4JT9A

Crystal structure of human sirt3 with elt inhibitor 3 [14-(4-{2-[(methylsulfonyl)amino]ethyl}piperidin-1-yl)thieno[3,2-d]pyrimidine-6-carboxamide]
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
KGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords NAD-dependent protein deacetylase sirtuin-3, mitochondrial
publication title Discovery of Thieno[3,2-d]pyrimidine-6-carboxamides as Potent Inhibitors of SIRT1, SIRT2, and SIRT3.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 274
sequence length 274
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4jt9A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4jt9A01
5MF6A 4IG9A 4JUBA 4Q9DA 1ZPDA 4J1TC 2NYRA 4GPEA 2H2HA 1U2DC 3F6BX 1O96B 3CLRD 1EFPA 4GG1A 5FYQA 2IHTA 1PT9A 1T9BA 1YI1A 1U28C 4BV2A 3U3DA 2EZTA 2Q28A 2QQFA 4ZP1A 4C7BA 3F6EX 1O97D 2A1UA 4K9QA 1Q17A 1POXA 1OZGA 2HJHA 3OE1A 4BVGA 2VK8A 2IHUA 4BN5A 2H2FA 1Q14A 3IAEA 1UPAA 4MPRA 5K3SA 4C78A 2H2IA 1DJLA 4D5GA 4K9KA 2JLCA 4K9PA 2WVHA 2UZ1A 1PO7A 5MGNA 2VBFA 1BFDA 2VJYA 1PNOA 4UTXA 1QPBA 3FLMA 3PDHA 2IHVA 4BVHA 2Q29A 1S7GA 2OORC 4L3OA 5EJ5A 3FSJX 4UTNA 2A1TR 5EJ9A 4RJIA 4V1CI 1U2GC 2NXWA 4TWJA 2JI8A 4K9OA 4RMJA 4I5IA 1YBHA 3EA4A 2W93A 2UZ1B 2OD9A 3GLRA 4Y6LA 1J8FA 1D4OA 2PGNA 1PTJC 1T9AA 4BVBA 2VBGA 2H4FA 4JT9A 1POWA 4O8ZA 4IF6A 4D5EA 3IAFA 4JUDX 5EJAA 2OO5C 4GM0A 3FZNA 4UTRA 2DJIA 1Q1AA 2JI7A 4UUBA 4G1CA 3D81A 4K9MA 4BVFA 1V5GA 4MPJA 4BN4A 2EZ9A 1SZDA 2FWNA 4TWIA 4QELA 4KGDA 4HDAA 3CLUD 4JU9A 1YHZA 5MFPA 2JIBA 2Q5QA 1YHYA 3GLTA 3U31A 5K6TA 2B4YA 1YNOA 5EJMA 2FR8C 4KXQA 1V5FA 4BVEA 2H4JA 4RMGA 1M2KA 1S5PA 2H2GA 3E9YA 4JUAA 4FEEA 1UPCA 4JUFA 1UPBA 4GM1A 2Q5LA 4UU7A 1MA3A 3HWWA 2QQGA 1Q6ZA 1Z8NA 2VK4A 3EY9A 4MQ5A 5K2OA 2H4HA 1U31A 1MCZA 4RJKA 3ZGOA 2H2DA 3ZGVA 1PYDA 2AG0A 4QPZA 1M2NA 5EJ6A 4KPUA 4UU8A 3LQ1A 1PVDA 4FZ3A 3CLSD 1PI3A 5FEMA 2VK1A 4F56A 3PKIA 4FVTA 5EJ7A 4JSRA 4BV3A 2VBIA 4UTZA 4V1CA 2FRDC 1YI0A 1V5EA 4R8MA 5K6RA 2C31A 2JLAA 2Q5JA 3K35A 4IAOA 1EFVA 2X7JA 3EYAA 1YC5A 2PANA 4X3OA 5BWLA 4RJJA 1T9DA 4MZXA 3ZG6A 2JI6A 1SZCA 5BWNA 4JT8A 4HD8A 4UUAA 1PNQA 3D7KA 5DEIA 4GM4A 1M2GA 4F4UA 2FN3A 5D7NA 2AG1A 3PKJA 4K9LA 1OZHA 1JSCA 3CLTD 3HWX1 5AHKA 1E3TA 4COKA 4X3PA 4UTVA 2OD7A 4FEGA 1ICIA 1M2HA 5BWOA 1YTLA 4RMIA 4JD5A 4Y6QA 2V3WA 2H59A 4MPPA 4V1CB 3JWPA 3CF4G 2Q27A 2FSVC 4QQ8A 1YC2A 4BUZA 1T9CA 5DGDA 4J16C 3D4BA 2PGOA 1N0HA 1XLTC 3GLSA 1NM5C 1M2JA 1HZZC 4Y6OA 5MFZA 2EZUA 3RIYA 5EJ4A 5EJ8A 2EZ8A 4RMHA 2WVGA 3RIGA 4GP9A 1OVMA 4JUCA 4L2IA 3GLUA 1Y9DA 3JR3A 2Q5OA 5IMSA 4JU8A 2EZ4A 1OZFA 4K9NA 4ZZIA 2BRUC 2WVAA 2OD2A 2JI9A 5DGTA
chains in the Genus database with same CATH superfamily
1JAYA 1ECPA 2FW7A 3X3HA 1B43A 2WFLB 3N76A 1IQUA 4BNNA 5IAOA 4HZGA 1K7SN 1VPVA 3AU9A 3GMSA 4PYRA 4W9NC 2NMVA 1JKIA 3EPPA 3I12A 1A4IA 2LCFA 1XMVA 4XI9A 3W5VA 4RD3A 3INTA 4PYLA 1K1EA 2HRQA 1FDVA 2CSXA 1O8BA 4M0FA 5JC8A 1PR2A 3ZV4A 1KJ9A 3M6AA 2H1SA 4U6NA 4NMXB 1L7RA 2SECE 4NP6A 1SELA 3LIIA 4ER5A 2NNLD 5B3KA 7AT1A 2Y1WA 2NUTA 5GADl 1QK5A 4JLAA 3PDIA 1VE3A 4NV0A 4ZC1A 5KKCA 5LJIA 2OBXA 4LDRA 1KDOA 1QP7A 4M76B 1Z7EA 4PYIA 1KFJB 1JALA 3UXEA 1V95A 1KAGA 1YI1A 4YUAA 1UJ5A 4HUJA 1RWKA 2HDHA 3CO0S 3FUTA 3ZUPA 3D4IA 1U28C 1QHHB 5JANA 3O38A 3P96A 5FR2A 2C5SA 3HV2A 1F20A 4Q7MB 3WQSB 4GH5A 2IFTA 1H8HD 2ID9A 2V0NA 2YN0A 3QFHA 4WESB 1N6RA 1C0KA 2SNIE 2ZIUB 1OB5A 2ZYSA 1FX1A 3BA1A 1JYFA 3SXUA 1SM4A 2ZB8A 3QLVC 1RU3A 3F2IA 2I1QA 1DOHA 3PLNA 4MKHA 2QJFA 5AK0A 8ABPA 1V37A 2Q8NA 4JBXA 2YXLA 5HZHA 1N5LA 3MWDB 1KMCA 2WICA 5FKJA 3X1MA 1T0JB 2OCKA 3GZ4A 3HM2A 1GZ4A 1Q2UA 4RL4A 3RS2A 4CQMA 1YVEI 4HR7A 4ER6A 2VR1A 2XYRA 3A3PA 1NE2A 4NCXA 5E1MA 3HWSA 1I5RA 4ISBA 1CXZA 2YY7A 5JZVA 1CS0A 2G9RA 1A1VA 4L0DA 1IDN1 3I32A 1VHJA 5KHOC 4JOBA 4Z0PA 4ZYYA 1KGSA 4RVCA 3PK0A 1USUA 1VRCA 3E8SA 2O6LA 3SMQA 1ZIYA 4IEEA 4NOKA 2ACKA 3UB4A 4CIXA 4UBLA 1XDUA 3UM9A 4L4UA 1V6SA 3FN4A 2QZSA 3H9BA 4QDOA 5CDYA 4F96A 2UUCB 2YCBA 3VTKA 3HUDA 2M9MA 3AR4A 3CNQS 4F8JA 3L7KA 2BJWA 3ROKA 2GCNA 1USKA 3ACDA 3CRRA 4R2XA 2HWWA 4Y6SA 3FGPA 4Z51A 2XEDA 4MLZA 3BQMB 3DV9A 4QUAA 2VSXA 1O9BA 1UUFA 3K5IA 4MP8A 1FFSA 4YMWA 1CPYA 4S2EA 1PJTA 2EKQA 4D7AA 3QRWA 4N0QA 4MR7A 4JMPA 5ES4B 4TTIA 4UM5A 4YP6A 2BFCA 3OEYA 2E1RA 4LJ6A 3G85A 2Y1EA 4OGKA 3JQ7B 3UMMA 4GBGA 3T7CA 4CZ2A 5C1BA 2BUAA 4OL0A 2DP4E 4D0SA 2B21A 1CWUA 3GG9A 4Y1RB 3CX4A 5AVYA 1A95A 3H13A 2REQA 3KZCA 5ENVA 3VI4B 4NOMA 4EHFA 4P35A 1HO3A 3VGJA 4EKGA 3SC2B 4F38A 5B1HA 1P3JA 1M6HA 3BEOA 4EPYA 5CX1A 3NBAA 3R7BA 4LWOA 3AERB 4IZOA 4PONA 3WSVA 1S01A 2JW5A 2VHYA 4HQLA 3BSSA 2V4UA 2ICAA 3OE4A 3PJGA 4RH1A 1UBFA 2F6RA 1J8MF 2AJCA 4N0EA 4OO3A 2V54A 1PV4A 4HGQA 1KEWA 3KEQA 2B6NA 2I54A 5AKHA 1IVNA 2IU0A 1WXEA 4IHAA 4EAAA 1M2VA 3R20A 4E0BA 1KBZA 4ILKA 2Q4EA 2O8EB 1DS6A 1P4GA 2AUNA 5I5GA 5CYOA 5K3EA 5C1DA 5KOIA 2ZJ3A 1EDBA 3JAWB 2I2DA 3R2JA 1NUAA 3SFVA 3AL3A 5A3VA 5BXYA 4A8JC 1K8ZB 3DE7X 2WBLC 2C3YA 4ZXPA 3RC7A 4RKRA 4D4HA 1NULA 2PYDA 4CMEC 2BGGA 2CNKA 5C53B 2R2GA 1KY4A 2LE0A 2X0DA 2C0CA 3KEGA 1JI0A 1Q1EA 2B9VA 3RLFA 1G5HA 3E3AA 4G4JA 3UFXB 5IVIA 1U02A 4QBFA 1XK7A 3KPWA 1Z18A 1CNMA 3CYFA 4E5KA 3AHIA 4IICA 1OXVA 2CVHA 3ESAA 5FPHA 3A6LA 3U26A 1DBVO 2VF2A 3QFRA 1B41A 2NPIA 4CW7A 3SS7X 5DM1A 3FG9A 1D4OA 5JWHA 1MOQA 1T2DA 2BM9A 1QOPB 1VYTA 2ZAGA 4KTTE 4V0MA 3S28A 3S2EA 4MCHA 1W4RA 3DGEC 3RVPA 4A6DA 3SKXA 4DDVA 5DBHX 5HQJA 5ESDA 3ER8A 1ZCBA 2H4FA 4F5EA 3KJNA 4G1EB 2H52A 4GI5A 5H70A 4GMFA 4CL8A 1TM1E 2AMLA 3KYCB 3KVOA 1WJGA 3EUAA 3LFUA 3QVOA 3NHMA 3TQQA 1E2HA 1ZICA 4ZGBA 2AN3A 3U4CA 4YLGA 2O3UA 3T61A 2YWFA 1MVNA 4G5SA 1YZLA 1EDZA 2WP0A 4I9UA 4JUDX 4PO3X 1MT0A 2BE9A 5FI3A 5B6PA 5FORA 1E64A 2NV0A 2X9NA 3MNFA 1KIFA 1ZJZA 2QTBA 4M89A 1YOVB 2HYDA 3FBTA 2WUEA 3P0IA 4PZ0A 5JAHA 4YRQA 1SU7A 1D7AA 1CUYA 5DRTA 4X93A 3GT3A 3ABOB 5ALRA 1HGXA 5I6DA 4YP0A 1H8HA 2ZTHA 1QGED 3CONA 3DWFA 1T24A 1ESZA 2XWJI 4PLHA 3DHWC 2IP1A 2WHXA 1NUHA 3KFVA 4G0MA 4BN4A 3OH8A 4IJQA 4MWOA 4YBZA 2ZKLA 3ZQ6A 3D0RA 1E1CB 1YI8A 3AUAA 3UHPA 4BLRA 1P45A 3TG8A 3WHLA 2GZAA 1G3UA 1CR4A 3IP7A 3N0XA 1SB8A 1TF7A 3PXUA 4U9UA 4BKQA 3NM4A 2QR2A 4CIVA 4F72A 1YCDA 1TCCA 1ZIOA 2QX8A 3FMVA 4PRKA 2J5KA 3H5VA 4KIUA 3G8AA 3WGQA 2YWGA 1EP9A 1P1RA 3DB2A 1YIAA 3THXA 1BQEA 3LQ4A 1C3JA 2OSVA 3H3XA 1N5IA 3AY6A 3V33A 1OLOA 1PV1A 4BKUA 4F2DA 2HSDA 3F3KA 1EG2A 3ID6C 2ZI9A 1YZ3A 3RH0A 2JIZA 3DVSX 2UV8A 1SVNA 3UMYA 2B4YA 4R3WA 1YR1A 5E0KB 3HO1A 1LU9A 2PGIA 2FLVA 1OIVA 5EC8A 3WRWA 4PN3A 2MYPA 3N8GA 2GYUA 3BF7A 1YNOA 3G2IA 1L5GB 2C4MA 4P7JA 3DLAA 3OT5A 2NXCA 1XJQA 1WCIB 3EZLA 3GUYA 3IBGA 3OZXA 3R0QA 4NYJR 1E1LA 4UKDA 4OBWA 5JFGA 5E6UA 4H77A 3VPAA 1LPOA 3KSBC 2JVJA 3VBCA 1XELA 2ECPA 5JARA 4PYMA 1FMJA 3T9CA 2DSTA 2IZ1A 2ZJZA 2PEYA 1Z4QA 3FOAA 1GU1A 1SVIA 1C7EA 1T6YA 4AN0A 2BY4A 3K2BA 4IOLA 3U60B 3ZR4B 1ZRHA 4AURA 2GETA 4JEIA 4OIMA 7YASA 3GC6A 1L8OA 3F49S 1RR6A 3I04A 1M2KA 1PR5A 2WWTA 4CIBA 4FILA 2C8VA 2X8JA 1H4SA 4QYMA 3AQ4A 4PZCA 2HCRA 3F0TA 4GYJA 5JT1A 2MSDB 2A0FA 2QD3A 2XQIA 3KJZA 1TNDA 5MGBA 1ND6A 3EHEA 4AKTA 1EX7A 2R8OA 4GM1A 3KXKA 4NFLA 2BCJQ 2WJ6A 4YO8A 4XWAA 5JBNA 1W30A 2ZTSA 1WPXA 2X15A 3AEXA 3UJ9A 5B37A 4ERXA 1SWVA 2WIGA 3NJ4A 3OICA 1USVA 2P9HA 1XNJA 3PHLA 4L4ZA 3TRIA 3VYRB 1Z12A 4EI9A 1Y3CE 1QZTA 3DCNA 4JXJA 3RC3A 3AL0C 5JFOA 2VZEA 5J4HA 1Z5PA 1ZKMA 3LHDA 3LXUX 1HSZA 4BATA 4CETA 2Y1CA 1KVTA 3NGMA 4QM6A 3NFRA 3KJQA 1EQUA 4MV3A 2BKLA 5T57A 2DMRA 4ER7A 3K8QA 3QOXA 3FMFA 1L7AA 2D2IA 5FOWA 2BMFA 2G17A 3UQZA 1EWRA 1NMSA 5F12A 3UJNA 4A8HA 2DERA 2WWVD 2HXYA 5TX7A 1Y8RA 2W48A 4F5DA 3VUEA 5CXQA 2B94A 4MUJA 4CIAA 1Z0ZA 2QZ9A 4RELA 1E77A 4RDCA 5JXWA 2O8FB 2XAUA 1T36B 4HNGA 1AF7A 1C1XB 1DV2A 2WE7A 3GRCA 1B1AA 4OH7A 4BBAA 3KZKA 3DJYA 3PPWA 3LBAA 2QN9A 3DEZA 3T0IA 1KP3A 4RK7A 4C2TA 3F1LA 1H2XA 3IA2A 1NVGA 4BV3A 4KQXA 4LSWA 5CB4B 5K99A 1ZVJA 1CZNA 4NKRA 4BQSA 2HCBA 3V4VB 3WGOA 3DLPX 5BSUA 1K98A 1HQDA 4BVLA 4ZV4A 5IKEA 3CE9A 3UWKA 3TSOA 4E5YA 4M1TA 5FWXB 3GFTA 4P5EA 3QNWA 4INPA 3UWSA 2I0FA 4RVOA 1NL3A 1PJZA 2JL1A 1TZ2A 4HGPA 4JODA 2B5VA 1UZUA 4MO9A 4MTCA 1BVUA 2C9ZA 4NENA 3ZW9A 2G83A 4MWEA 2C83A 3CWCA 3OEEA 3H2JA 3UW3A 5AKEA 4CT0A 5IWAB 2FPKA 4V0OA 4X1IB 4ENQA 5JD6A 3IUEA 2R8BA 3FUVA 4OUDB 3M6UA 2L0XA 4ZAWA 4YPVA 3CVVA 2WU4A 2QS9A 5FV7A 1FFXA 4O8CA 3AVVA 3P97A 2WF8A 2ZGVA 4DAEA 1M2EA 4AW9A 1DT5A 5KQSA 3MGBA 1KI1A 1BW9B 3VH4A 1YR9A 4R9SA 4YI3A 4UFPA 3CUVA 3QE0A 1U0RA 3MVEA 3O9VA 3OUUA 4FYMA 5FOVA 2VHWA 4B9AA 1J2JA 1L9KA 4CM1A 5K8UA 4DLZA 3P9RA 4S1TA 3T3IA 4BFUA 2DLCX 2Z2YA 1GZVA 3T3NA 4CMEA 4QLBA 1TFRA 4A5SA 4LQ4A 4ZEWA 1IEWA 2AGVA 1V5WA 2WLSA 4K3VA 1LFDB 5J5CA 4M9UA 1DO8A 4MMYB 2P0EA 4ZIRA 2QGNA 4QGSA 5HFJA 2J85A 4UNIA 4KOEC 1VLLA 4PC6A 5L7WA 4N3NA 3W79A 4C3ZA 3RAPR 1FK8A 3QPVA 4JEUA 5DTJA 5K2MA 3WGYA 2ANBA 1FYEA 1O89A 2VHXA 1OWLA 5E4FA 2VHEA 3T9FA 2F4NA 4DBLE 1ADCA 2VH5R 5EGNA 4INJA 2RHGB 3WLRA 2QHXA 2ATIA 3THWA 3BXFA 2PQ0A 1TF5A 1T0BA 2FPIA 1PG0A 3CS3A 5A3SA 4X91A 4ZYXA 5TIIA 3GPBA 4MXDA 3UMBA 4BMYA 4Q93A 6PFKA 4MKZA 2LNDA 2Y4OA 3KO8A 4P7GA 2QIOA 1IC6A 1II8B 1XRJA 3IODA 3IQFA 3LY7A 4N7BA 4AY4A 1FSZA 2PK3A 3MF4A 1JEEA 3PNSA 4QQ8A 3PZRA 4REMA 1TT5A 2XE4A 4DJAA 2ZJ4A 1AHPA 4KREA 4JLMA 3ZKAA 1RYBA 4HCJA 3N0RA 2XT0A 3K9HA 3CGWA 3RUAA 4C6TA 4MS3A 4BB9A 4FDUA 1U0FA 3FCYA 3GJ7A 3H9CA 1J9EA 1DUVG 2PQMA 1NC1A 3OETA 4ZQBA 5GJCA 3AVTA 2QR5A 2OM6A 2QMZA 2GEJA 1T8RA 4Z9YA 3H0KA 4C5AA 4UOZA 1JG6A 3QX8A 4RM3A 2Z2KA 4U5XA 2QGZA 3V80A 1L4YA 2G25A 1YACA 4BNXA 3K2EA 4BFSA 5NLLA 1UM9A 2WTAA 1XTBA 4J1TA 3PFIA 3E61A 3V8EA 3MINB 1FU4A 1W5FA 3EVZA 4DDHA 2P6OA 5MFZA 1LS1A 3IPRA 1JA1A 3MLEA 3I61A 1RAEA 1TDJA 4X85A 3RABA 5IXJA 2J32A 4F21A 3OU2A 5AK3A 2WVGA 3TXYA 3FR8A 2G8NA 4HBZA 4LYDA 1XTRA 2PJDA 3QEJA 3LUHA 4EARA 2XTJA 5KNBA 1GA1A 1EP3B 3BUSA 3WZ2A 2GFIA 3UKDA 2FUG6 3WJ7A 2FK8A 3SBOA 3DSRA 4TGLA 3AJAA 3VU1A 4L85A 3IUNA 3VPSA 4B3XA 1AZSC 1L1EA 1OSNA 3IVAA 2Y1DA 3PUYA 4TV8F 1P7YA 1ZUHA 5DMHA 2IOHA 4MWTA 5JH7F 5HSGA 2JA2A 1JXMA 2H7YA 1C30B 3FROA 4FDMA 1Y1KE 1Z7GA 3ONDA 5CA0A 1ACMA 4URXR 2PUDA 1E2NA 1K8XB 2HF9A 1GRNA 3G0HA 5CH8A 5FPQA 3TE6A 3IA7A 2ZYTX 3QELB 3QQPA 3WZLA 2WYUA 1U8TA 4KXVA 4OHMA 2WWGA 3VKVA 3BH6A 5CYPA 4EJ6A 4L6AA 2ILVA 1P5RA 2PEZA 3F2VA 1QTIA 3H75A 4XSHA 1FFWA 4J3NA 1IN4A 4HP8A 3UO8B 1ZAKA 2IS6A 1RFLA 1ZPDA 4UAJA 1WY5A 4PRYA 5IMBA 3N6VA 1OFVA 2HMAA 4LHVA 1TKRA 2H1WA 4UPVA 4YAWA 3OSUA 4HWOA 2CF6A 3WK7A 1XWIA 4S3MA 4L9WA 5F1OA 2NTYC 5I7HA 4J0HA 1R0SA 3K1TA 2NZVG 1MC5A 1DG9A 5D3MB 1PL6A 1ZZEA 4QVKA 5TB5A 1DQPA 4WBNF 4LZOA 3GDWA 3ZCSA 2ZR9A 3HYNA 4KH0A 4Y2YA 3G2QA 3ZLVA 3BA6A 3UVEA 1Z68A 4BNDA 4QPCA 4TQUS 3A37A 2XRMA 1P9RA 3MCZA 1J20A 2FZKA 4RE6A 4D8TA 3ZWOA 4Z7NB 4LQCA 4DLPA 1QE3A 1YDEA 3X0DA 2QYHA 1XU9A 3EGIA 4TUYA 3U7EB 1JEYA 2W6NA 2UYCA 5KVAA 1GZSA 3H6GA 3IELA 2G0NA 3GLFA 3F8SA 5BWCA 2GEKA 2IHKA 4JP8A 4LBZA 4RLQA 3SHOA 3ZCTA 4BRUA 4RU1A 2BI7A 4KNVA 1YQTA 2P5UA 5BSFA 1VKJA 4C5BA 1CT9A 4K81B 4MJLA 4PS1A 2FQWA 3GQBA 5TJHA 1O6CA 3MAAC 1XFAA 2P35A 3OKPA 1DC3A 4ACBA 2CVQA 2RGGA 3OIVA 3TMKA 4FS8A 1PE0A 2ASVA 1NTOA 1M8FA 2HBZA 2HOQA 5A4AA 2BGWA 4AI6A 3QM1A 2IBMA 3PHJA 4CDGA 5FD8A 1A9ZA 4OX9Y 3CUKA 1CULC 4XQGA 3B89A 5J43A 5HDBB 1LLQA 1SD1A 2ZIXA 3CR3C 4ZI2A 5K8IA 2X86A 3GROA 3RFUA 3W4JA 2J45A 3JASB 2HADA 2AC7A 2C5LA 1BYUA 1Z2PX 3VNUA 2NW6A 3BHIA 3NVAA 4N03A 4TMFA 2H2FA 3LOQA 1Q16A 2VJDA 2XKAA 4KKVA 3H97A 1MENA 1HURA 2X8LA 3FCUB 4XLZA 4A2WA 3B48A 4CKBA 1UPAA 4DV3B 4MPRA 5K3SA 2ZRAA 4N6NA 3VI3B 1NXWA 1ZM7A 3O83A 4G0PA 5BRNA 4W5RA 2J5XA 3BSWA 1K08A 1YBVA 4WEOA 4YV1A 1Z07A 5IC4A 5KYXA 1AQIA 2XCUA 3CX7A 3RF6A 4Q9AA 2HPHA 2P6NA 4LWQA 2YWEA 2QTAA 2W4MA 1YQXA 5A4MS 2L69A 1ORWA 4XM0A 4ZVMA 3HP7A 2XUJA 4KMSA 5K6AC 1L5LA 2PTHA 3TX6A 4AKIA 3OCUA 4R69A 5K0JA 4MDHA 2NUTB 4ED9A 5KQMA 1Z7BA 3PDIB 4ZRNA 4D9NA 1I3MA 4MKRA 3N5KA 2A9OA 5K0BA 2XTAA 1V1RA 3A1NA 3JYQA 4JI7B 4DUGD 9MHTA 1MB0A 4MV4A 2GX6A 2HF7A 3KV3O 4PBTA 2CB9A 1IIRA 2FZVA 4PPYA 1CZRA 2IJGX 4URFA 2N1BA 3A6JA 5FI5A 2IYQA 1XVAA 1F8UA 1VA4A 5B7QA 2A0XA 4LJRA 4B17A 1RLUA 4I19A 3WMFA 2IOFK 2KPOA 3ZWMA 4P2BA 3SHWA 4BX8A 1JSRA 1CEYA 2JLBA 1HG0A 2CJWA 4PYJA 4Z9FA 5CDSA 1QDLB 2QT9A 4BB6A 3LCUA 3MS4A 2HF2A 1TGVA 3ROFA 3SXUB 4YT8A 1T0PA 3UPTA 2ZJBA 1GTL1 4AJ4A 2HHAA 2JA1A 4YCLA 1KQGA 2YV5A 3E5MA 5FBQB 3CT6A 2IW1A 3CUWA 3HWRA 4BWVA 4RF3A 5L4NA 3BKWA 3IRVA 3VAZA 4JKYA 4PQRA 4TLAA 4CQMB 1NBMD 4DXAA 3L49A 3U7GA 1U0EA 3Q9SA 2FF5A 1WXXA 3H84A 3HC7A 3VVCA 3RUEA 2HRRA 1CS0B 1FTWA 5EHGA 5CA1A 4KQEA 4X6XA 3U4QA 3KPVA 3ONWA 1JW9B 1UFOA 2OV4A 4MUYA 4ONEA 3U9SA 4F2GA 4WLNA 3IB6A 2AMFA 5TNXA 2WIBA 3PGMA 4TYMA 4D3ZA 2V1XA 1SA0A 4HG2A 5DULA 1UDAA 3IV6A 5B5SA 3ZE1B 3VTFA 2ISSD 4QVIA 4C4AA 5JV5A 3WWOA 1V16A 1M6YA 4Y67A 1V7ZA 1FVFA 4N3AA 1IZYA 4QAJA 4OJTA 3NC0C 4Y2RA 3I5XA 1NBWB 4E5PA 1RRVA 1ONSA 3B9QA 2C54A 3N7AA 3MIIA 3S0JA 5DBGA 1J8FA 2G4CA 4LECA 5E1DA 3IVMA 4JOCA 3W6ZA 3H1GA 4I6EA 4EQ6A 3DEHA 4FI3C 3EIWA 4YS6A 5DBOA 3BCSA 3BJMA 4EM6A 2AS0A 1JU9A 4BTVA 1WUIS 4NEHB 4ZAXA 4B3JA 3EGXA 3QHAA 2XEXA 4MR7B 2B2XA 4MI3A 3RVRA 4D3SA 3P9NA 4B3HA 4YYZA 1XI2A 2BFCB 1TYZA 4JYZA 5J2UF 4PXYA 2WM8A 2XVMA 1BDHA 2D74A 3ZNOA 4EMUA 1Z2NX 3D6FA 1C3LA 2REQB 1OMOA 4Z1MD 3TLMA 3QH4A 1YJBA 1L8XA 2X7HA 1NLZA 1JZSA 2GSDA 3W90A 3FOCA 2WMNB 5EPOA 4OJNA 5CX1B 4UTRA 5ARCA 1VCOA 1W4BA 4NMMA 4B3IA 3RS5A 1JFSA 3PBKA 3TQHA 1EGQA 1KOFA 1TCUA 4XIFA 1W4AA 3HDJA 1NF2A 1M2WA 3WXMA 2WKPA 1ZJ6A 5FLEX 1LLCA 3CZQA 3T1NA 3K2QA 4D6PA 1M2VB 2E7ZA 3DFZA 1LDGA 3ESDA 1GL9B 2D13A 3BSFA 2FWNA 1RZ3A 2VNKA 4EGFA 1ZX1A 1SRRA 2OFWA 2JGRA 3L8CA 2X0FA 4N3GA 4ZYZA 3KELA 3GEGA 2MU1A 3GEBA 4KX3A 2YNMC 4HXEB 4REOA 1GM5A 5H59A 4NX2A 1RBZA 5ISMA 3W34A 4A6XA 4X8OA 1R37A 4PLZA 5JAIA 4KHPB 1P17A 2P2CA 4XQEA 2XMCA 2HSJA 3MFQA 4ZXFA 3LHSA 4KR7A 2O3RA 3DFKA 2GLTA 4RLFA 2Q5QA 4N7RA 1W6UA 4QDTA 3DCIA 3WIVA 5LJLA 4JL6A 2OV3A 1RJWA 2V7BA 4YDQA 4MI9A 4R3UC 4ZA2A 5EESA 2WHQA 2WABA 2XWBF 5CEEA 5FWYA 3H4TA 4MTLA 2DHEA 3LBHA 3RT9A 4XGRA 5JTUA 2WQ7A 4OMUA 3T3OA 5EHZA 5LQDA 1JQ5A 1N3YA 2H8GA 2JCVA 1H8EA 1TU0A 1QG0A 1WXGA 2DFTA 5JROA 2PX2A 3M4XA 1LW7A 4WBXC 3MGKA 2OLJA 4CG2A 2PDAA 2UXCB 4P3NA 1CK4A 1W29A 4IDDA 3UAWA 5LP1A 3OLVA 4C7VA 4FGSA 2IBSA 4QXOA 4XCVA 1QIFA 5FOSA 3DBVO 2FN4A 4DLLA 4B0OA 4HVLA 2WT4A 2AR7A 4Q01A 5IULC 1S5PA 5TF0A 5K4GA 4Y18A 4R8VA 4C4ZA 2Y71A 1CD5A 5AK5A 2I2FA 4NHEA 3WNVA 2ZRIA 4OI2A 3GPLA 3WOHA 1G2OA 1P3Y1 4IDQA 3G0BA 3M4JA 3Q41A 3BXZA 1K68A 1SR8A 2HO5A 4MS4A 5I3CA 2RH4A 4MQFB 4RV4A 1T9KA 3KQOA 5CJPA 2XB9A 1NF8A 4JT2A 1ETHA 1Z5NA 2XTNA 2DOKA 4IYJA 2HDNB 3KKOA 5CDFA 3QXSA 5A5VA 3EY9A 4KCGA 1R0ZA 2MWMA 2X4DA 3LWNA 4HWGA 4LPKA 5FOXA 1Y8QA 3K30A 2QN7A 3OZIA 3QLUA 3R41A 2HHJA 4ZAYA 4B31A 1XDBA 5CBKA 3H6HA 2FETA 5IXYA 4GBED 3HDYA 3K4PA 3LGAA 3UAOA 1G7RA 1LY1A 1B8OA 2GI4A 2Q5EA 4I8IA 1KEZA 3PD0A 3U16A 1Q7CA 5DDIP 9LDBA 1NDUA 1XDDA 1UFRA 1HEYA 3MTIA 3OVMA 1MAAA 1D2HA 4KPUA 2B30A 3B38A 3U49A 4MUIA 3I52A 3Q98A 3ZIUA 5KJ1A 4L9AA 3JALA 1PI3A 3U4GA 2BELA 1ZCJA 4ASUD 4WECA 5DI3A 4GXQA 3P2OA 3ZHVA 5GAJA 3G68A 1QYCA 2XW6A 1T5IA 1TRHA 1ZNZA 1IY2A 1N57A 3FA2A 3KB8A 2K87A 1JFFA 4AKEA 3W9UA 3ZQKA 4LFAB 4UTZA 3A32A 5E6UB 3JQFC 4D3XA 5D01A 1AB6A 4G0YA 1CJVC 2C5GA 4J4TA 4WVFA 4KSBA 4AB1A 5JEDA 4AULA 4UD2A 2AJ8A 3V9AA 4C4SA 2PIAA 4EVSA 4XEUA 2Y9PB 3CJTA 3TLGA 4DKJA 4QFMA 5BPFA 4QTYA 4TKUA 5DW0A 1DAFA 3AF5A 5EIEA 2X8JB 3RUHA 4OD0A 2GVDC 4ZALA 1AVTA 4ZVOA 5CFOA 1Z22A 1QHXA 2ON6A 1I80A 3G7NA 3SVTA 1KEUA 4DAOA 5DOZA 2EBFX 5DN6D 3TLAA 5GIOE 1S3SA 2I8LA 3NDPA 4O2AA 2A9QA 1SQFA 4O1MA 3BWVA 5CLGA 2G63A 3DOHA 5JSYA 5TMDA 3PXXA 3MJSA 2NO5A 1KC1A 2VOEA 4AY6A 3T94A 4BFLA 4TS1A 1Z8HA 5ALDA 4OHUA 4D1YA 5BQ5A 4J6EA 3HK2A 1G21A 1XQWA 2OR3A 2IS1A 3N70A 3HB9A 1QHEA 3PJDA 1W2HA 5KAPA 2VG8A 1KPIA 4HS4A 1SRQA 5CB6A 3CJQA 4V3BA 5HZGA 3NTLA 4DYDA 4LZZA 3KJIA 1GVNB 1J7JA 1R4ZA 4DSAA 2HK6A 2V9ZA 2AKEA 3ZXIA 4MRNA 3UWMA 1O6GA 3H19A 3L8GA 4U8GA 3D2LA 2Z8YA 4BFVA 3Q7QA 1A8QA 1Z6QA 3GLGA 1NRWA 2WP8J 1FFCA 5CPBA 2VATA 4ENPA 3PUXA 1NUTA 1NJ8A 1Y8RB 3C8MA 3IP9A 3NIBA 3QU2A 4LSGA 5CVVA 5GV8A 5LBTA 3QXXA 2PKXA 5DM2A 4XD7A 4YDHB 5L3SB 1XYVA 3DR5A 4E32A 3TNFA 1VKOA 1T3HA 2C5FA 3LZDA 3NRBA 4C03A 3TR6A 3SM9A 1D0VA 1U2ZA 1DTSA 3HCRA 3LGSA 1TD9A 1UWCA 3V1UA 2YFHA 1M6VA 2VCYA 3KTOA 4TV9F 3AFMA 4Z9XA 2MINA 1QVZA 4BZWA 1W0JD 3SS9X 3UBMA 3VYUB 3LUDA 1VCMA 5BW6B 1TIKA 3CG4A 3P9PA 3L77A 2JLXA 3N28A 2BM1A 1FY2A 4IX1A 5JXJA 2Q6KA 4P34A 3FJOA 4JBLA 2BP7A 2ZATA 4D43A 2JGJA 1EG7A 2ZP1A 2FPLA 1SXJA 2P1ZA 5HDQA 3NT2A 3BFVA 3CLRC 1XMJA 3GIWA 4EYQA 1FXWA 4I5FA 4IP0A 2J3HA 4NENB 4R8RA 4YMTA 3IUJA 4UUMA 4U7HA 5E4TA 2QMHA 1AT1A 2J59A 3E2IA 1I7SB 2JFQA 2PUGA 4ENRA 3OCJA 3BYZA 2BFFA 3QU5A 2ZQZA 3RHTA 5BYKA 5CCXA 3F1KA 4JQOA 3N2YA 3GLSA 3A26A 3O8LA 4KQMA 4RADA 4FW9A 1FFXB 4UVHA 4XGKA 4CVNA 5FX2A 5KMGA 4R9UC 2VKTA 1TQDA 4C4YA 1YVPA 2OWDA 3N8DA 5F21A 4C0WA 2MT9A 1M2JA 4XB2A 4NMWA 2BKAA 1E4YA 4YAJA 4F2PA 3V2HA 1Q50A 5DM4A 3B5IA 1QNLA 3ZY5A 7ADHA 3NIFB 2D2VA 3O93A 1Z38A 4IUBS 1GPYA 2WJZB 1ENOA 3LQFA 4MKXA 4JENA 1ADFA 4QOFA 3U48A 5D5QA 3H2ZA 4PSKA 3EISA 3IAUA 4YVFA 4YC7A 4ENTA 1VKNA 4RUKA 4ZIRB 5IT0A 1UPXA 4IG4A 5IF9A 2RE8A 3NUQA 2XOKA 3Q3HA 5IP5A 1G8JA 3G5MA 4ZO7A 3W9YA 5EVJA 1ZGCA 3NH9A 4QQKA 2QMQA 4FDAA 3AZQA 3OZBA 1C7ZA 1EX6A 1ZGAA 1CLEA 2W83A 1Z8FA 3C3WA 4HNRA 3UTCA 2YMPA 2XCSB 2CXPA 1H94A 1TKAA 2RHLA 2D5AA 3FMPB 5GY7A 3RVJA 3GLQA 1GG8A 3THWB 3BRQA 4ASUA 1JPVA 2FPIB 1EEXB 3UC9A 3UENA 4B87A 5AM0A 2OOSA 5HMLA 2Z4SA 2Q2WA 2VDLB 2C0QA 3H9UA 4MW9A 3R6GA 5SZIA 2GZSA 1XU7A 4PAGA 2WTNA 1TT5B 5C1PA 2WB4A 5KINB 1V1MA 5AOVA 2B5WA 4CQLA 3TNDA 5AKGA 4P93A 1YB2A 4C6TB 4MS3B 1JHQA 4UM9D 4BNJA 1S6YA 3I5AA 4ZOLA 1VG1A 1PW5A 4H7DA 3VO2A 4Z1OA 2ZUTA 4GO1A 2EFCB 2BI4A 2W6PA 2WU8A 5EE3A 4EJFA 1L3BA 3JQPA 1M0SA 2ZDQA 4MUFA 2WA2A 4TLEA 3TIIA 1M1XB 1ES9A 3HA2A 3KR0A 2JVIA 4L9SA 1UMBA 1VJCA 4PIPA 3A1DA 5H1YA 2Q41A 2Z8ZA 4HZUA 1DI0A 3AKZA 3KQVA 3PKZA 5ULLA 1TIBA 4UE2A 5KEIA 1UM9B 3DM5A 5CA0F 4LYEA 4I5DA 2IXTA 1NMXA 2JANA 4M1MA 3WADA 4URWR 3RS8A 2IZ5A 2C58A 2PT6A 3ROMA 1Z4NA 4PYOA 4NDAA 1B14A 1H0SA 4AZ3A 2VQ3A 3A6ZA 1JGTA 2I4IA 4P6VF 1JBQA 1JPNA 3U3DA 3IHTA 2RGUA 2JVKA 4J16A 4LJ8A 1WXHA 4LYJA 1FDOA 3U0BA 3ZPXA 4MAAA 5IAAA 1EUQA 1CJCA 3CR8A 1YZKA 4H27A 3DXXA 4H35A 4AZVA 1OH5A 4CF5A 2H8KA 1VL0A 4FP9A 5EEGA 2G9NA 3V55A 3MCWA 3GHHA 3T0GA 3ZHOA 1VI2A 4F91B 3HACA 1LD3A 1Z88A 3D7RA 3HPQA 3RVOA 3F47A 4NV3A 1Q17A 4ZQCB 4CDMA 3CH6A 4K6MA 4ID9A 3FMIA 5LUBA 4RTLA 4EQZA 3AOEA 2R4UA 1NF9A 4Q9JA 4GI2A 5CA0B 3EOZA 4X44A 3OOHA 2DAPA 3W78A 4FBGA 3CRW1 4A2PA 1RMTA 3LPLA 3FIJA 3M2TA 3PEFA 4OHWA 4EGCB 2E4AA 3A6FA 3ETEA 1C3EA 4E46A 3IKJA 1MN6A 3HB0A 4HB3A 3RE1A 1SURA 4A6EA 3LCCA 1H5QA 3GFBA 1D03A 1COWD 5DNWA 5JR3A 5ENZA 1I0IA 2IWHA 3EXHB 2VA8A 1XLUA 2GN4A 1KH1A 3AF4A 3GGPA 2MCFA 3NBKA 3W7AA 4C89A 1DJLA 1SK8A 4W5TA 2X77A 2YHAA 2PRKA 2G0TA 3VZDA 2CFIA 4BEWA 4MKGA 5EWMA 1N5MA 3HEMA 4XVUA 1M0WA 3WC4A 1L0BA 1L4FA 1T2FA 4JLBA 5HE8A 4ZPXA 3K1AA 4OXIA 4CLEA 5IAJA 5LVAA 4LCBA 5ADHA 4LBWA 1PDOA 4EHAA 5JATA 4D3FA 4OX9B 4MCIA 1FU7A 5TQ2A 1CUIA 2R44A 3G88A 1NUSA 4UC0A 1EPUA 1KDPA 1Y1TA 2NTJA 2QAJA 4HAYA 1GOTA 2RGNA 4ESVA 1BROA 4NL4H 3A6KA 4FUTA 4DRYA 1QHNA 3WP1B 1UADA 5C51B 1TJ4A 3RW9A 5BWBA 3H65A 4BNDB 1LS6A 2DWPA 2RK4A 3BXOA 3CSDA 4FZVA 1IBRA 3ZS9A 5B6IA 2O3SA 4IMIB 5L53A 1DQSA 3V5NA 2CNLA 1RLTA 2J6IA 3GH1A 3OZEA 1XVUA 4WASA 1KQOA 4TUYB 5GTDA 2GLUA 3DYIA 4Y2QA 1F4VA 3GLFB 1S7GA 4RZUA 2RGEA 3N58A 5DCUA 1L5FA 4C0XA 3E3OA 5ADVA 2R6ZA 3STVA 3FKQA 4PE5B 1E1RA 3RIXA 1FDIA 1A04A 2HIMA 4IXMA 2XRFA 4M37A 4PCVA 4A82A 5EJ5A 3G6WA 1GAXA 3U7IA 4NZ9A 4MLCA 4IJ5A 4BQRA 3GQBB 4HFNA 3M9XA 1M1UA 4DRXA 2PPVA 2Q4BA 3PC6A 3E70C 3K0AA 3C98A 1W0CA 3HADA 5C8YA 1EIZA 5BOVA 4Z99A 4RTKA 4J1QA 2RBKA 1B0UA 1SUSA 3OFSA 3WK6A 2WJYA 3L5KA 5EFOA 2VCHA 4YXWD 5JY6A 2F43A 1AZTA 2ZI6A 5F3WB 3QSGA 2ZIXB 5ECDA 1YDFA 4GPTA 2WYIA 4EJ0A 2D7DA 1N92A 4R5HA 2XMBA 1U0LA 4TL8A 5DZSA 1JEJA 4J7AA 3T41A 2YX1A 4UHJA 4O3MA 3IPXA 3A2NA 3L0BA 4NEGA 1MT3A 1I4OA 3EEQA 2X6TA 2F8MA 4Q12A 4HNUA 5KYTA 3R9WA 2X76A 4OM7A 3VJMA 1G8PA 4CKBB 1DIGA 3OEWA 3Q1KA 4RZQA 3ESYA 3GLHA 4DDUA 1ISIA 1LNSA 3LO8A 2VAMA 5IHPA 1DWQA 4B8YA 2F3UA 3S68A 5KYXB 2BYTA 1JTVA 1QQAA 2IPOA 5CVJA 2F4VB 4ENVA 3EZYA 1Z4MA 2IOFA 1JX6A 4MNTA 1YQDA 5ERXA 3BHMA 2XQJA 1ZONA 2JGEA 1N9GA 3OHSX 4Q21A 4B8WA 4XTCS 3BGWA 3PR3A 4NBUA 5HK8A 5ITWA 4XWKA 4TL7A 1V1RB 3BFXA 1BS1A 3JQCA 2V7QA 1TMOA 2NTNA 4YN3A 3ZKWA 4ZYWA 4J07A 4DWOA 1WP4A 2QVYX 3BWXA 2MR6A 3Q15C 1I7DA 1XMIA 4HNHA 3OX4A 1QP0A 3VDXA 1Y7IA 3CUSA 4FZJA 2EX1A 1GPMA 4M0LA 1K0UA 5EE0A 3W5UA 2X2FA 4KNWA 4KLCA 3L5OA 5D2CA 2B3TA 4JMLA 5CA1F 3T4EA 3N8IA 5EY5B 3BREA 2FMKA 5FL3A 2CJWB 4AJJA 4DA7A 1N3BA 2ZQ5A 2IRWA 1T6XA 1ZIXA 3P0RA 1ZNQO 2JEOA 3G5AA 4CEIA 2Q3BA 3C6ZA 3S99A 1X39A 2QRHA 2Z58A 3I09A 4IZHA 1OX4A 2R65A 3JQAD 3PRKE 1RC1A 2W6QA 4KMRA 3KWJA 4LZPA 2HUPA 1ZK1A 3LNTA 4H4DA 4HQNA 4NFHA 1E59A 4ZO9A 2DPGA 3OO1A 4BC0A 1OHHA 1BN6A 3MTJA 1ECJA 2R48A 3PICA 3C43A 1X8JA 3FDJA 3UJPA 2JLWA 4ND8A 4PTZA 1L1QA 2AFRA 2DF8A 2C4VA 1T8TA 4J7CA 2FWJA 3TZ6A 1XPUA 1T5OA 5CA1B 1U3GA 3ND5A 4JC4A 4ZD6A 4QVGA 3BVPA 4KWCA 4D4IA 4G5QA 1TVMA 2WF5A 1SG0A 3D02A 1E2MA 1TEHA 2HMYB 3NYQA 2JKVA 4EELA 1KVUA 2ZUCA 1SA0B 4X3CA 3LUKA 1QO0D 3OX3A 3ABIA 1TW3A 3HDVA 3DDNA 1V16B 3DL7A 2BLLA 1OFGA 4CYMA 2I7VA 4RNDB 1MHTA 1LDYA 5HJ5A 2KWIA 2X14A 3OLCX 1ULAA 3FLBA 3GVCA 2A4KA 5SZKB 3W8RA 1RXCA 1CP3A 3F4LA 2FR8C 1E3DA 4BO1A 1P7PA 1I33A 1VC2A 1IZ8A 4EQ6B 3BIFA 1FLNA 1R0LA 2F1HA 4HXGA 4MMZB 3HFRA 2CNNA 2G4VA 2I66A 3R4CA 5AUQA 4G5HA 3KVVA 3EGXB 3LJKA 3DJFA 2D0PB 1SCJA 5TMPA 3QE3A 4MIKA 4NG5A 3BB3A 2NQTA 3CMMA 5E9QA 4H1TA 2I03A 4AWBA 2ESRA 2ONZA 5DWVA 1R9NA 2GXUA 1C8LA 1P2VA 1GUBA 1UPCA 2DUWA 3N8NA 4BNKA 4NPHA 3F6YA 1PSZA 3AZOA 1YVUA 4JLNA 3RVQA 5KNDA 2O20A 1ZOIA 1Y81A 2Q5LA 1YJQA 1TMYA 2P9BA 3C74A 3VC3A 1N2BA 3O2JA 2P2LA 3ZIAA 4FB4A 4LMAA 4NCAA 1RQ2A 1CY6A 2EV9A 3V2UA 5DHAA 4JYBA 1O1YA 1V2HE 1ZUNA 1J0XO 1FVOA 2QKYA 4GOJA 1SUWA 1TJ5A 3MJCA 1XZFA 2QU7A 5ITVA 2AQKA 4BEVA 4L5AA 3RYFB 2DZDA 2QTFA 3NETA 4N18A 4RORA 3SJCA 2FN8A 3KKMA 4D9HA 4RW0A 3W3AH 1PSDA 4JI6B 4O4LA 3WO1A 4L6IA 1MCZA 4EFMA 1XEFA 3OF2A 4B6GA 4FN4A 3HBLA 1ISHA 1I3NA 2I4OA 1HFEL 3DMTA 3FUXA 1U4OA 3IV7A 3PL5A 4GP6A 2C3MA 2VDWB 5JG7A 3QMMA 4NJMA 3TKYA 1ZVQA 1AKNA 2Q5IA 3A70A 1DBWA 1PNTA 4LIPD 3AR6A 1FYVA 3PQ3A 4KQWA 4L22A 1G9XA 4QUDA 5LBUA 4Q47A 1DHTA 4MW7A 5B4UA 5ITZA 1TLTA 2JJQA 4GT1A 3ZXSA 2BWJA 3IE0A 2KS6A 3H9EO 3F6RA 1Z0KA 5FWYB 4CIWA 3EW7A 1VCHA 1KGDA 4QYSA 4FVTA 3U4AA 3PC3A 3A7DA 1GR1A 4GPD1 4OSEA 1N33B 2VFAA 4KLZA 5A4DA 4IEFB 1SMKA 3K8YA 4KIWA 3WGGA 5HIJA 3MAGA 4UHCA 4WH0A 3IDSA 3SS8A 3JD1A 3U7QA 6LDHA 4FLFA 2X3YA 1RKQA 4K1LA 2CSUA 4J2OA 2QLJA 5J58A 1DIAA 3HCOA 2PE5A 5A9SA 1QYXA 3IUQA 3VFDA 4B48A 4CKCA 2Q21A 1SJ9A 1Y5MA 1O6BA 221PA 1L5OA 4RBNA 5DP1A 2GHQA 2J3KA 3IR7A 3DTVA 3LI2A 3AVPA 4PYKA 2C31A 1VG9B 2DH5A 1FMTA 1YRAA 5TPWA 3UICA 3DLTA 4Y0VA 1DKMA 4US1R 5FTLA 1XZQA 1MPXA 1P4AA 1A82A 1UBHS 5DHQA 3DAFA 3SSAA 1BXRB 4MS4B 3I28A 4P3XA 4UAGA 1UXJA 4KAFA 1IXRC 1YC5A 1KZHA 4LRTB 1M66A 2PANA 1NBME 4MRRA 4YH1A 3OC0A 1ZMXA 2BEUA 2VUIB 2YFQA 2Z6VA 1XTVA 2JD0A 2JI6A 1E63A 2G09A 1AF4A 2YBEA 3FYHA 4GBMA 4WXYB 5PNTA 1G2IA 3PR1A 3L4SO 4JT8A 2BISA 2NVWA 4UUAA 3O31A 1SOAA 2F3TA 1Y8QB 1MB4A 1G8HA 4NQRA 5I7VA 2AC4A 2AMJA 3JQAA 1QBKC 4EVRA 3N9IA 4HWTA 1JNXX 3ORFA 4J0EA 5AKXA 3L0ZA 1Z56C 3ZN2A 121PA 4NK4A 4FHGA 3OIGA 4LJKA 3IOMA 2EKDA 2P40A 4KODA 4KPUB 4DCGA 1LBIA 2PSJA 2AWOA 3WSWA 1NNEA 4KO2S 1QU3A 1IZ9A 4HFJA 5C7LO 1MB2A 2O2SA 2YVAA 3JALB 5DGXA 1Q1BA 2BE7A 3UB2A 3L2OB 2IBTA 2XF8A 3COZA 2GPNA 5DI3B 4BPRA 1QLWA 1GITA 3CNOA 2I91A 3NKLA 5JBQA 3N75A 4O2AF 1S4MA 4X1KA 1K4MA 2JIRA 3FMGA 2O9JA 4MW2A 4TXJA 3WR5A 5LZ9A 3KG2A 1UPUA 1JFFB 3IXMA 2BOVA 5KC9A 4B44A 1CVRA 4HVAA 1RRCA 1C7JA 2WHYA 1EK2A 1KU0A 3O8RA 3RC2A 3M5WA 2TSYB 4B46A 1GNTA 2QZJA 3C6QA 4ZQIA 5AKZA 1ZHFA 3FYUC 5T4HA 3UGQA 1R6DA 4EB6A 1B2RA 3WLSA 1AO0A 3TLGB 1H4VB 3QVWA 1C4WA 4TKUB 3UH1A 2WJ4A 5DNVA 3QGMA 5CCBA 5IS2A 2C4KA 1BDJA 3BRWD 4MRMA 4QOHA 2GMWA 4XYMA 3FGOA 2VLBA 1GCGA 1OLSB 2BRUA 2RGWA 3BERA 4R1QA 2ZJYA 1CRQA 2CKMA 3KOYA 3GI1A 2EW8A 3O0DA 4O2AB 3UMFA 3N3AC 4ZO4A 1LBSA 2PCLA 4XCXA 5F2KA 3T5MA 5FA8A 2JAOA 2OGTA 5A1TA 1Y1LA 2E5WA 1G21B 1Y6GA 1TCVA 2F9LA 1R5NA 2YV4A 4ATNA 3DZHA 4CTOA 5I51A 4GI3A 1H3NA 1VSQA 1LRLA 1DJNA 4KEAA 3TZQA 4NJEA 1E7YA 3IJRA 4B85A 5L8VA 2XYVA 3ILSA 3QU4A 1NX6A 2J6CA 2FAXA 1AIPA 1UBLS 3JRXA 1OTYA 4R2JA 4AJKA 2Q1TA 3R09A 3FPCA 3ESXA 1BGVA 2Y0EA 2G28A 4G9EA 4LYHA 3DOEA 2ODWA 4MDYA 1OBVA 3GLGB 1WKCA 3DNPA 4KR6A 1GNPA 1RHQA 3SR4A 2DHCA 2O8NA 2W2XA 2GEVA 4U39A 3PQ6A 3QOYA 1V5IA 1E6LA 4RACA 3GLUA 5ESRA 3IIEA 3TTYA 3VH1A 1TZKA 1WNFA 3SOPA 3ZY6A 3AF3A 2CLSA 4G5OA 1DL5A 4EJMA 4PPNA 1CYDA 1PYOA 3B85A 1U5BA 3O90A 4DW8A 1UP4A 3C7AA 3EVGA 1ZP6A 2OT3B 3DP9A 4M9ZA 4P3KA 3A3KA 4RYLA 3EXFA 4HFMA 3FF4A 4XDHA 5EJGA 3RREA 1QKIA 3TS1A 4ZHQF 4B3MB 1M6VB 2H9YA 2MINB 5JSFA 4KR2A 2C77A 1JLLA 1KYWA 3BTSA 4V38A 3OE5A 1YRQA 2VJNA 3HGTA 1M2OA 3E18A 1GTRA 1QJCA 4YGYA 5ALUA 1NPDA 2RGAA 6ABPA 5G0TA 4G4SP 2BP7B 1ZSVA 3L46A 2HXSA 5AKYA 3I3OA 3TWOA 5A5EA 2GD1O 4YRLA 2NYRA 1NW3A 1SXJB 1W4ZA 2YYAA 3JRWA 1F6WA 1NATA 3SGLA 2W6JD 1OJ7A 3JWGA 4W5JA 4F6CA 1H6BA 1DEXA 1H85A 4NS4A 3PEWA 5C7OO 3F4BA 1GGMA 4A91A 1PX2A 2IE0A 4EFKA 4N48A 1SBCA 1XJWA 2J7PD 3PGA1 2BFFB 2WEKA 5BW5A 2JFZA 5CU7A 3C45A 5EP4A 3CIFA 3NHZA 3HI4A 4J1SA 5IUJC 5KSYA 3D6HA 1EU1A 5KMGB 3QWBA 1NOKA 3LT1A 3IP5A 4DG5A 2ZETA 3KLOA 4RTQA 3LKZA 2Q0HA 1KAOA 4JEHA 4Q05A 1YFLA 4GG1A 1Q0TA 2OENG 4EG5A 1PJAA 1JSXA 2EGUA 3C1OA 4QPDA 4KAJA 3EVTA 4D3YA 3LG2A 3ETCA 3K9FC 4AIIA 2P5TB 3UOGA 1WZEA 1JG7A 1ZINA 4NH4A 3RASA 2YZNA 1GN9A 3VR5H 4CT5A 1E1NA 4RF2A 3ZWAA 3N0TA 1TK2A 3ZNQA 3T7JA 4KTVE 1Z0IA 5AD1A 3O8CA 2IYPA 3BCRA 3AHGA 4BO0A 1AXEA 2PD4A 2PNJA 1ZRNA 1BA2A 2ZTVA 1XLTA 1QGUA 2YJ6A 4RXMA 3NJRA 2AZDA 3AFOA 5DP2A 2A1UA 4K9QA 1I5OA 1WUYA 3ZDRA 2Q1XA 3CVXA 2ZUWA 4Y1GA 1II0A 3T7RA 1PJCA 2PL3A 4ZOLF 4M1WA 1M6EX 3IL2A 1AA6A 4O4IA 4R05A 4PHCA 4YONB 5LUAA 4TRNA 3WBFA 2M2IA 4Z7JA 4F4CA 1YB7A 3EVFA 3HJBA 1DELA 1RSZA 3AGPA 4ZT5A 4KWEA 2H7XA 2JFBA 4KSYA 3DNMA 5A6VA 2IHUA 1X1CA 2O4CA 4O08A 5FO0A 1IN8A 3V7YA 4ALJA 2IGTA 5JCJD 4BNLA 3WNQA 1Q14A 1UK8A 2Q49A 3B6EA 2CXRA 2XLBA 2IHZA 1X9HA 5CURA 1E9BA 1KRHA 1AHIA 1DARA 2IKSA 3A2LA 1YZFA 2XIQA 1BHSA 2CLOB 3PFFA 1E96A 4RZSA 4UNNA 5EXTA 5IFLA 4ND6A 4DSTA 5AW5A 4WZAE 3HYTA 1XCGB 3U4MA 1NMQA 1RPNA 2KMLA 1P1IA 1V1MB 4CQLB 2QPLA 3GA0A 3OQIA 1OGYA 3VC1A 3WLJA 1U8XX 1XO1A 2DQ4A 2EQAA 4ZEVA 4XZ3A 5I8PA 1GQQA 1N5RA 2VL7A 4RM2A 1U90A 1J2EA 1Q0UA 3NW9A 1VLJA 2BF4A 3B1ZA 5DX8A 4IDEA 1AN0A 1RYFA 2WG1A 2ZREA 1UMBB 4Q1EA 4HZUB 1AKMA 2EP5A 2H2WA 1E32A 4KQ6A 1HLFA 1KYQA 1EGVB 1WOYA 4IX9A 5BV7A 4IJMA 1O94C 4RA6A 3H5AA 3HFSA 4JQCA 3A4YA 2O8CA 3IS3A 3OZFA 4N49A 4ZAZA 4AZ3B 3TKLA 3NVDA 3WK5A 1TC2A 2CHFA 2ZI5A 3CTMA 3WKAA 1CZKA 5A2QA 4MDEA 2ZITA 4RANA 4WK4B 1BGWA 2Y4NA 5CT8A 5JJ5A 2I34A 3JZFA 4B79A 2X9VA 4ESEA 4UTNA 4P8RA 4KQFA 1O58A 4RVFA 2QRUA 2HZ7A 3A6HA 4RZHA 4Q82A 2GH1A 5IANA 2WUVA 1IZ0A 2R6JA 3ZWCA 1H4TA 3U3RA 5HX7A 1N7IA 1E7RA 3O2NA 3ZY4A 1MNQA 1QC5A 4X7BA 1JLRA 2R8RA 1GSOA 1QB8A 2IV2X 3RQIA 1E3SA 2Q2OA 3A9WA 1OILA 3F3MA 3AWDA 3TD9A 4DJJA 2E48A 3EGDA 4HRVA 2NSYA 3G17A 3BQ9A 1FUIA 3UN1A 2NM0A 5TPZD 4B6OA 5K3AA 2Q3DA 4ICIA 2FSPA 2QVCA 4CT4B 2XDAA 3MWEA 3OX2A 1YFZA 1Q0HA 1U28A 1UBGA 1OKKD 2QD5A 4ZGWA 1RYHA 1FQJA 3ANSA 1P5FA 2I80A 3B9PA 3ELDA 4F92B 1U94A 3EC1A 3ORYA 2W4QA 3LUBA 3LCMA 4JAVC 4OB8A 3DA8A 3UAVA 2CNBA 3KIPA 2XZDA 4R6XA 2QX4A 4JYCA 5EWMB 2VH1A 4JI5B 1F2TA 4DYVA 3QLVA 3EFHA 3R7DA 3K1AB 1R5OA 3ZZ0A 3MOSA 1VFPA 4I6GA 1MX3A 5F76A 4X62B 1A76A 1Z34A 1DADA 1E1MA 1ODJA 1Y4UA 5IDYA 1RWVA 1V4VA 2F64A 3B6KA 3I9KA 4HY3A 2OZPA 5L7YA 3UMRA 4D9KA 3S1SA 2W6JA 2PUBA 1QGDA 2DX7A 2PX5A 3TW4A 4TOIA 5C8YF 1OTHA 1HMPA 2A7QA 4DXHA 4MVJF 3LAWA 2GCEA 1FDTA 1GKKA 1RQNA 2R7MA 4TMYA 1DRJA 3WS7A 1T4BA 4EHHA 4L57A 4YCDA 1EJBA 4XLLA 1DX4A 2WWXA 2BM8A 2FPXA 3CNLA 2Q9UA 1FPMA 4KE9A 3BEDA 3MMPA 1Y1QA 1DDIA 1DXQA 3PC8C 1I2AA 4I1YA 4RQAA 3AF6A 2O2JA 1PT5A 3HUUA 3FWZA 4DIMA 1XG5A 3KAJA 4AP9A 2P69A 1EA7A 2ZXUA 3G8DA 3R6LA 4BNHA 4D5EA 4YRNA 3ONEA 2IYFA 2Q3FA 3EGCA 1IN5A 4DRXB 2CDCA 5HHTA 3EWAA 3K0AB 2Q7DA 3WYAA 3S8EA 1TI7A 2R00C 5J5AA 5JMTA 4D96A 4DMMA 3WLHA 1V9LA 2QAGC 3LUCA 4BMXA 2DJIA 4RY0A 1ONNA 4N47A 1MO6A 5C4IA 3D81A 1XCLA 2F43B 3KFXA 5JIBA 2XB6A 4XDYA 1JEOA 3IERA 1H05A 4FZRA 3WA6A 1HDGO 4MGYR 4IOMA 4O2BF 5F7XA 2FZWA 2AG8A 2YN4A 1MD9A 4NIMA 5ALKA 2NU9A 1P6UA 1SKUA 3SKYA 2XKJE 1N3LA 3ETLA 2LIPA 2X22A 2RFLA 3GLHB 4I3FA 1G20A 1MTOA 1ZM9A 4HVTA 1U8YA 2F3QA 4D4GA 1QIMA 3V4RA 3SHFA 2WJIA 4CMAA 5B30A 4XEHA 2ZWAA 3Q1LA 1N6HA 3BD6A 3UHOA 4RGBA 1JL3A 3UTDA 3ZK8A 4BKOA 1YAJA 2R9VA 3WDSA 4AUNA 2BMAA 1KTIA 4OJYA 2WTMA 2VTVA 3SYKA 4PQFA 1DC4A 1N9GB 3A36A 2PUWA 1SVLA 4UEOA 3AONB 3VSBA 4YYEA 4HNQA 4Z7QB 3A6GA 2PZFA 4YRPA 3O4GA 2B35A 1F0NA 2MSCB 1B1CA 3ZCQA 4RETA 3ZKWB 1T2EA 3PEYA 1DNPA 2ZDGA 4KK3A 4M1KA 1D2CA 1YR8A 2D1TA 3GGDA 2W71A 1U2QA 1T0HB 1XJ0A 4BVEA 2JHFA 1G8SA 2PCJA 2VDJA 2ZSAA 3GAZA 3PA8A 4RS4A 3RKRA 1OIXA 4AJHA 4ZYTA 2O1EA 1X42A 2WC1A 2O0LA 2XQGA 4M8LA 4BKRA 4M8KA 4ZREA 3SEQA 1E6UA 1TU4A 1I4EB 5KJFA 4RAQA 4D8YA 3AY3A 1C3OA 1QHGA 1MJNA 2AJTA 2WUFA 2VIIA 5FQOA 4KN9S 5LNK6 4JUAA 1UXIA 3VGPA 1Z7YA 2VYFA 2NYUA 3PQ2A 3WG9A 1UDWA 1VHTA 1K3UB 5E3IA 1XZJA 1DAEA 1WSWA 2GJ9A 4K2HA 5BUQA 1EK5A 2BZ0A 2G5CA 3KTFA 4ARVA 2OCGA 5CMLA 3S2SA 3WY9A 4CEIB 4GYYA 2IZOA 2ZBUA 1MA3A 1OXKB 3JW8A 3KPUA 3HCWA 3T7KA 1OX4B 3KPJA 4AN4A 4EL5A 4UVEA 5BMOA 3GOQA 3ZH2A 1A9TA 3HWWA 1JDJA 1KZGB 5JW6A 1FUEA 4CMKA 1ZCFA 1QNFA 1TM2A 1FDUA 2DFDA 2FW0A 3CH5A 3F46A 3H2GA 3MHPA 2I8CA 4FYHA 5ENDA 4RTMA 4RIGA 5AM4A 3OBBA 5AFSA 5HILA 1U8ZA 1T1SA 1VIMA 3RLIA 2F1JA 4ND8B 1JDBB 5ECWA 2XZLA 2W43A 4EJSC 1AZLA 4Y9DA 1HNNA 3K31A 4OHPA 4FR2A 3T7DA 1G19A 4F4IA 5IJAA 4YHHB 3EUFA 1H6DA 2X5KO 1UH5A 1QYVA 1U9CA 3HABA 2Q7OE 4QWWA 1M2NA 1ZN9A 2FJUA 2Z30A 3BZWA 3LQ2A 1I6KA 2GK3A 4JDUA 3IDAA 1L5KA 3NT5A 1ZFNA 3EVCA 1FS4A 1J0EA 3HDQA 2GZDA 3QHPA 4R0MA 3EF3A 5COBA 3QF7A 4QGBA 1RTKA 4IVQA 5FWNA 2O7QA 4BLOA 2ZE5A 1D07A 1ESDA 4MV8A 3DE0X 2O1WA 3TK1A 2PLNA 3P9KA 3C97A 4FOSA 2Y66A 3CE6A 2ZZMA 3FYTA 2AFIE 1COZA 1RT9A 2HMUA 3ET4A 3HHPA 3HJHA 4G3XA 2PL9A 2C7QA 1X7XA 2P4QA 4OQPA 4PHFA 1LCIA 4BB0A 1PZGA 1BX0A 1UKEA 2BI8A 3KCQA 4M4SA 821PA 1CFZA 3QEMA 2ZW9A 5TVKA 2F9FA 4UHDA 1RCUA 4TVSA 1ZDMA 5EUCA 2GBLC 3P2IA 2HBQA 2Q1WA 4R68A 4B3SB 1DEKA 4OREX 3LF1A 1PJLA 4TLDA 3DCJA 2YOFA 3NORA 1JEQB 2H08A 4R8MA 2JFNA 2AR9A 4NWIA 3S5UA 1PFWA 2QIPA 4O4LF 2JIDA 3I1FA 1XD2A 1OFUX 1LLDA 1SBQA 1L3CA 1U1DA 2D3TA 2VHCA 4URHA 2JK0A 3LXMA 2IP4A 5DM60 2V59A 4L5JA 4OP3A 1XCPA 3LYUA 4CCWA 2HWUA 2NO1A 2PZAA 2RAUA 4CG0A 4DN6A 1YS1X 3AETA 4Q1FA 4Z8XA 2VSOA 2FZ4A 4DMFA 1ZS9A 4FFNA 4MW4A 2AE2A 3PVSA 3HU2A 3OAAA 4RJLA 4QXAA 3OBIA 1ZEJA 2X9LA 4IXNA 1ZUNB 1CLUA 2ZJ7A 4YP5A 2N75A 4LTDA 4IWNA 3G2PA 1B74A 4P86A 2XUHA 3LY9A 1EUCA 4OA8A 2I1LA 2X1LA 4KIFA 4TYQA 1B4DA 1M7HA 2E4XA 1D1PA 4WKNA 2CLDX 2VAVA 4UMDA 2QPAA 5ALQA 1N5KA 3PWTA 1YZHA 1IOWA 4KLNA 4O4LB 1WTAA 1U6IA 3EDQA 2FFHA 3I73A 3UK2A 5B3LA 4DLUA 5EIOA 5EZYF 3AHCA 3L92A 3X1KA 3FCEA 3X1YA 4H3SA 2GCOA 1CERA 2HV9A 4NJMB 3PKJA 1JWAB 3VHXA 3T54A 1TGYA 1UJ4A 3JQ6A 3T7TA 3OCWA 3F8TA 1I1OA 1H1LA 2XXJA 1IUOA 1L7NA 2WZBA 1WM1A 5TC4A 2CUZA 4EPWA 5A4KA 1PG2A 1TTHA 4LXHA 4LXTA 4YLEA 1C9DB 3P8ZA 4C43A 4D8VA 5JD4A 4UPEA 5ITZB 2PL5A 4QRIA 3MBOA 5AQEA 1B8VA 1N25A 3H04A 3ODPA 3PRYA 3QU7A 3WYCA 2GK4A 1FXSA 1LUAA 2VNIA 4FOTA 4JZYA 1XCOA 1ZAYA 4X45A 4Y6QA 4OQMA 1NKVA 4RKWA 3TRDA 2PVCA 3VR2D 3DO8A 1W75A 5FL7D 2BVNA 2OVBA 4LKOA 1A8HA 4A26A 2HHCA 4IIDA 2W70A 2CFSA 3KL4A 2NTEA 4D3DA 4DA9A 1H93A 3U7FB 3B1JA 4DV0B 1N4AA 3GRPA 4XXHA 1V7PC 5EQTA 1JG1A 1G7CA 1F06A 1XQYA 1J07A 2O3JA 3R5KA 4Y2VA 5A9SB 3LE8A 1KVRA 3GZNA 1JT2A 1KMQA 2QRVA 4FNOA 1VE1A 4KX5A 4PTYA 1VJ0A 3WV5A 5AW3A 3SNKA 4AF7A 3DTVB 1QIDA 1LTQA 1IB0A 3EZNA 1GYPA 5TPWB 1T5LA 1WCWA 5LSAA 1T3ZA 2X7XA 5T8KA 4MWCA 4H1UA 5EXEA 1DQRA 5FOQA 1L5ZA 4F1KA 1MG5A 1KXZA 3PNMA 3ZGLA 4ZJZA 2DHDA 1JJ7A 4JBWA 4ZOCA 3EDCA 2BEUB 1NXTA 2IU3A 1D2GA 1QORA 3FOBA 1FNMA 3HXQA 2MR5A 1JXAA 1GPAA 4ZDWA 5THKA 2ZVDA 3CF6R 1VSUA 2P2SA 4HDSA 5DI9A 2O57A 3U9TA 1EZ4A 2EZUA 1I6WA 3R0ZA 4HAIA 4S12A 2JFHA 4DMLA 4C76A 3FB1A 3JQAB 3OOSA 2CFTA 2NZYA 3UUFA 4BE4A 4LQLA 1HETA 1A7UA 2Q62A 1HLDA 2I3DA 3HZZA 1AGPA 1ODSA 1XT6A 3AKCA 3IESA 4GGMX 1MJGA 2VWQA 4ZTUB 2IUSA 5JAMA 2GGSA 4GSYA 4LRSB 3AC0A 1KOLA 5H4GA 5MHTA 1L9XA 4JUCA 4B6RA 1A7AA 4TN1A 1KP2A 2I6TA 3DHVA 2RKOA 4FHFA 1U0NA 3M6MD 4GLFA 2YRFA 2E4WA 3KKZA 3RVMA 4AX4A 2HT6A 2VJQA 1DEAA 4ZAVA 4G41A 4UFNA 3TTTA 2EZ4A 4J90A 3VR3D 2VPXA 5E38A 2JJ2A 3UG6A 2WQ6A 3K6KA 4AO8A 4X1KB 4EUEA 2WJ3A 4ZDKA 2E55A 2VTKA 3CRVA 3O2QB 4JJ4A 2WFMA 2G36A 3R0VA 1JIIA 1IDOA 2P3SA 1EX9A 1EHCA 2GBPA 4OIFA 2DEUA 2DQSA 2R60A 1ESCA 5HFAA 4EB6B 5CHEA 2IUTA 4LMRA 1Z6YA 2EF1A 4KP7A 4TTVA 3RGGA 2GXSA 3OZRA 4JJZA 3ILHA 2K2WA 3FNQA 5ICGA 1MP0A 2JCSA 2Q2QA 2XB4A 2YZGA 3IX7A 1UZNA 4HUQA 4K6CA 1NLYA 4LYAA 4OQFA 5DE3A 3NS7A 3WFIA 5A4JA 4JLJA 5DGCA 4GLOA 1VXRA 4IJ6A 5KWVA 3D7LA 4IDHA 4MRMB 4JOQA 2J9ZB 1JIXA 4P22A 1JVNA 1N2CA 4DLVA 1UK6A 2ODNA 3EXEA 3F3YA 3N2IA 4QGHA 1LX7A 5AVJA 5TRTA 2UZ0A 4JELA 1JWLA 4FW8A 1QG4A 1X1RA 1DU4A 1Z4IA 3HCBA 3PJEA 5BMVF 1IVSA 4LOKA 1ML4A 4BIMA 3GNSA 3I5MA 3QWAA 3TTWA 1QIGA 2ENUA 1AK1A 1I01A 2H3EA 4I3GA 2BUCA 1RBQA 4CLXA 4MS1B 2XNDD 2H18A 2HSZA 4IQ0A 5LLDA 2G5TA 3UMSA 3B9RA 4GIBA 1OROA 5G0VA 2A67A 3WHIA 3RHSA 4LZAA 3K09C 4PC7A 4CF7A 3TIFA 3ED1A 4GVXA 2NZWA 4I2VA 1GTJ1 1VYVA 1M73E 2P9TA 5K0TA 1SCBA 2ADOA 3COWA 4M3NA 2EZTA 4FT4A 1MUUA 4RD0A 1QF6A 1LBHA 4P0TA 1BSVA 5FUYA 2QW0X 1B0AA 4M2LA 5CYFA 4YRKA 1MDBA 4IIJA 2B4QA 5EZQA 4ZN6A 5IPFA 3BK1A 1S8FA 1RLJA 2B4KA 2OHJA 4KQJA 1FP4A 2W90A 1B2LA 1TO6A 3NTUA 2C9YA 5B58T 4BX0A 5HJ7A 2ZIZA 3GRUA 3IUPA 2IWRA 5K3OA 1N8NA 4YMGA 5KU7A 1OAOC 1JIJA 2XHZA 3GP5A 4FJ1A 4MAFA 4U2DA 5B1SA 3D43A 3N07A 1U5BB 3NM5A 4TRRA 2PLFA 3E03A 5FBVB 3ZWDA 3EXFB 3GMDA 2NV2B 3DMGA 3GEIA 3H99A 3OE1A 4P80A 2QYTA 4WZBA 1QO9A 1JLLB 3E27A 4O4JA 4W99A 2DWCA 4HH3C 3KETA 1X0XA 1N2OA 1E2QA 1M2OB 3IAEA 1OYOA 4HDMA 2QN1A 3HYRA 4MWGA 4PGFA 4QFDA 1GTG1 4D81A 4LMBA 3T7AA 1PAUA 2H2IA 4MH0R 4N5DA 4M1EA 4WN3A 5IH7A 4TYYA 4JEMA 3MGGA 1T1EA 5LD2B 1MQSA 3GRAA 3NXKA 3LKVA 1XRQA 2HAEA 4IVRA 4EUFA 1HFJA 1X77A 3ER6A 1NHGA 5ALOA 1LPPA 2D7CA 2OBBA 1P8AA 4HAZA 5JDCA 4J3JA 4NCHA 3IOBA 5E6RA 3NAGA 2PN1A 2UZ1A 2OPBA 2J7KA 1SCQA 3LVQE 5E1BA 5FAKA 5L51A 4ZO6A 1R8QA 2OXFA 3GFQA 1NVAA 3O1HB 5CCDA 1DC6A 3TOSA 621PA 4MX8A 4QASA 3PTAA 4H1WA 1IMOA 4B4DA 4DM7A 4Z54A 1N9ZA 4Z3OA 1USIA 4HQ6A 4O4IF 4R9NA 1AQYA 1N9KA 4BVHA 2ZVPX 3AFHA 1IXSB 4Y2GA 1F3LA 2QI9C 5AXAA 1FBNA 1WV0A 1V43A 2QG4A 3BSYA 5D87A 3H18A 4DC0A 1G5RA 2VT6A 4ZRMA 2B8JA 3J7TA 3VDRA 3G02A 2G70A 1CUSA 3R5FA 4QOGA 5EP3A 5IBPA 4C2BA 2BFPA 4EW3A 3DW1X 3B53X 2DUUA 2MSEB 4KC0A 4LGMA 4ZK6A 1VMIA 2UVQA 2OZLA 1RZUA 2DU8A 1QGUB 2RI1A 3AHHA 5BRJA 2ZCUA 4WCFA 1ABBA 1LF0A 2A1UB 2AQHA 2JGDA 1PTJA 4CHGA 3EZ6A 1P73A 3L7NA 3NDRA 3WB2A 2R6GA 4B81A 4GGPA 3E23A 2AD5A 3KJXA 3SY8A 3D1LA 3WB9A 4DV1B 4J9UE 4O4IB 1L3IA 4JR2A 4JC0A 2QMOA 4J75A 3DF7A 2ZANA 1WZCA 4QICA 4BX3A 4G84A 4EG0A 4E30A 4FWBA 1G5IA 1RXWA 2WHPA 4ITVA 5AI6A 4TXMA 1PFUA 3QTLA 3ABZA 1FYDA 2YW9A 3VR3A 3W9BA 4PNPA 2D2EA 3ZVKA 5DTEA 1M67A 2QTCA 1V6AA 2C3UA 2P9EA 5FULA 4DE5A 2D1RA 1DJOA 5I01A 4Z4EA 5AT1A 3QQ5A 4MQ6A 7ABPA 1NXVA 1ZSNA 3P9SA 1WP9A 1GZHB 3ZXXA 1ZESA 3MMNA 1D5WA 4Z4CA 4RPLA 5TY0A 1KI4A 1XHEA 2WD7B 3OQIB 2XYGA 2IUEA 3QVGA 1NYQA 2FR0A 3H11A 3IEKA 3W5CA 1C9YA 3AL2A 3DE6X 3EMKA 3STHA 3SHQA 4LY0A 3LDHA 3FRHA 1L5HA 1C1HA 3E1KA 1KSGA 3SN6A 1F7UA 2QORA 4NCJA 4MK4A 3V1NA 3ZCUA 3BWBA 7MDHA 3WWZA 1KQ3A 2ETXA 2HPZA 3GLRA 3F4KA 3AF1A 2R6R1 3BGDA 5AJUA 3P45A 5FF9A 4GOLD 1GG9A 2IPNA 1QWOA 3R6TA 4W63A 4Z2YA 4EO7A 5ITSA 1ZH8A 3LLCA 4J0KA 1CHDA 2HO4A 3DLHA 2ASEA 1ZVMA 4RA6B 1OAKA 2IEZA 3GRYA 2BEJA 5EI5A 2O8CB 5EXSA 1J56A 3II6X 3J80A 2XJ9A 1CR6A 4JT9A 3ZDYB 3DOJA 2ZYAA 5JY1A 3UHAA 3O8NA 3RK0A 5I7OA 1KOJA 3FYCA 2Z4TA 5IJ0A 2BUBA 4O8ZA 1C8VB 4MUAA 2IYLD 1BFKA 4WSOA 2CY0A 2I33A 1WDMA 3GFPA 3MBKA 1CQWA 3F98A 3JQ8B 1MRZA 3IAFA 2E5LB 2K7FA 1QQBA 4QOEA 3SC3A 4M21A 2ZTUA 2XADA 4E1AA 2JATA 3A1VA 5JC1A 2VHJA 3BD7A 3M5CA 1JR3A 1X1TA 1OZAA 1WUHS 5KOJA 3L1UA 3S8YA 4IKPA 1QC5B 2OCPA 1PKXA 4OQLA 1OUMA 4MJXA 5DTIA 4PLPA 4YFVA 1CUCA 3ZV3A 3GPCA 5CNKA 4TMWA 3CZ9A 3RV3A 3KOZA 3EGDB 4M9SA 4A16A 1KO8A 1GCIA 2ZYRA 3D64A 3QNMA 4YCMA 4UPDA 3VPBA 4NE7A 5LDGA 4PNEA 1KH2A 1XMSA 2O7RA 3O6VA 1CEXA 1TVCA 1R0XA 4F6RA 2PSHA 1XUOA 4RHFA 4QOSA 3GDGA 8LDHA 4C3VA 2B34A 4HDAA 1KIMA 1U0HC 1UOPA 3P0EA 4JU9A 3V7WA 1XTQA 3G2LA 2WTUA 1JXOA 2GFHA 1YHZA 3DMYA 4P54A 4QECA 1XZMA 2I22A 1BWSA 1QB7A 5FI1B 5J3JA 1MB9A 3WTBA 1KC3A 3FSGD 3ES9A 4OYHA 5CVTA 3ANNA 3A05A 1F2TB 4QJBA 4UHEA 4S0XA 1ZCAA 3F7TA 2OQ2A 2FOLA 1JE0A 4JVOA 5AUPB 5IUNC 1E9SA 3Q6MA 4PLFA 4HGRA 1NJ1A 2SHKA 1CIJA 4ZJPA 4JYPA 1INLA 5BP7A 5KJ6A 4ER3A 3V8PA 4R2IA 1RRPA 1HORA 1LGYA 1FZTA 4AX8A 2BBOA 2PA0A 1CUEA 3JD4A 4YHBA 2QM8A 4GL4A 2H7VA 5EJMA 4BIIA 5AHOA 4YACA 3I72A 4L5YA 1ZMOA 2EIXA 2X0RA 2XE8A 2VEDA 3UAZA 1PQYA 3CPHA 5F2NA 5AIBA 3MQ4A 3H1FA 3S7ZA 2VAWA 1FTQA 1T1IA 1WD5A 2JZOA 3JQBC 2YXPX 4M0KA 1SPXA 5LP6C 3ZGNA 1N3IA 3BFKA 1U80A 2Q5HA 3BG5A 3L40A 3MJVA 4KV7A 4NPAA 4MICA 1WLYA 4YJGA 4GR4A 1D6SA 1ENYA 1JKXA 2QGFA 2P9ZA 1VZ2A 4FEEA 1GAWA 2EW1A 3RTBA 3E9MA 3RO7A 4YV7A 4H3HB 2RSLA 1M1ZA 2QSJA 4EABA 3W1EA 3DL4A 4MRSA 3EXG1 4EJ2A 1L5RA 4XWTA 3DOOA 2QQEA 5HG0A 5JCOC 3EARA 5CVEA 3C3JA 3NOQA 4MCAA 4TXNA 4W1QA 2HPVA 1ORIA 4OQ4A 4D02A 1J09A 1XEWX 3TQTA 2SKEA 2NU9B 1V45E 4JLPA 3STYA 3ZHZA 1JQJC 4AYXA 3LCVB 2PD6A 2FHSA 1DUSA 1H1TA 3IAAA 1GILA 3R44A 5F52A 1ZRSA 1XL0A 3I37X 3LM8A 1G20B 1IRXA 4RVUA 1AA9A 2X58A 1Z4KA 4NZNA 4BV8A 1UBSB 4IR7A 1C7RA 1PEDA 1W0KD 1PVDA 1M6WA 3CFYA 1IOLA 5CM2Z 2BDTA 2YMLA 5FEMA 1H9BA 1TA9A 2C61A 2QTVA 3GJ4A 2O7NA 1YXMA 3LLMA 4BP9A 1QQ6A 3IQHX 2GHTA 4F7WA 1GFWA 2GPWA 2YQ5A 3DVLA 3SF0A 3TYXA 4AZTA 5BOSA 5HUHA 5GVSA 1X13A 2ZJ2A 3LA6A 4UMVA 3REQA 3WRVA 1MF7A 3H8WA 4DR7B 1K2VN 1E9VA 2RH8A 4MWBA 4DUYB 2IEIA 3A27A 3R3HA 2HLHA 1VCIA 4A8JB 5DKFA 1D2EA 1VCNA 2YNMA 4JI2B 3CPJB 2HEIA 1EAMA 5JOQA 3RADC 3GT0A 1EWKA 3DO6A 1QXSA 1X15A 2XDWA 3PFGA 3PGXA 4LNUA 4LX8A 3L8EA 3U3ZA 1XN4A 1ZO8A 1DTEA 5D7BA 2H00A 4RFSA 1C3OB 1D7OA 3AUXA 2H1HA 4V0QA 1HSOA 1ODKA 3FHCB 2R86A 3KZMA 1CJBA 2NLOA 1KETA 2JCYA 3DE3X 1OT3A 4P53A 2PV7A 3J7AC 3HU5A 3KJHA 3GD7A 3PXGA 1U3UA 2AT1A 3PG5A 1Z08A 1PWEA 2Y1FA 4V0LA 5EGSA 2WD8A 2F2TA 1P2GA 2AFHE 3R5HA 4FR5A 4UZEA 3AFIA 4ZOEA 5EERA 2AI2A 1XZEA 3M3DA 4WWHA 4YMHA 3CTPA 3IO5A 1NZJA 3MRTA 4AU1A 4WJLA 5AW1A 2VHTA 1XZHA 2H16A 1MC4A 1CF4A 1XTPA 3R8CA 4OMDA 2XI4A 1WQ1R 4KVGA 1H3EA 1NF3A 1NJGA 1A4RA 5KCMA 2QTMA 4NCIA 4F93B 3ZVNA 2V7VA 3OQ1A 4WK2B 4Z9AA 2PXCA 4IS2A 3BE5A 3M3PA 4CM9A 4ESHA 1OU4A 2CMDA 2PX8A 2VT3A 5D7NA 1GT6A 3BJIC 1XAGA 1QYRA 2A6PA 2FEKA 3Q9LA 4QULA 1YT5A 2J0EA 2P77A 3ABQB 3T06B 1NM5A 4D9EA 2WHEA 2AN9A 2R6FA 2OVFA 2CJFA 4RH0A 3RWMB 2WWYA 1N7GA 1L5SA 3U3JA 1JJAA 1JQKA 3Q9NA 1XAHA 2XUKA 4DLSA 1A5SB 2CL7X 5ES3A 3IAM6 5AJXA 5EPEA 1E60A 3SZMA 4QLOA 1ICIA 1MAWA 3LHIA 2C8KA 3NGLA 3S1AA 3FCCA 5BNIA 3P9YA 2Z2ZA 2F00A 1G0OA 3ENQA 3OZGA 5AOAA 3LQQA 4S1NA 1X7XB 1Y7LA 3GA5A 2RG1A 1NP6A 3UMCA 1OA1A 2HTFA 3QEMB 3IP8A 5TQ2B 3MK31 4G2TA 4MUNA 4Q7EA 2HFJA 3K7EA 3L8MA 1Q7TA 2DR3A 2Q27A 3GFFA 4Q6BA 2I7TA 3NAQA 4C07A 5HGXA 4ZCRA 3X1JA 5CFMA 4YY3B 1X87A 1JAIA 3Q3IA 1U5CA 4HJRA 5D5PA 5CX4A 4DCSA 1YZQA 2R66A 1PFKA 1XD2B 2QYSA 1PT6A 3UV6A 4CV0A 1CUUA 4Z8YA 2B78A 2W6IA 3B2EA 3CQ9A 1TAQA 2L18A 3HU3A 5DGDA 1V0JA 5DX1A 3ZWPA 4E4TA 4Y2PA 2AX4A 3QZUA 1U2RA 1UEIA 5IARA 1HY3A 4JSYA 3LK7A 3H1AA 4OV6B 2BMDA 3AETB 1W47A 1X0VA 4HRXA 4J4HA 1GCUA 2IDJA 1HDEA 4TLCA 2JJ8A 3SVLA 1WMFA 2I3AA 3Q85A 2R4TA 3SR3A 3RSGA 5J23A 2XVZA 2DH6A 1HLGA 3N0WA 4XUEA 2OHOA 1EUCB 3GCXA 4F45A 3Q12A 3TUIC 6Q21A 4FB5A 5JI2E 4IIVA 2X8BA 4QKQA 4JJAA 3SYRA 2A86A 3TVTA 3UH0A 1MRNA 4RGYA 4B2IA 4JP3A 3WLFA 1W5AA 2FKNA 4AP5A 1A5ZA 2IZ7A 2FP3A 1U2DA 4CMGA 2C2ZA 5KYVA 4D4KA 2LCIA 1ADGA 2GCOB 3H2YA 4PZLA 1ECBA 3EDMA 5FNZA 1OVMA 5TEVA 3VHXB 4M86A 3ZQJA 1G38A 4GZ6A 4D9IA 1V2GA 3FFAA 4L27A 5AW9A 5KX5A 1XF9A 1BE6A 4R2HA 4BRZA 3JQ9C 2YW2A 3H5RA 4Y6RA 2OHFA 3KYIB 4U4AA 3W3ZB 1U7HA 3K6RA 4DLYA 2QK4A 4NV1A 3I9V6 1QE5A 6YASA 4ZV7A 1DHRA 2IUYA 2YHBA 4C0AC 4CBVA 3L4KA 2EGGA 2DETA 2A0WA 2SCUA 2Y2UA 3TQCA 1XTTA 2AKYA 2MYTA 1CDZA 2R96A 2FPSA 2VBCA 1K3FA 2NTVA 2PS0A 1NYRA 1T34A 2EFGA 2ZYDA 4LXQA 4P4SA 1FW8A 5ALEA 3W2IA 3BE8A 4TMXA 1K8QA 3LX8A 4UBKA 5FQNA 4CFSA 3FDXA 4OLHA 3KVRA 4R71A 3H8VA 5LWQA 4FJ2A 5JJIA 3NASA 3LC0A 2VDUE 1WPQA 3I9OA 1LFAA 1NVVR 3GZNB 2QRVB 1ONOA 4P82A 1Q0QA 5K7SA 2C2OA 3G1TA 4IGIA 4KRGA 2R1UA 2YJGA 2RJNA 4TLLB 5EWJA 3TPCA 1N34B 1ZLXA 4MGIR 3EAQA 1CV2A 3EB9A 3QTTA 1B6SA 3W5JA 2ZRKA 2VXCA 3KSMA 5A0FA 4B83A 1X38A 2RHWA 2EDCA 2JD2A 3E7WA 4M1YA 5FPYA 4J0JA 4Q1BA 4DA4A 4IF4A 2WIFA 4OAOA 3TTSA 3WGTA 4HLUC 2GWRA 2JH8A 2I4MA 4OXNA 4E14A 3EZ9A 2NXEA 3EH2A 3SR0A 4JLKA 1IRIA 4EFLA