3CXRA

Crystal structure of gluconate 5-dehydrogase from streptococcus suis type 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
260
Chain Sequence
b'QFSLDQFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase with different specificities
publication title Structural insight into the catalytic mechanism of gluconate 5-dehydrogenase from Streptococcus suis: Crystal structures of the substrate-free and quaternary complex enzymes.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Oxidoreductase
total genus 101
structure length 260
sequence length 266
ec nomenclature ec 1.1.1.69: Gluconate 5-dehydrogenase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3cxrA00
5ENVA 3VPSA 2EW8A 4CL3A 1A9ZA 1M66A 2NWQA 4YJHB 3QQPA 4JJGA 1GCUA 1LSSA 3DZFA 4BNXA 2ZTUA 4B3IA 4B8WA 1WMBA 3AOEC 3I9NA 5G0UA 3BHJA 3K96A 3VVCA 2D5CA 4KOAA 3DC2A 3ASVA 5JAIA 4OHUA 5L3ZA 4IXTA 4P4LA 1PJBA 2VWHA 1K5HA 1KYQA 3DO5A 2UDPA 1CQJA 1GU7A 1GR0A 4U5QA 1XGKA 3QVOA 4E2XA 4U0JA 1NPYA 1YQGA 1KBZA 2QRJA 1NXQA 4H16A 3DTTA 1L1FA 4OKIA 1N1EA 1PGOA 4XWYA 1ZH8A 2DVMA 1U9JA 4FW8A 3BMNA 3WFJA 3CTMA 3ZWBA 4JLWA 1Q0HA 1PWXA 2YV3A 4IGEA 3GQVA 5C37A 4RPHA 2X5OA 4MVJG 4NJMB 4UVHA 1GV0A 1KY4A 2CVQA 4BNHA 1KOLA 3RJ5A 3G1TA 1HYEA 5KJ6A 1H5QA 3DQPA 3FNEA 1PGNA 4QSMA 4BNMA 5B4VA 1YBAA 5KIAA 1RM3A 2QHXA 2NVUA 2CF6A 3OQ6A 5DULA 1HDXA 3OIFA 2IZ0A 4MP8A 3WJAA 3JQFC 5L45A 4ZQBA 1CQIA 5JLAA 4F45A 3PZRA 2QYSA 3ZW9A 1PL8A 1NFQA 1MC4A 3FN4A 4U6QA 5JBIA 3ZHXA 4HFJA 4WPGA 4K6CA 2JHFA 2H6EA 4XYBA 1C0KA 2J8ZA 1XIVA 1X1TA 3UF0A 2UAGA 1QKIA 2DTEA 2VRCD 2B0JA 1DLJA 1MLDA 5TLSA 2IEDA 1JQBA 1VPDA 4D3SA 3ANNA 3VDRA 1ZMOA 2PKQO 3GZ4A 2YW9A 4FR5A 2POQX 1R4MB 3CZRA 2EHDA 1GCOA 3A4VA 3E18A 1PIWA 3K2EA 1A4IA 3DBLB 5KVCA 1RM5A 4J91A 4ROSA 1B15A 4EBFA 2J5KA 4WLNA 4W9NC 1PR3A 5LC1A 4LSWA 3G49A 3HN2A 4RF5A 5DCUA 5TT0A 3D3WA 3VH2A 4D7AA 4TQGA 2C5AA 2C20A 4NU5A 2OBYA 3LC2O 4M55A 4R5MA 4J7UA 4EYEA 1UZLA 1GYPA 2FWMX 5A05A 2UUPA 2VQ3A 3DBRA 3GHHA 5EJ2A 3TZ6A 4GWKA 5KJFA 1NBOA 1Z74A 4IQ8A 1LDBA 1L7DA 3MTJA 3WQQA 1AUPA 3F4LA 4RVSA 1JKJA 2O50A 2Q1WA 2O23A 2JD2A 4YJGA 3FPCA 4BQRA 3LF1A 4FIZA 4A73A 4NBUA 4BMVA 2X23A 1E3SA 3HG7A 5BSGA 2OOSA 2BFPA 2PR2A 4GSKA 3D5QA 3GNSA 3GDFA 1N9GA 3ZN2A 1VKNA 4LVUA 3M2PA 4QO7A 1DC6A 3I83A 5IDXA 2FPIA 2WDZA 5K6AA 1FF9A 2P4QA 2HKIA 3AM5A 4RF4A 4AJJA 3F6YA 1A27A 5IDWA 1LTHR 1OI7A 4WK6A 4BQPA 1E77A 3GAZA 3ONDA 3UOGA 3V1TC 3VAZA 2ZTVA 4ZU3A 3W1VA 3RROA 3AM3A 3MJEA 4ALMA 3PWZA 1JN0A 1PJSA 4MIYA 1GQYA 2IE0A 2PZLA 4Q39A 3D4OA 3NRCA 4GX2A 5B37A 3DZIA 3PFWO 2EW2A 1IYZA 1YVEI 4OGWA 1IHXA 3AI3A 4FFPA 5AVOA 1Z45A 2R00A 3H9QA 5JNLA 1I2ZA 1PTJA 1Q7CA 4RQTA 5TQVA 3TOZA 3S2GA 5L4SA 2IXAA 1RM0A 3RUDA 4CV2A 1WNTA 1YJQA 4L4RA 4FC6A 1DIHA 4BNVA 2EKQA 1ZBQA 2NACA 5KTKA 4EI2A 3ETDA 3AOGA 2Q2QA 4XR9A 5TX7A 1Z82A 3CE6A 4C7KA 1H2HA 2RHRA 4I9UA 5JO9A 1HYHA 2VHYA 3WG9A 2HRZA 4JQCA 3EZLA 4BNWA 4CMKA 1RYDA 4DYDA 1E3WB 4Z9FA 4E5PA 3GK3A 1DRWA 4O63O 2JAHA 4Q3AA 2I5PO 4WECA 2OHXA 4AVYA 4R4JA 1X7HA 4D0SA 5ER6A 1C1XA 2FRDA 3I4CA 2BLLA 3KB6A 4HP8A 4JP3A 3V1YA 4YT2A 4UUMA 4CLRA 4EEXA 2HMSA 1NASA 2AMFA 2WYVA 3WTBA 5U9CA 3NJ4A 3O38A 3JQAA 3K9QO 1JDJA 1PS8A 2SCUA 3K6JA 4NIMA 1GEGA 1I33A 4NU6A 3GDGA 4R54A 3RI3A 5LDHA 1UP7A 1HTBA 1LQTA 1ZSNA 3LQFA 4WASA 3GVIA 1PL7A 1WP4A 2NU6A 3VHRA 2BFAA 3RAJA 2X5JO 3VH3A 2GDZA 3JV7A 4FFMA 3TQHA 1BG6A 1XQ1A 3R3JA 1M67A 3FD8A 1HETA 2C59A 2I66A 5KVSA 4I9HA 2VHWA 4WE3A 2OUIA 1V0JA 2FOIA 1B8VA 1EBFA 1M75A 1IOLA 1EUCA 4GGOA 2X7HA 4TRMA 3HUDA 1O95A 4CQLA 4EJ0A 2YZ7A 2EERA 1U8FO 1U2GA 5A3VA 3RUEA 1EFLA 5JXWA 3TN7A 1KS9A 1E7RA 4PLWA 4J7CA 2AEFA 2NQ8A 2YDYA 3H5NA 9LDTA 1LSOA 2GN8A 4IS3A 1NVTA 3QA9A 2VZ8A 4TKLA 1GFSA 1B16A 2EIHA 3CIFA 3KXDA 4FJ2A 5KVQA 3LC1O 3MWDB 4XYLA 3ZWMA 3W6UA 2PGJA 4TVBA 3QW2A 3NKLA 5LDGA 2UYYA 2WJPA 4CMJA 3JQGA 4PCVA 1R15A 3GGPA 3P2OA 5FI3A 5ADHA 5FEUA 1WMAA 1QLHA 2P9CA 1MFZA 2O7SA 2GRAA 3H9UA 3IIEA 3KTDA 3P7MA 3ROMA 3WJ7A 1SC6A 1TVEA 3AU9A 1VE9A 5CDTA 5A3JA 2DFVA 3F46A 4J3FA 1M6WA 4ND3A 3WYEA 3ZHBA 3PRJA 5K9ZA 4QFDA 2HDHA 4Z0PA 7MDHA 1ULUA 2HJSA 3SX2A 3GMSA 1I8TA 1AXGA 4WLEA 1KEUA 2D4AA 3F3SA 1LRLA 2AE1A 4F6LA 4W99A 1QRRA 1QYWA 3DFZA 2Q4BA 2B4RO 1C0LA 2BI7A 3GVPA 3I5MA 3JD2A 4I5DA 3GN1A 2AG5A 2EF1A 2A4KA 3QWFA 4YRDA 5A9SA 3FI9A 3MZ0A 2O3TA 5BNIA 1T2EA 4O0LA 3JTMA 3BAZA 5IF3A 1ULSA 4U6SA 3HB4X 3VPGA 4GVXA 2VT2A 2IYPA 2EXXA 1EK5A 2PGLA 2D59A 2Q2VA 3KRTA 4Z3DA 2Y1FA 3K5PA 2AHRA 4M1QA 3Q3CA 4BO6A 1PZEA 3HQ4O 2RH4A 4J2HA 2NM0A 4RDHA 5L51A 4DVJA 1YBMA 3RUHA 2GCGA 2AW5A 3R0IA 2C7GA 5G0TA 2QIOA 4OOEA 3ANLA 4RZHA 4IDBA 2ZK7A 5J23A 2R00C 3JQ7B 4IIVA 3ZHZA 3SC6A 2P91A 4DXHA 4U7WA 3TNLA 3GUYA 1UDCA 2PNFA 3A06A 5JCJA 4J4BA 2Y93A 1I3MA 3RUFA 3DMTA 3PQFA 3NAQA 2X0IA 2G17A 4CM6A 3OJ0A 1E1MA 1MC5A 1OBFO 3INTA 1NQ5A 1P0CA 2GUGA 3KM0A 4CLXA 1AE1A 1CWUA 3GPIA 3ZW8A 2VUTA 4HBGA 3AFMA 3DBHB 2VTDA 4RO0A 4E12A 4MVJH 3UICA 1BRMA 3PWKA 1Y1PA 3W8EA 1IULA 4IPTA 5A02A 4XD2A 4LN1A 3ZWNA 1OZAA 5BSHA 1X15A 5EESA 5DP1A 1FMCA 1P77A 1R37A 5ILOA 4A0SA 4BKUA 1O94A 3OJOA 1U28A 2I3AA 4URFA 2CSUA 3OF2A 4R1SA 4PLVA 3DBVO 3UUWA 5HWSA 2D1YA 4GX5A 1HT0A 5G0VA 3ZWCA 3WS7A 3TRIA 1ZEJA 3KLPX 4QT0A 4WNCA 4ZJUA 4CUZA 3U9LA 4PLYA 3S8MA 3I9JA 1PWZA 3TSCA 4MVJA 2VOEA 3L77A 3DOJA 3DZHA 4MKZA 4WKGA 3KEOA 5TRTA 2OO5A 3H5AA 1D1TA 4IJWA 3WOHA 4EGFA 5L95A 2CF5A 1H9BA 1C14A 4WNIA 4CUJA 2EKLA 3Q9NA 3QJ5A 3OEWA 5AXDA 2PA3A 4ILKA 4PG8A 1LEHA 4G65A 1CERA 3PHGA 1YOVB 4PG7A 1SB9A 4D3FA 1DDOA 4AJPA 1YJ8A 2RHCA 1UUFA 2Y0DA 2E37A 3E5MA 4FS3A 1GPJA 1H6BA 3R3SA 5DZSA 1ZNQO 1PQPA 1ZEMA 2PV7A 1ZZEA 1EQ2A 1DFHA 1KY5A 2I6TA 3ZV6A 4YEDA 4QEDA 3OECA 2QRKA 1ENZA 4OMUA 1WVGA 4PZDA 5EERA 1A5ZA 2AEJA 1KEVA 2Y1EA 1UXGA 1PZHA 4NDNE 4AJIA 5CEEA 1LSJA 2O3UA 3TDKA 1VI2A 4R1TA 3SXPA 2J3HA 4LW8A 1SPXA 3VZQA 3F9IA 4IS2A 3FR8A 4E5MA 2FP4A 5F1KA 2DT5A 2GD1O 3WFIA 3JCZA 3WMWA 2YUTA 4BOYA 1QORA 1QV6A 4NK5A 2A94A 4O1MA 1LA2A 4MKXA 3OIDA 3ULKA 4XIJA 4RGBA 5KWEA 1QMGA 1UAYA 3NV9A 1H9AA 1MUUA 3ADPA 3E5RA 1ZJZA 1D8AA 2GF2A 4E2WA 3C7AA 3LVFO 1CEQA 4J43A 3Q11A 3TWOA 4AJOA 3F1KA 4IDFA 1E3JA 1P1JA 1YRLA 1C0IA 3ETEA 3GVHA 4E6PA 4ZRMA 1CJCA 5T64A 3S1LA 2GZ1A 5AXBA 3HDJA 1T1SA 4YQYA 4YJHA 2B36A 4L75A 2EP5A 3X2FA 1R0KA 2FHSA 4BO4A 3GEMA 4AJ1A 3MTGA 5IXYA 1SOWA 5I9MA 1PSDA 1UP4A 3AWDA 4IDGA 4QX6A 4TSKA 1ZO8A 2DQ4A 5JCJD 5L40A 3HDQA 2P2SA 4UUOA 1EVJA 3NTQA 4W4TA 4LMRA 1WXDA 5TC4A 3G17A 5F5NA 4RF3A 5KKCA 3I3OA 3QV1A 4II3A 1YB1A 3ENNA 3RC9A 5LCXA 5ITVA 4NBRA 1NFFA 3GRKA 4OIMA 5THQA 2OORA 4YDRA 3V5NA 2PTGA 1EDOA 1E1KA 4I5FA 3S2FA 3I4FA 5BT9A 2Q50A 1L7EA 2H5LA 3IUPA 2E6UX 4NBWA 5KJCA 4RPGA 4TRNA 4U0KA 5I8WA 1JVBA 4WGGA 4J0EA 1GTMA 3ICCA 4E5KA 4EITA 5CG1A 2FR0A 1JWAB 3ZZNA 2OXIA 4P8RA 1GPDG 3MOIA 5ES3A 3KYDB 1VLLA 3HFGA 1W4ZA 3G1UA 2VUUA 1HDRA 3L07A 3HSKA 1M76A 1Z7EA 3F1LA 4B7CA 4XJTA 1DPGA 1U3WA 3FSRA 3GH3A 4NFHA 1MV8A 1EUZA 2FY8A 4I08A 3O8QB 4YR9A 1LXCA 2DTXA 4R1UA 4WEQA 3RFTA 4MVJD 4L4XA 1H94A 3I9LA 4B3HA 4CR8A 4XGIA 1KVRA 1GY8A 3DWFA 4R5HA 1F0YA 4Y98A 4HY3A 4J7XA 4NMHA 3W4JA 2AA3A 2NV6A 1SMKA 1R12A 3B1JA 4ALNA 1N2SA 3JQ6A 1R4MA 4J49A 5TJ9A 3TFOA 2X9GA 4XDZA 1IHYA 2EG9A 4KTVE 2BRUA 1AGNA 3DBLA 1XSEA 5L4NA 2Y0EA 3RUIA 3P5SA 1YXMA 4JK3A 4DC0A 4PZEA 2PZMA 1EZ4A 4L76A 3P19A 3LLSA 4GSLA 1N7GA 2GN9A 1XG5A 1YB5A 3I9MA 2G0TA 3RVDA 1E7WA 3E9NA 4S1VA 4MINA 3CXRA 2DPHA 3EK2A 4RQUA 3L6DA 3H6KA 3PDUA 3LK7A 3RC7A 3Q6IA 4WOJA 1F14A 4IMPA 3JQ8B 1OMOA 3EW7A 1GZ4A 1VJ0A 3EMKA 2UVDA 1HZZA 1Q0QA 2ZTLA 1FDVA 2EP7A 4FCCA 1MG0A 1I2CA 2OP1A 3GMDA 4CLHA 4FOSA 3PHJA 5A5FA 1H93A 3Q2KA 4OQZA 3QP9A 2NTJA 3AY3A 1P45A 4TMFA 1NQTA 1P1FA 4FD3A 1HEUA 2ZYDA 1E5QA 2PK3A 3HJAA 3QHAA 5BNTA 1GZ3A 3DAFA 4JN6B 5HA5A 4XCVA 4FJ0A 3WGGA 1K3TA 1YKFA 2WMDA 3RFVA 4KQWA 4FQ8A 3VTFA 3ORFA 4O6VA 3VZRA 1V3TA 4KUGA 4PGFA 3NX4A 3OHSX 3HADA 3OQBA 2C5EA 2DLDA 3WSVA 2O3QA 4JJIA 1B8UA 2PD3A 5KJ1A 1WZIA 2W8ZA 3M2TA 1SO8A 2AQIA 3PIDA 3LDHA 3ZI0A 3K92A 3C1AA 4E5NA 1WDMA 4CM5A 5DN9A 3TFQA 2CY0A 4YVFA 3DAPA 1HDZA 4LCEA 2B83A 3GRPA 2UUOA 2V6GA 2NSDA 1ISFA 1R0LA 2HLPA 1MXHA 2O3SA 4W82A 3RKUA 1DBVO 2ZB7A 3U4DA 4E5YA 5CAEA 3FBGA 1EVIA 5CFZA 1YBVA 1E3WA 2WD7B 3FNFA 1DHTA 1EQUA 1GDHA 1R0SA 1Y8QB 3DHYA 4CM9A 3KBOA 4IINA 4RCVA 3DZBA 4OXNA 1H6AA 2VZ0A 5HS6A 3PDJA 3DMYA 2ILTA 2J3IA 4HV4A 5A9RA 2X4GA 1YQDA 5DNAA 2O3JA 5L9AA 3PEFA 4HADA 4RPJA 5A9TA 4J4HA 3JYOA 5THKA 2Q2WA 4M87A 4YRAA 1UXKA 1FDUA 3ZV5A 3WGIA 3ST7A 1C3VA 4B4OA 1P1RA 1K6IA 4ID9A 4LGVA 4LVCA 3VZSA 3SBOA 1DOHA 4E33A 3G0OA 3PI7A 3KO8A 5T5QA 1DC3A 2NTNA 5A5EA 2GZ2A 3U5TA 3ZHYA 2X0NA 2BFOA 2WD8A 4QO8A 4OXYA 1HKUA 1UXHA 3HDYA 2DPGA 4OM8A 4KWIA 4NNJA 5ILGA 2JFHA 1HDOA 3B1KA 4EEZA 3RIHA 5CPBA 4GVLA 1PZGA 2BF7A 2FR1A 3U49A 5IZ4A 2AE2A 3JD1A 5JO0A 1YL7A 4TRJA 3E6AA 1I0ZA 1RPNA 1XQ6A 1Y6JA 2J5QA 5BNFA 3T4XA 4G81A 4GMFA 3JQBC 5EIOA 3UHAA 4YB8A 4QFCA 4U8GA 3IKTA 5CDYA 2PZJA 1A7AA 2Y68A 4ND2A 1Z6ZA 3E1KA 4IXWA 4BMSA 1H2BA 2IODA 1YL6A 1YDWA 3WXBA 4CPDA 4DUPA 1NTOA 2Y05A 3L6EA 3AJRA 5C7OO 5A1TA 3UCEA 3WR5A 1U8XX 4HNHA 4LSMA 1Q2XA 2JKVA 3ICPA 1LI4A 2CDBA 4OQYA 3UCFA 4EW6A 1BVUA 2AQ8A 5KVVA 3TL3A 1U4SA 1C1DB 4J4TA 4BNZA 3HDHA 3MJSA 4IUYA 1GQQA 2X8LA 2DBRA 3VZPA 4HNGA 4BGVA 4B3JA 1ISGA 2YYYA 5IG2A 4BO1A 3RCBA 2PY6A 4A5OA 1VRWA 1UDBA 1KIFA 4DIBA 5F3RA 3L6OO 3FF4A 2BI8A 4CJXA 1M2WA 4CODB 5B4UA 1HL3A 3NT4A 3GVCA 2VWPA 1ZW1A 3NDJA 1R66A 5F5LA 4FFNA 1YGYA 5COBA 2NTVA 2HK9A 2OGUA 2X58A 2FPGA 3AUUA 1P0FA 1I24A 4YCAA 3UW3A 1BTOA 1LDEA 3RSHA 2Q3EA 4D43A 4NFYA 1GEEA 4XYMA 3ZWAA 1PL6A 1NPDA 2J6IA 2VCYA 4ND4A 3GEDA 5I7FA 3GUCA 5FF9A 2PD4A 3EGOA 4KTTE 1JA9A 3WGZA 4YJFB 1AHIA 1N5DA 5FFFA 3L9WA 3V2GA 1DRVA 4XX0A 3PJFA 4MVJP 1LU9A 4LRSB 3JD0A 2QZZA 4DL9A 4CM3A 5JE8A 4OH1A 4BL5A 3CZMA 1R16A 2LDXA 4PG5A 1ENYA 2DUWA 1T2AA 5G4LA 4BKQA 4MIOA 1VL8A 4WLOA 3BMOB 1NQOA 2ZCVA 3SLKA 4Q3DA 2GPTA 2XF8A 1X0XA 4DWVA 4HX5A 1QYCA 4N7RA 4BNTA 5DOZA 1UZNA 3MCVA 3RBZA 3AY6A 4IDCA 1SEVA 3FRJA 2X9NA 4ZD6A 1IPEA 1LNQA 3EAGA 4TWRA 1P1HA 4CM9D 4D41A 1BWSA 2Z95A 4K28A 3GZNB 4F46A 3EYWA 5ER9A 4XRRA 2VUSA 3WMXA 4M86A 2IYOA 2P5YA 4DPMA 5HM8A 4R51A 3HFSA 1DIAA 2XPCA 4UUNA 3OJLA 3JQ7A 3KZVA 3NT2A 2PWZA 1LJ8A 1TT7A 2Z1NA 1NVGA 1B26A 5JAMA 3ZU4A 1DRUA 3NUGA 2NVWA 4HKTA 3KV3O 5GMOA 1E3LA 8LDHA 2P4HX 2ZQYA 5TF4A 2WM3A 3AW9A 1EUDA 4OSOA 4Q3EA 4XYGA 3QWIA 1I10A 2QQ5A 2CNBA 1JTVA 3IL2A 3V2UA 4MOWA 2NU7A 1FDTA 2QG4A 4DBZA 4XR4A 3DBHA 2DBZA 2HMWA 2V6FA 5EQDA 4J16A 1WWKA 1F06A 1HWYA 5IFLA 4YQZA 3HHPA 3GG9A 1EMDA 3ZNPA 3FPLA 3HZZA 4ITUA 4NHEA 1LDNA 4I1IA 2QYTA 2ZIZA 3DXFA 1DAOA 1HF3A 4Z9XA 3TPCA 4CMEA 1IZ9A 5JPIA 2G82A 3TZHA 2I76A 3ZNOA 2YV1A 2O7QA 2NNLD 2WTBA 4RF2A 4KQXA 3PYMA 3LLVA 5T8KA 3ANMA 1P74A 4O59O 1T2CA 4MVJE 4M54A 4YAEA 1P31A 2XOXA 3GDOA 4QTZA 1ZK0A 4WCDA 1EE9A 2HK7A 3PJGA 2YJZA 1E3EA 2D0IA 4WCFB 4CM8B 1Y81A 2X0JA 4RVGA 3VVBA 2JFFA 4CM7A 2CDAA 5AOVA 1DFGA 1E7MA 3MWEB 1HLPA 1AHHA 3STHA 1YOVA 4AJEA 4YPOA 4NJOA 4W7IA 2CDCA 1RYEA 1ADGA 1FJHA 2FN7A 1YE3A 4LMPA 2RBEA 1VL0A 5HBRA 2Y66A 1VKOA 3LT0A 4XA8A 4QXMA 5JAZA 5DCYA 2E49A 3MEQA 3U09A 3JYLA 1I36A 4RLHA 2B35A 5KKAA 2A35A 4CMAA 3A9WA 3JD4A 2HK8A 4GLLA 2NU8A 3NYWA 5CP8A 5K6AC 1NX6A 1EDZA 1U7HA 2EGGA 3ZV3A 2GO1A 4E4YA 4RVHA 2DAPA 1ZIDA 4HFNA 3K73O 3UKOA 3O03A 4EZBA 1TA4A 3OA0A 2Y1DA 3GGOA 4DQUA 5AXCA 2CD9A 2Q45A 3U62A 2JHGA 2X22A 1LBEA 3V8BA 2NLOA 3CUKA 1JAXA 2DBQA 4HWKA 3OA2A 1BXKA 1OC4A 2HMUA 4IJKA 1W8DA 5TS3A 1T4BA 5ICSA 4I5EA 3DR3A 3CINA 3EDMA 2VWQA 2OFPA 4FC7A 2G1UA 4BNFA 2WWRA 3I23A 1JU9A 4DTIA 5IXSA 3AFNA 1B2LA 4IDDA 2GLXA 5CDSA 1XYGA 3CMMA 4ALKA 2GASA 1DIRA 2HMVA 4ZQGA 5ICMA 1NHGA 4CLOB 4IBOA 1JLLA 2Y1CA 3KETA 3OFSA 1XDWA 4HFMA 3ZWYA 3MJTA 2JCYA 4R69A 5I7VA 1DC5A 5AXAA 3ON5A 4UULA 4CQMB 3PZBA 4DBVO 4LISA 3C8MA 2HSDA 4IJVA 6ADHA 4WOKA 3HN7A 1NM5A 1QYDA 4EUHA 3PVZA 4BNNA 1V6AA 3DL2A 4EDFA 1P33A 4FB5A 2I99A 3IDSA 1BGVA 4E2ZA 4CLEA 4XYEA 2C2XA 1D3AA 1KVQA 2YY7A 4Z3KA 2FSVA 2R6JA 4Z9YA 4OAQA 1IL0A 1ZK2A 2BH9A 2RAFA 3IC5A 1YWGO 4J6FA 1BW9B 1YH3A 2X9VA 3UVEA 2J3KA 3SJUA 2NU9A 4XQ9A 3ZU5A 2QX7A 2B4TO 4UEKA 2P5UA 3PP8A 2NVBA 1VJTA 4OO3A 4E2YA 3MOGA 4XZ3A 3U0BA 3GNTA 4PLTA 5HTOA 3ZWOA 3FWNA 4UUPA 5CEJA 3JQ9A 3VH4A 3KYDA 3WICA 1EVZA 3LYLA 3WGTA 4AJ4A 1R4NB 3D64A 1KERA 5T6BA 3G79A 3FTNA 3R1IA 4XIYA 4UVDA 2W98A 3SC4A 1B3BA 3O8QA 1MX3A 5T67A 1MB4A 2VN8A 3GVXA 2O2SA 4E0BA 3W4KA 3F4BA 1PZFA 2PD6A 5T57A 3E03A 3GOHA 5EQFA 5MDHA 1F8GA 1Z73A 2AG8A 3GFBA 4R3WA 1B0AA 3ETGA 4CMCA 4BVAA 1JWBB 2P9EA 1W0CA 1PS9A 3PQDA 3TZKA 2WYWA 1TLTA 5TT1A 4P22A 1DC4A 5JFOA 1ONNA 3GY0A 2IEBA 1WW8A 3KEQA 3Q9UA 1HXHA 3GFGA 4CMEC 2IZ1A 4A10A 5G0WA 4FBGA 1Q7BA 1GYQA 2LDBA 3FNHA 3NDIA 4TROA 4F6CA 3I9KA 4FGSA 4Y8VA 1U2DA 3DTYA 5DDIP 1XA0A 1U1IA 4FFOA 5G2OA 1SB8A 4MKRA 2JCVA 3F5QA 4NQZA 4JNKA 3C3XA 2V6BA 3JYQA 5GZ6A 3C85A 4BO3A 2PKRA 4Q3NA 3GT0A 5TNXA 3IUSA 3JQ8A 4W7HA 2PFGA 5F1PA 1VL6A 1TB4A 3I6IA 3RWBA 5GZ1A 2OZPA 4BGIA 3Q2IA 3IP3A 1ONOA 1ZUD1 2Y0CA 3EY4A 4DLLA 1RM4A 1ISIA 5BR7A 2W2LD 2I65A 3U4CA 1A72A 4BO2A 4CMIB 2DC1A 2QZ9A 3BTUA 3PYXA 4QUKA 3I6QA 2IXBA 3WSWA 1DHRA 5I8ZA 3HWRA 2Y67A 4YBZA 1ML3A 4J1QA 3JQFA 3B1FA 4MJLA 3BMCB 4JX8A 4Q3CA 4UEJA 3IKVA 2HAEA 3BMQB 3OJEA 4DIFA 1V35A 2P9GA 1Y8RB 9LDBA 2I67A 4J1SA 4K9DA 4MDHA 4DREA 4NG5A 3UFXA 3VOSA 3WQSB 3SEFA 4JIGA 4FN4A 2WSBA 2WYUA 1UZMA 2YV2A 4L9RA 3VTZA 3TOXA 1DEHA 2FSSA 3DEYX 3A14A 4BKRA 1T26A 2Q1UA 4GI2A 1E3IA 5A04A 1DO8A 4M49A 1EFKA 2BGMA 5B4TA 3EUWA 4ZGWA 3M1AA 1JVSA 1MGOA 1TI7A 3V1UA 3ZNQA 3E9MA 1NQAO 2AEMA 3ZNNA 5JY6A 2ZB8A 4RORA 1I32A 1PQUA 2Y99A 2RCYA 1OC2A 4R68A 3DB2A 2EEZA 4GX0A 5ENDA 3ONEA 1S7CA 2WD7A 1BVRA 3LZ6A 5ITWA 1Y8QA 3FWZA 3RBXA 4AICA 1G1AA 1I5RA 2ZB3A 3ZWPA 3IMFA 2B5WA 4BNGA 3DMTC 3KUXA 1FDWA 1LC0A 2ZCUA 3U3XA 2W2KB 1DXYA 4E31A 4BO5A 4YACA 2BFMA 3X2EA 4DPLA 3PHIA 3NEPX 2GZ3A 1EEHA 1SOVA 2VYVD 3WIEA 1GYRA 4CUKA 1HSZA 5A4DA 5C5IA 2D5AA 3ZU2A 2HO5A 2ZJ0A 5L7YA 1PJ3A 1J4AA 1LRKA 1R6DA 1V9LA 4XB1A 5DBGA 1ZK3A 1PQWA 5COAA 3N58A 4MVJF 2Q49A 5CDUA 1WDKA 3WBFA 1P1KA 1ZSYA 3RC2A 3A28A 1AXEA 4NI5A 3PJEA 4ZICA 3DHEA 2IZZA 4BB5A 4MP3A 2YQ4A 3E82A 3IJPA 5JC8A 3OP4A 1A9YA 3OIGA 4UVGA 2VRBA 3RBVA 3UXYA 1MP0A 3AI1A 1CYDA 4XJSA 2O3RA 3C7CB 4PVCA 5IAAA 1O89A 5EL0A 4E30A 1WPQA 2PH3A 2O4UX 2V6MA 1Y9AA 3EVTA 1VJ1A 4CV0A 1QG6A 1GZ6A 1E7QA 2G5CA 1BXGB 2CVZA 5B1YA 2HRBA 3OBBA 4YAGA 1Y7TA 3ZWVA 5KNLA 1A4UA 3QRWA 5COQA 1UH5A 1C1DA 2VHZA 2JAPA 3DZKA 4NZ9A 1LQUA 3T7EA 4YAIA 1W73A 3O26A 1Y9EA 1DLIA 1UAGA 5U4QA 3QVXA 2PKQP 1F12A 4YT4A 1T2FA 1FDSA 4ALIA 5JC1A 5HRUA 5DP2A 3WQRA 2EJVA 1F8FA 3UCXA 4AJ2A 3DZGA 1IPFA 3CEAA 3L0DA 3KSZO 1KC1A 2DUUA 4PG6A 1KETA 4JXKA 4K26A 4Z6KA 4P4NA 3CMCO 4Y6SA 1NAHA 3WB9A 4GKBA 2Z1MA 3N7UA 3K31A 1E7YA 1V3VA 1Z75A 1HRDA 3D4NA 3F47A 4YJFA 1HE3A 4BGEA 2JFGA 3IQDB 1VC2A 4J1TA 3ABIA 4ZN6A 3PK0A 2PLAA 4CM4B 1LDYA 4NH4A 3B6ZA 5DCWA 4CR6A 3RASA 3G3EA 3W8DA 4BV9A 2PGDA 4GMGA 3VDQA 2GR9A 1X14A 5F1OA 4KP7A 3BMOA 1U3UA 5L7WA 1IY8A 4RVFA 3WGHA 1PGQA 2DU8A 4RPLA 4C4OA 4L4SA 4DLBA 3MJVA 2R2GA 5DF1A 2B5VA 1E6WA 4NBVA 1E6UA 1NR1A 1DFIA 3PXXA 1N8KA 3UH1A 5KOIA 2F00A 3GZNA 4J90A 2H1SA 1DAPA 4C7JA 4YXFA 3ENKA 1GADO 1X7GA 4K6FA 5FYDA 3BTOA 1WDLA 3LC7O 2UV8A 1IZ0A 1I3LA 1HSOA 1WAMA 1ZXBA 1B8PA 5IDYA 5EPOA 4CV3A 2GNAA 3QVWA 1ONPA 1V8BA 4PLCA 4B4UA 4RV9A 4A2CA 2WE7A 4MVJI 1NR7A 4GLOA 5G4KB 3PQEA 1D1SA 2VYNA 3O4RA 5CDGA 4JCOA 4GX1A 3WBBA 1XLTA 4B4VA 1XCBA 1XEAA 3GN2A 3GF4A 4GL4A 5KCZA 3RC1A 1H6DA 4FOOA 4RJTA 4YA6A 5L7TA 1LX6A 2HU2A 1ARZA 3U4HA 3H4VA 1YL5A 4FJ1A 4PLHA 1TT5B 3D3EA 4HUJA 4CL8A 3GAFA 5I7EA 2BHLA 4D44A 1PJQA 4KWHA 4MIEA 4S3MA 4ALLA 4I8XA 1SCUA 5C7IO 3H65A 4E21A 5L4LA 1ADCA 4IZHA 3AM4A 3H5RA 1E1LA 4IDEA 2XXJA 1YQXA 3EZYA 1CDOA 4ZRNA 4ZA2A 4TRRA 2ET6A 3KYCB 1SZJG 4GGPA 3WNVA 2X1HA 1UXIA 3H2SA 2XXBA 4R16A 2ZJ1A 4A26A 3KSUA 3L4BA 4PRKA 4YTEA 1RKXA 3VPHA 3WNQA 4BUCA 5C7LO 3GG2A 3RUAA 2C82A 4TZTA 3TZQA 5IN4A 5JDCA 1IUKA 4B7UA 4PRLA 1ISHA 1J6UA 1PJLA 3NDRA 1U4OA 3C1TA 1HYGA 2WEKA 3UAGA 3BTSA 2W4QA 4IIUA 3D4PA 1UJMA 4GWGA 3RFXA 4E32A 2X6TA 3WGOA 1X13A 3ADOA 3LF2A 3COSA 2E82A 3OH8A 3SLGA 4WCFA 4CM8A 1ZFNA 5I7SA 4W6ZA 2VNAA 1GUZA 4PZCA 1FXSA 5GY7A 4IMRA 3K2BA 4FFLA 5KJEA 1BMDA 4E3ZA 3QIVA 1IB6A 4GKVA 4J9VA 1MA0A 3MJCA 1CRWG 1NFRA 1VM6A 5DBIA 2PZKA 4Y67A 3E8XA 1YS4A 4R9SA 4BNJA 3BA1A 3N74A 5A06A 1E5LA 5TGDA 3GHYA 1PJTA 4J1NA 4ZQEA 1J0XO 1NWCA 3BMNB 1K0UA 1ISJA 2AXQA 2D2IA 2XAAA 4UAGA 4WUVA 2EV9A 2TMGA 5I9NA 1NNUA 4YT5A 4DC1A 1XHLA 5IN5A 2J3JA 2GYYA 3DHNA 3ASUA 3LT1A 1B3RA 4TZKA 3VKVA 4KZPA 4BMNA 1ZXLA 1YB4A 2A92A 1OFGA 3WTCA 1T25A 3PJDA 4IM7A 4Y9DA 4XDYA 2NVUB 2V7PA 4MVJM 4RDIA 3WLEA 3INRA 1QV7A 1JKIA 2I3GA 1QR6A 1UDAA 5DT9A 3A1NA 5JMWA 2HJRA 3OMLA 2EGHA 2BGKA 1HE2A 3FCOA 3C24A 5TIIA 3SVTA 4KUEA 5CG2A 5JCXA 5FWNA 3QWBA 4GH5A 4IJUA 3W6ZA 3PWSA 4TKMA 3MJ4A 3AU8A 4IY1A 3WGYA 4EUEA 4B8ZA 2FMUA 1NWHA 1GD1O 3GEGA 3JYNA 5K0ZA 2NADA 3BYZA 4JP2A 2FZEA 2HQ1A 3DFUA 1G6KA 4J0FA 2A9FA 3QE3A 3GC6A 4CLOA 1I3KA 4KMSA 5B12A 4UEOA 4DGSA 1Q0LA 1EBUA 4GBJA 4Y6PA 1PGJA 3JYPA 1GQ2A 4WJZA 1E0DA 2DFDA 1Z7BA 4RLSA 5HS4A 3DAGA 4GAEA 4LK3A 1EK6A 4H7PA 4R1NA 4CR7A 4P4GA 4BKPA 4CQMA 1ZSVA 2BKAA 4AJHA 1UR5A 4AJKA 2D3TA 3VKUA 4FDAA 3D3WB 4JGBA 2YQ5A 1A71A 1LLQA 2O2YA 4PLFA 2O4CA 4D0RA 2VYND 2HCTA 4AFNA 1U5CA 3DBRB 1HE5A 3PGXA 3LT4A 3QLJA 4BNUA 1HDCA 1XELA 1BHSA 4YAKA 4YT8A 4YJGB 3D5TA 4BHTA 2G76A 2WE8A 4PIVA 1BW9A 2IRWA 4D42A 4D46A 1KC3A 1KEWA 4A27A 4DMLA 3LSYA 4HFRA 3CH6A 3BXXA 4K1LA 5L53A 3UGKA 5BSEA 5EINA 3LU1A 4B79A 3M1LA 1N9GB 1XU9A 1SAYA 2CMDA 1VSVA 5EN4A 3B70A 3ZCXA 3KOUA 3ROQA 4PFJA 4BNYA 1XR3A 1T1RA 3Q1LA 5DOVA 3KLMX 1DIGA 1GL3A 4AL4A 1DSSG 3V2HA 2IDZA 2RH8A 1Q1NA 1R4NA 1HDGO 3VC7A 2JL1A 2TMDA 3KSDO 1N7HA 1WLYA 2Z5LA 3WWYA 1P9LA 3QSGA 3GGGA 1C0PA 4ZHSA 4R9RA 5F21A 4R41A 2Y1OA 4PVDA 3VPXA 4DYVA 1H0KA 1LLUA 1GUYA 4D79A 4KDEA 2VHXA 3BZUA 4DQVA 5IDQA 5JYEA 2H9IA 1T24A 1LSUA 1LC3A 3NJ8A 4PLPA 4EUFA 1E1NA 3L4SO 2Q1SA 3ZH2A 2DKNA 2C54A 1RWBA 4I5GA 4IGFA 3GNQA 3P2YA 2C07A 4QQRA 4XEHA 3RQSA 3IAHA 4JBHA 2B37A 2E48A 1MG5A 1PGPA 1PR9A 3CSDA 3QWHA 3ZDFA 3TJRA 2H63A 3JQCA 4TVOA 4CMHA 3NTRA 3GPDG 4INAA 5C3MA 1HDYA 2DM6A 3L4BC 4OJNA 3T7CA 4XQGA 3LT2A 4EJMA 5JDCC 2ZATA 1BDMA 1Q7GA 3I9OA 3PHHA 3CKYA 1MFPA 3PHLA 2AQKA 2GN4A 4OOFA 3K8ZA 4RL6A 2W2LA 3VH1A 2VNSA 1X0VA 2B69A 2GGSA 2YFHA 3RJ9A 5JY1A 2Q46A 1C1XB 1J5PA 4IQ0A 3RKRA 2D8AA 5AYVA 4WCFC 3L9XA 4CLRB 3D0OA 2J5RA 1NPTO 3BHIA 1P3DA 3JQAB 3PPIA 3WX0A 3DONA 5AQ1A 4OKNA 3RU9A 3HB5X 1EVYA 1CIVA 3D1LA 1TXGA 3PTZA 1N92A 4NPCA 4Y6RA 3C7DB 3JD3A 3ROKA 3H7AA 3RU7A 4CMIA 2Q99A 4II2A 4FSHA 3EHEA 3H9EO 3OSUA 4PLZA 1PS0A 2ZB4A 1U5AA 5TSDA 4CV1A 1ORRA 3BMCA 3AI2A 3GA0A 3K30A 4D3DA 3JQAD 1U7TA 3BMQA 4WLFA 4EJ6A 1N1GA 4F3YA 4DA9A 1EE2A 3M6IA 1Y8RA 4XQCA 1ZK1A 2NQTA 2EKPA 2YHIA 2FPPA 3PLNA 4H15A 4CQMD 1QSGA 1SEPA 1G0OA 3WYCA 1LUAA 3ZWWA 4CQLB 4M89A 1H6CA 3IOYA 1G0NA 2ZYGA 4JROA 3FNGA 3B20A 3AK4A 5G0SA 5JS6A 2JD1A 3FBTA 1K2WA 4GPD1 3E48A 4UVIA 1W6UA 2C29D 2OBNA 3JQDA 2ZTMA 1KEPA 4JJFA 4DLAA 4N5LA 2VZ9A 1LLCA 7ADHA 2CZCA 3WDSA 4XB2A 4CMGA 1QYXA 3FTPA 1NYTA 4PG4A 4BO0A 4MPDA 3TZCA 3AUSA 4WLVA 4DMMA 5JW6A 5IZCA 4G2NA 4H3VA 4OXKA 4AJNA 3NGXA 1XWFA 1P1IA 1YO6A 4RPKA 4ALJA 4XKJA 4YAJA 3PLRA 3W8FA 4L74A 4BV8A 3BTVA 1AN9A 3W4IA 1RJWA 1NHWA 2C2YA 4UVEA 4A7PA 1ADBA 4KDFA 3ZU3A 2ZQZA 2C0CA 1GAEO 4DQXA 1GUFA 3JQGB 1YDEA 2GN6A 2VYVA 1NVMB 3ITDA 4P38A 4RVUA 3O9ZA 1I3NA 3OICA 3PIIA 3S2IA 4J9UE 5JDIA 1OAAA 1LRJA 3HE3A 4E13A 1PJCA 5H82A 2W2KA 1NP3A 1QXSA 1UXJA 1E7SA 4BNLA 5CEFA 1ADFA 1M6HA 1TEHA 4LRTB 3WYBA 1LDGA 3IS3A 1I01A 3BHMA 2I9PA 4IDAA 4NK4A 3QWAA 4Z0TA 4BO9A 3H3JA 3OJFA 3HNPA 1JAYA 4OYRA 1PU2A 3INGA 4YJDA 3AOEA 4Z0HO 2JD0A 2OL4A 1BSVA 4BGUA 3E9QA 2FR8A 2HMTA 3WWZA 1HE4A 1I2BA 1XKQA 2OP0A 3CPSA 4WLUA 3NGLA 1J49A 2CUKA 2BGLA 5A9SB 2OMEA 5T8KC 6LDHA 4MO2A 1ZKMA 2CFCA 3IP1A 3I52A 5MGBA 4ESOA 4BO7A 5I9LA 3ZWXA 1JW9B 4CMBA 2VT3A 4BS9A 2V65A 1CETA 3DDNA 2GSDA 1XU7A 3OM9A 2AQHA 4IZIA 4Q9NA 4XGNA 4J2OA 1PX0A 4ZVVA 1BXGA 4G5HA 1U3VA 1OOEA 4DPKA 4OL9A 4NR0A 2JJYA 1D4FA 2X5KO 3OQ1A 3EC7A 3H2ZA 4RZIA 4WEOA 4R3NA 1O6ZA 4JBGA 1D7OA 3NT5A 4FGWA 4NFSA 4NBTA 4XRGA 4L0QA 3JSAA 1CF2O 4X54A 1P44A 1IE3A 4FPXA 4N5MA 4PN3A 1T4DA 5H81A 2W90A 4L8VA 4YRBA 2BMAA 4YYZA 4AG3A 4ND5A 1O0SA 2YHIB 3OEYA 2Q1TA 1KVSA 5U1PA 1QYVA 1SNYA 2BD0A 4JBIA 1QP8A 2HUNA 5GZ3A 4ZQHA 4OSPA 2C7VA 4CLDA 2NUAA 4UREA 3UN1A 2O48X 4YWJA 1ZK4A 4CM1A 1BXZA 3IJRA 5BQFA 2YDXA 2YHUA 2EWMA 3H3FA 3T4EA 5JSFA 2VHVA 2DTDA 3KHUA 3FHLA 4I9NA 5EMHA 3F5SA 2ZYAA 1ENPA 2YFQA 1BDBA 2DBVO 4W9NA 3S2EA 1X7DA 3ITKA 3FR7A 4R01A 4A03A 5BSFA 1FK8A 3ZGYA 1O5IA 1LDMA 5CPFA 4CM4A 3TL2A 4RVDA 3RUCA 2B4QA 1T2DA 4NJMA 4QECA 2Q4EA 4B4WA 3AY7A 4ONEA 1KVTA 2GERA 4AJLA 4DIOA 4N54A 3AUTA 1PJ4A 1Y5MA 2X0RA 3AUAA 3ONFA 3WLFA 1YONA 3JQBA 4IQGA 1LLDA 5TJHA 3GR6A 5IJZA 3ROPA 3S55A 1K6JA 3D7LA 2VRCA 1DJNA 1GV1A 1ZMTA 4GQAA 3SJ7A 4PLGA 3ZV4A 1PEDA 4M8SA 8ADHA 1HLDA 4L73A 1WZEA 4D45A 4N5NA 5JAQA 4N18A 4LCJA 1S6YA 3H8VA 2FZWA 2PH5A 3PFFA 3NTOA 4XQEA 5FI5A 4BO8A 3DZJA 4BIIA 4HXYA 2VTEA 3KVOA 3TF5A 1O9BA 4KUHA 3H9GA 1NAIA 1O8CA 4BNKA 1ZCJA 4ND1A 1E92A 4ZQFA 3GLQA 4BB6A 1B14A 3JQEA 3PYLA 2VOJA 3Q0EA 1B7GO 3BIOA 1SBYA 4O5OA 1Y5RA 3WGQA 5JMPA 1X1EA 5G4KA 1E6EA 3U4IA 2CVOA 2BELA 1DB3A 1ZJYA 2EJWA 2RIRA 3QVSA 4DRYA 4MP6A 1QLJA 5IZCC 1V3UA 4Q3BA 1HZJA 2E4AA 1VSUA 3JQ9C 3OETA 2X86A 5H83A 3EVNA 3WIDA 1ENOA 3R6DA 3RD5A 1U3TA 4FFRA 3C1OA 1TT5A 2Y1GA 3I1JA 4XGKA 3KYBA 5JYDA 3QY9A 1DIBA 3VPFA 2F1KA 3DOCA 2ZKLA 3QVTA 1ISMA 2VWGA 3PGJA 4BKOA 1UP6A 4BNIA 5JDIC 1A7KA 3DOOA 2JCXA 1MXFA 1K6XA 1F17A 1I30A 3KYCA 1ID1A 2QW8A 5A03A 1ZVMA 2QRLA 2P68A 4B7XA 1PJ2A 1DJQA 1JKFA 1K89A 1KVUA 3H9JA 5CHEA 5DBFA
chains in the Genus database with same CATH superfamily
1KMNA 4Y2HA 5DYIA 3SS9X 1I2AA 4ME6A 3C6BA 3AKEA 1XA3A 1BU5A 3FM9A 5H1YA 5KMGA 2HCBA 2W42A 3U61B 4GYJA 1A9ZA 4TTRA 5LD2B 4YJHB 1JQKA 4LDJA 4JJGA 4BNXA 4OF4A 4LECA 1DOAA 4KMMA 1SM4A 1UM9B 3AZPA 3AOEC 4KNVA 4LRYA 1P1BA 4C30A 4CKWB 3FVTA 1AQNA 3BHJA 1U0LA 2D5CA 3GUUA 3DMPA 2C1ZA 3UAXA 3ASVA 4IKPA 5CM9C 1F2DA 5D87A 3LECA 1UZAA 1PJBA 4ANFA 2JW5A 4ZYWA 1K5HA 3UBTA 1KYQA 3DO5A 3T35A 1GR0A 2G63A 2ZVDA 4JXJA 3V00A 4DLXA 1WQ1R 1F8YA 2IXGA 1ZIXA 1NPYA 3LWZA 2E6KA 3EXFB 4XM2A 3FBWA 4Q4AB 3NBMA 3KWJA 2OV8A 3EOAI 3NH9A 3ZWKA 1GTSA 1ZVVA 1N1EA 1F2TA 1K9SA 1Q14A 1C3JA 2QVZX 1ZH8A 3G6KA 1SVMA 2AK3A 2DVMA 3HKCB 3LA8A 3MERA 4R2MA 5KSYA 3CTMA 3ZWBA 1I1NA 4JLWA 3MT8A 5JWRA 3IJEB 1OFHA 3GQVA 1QKJA 3HLYA 1P0MA 3S1SA 1FX1A 4BNHA 5DLEA 2GYWA 3QG1A 5KYYB 3DUFA 3G1TA 4A8JA 3OPVA 4IIJA 1HYEA 1TYCA 4QJIA 2NG1A 5KJ6A 3IPCA 4L7VA 3BD7A 3FMFA 4XW2A 4Q1DA 1CZOA 1JSCA 1RZ3A 2ZRDA 3K8OE 4HH0A 4YDSA 1G5IA 2YTZA 4PAWA 4JSRA 5DW3A 1DJMA 1II0A 2NVUA 3OQ6A 1XPJA 1ZD9A 2IZ0A 3E58A 5B30A 3JQFC 5BORA 1WM1A 4GG1A 2FWAA 3LHFA 3L92A 4NQRA 4QFBA 1PL8A 1PNTA 4A6PA 2ROQA 2CXXA 3U49A 3IX7A 1AK1A 2TRSB 3I39X 2JIZD 5AKYA 5C31A 4RA6A 2JHFA 1SQ6A 3L04A 4XYBA 4O2AA 1X1TA 2OXTA 1RD4A 1TIKA 2XB8A 2UAGA 3CF4A 5CLFA 5IULC 3DQQA 1FTWA 2I6SA 4QOSA 1RAHA 3ER6A 2VRCD 4J76A 4S2UA 4XFKA 1UK6A 4YAOA 5EKUA 3ZXUB 4AF8A 2EAUA 1EFHA 1G7SA 5EQJB 5TLSA 3F97A 3GZ4A 4QM6A 2POQX 1W581 2WIAA 3NHJA 1CRLA 2LBPA 1XCJA 2O2EA 5LZ2A 2AF3C 1PIWA 3K2EA 5IZCA 3DBLB 3EG5A 3WKAA 2HF9A 4LV5B 1NU8A 2FMHA 4QA9A 5I9SA 4DZZA 2R5FA 1MW8X 3SHQA 1VE5A 4R8KA 1IWOA 2R5NA 3P9XA 3QFCA 4HXFB 3L7JA 2BBSA 2WLSA 2FGJA 2VDWA 2BHRA 1WR8A 3GIDA 2IF2A 1SVNA 3G49A 3HKDB 4LXIA 4RF5A 2PGIA 1KH2A 5DCUA 5AMXA 4RSRA 2YX1A 3I92A 4MV8A 3VH2A 4D7AA 1POWA 3IDQA 2FE1A 2QN9A 4ZO6A 5CB8A 4ROTA 1RQRA 3LC2O 1FJGB 1CUAA 3RTBA 4EYEA 5A05A 1P75A 4RQAA 1EG7A 4GOMD 4H59A 4KOEC 5KJFA 2X6RA 4DCUA 3CVWA 2IZ5A 4AUEA 2PXXA 3U16A 1QH1A 4IQFA 4LJAA 3F4LA 5B2ZA 2VT6A 4UARA 1BS1A 2O23A 2QL6A 4HXEB 4M2LA 4X00A 5HMMA 2R4UA 3R76A 4EG6A 2V55B 3DBIA 5B1EA 5C8YB 3OURA 4FIZA 5A6SB 2JIDA 5FBKA 4NBUA 1SG6A 4BMVA 2X23A 1E3SA 1AKQA 1JSZA 2IS1A 1PBTA 2OOSA 3JAWB 4PBRA 5BNZA 4GSKA 2WSYB 1QRAA 1VL2A 2ENWA 4RADA 4Z1MA 5DGXA 1A5TA 4LVUA 3ZN2A 1P4AA 1TU4A 3T7AA 2Z4RA 5CB0A 1YVRA 2FLVA 3O3MB 3W5HA 2CFTA 3D3QA 4C6SA 5IDXA 5K6AA 5H8WA 3JQQA 2P4QA 1RYMA 2HHJA 2J7PD 4QLAA 2IXDA 3NORA 4JVOA 4LZAA 3WYGA 1T5LA 5AVUA 4Y7DA 3N59A 4WK6A 3DXXA 1RXVA 3B3JA 3HI4A 1H2YA 5KPJA 1GZSA 2Q5IA 2P6OA 4TYPA 1ULBA 4ZVPA 4N7MA 1TJ4A 1V8FA 1JAHA 2ZLBA 2M98A 3EULA 3B13B 3RROA 3UMVA 4E70A 5D2CA 4YRKA 2A33A 4KQCA 3PWZA 3GLIB 1AK9A 1GQYA 5AOBA 1SUAA 3N28A 2IEIA 1UPUA 2PZLA 3C16C 4DCCA 3LBYA 3NRCA 1W93A 1SHLA 1E1CA 1D8TA 1XZNA 1SXIA 2W2VA 4TT3D 4XCQA 5B37A 3RSFA 3SHFA 2EW2A 1IYZA 2F8MA 4PZYA 4LV8B 3M6VA 1UC4B 2B0CA 4GR9A 2BTEA 3H9QA 4OJTA 4AD8A 1E96A 2BKVA 4OATA 1I2ZA 4RLFA 4AN0A 3QHPA 3CVYA 3FMIA 3TOZA 1IG3A 4PBTA 5L4SA 1WF6A 3TSAA 4HN2A 2IXAA 1EWRA 3RUDA 3S6JA 4CV2A 3QX3A 4TMVA 2B92A 2KMLA 4Z7OB 3OPYI 4DCSA 1W75A 2C3YA 2ZRPA 4C2AA 4O33A 2K6GA 2EKQA 3FCYA 3I1FA 4I50A 1ZBQA 4BBZA 5I6DA 2WJHA 4BQEA 3MTIA 4CFSA 1Z18A 3AOGA 1DKUA 1X3SA 1SC9A 2C00A 3GWGA 5TX7A 1MBZA 1A8IA 4MHTA 4B6JA 5GJWC 3I6YA 4QG7A 2VXCA 2RHRA 1WO8A 4I9UA 4TUYA 1JGTA 3CLTC 3UG7A 1CLEA 3B3GA 4DWJA 1H05A 4BVHA 3TQCA 1COWA 5LP6C 4BNWA 2RJNA 1A8PA 4RX1A 1IVSA 4Z9FA 1L4YA 2W6NA 3GK3A 1ODLA 1XHEA 5DBHX 4IZ6A 1DRWA 3OUZA 5DNVA 3G85A 5IUJC 1NE2A 1XRSB 3H6HA 4MDEA 5JAIA 1RHJA 1USWA 5FO0A 2ECQA 1UJ6A 1YE5A 2PMKA 5DIFA 2FW8A 4OYLA 4X95A 4Q5IA 2ASEA 1JDTA 1JDVA 2FRDA 4E4RA 2O8EB 3GH1A 5GADl 3BGDA 3BGIA 2BLLA 3KU4A 4HC4A 4AAYA 2WYVA 3B3QA 2QRHA 5ENZA 4ETMA 3GNLA 3UW1A 1S2IA 3QOWA 1L7QA 3N7TA 2BEVB 4OHPA 4WESA 1I33A 4IDOA 3KALA 4LRXA 4M53A 2JFQA 2XYGA 4NU6A 1UP7A 2G7MC 3SBXA 5CW1A 3HJFA 2YN0A 4P4UA 3M89A 1LQTA 4HRAA 3KQLA 1LK5A 3I9V6 3EPHA 1EXMA 5J2TF 2ZT6A 2YVUA 1PL7A 1WP4A 4NJEA 4J2TA 3NIDB 3VH3A 4QEKA 3TQHA 1C7IA 3HXMA 4PGGA 3MGBA 1XQ1A 1L1EA 5DO9A 1CNMA 3FD8A 4HEQA 2C59A 4MAFA 3GZTB 3I5UA 4UBMA 2OUIA 1V0JA 5ARDA 4DV0B 3VFDA 3TXYA 2X7HA 1E2NA 1O95A 3E81A 3PUVA 1U2GA 2R48A 3WLSA 3ZIUA 5A3VA 4C2UA 2XQJA 3UJ7A 1RXSA 4G5RA 4HTFA 2O2HA 3L7BA 2AEFA 3HYRA 1KKUA 2YDYA 3CZ9A 3EDYA 3MA0A 9LDTA 2GN8A 2G04A 1NV9A 4NOMA 1MQ9A 4PPFA 4WXRA 2F55A 2VZ8A 1RAAA 1LBHA 3D81A 1GFSA 4TKLA 4GDMA 5KVQA 3QKRA 1WXGA 4I1SA 3DEZA 5CLIA 1AIPA 4L5CA 3LKBA 5HM6A 3MWDB 4JB3A 4W8OA 4ZANA 2DRIA 3QW2A 5A0VA 2F1RA 4GBGA 5LDGA 2VXYA 2A30A 1F0PA 2PJDA 5FADA 1YZVA 1V45E 2FSHA 2QMEA 3HVKA 4FYMA 1KYWA 3RR2A 3JQGA 4J03A 3GGPA 3GRVA 2JATA 5IUKC 5HSGA 3OE7A 2H07A 2O57A 2O1WA 3ESCA 4R2JA 5LIRA 2GCOB 1EB9A 4KEAA 1WMAA 3O91A 1A1SA 4WZAE 3IIEA 3WJ7A 3LO5A 2A1UB 3R75A 3TLEA 3RTDA 1VE9A 4MKGA 1OGJA 2B1RA 3HEMA 3H5TA 5CDTA 1ONBA 2RB4A 2ZUVA 2P2LA 4O4LA 1UDRA 1AKWA 3RPEA 4J3FA 2JGDA 1KI3A 1M6WA 5FUBA 2IHNA 3WYEA 2FPGB 3E9RA 3ZHBA 4FXOA 3ZCUA 2F3TA 1KRHA 1VDMA 2VDUE 1SUSA 4NWIA 4C0WA 1KMQA 2HJSA 3H84A 3SX2A 3GLFA 1F38A 2WSIA 3GMSA 2PUGA 1ZRMA 2A58A 3EIHA 3F98A 1P7WA 3LXRA 1XZQA 1KEUA 4DLPA 2RE8A 2REBA 3F3SA 1V6CA 4KX3A 4MPPA 4TTSA 4F6LA 4W99A 2OG1A 1C9NA 3VC2A 4C4SA 1XC7A 1MO2A 1C0LA 2GJSA 3AVPA 3JD2A 1B76A 4RNDB 5DT2A 3S5UA 3GN1A 1Z7GA 2AG5A 1DUVG 1RTKA 4G3XA 5DHUA 4YC7A 3PGMA 1J8QA 2PS3A 2BEUB 2AUNA 4EUKA 1FP4B 4G9GA 2J0VA 3L7NA 3FI9A 5I4CA 4JY7A 4MRNA 1LWOA 5K7SA 2FHPA 4JBLA 2GHQA 5BYKA 2O3TA 3WWPA 5BNIA 2CZGA 4BUZA 4F8YA 1WY5A 2IYQA 5AM1A 2O2XA 2PJZA 4N40A 2ZYTX 3JTMA 3X1WA 2W48A 4V0MA 3REQA 2IYPA 4D79A 1EK5A 2PRJA 3KQWA 4ASUA 1IOZA 4A2WA 2QJTA 4B6PA 2Q21A 1RHQA 2G77B 4XQ0A 5F3WB 1PV2A 1OLUB 3AJEA 3EGXB 3HQ4O 3KZ1E 4J2HA 4WNAA 4DVJA 1C2TA 2O54A 1BCSB 3SG0A 3R5TA 1DIOB 3N0VA 2PX0A 2IYAA 3PA6A 3U1BA 2IBTA 1KZYC 1OIVA 3FI0A 5EWJA 4ARVA 2QIOA 2G9UA 2X3YA 2GBLA 4WA7A 2Z0MA 2CDNA 4RZHA 4IDBA 5J23A 3HBMA 4GS5A 2R00C 3EH2A 3IP9A 4WBSA 5LQKA 3ZHZA 2E4UA 4KQFA 4DXHA 1QRTA 4DV2B 4U7WA 3GUYA 3NBXX 1Q44A 2SHKA 1EVEA 2GFQA 3A06A 3P27A 4J4BA 5FOQA 3SLRA 3RUFA 3IQFA 4UM9B 2B2CA 3B1YA 3OJ0A 1Q57A 1NW4A 4MYSA 3BQMB 1P0CA 3QBDA 1Z3IX 4YRFA 3P4XA 4ECEA 1P4RA 1PNOA 1A5AB 1TVKB 1ZM3A 4HJXA 4A6XA 2R6ZA 3UK1A 3DBHB 4E12A 3OPNA 2O1SA 4P7KA 3ZLJA 3G9XA 4QJBA 4ZZ1A 2FZLA 2VZEA 3B52X 3MS7A 1Y1PA 3EDOA 3QM1A 3W8EA 1IULA 4IL5A 4ZXFA 2QTNA 9ABPA 5J5VA 3N2LA 5CGQB 3OIUA 5T3UA 4G5SA 1TDJA 1S3GA 2QPLA 4I9GA 5FD8A 2R60A 3AERB 3UMFA 5A02A 1X15A 5EESA 1RRFA 3AEKB 5BSHA 3U60B 2D5LA 1OA1A 4JNCA 2VEDA 4NLLA 3HDGA 5JLJA 5ILOA 1E60A 1W85B 1XZJA 4BKUA 2QUJA 3M82A 3OJOA 3IAFA 4WADA 4FN5A 2I3AA 4URFA 1C29B 3UUWA 1MRZA 3JWGA 2ZE6A 5J59A 1TFUA 3ZWCA 3MHPA 1ZEJA 3RTCA 2D2FA 4R6XA 5DHFA 3U9LA 3F67A 2C4VA 2PA0A 3Q8XB 5D7BA 1Z0UA 2IHUA 2HHLA 5FOXA 5J2UF 5TF0A 2COUA 4B3SB 3QBTA 3IPLA 4UNQA 4QXRA 1OI3A 4MVJA 3FLMA 2WHXA 5I5GA 3LCCA 3N2KB 2CL6X 3OY7A 3T5BA 3A6JA 4WKGA 1X7XA 2PUAA 3PUIA 4G5XA 4ZT7A 5ICGA 2WVJA 3WOHA 3AX6A 2W0SA 4RJ2A 5L95A 1Z4KA 2D1QA 1E18A 1C14A 2MYPA 3FXAA 2V8BA 4HZIA 4WNIA 3QJ5A 4G2TA 2ZCJA 2DH5A 3OEWA 3RKSA 4E15A 2OCDA 1G3UA 4X61A 5LSAA 4BECA 4AWXA 1M6VA 3PHGA 1KEEB 1OX4A 4Q1FA 4RZXA 1DKLA 1L7XA 1BD3A 1SUDA 2W2MA 2ZR7A 2ZUUA 4NENB 5DMXA 1K8YB 1P9NA 1TX4B 1VLMA 4LQCA 4ZCPA 1ZU4A 4A92A 5EHZA 5K3EA 3TNFA 1OPXA 1P91A 1V8ZA 2PWBA 4JXZA 1GAWA 4MGKR 1ZEMA 2HNBA 1EYZA 1ZZEA 2PV7A 5LIPA 3V55A 1DFHA 1M1UA 4JVSB 5CT4A 5EP3A 1N5RA 3RIMA 1YCHA 2I6TA 4EYQA 2F9FA 2WILA 4QEDA 4B3CA 2X2OA 1ENZA 2OK8A 3HB1A 2ZJZA 1DJPA 1TOAA 2PGAA 5EERA 3I8XA 2A9OA 4LY6A 4IFIA 3JAMA 1WKVA 3D0KA 1PSWA 2CC2A 4NDNE 2QE7D 4JJ7A 3TDNA 2NZXA 1TUBA 3CTPA 4XM1A 1P17A 1BIFA 3SVZA 1LSJA 2O3UA 2GETA 2V98A 5AK3A 3TDKA 1PUIA 4R2HA 4WIAA 2YKGA 4JJ8A 3VR3A 4F86A 5HPYB 2H0QA 1FUIA 3UB3A 3TOVA 2YVAA 2ENUA 3SWWA 4E5MA 2IS6A 2GRUA 2DT5A 1IM5A 2IYNA 3CLRD 5C4IA 2DR0A 3FCCA 3E27A 1QORA 1LA2A 1X7ZA 3PRKE 4MKXA 3R40A 5JISA 1MH1A 3IEVA 2B82A 4C6TB 3IE1A 4RCYA 2QPTA 3ZQ6A 3AIKA 3ADPA 3QU4A 1KR2A 4WINA 4LF7B 2VJNA 3L5KA 1JFRA 2PBZA 1CEQA 3TAUA 1WEHA 2RGNA 3TWOA 4IDFA 4DEXA 3RGGA 4M1YA 1DS6A 1YRLA 3V4OA 3ETEA 3AHGA 1EK0A 2OGSA 1ZGJA 2RD2A 4BFTA 4ZRMA 2VPZA 5T64A 1V11B 2A57A 5C80A 1ZN9A 3DPSA 1UBTS 4LY9A 1FVXA 4YJHA 1UPCA 2B36A 3NBAA 1N4AA 4BIMA 1M1YB 2FPRA 4LE1A 5ERYA 3ASYA 4CKWA 1UM9A 4WY8A 4XAQA 4BO4A 1C9DB 4AJ1A 3FB4A 4UAUA 4S12A 1SOWA 3DOHA 3MTQA 3GFRA 1S2GA 4DAOA 1Z6TA 4YX9A 3ZS8A 4I3GA 4QX6A 3UTCA 1ZAKA 3K4PA 4FONA 3DTVD 2LP4Y 2C5FA 3R0JA 3RSCA 2EATA 4TSKA 4XSVA 1ORHA 2HL6A 5DNWA 4HGQA 3O73A 4EJFA 4Q66C 5DN6A 2ZVJA 5HILA 4PYQA 3FROA 2ZIUB 3EXFA 4DR5B 5F5NA 1NUUA 1Y7LA 4LXYA 1N8SA 3TEJA 2AT1A 4Q4AA 3I3OA 3QV1A 4KXLA 3ENNA 4R8SA 5KKCA 1NW7A 4NYIR 5CA0B 4ZVUA 1YI1A 4NBRA 5FFMA 1NFFA 3HKCA 3ACBA 3H13A 4QSHA 1UQTA 2G71A 2IYWA 2IYFA 4YDRA 1E6KA 3AIIA 5I01A 2NU9B 4GKKB 3PF9A 4G24A 5AKLA 2DPXA 4PSVA 3D4LA 4YUZA 3S2FA 4XGQA 5GONB 3I4FA 5KYYA 5TMPA 5IT0A 4NBWA 2H5LA 4Z99A 4FW9A 4J0EA 2A0KA 5HR5A 2FZCA 1A3CA 1TZBA 5DCLA 2FR0A 1FCJA 1JWAB 1OV4A 1ZH4A 2DHEA 5JXIA 3KYDB 1Y63A 2JKZA 3FZQA 3BGOS 2YICA 1VLHA 2QZ4A 3E4DA 3LW8A 1TECE 2WU0A 3F1LA 4Q3LA 3LBFA 1OGIA 2FH5B 1GGVA 3ESZA 2ORYA 2C2GA 2FFHA 3O8QB 1LXCA 1Z5NA 3Q0TA 4G85A 1L9KA 2ST1A 4E94A 4EMTA 4A8TA 1FP7A 1YRBA 1OH7A 3DKIA 3RFUA 3L5OA 1DKNA 2B1GA 2C3UA 1KVRA 1UC5B 5EKXA 3WKDA 3FFWA 1PLLA 2ZPAA 3NP7A 4J7XA 3BCHA 3P9CA 4G56A 4NMHA 2VJLA 2NV6A 3CF2A 4G0UA 1W29A 3OZAA 1R12A 1ZI8A 1YR2A 2O5VA 2QD4A 2WVGA 1EK1A 1UMCB 3B1JA 4OPMA 3UJCA 4ALNA 5I45A 1J9ZA 4YCSA 4G0OA 5TJ9A 3TZBA 4KR6A 2BJHA 2GZRA 2X9GA 2ZXEA 4XWKA 3H19A 2BRUA 2EKBA 1LKZA 3DBLA 3QLVC 1KAHA 5L4NA 4MQ6A 1FE8A 4BDTA 1IZYA 4PNZA 3P5SA 3C3JA 4CN9A 3MWJA 3HKDA 3E0XA 3RRFA 4DC0A 1D2NA 1R6UA 4PZEA 5H4GA 2VQEB 3I8OA 2H4FA 1CHNA 1X9GA 4I4IA 1YA4A 4BEJA 4F4FA 3R3UA 5I5EA 4LSGA 4GNRA 1W88B 3QE0A 2OHFA 5FULA 1M2EA 2RG1A 3AR5A 1XAJA 3H11B 4OB6A 3RVDA 1IDOA 2EL9A 3A1TA 1HUQA 3BWVA 4AUMA 4ETWA 1EQAA 3L7CA 1ZN7A 3BXHA 3COYA 2WF7A 4JOCA 4M7RA 3TRKA 3RVPA 5JYCA 1MNQA 3TX2A 1VG8A 3EK2A 1ATZA 3L6DA 4GLBA 3LK7A 1PVDA 5C8YA 1YI8A 2P5SA 2G83A 4Z7JA 1J07A 2LCIA 5A6SA 2OO5C 2G9NA 1NLFA 3JQ8B 3Q5GA 2JFZA 2DUNA 3JAWA 1T9GS 4GOND 2WZDA 5C8DA 5JBQA 2EP7A 4JU8A 1VP9A 2CVHA 3IOCA 3E9YA 3M9WA 2X4IA 1H93A 2RBKA 4M6WB 2FYTA 1BDJA 1DMRA 2HN9A 1AG9A 3AY3A 3OG9A 3QMWA 3EQZA 1D5CA 3CR7A 4PX2A 4CGYA 3P0JA 3QHAA 1E5QA 3HJAA 3EVGA 4V3BA 2D5BA 2ZIWB 4JN6B 1U7XA 5HA5A 3KAJA 3RV4A 2VG8A 2RK6A 4HB0A 1VPVA 3GAMA 4QXQA 3O92A 3ZZ1A 1GNVA 3RFVA 1BDHA 5AW4A 1VTKA 3RRMA 4MUNA 3DZ8A 3MQ4A 4XD7A 1LFAA 3MXTA 2J9XB 2H1HA 3GLIA 3UFXB 1NBMD 3DKKA 4AY4A 3GDWA 4D8YA 1M5RA 2H5IA 4BFXA 2FN3A 1KIAA 4WACA 4OI2A 3AVUA 4N12A 5GQSA 5JH7F 2O3QA 4JJ6A 4JJIA 2XT0A 2YMQA 4KAAA 1WZIA 1XEXB 2POCA 4H1UA 2WAAA 4IHAA 4BKMA 2NPFA 1FXUA 3A1SA 2QQEA 3H8SA 5BN3B 4B09A 2WJWA 2PFSA 1JIXA 5ADUS 2ZRIA 3NALA 5KTTA 1VPEA 2Y1KA 4JEIA 3DAPA 3DE6X 4QG3A 2B83A 4C9BA 4Z51A 5TPWB 2CB9A 4IGIA 5LUAA 5J4YA 1ISFA 4S1WA 1PZNA 1DBVO 3HCEA 3M1YA 4XLZA 1P2VA 4DIMA 3EDQA 4YR7A 4TX1A 1LS1A 4ZQIA 1X94A 5CFZA 3K16A 1KJIA 2C92A 2G1AA 4DLSA 4EPTA 2UZ4A 1M7HA 8GPBA 2HREA 3G2LA 3WGMA 1FS5A 1QX3A 1ZM7A 4I4TF 4V0KA 3ROTA 4RTNA 1GDHA 1LJLA 4OX9B 5DGHA 3TLMA 1YCGA 4RFVA 4IINA 4RCVA 1Y9ZA 4OXNA 1WZCA 1OAKA 2JJ8A 4CTNA 2XQVA 4BMYA 3PDJA 4HV4A 4XTRA 4HGRA 5GJCA 3T9CA 4N0EA 1E9FA 1MF7A 4HBZA 4B9EA 4BN5A 3FRHA 1T13A 4JYMA 3PEFA 1ZIPA 2O8EA 2DX7A 5E7QA 5THKA 2Z9BA 2GAOA 2HTEA 3D6AA 3C70A 1KGDA 3C74A 3DFFA 1RACA 2YZNA 3N3AC 4I8DA 4WKOA 4B4KA 3FOCA 1AMUA 1FDUA 1MAUA 4YCNA 1XROA 2YC2C 3ZV5A 5ALDA 2ZT7A 3COWA 1DQZA 4TPKA 4IHKA 1G3QA 1J0EA 3VKHA 2LRHA 1BEZA 4LI3X 2BEVA 4OTZA 4LVCA 3VZSA 4IKOA 4RU1A 4RHFA 5F64A 3CSUA 3HCRA 2P8JA 4E33A 3G0OA 3HC7A 3M4YA 4G67A 5CJ2A 1SRRA 5JS8A 1H4QA 4YRIA 2LTAA 3AUXA 1Z7WA 1AO0A 1A77A 2X0NA 2BFOA 2XMRA 3GP3A 1QQAA 1IB0A 1HKUA 5SZJA 3GFOA 4RNCA 4KWIA 3TGPA 3H05A 4YMWA 2E85A 4EEZA 4JLMA 2DWQA 1SQSA 2FN9A 1BFUA 3BSSA 2FR1A 4QLBA 5JO0A 2AE2A 4CF6A 4JEMA 1YL7A 1XZFA 3DP9A 3OEEA 3P9SA 4J0IA 3E6AA 2HDNB 4TRJA 1QTQA 1XQ6A 3MQ2A 4JIMA 1M2NA 3L79A 3RQIA 3AVOA 2AL7A 3T4XA 3JQBC 3CRNA 4QFCA 4P3XA 2PZJA 2GK4A 1XN1A 3OCYA 1OE0A 4O4IF 3A3KA 3E1KA 5DX0A 2F6RA 4H35A 4M4SA 3W7AA 1XNRB 3W9BA 2IU3A 4PZZA 1Y42X 1QBKC 3WHPA 1N8TA 1NTOA 4EO7A 3AJRA 1Z68A 1JQAA 2J3DA 4YNBA 3UCEA 3CLSC 3WR5A 3NOVA 1ZONA 3OLWA 2I8AA 3OX3A 4A3SA 4DJAA 3M49A 3ICPA 2F48A 4PWZA 4MCIA 4EW6A 3C97A 5KVVA 1UPTA 1K7FB 3DDZX 4KE6A 4MQMA 5HF9A 4MAMA 5B3AA 3D54D 3R9KA 1Q21A 1OTXA 1D2RA 3HDHA 3MWDA 4PS1A 1DAEA 1TCVA 4ZP1A 1YC2A 3W78A 2PUBA 2QTWB 3QYFA 3VZPA 2OV6A 1MO4A 5HKBA 1B6TA 3DKPA 4B3JA 2HRRA 5JNSA 2YYYA 2HJHA 4F2PA 1NVEA 1DC8A 1W25A 3A7DA 3EIEA 4G5QA 1CUZA 2GPBA 2ACVA 3IB6A 2JGRA 1UDBA 1KIFA 2CHUA 1ONSA 2XNJA 2GA8A 4XI9A 3EDRA 2FLWA 5F3RA 3L6OO 3FF4A 2QLBA 4JLVA 1USIA 2A1UA 2AN3A 1BMFD 2H2DA 3U40A 5B4UA 2VWPA 2P7IA 5F5LA 1R66A 1XMIA 4FFNA 1YGYA 4M1ZA 1HQYE 4OM7A 2FPGA 1C3EA 3AUUA 4YCAA 1I24A 1U0FA 2ZPUA 4ABYA 2B20A 2GOYA 5K8CA 2JI8A 3RSHA 5CCBA 4N5HX 3GLFE 1YRAA 4XYMA 4B6QA 4JUIA 1PL6A 4KDRA 1SBNE 4YHBA 1E9AA 3INYA 3LT5A 2CNNA 3GUCA 3KQTA 5FF9A 2IC5A 3EGOA 3TJZA 1P73A 4LGYA 4UNSA 4XDGA 4DAEA 5JXJA 1MOSA 4CI0B 1M8JA 5EJIA 4GYYA 1DRVA 3KOWA 1CV2A 4H7HA 4MVJP 5EIXA 1E99A 1EX1A 4DL9A 1W47A 2BEUA 1IATA 3OHPA 2DJIA 1FP4A 2A9RA 4Y6QA 1XTBA 2OLJA 1YE8A 3L2OB 2CJFA 2LDXA 2BJVA 2DQYA 2ZYRA 3G02A 3G2PA 2P35A 5M04A 1QP4A 4A1FA 5EHNA 1QAMA 1TMYA 4BKQA 4PN7A 4FIDA 3CT6A 2VJYA 2E2WA 1NXWA 3BMOB 4KBYA 4LZWA 2Y2UA 2GPTA 1NT2A 4O3FA 1J8YF 1ZIYA 4V0ME 5D3KA 3ZOZA 1C1HA 3EZ9A 1P0IA 1KDZA 1J0CA 3MCVA 4NE9A 4PO3X 2Y4OA 4R8VA 1RABA 1KSHA 4XB6B 3DJYA 3RBZA 2Z2JA 2X9NA 4O4JF 1IPEA 4ZD6A 1UM8A 2UUCB 1AKUA 1OLUA 3EGXA 4L6AA 3DT9A 1NYLA 3IHTA 1ECCA 3TCKA 4X62B 1BCSA 1GARA 3EYWA 3ZYCA 3L01A 4XRRA 3HXQA 2PGNA 3W3ZB 2M6SA 1UFRA 5HM8A 4U39A 4ZO9A 4DPMA 3R8XA 1PFWA 3QNMA 2Z3VA 3H5OA 2YCLA 2X0DA 2OO7A 3O8LA 5EOVA 4UUNA 2IOQA 2JNWA 2ADFA 2HIGA 2CNWA 2FVXA 1Q11A 3OJLA 4ZEXA 3KZVA 2JIBA 3ZZMA 3BJMA 2PWZA 3DAHA 5KX5B 1R9GA 1QLWA 5AVSA 1TT7A 3EUEA 5JAMA 3R7LA 3HV2A 3K4HA 3ZU4A 5FOVA 3L7OA 3NUGA 4HKTA 4YRGA 4PQGA 3HSSA 8LDHA 2ZAYA 1QFMA 5KDLA 2P4HX 3NHSA 1ZOPA 1UWVA 1P5FA 2WM3A 3LPNA 1XTZA 3DL4A 3FPHA 1OLOA 1VLZA 3AW9A 4XYGA 3TGLA 2GCPA 3VJLA 2GZHA 3LUPA 1KJ8A 4TSRA 1TVKA 1RIFA 5EUBA 5FWYB 2PV0A 2Q5EA 2P67A 4TTAA 3DBHA 4N4AA 2X40A 4DLVA 4OI4A 2HMWA 3VPDA 2V6FA 3UWDA 3WHIA 1XFAA 2DH6A 3RSOA 5ADVA 1HWYA 4Y6OA 5LYJB 2ORWA 1JX6A 1O6FA 2FJUA 5ALGA 1P5JA 4NOJA 3FPLA 3SZ3A 3NFYA 3ZNPA 4QUDA 3AERA 2W6PA 1LDNA 1XTKA 3AEKA 3P0EA 1VE6A 4I1IA 4LDNA 1DAOA 3C8HA 3EF3A 1DTEA 1JSXA 1W85A 2HLDA 2ODQA 3QX9A 2XT9A 1WS6A 1IZ9A 2W00A 1UEIA 2I76A 4IRUB 3ZNOA 3UKJA 2O7QA 3OE4A 4AURA 3ZVNA 1EFPB 1UKYA 3D31A 3DEJA 3H7IA 4TV8B 3ANMA 1P74A 1Z35A 4MVJE 4Q03A 1AS3A 3CM0A 2WC1A 4MTLA 3UMBA 1P31A 1JPUA 1KF0A 2XOXA 3GDOA 3N2KA 1Z3CA 4G1MB 4PPQA 3WZ2A 3DBOB 1Q83A 5G53C 3U6BA 4AX4A 2P9FA 2QZPA 3R9WA 2CDAA 1I5OA 5AOVA 1O96B 4G8CA 3SX4A 2WHYA 4HTAA 3TD6A 4EMSA 2IK8A 4EA9A 2ZJAA 3KEMA 1KEEA 4G0NA 4DYHA 1RU3A 3TSZA 5HZHA 1ADGA 2AF4C 3DUWA 1P4SA 4G41A 3JZAA 4NENA 4H0NA 2FN7A 2AYYA 1YE3A 2HRCA 4G5GA 4BZZA 2H3EA 3A3NA 4QNMA 3LT0A 3KAQA 4KMOA 1FVHA 4NXNB 5JCXA 1JHMA 3O1IC 3QEOA 2E49A 3DV0B 1QONA 1BX0A 4RVNA 5HCIA 3ZBUA 1I36A 3H5IA 4F2WA 5KKAA 1KQ3A 4LHEA 2A35A 2JKYA 4C1BA 4CMAA 4OQMA 5CD1A 1QQ7A 2WMOB 3ZGXA 2RK3A 4YALA 5IJAA 4GLLA 3U4GA 4C4RA 5IUNC 1L8AA 4JT8A 4LC9A 5E3IA 4YP9A 1G9SA 1AGPA 3PFKA 5L3VA 1U7HA 3VOAA 1XALA 4FZJA 2GO1A 2GESA 4E4YA 1I2DA 2YASA 3L1UA 5HHTA 4LGMA 2E7ZA 3JWHA 4DM4A 1Q17A 2QK4A 3KJHA 3HXOA 1X3LA 3EISA 5IVDA 4J0QA 2P1ZA 5AXCA 3UOWA 3ZTWA 3UJ8A 2GN1A 2Q45A 4X85A 4DE5A 4RM2A 1LBEA 1T29A 4DLKA 5DYWA 2V7QD 2DBQA 1BXKA 1UBJS 4ZOAA 4IJKA 1T9CA 5DHAA 1SHZA 1XQVA 3CINA 1FNNA 1KAMA 3ESBA 1P5RA 4WL0A 5U4XA 1GRRA 4Q00A 5AKKA 2LCFA 4C6TA 2G1UA 4BNFA 1GGNA 4Q02A 1JU9A 1DKPA 4P80A 3PIRA 5CDSA 2BLNA 1XYGA 1TF7A 1CIJA 3CMMA 2FUNB 4P31A 4OHRA 4R98A 4XIIA 3EXIB 5AKEA 3FVRA 3HP7A 1P2GA 1Y1QA 2HMVA 1EIZA 1NHGA 2O0HA 3H16A 3O90A 4NMLA 1PTJC 1ZKDA 3CFYA 3L8YA 3CJTA 4CLOB 4YQFA 1RJ9B 1F51E 1U9IC 4OJMX 3WIVA 2ZYUX 5EFZA 1U8ZA 1V11A 5CXSA 1Z15A 1OBOA 3EGDB 4R69A 1QIMA 3BE4A 5AXAA 5ALSA 3EIQA 4EFMA 4D9KA 1M1YA 4KRGA 4Q0MA 1N3BA 2NXWA 3T41A 3S70A 3GELA 3OIVA 3PXUA 4LISA 1V16B 1JBQA 1ZMRA 2HLHA 4NVRA 2R1VB 3T3MB 1JEQB 1H4SA 3H2KA 3C87A 1Z0KA 3D8UA 4WOKA 2C5GA 1Q0PA 4N1AA 3AXTA 4IFBA 4C07A 1AU9A 4QXPA 1V6AA 3WL4A 1MT0A 3W5CA 1JYEA 1VSQA 2UYOA 1FMTA 4AN1A 1EXWA 4HDMB 3IDSA 1GIAA 4MEBA 3AVVA 3FFBA 1IHPA 3GJ5A 3E7PA 3LWBA 2C2XA 2IZ6A 3P2EA 4XYEA 1XZBA 5C1OA 4Z3KA 1H3EA 2R6JA 2KSQA 4G63A 4OAQA 1K4KA 3OZDA 1YWGO 4EF5A 2YS7A 3RTGA 3SNHA 1KDRA 2ADOA 1KAGA 4QU9A 3TQFA 3UVEA 2P90A 3P94A 1BA3A 1Q84A 3WBJA 4WBNB 1IN1A 1CF4A 1W19A 2NU9A 5HJEA 2E5LB 2TECE 3TLJA 5GONA 3PP8A 4TLAA 4KU4A 2PPLA 1VJTA 3GLHB 3EFEA 1KKLA 4ZGGA 4MJ3A 5KKNB 4E2YA 1YIDA 2R87A 3MOGA 4NV3A 4FZRA 3U0BA 5HTOA 4PLTA 1II8B 1S3IA 3D8SA 5J4LA 4UAJA 5CEJA 2FDRA 1CX9B 4URHA 1VLQA 2IU6A 3KYDA 3KPWA 3QEKA 3WICA 1ZCZA 5BV1A 4V1CI 1R4NB 2BH2A 2V7TA 4S1OA 5T6BA 1Z4IA 4FOPA 3FTNA 5BYAA 4MLZA 3P9KA 1X7WB 3EZ7A 2CLFB 3NATA 3BFPA 1YR3A 3TTYA 3PGA1 5DYGA 2VSNA 2TS1A 3O8QA 4GYKA 1K63A 3M6WA 4RMIA 4AZVA 4I36A 2NUTB 4MV9A 1AURA 4BB9A 1MB4A 1Z12A 1PI3A 2VN8A 3GVXA 4HLCA 4IDPA 4E0BA 2FF5A 1DC7A 2KI5A 3EGCA 3MT0A 2H11A 3GOHA 4RE5A 1GZHB 4X3CA 1RAGA 4JH0A 4MGIR 4UKDA 1MT3A 1YD7A 4FYVA 3FCEA 4JKYA 1UMCA 3ZU6A 4YMUA 2BBWA 5LLSA 5EZQA 4BVAA 1JWBB 1Q22A 2QSYA 4M0PA 5ARBA 1EESA 4HAWA 3E3LA 1RLJA 1BAPA 1KJZA 2RB5A 2VSFA 2W2XA 3CEJA 1GZUA 2C2KA 2CLIB 3F9RA 3OFND 2VPQA 4Q48A 1DJOA 5CVTA 1ONNA 2FQWA 2IEBA 5JARA 1UT8A 3WKCA 4BV2A 2XNSA 3BRSA 4QUGA 3C6MA 4QUEA 5AIAA 4Z0NA 3ZI4A 3Q9UA 4P92A 3MBKA 2QRPA 1JFFB 2ZRFA 2AW3A 3NVAA 2ZWOA 4L15A 2CB0A 4Z9BA 4CMEC 2XUPA 1QYIA 2PX4A 1W88A 3FNHA 2LDBA 4R81A 1R0RE 3C3KA 1XA4A 5LBUA 3H11A 3PPXA 4IYJA 3ZE7A 1N32B 4KNYA 2PX8A 4HN4B 2XAUA 3FMGA 2AOUB 4M98A 3ADBA 2NPOA 1YQ9A 4MQ4A 4MKRA 1CK4A 4JNKA 1BQ4A 2V6BA 3C6XA 3JYQA 3R77A 3OBIA 4HPWA 1OYVA 3ROFA 1FFYA 4M60A 4KYTA 4PF1A 5AKHA 3SKXA 4JT2A 1ESMA 4ZDWA 1SULA 1T0PA 3JQ8A 5AUOB 2ZIEA 4JLUA 1G7CA 2YNMA 5AVWA 4M8NE 1D0SA 1Q1QA 1VL6A 2HWYA 4BB0A 4KACA 4B2YA 3W5DA 5IT9A 4KITB 3OCXA 1HE8B 3KJGA 4OFBA 4NAHA 1ZUD1 3DYVA 3EY4A 1OAOC 5BR7A 1DU4A 4M6WA 4A91A 2C83A 3GJZA 3PS9A 1GKLA 1TZ2A 2OGWA 3E9ZA 1A72A 5I4IA 3KD3A 3I6ZA 1P81A 3BTUA 4FMPA 4FFWA 3QHQA 4TQAA 3F3KA 1FNBA 3SM3A 3OEHA 4FOLA 1FLNA 1JLSA 2E87A 3BEDA 3WSWA 2G07A 4YBZA 5IXJA 4J1QA 5BVHB 1SU4A 2NNWB 1PN3A 4UEJA 1OLSB 5GP1A 3PD1A 1T10A 3BMQB 5FWDA 3BBLA 4NY1A 1A8QA 3CLRC 3O4FA 5E8JA 4K9OA 4AROA 3DE3X 3K70D 4XWWA 5FUVA 1RRVA 2R6FA 2Z5VA 3P52A 4PAQA 3GLIE 1QOPB 1YAJA 3UFXA 3VOSA 3LP6A 4JIGA 3K9HA 2WSBA 1BROA 1T2VA 5HKKA 1XTSA 1KZ7B 3KR2A 4F9FA 3K05A 1IQPA 1WZNA 5EIHA 4BKRA 5TS2A 4LKRA 1XEXA 1VIVA 4GI2A 5A04A 2VO1A 3L8FA 1XMXA 2HSEA 3A2LA 2B4KA 3UV3A 5B4TA 3L4EA 4JKIA 3RM3A 3X1XA 5BN3A 1K2VN 1VKHA 1JVSA 1TI7A 2FEKA 1OUMA 5CA1B 1WXHA 4HSEA 5IAGA 3ZNQA 2VNJA 3ABOB 1NQAO 5BQOA 1EVKA 4N03A 1NIPA 3OX2A 3FUXA 1YB6A 1KI9A 5TPWA 1XLUA 3VR0A 4NABA 3LTNC 1L5HB 1JAZA 4AKSA 6ABPA 1VECA 1SD2A 3UO8B 1AV7A 3EPKA 3T5PA 1OC2A 2VT7A 1U2RA 5EJMA 1C7JA 3DB2A 1RKBA 4B2IA 3G5UA 1I6WA 2DFPA 1AF7A 2WVHA 1WCV1 2XMCA 4D6YA 1PVOA 5DGIA 4JUFA 2QM7A 3V8NA 1I5RA 1FSPA 2ZB3A 1TM1E 4MAAA 2GNPA 4LSZA 3DMTC 5D84A 1KDYA 4BLQA 1PZXA 1VJGA 3FOZA 1NDUA 2HH9A 4UCQA