA 4IMRA 4E31A 1HZZA 4YVFA 5K9ZA 1ZMOA 2O7QA 1P1JA 1TT5B 1X1TA 4UUPA 4CUZA 2VUSA 5GZ3A 3GVIA 5COAA 4ALKA 3AU8A 1O6ZA 3NYWA 1KETA 3EC7A 3W8EA 3C7DB 4MVJF 3WQQA 2QX7A 2VWPA 4OKIA 4ALNA 5L4LA 4W7HA 1R16A 4R1SA 4BKRA 3ROQA 2CY0A 1PQUA 2J3KA 1V0JA 3SX2A 4EJ0A 4IJVA 2VUUA 4IXWA 2VHWA 1E3WB 4Z9XA 3K2EA 1NP3A 4JQCA 4NBUA 2X0RA 3TOZA 3TF5A 1WAMA 1YJ8A 1NX6A 3FSRA 2B69A 5L45A 1H6AA 3RBVA 3HDYA 5TIIA 4G81A 4BGUA 3MCVA 5JS6A 4AJEA 2NU8A 3ZWMA 2VYND 1RYEA 1ZW1A 2NVWA 4IZHA 1Q1NA 1HYHA 2DBZA 3U4HA 1LJ8A 4QTZA 1LI4A 1LUAA 1WDLA 4XQEA 4OIMA 4TWRA 4CL3A 5FWNA 3E9MA 4NFYA 3AOEA 1J0XO 5JMWA 2GLXA 3JQBC 4B3HA 3QA9A 1P1IA 4R1TA 3WGZA 3RI3A 4GMGA 4WOJA 1M75A 1U5AA 1EUDA 2X6TA 1TB4A 3E6AA 3UHAA 3P2YA 3H9EO 4ILKA 4FJ0A 3STHA 5JCJD 3MOIA 1DRWA 1H0KA 4ZU3A 3V1UA 2GN4A 3K30A 3S2EA 2BFAA 2B4RO 3PK0A 1CYDA 1Z73A 2B35A 3SLKA 4J1TA 2CDBA 2VZ0A 1BW9A 1GPJA 3HUDA 1NAHA 1RWBA 1G1AA 3I9KA 1N7HA 4R41A 1ONOA 4E4YA 3O8QA 3LLVA 2PGDA 1FDTA 2NLOA 3Q6IA 2V7PA 4ZQHA 2RBEA 4L76A 1PJ3A 5DP2A 1MXFA 2PH3A 3DAFA 1KEUA 3ZWWA 1GCUA 1A7KA 2FPIA 4BNJA 2QRJA 3PFWO 4DREA 2QHXA 1VLLA 4UVIA 3H9UA 4FJ1A 5DCWA 1WNTA 4DPKA 2J3IA 4J7UA 1WDKA 1GPDG 1XKQA 3GEDA 3CE6A 4RVDA 4DIFA 1VI2A 3U4DA 2VTDA 3OFSA 5KIAA 1SBYA 5JSFA 2YQ4A 2HAEA 5IJZA 2YQ5A 4TVOA 1F06A 3RUIA 3KETA 1EMDA 3OECA 2C20A 3DWFA 2JCVA 3TZKA 4IJUA 2YV2A 4ROSA 3CTMA 4RF2A 3VDQA 2NU7A 3I4CA 4NBTA 3V1TC 3ZW9A 4NQZA 1JWAB 1LDNA 1UH5A 4RPHA 3SVTA 5L51A 4MVJM 4XYEA 1B7GO 2IZ1A 3QVOA 4BNFA 1MXHA 2E37A 3VZRA 3WS7A 2BELA 3IP3A 3GAFA 5ADHA 1L1FA 2QYSA 1NWCA 1DBVO 3WGIA 1E3IA 3WQSB 4DA9A 3RJ9A 3F5QA 4DTIA 3QJ5A 5DDIP 4OKNA 2NNLD 4OQZA 8ADHA 3ZV5A 3IKVA 2VRCA 4EYEA 3CKYA 4MVJE 4QT0A 1TT5A 2ZYGA 3PXXA 1PS8A 4NBRA 1ZCJA 2AQHA 4I08A 3E18A 5EMHA 2V65A 1ZH8A 3QLJA 4E5KA 1N1GA 4YAKA 3HNPA 4CQMD 4PLGA 2ZJ0A 1IE3A 1W0CA 5C3MA 3ASVA 5MDHA 2GF2A 3I9NA 1SOWA 2HRBA 3P7MA 1EVZA 4RVGA 1BXZA 5JAQA 3RU9A 1O95A 4E2WA 2BKAA 4A03A 4PG8A 2X22A 2AA3A 1YWGO 4NU5A 3JYQA 3D7LA 3S8MA 4EGFA 2Q2VA 3GC6A 3GH3A 4L9RA 4MO2A 1XELA 4CR6A 3IL2A 3ROPA 2FZEA 4N7RA 1NNUA 3MTGA 3W8DA 4AJPA 3ZGYA 1DRUA 4OQYA 3W6ZA 1CIVA 4ITUA 1IPFA 5HBRA 1OAAA 1DXYA 2G1UA 3DHNA 3QV1A 3GVXA 3VPGA 3DZBA 3GY0A 4Q3DA 2ZTUA 3WMWA 3LT1A 4KQWA 2I65A 4JNKA 2Q1TA 4G2NA 2EV9A 4E30A 3DMTC 3AOGA 2X9GA 3F5SA 1DFGA 4NR0A 2ZKLA 3GPDG 3RUDA 1MA0A 1YB4A 3JQFC 4JJFA 4PLVA 4BNMA 3ZNOA 2PLAA 1HDGO 1ZJZA 2OHXA 3AY6A 3NJ4A 2PA3A 3PIDA 4Q9NA 1U28A 5LC1A 4JP2A 1ZEMA 2GZ1A 3NAQA 1OC2A 3GZNB 1HLPA 2UUPA 2DTDA 5FYDA 1EQUA 4BQRA 3GUYA 5L7WA 3F6YA 2JD0A 3JYOA 4J7CA 2VNSA 3DHEA 2Q49A 4DGSA 1VJ0A 4MVJG 5IG2A 3JD2A 2Y1DA 1CJCA 5K6AC 4HFMA 3QWHA 5DCYA 4BMVA 1Z7BA 1M67A 1BTOA 3OEWA 2ZTMA 4JX8A 4ZQBA 4F3YA 3TQHA 4YJGA 1CQJA 1DAPA 3G17A 5GMOA 4WPGA 1AHHA 1HETA 2ZTVA 3C3XA 4CV1A 3GHHA 3HADA 4GPD1 2I9PA 4NFSA 4H7PA 3GF4A 6ADHA 3ON5A 2EHDA 4GSLA 4NH4A 3WGGA 4BL5A 3RUEA 5B12A 4UEJA 3FBGA 1UAGA 1FMCA 5TC4A 4BO7A 1YXMA 3KSZO 4A26A 4CLOB 4XB2A 1T1SA 1H9AA 3OJEA 1C1DA 5JDIA 4AJIA 1XR3A 4BIIA 3NT5A 4QFCA 4XR9A 4UVEA 4ESOA 2PR2A 2Y05A 3CZMA 4GX1A 3VZPA 4L4XA 5BNTA 5IN4A 4XGIA 2ZQYA 3PQEA 3U4CA 3ZHXA 2C0CA 4BNUA 2C07A 4CMKA 4FIZA 1GEGA 1JDJA 1ZK0A 3DZIA 3RBXA 3UXYA 2VHVA 1DIGA 2AMFA 4WEQA 2VQ3A 4BGIA 1GD1O 2BGLA 3DO5A 3P5SA 2YFHA 1DC5A 1IYZA 2IZ0A 4ZQEA 3VOSA 1HE3A 3AM3A 4DQUA 3VHRA 1W6UA 3WTBA 1O5IA 1LDBA 4ZN6A 5TGDA 2A94A 4TZKA 3VPXA 1Y8QA 4DLLA 5I7SA 1KS9A 2P9CA 5EIOA 1ZNQO 4E21A 2EEZA 3UN1A 1H6BA 5EN4A 3CXRA 3GG9A 2D4AA 2F00A 3GLQA 3I5MA 3LQFA 4MP3A 4LVCA 2VWHA 2CDAA 2EG9A 1F8FA 3MEQA 3O9ZA 5DN9A 3DZJA 4OMUA 2DLDA 5I9MA 3RAJA 2C7GA 1MP0A 5DOVA 2VN8A 1YE3A 5CG1A 1XWFA 1O9BA 1XLTA 1UXGA 3K31A 4J91A 4PVDA 3GVCA 3AW9A 2G82A 5G0SA 5L4SA 1YL7A 2GPTA 3H5AA 1HDRA 2AEJA 3UICA 4A2CA 5B1YA 4NG5A 4ALJA 2GUGA 4P8RA 5CPBA 2O3SA 3KUXA 3L6OO 1R0SA 4J43A 1TLTA 1CWUA 4GL4A 3KVOA 2P5UA 3U0BA 2I76A 5JYEA 1UP4A 4WE3A 3BTVA 2F1KA 5ER6A 3S2FA 3AUAA 2EWMA 3IQDB 1CETA 4FDAA 2HJSA 1E5QA 2O23A 1ISGA 1IHXA 2GD1O 1NR1A 3Q2IA 4EZBA 4TRRA 2X8LA 5EESA 1RPNA 2DUUA 4DQVA 1UDCA 1A9ZA 1LDEA 2IRWA 1YRLA 2QZZA 4O5OA 5A5FA 1AXGA 3QP9A 2JFGA 1EFLA 1P45A 3BMCB 1B14A 4IGFA 1A71A 1ZK4A 1R4NB 5ENDA 4CMEA 1JKJA 4B4WA 3KHUA 1I3NA 1YDWA 5A5EA 2I99A 2WD8A 4RPGA 5IDYA 1D7OA 1V3VA 3JQ9A 2CZCA 2RAFA 5IXYA 1PJ4A 3GDFA 3WGOA 5BT9A 4RLSA 4IQ0A 1PWXA 1T4DA 2P9GA 1ZBQA 5JDCA 3DTYA 3ETDA 4KUGA 4D3SA 4E5YA 2NVUA 1HE4A 3Q3CA 3GFGA 4CMCA 1EBUA 5F1PA 4IJWA 3SJUA 4PG6A 1U3WA 3N74A 3UOGA 1W73A 4BNTA 1HRDA 3CUKA 5G2OA 1C0PA 2HMSA 4RZIA 2HK8A 3M2TA 2IYOA 3CPSA 3L4SO 3ADPA 1AXEA 4EEZA 4XGKA 3WWYA 3JQGA 4JXKA 4YAEA 3R0IA 1R15A 4D43A 3MJEA 1BVRA 2X0IA 2AQIA 1ISMA 3IUPA 4CQLB 2Y93A 3B70A 3AI3A 1I32A 3OJLA 2QIOA 4NJMA 2BI7A 3O26A 4JROA 4CM7A 4J4TA 4P38A 1OI7A 1Y7TA 4W9NA 5A04A 4PGFA 1PZFA 3UH1A 4OXKA 4KTTE 2IDZA 1Q0LA 2QG4A 1PIWA 2NTNA 5TLSA 1I0ZA 3ZV3A 1P3DA 2XXJA 3JV7A 1YJQA 4IUYA 3A4VA 4CLRB 3KYDA 3OP4A 5A9SB 1E1NA 1RM5A 3ENKA 5T8KC 3ANNA 4ZA2A 1NYTA 1EUCA 1HL3A 1LLDA 5GY7A 3H7AA 3NTOA 3JQDA 4PVCA 4NJMB 2FPGA 1QXSA 2Y1EA 4J2OA 1Y8RA 3AY3A 4OSPA 5A3JA 1T2AA 3ZWAA 1Q0HA 4UAGA 2WWRA 2O4UX 4JK3A 4PCVA 1P1HA 4Z9YA 4E0BA 3ZU4A 5TNXA 1E7RA 3I9JA 1B0AA 5JAMA 1A72A 4WK6A 1NFRA 5KVSA 3AFMA 5DCUA 5F1OA 4JN6B 2H9IA 4IDDA 4JJGA 1I2BA 4DLAA 4B4UA 2X1HA 1I2CA 3WGQA 1YQGA 4CM8A 3D4PA 3D3WA 3EHEA 5ES3A 3U5TA 3U49A 3ZI0A 5AXDA 4YT8A 3MJSA 4QO7A 1V9LA 4P4LA 2Y1CA 4RPLA 4XX0A 3ZU5A 2NVUB 1GZ6A 3VPFA 4BKQA 3PZRA 4JBGA 4MJLA 5KJCA 4B4OA 1WXDA 1HZJA 3GT0A 4ZGWA 2WYUA 4DIBA 4CMEC 4FN4A 2B37A 3RUFA 1R4MB 2UV8A 4GQAA 4F45A 3NEPX 1NHGA 3TL3A 2O3TA 3EVNA 1E0DA 2IXAA 5H81A 2IEDA 3VVCA 4XB1A 3WIEA 1DPGA 4CM9A 4R54A 4JBHA 1K89A 2R00C 4AJOA 4E13A 4MOWA 4TRMA 4JBIA 3LC7O 3GGPA 4K1LA 4E2ZA 4HKTA 2C59A 2AQ8A 1V3TA 1BXGA 2B4QA 3D5QA 3GVPA 4RJTA 3HE3A 2B0JA 4M54A 4CLXA 4BNIA 2NV6A 5HM8A 1UZLA 1CEQA 4YAJA 2VT2A 2PV7A 3TZ6A 5U9CA 3VH3A 1N2SA 3OQ1A 5L40A 2J8ZA 3FWNA 1QG6A 5G0UA 2DUWA 4A73A 3PGXA 1Q7BA 2P4QA 2I6TA 1SNYA 4YACA 4RDIA 3OA2A 4Y6SA 1PGNA 4YAGA 4CMIB 1MB4A 4ZJUA 1UP6A 4ZICA 1U4SA 1YBMA 3D64A 4JLWA 3AM5A 2VWGA 3DMTA 3TL2A 2PK3A 4AICA 5KWEA 2BFMA 3KBOA 4XGNA 3DBVO 3HB5X 4WNCA 7ADHA 3GZ4A 1EQ2A 4BMNA 4BNKA 1P0CA 4NK5A 1Z45A 3DR3A 3V2UA 5IZCC 3ZZNA 6LDHA 3DB2A 2DC1A 3OIGA 2VHYA 3T4EA 4CLHA 5EL0A 3VPSA 1VKOA 3C85A 2Y1FA 5FI5A 4AVYA 4DMMA 2YYYA 2CSUA 5F5NA 4OYRA 3ZHZA 3DBHA 4TKLA 4IDGA 4E5PA 5THKA 4O63O 2FHSA 3T7CA 3IP1A 3P2OA 4FS3A 2HU2A 1B26A 2WSBA 2WMDA 3GGOA 4YJFB 1B8VA 1LBEA 1Y8QB 2Q1UA 1HYEA 2P91A 5KVQA 1MV8A 1P74A 3KYCA 5BNFA 1YKFA 2ZB7A 2GN8A 3KOUA 1PQPA 3BYZA 3HN7A 1B8PA 1AUPA 2FPPA 4HADA 4XRRA 3WICA 3B1JA 1ZXBA 2A4KA 3EDMA 1K3TA 3JD3A 4R5HA 3FNHA 1I3MA 3ZWVA 1NQ5A 1KVSA 3H5RA 4AJNA 1FK8A 1GADO 5AOVA 2UVDA 3JQBA 1XDWA 5JY1A 1KEPA 4BNGA 4RF5A 1RM4A 3F47A 1LDGA 1U7TA 1PL8A 1PR9A 3DBLB 4EJ6A 4M87A 3PIIA 1VSVA 5KJFA 1NBOA 3DQPA 4BQPA 3FPCA 4IQGA 3RQSA 3KV3O 1WZEA 3PFFA 3AY7A 2DFVA 3K92A 2JD2A 5IN5A 1N7GA 3QWIA 3RUCA 4CUKA 5JPIA 5A4DA 4DMLA 3L07A 3EAGA 4J0FA 1LRJA 4YJGB 3EW7A 5BSHA 1DC3A 1GZ3A 4WLOA 1NQOA 3PRJA 4BB5A 3EY4A 1TT7A 2OO5A 4RV9A 1JAYA 2POQX 3L77A 1EE9A 1E92A 4R3NA 3JQCA 3ZNPA 4QQRA 3RIHA 5DT9A 4KTVE 1WP4A 4OAQA 2JCYA 1PU2A 3U09A 4K28A 4DPLA 5COBA 4Q3AA 2I5PO 2W2KB 2GNAA 4PZCA 2WYWA 3ZN2A 4PLFA 5EINA 4LCJA 3EYWA 3K2BA 1YL5A 2TMDA 5B37A 3IIEA 4AJ1A 4E6PA 1PZHA 3A28A 3QHAA 4IS2A 3IS3A 3SJ7A 3VVBA 3V1YA 3ENNA 4LISA 1BHSA 1GEEA 4J1QA 4LRTB 4WLNA 4Y8VA 4YJFA 5CEFA 1T26A 1JN0A 3DZGA 1E7MA 2DTEA 3BXXA 4II2A 4INAA 3WSWA 1TA4A 4PLTA 3C8MA 3CH6A 4N5LA 1Q0QA 3ANLA 2E48A 2I3GA 3INRA 3JQAD 5CP8A 3NRCA 3G1UA 3D5TA 1QV6A 5C5IA 3ZU3A 1Q7CA 3WJAA 1DIAA 3PP8A 4I9HA 1V6AA 2ZYAA 1U2GA 3KEQA 5DZSA 4QUKA 4BKPA 1O89A 2JFHA 2PWZA 3IJPA 4GVXA 1Y9AA 2WD7A 4FFRA 2BFOA 4S3MA 4LK3A 1NVMB 1HSZA 3KXDA 3WGYA 3TN7A 3I6QA 2ET6A 4BO5A 3G0OA 3HG7A 2P4HX 2DBVO 1MX3A 4J6FA 5DBFA 3BHIA 4I5DA 4Y98A 1X13A 3VH4A 1T1RA 2CUKA 3AWDA 1M2WA 3BHMA 3H2ZA 3U3XA 1B8UA 2EJWA 4OHUA 3WFJA 4BO4A 3B20A 1FF9A 4QO8A 4I9NA 3LC2O 1BVUA 3B1KA 3LT4A 3RC2A 3K73O 4CMGA 2WM3A 2C5AA 5JLAA 4DC1A 2C5EA 4DYDA 1HDZA 1E77A 3AOEC 4Q3BA 3A14A 3F3SA 4HBGA 1GFSA 2Z95A 3E48A 1BG6A 2PKQP 2FR0A 4CR7A 4BNYA 2HQ1A 3HDQA 2HMUA 2CMDA 2NWQA 4CQMA 2NQTA 3WR5A 3DBHB 1BDBA 3Q9NA 4PLYA 4PLWA 1Y81A 3JTMA 4D42A 4LRSB 4WCDA 3FR7A 4M49A 2YZ7A 5T6BA 1ULUA 3ZV4A 4FPXA 4YAIA 1LSOA 4PZDA 3LT2A 3CINA 2ZTLA 1X0XA 5AXCA 3GQVA 3GFBA 1GV1A 1EDOA 1VJ1A 3BMQB 3RCBA 2VHZA 5F5LA 5CFZA 3FR8A 3GNSA 3WBBA 1X7HA 2BGMA 4CM8B 5TS3A 1OFGA 1V3UA 5A9RA 5IDQA 3RSHA 3JQ7A 1DC4A 5B4VA 1U4OA 4G65A 4U8GA 1R0KA 4IPTA 2P5YA 4FSHA 3FNFA 4KP7A 2NVBA 1U8XX 4E2YA 1A4UA 3KTDA 4W4TA 1BW9B 3ZWPA 4PLPA 1IB6A 4C7KA 2C82A 1HEUA 1MG0A 1EVIA 2X9NA 4EI2A 2YFQA 3W4JA 4CLEA 4ZRNA 4R01A 1JA9A 1BRMA 1KYQA 1QLHA 2NSDA 3H9GA 4XIJA 1WMBA 4E12A 5I7EA 5CAEA 1GY8A 2QW8A 4PRLA 2FR1A 2ZATA 3U9LA 3R3SA 4OOFA 3FWZA 4S1VA 2XF8A 3GK3A 4MKZA 1Z82A 3WLEA 4EEXA 5IXSA 3GGGA 5JC1A 5TSDA 3JQ7B 3ROMA 5KVVA 4BHTA 1P0FA 3PHJA 3OM9A 5JCJA 4XZ3A 4P4GA 4WLEA 2Q4EA 2DBQA 4UUNA 3PJGA 4GX2A 4NBWA 4WECA 4BGVA 4A0SA 4BNWA 4YCAA 3L0DA 4MVJH 1I10A 3QVXA 2VTEA 3WQRA 5I8WA 1U9JA 1TXGA 3GN2A 5B4TA 5JO0A 3TZHA 5G4KA 2DTXA 5L53A 1ISJA 3ADOA 2AQKA 1PJ2A 2IEBA 1GYQA 3GR6A 1IULA 4K6CA 1KVTA 1QORA 4FFLA 5U1PA 1FXSA 2HKIA 3WB9A 1PZGA 4GBJA 4AJ4A 3DBRA 1TVEA 3JCZA 2I67A 1XYGA 1NVTA 3GNTA 3G49A 4J9UE 3WOHA 2GCGA 3AM4A 3BAZA 4GX0A 4OJNA 4WEOA 5G4LA 4AG3A 4URFA 1SEVA 3RFTA 1JLLA 3WLFA 2BI8A 1DHRA 3C7CB 2C7VA 2QQ5A 1ZSVA 4Q3CA 1DO8A 3H8VA 1XIVA 1P1FA 1DC6A 5FFFA 4CV2A 1C1XA 1DIBA 3K6JA 2EW2A 2P2SA 4RCVA 5TX7A 1QMGA 3NJ8A 1H2HA 2GASA 3CMCO 2ZJ1A 3KYDB 2ILTA 3GHYA 3WYBA 4ALMA 2J5KA 5HS6A 3OBBA 3PYXA 3TZCA 1WMAA 1VC2A 5I9NA 2GERA 3KEOA 1ORRA 3RROA 4GKBA 3LF2A 1D4FA 4E33A 2DFDA 1OC4A 2X7HA 5K6AA 3RUAA 3RKUA 3VH2A 2BF7A 3QWFA 1R12A 1T2FA 3T7EA 4BO1A 3JQEA 2WEKA 1D1SA 2ZQZA 2DKNA 2EXXA 2RHCA 3E82A 1LU9A 1XU9A 3DAGA 3JQGB 1KY5A 1YH3A 3BA1A 1GQ2A 1E7WA 2FN7A 1JKFA 2JFFA 2QZ9A 5JY6A 1VL0A 1NQTA 3U62A 2W8ZA 2HK9A 5IDWA 1C0KA 2CVOA 1WWKA 3QY9A 2VNAA 3ORFA 4AJJA 1KOLA 4D7AA 1VL8A 1QKIA 3GEGA 4XD2A 5JBIA 1IPEA 3NTRA 4RZHA 3I9OA 3QW2A 3OQ6A 1X15A 2NU6A 1E7YA 4ND1A 4TKMA 4Y6PA 2FRDA 2O2SA 2XOXA 3H6KA 3NT2A 1PGJA 1QYCA 4XIYA 3WX0A 4B7XA 4R5MA 1GDHA 3V2HA 1YO6A 4A5OA 4P22A 5C37A 1ZO8A 2NTVA 4PLCA 3IC5A 3OICA 3UW3A 1SOVA 3K5PA 5G0TA 2JD1A 4ID9A 1F17A 3L4BA 4J9VA 2CVQA 2B5WA 5HRUA 4HXYA 1Z75A 2WDZA 4B7UA 1HDCA 2JJYA 2YDXA 4C7JA 4PIVA 3JD1A 2R6JA 2P9EA 3L9XA 4W99A 1I5RA 2J6IA 3MWDB 4F6LA 1X14A 3JQAB 3I83A 1I3LA 4FBGA 5FF9A 1AHIA 1VPDA 3ZWNA 4CM3A 3I1JA 4RVUA 1L7EA 2X86A 3FBTA 2WD7B 5IZ4A 1JKIA 2CNBA 2GO1A 3DZKA 4WASA 4ZQGA 1YONA 4CODB 4AFNA 4DPMA 3AUTA 4NHEA 4RPKA 4RQUA 1E1LA 3SXPA 4TROA 4DLBA 1WLYA 2JHFA 4FJ2A 2B5VA 2Q50A 4L0QA 5F21A 4C4OA 3BMNA 4FD3A 1ID1A 3ZV6A 2CFCA 2EGGA 3F4LA 2EIHA 1B2LA 2HO5A 3MJVA 3VTZA 4YT4A 2IYPA 4D3DA 5KCZA 3FD8A 3ZW8A 5HWSA 2DAPA 3C7AA 5DNAA 2BD0A 4H3VA 3MZ0A 2PKRA 2W4QA 2D5AA 4W82A 4PZEA 1UAYA 1GYRA 2Y0CA 4IDEA 2O3JA 4GGPA 4HFJA 5BR7A 3V8BA 1F12A 4ND3A 5ENVA 4U0KA 4H15A 1UDAA 4BNHA 2DPGA 2OBYA 1P77A 4RVFA 2O50A 2X58A 4EW6A 1ULSA 4RL6A 2AXQA 1FDWA 3C1OA 2D59A 3JQ8A 4B79A 3INGA 4IQ8A 4KUEA 4YQYA 4Z3KA 3PTZA 2H5LA 1PGPA 2PNFA 2VZ9A 1H9BA 5TRTA 1ADBA 3LDHA 4J7XA 3HB4X 4WUVA 4A10A 5IDXA 1EVJA 3ZNNA 3GAZA 3F4BA 1U8FO 1KC1A 4FGSA 4QFDA 1D3AA 1GZ4A 4N18A 2V6BA 1CDOA 2VHXA 1Y9EA 1LLQA 3SC4A 2AW5A 1YBAA 4BKUA 3VDRA 4Q3EA 3JQ9C 1HXHA 2WTBA 2G0TA 4NJOA 3RVDA 3LC1O 2FSVA 2JCXA 1HT0A 1UDBA
chains in the Genus database with same CATH superfamily
3OT5A 3E5HA 4J1SA 4RSMA 3TTWA 2HT1A 2OZLB 3JQQA 3L8FA 4LTNA 4BVHA 2OZPA 3NGLA 2XIJA 1EYZA 3Q85A 4YEDA 4E46A 4D4MA 2AJTA 2AKEA 3KBBA 4DZTA 2HWWA 5ITVA 3H75A 1Z2EA 3RH0A 1PQ4A 1VFNA 2R1VB 1OOEA 5FWYA 3IP9A 1ORTA 4PC2A 4ZEOA 2XV1A 2PKCA 1QRDA 4PG5A 2FPXA 2Y68A 4OP3A 4C5BA 3LD9A 4Y2TA 4ZOAA 4B3GA 2BCJQ 2QTHA 2X6RA 4O4IF 3FF4A 2YRFA 3L82B 3RAGA 4ZV4A 1NI5A 3VNAA 4B83A 1ODFA 1RCFA 2AMLA 1CRQA 1YBVA 3FTNA 5EKSA 5ELLA 4XWKA 1H69A 3BFVA 4UOEA 4GXRA 5IWCA 1PS9A 3M33A 5AXAA 1N5DA 2LBPA 1QTNA 3UT0A 5J5AA 4QUAA 1WBBA 4PYJA 4C7OB 2O3UA 3AEKB 3EVFA 2XCLA 3IPCA 5K0LA 5F98A 1OZFA 3FN4A 7GPBA 4YT5A 1NFFA 3KQSA 3WIOA 2Q4BA 4BWFB 4URWR 2AWOA 3GA5A 3S8EA 2VBCA 5F23A 4FFPA 3QELA 5FTMA 3X2EA 2MINB 4EPWA 1XNQB 3RLIA 2REXB 2VOJA 2W0SA 2QVBA 4QFBA 1N78A 4C3UA 5F1KA 1MHTA 1MH9A 2HLHA 1G7SA 1RWQA 4JZYA 4IY1A 5EIBD 2G09A 3N8GA 4X1KB 1YTLA 5JUWA 2R5FA 1L5LA 3MELA 4KYUA 1G3QA 5J40A 2J3LA 2ZPAA 5FTLA 1NNEA 1YR6A 2OCKA 2XYQA 3EWAA 4J1NA 4CM1A 4DCOA 5CT4A 5KS2A 3N0WA 4OI2A 4J0EA 4EY5A 2I71A 5AJYA 2R8BA 4MNTA 2HEGA 4RVOA 3IT1A 3TRKA 4UHBA 2QN1A 2PZMA 3GOHA 4PO8A 2WG1A 3K0CA 3ZWYA 4QJ3A 2MU1A 3FGZA 1UBLS 3U31A 4BYMA 1C5KA 2B8NA 4N54A 3C16C 1W0KA 3SC2B 3M6WA 3VTFA 3U6KA 1D8AA 3OQIB 1KGDA 1NN0A 4ED9A 4PN3A 1NIJA 2OR3A 3EGOA 2FSPA 4IIVA 1M76A 3DAPA 1X7WA 1PL6A 2BFWA 5BRNA 4G01B 4OQQA 2EFHB 1RC0A 2A67A 3PZBA 4AWXA 2B4AA 1DOHA 4P35A 1UODA 2YX1A 3KOMA 4DL9A 1HQKA 2VCYA 8ABPA 6ABPA 4K26A 4KWIA 5K51A 1LVUA 1C3XA 1T2CA 2YW9A 3VC1A 5FEMA 3RS7A 2EBHX 3I2KA 1I3KA 2V6GA 3LBAA 3OIDA 3OUTA 4MVWA 1AY0A 4LZAA 4P4TA 2IOQA 5HA5A 4G24A 1OFVA 4C76A 1U9IC 4F85A 5HZKA 1XYVA 1YRQA 3GJ8A 2ODEA 1FPMA 2Q3EA 4UUOA 3TBFA 3UCFA 3U9TA 3RUHA 1T2VA 1QVRA 3I9LA 2ZPTX 4QULA 1T9KA 1FYEA 5HS4A 3S8YA 4R0NA 1EFRD 2JAHA 1GLGA 3H1BA 3OJCA 4G97A 3VH1A 1JQDA 2EEPA 4CMAA 2GZ3A 1P4RA 4UBNA 1ZM7A 4MCAA 1OLUB 3VR1A 5BNIA 3QQPA 3EVTA 2C88A 4II3A 4NYJR 3ID6C 1X70A 3B9BA 4AJLA 2RHBA 4DXDA 1E79A 4NBSA 4YC7A 1WZCA 4CUJA 1FDSA 5JJBA 4UVDA 3NQ41 2B6NA 1CUSA 1H66A 4JYAB 4QFMA 4Q9DA 3JD4A 1P5RA 2AOUA 3Q0TA 4LGVA 3W8NA 3CLHA 3GRPA 2ZSJA 4I5EA 2F3TA 2VHEA 5JD3A 4H3SA 4PFSA 5AW5A 4DZRA 5I7VA 3ZHQA 1ZI8A 2GXAA 2P1RA 2V6IA 5IAKA 4L5AA 2X4DA 1TK2A 3NTQA 5C5DA 1B1AA 4JL6A 4DV3B 3CR7A 4JR2A 3ZGXA 1UPFA 3SXUB 1A9RA 1RXYA 1J0BA 4MP6A 3U7GA 2ZSKA 3QTBA 4B8WA 5G41A 4V0LA 2QT9A 5HK8A 4YDHB 1B6TA 2E4UA 1GHTA 4XTRA 3NG1A 1NRWA 1E3JA 1JHOA 1CS0A 3ELDA 3GPIA 3H2HA 3F46A 1HF3A 3A4LA 3G0CA 4J1TC 4ZAGA 3ZDBA 2C2KA 4MWOA 5J2TF 3I5AA 4IVQA 3VV2A 2O8EA 3EC2A 2J4CA 2DYKA 4D9FA 1NULA 4C21A 4C87A 5BSGA 3CT6A 2IYUA 3PEFA 4OQLA 1EZ4A 1YIAA 3FCSB 1WMFA 2I66A 1DIRA 3GG2A 2FNAA 1G0NA 1P9WA 4WAUA 3M6LA 5WRFA 1RHJA 1X1AA 4AO7A 4AS1A 2GCOB 4M1ZA 1UXHA 3CSDA 4NU8X 4QEKA 4QHSA 3VR2D 3VXKA 2QENA 3SXUA 4LC9A 2XOEA 1KBZA 1CRWG 3X44A 3C24A 1NG9A 1J70A 1QK5A 3QOYA 3V42A 3A25A 4DQKA 5EERA 5TQ2A 4BLPA 1LFAA 1QB8A 3AHCA 1PHRA 5E2IA 1I24A 3AH8A 1C7ZA 1T3LA 1ZX1A 1HH4A 1SD1A 2B1RA 3JWIA 2OTCA 5ALZA 1QV9A 3D4OA 4CLRA 2I55A 2YY7A 3FPAA 2AJLI 4MGIR 4Y7CA 4ZODA 3JRXA 3WLRA 1P33A 3OUZA 4B3XA 3BRWD 2WU3A 5LD2C 5AKXA 3A2KA 2WYHA 3ZZTA 1V37A 3M9LA 4PPYA 4R1LA 2WWTA 4WKGA 4FYHA 3HBMA 4ZGBA 3OLYA 2WVJA 1BA3A 3ZIAD 4IDCA 1G42A 2JKVA 1ZK3A 2G70A 2WF7A 1XALA 2W37A 3I4FA 4MYCA 5HW0A 1HT3A 1RHUA 1ESZA 1XZBA 3KO8A 3TVTA 1SPXA 4RHYA 2V3VA 1KI8A 2D74A 2JG3A 4CIYA 1KDPA 4KKVA 3LIPA 4EQ6A 4ZZ0A 4QBIA 5CURA 1Q95A 3K9CA 3QVSA 4IICA 4UFOA 4L5IA 5AJXA 1RXVA 1NPYA 1AN0A 4ZT3A 3LQKA 2M1ZA 5FD8A 3PCTA 4XQGA 1YB2A 5FLKA 4CDNA 1LQUA 1NQAO 5AKGA 5FOUA 4LECA 4E5UA 4M9ZA 2B4KA 1YULA 4CFYA 1SHTX 1YBHA 1VG8A 4C1NA 4BLSA 3AVPA 4JVNA 5F7ZA 1U7HA 5LP6C 1ISHA 1X8XA 1J8MF 1BVHA 2PN1A 1SR8A 3PFCA 1BN6A 1WR8A 1J06A 4KPUB 1KJ9A 1ZJJA 1GPBA 4JT2A 5I45A 4S2UA 1OASA 2OFOA 3U17A 2ZYSA 1FRQA 4OHYA 3BEOA 5CXUA 3QKUA 5GTDA 4QPDA 4FZ5A 2CD9A 4P9NA 2GFHA 2ZB3A 2RJNA 5BOVA 1A5TA 3OEYA 3IV7A 4CM4B 1U2ZA 2PMWB 2VZLA 3VVMA 1NVVQ 1ONPA 1K5HA 1VLMA 3DS8A 3QWBA 1HDOA 3T54A 5IJ0A 2QSJA 2V6FA 3GLKA 4XDGA 5BN5B 3FHLA 4O4JA 4YMGA 3FYHA 1EEHA 2Q29A 3MJFA 4XCVA 2NP6A 1Z34A 2QP9X 3NNSA 2I3ZA 4LF6B 5BV2P 1ZOPA 3M1LA 4LYAA 1RU3A 1MO4A 1Z2PX 5CDUA 4AKHA 2CEAA 3N7UA 1DHTA 2PEYA 2PYZA 4QTUB 4L73A 4UBJA 5IJAA 4TWJA 3RK4A 1D9XA 1KDOA 4D45A 4NBVA 4HNTA 4PQEA 1W1WA 3NHSA 2WA1A 1UMCA 4OUDB 4PAQA 4AC9A 1ABBA 3ZJUA 4RJJA 4XA8A 3V00A 4DKJA 3QBDA 2MDTA 3BK2A 1JBKA 4UDOA 1ZD8A 4ZOEA 5AVTA 3HPQA 1V41E 3NT4A 4FR5A 3H19A 2NP7A 2OOSA 2GJSA 4ARZA 1CUUA 2XMRA 1Y1LA 3G2JA 2VR1A 4RTJA 3ASUA 4INZA 5DP1A 1E9AA 1OF1A 3EXFB 5FA6A 2I91A 1MTZA 1X94A 4RYDA 1K8YB 1ZSNA 2DUJA 2WF8A 3A9WA 4QQNA 2CT8A 4F06A 2ETXA 2QMQA 3EE6A 5LMNB 5IVPA 2IP1A 3LUCA 3ZUGA 3EPPA 3RVOA 1Y82A 4KH1A 4BO8A 2AN9A 1H6DA 4MVYA 1F4PA 4D3XA 1NBMA 4NCNA 3SEZA 4CTJA 1ZM4A 1GM5A 1DTWA 3C1AA 5EUMA 5HCUA 3OCVA 3UK1A 1YR8A 4QECA 5B58T 3EXEA 2P2GA 4CHGA 4E5VA 1JEAA 4MRVA 4Q4DA 1EX9A 5D5HA 3TQRA 1N6LA 3FY4A 3B1FA 1B2RA 3PNQA 1ZS9A 1YS7A 2JGDB 4ZVSA 1G4HA 3UUEA 4PX5A 5IASA 2CL6X 2C2OA 1XMJA 3ZWXA 2XB8A 1A4IA 4AO8A 4TLBA 1T3HA 2QRKA 2VUIB 1UR5A 2Q5QA 3GUHA 1JPNA 1B3RA 2BFEA 2BGJA 3GJ7A 1NBAA 3HGTA 4NS4A 4HVCA 4Q7QA 4IILA 4BJ1A 4HH3C 4FOOA 1EVKA 2YJ3A 4ER7A 1A4RA 3A1EA 4O4HB 5L9AA 2ZIUB 5K3OA 2PR7A 1J21A 1JG4A 4RCYA 2XPCA 3TVYA 1UP7A 2VAWA 3FOBA 3DVLA 4Y6RA 5M2QA 1Y37A 4TT3A 4JI3B 1S8AA 5LN1A 3H2SA 1ZSYA 4DLPA 3PG5A 3U3RA 4BMZA 4DCMA 4OHBA 1AKQA 4TL7A 3GJXC 4BCCA 2X42A 4R7GA 5KSWB 4M8SA 3F3YA 3VGPA 4BNZA 2FVYA 2ZIZA 1PVOA 3OQBA 3N6VA 3D2LA 1U2PA 5D3ZA 1CZUA 5ICFA 1BSVA 2XGGA 4URXR 5JSQA 1FYWA 1S2MA 2HU7A 3ZG6A 2YFYA 3LW7A 1DXOA 5DYGA 1RHQA 2L18A 3T3IA 3ZE8A 2ATVA 2HMTA 3W3AA 1EGVB 3U2QA 2HCTA 3QOWA 3IDOA 3IAEA 1I6WA 2RK4A 3DONA 4IF4A 5BSKA 2YZKA 3SJAA 4A36A 1FFGA 3VSDA 3JQ8B 1PJRA 2PJRA 4LQCA 3D6NB 1K92A 1O7JA 2A5JA 2TMYA 3CX3A 1NSTA 1Y5NA 2DLCX 1FEZA 4UHHA 5F7OA 4PZ9A 3NKFA 1H1TA 4BWGA 2GDZA 5FEUA 1K6XA 1MIOB 4LNHA 4CLDA 1AA6A 3DZHA 1PL7A 1FMLA 3USES 3VJLA 1C7QA 1HYGA 3GJYA 3CJRA 2UZ1B 1UBUS 2JEOA 2MJLA 2VF4X 3KLBA 4R40A 3O3NB 1SXJD 4WKPA 3VI3B 4WY5A 2RCNA 1CUYA 2EKPA 2R2AA 3EQ2A 3PHIA 4QOHA 1JX6A 2BBOA 4AW9A 3BREA 2OILA 3CR3C 1ZNYA 4U2EA 3D1VA 1DB3A 2VNJA 5E9QA 4AXBA 4RTLA 3BMNB 3ZNQA 1KEEB 1R8SA 4HPJB 4IGKA 4M1EA 2XAAA 4LYYA 3J81A 2IEZA 2EC5A 2GT1A 2WAOA 3N5CA 1X80B 4FGLA 4JLPA 4I1PA 2D2XA 3HDGA 4REQB 1PRYA 2ODAA 2FE4A 1N8SA 4L28A 4BP3A 4I50B 1IATA 2VXOA 4CI9A 2Y1WA 4E3ZA 5JYDA 1EM8B 5JJ5A 3TTSA 5I9LA 3VZCA 3AEZA 1K9SA 1MDBA 2VJMA 5AK4A 4B81A 4HDCA 5IAAA 3K9BA 4IS3A 5BQFA 4ZCSA 5LNK6 4X00A 3DBLA 4QU8A 4C4SA 2QD4A 5HDQA 3CGWA 3FPHA 2YV3A 1R9NA 3NTLA 1NC1A 3U37A 4DRYA 4P0PB 4ENUA 5B3AA 1Z6AA 4TMKA 3UJ9A 4BB6A 2YXBA 2J9FB 4G1VA 4DMGA 1E7SA 5HIAA 1Y6FA 2P2YA 4E3WA 1CB0A 4ZT2A 5U4QA 3ER6A 5IS2A 1RM3A 4PGMA 5GINE 1XEAA 1PSZA 4AJ2A 3O4HA 3TRFA 3IEIA 1VB3A 3CS3A 4HRAA 1CDZA 1SZCA 4TLAA 5AW8A 3QPVA 1H23A 3ONNA 3BAFA 5IJ9B 4NTZA 3KXLA 4P93A 4MI3A 1GR0A 1AM4D 2EIXA 3IERA 3KYCB 1RJ9B 5AK6A 5AXBA 3TDKA 3TUZC 4DDMA 1WTCA 5ALPA 4BEJA 2YXPX 2CFSA 1XAHA 4ZRMA 4FYMA 1ZOLA 5A03A 1GUZA 3SDZA 1PJSA 3U4QA 2CGEA 4IFEA 3LC0A 3GEHA 2P9ZA 2XUDA 4Z0TA 3UMJA 3UWDA 4BZQA 1F3OA 1NUUA 1N5IA 2QPAA 3ZWOA 2JI6A 3DAOA 2A88A 4EHBA 3GQBA 4EI8A 3BICA 3OKFA 4QDXA 1BMFD 1COWD 2BEVB 2BM1A 3FPLA 3WWPA 4AX8A 5K4HA 1G16A 2CJWA 2ZIEA 5C31A 1AK2A 1N3LA 1BO6A 2BHRA 3FI0A 4TV9A 2Z9CA 1XTKA 3WZLA 3HO1A 3VC2A 1BVYF 4DRXA 1VL6A 2EZTA 3DM9B 4KVAA 2FMUA 3H3XA 1K5DA 1Q7EA 5IW8A 2IT1A 2W6OA 3D8NA 3S2UA 8GPBA 3ZQ4A 3D4IA 1HT2E 2WV9A 1JW9B 3N8KA 4F4CA 1Q1BA 1VMEA 1YVEI 1PDVA 2V8BA 1WW2A 2QDKA 1Y9ZA 3AB8A 5FUYA 4ZDJA 3F8TA 4RTQA 4O6VA 1P4AA 2IPAB 2R97A 4D41A 1PD0A 1O6GA 2ZYIA 3D43A 3RIYA 3RRBA 1JBQA 3HXKA 3Q0EA 3EGCA 1AZTA 3RWBA 3VHXA 2NMVA 2JHGA 1FFBA 4UXJA 2BHSA 3ZU2A 1Q0ZA 3GCDA 3RARA 2D7DA 4L0MA 1UWKA 1XB2A 2ZIXA 2RH5A 3D8BA 3TW4A 3M89A 4KOEC 1LNQA 5KYYB 2XB6A 5K6RA 4G1EB 4GD3Q 2L17A 2F48A 2Q2OA 3NM4A 4AS3A 3EC1A 4GE0A 3TPCA 2ID7A 3TBHA 2ATIA 4YRAA 1K75A 4ALLA 2B3TA 2I4OA 2BFPA 3RODA 1Z16A 2ZCJA 2ZWAA 3IXMA 3BTOA 1VCNA 1IMOA 4UOQA 2PD6A 4JYZA 4WQMA 2JFQA 4YMIA 1VG9B 2HRZA 2WTXA 1T24A 3DT8A 4W9NC 5KNDD 5F3RA 3A6HA 4FN5A 4OO3A 3VYUB 2EKDA 2QBYA 4KLRA 2Z1NA 1IL0A 1Y9DA 2D5CA 1NW4A 2VDPB 1F1JA 1L7RA 4FHFA 2V5VA 3W2HA 3DBRB 4CKWA 2BE9A 2Q3LA 5E1BA 4EI9A 1HEIA 3KQLA 4MI6A 4D5EA 2FFRA 4JLUA 3GDOA 5IBCA 3HJHA 1C4OA 1VRWA 4RH1A 3BK1A 1MPXA 2HQSA 1HGXA 3O03A 1G5HA 1JJVA 1JR2A 3HZHA 3PLNA 5IWAB 1LC3A 1LI7A 3QPBA 5B4UA 1VL2A 1XXHE 3HP4A 4MGHA 3REQA 3IQWA 2PWAA 1G8AA 1DLJA 1YBFA 3I28A 4X45A 3HR8A 2YJ4A 5J59A 4U2GA 5H83A 1XDDA 4UBOA 5B6PA 3TCXB 1KWKA 1NJ8A 1ZG3A 1TEHA 1XFDA 1JKXA 4MWSA 1JDBB 2FPIB 3AONB 3H17A 4WN9B 2H4YA 2OAGA 2A35A 1IHYA 4D25A 5EJAA 1UKZA 3HVRA 2DM6A 3R23A 3KCQA 4UUBA 5IBPA 2CXNA 2RGGA 1XMSA 1QRRA 4FGZA 2CNLA 1SCUB 2E9SA 4OSEA 3WDMA 4J16A 5FPKA 3O8QB 5LFAA 1UJCA 3UF0A 4A2QA 4EHLA 5ITWA 4JWTA 3RG2A 2ZZKA 1V47A 1YQQA 2PL3A 3MS2A 5JE8A 2CMKA 1DAOA 2JLAA 2ZPUA 3JZDA 4MVCA 3CRW1 1XJ5A 2DWCA 2JLQA 3ZI4A 4DLRA 2RGEA 4POOA 3L7YA 4Z49A 3G2KA 3Q7PA 1K2WA 1A88A 1NQXA 1N36B 3PL1A 1O08A 1POWA 1M2EA 1VP3A 4N5MA 2GAIA 2QZPA 4TXJA 2HHJA 4WLVA 5JZBA 4RKFA 1LCIA 2H85A 3DMPA 3LYLA 3MRXA 5AVJA 5FO1A 3H99A 3D8RA 4N5HX 1E1CA 1QFSA 3H6HA 1I4TD 2GD2A 4L4YA 1CEEA 1JQBA 4D0RA 3K9QO 2LIVA 4CQLA 1GQYA 4FI3F 3E9QA 2H00A 3Q9UA 2ID8A 4RHCA 5BSFA 3FTDA 3K2QA 2K5UA 5KDOA 4KXXA 3EJWA 4NS1A 1YRBA 3OT1B 1NXQA 1M8FA 1U3VA 4OGWA 2ZZMA 1XI2A 1XLWA 3OTGA 2O0HA 1O6BA 4MIEA 5ARCA 1SKAA 3JVUA 2X8WA 4EGQA 1U9YA 4O2BA 2ZREA 1C50A 4TQ9A 4WXYB 4KGVA 1Z47A 5IABA 1E9RA 2LDXA 2QXUA 1YB1A 2ZSUA 4CODB 5B6JA 1VHDA 5G1PA 4QXAA 4J0JA 5HRAA 1NJGA 1G5TA 1E32A 1TM1E 4YJHB 3BZBA 4BO3A 3Q98A 3EEYA 2G25A 4I5GA 2PUAA 3DLCA 4NV0A 1E4VA 2E4WA 5ESXA 5FPQA 1M6NA 1BROA 1FQJA 4TWIA 1RAGA 4UMDA 2GETA 5L7YA 3O2QB 5LQKA 2BHLA 4IFTA 3EFOA 4GL2A 2F9LA 4H35A 4OFZA 3RYTC 1R6AA 1NLYA 3HWRA 2PKEA 4F4HA 5K8LA 4UEKA 7MDHA 3FWKA 1TAHA 3T9FA 2JLZA 3P94A 3A3PA 1J2JA 1XMIA 1X7ZA 3UAXA 4JP3A 4S0XA 1J8VA 1KEVA 3ZJTA 2G63A 1TRHA 5ABPA 5LP6B 1Q0TA 1LBTA 2HRRA 4X60A 1MLDA 1Q1QA 5LQRA 2RGUA 3CH7A 2WQZA 3KXPA 3MMPA 2HMWA 3WGHA 3WO0A 4H6PA 5D5QA 3U3KA 4ZJPA 3D4LA 1YOVB 2YVLA 3IEVA 1JILA 2FLWA 2QN2A 3SVLA 2AG5A 3SQWA 2Q3DA 1FQOA 3RLFA 4HVAA 3JRNA 2J5XA 2TYSB 4HSGA 2P40A 1F14A 1WPQA 2W2XA 1LSSA 3PHHA 5JCOC 2WLSA 1LK7A 3EVCA 1EG7A 3Q4GA 3NWBA 3H2JA 3I2YX 2VRBA 3O4IA 4IV0A 3DPSA 5HKKA 1O0CA 5KNBA 1TIBA 3LZCA 1UC8A 2JVKA 1K5GA 1PUJA 4F92B 1CY1A 3TLZA 1IXRC 3V33A 5TT1A 3WKEA 2ZYDA 1KO1A 1QOQB 2G9QA 3LOQA 1UBOS 5ESDA 5EZQA 4AURA 3IMCA 3E3LA 2QL6A 4CZ2A 2CVHA 2Y1XA 1RQXA 1NVWQ 3ZX5A 1GU7A 4G4IA 1IBCA 5E4TA 4X84A 3M4NA 2DT5A 2AUNA 2BSXA 4KAAA 3KKMA 4TKZA 4KQ9A 3UVEA 2J31A 1IONA 3HI6A 1LW7A 4KX3A 2NN3C 4GZ3A 3K9WA 2YFKA 3DE2X 1HI9A 5F7XA 1OT3A 3GFPA 4M89A 3PICA 5LXTA 1YDFA 3PQ2A 1MEJA 2XB9A 1XMXA 1WMEA 3O90A 4H31A 3SP1A 1VSUA 4WZAA 1XCGB 4YCJA 2K2QB 1U8ZA 1Y89A 1ZIOA 3STUA 3WRXC 5JI2E 2YINC 2JCBA 2Z5VA 3T34A 2IPMA 4EG4A 2NYVA 2QPOA 1OWPA 4RY8A 1ZXLA 1AK1A 3AUSA 4RXMA 1IG3A 3LUPA 1Y80A 4LHEA 5A6VA 4FFMA 1GL3A 4NFHA 3MRSA 4MW2A 4NIMA 3B5IA 4YRJA 1IVSA 2HBYA 2CL5A 2DRIA 1GXSA 3ITDA 1AMOA 2RHHA 3TCNA 2PUJA 1OHHD 4Y2QA 1AGYA 2OV4A 3TOVA 4QXOA 5DF1A 1H2YA 4OQNA 2F3QA 3NHJA 3ICOA 3PI7A 1HTBA 2PSEA 5EP4A 3LTNC 1O94A 2CVPA 1P61B 1KXZA 3BCRA 3C1TA 4ZCRA 1KZYC 2WU1A 3HY6A 2C2HA 3K1YA 4DBZA 5B1HA 3S99A 3CF4A 2LCFA 3G1WA 1PK7A 2CL0X 1QE5A 2QRPA 3AKDA 3PKIA 2IYQA 5IP5A 1QP0A 3FOWA 1XZAA 1UBFA 1VHQA 3P0EA 4ZYUA 4M6WA 1YD7A 5AP9A 4DNQA 2G5GX 3K32A 3BL6A 3AINA 3NALA 1LPBB 1M6WA 4OJYA 4P2BA 4WCFB 1C30A 2RG1A 5AI5A 5IYZF 4EOGA 1SG0A 4OJMX 3NTXA 4H0FA 3CBGA 1U3TA 3CQ9A 2G07A 4FFBB 3D9QX 3L6DA 3MOGA 4U7WA 1ZKDA 5CDYA 4A6PA 2C7QA 3NHBA 5DLDA 2H65A 2RKWA 3B6ZA 3CYFA 3PXCX 4A27A 1NLZA 4CDMA 3IOCA 2P4SA 4IUBS 4M8KA 3WE7A 1UBJS 1RBQA 1WLSA 1LX7A 2LVBA 4Q3NA 5BVGB 2UUBB 4C0AC 5EGSA 4IDAA 2ZCUA 2HO4A 2FPMA 1JNXX 1N1EA 3OHMA 3HCPA 1ZRSA 4PN7A 3ONWA 2Q7XA 1TGYA 2JC3A 3K0FB 3ANYB 4P4NA 5LIPA 3NR2A 1HE1C 1TJ4A 4HNHA 4HP8A 1CZKA 2BFDA 4GOND 2GXUA 2X77A 2PZKA 3TLGA 4M1QA 4PSDA 4YJ2B 1M6HA 1PQWA 3BIOA 1QQAA 4F04A 5BSEA 3E1KA 3D2BA 1JSZA 1T9DA 4L4RA 4L95C 2ACWA 3PXGA 4UEOA 1KO7A 2FR8C 1ECFA 3W2IA 1MX9A 2FSVC 4N7JA 4KIJA 4YAWA 3TLYA 3PDIA 1NU6A 4J0DA 4R2HA 4R3WA 2J41A 1XA3A 3TTXA 4WXMA 5DGDA 3MF4A 1QUEA 1PJCA 4X8MA 2OCAA 1AQNA 3B82A 1P7PA 4LJ9A 2YZNA 4OGGA 3U7QB 4DR5B 1G8KA 2B9EA 1M7BA 1Q22A 2VUTA 3M3PA 2VF2A 2YN2A 4HX5A 4KQJA 4JHXA 2FYTA 4WESB 1EJBA 4OHRA 1NXSA 1H8HD 1GKIA 3QTLA 5F1YA 4NAHA 3W2FA 2WE7A 1SZJG 2WSYB 3JPYA 3GPCA 3BL5A 2O3QA 4FGJA 4WTOA 4BV8A 1YQUA 4J0GA 4MR9A 4MWZA 2FJUA 1YS9A 1JWBB 3JZIA 1HE2A 4NX2A 4ETIA 4RPJA 1WXHA 2CXOA 2GTPA 2BEUA 1FB5A 2YCBA 2NYRA 2TMKA 1HRKA 4P31A 2OL4A 4HC4A 1EDZA 4OH1A 4C5CA 1Q20A 1UANA 2V96A 2P35A 4OMDA 4EA6A 3RD5A 1JDNA 4EMUA 1RMQA 1WABA 3OQMA 4Y2GA 2DY1A 4RZUA 5J63A 2G4CA 5MGBA 1IY1A 3QG1A 1C14A 3SSMA 3MWJA 4ZYVA 1Z4JA 2C4MA 1ENPA 2C2XA 2HSJA 3K8ZA 4S1NA 2IODA 1SHLA 4FKMA 3ROEA 5K3DA 1DADA 4O02B 2XUKA 3WZ2A 3PUYA 5EHNA 1O9HA 3OQNA 1RYZA 4FHDA 3JSXA 3OCCA 5IU6A 2GEUA 4I3GA 2FPUA 3R6DA 4LMPA 1XU7A 2BGTA 1Z18A 4LSZA 4QTTB 3VKFA 4XYLA 1IBRA 3PDJA 2AOVA 4CT5A 4GOOD 4EENA 2ZJZA 5JPDA 2AHRA 2B78A 1SU4A 2BBSA 2PTHA 1CNEA 4H60A 4YIKA 3WKCA 3W3AH 3I5XA 1KK1A 1W96A 2VPZA 1LTQA 3PJFA 4MVXA 1LSJA 5DU2A 1EIZA 5CLFA 3LF1A 4KBGA 3JYPA 1JV2B 5H82A 3KFVA 1C3VA 1DSSG 3AX6A 4MKIA 1HE5A 4IOKA 4ESVA 3PEEA 2YTZA 3NORA 3HXLA 3BOSA 3U7EB 2PWPA 4F86A 3EZ7A 1TT5B 1X1TA 1Y3FE 3NO4A 3IP8A 3I73A 3O8DA 4Q1AA 5AHWA 2JAWA 3GVIA 4Q18A 5GZ3A 3AU8A 1X7XB 4QYWA 5I6DA 4OBXA 5KZMB 3UPTA 3OD5A 4I55B 1SWWA 5TPWB 1NJFA 3BJEA 4F1JA 3C7DB 4IWXA 3O9VA 3PUKA 2QX7A 2VWPA 1M34A 4XASA 3IOEA 4QTYA 3EEQA 4L5YA 1OV4A 1J0DA 2OQ2A 4ES6A 4ZCLA 2ZE6A 3CB4A 3COZA 3CX8A 4ND8B 1EFRA 1Z5PA 4JP8A 4V39A 3ROQA 3WLIA 4KWCA 3N8NA 3CX7A 3EWNA 1QTQA 1NBWB 1OLXB 2NIPA 1XZNA 2VUUA 4IJVA 2VHWA 1E3WB 4KE9A 4U8HA 3K2EA 4ZPJA 1NP3A 2FJPA 4NBUA 4EF5A 3TOZA 5HK9A 3TF5A 4NPHA 1JR3E 1UMKA 1DL5A 1NX6A 4RA6B 4K0KB 2Y6VA 4LUCA 2B69A 4NBKA 4MAAA 4PEVA 2O8FA 3EDQA 3HDYA 4KWEA 3LA8A 4G81A 2FFAA 4XX0B 3ZKAA 4F2DA 3O8OB 3OZ7A 4PCUA 3LGAA 4AJEA 4AMUA 4CF6A 1JIKA 4K9LA 1XD2B 1SD5A 4DA6A 1FCJA 3K0AB 3EZNA 5JVDA 2CNWD 3HBNA 1RYEA 2DBZA 1HYHA 1XTUA 1KFJB 2O8VA 1V1RB 2R1ZA 3K35A 1U99A 3BGIA 3WGVA 1WDLA 3NEYA 2A4MA 1EWRA 4P34A 4BMYA 3PGKA 3B3AA 2C5SA 1NW5A 1TAGA 1JQ5A 3SD7A 5HTKA 3QA9A 4TXLA 5D1HA 4ZT6A 3D54D 5A6SB 2WHXA 2DPXA 2Z30A 4FSXA 2ZUTA 5C4MA 2OV2A 2FG7C 1HE8B 1U5AA 3E1GA 4QG7A 1TKRA 1TB4A 4YBRA 3D7KA 3CISA 3P2YA 5AKJA 2GEDA 3H9EO 4PR3A 1WZ2A 2VQ6A 3MJHA 4F11A 2IYZA 3AQIA 3MOIA 1E60A 1H0KA 1UFKA 2JA1A 2FN3A 3ESAA 4B2YA 3K30A 1ESDA 2BFAA 2B4RO 3OLQA 4MB2A 4AG5A 2B35A 5A4FS 1AF7A 1NP6A 1Q57A 2Q5FA 4J1TA 3UENA 3RJMA 3CVVA 4CKYA 2VZ0A 1BW9A 2IX3A 1GPJA 3M1IA 4TN1A 5FUXA 5IH7A 1N7HA 4DJ5X 1PWHA 1JGTA 3KTAA 4E4YA 1VIAA 2QL5A 3LLVA 4PYLA 2PGDA 3G5UA 4XD7A 5HF6A 1FDTA 1PG5A 2OA0A 1G8MA 4ZVTA 2IY8A 3Q6IA 4RMHA 4CCYB 2AN3A 4F9GA 1OGIA 1PJZA 1V11B 3LL4A 2V9PA 1V3QE 5KTRA 4QYXA 1A2BA 1MXFA 4RFSB 3EDOA 5JNTA 4AQ7A 1C3OA 1QCZA 2JHAA 2CD7A 4V24A 3ZTWA 1PX2A 3L7IA 5FOWA 3RS9A 4K6KA 3EDYA 1VLLA 1M2GA 2OO5C 4FJ1A 4OAPA 3UQZA 4DJDC 4DPKA 3CLUC 2VH2A 3EAQA 2DHDA 4PE5B 3RAFC 5JJCA 2NU9B 1EXMA 2BOVA 2MR5A 1ZR2A 4RVDA 4O3FA 3PUHA 1OZHA 1Z4LA 3VI4B 2CFOA 3CTPA 1VI2A 1ZCAA 3R3WA 3F6CA 1YR3A 2JW5A 4D74A 1Z26A 5E6UA 1SBYA 1E2HA 3C5WP 5JSFA 4IIGA 1U7OA 5IVHA 1WF3A 2YQ5A 4MMYB 2YHAA 3GXBA 3RUIA 1V95A 5CTAA 3ZGOA 1O2DA 1F3LA 1XTRA 3TZKA 2XAUA 2P69A 3OPYI 5PGMA 3VDQA 2HHLA 3L8DA 4FXPA 5FBWB 3GRUA 4MUGA 4DJAA 3T3NA 4NBTA 4Q1FA 3ZW9A 1IM8A 1MEEA 4LY6A 3QY0A 1SXJA 4G0QA 1MA3A 4MQEB 4M9CA 1LDNA 3DEZA 4RPHA 3OTIA 4B74A 2MWMA 4UCXA 5K05A 3UAVA 1AQIA 1MT3A 1KEZA 3AESB 3EOBI 4ZREA 4MVJM 1B7GO 4BNFA 3VZRA 3WS7A 1C4XA 1S8OA 1B8NA 3A3KA 3BWXA 2JARA 4MUMA 5E6SA 3K72B 3GAFA 3UATA 3UIEA 5ADHA 2QW0X 1L1FA 2QYSA 1FLVA 4KR6A 1IOVA 2VT6A 3LHDA 4AN0A 4AKGA 1DBVO 4OFBA 1R6XA 2KLBA 2QTGA 2R1TB 3WQSB 4MS1B 1USWA 1N32B 5EMKA 2E89A 1GDTA 3QJ5A 4RHUA 5DDIP 3GD5A 2NNLD 2YOGA 4JB8A 4DLXA 4XB6B 5JASA 3KKZA 4F9EA 3HJFA 2NO5A 3M6MD 4YMTA 2YRXA 3C6XA 3LXRA 4QT0A 2ZUUA 2ZYGA 2L2QA 3PXXA 3TNDA 3KZMA 4KQCA 4NBRA 4HYTA 2Q8QA 1DUIA 3Q87B 3EGXB 4ZYTA 4KNYA 1MU0A 1Q6ZA 3LPDA 1YUMA 2WWWA 5AIAA 4PHFA 1YZ3A 1MMFB 3I0NA 5AK3A 1DELA 2EL9A 4S24A 1FBNA 2A1IA 3LKBA 5MDHA 1JYEA 1KQNA 4D99A 2H1OA 3P7MA 4NLLA 1EVZA 4BNDB 2DUNA 4EYKA 1LPMA 2BKAA 2V1XA 1RIIA 1MTOA 4MUKA 1F2TA 4DDTA 2VEOA 4KRFA 2X22A 2PEZA 4WW0A 4PSAA 1YWGO 5CJJA 2DH6A 1R4AA 5AJVB 3S8MA 1F0NA 2PWBA 4X85A 3ZY2A 1RQPA 2FPSA 3AUXA 3M5PA 3N0VA 4NCIA 1KEKA 4ZOLB 1I5EA 1NNUA 2V8OA 4JJ7A 3Q88A 3W8DA 3WB1A 1CIVA 4HEHA 1IPFA 1TJNA 4KQEA 3AUFA 2JJMA 3ANTA 3EG9B 3DZBA 3TGLA 4NMXB 3WMWA 3LT1A 5KHLB 5LYYA 2GJAA 3N2GB 4LGYA 1Q14A 1EH5A 3G8BA 2EV9A 3VNVA 3VRHA 4E30A 3IDAA 1DFGA 1WOYA 1JAIA 4ZAVA 5TR9A 5KAMA 1ECBA 1J8FA 1N5MA 4D8UA 4G07A 4POAA 1UDXA 2D5LA 2ZSAA 4URYR 3JQFC 4R2MA 8ATCA 1L8LA 3DMGA 4JJFA 2QE7A 4KLZA 3OOWA 1RP7A 1XPJA 4LKRA 1JMKC 4N6NA 3X1XA 2PLAA 3ZNOA 3AIMA 2IYSA 2R96A 3UEOA 4BLOA 3FAZA 4UEQA 5LC1A 4DSTA 3VUEA 1O87A 3RV3A 3U80A 1TIKA 1A8UA 1L8AA 4KVGA 4K03A 4IH9A 1HLPA 4I0WB 2DTDA 1SVKA 1NZJA 3D7RA 1EQUA 1SRQA 3QFCA 3THRA 4BQRA 1OLOA 5E4YA 4LEIA 5BQOA 4AULA 3F6YA 5AOBA 2JD0A 1M0SA 2VXYA 3BH6A 3GYGA 3SG0A 2RHLA 3OZIA 2XMZA 2ICAA 3FWPA 3PDIB 4MVJG 5IG2A 3UV6A 1DUSA 4L9SA 2B8TA 2HUPA 1DG9A 2OG2A 1WB6A 3CZCA 3QF4B 1WY5A 3EHDA 3DVAA 3E22A 5ECWA 5DCYA 3EF3A 1GPYA 4DY6A 4X3PA 1BTOA 3D3QA 3OEWA 1YI8A 1UQUA 4F3YA 3TQHA 3N2LA 1W4RA 1JXMA 2WWXA 1CQJA 4QQKA 1UBTS 4LGMA 4BZPA 2BUBA 5I4BA 4WPGA 3LX6A 4M8NE 3SS8A 1HETA 4LPSA 2C03A 3C3XA 4LV8B 3DTNA 3ROGA 4X94A 1VCOA 3BWCA 5EWJA 1Y1KE 2DCMA 2ZJ3A 3OLZA 4E1VA 4MHTA 1VJDA 2QGNA 1AZSC 4XARA 4ZJYA 4BL5A 4RTRA 1WHTA 1IK6A 2FPLA 3OIUA 3FBGA 1UAGA 1FMCA 1AC5A 4IJQA 1X38A 4A26A 4Z1MD 2C7PA 3L40A 3TLKA 1J0AA 1H9AA 3U0VA 2NO9A 1XR3A 3S40A 1Z56C 1XRNA 4QFCA 4RMIA 2YWCA 3V32A 4ESOA 1T9GR 1ZD4A 3SGLA 2P2NA 1ONSA 2R7AA 5DNVA 4FFDA 3UNXA 2ZDQA 3PPXA 4L4XA 1VYTA 2B1JA 4UU0A 5AHOA 2Q7OE 4GVPA 3PC6A 3U4CA 2C0CA 3H8JA 3MBKA 3ZHXA 4AYXA 4B40A 4BNUA 2M32A 5F33A 1PCXA 3DVSX 3DZIA 3LLUA 2CUZA 1OROA 3PNOA 4TS9A 3RBXA 3T1HB 2JAUA 2VQ3A 4KO4S 2BGLA 5AICA 1BDIA 1DC5A 4ZQEA 1ESMA 1HK7A 1GGKA 1O97D 1HE3A 2PWYA 4DQUA 1KS2A 1J8QA 2OV3A 2YV4A 4NATA 3RHTA 1U0HC 1ZHHA 5E3HA 1TKAA 1W6UA 3AJ8A 2A30A 3KQUA 2XRZA 4EVQA 3R0ZA 5CYPA 2OB1A 5D8DA 2WWVD 5EJ8A 5HPYB 4QDOA 5F5XA 1KS9A 1FBTA 3GH1A 5EJGA 2JVJA 4Q4JB 1CUDA 1JE0A 1AQ6A 2AXNA 4Q0MA 3DYBA 5DYTA 4JITA 4TMVA 4L0DA 2I4RA 4FQ5A 3TW6A 2HY7A 3COVA 4YRFA 4MKHA 1DQRA 2RONA 4JR1A 4LVCA 4D9KA 4R6XA 1DBQA 1KH2A 1KJQA 4UNNA 1F8FA 2EL7A 3O9ZA 1Z88A 3TLAA 3O3CA 4OMUA 5I9MA 1QCYA 3QJYA 3W1WA 4BQOA 2V0CA 5DOVA 3R5TA 2PX5A 2ZR7A 5CG1A 1XWFA 1VJGA 2BUAA 2O6HA 4PFQA 3HXOA 4HK4A 4FFWA 2PS9A 5ALVA 4JQYA 4YQFA 1DKUA 1KBQA 1N9ZA 1T0PA 2NZYA 3MRTA 4NC9A 4QU9A 5G0SA 1H22A 3AT1A 4BFWA 2GNOA 3KPUA 1SG9A 2H31A 3I64A 1SKMA 4F3NA 4LQDA 1Z7YA 1GRNA 2BMFA 2QAIA 3DE0X 3Q6NA 4BQNA 5B1YA 4AAYA 2QQ0A 5KINB 3BJIC 1FDOA 1F5SA 1JAHA 3DDSA 2ORIA 4OI1A 1E18A 4PPNA 1BHJA 5KB3A 1TQHA 3ZGNA 1UKEA 1HMPA 2A0WA 3HCRA 4F5EA 1R0SA 1Q44A 2D62A 4HLDA 1Q15A 4HDNB 1TLTA 2QA5A 2JIOA 5KPDA 1R3UA 5FI1B 4GL4A 1G41A 3HB7A 4Q9KA 3G0BA 3DKIA 3ESRA 1JEYB 3EUFA 5G3ZA 4DIMA 2GBLA 2BP7B 4UW9A 1QF9A 6CHYA