3W7VA

Crystal structure of axe2, an acetylxylan esterase from geobacillus stearothermophilus
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
219
structure length
219
Chain Sequence
MKIGSGEKLLFIGDSITDCGRARPEGEGSFGALGTGYVAYVVGLLQAVYPELGIRVVNKGISGNTVRDLKARWEEDVIAQKPDWVSIMIGINDVWRQYDLPFMKEKHVYLDEYEATLRSLVLETKPLVKGIILMTPFYIEGNEQDPMRRTMDQYGRVVKQIAEETNSLFVDTQAAFNEVLKTLYPAALAWDRVHPSVAGHMILARAFLREIGFEWVRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title A unique octameric structure of Axe2, an intracellular acetyl-xylooligosaccharide esterase from Geobacillus stearothermophilus
doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 90
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3w7vA00
1BWPA 1DEOA 1BWQA 1U8UA 4JJ6A 1PP4A 5BN1A 1ES9A 5A4AA 3C1UA 4Q9AA 4M8KA 2O14A 3HP4A 4HF7A 1FXWA 4K40A 2W9XA 3DT9A 4RSHA 1YZFA 1ESEA 4RW0A 3SLRA 1VYHA 1V2GA 4IYJA 4JJ4A 4H08A 2WABA 4TX1A 2HSJA 5CD9A 4NRDA 1K7CA 4I8IA 3KVNA 4HYQA 2Q0QA 1J00A 5JD3A 4LHSA 3BZWA 1IVNA 1WABA 3MILA 4JHLA 4K7JA 1JRLA 3U37A 2VPTA 3RJTA 2WAAA 4JKOA 4DEVA 3DT8A 3SKVA 1DEXA 1ESDA 1ZMBA 2WAOA 3P94A 4PPYA 3DT6A 2APJA 1ESCA 4OAPA 1FXWF 4XVHA 1Z8HA 3DCIA 1BWRA 4JGGA 5HOEA 2Q0SA 4S1PA 3PT5A 4OAOA 4K9SA 3W7VA 4Q7QA 1VJGA 3DC7A 5B5SA 4K3UA
chains in the Genus database with same CATH superfamily
4QECA 3QU7A 5CM9C 4ZI7B 1NVVQ 5K03A 3DV0A 4FB5A 4ARIA 2XRFA 4Y1FA 1NF8A 3SHOA 1QCYA 1G3MA 1VP3A 5EP4A 2E18A 2XCTB 1ORHA 3E5MA 3MF4A 3A1WA 3IB6A 1CUWA 1T34A 1XMSA 1Y33E 2G06A 3LQYA 4P4TA 4UBOA 1Z33A 1SC1A 1XD2B 1NXOA 3RFTA 2HNBA 3ZQ6A 2HO5A 4Z4FA 3F71A 3FB1A 4OBEA 3R0IA 4RKEA 4X6LA 1CJTC 4ABTA 5BQ3A 1D09A 1ZXBA 2C7BA 3NETA 3QE3A 1MW8X 5F9MA 3IUPA 2FB9A 1ZXLA 2PR7A 1BOOA 3UFXB 3DE3X 3DP9A 1H3NA 3NIGB 1CP3A 3G8AA 4IYJA 3JYLA 4TZKA 4R1NA 5ALPA 2CFTA 2VOJA 4ECAA 1TU4A 2C4KA 2X2EA 3HO8A 5J5AA 1RMQA 5FL7A 1TM7E 3QFSA 2ZTMA 3EXEA 5ALMA 4RYLA 5EIFA 4BKRA 2XCUA 3CSUA 1J0BA 2NM0A 2OAP1 3MGGA 3OJOA 3ZOZA 5ALIA 1Z8DA 4IHJF 2JRCA 1VCIA 1SIUA 4G0ZA 3HCFA 1X7DA 2ECFA 3BRCA 5BY2A 2XHEA 4M9SA 4LC1A 5L7YA 3R24A 3U81A 2HI0A 2FAXA 4MWZA 4PQYA 3OLQA 3QXCA 5KOJB 3A31A 4E51A 2YCLA 4AMVA 2IPMA 4UATA 4DQXA 1JAYA 1MC1A 4AVYA 2VZ8A 5LBUA 4BNGA 3DJFA 2XB6A 2I91A 3GARA 3MILA 1FRQA 4G1MB 1U5BB 3R5KA 4F4JA 1D1TA 1X42A 2OZKA 4TXJA 1LSUA 4JXKA 1GPUA 1KH1A 2CK3D 2DFLA 2XQKA 4PHFA 1CR0A 2HQ1A 4O4HF 1AGRA 2ZBUA 3BIXA 5HKOA 1BHJA 2G71A 4AJHA 5GPBA 4DV4B 1CK4A 1E77A 3LCCA 3KS9A 5EMMA 1KO8A 1GYQA 5BMVF 3GFFA 3PQ6A 4XYLA 4IOLA 2FPSA 4MDHA 3FWPA 5CG2A 3QG5A 2GPAA 3RRNA 1DKRA 4TWZA 4IH1A 2HA0A 4A1FA 5C1DA 1JEJA 1EBUA 1U5CA 2ZU0C 3L7BA 2ZUTA 4I1VA 4YHHB 2ZRQA 2J85A 3FJ1A 2VPIA 3VR4A 3ZVKA 4LOJA 4M22A 4RSRA 5LB4A 4WN3A 3QYJA 2X8JA 4ZT2A 3S44A 3GU3A 3N7AA 1JH8A 1IH8A 2GBCA 1MJ5A 4ZMBA 1SPBS 1JSCA 2RG7A 4I7EA 3EDMA 4EJ0A 1SD2A 3BJIC 4NNJA 4RHEA 2YHIA 1C7JA 2ZRBA 5G1OA 5IUJC 2CT8A 2IELA 3ETGA 5JDIC 3ZXUB 4AKIA 3T9DA 1II0A 1PNVA 3WWEA 3H9UA 4KK4A 3UG6A 5LWQA 3F6PA 5LL6P 1VE5A 1EE2A 1ORRA 2EOAA 2HSWA 2QPTA 5LQCA 4KVAA 2GOYA 4E07A 1DGQA 2F59A 2O1XA 4HB4A 4H4EA 1KAMA 1PR2A 2OB1A 1U9YA 3CRW1 2PXXA 3K5WA 4CM3A 2GVNA 4CZ2A 3AM5A 3B2QA 1SK9A 1V95A 1AUVA 1QH8B 3CLUC 1D4ZA 2BEUB 3PFWO 1XN4A 1YRQA 2W2XA 1W87A 4IDEA 1QAOA 2WV9A 4R1SA 3E8XA 1W1IA 4CIYA 1U2DC 1YB2A 5DP1A 3HUTA 5JH7F 3VDRA 3AR9A 5B7QA 3ZI7A 2XCQA 2ZSDA 1CUYA 2TMGA 3EGVA 3KDAA 3OA0A 4LKOA 3VDXA 3DL4A 1ULHA 4BO6A 3ZNOA 3LNCA 3MYRA 1U0GA 3O8QB 3V7YA 1NVAA 1ZC3A 4WXRA 2KBEA 3C43A 3EWAA 2Y99A 3LPMA 2O2HA 2GBGA 3P4YA 4FHGA 3RARA 3VJLA 4DZTA 1JG4A 3EFOB 4HNGA 3C6YA 1MGPA 2D5CA 1J8QA 2CLSA 1V1MB 1DQRA 2GZMA 3JQAA 1DB3A 3JVEA 3UUGA 1WD5A 2WSBA 2ZP1A 1GZDA 2HPZA 4FYJA 3UJ8A 5KVCA 1EDDA 3DOIA 5IARA 3ORQA 2YXNA 4KXYA 4NE9A 3GBVA 5EIAA 3RU3A 4DSTA 2DR2A 1FSPA 3SY8A 4J16A 4Q4LA 3T3IA 2R6GA 2ARKA 1R9JA 1C1DB 3S5UA 4D9HA 3QNMA 4NCXA 4B7CA 5AUOB 2TECE 2HUNA 2JFGA 1IPEA 2C4VA 2QWXA 4J4TA 2AWNA 4WMLA 5BUSA 4DB2A 3FZQA 2Q1UA 1USKA 1W4BA 4L22A 1RXYA 3VPSA 2WP0A 1IM2A 5HDQA 2ZIAA 4FEYA 4DIFA 1E2JA 4L8GA 4OHOA 5LP6A 5B3AA 1R2QA 3VU1A 4B4OA 1JZQA 3IQDB 2Y66A 5DB4A 1GDTA 3UAOA 1Z07A 3M83A 2PUFA 1AKVA 1SQFA 3C6ZA 3FTPA 5DGIA 3T7DA 2HAEA 1ZUNA 5KKCA 4AJLA 4FIZA 4OQQA 1J5XA 3TLXA 1BMFA 2KQUA 4QRIA 1NVGA 1PD0A 4G01B 3PWSA 5D87A 3JD2A 1U9CA 1SQGA 4BMDA 1XJWA 4RQBA 4F4CA 3KKOA 2JLCA 2RI1A 2QD3A 5E6SB 2QE6A 5DIFA 4C7VA 3AO0B 1XK7A 1OAOC 2O2YA 1Y3BE 4NPCA 4ROTA 5DNAA 4DEVA 1BQEA 3M2PA 5TV2A 5HOQA 1G6OA 2EGGA 4TWRA 4G67A 3DA8A 3R3VA 5CA1A 1UPBA 4M1SA 2GKGA 4ND5A 1IN8A 1DI0A 2AR7A 2DM6A 3UJPA 2C77A 3QNUA 4IYRA 1YJAA 1ND6A 2ZR8A 2VDLB 1R18A 1X7WA 2KPOA 1QQTA 2REQA 1GPAA 2DVMA 2I6UA 3DL7A 3PPVA 4PTLA 3SOZA 1WB6A 2P2YA 3TB4A 2AG5A 3UK2A 1J5EB 1E5VA 2IXBA 1ODIA 2H9IA 1I1NA 2O3QA 4FFSA 4C7BA 4INAA 4WDRA 5GMOA 4JQSA 2FPOA 1O6GA 3IURA 2WTXA 4K6HA 3BL6A 5JCJA 5FORA 1E9FA 3PEEA 3TTXA 1XRMA 3DWEX 4I4NA 3KSAC 2PBLA 3LC7O 3BB4A 4IIJA 4EA8A 5TNXA 1X13A 1Q0PA 1KU0A 2GLXA 4LNUB 5JISA 3H9QA 3L07A 1BEEA 3PNPA 2ZSHA 3DO8A 4UVIA 1OIWA 5A04A 3DVLA 1Q0UA 2RHWA 4F96A 4YMHA 2F8MA 2D2XA 2HRQA 3NZEA 4K9NA 3ZWOA 1SKMA 2IS4A 1Y8RA 4LRSB 4RDXA 3QV1A 3E8MA 3A7EA 4B2YA 1PGQA 2V59A 4UAJA 2VP0A 2VSNA 3IHTA 4MUNA 5IH7A 1GPH1 1N6KA 5EUMA 1WY7A 4K6GA 4HEQA 5ECYA 4ZAFA 4O4IA 2GSWA 3STTA 1R4NA 3G8DA 1QLJA 2AZ4A 4L2IB 4DYHA 1HA3A 2V6GA 2OWDA 4PE5B 4YNBA 4QTYA 3UT6A 2MSCB 2FH5B 2Q21A 3OTIA 5FTWA 3AUUA 5EHXA 1SVSA 2ORWA 1PJCA 1R37A 1BS2A 3DM5A 3SE0A 3ZDXB 4DMHA 6GPBA 3MHTA 1M83A 4BLOA 4P3XA 4C0HA 1KS2A 1M33A 3KL2A 1RTKA 3VVBA 4DMMA 1T0JB 3JQCA 5HZMA 2Q9BA 4KYTA 2EFGA 3QU5A 4G85A 2PHZA 5IUKC 3ZI0A 1UBRS 3AGPA 3DHEA 5TMDA 1J1UA 1IQ0A 1JZTA 5BV2P 3OZGA 1OKKA 2HQRA 4NV0A 5JPDA 5JQGA 3KWFA 4LYFA 1B8VA 4EHNA 4PIMA 1OWNA 3QBDA 1W1WA 1DAIA 2YYYA 3A05A 3MTGA 4X7MA 2DWQA 5CM2Z 3OFJA 3ZCXA 5J2TB 1PJSA 1SVOA 1LD3A 1YIOA 2BGGA 1DUIA 1PT7A 2RGNC 2W0SA 3IDQA 5COAA 3T7AA 4EGSA 3RRZA 3LCJA 2RGWA 4Z9BA 4E15A 1P5ZB 5IDXA 2GBFA 1GU7A 1P4SA 3U44B 3CZ9A 2OENG 2R1TB 2ZTHA 2V8OA 5DW3A 5F77A 4IGKA 3RKUA 5FBWB 1WTCA 3DZJA 1WP9A 3O3NB 3OHMA 3K5PA 1KHTA 2VZEA 1KDPA 4U7WA 5EFZA 1WXHA 2CLCX 3I01M 1ZN9A 1VL1A 2YHBA 1HOXA 4JX9A 4NENB 3E27A 2PAAA 4NZZA 1S2GA 2FVXA 2A88A 3ZBPA 2O8CA 3JD0A 4P8RA 2VYQA 3HR7A 1BROA 2R6JA 3HA2A 4ZCLA 3WL5A 4QVIA 3AETA 4EH1A 1A7KA 3ZD7A 1EH5A 5FPYA 1UK8A 4RDIA 1EM6A 3UWKA 3D5TA 3RUAA 2G63A 4PSDA 3CPSA 5CW2A 1G1AA 3ZQ4A 5CIYA 1I80A 3LXMA 3Q7RA 4YUAA 4B6SA 3A6DA 3H1PA 4WERA 1YR8A 2JFUA 1M1ZA 1OWMA 4BO2A 3DOFA 5JAIA 1SVLA 1GAEO 1RJ9A 1WVGA 2JH3A 5BNFA 2QRHA 3PQDA 2HSZA 2ZT6A 3ABIA 4YCBA 5FOQA 2WUFA 4W99A 1SZJG 1D4AA 3O1IC 3K2QA 1GFZA 5SYNA 2I1WA 3PA8A 4EVQA 1YAJA 3P9QA 4YCNA 3V1MA 1RAEA 1LQUA 2B94A 1YXMA 2VJOA 1IN5A 4N5HX 2VHWA 3UQYS 4KDRA 3ITKA 2CSXA 4FFRA 3ZJ4A 3K70D 1CJBA 5CTJA 4YLYA 3EFEA 3FDZA 3F7TA 4WCFC 3MOIA 3N07A 4CNQA 5AHOA 3GCZA 4E4RA 4OU4A 3VU0A 4N7BA 5B12A 4P7GA 1CTQA 1G3UA 3RF6A 2MYTA 2PKWA 4HFJA 2V7WA 4DDUA 2AC2A 3EK2A 1VGQA 2A14A 2O1SA 4P4SB 2QJWA 1KI2A 3GK3A 2BFEB 4MVJG 2ZQ5A 5KEIA 1IN7A 4J3NA 2FFQA 4CM5A 4UQPA 1IUKA 1AVTA 1V47A 2XGOA 4LEIA 4TMKA 4Y67A 4BLRA 5IANA 1P7VA 2WPNA 3BSWA 4TVOA 3M4NA 4QGGA 5EMKA 5U4QA 1EVKA 2BGNA 3SXUB 5L4LA 1SHLA 1EDOA 3EZXA 1OWLA 3FFAA 4XOUA 1J2UA 3DBHB 3E3LA 1VLHA 4HK4A 2ZRLA 3N0RA 2VRCA 2ORED 4GI5A 1N4DA 4J90A 3WFIA 3WK4A 1T9KA 4B3JA 2DR0A 5KPJA 3U6BA 1VFPA 3V32A 4K2AA 3K6JA 4EIWA 5K4GA 1NTRA 1W9MA 4IV8A 5E9QA 2O8EA 4KI0A 3ZU4A 2FR8C 3NKFA 4LN1A 2NZYA 1B0UA 1DJOA 2W2TA 4B6RA 2WIKA 3HTXA 3FOCA 1WF6A 3G7SA 1H5QA 2ZJ7A 4XGKA 4KGDA 2JARA 4ZRMA 5HJEA 2FPIB 3VR0A 4GBGA 4LGCA 3WHPA 2CXPA 1ISIA 3Q11A 1C4XA 4OXXA 4MV1A 4D8TA 4EA6A 3JQ8A 2QJTA 4XM2A 2IY9A 1H1LB 4CV3A 5BSWA 2X5KO 3NP7A 3NRJA 3EGOA 1VXOA 2FZ4A 4PAWA 1FQJA 2HA6A 1BH6A 5IBQA 1Q6YA 1Z0JA 2F00A 1PJRA 1D5WA 2D54A 1Y5IA 1ZCBA 2Z56A 3ZWYA 1JJAA 3RWOA 1FCJA 4A0GA 3AX6A 4RFVA 3IC5A 5G0UA 3GJXC 2JVKA 2QENA 1ZW6A 4FILA 5H4HA 4E5YA 4D74A 2R8XA 3GDWA 3Q6NA 2VXYA 3C3KA 4OB8A 4TLBA 1QQ6A 4BUCA 3U61B 3ND8A 5EXPA 1JFSA 4RF2A 1VMKA 1K98A 3HLTA 3EUFA 4TM8A 4OPMA 2VHEA 4GLLA 1QV6A 1J8DA 3GLHA 4FMCF 1LUAA 3G8YA 4ZU6X 4EB3A 3DEFA 4D99A 3ENWA 5FWAA 3TVDA 4B7XA 1FJXA 4RY9A 1D2RA 1NE7A 2WE7A 4PRYA 2O2XA 3WOVA 3I6YA 1YDHA 4QARA 3W3AH 3EXFB 1UEJA 2RHHA 4OEHA 4B4WA 4C4SA 5AXBA 4ZCMA 2UVDA 3AVVA 1PSZA 4GMKA 1K27A 2QVCA 2RHJA 1RP1A 4I50A 4MS1A 5IH3A 4MEJA 4E21A 2AJLI 2YOFA 4MKGA 1M0SA 1UC8A 2JGJA 2AJDA 3A3PA 2WNIA 2RBEA 3WAGA 2Y1KA 3EQZA 1GG2A 1Q15A 2Q6OA 4DR4B 2JFHA 2QHXA 4UFOA 4E14A 3L7AA 2C2HA 4F38A 1U8XX 4M60A 4PPYA 4ZC1A 2O1EA 4KYIB 4ARSA 3KAJA 2H2WA 4AL4A 5EYPA 1RQ2A 4PRKA 1TC2A 1GTL1 1WO8A 3R23A 4IMIB 4M54A 2NTNA 2BISA 2VJPA 2CYAA 5JW6A 5GZ1A 2Y2VA 5ALSA 5SY9A 2NXJA 3NU1A 1EFPA 5FUVA 2J9YB 4CTKA 5J4HA 1JJFA 1N77A 4DUPA 1TM3E 2JGDB 4RAQA 2RGEA 1LQ2A 4HCJA 3NRCA 3RSGA 2A59A 4QGSA 1YZHA 3MB5A 4ROSA 1DBSA 3FOZA 4J07A 3W7VA 4QD3A 4P0QB 1Q3HA 3GFOA 3QLEA 3IKVA 3AR8A 4P5EA 4WSOA 4KNYA 1F7UA 3B1FA 2OV8A 2BFBB 3SZRA 2Q3CA 4HX2A 2WKWA 5BN5B 3HXOA 2OAEA 1SXQA 1WOMA 2RK4A 4CG0A 1ACJA 3OVMA 1GRQA 1WULS 4RE6A 4UM7A 3RK0A 3RC9A 3BREA 3ITEA 3BIOA 2WFLA 3T5CA 5EKTA 2D7JA 1ZKMA 3KDSE 3WIUA 4A26A 4JR0A 3IERA 1OI3A 2NO0A 2E5LB 2ZM6B 4YJHB 2AJCA 5F12A 1CF9A 1DBQA 2J0UB 4M1ZA 4NMLA 2AYXA 5LQMA 4GBJA 3WGNA 2HCTA 1KY2A 4XVUA 1M9NA 2KMLA 2Q5FA 4IXMA 5D7BA 2X9LA 3ZIDA 3LUGA 3KOXA 4ZMRA 2BL4A 4WBNF 3L01A 4KU4A 4UMVA 4JL6A 3P2JA 1NLZA 1IJKA 5TGTA 1C50A 4OHMA 4NAVA 4CM8A 2EJWA 2HY7A 1Y5RA 4B9EA 3EQ6A 4TT3A 1EIWA 2HU7A 1IFXA 2JGKA 2AMFA 4G4JA 3H2GA 1XV5A 3L77A 1E5LA 1Q91A 2A35A 2XB9A 3T3EA 4ZIRA 1JPUA 2C7QA 4XYMA 4DE5A 4YJ2B 2E4UA 4EYQA 3SYTA 4MKXA 5FO1A 5JBNA 3NYIA 1OHHD 3NALA 1J0XO 3PGA1 1GXSA 1VHJA 4A8TA 4IQFA 1MB9A 2I2WA 5J3JA 2QUZA 5IJWA 3TR5A 4QUKA 3I3SR 4KB5A 4QBTA 4DLTA 3GA0A 3HPQA 3I2HA 4HAYA 1W0CA 2VI5A 4G07A 5BP7A 4YAEA 3Q8XB 1L8AA 4HDQB 1H2BA 1J09A 1M6HA 2BONA 3KEFA 1CHNA 3OE1A 2P2LA 2QT0A 5U4XA 3RUDA 1WD7A 4EY3A 5I7AA 1U3UA 4TUYB 2KS6A 2XHZA 3A10A 3DDZX 3RYTC 3FCYA 1U0LA 3QKIA 3ACDA 2UYOA 4JEHA 2O7QA 4AS3A 4NK5A 1AOXA 3KEOA 1II8A 3K70B 3G79A 5DTJA 4GPBA 4N01A 2H54A 5C34B 3IILA 3JAKA 2IU6A 3Q0EA 4ZAVA 4L4XA 4GWLA 3HPRA 5HIJA 5TLSA 1GGJA 2OEPA 1JAXA 1NQAO 3RK1A 2WYOA 4OLJA 3RT1A 4D02A 5DP2A 1KDRA 3E23A 4TKLA 3RC1A 1E66A 4CMKA 3KJXA 3N7TA 4UUNA 4NYJQ 2CUNA 4FGZA 1VZ3A 2X5JO 4O0LA 3TE7A 3WB0A 3PCRB 2RI6A 4JLUA 3HN7A 5IFKA 2C5FA 3OPNA 3WBFA 1ADJA 3ADBA 1Z4LA 3WB9A 4AO6A 2V5UA 4AYTA 3RANA 1BAPA 1ISGA 1O6CA 3A1NA 3C5HA 5CGQB 3U9LA 4LBVA 1CUAA 4LY0A 1J33A 1TQ4A 2YN0A 1G8MA 2AOTB 2Y1GA 1XCOA 2ZQYA 3KTFA 5DV9A 3VZRA 2P67A 2FLVA 1F2DA 2HYIC 3RUEA 3OIFA 3PE6A 5TQ2B 4EPRA 4O33A 4HRVA 1EBFA 4E3ZA 3ZKAA 4REQA 5IWAB 4AK9A 4ZVSA 1I7PA 2LIPA 1GG5A 1NJ6A 4IOKA 2X9QA 4N0MA 5DYYA 1RAIA 4HN4B 1M1YE 1EK0A 1RPJA 3CGWA 4HI0E 1MG5A 1XL1A 4IGIA 1MAHA 1NFQA 3C15C 1MX9A 2G08A 1V11B 4LPSA 4RH0A 3FKSA 4WA7A 3TLBA 2Y4OA 3ML1A 1G6HA 1U2EA 1MN6A 2FA9A 2W00A 3R4CA 2QUJA 3O4VA 3VSDA 1O7JA 1IHDA 2J9RA 2WVJA 4J4HA 3TSZA 1ZKDA 3B3JA 5IHXA 1CUFA 4L9RA 4UE6A 3LX4A 4PO9A 4QBGB 2QN3A 5EWMA 4A91A 2PTGA 5MN4A 4TZ0A 1O4WA 2J9XB 4ZGWA 4KQIA 3PQCA 3OQOA 2XQGA 1OIXA 1SVWA 3VQTA 1NZFA 5CBPB 1SXGA 1TKRA 3ORFA 3E9RA 2R6R1 3H0KA 5FR1A 3A25A 4F84A 1A9QA 3FTFA 4BMCA 4KKVA 1SUWA 5L3SB 3SC2B 2WFAA 2XKAA 4ECEA 3RF7A 1WNTA 1OC2A 3CUUA 2XQFA 3VBCA 3W2HA 1OOEA 2A0FA 4UEQA 1KC3A 3RFFA 4H4DA 2VIIA 1Q95A 5AVXA 3BQ9A 3L4SO 3AC0A 2ZRDA 3EEFA 3M6UA 4V1CI 2XWQA 1AX9A 2CHEA 3D0OA 3RG2A 4EUSA 1TNDA 4YP6A 1GL7A 2OOSA 1S4MA 1MXFA 2VTBA 3F97A 1JT9A 3AIKA 3IMKA 3GLVA 1FQOA 1OWPA 5TSDA 4MUGA 2NUTB 5L40A 1NOKA 4NZOA 3TL2A 1T5SA 3N2YA 1OXXK 3UY4A 1GPDG 3NV7A 4PQGA 2BELA 4ETMA 4IV0A 1L7BA 4WESA 1T5OA 4LVUA 1E9RA 3DC2A 3PQEA 1JWLA 2Z3VA 5J63A 1JKJB 3I5MA 1RI2A 5IC4A 4LXHA 4MKZA 5ALNA 1N25A 1QR6A 1LVHA 1H05A 3PE3A 5FTMA 4BWFB 4MUJA 3FMOB 5J23A 2QMEA 1ZNXA 2QTGA 1F38A 5CDUA 3T5PA 1WL8A 4RQUA 1DO0A 2W6MA 4JU8A 1C3OB 1KPGA 4EKYA 1QTQA 3IVMA 4LYEA 2ACWA 3PX7A 1GM5A 4GYYA 4XB2A 4LHSA 1OCEA 5DH9A 2QIOA 1NOJA 4EFLA 1T3TA 2LUOA 1JEDA 2NXCA 1F1JA 1F2UB 1ENYA 3LCMA 3ONNA 3IAFA 4J6FA 4LG1A 4E22A 1DHTA 2GN8A 3L4KA 4XWOA 1JXQA 1E3TA 4XYGA 3WHLA 4A6PA 1HEIA 2FZLA 2QTCA 2X0IA 3GMDA 4B71A 2PGDA 1U7TA 4XEHA 3H5LA 4DCNA 2B1QA 5I6DA 3ZDDA 1FY2A 4W9NA 2BR4A 5E8JA 5KYNA 2OFPA 2WRZA 1R0KA 3H65A 1G7RA 2AC4A 4PS1A 4US1R 3QTLA 1BIFA 1J4AA 2BFDA 3KFXA 3PRKE 1KFEB 2ZSJA 4JP1A 4KE6A 5ALRA 3BN3A 2MR6A 2C54A 4EUNA 5JSQA 5T5QA 4MTCA 5F2NA 4P5PA 3WGQA 1ZJ6A 1E89A 2FZKA 2PM8A 3ND5A 2YN4A 4ML3A 5AR1A 2Z6AA 3ZYCA 4CEJA 4BNJA 3FOEC 4Z8YA 3E35A 1F0KA 1X92A 2NUAB 4D80A 5AKJA 4I1PA 3BJRA 2IOFK 2EZ8A 2VHJA 3FNGA 4PHGA 1ZX1A 2QAGC 3TDMA 1Q1GA 2I2CA 1P19A 1VKOA 4LWPA 1E61A 3Q0TA 5JYDA 2DEUA 3FAZA 3LC0A 1T1RA 3P5BA 4KN9S 2RHTA 2OVFA 3B7WA 4TMYA 4Y9DA 3X44A 4ARVA 5K09A 1BX0A 5AWFC 4QUEA 2GERA 3ZS9A 3U7HB 1UXOA 1I3KA 1TXGA 1CDDA 1ZAKA 2A1IA 5IAJA 5KJEA 3PNBA 3KRTA 3T1OA 4D9EA 1D6JA 2EQ5A 3V80A 3SX0A 2G17A 1GAJA 1RM0A 1T0IA 1W36C 3EGCA 1XZQA 4MR7A 4WZBE 3QF4B 4BQIA 5HKAA 2HWUA 3KXKA 3A37A 3N59A 1H6CA 4R71A 2CCGA 3V8QA 3W8NA 2P5TB 1UPXA 4TQUS 2Z5LA 5K3SA 2BUCA 3JQFC 2I2FA 2IYEA 2A4MA 3OG9A 4FGJA 1P4AA 3SJAA 3UV3A 3TDKA 3UXHA 4H0NA 4ZARA 3I1FA 3KELA 1CS0B 3EIWA 1EDZA 1W4LA 3ETDA 3R9IA 5AHWA 3U3OA 2CYCA 5K0FA 5CD1A 4JB3A 1E2BA 1UT8A 1Z37A 2WUGA 1JNXX 2W5UA 2X41A 5FBKA 4BFVA 4RSHA 2R7LA 4DSUA 4WY2A 2AN3A 2OLJA 2ZUFA 1F4LA 4YP7A 2FN8A 4LZPA 1D7OA 2A5JA 3K09C 5TJHA 3K6RA 1EGVB 1ZK2A 4BN4A 3NDBB 2Q9UA 2VPYA 3X1XA 1KMIY 2RARA 4LS3A 2FOXA 2CL0X 4JNCA 1JQ3A 2ZBDA 4HAZA 3BF8A 4AJ9A 1O5OA 4X71A 1BXKA 2VUIB 2XBLA 1U7PA 3CE6A 4RA6A 3UATA 2QZ4A 1GZ7A 2AVNA 4DR6B 1ZIDA 3L49A 3V7NA 4IV5A 4XX0A 1O2DA 2GYUA 2ONZA 2X9NA 4ZFNA 4LW8A 2AHOA 1J2YA 3OD1A 1Z6PA 1LNQA 1WHTB 3MAJA 4EI7A 3BWBA 4PAGA 3SK0A 1SH7A 3PI6A 3ORYA 2Y4NA 3BAZA 3RRYA 3CBQA 3FYUB 2R4QA 4ZANA 1TFUA 5FNVF 1DELA 3AJDA 3I9V1 5FQOA 2QM3A 3CZPA 3SQMA 4YY3B 4RHUA 1N2XA 2IHZA 3HVUA 2AN4A 4GM4A 3TQRA 4RTNA 3UK1A 1CJUC 3KG2A 4OK6A 2F17A 3CUTA 4CDGA 4ZO4A 1JR2A 1K8YB 2RFLA 4P22A 5IDWA 5JFOA 4D4LA 3L4JA 1OX5A 3RYHA 3SXJA 3VU8A 4EITA 2CLKB 5IKPA 3N2LA 2ONKA 4R2IA 3EF3A 1RQ7A 1EHCA 4PCUA 5E6UB 1XZJA 1LU9A 1GZ6A 1Y7IA 2W2VA 4Y1GA 3OCUA 2PT6A 4JOSA 3NP9A 1NRXA 2FW8A 4H59A 5KTTA 5ALFA 1J25A 2VNAA 5TEVA 4IWNA 4ZDKA 5BSKA 4QGHA 1JFLA 1QYVA 1XHFA 3EFBA 3FUTA 4LZWA 4RD1A 4D6YA 1NW8A 3WR5A 1FW6A 1ZGZA 3RJ5A 3VNSA 4RANA 2CDRA 2QM8A 2XMGA 4HOYA 3RRMA 4C3ZA 2FG6C 2BGKA 2FQQA 2K7FA 1E79A 2XF8A 5DISB 1RHQA 1DNPA 5BSUA 3VR2D 3K0EA 2VBFA 4KQ2A 4BBJA 2BF7A 4OATA 4OHBA 4LJ9A 4BX3A 1JDUA 1Z28A 1WZCA 4TWIA 5F1YA 3ONDA 2GN0A 4MGEA 2ADMA 4X94A 4FGLA 1K4KA 4EWLA 5HFAA 3NHBA 3VKFA 2M32A 3IVCA 3W3AD 1A71A 1L8QA 2G0AA 4L9AA 1XLTA 1SWVA 3S1SA 3SXPA 2UYHA 4S1PA 1NAIA 3OWHA 1VHTA 3U1BA 1E1CB 3AQ4A 1JAZA 2SKDA 2OM6A 3G5TA 1FBNA 4R51A 1KKUA 3B6IA 2F8SA 5F7ZA 1HLFA 3T35A 3V7WA 3S6JA 5KWSA 2IITA 5HM8A 1SRQA 3ECCA 2HJSA 1UKYA 1GGKA 1NU8A 1VI5A 1ZD4A 2FU5C 2R25B 3DDCA 1K6MA 3N0TA 4V02A 1V4BA 2B98A 3KHUA 1F0NA 4XUDA 1JI3A 2ZSFA 2ZB7A 3I2GA 1B6RA 1GDDA 1AMUA 1HFWA 2C4UA 1NJFA 3A36A 4KO1S 4WZBB 3WS7A 5TMPA 5HGJA 2F6RA 1RJFA 1N2SA 3QVUA 2CMKA 2DBRA 5JCZA 3LWDA 4DGSA 4NOJA 4ZEWA 5JNLA 4Q9AA 3T4EA 5K6AA 2FGJA 2O2EA 1VHDA 2FETA 2WUDA 1W7AA 3BGOS 3WX0A 1GNRA 3MTJA 5FA6A 3TVTA 1RBYA 4MPPA 1N9GB 3V48A 2GF2A 1GCIA 1UZMA 2A1UA 2D1YA 3QJ5A 5D3MA 4YYEA 1LI5A 3NHUA 3M9LA 3OBBA 1WVIA 3S40A 3QNWA 4B3RB 1RLJA 2BW0A 1E4YA 3EA5A 3ELWA 1E0DA 1E0JA 2HRCA 4QFMA 1H69A 3FUVA 2MYNA 5KI6A 5LIPA 2XMZA 1JG2A 1MO4A 3BMOB 1MJGM 1I4OA 3IUSA 4GXNA 1T0BA 2CHQA 2HA7A 2WM3A 4HN9A 3SFVA 1E2PA 1EQAA 4B2PA 3W5BA 2ODQA 1KYIA 4F06A 3ADKA 4H08A 2W6JD 4CGYA 1EMDA 1TJYA 2JCXA 3FMPB 3QVKA 4CN8A 5C9ZA 4Q00A 1PLLA 2YBEA 2V3CC 3RYIB 1HDYA 1XVAA 2DHDA 1WPGA 4QWMA 4RK7A 3DV9A 2PRZA 3HKDA 2QX9A 3NM4A 4S12A 4U2GA 4EZIA 5AHXA 3RLIA 5B2FA 4ZYWA 4CMAA 3UICA 3VNRA 4S2UA 5ILOA 1U2QA 2YNMA 3ABZA 3VPDA 4DRYA 2H2IA 1XNJA 1Z2OX 5ALXA 3D1JA 3WICA 3IVRA 4DL9A 1Q5PA 1CPYA 2WDZA 3C1OA 1ZPDA 4RZQA 2ZE8A 1L4UA 4D57A 2GHRA 2DPHA 5EVJA 1W34A 1AUOA 1J07A 1SZPA 3HU3A 4G1VA 2I03A 3BZWA 1N6LA 4BQFA 1FMTA 1QFXA 2ZXFA 1EGAA 1AZTA 3DTTA 4OJNA 4FDUA 2M6RA 4QYSA 4WJKB 3ZHBA 3G82C 3MMPA 4L3WA 5M3BA 4YLEA 3VNBA 3QLTA 1GTRA 3R3SA 3NFRA 4UUBA 3LYHA 4KQJA 1WDMA 1RWWA 2W8ZA 4RELA 1Q0HA 4ZJUA 2E1RA 2V4MA 2ZYVX 2ZDHA 1FTYA 1MOPA 4NMHA 2UYCA 2HXSA 3WWYA 4GICA 1G5TA 1D4FA 4GWKA 4QBHA 3SVLA 2VAWA 5KYVA 2Z6VA 3GEDA 3KQHA 4N82A 1FRVA 2D74A 1JN0A 1N2JA 4AX8A 1E1KA 1L9KA 1NJ1A 2DYKA 2VAPA 4LI0A 5AJZA 5SYAA 1TA4A 1EGHA 4P98A 4XCVA 1XZDA 2JGAA 3T1TA 1ADYA 5HE8A 5C46F 5KTRA 5K8TA 4DF3A 1I0LA 2PMKA 4IZOA 4HWPA 4O4LB 4UBMA 4WTOA 1A8SA 2BFFB 5HZHA 2O2JA 2GPJA 4BRUA 1X19A 2G9VA 1T6YA 4DQLA 2IYRA 3T7KA 1Y1QA 2QVBA 1WZ2A 4QHSA 3VUEA 3T99A 4KCGA 4KO8A 1VJGA 5CPFA 4BX9A 2V7UA 3HHEA 2WQ7A 2AMLA 4E2FA 1D03A 4FK8A 5KWEA 2DQKA 1F48A 4DNXA 1YVUA 3BRSA 1C80A 1U0OC 2JBAA 4DVGA 2WJPA 3EEQA 5KZMB 1U0FA 3CURA 5A06A 5AKYA 3VHQA 1QPBA 5GGYA 4ARUA 3O73A 4NVRA 3EQ7A 1PJ2A 3ZJYA 3AH8A 2NZVG 1G59A 5BSRA 4QOIA 1U11A 4RY8A 4IKEA 2JKZA 2IS6A 2JAUA 2JGEA 2ZVDA 3PWZA 4RD6A 3D6VA 3GBPA 1AQJA 1ZICA 2HDWA 3QTBA 3JQEA 1UBCA 3BYZA 1ENOA 3RTGA 3ENVA 3GFSA 1NQWA 2CNWD 2Q5HA 2R7AA 3MELA 4FNOA 1Y7PA 1ECGA 2F1HA 2NMVA 1G42A 2VCEA 3LUCA 1P2VA 3SI7A 2C7RA 1CKEA 1P3JA 4OJKA 2O7SA 1ZM2A 4ZO6A 4KR6A 3H1EA 3LVFO 3OWOA 4AECA 4WNAA 2LXNA 3Q2KA 1PJTA 2PGXA 4E2XA 1E96A 1TQHA 1SZDA 3AHIA 2GBLA 4YR7A 1NWHA 4BQSA 1RKUA 4XWTA 3QWFA 3N8DA 4F04A 2A4KA 2XT6A 3BCUA 2BFNA 2I5PO 2RHCA 5CFZA 5D51S 3VUFA 5T4EA 3H6KA 1B2RA 1QCCA 4KFUA 2ZI4A 4G41A 1JR4A 2GN1A 3DNPA 1BS9A 4G0OA 1R1DA 4PZLA 2FEMA 3NG1A 9ATCA 1WCWA 3H5AA 2AFVA 2F8LA 3KLPX 5H70A 3ZE9A 1C8KA 1QLWA 2PVPA 3A2MA 4NU0A 3L0PA 4Y1RA 2AFIB 3IKJA 4PR0A 4A7PA 4BEJA 5BSVA 4MW2A 1SHTX 1EFUA 2G4VA 1FEZA 2VDWA 5JARA 1R8JA 2IPOA 3KXLA 5HIAA 1ENPA 4J7CA 3UYLA 1P2TA 1YJBA 4ND2A 4HJXA 5GWXA 1SCIA 3A4MA 3GQBB 2XGJA 2BY4A 4QELA 5EJ2A 3AWIA 4EHAA 3DEIA 5FULA 2ZYWX 1EDBA 1YACA 2L17A 1Y7LA 3LY9A 4G0XA 3ENZA 1ZGCA 3A4TA 3GJZA 5IZCC 4EG1A 2HMTA 2FWIA 4G0PA 4DCTA 4PN3A 2IC5A 1KI1A 3COYA 2AK2A 5M5BA 1BJKA 1A9OA 3OUTA 4BV3A 4NH4A 3OZBA 3IALA 1LTKA 4NMMA 1LXCA 5LKRA 4ZVLA 1SXIA 2YQZA 2X0RA 4JJGA 3ED5A 1Z5NA 5CVVA 3PFHA 1LV7A 1D8TA 4FR0A 1NW5A 3X3HA 2PX0A 3QPBA 4FC7A 4E4TA 1K5DA 2RGRA 2Q0XA 3TR0A 1RHRA 1V26A 5E9JA 3WLRA 4C4PA 4RD3A 1MEEA 3UMGA 5LNK6 1FVOA 3BD6A 2YMQA 4LF5B 1WPXA 3FWHA 1FFAA 1B8PA 4B6GA 4N54A 3KBOA 2PBZA 1IZ9A 4GX2A 2RJOA 1EXMA 2OZVA 1DRKA 2QJRA 2JZCA 1QO9A 4EW2A 2L0XA 3WA6A 1ZY2A 2ILVA 3COSA 1TLLA 3O8OB 1DVRA 1E2NA 4YAKA 4OGWA 3FPKA 4PBTA 3ZWDA 2AZTA 3E9EA 1ZK1A 1JMVA 2GDJA 3BXXA 3GXBA 1JQAA 3CT6A 5E4TA 1DDGA 3KTAB 1ZZGA 4NI5A 2VP9A 3UJ9A 3VYTB 1I4DD 4C20A 3CLTD 4W5HA 1JTVA 4PYIA 2XZOA 1A50B 1IMOA 4KP7A 1J90A 1XYYA 3GPLA 4YRCA 1XWWA 1FSZA 1M8KA 4AWBA 1PYDA 2QL7A 3FNQA 4JLOA 4Q1BA 4N18A 3AI7A 4IIBA 1KSJA 3Q10A 5T41A 3DBRA 3ZU5A 1QE3A 3Q9NA 2HMUA 4XQEA 3VU9A 5FEUA 5MF6A 1JDNA 4BJ5A 2PD3A 5DTRA 1T9CA 3RAFC 5LR6A 2KHZA 4WA8A 3BG5A 3DR3A 2IPAB 2OSVA 4NKRA 4YXWA 1B93A 1MA3A 5F4BA 3OX4A 5T4BA 1FU7A 3PFBA 3T3DA 2PR2A 3O95A 5LQUA 1TAQA 2QN8A 2OHGA 1P4GA 4BNUA 5ALQA 4EKGA 3C3MA 5F5LA 2ODNA 4UVHA 1ZD8A 1N57A 4HLNA 5K6RA 2C29D 2NZUG 4XJVA 2Q1WA 3DQZA 4JR2A 3VOBA 4EUKA 2GD0A 1A95A 1P8AA 1X3LA 1R8SA 3JTMA 3AR6A 5TQVA 4DLKA 4PONA 5JRJA 1R6XA 1UMDA 1A5SB 1CJSA 1JR3A 4MQ5A 4QOHA 3GFVA 2QY6A 3NBYC 4EG8A 1UBLS 2ODWA 5LD2C 4Y9UA 4NTZA 2R8RA 4ID3A 2VUSA 2Q7OE 1NULA 4RCVA 2PQ0A 1GZ3A 4YBZA 2BSXA 1I3CA 4I55B 1UBGA 3T9BA 3B1ZA 1DEHA 2ZI7A 2A3NA 3BF7A 1JLLB 2YYAA 3T95A 3WRXA 5IKXA 3O47A 1NKTA 2NP6A 2XDQA 2GNPA 2JA2A 4ZK2A 1G98A 4IXDA 2C31A 3CR7A 1LB1B 3SWWA 2DULA 4LDJA 2GXAA 1HYHA 4PLTA 3M1AA 5AHKA 4HZUA 3SHTA 3ZBUA 4AAYA 1SNYA 1MB2A 3GY0A 1Q2UA 1FVHA 3CW9A 3N2IA 3SKVA 3ZJUA 1E32A 1PR1A 3AT1A 5JCXA 4DC1A 2FDCA 3DDNA 4MJXA 2C92A 3FVQA 4GS5A 3VJKA 1ZNWA 3B5JA 2Y0EA 4BPRA 3MRVA 4FGWA 3MSXA 3UJ7A 2C07A 1O9HA 5I8ZA 2C5SA 1WXFA 3JYHA 4EABA 3UHAA 2JH9A 5F9HA 1L4BA 5C35A 3RS3A 1UJ5A 3CO0S 4CUZA 1O9BA 1YOVB 4QBFA 1E3LA 2VJYA 1LBTA 2Q3MA 4Q3KA 2IZ6A 3KO8A 2EVWX 1N2ZA 3KD3A 4NSNA 2KYRA 4F46A 3U5TA 3F67A 2QR2A 1HDEA 2ZRIA 3B9QA 2CD9A 2OHJA 3U9SA 4ASUA 1TPYA 2O8DA 1H0HA 1M2OB 4B84A 4D8YA 3CH6A 3DE6X 3JZAA 4I0WB 1I6KA 5I7EA 4CKXA 3N39C 1Z9BA 3CH4B 2WB2A 5K3BA 2WTAA 2I1LA 5JADA 4BRWA 3DPSA 4HLDA 1K3TA 1R6UA 1XMPA 2X9GA 2OKCA 2OCYC 4IFIA 1UADA 1HETA 4OQMA 5MHTA 4HB2A 5E1MA 2QUIA 3KT3A 4HNQA 3UAZA 2GN2A 1EVEA 1NBMA 1OFIA 2XOXA 2HMYB 3H13A 3G2KA 1JI0A 3I53A 4D9IA 4ZGBA 2I8CA 2C82A 5TS3A 2QZ9A 2WINI 1U1GA 2X8LA 5DCWA 1WQ4A 2Q50A 3KSZO 4ND6A 1E9SA 1ZQ9A 3I6IA 5GM1A 1NBAA 2W2KA 1W1UA 3FFWA 2XUOA 3HP4A 1TCBA 2G9NA 1KJ9A 1T24A 1ZCFA 2SKEA 4WHMA 5ED0A 4DJ5X 3E1SA 4Z51A 1EFTA 4KIGA 3W90A 4TOIA 1QWOA 3TD2A 3VO2A 4C05A 1R16A 1UMCA 1UEXC 3AHEA 3WBJA 3DAOA 1HDOA 3UCXA 4IKPA 3N6RA 3KR9A 4ZP1A 5AK5A 2OUIA 4NU5A 3OAAA 4F12A 1AA6A 4PZCA 1WUHS 3D8NA 5A3QA 2XE4A 3GZNB 3KYDB 3SR0A 2PUAA 2EX0A 1VDMA 2R44A 1P2DA 2HM7A 1ZGBA 5I9NA 2CMFA 3UJ6A 2PFSA 4AMBA 1FDWA 1ORVA 1ZSNA 4IKOA 2QSJA 2P62A 4A0HA 5GJCA 5LZ5A 1HMPA 3EVBA 2HBRA 2H51A 2V7EA 3I23A 5KYXB 3PVCA 5JRZA 3WJAA 2HHCA 1GPLA 3UGTA 2JFYA 1K8ZB 2ABWA 2JCYA 1U1IA 3D0RA 2H92A 2LD4A 3U7FB 3CISA 3V8VA 2GHQA 5A4KA 1DCKA 1PZNA 1Y1SA 2IW3A 2XCLA 4LHXA 1ZMXA 1BD3A 3JPYA 3A6KA 1OBVA 3EVTA 1BFDA 3U7IA 4U8HA 4RVOA 1MH9A 1PSDA 5LQNA 5HS4A 4DR7B 1MT3A 1U4NA 3I83A 3PGMA 2JI4A 1ZN2A 1FS6A 4HFNA 4S3MA 3H5TA 4Z3OA 3OJ0A 4HDCA 4NK4A 1Z5GA 4MQBA 1MQ9A 2X8WA 2FYTA 3N8IA 3ZV4A 1WUYA 2PH3A 4JI2B 3A0UA 4QBKA 4G0UA 4Q82A 1L3IA 3EH2A 3PCTA 4HR7A 3ZKWB 3OX3A 4AWXA 3HRKA 4IEFB 2WPDA 4HTAA 5KAPA 2B6HA 2LPMA 2CXNA 1SAYA 3K32A 3HP1A 4YRDA 5HK8A 3LRXA 4OLFA 3RS8A 1UJNA 3DW1X 3QVSA 4E5KA 4BE7B 1BCRA 3WWPA 1ZJYA 4UUMA 2GB4A 2B7LA 2ON6A 3BCSA 1L4FA 2GHTA 2ZYIA 4PHCA 1MEJA 1GZ4A 2QT1A 4W1RA 3T7JA 2QTLA 4JJZA 1L4MA 4YJFA 2B8NA 1LSSA 2ONYA 2P8JA 2PLRA 4HUJA 4IPTA 4UZFA 3UWMA 4OYHA 5CLGA 1XSEA 4DBLC 3KU1A 3Q5GA 3S2SA 4UOZA 1ZLYA 2QB5A 4ZVVA 5IU6A 3NKVA 1NUAA 2HF9A 2QS9A 4BNYA 6CHYA 5DK6A 1XJ0A 1IYZA 3ASYA 5F33A 4BLWA 1U2PA 1Q7CA 1FXWF 1U8FO 2JATA 2Z5VA 3LCUA 5FPHA 1W0JD 1GQRA 2HA3A 4UBKA 4C4RA 4GZ5A 4QAJA 4MYDA 2BTQA 1N3LA 3PXBA 4MQFA 4CMIA 2PH1A 4DIMA 3GFGA 5F23A 2DFKB 1EB8A 1B14A 2GUGA 3PNSA 5FF9A 2DLCX 4GLBA 3KZNA 1ZSYA 2VK8A 3HV0A 5IJ9B 3WGLA 4NABA 2NTYC 2A0YA 4UUOA 3WNZA 3LUPA 4NJMB 2XTZA 1ZIOA 2YUIA 3DHVA 1S3IA 1TEVA 2WWWA 2VXBA 4IJQA 4RF3A 1MIOB 2X1VA 4WLNA 4ZYTA 5KNBA 4AMZA 3NAGA 3PDIB 2D7CA 1NBWB 5JSYA 3N6XA 2W2LD 1TMYA 1RBZA 3GRKA 1F8GA 1E4OA 5HTOA 3UHPA 1G8GA 1ZRHA 4RKFA 4UULA 4BGUA 3ZR4B 4RVUA 3A1TA 2H63A 2QX8A 4H60A 1QH0A 1YE8A 4MW5A 2CMHA 2DERA 3SLGA 4CIWA 4R1PA 3UPUA 2W9XA 4KPYA 3GPBA 4H3HB 5EIEA 3SJCA 5AI9A 1CE8A 1VE1A 3HKEB 3NOXA 4AUMA 1HE8B 4CWAA 3CVXA 5JZOA 2ERCA 1PZHA 2QORA 1B0AA 2QW8A 1Q11A 4A6DA 4QRDA 5C1PA 5JS6A 5BNIA 1FYDA 3N5KA 1ISSA 4PSAA 3AEYA 3K0AB 4GWGA 3F96A 4I2VA 1O57A 2VHXA 1BEZA 5ELMA 4BB6A 4RW0A 4BZXA 1MA0A 2ZRJA 4DQ0A 2A8YA 3RREA 3KZOA 3KJEA 3O8LA 1ZI9A 3U4HA 1JDSA 3ES9A 3ME5A 2C42A 2BMFA 3F8SA 3N76A 4WK2B 2ONJA 4BFUA 1MRSA 4M9CA 4YO8A 3NWEA 1R0XA 1XE3A 4FFVA 4BNZA 3ZGXA 2QRLA 2FUEA 3MCWA 3PR3A 3TKAA 5JD4A 3N8HA 3OUUA 1Z6AA 4WKCA 4X92A 5LCXA 4CMCA 1WSAA 4EYSA 3UMCA 1NI5A 2O3RA 4IIYA 1E2LA 3TD6A 1PT8A 5IT9A 1VJ5A 5G3ZA 1ISHA 3VKUA 5C8ZA 3TG8A 4HDMA 2VJKA 1E3WB 3CRMA 1RWVA 4Z3DA 4IIEA 1XX6A 4JL8A 4TL8A 2JD0A 1KSGA 1H4SA 2GPBA 1WABA 2PS1A 2YZNA 1YA8A 4IJMA 3O9VA 2DPGA 2R47A 3PNVA 4ZDWA 4AG3A 1LPMA 1W0KD 2F62A 3GR6A 5SICE 3KXDA 3VO8A 1GQOA 2ZAOA 3IUBA 3QVVA 1WEHA 2ZIVB 4KMMA 1U81A 1B3RA 3FHLA 3IAEA 4FSDA 3GLFE 5ALVA 1G21A 2GK6A 4HATA 4XDZA 5AVVA 2AI1A 2KM1A 4U9UA 1OA0A 4GIBA 4C76A 4YT8A 4X95A 1CYEA 3I42A 1O94A 3U7RA 2ENWA 1RC8A 3ZCUA 1SN7A 3MWGA 1BE0A 3FYHA 3KU4A 3RJ9A 4LNHA 3AZOA 1APBA 1IBSA 2NUPA 4G0NA 4Z2YA 4KPUB 3PGJA 2QVZX 2HZBA 1M2JA 4KODA 1QUFA 3H2HA 2XOKD 2G5GX 1N1DA 2QVGA 2BAGA 4XDGA 2Y05A 1C3XA 3GRCA 4ARZA 3K0SA 1AV7A 3KYBA 1SQ5A 3OE7A 4MSUA 4CM4B 2AD1A 4EDFA 3GMIA 1HFEL 3SBDA 1VDZA 2YS6A 3CB4A 2ENUA 3E9ZA 3MTQA 1AKUA 4Y9TA 4IRXA 1E3SA 1ZH4A 2Z08A 4RJIA 3ERCA 3NBQA 2QTMA 3ZK7A 3MOSA 4LYAA 4O2AF 3VSBA 3P2OA 3HVIA 2X1HA 4Q3BA 2WJ6A 1JIQA 1YMVA 2QMZA 1Z2NX 2RGXA 3AF1A 3CKYA 4MGHA 1U0RA 5DNEA 4UHDA 1C4OA 1IONA 1EVJA 4QUHA 4V0LA 4XQ9A 5JXGA 4LFCB 1DEOA 1SUBA 4EY7A 1C9YA 7REQB 3LQQA 4UHFA 2O5CA 3KP1A 3K5IA 4IVRA 1L5LA 5AQ1A 1Q1BA 2EYQA 2BFCB 4IIXA 2QTVA 5HKLA 3WXMA 5LYJF 3AL0C 1NONA 2F43A 4JQYA 4L95C 3AXTA 4WXHA 2H9AA 1Y8QB 4FYMA 4B83A 4JVOA 3Q7IA 2XWJI 4EGQA 1KI9A 4L51A 5DSZA 1YR7A 1FYFA 4DV6B 2YH2A 2F48A 1E1MA 2XVMA 1B0ZA 3KZVA 3NC0C 4M98A 2R48A 5GONA 2OCDA 4D4MA 3HZZA 1F5SA 3SR4A 2O5EA 2H07A 1FB5A 1RKVA 2GCOA 2QE7A 3A4YA 3KJQA 4GVLA 4NEHB 4MVJP 4PVCA 5A02A 5C7LO 1URPA 3QU9A 3LQKA 5CDGA 5C4MA 1XT6A 2C2YA 3X1MA 4OP1A 1ONNA 5J2UB 1CY2A 2BGMA 3HDYA 3FSGD 4NWIA 1QU3A 5EN4A 4FFMA 3WRYC 2GLUA 4ND7A 1P31A 2VYVA 1CY1A 1ATIA 2A5YB 2CVQA 2R4TA 3CT4A 1Z74A 4IHQA 4C4OA 4XCQA 1NM5C 4BJ6A 3AEKA 2BE7A 1XQ9A 3KUCA 4UHKA 2JC3A 1BXRA 2ZXUA 1JMKC 1R0BA 2NN3C 2Y0CA 4ZTBA 2QRMA 2WP8J 4G5OA 1JIUA 3VFDA 2E89A 1XZ8A 3GPDG 1IBLB 2RONA 1CY7A 2N1BA 2QTTA 1WXDA 4M8NE 1XQ1A 2Q3JA 2NU6B 2VH2A 4TVBA 3RM3A 4BLTA 3MNFA 1PJLA 3GOQA 2X8AA 2ZIWB 3MPUA 4GNKA 3A26A 3HR8A 4UC0A 4RZ3A 2FSUA 4K9LA 3T5GA 1A72A 1NW3A 2XMCA 3G49A 2IRWA 2QP3A 2ZLBA 5A4JA 1UDCA 1HDCA 3AEUB 3AHCA 3AIMA 2EHJA 4Q7JB 4FFBB 3COVA 1LS6A 3D5EA 2DFNA 2NO7A 3ZZ0A 4ZI2A 4LJ5A 1HYGA 1YHYA 1Q3KA 2NW6A 2ZIXB 2ANCA 1C1XB 1WG8A 2EIHA 3PWKA 3N3BC 4B6QA 4KQHA 2G07A 1VPVA 1V8ZA 3PQ2A 4J6EA 4RULA 3U31A 5CM8B 5KB3A 2J3HA 1QG4A 3D8UA 9ABPA 3NKLA 3EULA 2D06A 3KFVA 3PB3A 3EXHA 3NBMA 1QH9A 4PIVA 1DEXA 5LMZA 1WKVA 2HSEA 1FFBA 3IXMA 1VLMA 3MZ0A 3NHMA 3KZCA 3SE7A 1BMTA 4MW9A 2VLBA 4XSGA 1NPTO 3L02A 4FQ8A 4QXRA 5JZMA 4X1OA 3W7AA 4JSTA 1WDTA 5I4CA 5FQNA 1SRRA 3K2BA 2NSLA 1OBCA 2C5LA 1E64A 1SBZA 4V24A 2UU9B 4W1SA 2HK8A 1I1QB 4FOOA 3L4EA 3QU2A 3DE0X 3E7FA 1N0UA 1Y1PA 1Z6TA 4UHJA 5DXJA 3NXKA 2FHPA 2ZROA 1H9BA 3PD7A 3JW8A 1X0VA 2FRDC 1XU4A 2HXGA 2FWAA 3HN6A 1UM9B 3UB3A 3OQIB 4R2KA 1PWHA 1TU0A 2INGX 4N9QA 4R5MA 4AF8A 5HKBA 1LPNA 4REOA 3SDBA 1MBZA 2V97A 3MXOA 4L0QA 3PQ5A 2WZCA 1IBMB 2QMHA 2UZ0A 1XRSB 4X24A 1XRRA 3AVQA 3AM3A 5B6IA 2P30A 1DCFA 1P74A 2EDCA 4YJGB 1EP3B 2PPLA 2YW9A 2OCGA 5EL0A 2FQYA 4P53A 4C29A 3KVRA 4NG5A 3LZ6A 4Q9IA 5LXTF 1I94B 4ZHQF 3ET4A 1EU1A 1W19A 2BZSA 2X3FA 3OIWA 4FLMA 2IXGA 3PLRA 3K9CA 2FG5A 4TKUA 3HZRA 3FVRA 4OGFA 2I65A 3ASVA 4QNNA 1DKQA 3R7BA 3FPBA 4QULA 2IZ1A 3MCTA 4DREA 1YR3A 1AXEA 4ENQA 5K45A 3GPCA 4IQ4A 4L02A 1DKNA 1I3MA 3COPA 3CXRA 1WOYA 2RHBA 3JR3A 1TJPB 4G1BA 1CUZA 3ZLJA 1DHRA 1CQWA 1W2GA 3OH8A 3R3XA 3NAQA 2V5AA 4H7JA 4K0RA 4KMSA 4G84A 2J59A 3BXGA 3IA7A 1I2ZA 5LLSA 4CM9A 2FOIA 4GGPA 1XMJA 3TTSA 1V1RB 1MO2A 4FHEA 4ALMA 1NUSA 1U8YA 3O5AA 3P45A 5KTOA 2A7XA 4LF7B 5FAXA 3QVGA 1YJ5A 3NXSA 1DFIA 2EU8A 3LECA 2X2OA 2ZFUA 3BUSA 3DE2X 3HI4A 4UZSA 3HFGA 4Q24A 1XALA 1GZSA 4C06A 2IHVA 2RHRA 3L1HA 3OIVA 3HN2A 1R00A 1L7PA 2E82A 1OBOA 2HKIA 1MOZA 2FUCA 1QHGA 2NU7B 4N8EA 3VR5A 1I6MA 1VHQA 1IZ8A 2N9UA 4JLMA 4L76A 4AICA 3CF0A 2JANA 3K0FA 4F86A 4NRDA 2DXIA 4KR7A 2H4HA 4Z2AA 1XLTC 1V9LA 2HT6A 1J1ZA 3NBZC 2ZRAA 3DOJA 3OZFA 4BQOA 1YTUA 3WKEA 1MB4A 1G16A 3OICA 1XLWA 1EFCA 1Z5WA 2J6IA 2WSYB 3WBKA 4RTPA 3OEHA 1RT9A 4JUIA 4EFNA 1KK0A 2JZOA 3OOSA 3HUUA 4HWKA 3R8FA 4LA4A 4NESA 4EFDA 1YMQA 4Q7MB 4G8JA 5I45A 1B15A 3IIIA 3MAGA 1UKCA 5BRJA 1Z7BA 5BQFA 2Z3WA 3Q2OA 2O23A 2QROA 2WOJA 5L6LB 1O6ZA 1XXHB 1JUDA 1TAUA 5D84A 4Q18A 4LCBA 1TVKA 1UDAA 2RBKA 4D9GA 3IMCA 3U3ZA 2HLPA 1HY3A 3HBLA 1SB8A 2LR0A 4OIFA 3ZGVA 1OH7A 4NHOA 2VOEA 4MMYB 4XPIB 4YGXB 3NEPX 2PO5A 1H22A 1FMFA 1VMAA 4I19A 4MV0A 3GUCA 4XLLA 3A9TA 4ZT5A 2OA0A 3N70A 4G9EA 3OZAA 2HRBA 1CZLA 1MPXA 1YR6A 1MO5A 3O9ZA 4Q3LA 4UM9D 4EELA 3W1WA 2X5NA 4Z4EA 1H2XA 1I01A 4HPWA 3TLGB 4AN4A 4KQFA 5HRUA 3HDTA 2BKXA 4RK1A 3GA5A 4L28A 4U5XA 3CE9A 3L6BA 4OLBA 1V3VA 3QVJA 4N41A 3H8WA 2H4XA 3O03A 1JHAA 2VRBA 3BDAA 2WMOB 3PG5A 1JU3A 3GLIE 1M34A 1A4XA 1PRYA 2YMLA 3I32A 2H4JA 3A1SA 4CR8A 5IAOA 3OM8A 1ZAYA 4IJ5A 3ZY6A 3KR2A 1ZJZA 1NYQA 2C00A 2ATXA 4GP9A 1B2LA 1I7NA 4RK5A 4U6NA 3JASA 4XIFA 1M6NA 5T8KA 1D3AA 4A6XA 2XB2A 1OTXA 5IVIA 5LU8A 2YNMC 2WIAA 3FETA 4LKRA 4F6LA 1JYFA 4PC2A 1X1EA 3ZIAD 3G0BA 5HXAA 4QQ8A 4WVFA 4QQKA 3BMQB 1U8UA 4X9XA 4G23A 2M2IA 1UL1X 4PHTA 1PL0A 4L9WA 2YRWA 4MO9A 1KQPA 4O2RA 1CBUA 3C8UA 4LOLA 4BXOA 1WY5A 4IHAA 4Q9HA 1HYEA 2PUTA 4KWCA 3FZEA 1J56A 2NTJA 4PYRA 5BSGA 2G1UA 2HB6A 4C03A 1JEYA 1AJEA 5C8DA 2R68A 2G3YA 4HDSA 2XMDA 3VSAA 4QT4A 4UE3S 2V6JA 2WWHA 2IGTA 1R5NA 2C7GA 2GASA 3VAAA 4C3OB 4IIGA 3DS8A 1YZFA 4OHPA 5CU7A 5E4YA 1ISPA 2GPYA 4NV1A 3TR6A 3W2IA 2Q5QA 2XECA 3A2NA 3FLEA 3MWEA 4ZCRA 2HPHA 1Z34A 4RSGA 2CDAA 4OREX 4YQEA 4PG5A 3ILYA 1SXJA 4YV0A 3FDXA 3NTXA 1QGOA 3GNLA 4GC9A 4Q66C 4MP8A 1VRCA 4S0XA 2JS7A 4MDYA 1FQKA 4UHEA 1TKCA 4P7JA 2BVNA 1S8OA 3RAJA 3R6LA 1PT9A 2WJWA 3USES 4TL9A 4V0RA 1DO8A 4B5KA 2QY9A 4GW3A 1JHRA 2QRVA 1PF7E 3KTDA 4CKBA 1QPGA 1Q44A 5GAJA 1UWLA 5L95A 3GVCA 4RVNA 2E4WA 1TKAA 2X7XA 2VHUA 4LX8A 5LLTA 4WLUA 3OQNA 1FTQA 4F2DA 5AYVA 4MVWA 1J06A 4C4XA 3P20A 5BNZA 3TUJC 4CKZA 1QPZA 4WINA 2PV0A 5KX5A 2YWCA 2W6NA 2E48A 5EJEA 2AC7A 2QM0A 4N03A 3UYKA 5I8PA 3RU2A 3GRPA 5I9IA 1X74A 1FUKA 1YDMA 2Y9MB 1L7AA 5A3JA 3RYCB 1LDGA 4H18A 1XAGA 5JFGA 3ZD6A 4TXLA 4WKNA 3KPVA 1PBNA 1BGXT 1Z0FA 1RLUA 2RC5A 3AF5A 3Q12A 4K86A 3NUZA 3ZE0B 1L2TA 2Z5FA 3MRSA 1GZ5A 2R6HA 3ZV6A 3AVYA 2Y1XA 3B1KA 1GGEA 3NM6B 4KE8A 4B47A 1SUPA 3ISJA 1T5IA 3EGIA 2I1VB 4HDNB 5CT6A 3SJZA 4C0XA 2ZE7A 4QPZA 1OI7A 1ZJ5A 9GPBA 4QYTA 5SZJA 3ZV7A 2Z8YA 3F78A 1SU4A 3MA0A 2HD4A 3SOPA 4TV9F 3VPXA 2APJA 4S1NA 3B60A 1T8SA 1EAMA 3PSHA 3NC1C 5TDHA 3PD0A 3IOEA 3U09A 1XDBA 3T7IA 4UOEA 3GLRA 4TKMA 3FY4A 4NFYA 3WL6A 4BV2A 2O54A 2D0DA 5AOBA 3TNDA 1CYDA 3I34X 4J0CA 1HR0B 2GNAA 3KKPA 3PXDA 4L8YA 4RV4A 4XJXA 3I73A 3GLIB 4LFAB 1QRRA 1CQIA 2MWMA 2OORA 4Q21A 1UQRA 3ESXA 1D5CA 1XZIA 4HTFA 3W9UA 5CG1A 4TYQA 2H2HA 2K4MA 3PC8A 3D64A 4KL8S 4PPGA 4QVGA 4ALKA 3ZWKA 1PFUA 2BMVA 3K9LA 4X90A 4FCTA 2JHFA 4HH0A 4IR7A 4WN9A 3JWJA 1V5WA 5I9BA 4ZZIA 1XNGA 1REQA 1DAGA 1GQYA 3SKYA 1QDEA 3CLUD 3C8ZA 4P32A 4B4VA 5E2AA 4L7QA 4CR7A 2HH9A 3C45A 3Q6MA 3BD9A 4KE9A 4R05A 4J1TC 4OQXA 1MO6A 4Y2RA 3NTLA 4Q3OA 4MQ4A 1EINA 1C9DB 2H4YA 1N2GA 3M7IA 3IQHX 3QLVA 5JDCC 4RWZA 4TMXA 2G9QA 1EFRA 1U31A 4L5YA 4W1QA 4YONB 1XD2A 2PT7A 4RZSA 4DSNA 3AFGA 1FX0B 1QVVA 2YIMA 3KX2A 4YQYA 3MS4A 2FP4B 4LUCA 2H1FA 4L0MA 2CB9A 1GYRA 1ZMTA 2ZJ2A 2E2WA 3FZNA 1GG9A 5KNCA 4FIDA 4FFWA 2C83A 3WLAA 3HU2A 1D7AA 3FB4A 2HBZA 4JODA 1I6LA 1FLVA 4KMRA 5AHRA 1LSJA 1Y9ZA 2NO4A 3H0CA 1B76A 1P7YA 2ZUEA 2ZULA 4HB0A 3FPGA 4YIKA 1NMEA 4CCYA 2CVZA 4CDRA 2V45A 1COWD 2PGJA 2BI4A 3E18A 4UKDA 1UOPA 2PZAA 2VQ6A 3H17A 4DGQA 4KXFB 1NR1A 2HRZA 1GKIA 2D1SA 1B1CA 4UU7A 1K4YA 2VJMB 3UTDA 2JIOA 4F4FA 2WF5A 5CJ2A 3RIMA 1HE3A 5A6SB 2P4HX 4YYZA 2DHQA 2GVDC 3SVZA 1QRTA 1EG2A 2P3LA 4NCNA 1S0UA 5BT9A 4E46A 2HCRA 4HL6A 2JIMA 4KVGA 4ENWA 4UM9B 4QL3A 4X8MA 1IXSB 3CX3A 4I1UA 1F7VA 3GLUA 5B4TA 2ZRHA 1VIMA 1IRIA 1ITZA 3TRDA 3SDSA 2E21A 3OO1A 3UHFA 5ADHA 4OHKA 4YP0A 4ZRNA 2HLNA 4IGEA 1ABFA 4F8JA 1M6VB 1H9AA 1B0PA 1NJSA 2JFOA 1QO0A 2ZIZA 3H4TA 3VV3A 3U37A 4LSGA 3QLUA 3KKQA 3T5BA 5LZ8A 1Q7GA 3W2EA 4E94A 4ZJYA 5JEEA 1VKNA 4M0MA 4F71A 1CZKA 2J41A 5D8DA 2Z5GA 3F3MA 5HUQA 1VXRA 2B4TO 3KEGA 4L8LA 3CZQA 3M1LA 5DCUA 5E3IA 3V5NA 2PU5A 1YZYA 4PSVA 4OL9A 2F3PA 4TMZA 3ICPA 4ISCA 4OOEA 1A7AA 2P5UA 4CMJA 3FCUB 5IVDA 5A9TA 5FI3A 5JLJA 2G9UA 2HWYA 2B5OA 2I6QA 3BMCA 3P94A 4HZGA 1CJVC 4J2OA 3SNKA 4Z7OB 1YUMA 2VA9A 4PY2A 3FW1A 4XQGA 3IJEB 1Q7EA 1Z16A 3QUTA 5EEGA 5K8LA 4OXQA 1IHYA 4GF5A 5HZGA 1TAGA 2BZ0A 5A7GA 1GCOA 1D9XA 3J7TA 1PV4A 2P1RA 2P9JA 4BMNA 2GEDA 3BXEA 1HG1A 4LXTA 3LUHA 1AGNA 2DFDA 1P9NA 1GFWA 2I6GA 1TO1E 2V74B 3W79A 1B73A 5KWIA 7REQA 5AJYA 3WO1A 2X4GA 1TTHA 2PH5A 1YZQA 3OURA 4QLOA 1CEYA 4IVPA 4FM9A 5FD8A 721PA 3A2KA 3JQDA 5ANRB 2HW8A 1E2HA 3T5TA 3TI7A 1FS5A 3DD5A 3S70A 2BJHA 4CVNA 1YONA 4GRAA 4RM2A 3PUYA 1RRFA 2JLXA 4DJTA 2P6UA 5EZ6B 3RSCA 4ILEA 1GA6A 2E4ZA 3P4XA 1R7RA 5FV4A 1GTJ1 2BWJA 4P2BA 2BKVA 4AJJA 5EZSA 1YDGA 1YCFA 2ICAA 5IJ0A 5JNTA 1US8B 2I9PA 2OMKA 3AHGA 1GGFA 1YBVA 3OECA 3Q9SA 4OFXA 3DT9A 4XH9B 4DSAA 2HF7A 4IL5A 3FVWA 4R3UC 4K9OA 3O1LA 1IBKB 1H0RA 2UXBB 4DLNA 3SIXA 4DG5A 3GJTA 5T3YA 1Z5PA 4XVCA 5BN4B 3UOGA 3LBAA 1RM5A 1QBGA 1Z3CA 1GQFA 4DC0A 5KQMA 4O29A 5BSEA 5H5JA 3HJHA 3GVHA 4YMIA 4A5SA 4B2IA 4JZYA 5A2QA 3TM5A 1F9EA 1QBKC 2GYYA 4GL4A 3OZTA 3R6GA 1O0BA 4XZ3A 4ZHQB 4O2BB 2OCPA 4G8CA 3NM5A 1GSHA 3WLTA 4J4BA 1JBEA 4CMHA 3ZJTA 3RFXA 5CFPA 2CLIB 3IDSA 5DW0A 2OWEA 1QE5A 3C5CA 3E61A 4L0CA 4XCXA 2ZJBA 3HJGA 2UUBB 1VSUA 3N28A 5EJGA 1TADA 5CT8A 1VL2A 4PWYA 3W5VA 2J33A 8ATCA 1IN6A 3GDGA 3CMCO 3CKKA 5TS2A 3I58A 4HNSA 2ZJFA 2EXXA 1JSXA 1QOZA 2NYAA 4MRRA 4PLCA 3V2GA 3HFJA 5BWCA 1WB9A 3RCBA 4KK3A 3LA6A 4O02B 4QEDA 3TPZA 3VO1A 2VO1A 2FWJA 1YA4A 1QIKA 3AM1A 1Q0RA 1UPCA 1HFKA 4GE3A 3WGUA 3COZA 2ZZMA 1ZUIA 3D7MA 2H3HA 4ZQBA 3SF0A 3TQSA 4ZICA 3TIGA 3HXQA 1OLUB 2WIJA 4B1FA 3CYFA 1KWGA 1DIOB 1IG3A 2FI1A 4BO3A 1YWGO 4LMBA 5TMBA 1VGRA 4D9JA 2QXUA 4DJFC 2J3KA 5THXA 1UP4A 1NKVA 1TK9A 2OT3B 2PVCA 3D6AA 4QPPA 1YD7A 2DLDA 2W98A 4IQ0A 2Z4RA 3D2LA 2RC6A 3V7FA 2ZSAA 2C2MA 1TC1A 3B3AA 3ZLVA 4FOTA 3NCHA 3WDMA 5F52A 4D81A 4JSRA 4E5SA 2EWVA 2UXDB 1PL7A 1UKVY 2I66A 3R3HA 3KJGA 5BUCA 4KC0A 3HO6A 2IYUA 4DQDA 5EJ8A 2C9CA 1EK2A 2A0UA 3IP6A 5EMLA 5H3HA 3JVUA 1P1HA 3PFIA 5FO0A 3X1DA 4E7OA 3INNA 1ZG3A 2C96A 6REQA 3A4NA 3S7ZA 1DT3A 5A3VA 4DDMA 5EWLA 2QJOA 3EZYA 2ECKA 1XTIA 2IY7A 1TYDE 3H8JA 2BTOA 4G3XA 3FWZA 1WCIB 4QOJA 5JV5A 1DJNA 4XR9A 4AY2A 2W6PA 4N48A 2YXDA 4CMBA 4MV4A 2XBMA 3RTCA 1VE9A 1WETA 2IIVA 1FNDA 1YDEA 1L4HA 2Q6IA 2EF0A 1K63A 2ADOA 4G9GA 5AICA 1DLJA 2EYUA 5KVSA 3NH6A 1PE0A 2PJUA 3DEKA 4Z0PA 4QJ4A 2B8WA 4F3CA 4K05A 4W5JA 2FLKA 3PR2B 4E6PA 1BW9A 2V7BA 3RROA 1AUXA 2VC2B 2XNHA 2PU7A 4PZUA 4AMUA 1DJLA 1SM4A 2A58A 2HOQA 1Z29A 5AJHA 1ZESA 4YT5A 4WD3A 1RBMA 3BMNB 1NP7A 3AY3A 2JG3A 1T4GA 3DOCA 5DE3A 5T64A 1G38A 3EOZA 3B2EA 4ZHSA 3IMGA 3ZOKA 2VJQA 1U3DA 1JIIA 1G18A 4R7ZA 4B87A 2WT8A 1G2PA 1KEWA 4ESOA 2AE1A 4KO4S 3HCOA 3VPFA 5EPUA 5KKAA 5FLEX 3K72B 4EX7A 2ZBRA 3W8EA 4EG3A 1ODJA 3ZZ1A 2X23A 5JAUA 2MINA 3IQWA 2BT4A 2OYSA 3CCBA 3MB8A 3H5IA 4J91A 2FMIA 3EEBA 2J6HA 2C0QA 5SZHB 2ZCVA 3BHNA 4MMXB 1M5UA 1RE0A 3AEQB 1ZNQO 2XTJA 1PEKE 2X58A 5DGHA 1IY8A 3QE4A 2XA2A 1QANA 1KL7A 4DMCA 3FYUC 3HKBB 5IBCA 1IIBA 2WA2A 1E2IA 1Z36A 4K81B 4K5QA 2WJVA 1PWEA 2XNSA 5DNWA 5F2KA 3V2HA 2GRJA 2WAYA 1ZVKA 3FRJA 3LUDA 4TYMA 3V8RA 4M21A 5D6NA 3RVKA 3B5IA 1XQXA 3V9PA 1GPWB 3PJGA 3QYAA 3KZXA 3BZBA 4ODIA 5IHPA 1YB1A 2ZOSA 3KKNA 2JIZD 4GRDA 1MG0A 5JTUA 3P7MA 1KH2A 4YRNA 1C2TA 1BDIA 1XTQA 5KYWA 4TRRA 3ROQA 3ZNQA 4ZVRA 1CQXA 1FSSA 3PEVA 4B3TB 2AYYA 4KXQA 4O6VA 1EK6A 1DIBA 4J1QA 4GOKA 4LGMA 3MT9A 2E9SA 5LA6A 4JU9A 4XW2A 4CE6A 2P9FA 1U1CA 5ARDA 1EX1A 4DXHA 4R8VA 4HEJA 3ZTYA 5CVUA 3ICQB 4C7KA 2XD4A 4L72A 1KXZA 1V16A 4CR6A 2GEFA 1VL6A 3NTUA 5TT1A 4C14A 5C8YA 1W25A 3ULKA 1WS6A 5KYYA 4FMDF 4U9HS 2XT9A 1PGOA 5BR8B 3EAQA 5KAMA 3PEUA 2EKQA 2Q6KA 3F9RA 4KPFC 2WD8A 3FDJA 3S7TA 3FMFA 3PYLA 3ZZUA 3PNMA 1H94A 2H0QA 4UCWA 2CFRA 2HJRA 3H83A 3ONEA 4FS3A 4FHCA 2JIRA 5DYNA 1M8PA 5IAGA 1T29A 1T2FA 1V4VA 1POXA 1CXZA 1VFNA 1YQGA 2I8AA 1OLXA 3E5NA 4B3MB 5EJ9A 4ZI5A 1ZVVA 1VCHA 3HVHA 4BP8A 3EVFA 4I8XA 3RHZA 2YZ2A 3GWZA 4J0QA 1I0ZA 3KQLA 3ZWXA 3L0CA 2IBSA 2WJHA 4TTIA 5FI5A 3SM9A 1GEGA 3LCVB 3OFVA 4RH1A 1Z5ZA 3MINA 3M81A 1KP3A 2CUTA 3C4JA 3QOWA 5CA0F 4RKQA 3U80A 1A9PA 3TW8A 2A94A 2OBYA 2R3SA 4HAWA 4BNXA 4DN6A 4J1NA 1A7JA 1UZUA 2BEJA 3B8EA 4X3PA 1V96A 5K4HA 1ZA2A 4UDOA 2FX2A 2WYHA 4CM1A 3NJ8A 3BFKA 3EZ6A 4MXDA 3L1VA 4IINA 4P4UA 4ZYYA 2NYVA 2AOXA 3P97A 1TZJA 5EERA 1OTHA 3T4PA 3MXTA 4DPMA 5IVHA 3AIIA 3FNRA 4KIUA 1PZFA 2Y1OA 3OT1B 2OD2A 2PRKA 3TINA 1XG5A 3BK7A 4D3ZA 1U8ZA 4ZCIA 3DE7X 2Z8ZA 3CH7A 3IEKA 3IRUA 4MIKA 5EXXA 4YJ3A 4ANFA 4IDFA 3LH5A 1DRJA 2DU8A 3JARB 1BXGB 4PFKA 4H7DA 1M7BA 4TTSA 3NBFA 4JNKA 5DRTA 3V6MA 4F5EA 4YV2A 4PANA 3ICCA 2ZUBA 1ZOOA 4MI3A 2QUBA 1LNSA 3ED1A 3WLSA 2C0CA 3PKIA 1XB2A 4POAA 1ULTA 5IFLA 5KIAA 3U62A 1E4EA 1WA5A 5CB4B 3F47A 1H85A 4CCAA 5T3UA 4OA8A 3BC1A 5ISMA 1R9MA 2EBUA 2YVKA 3MMNA 1FUYB 2GXSA 3GEGA 2V0GA 1JLKA 2DOKA 2XVYA 3N0WA 1NXSA 1N75A 1P29A 1YR9A 1W93A 4OY3A 4DCMA 2UZ3A 4EATA 5LKAA 4IILA 2BR5A 1EWQA 4JI5B 2RHLA 4HMPA 2VT7A 1CRWG 2YFKA 4UUPA 3VSEA 4EB6A 2QRKA 3FTQA 4X1IA 2ZWMA 1EE9A 1AKTA 1IVNA 4KXVA 4M6WA 2OXTA 1A3CA 2JAQA 2IHUA 1YJQA 3A1EA 4HQFA 1CDOA 3BTUA 1ZUD1 4NU8X 1YS2X 3G2QA 1L5RA 1Z4IA 2LWIA 2W22A 4BQRA 3FHJA 5I4KA 2Q5LA 2Q4DA 1H4TA 2FE1A 2W8BA 2VVTA 1BQ3A 3BK2A 4JJEA 2OGZA 5E7QA 1D1SA 4FWBA 4ZVMA 5BQPA 4IHJA 3H9JA 3GG2A 4Y8VA 5G4LA 3ND9A 1XEXB 1C30A 3ANLA 1OYYA 3H9GA 2B6NA 1E3EA 1DDIA 2V6MA 5EZYF 4PYKA 2FXIA 1TUEA 3HNOA 3MCZA 3LL7A 4ESEA 2QTHA 4RHCA 3OZRA 2HGSA 1MENA 1WCV1 4JCCA 5IAAA 2GETA 1GL9B 2IX9A 4NBNA 2MR5A 2QNIA 2AEFA 1ZD3A 3K73O 3M5DA 5CH5A 1K97A 2XZDA 4KMOA 2I3DA 2VWPA 4Y2HA 1E5QA 2G1KA 1CLUA 1XL0A 3CUWA 1AK1A 1GOTA 3D6MA 3U16A 4JWKA 3AESB 2QQGA 2RJNA 4UXHA 2ZZKA 4O4HA 4BZZA 3ZCQA 5P8WA 4NCHA 4G5QA 5A4IS 2AN9A 3EGXA 4RZ2A 3ZLTA 1OUMA 2BBSA 3D9QX 5J5VA 3H7IA 5BMVA 4F6CA 3DEZA 4F9GA 1KY5A 4C5CA 1GTSA 4RMJA 2BFBA 2Q29A 3FUXA 2QYTA 4X84A 1C29B 1CIPA 2J7PD 3TRIA 3TZCA 4C6SA 3O8NA 4ZOLF 3EA0A 2FY8A 1FLNA 2GD2A 3N2EA 5DZSA 3TDNA 4D4IA 3THWB 2HBQA 4FJ1A 1WMDA 2R8ZA 1A96A 3N58A 1MU0A 4D6XA 3I4CA 3RJMA 2JJQA 1IJFA 4RJTA 3H86A 1JR6A 1PW5A 2BH9A 3OSUA 1P5RA 4ONEA 4U0KA 1E7MA 1X7ZB 4GXQA 4OGKA 3IBYA 1WXEA 1T1EA 4OVKA 5DNYB 3D7SA 2FMHA 4HQRA 1OBFO 2J9GA 3L79A 4HPJB 3U4AA 1HYBA 5CW1A 3PLNA 4E0BA 1GSOA 1X7YA 1MUUA 2BF4A 2NZWA 4INOA 4A03A 2GI4A 3R3YA 5JMTA 3EPLA 2FK7A 2NOAA 4NARA 3TW6A 5KHAA 4EO7A 1YI0A 2IP4A 2JAXA 3G1TA 3GBSA 3P2EA 1H3FA 4XE5A 3V3KA 2ZG6A 3CVOA 1BSVA 4I1OA 4DMFA 2PUJA 3VVCA 3Q3HA 2A3RA 4XIJA 3DLPX 3L6EA 4ZAXA 2YHUA 1RYBA 3UMYA 1YKSA 3JATA 4IBOA 5KQGA 1BG6A 2Q0HA 5AVJA 2OP0A 5FHRA 5BN3B 5CX4A 1BN7A 1YBMA 4C43A 3PHCA 4II2A 1A1SA 4PAMA 4ZQEA 5EKUA 4OSEA 3LFUA 3ROZA 3EC2A 2O8BB 5JH7A 4BQQA 4MJ3A 5TQ0A 3W5DA 1DAKA 2FPGB 2WD7A 1KYWA 2L69A 1KGDA 3HZHA 1TO6A 3ZV5A 3F46A 5BWMA 5CD9A 4Y6QA 1IXRC 2CDNA 3C7DB 4J0DA 3C5EA 5FPKA 2ZK7A 2ZVQX 4TYNA 3I9FA 4YRSA 1TZMA 4PIPA 3WTBA 3DVAA 2J0VA 4PXSA 3WLKX 1AKYA 2E87A 1L8XA 2EQBA 1JLMA 3N2ZB 1UBEA 3AEXA 2BFAA 3B48A 3C98A 4PFJA 3KSRA 3LQ1A 5FOVA 1NG1A 2RJ3A 3P9RA 1VGVA 3AVPA 1F12A 2IUFA 1TUBB 4GBMA 4KAJA 4XWYA 1YIAA 1ULBA 2B5VA 4QOGA 5L9AA 3U9TA 2Y76A 3CUKA 1AURA 4M1YA 1FDOA 4UVDA 3TB6A 2SCUA 4CL2A 1XTSA 5FPQA 3WNDA 1EVZA 1UJCA 4X8HA 4W5NA 5ALEA 2V7QD 1UWVA 3UWDA 3SZGA 1K3UB 2C03A 1MKYA 5AI5A 4CIDA 3TXYA 1P1KA 4Y3UA 2HHHB 2UAGA 3FDFA 1SA0B 3ZW8A 2WHPA 4ZVPA 4F92B 1V3TA 1ZRMA 1KI3A 5CB0A 2VXOA 5KKNB 4V0ME 3TZKA 5BNTA 2JLQA 5BORA 1Q84A 1G7TA 3NHFA 3B6EA 1Q19A 2PLNA 2UZ1B 2DUNA 4HGOA 4AU1A 1EP1B 3FFTA 4OMUA 3KUXA 3FF1A 3OU7A 1E4VA 3CN9A 4AQYB 2XNDA 5FOWA 1CZRA 1LPPA 3HEAA 2PJDA 4RLQA 3S8EA 3D6UA 3LKVA 4EPTA 3WA7A 1AO0A 1HO3A 2WFMA 1LBSA 3PL1A 3AV3A 3K7EA 5FA8A 3WP0A 5CX1B 3IQFA 3Q3JB 3SX2A 2ZI3A 3H6GA 1MABB 4WKPA 2PA0A 4QYXA 4RD4A 1XHLA 3HH8A 2NU9A 3GRUA 3GUUA 3I3OA 4GMHA 1WMAA 5EMNA 4EG7A 2P3OA 1W36D 2B9VA 1MIHA 3I9OA 5DM0A 1XZPA 3QBJA 4WE3A 2WWVD 1QRAA 2DY0A 4BC1A 4DM3A 1D0VA 2PJRA 1C8VB 1U2GA 2W90A 3OJLA 4HPXB 1H5UA 2DP4E 2ZJAA 3I8SA 4IAOA 1V35A 1YH3A 4DFDA 1N2HA 3JZDA 5GY7A 3HYNA 4F2WA 1UFKA 3PUHA 2OTCA 4XLTA 3C1UA 5F7JA 4E5VA 1QGUB 1MV8A 2HDHA 4DLUA 4XRGA 2VZLA 4J8PA 3AY0A 1XLVA 3WHIA 1DADA 4BB9A 4OI4A 4POOA 1ECLA 4PC7A 4HGZA 4M89A 1KK3A 4V0KA 3ILSA 5JSUA 3DLIA 3VXKA 2JNWA 4D97A 5LOVB 3I12A 1XNRB 1JKXA 4WADA 4BNNA 3ONFA 3AFHA 3ICVA 2IWRA 1TI7A 3WLHA 2I29A 4Y2QA 5JU6A 1IEQA 3ANXA 2KSQA 1LLDA 3M4JA 5KSYA 3EMVA 2J87A 1UMBB 5FUQA 3WZMA 1QGED 4ZV9A 5L45A 4DUYB 3GEMA 5CAEB 1B43A 1LX6A 1X1SA 1TIKA 3MIIA 2VCHA 3MOGA 4G24A 5EJ5A 1KZ7B 2ZI5A 2NPIA 4E33A 3LQFA 2X0EA 2B1JA 3EYAA 5EXSA 5JZSA 5D6OA 4C21A 3ESQA 3AXSA 3JR7A 5AK6A 5K3FA 2DWPA 2A9FA 2Q6TA 3KOMA 1EUDA 5EJAA 4N47A 1JQEA 1SHKA 1X9HA 2IYTA 2R6DA 5IYZF 5ICSA 5JZVA 4BC0A 4LJKA 3CX8A 1WW3A 1ECFA 1V41E 3OTWA 3VZBA 4MROA 5C1OA 3QELA 4QUGA 5HMLA 3OZXA 4AY5A 3BGWA 3E9NA 1CUBA 1JEEA 2ZITA 4XFKA 2P9TA 5JVDF 1JA1A 8ABPA 2XUKA 1E7YA 4OQFA 3K6SB 4LJAA 4R8LA 2QK4A 5H81A 3UAWA 1U3FA 2JA1A 3WO0A 3FKJA 4IXWA 3ESBA 3E3OA 4HMQA 4DWVA 1BDMA 1T2NA 4BCBA 5IS2A 4LV8B 2DKOA 4XM0A 5COBA 2VPTA 4XYEA 3VPCA 1B6TA 4DBVO 1YS9A 4HN2A 5BPHA 1U7UA 2G82A 4JT4A 2XWPA 3U7QB 5IM5A 5IABA 4Q02A 5JJKA 3LSYA 1Z56C 2GARA 1R74A 4XWAA 4X60A 3BGIA 4FZRA 4EW6A 1KMNA 5ITSA 1U7OA 1SUSA 4QX6A 4RXMA 1EM8B 1SUAA 2AOUA 2QIPA 3R77A 4GSKA 4WWHA 4DLXA 4UPEA 2X5OA 4QE3A 3OMWA 2J0SA 3VC1A 2D5LA 2YWJA 3AUKA 2PLWA 3MWJA 1SHJA 3Q3EA 3IEXA 1A98A 1QCDA 5JYCA 1OPXA 1N2BA 3WY9A 1D9ZA 4Q1EA 2BM8A 2XDAA 1PDOA 5DBOA 2NU8A 2WKRA 4H1TA 1XEWX 4O1IA 4P7FA 5REQA 4DMLA 2VK4A 3N2GB 4DCJA 3OE4A 2ZAMA 4GOLD 4RMIA 3AVTA 3HCCA 4AG5A 2ZBPA 5B7NA 2A9PA 4MKRA 1Z88A 3PNYA 4LGVA 3QF7A 3GJYA 3DLTA 1M1YA 2A5LA 3MJDA 5EPOA 2BGIA