4M1QA

Crystal structure of l-lactate dehydrogenase from bacillus selenitireducens mls10, nysgrc target 029814.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
312
structure length
312
Chain Sequence
TKTSRVVIIGTGAVGSSYAFSMINQNVTDEMVLIDLDKRKTEGDAMDLNHGIPFGAPTKVWAGDYGDCKSADIVVITAGAAQKPGETRLDLVEKNANIFKGIVDQVMGSGFNGIFIIATNPVDVLAYATWKFSGLPKERVIGSGTILDTARFRFLLSEYFDIDVRNIHGYIMGEHGDTELPVWSQTRIGSEPISRYMDKYKPDGSNKDLDEIFVNVRDAAYHIIERKGATHYAIAMGLARLTKAILRNEQSILTVSTLMEGEYDLDDVYIGVPAIVSQKGVERAIEIDLNDEEMKKLHHSSNTLKDVMKPIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of L-lactate dehydrogenase from Bacillus selenitireducens MLS10, NYSGRC Target 029814.
rcsb
source organism Bacillus selenitireducens
total genus 97
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4m1qA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4m1qA02
1NPTO 1DJQA 4KWHA 4ND1A 3MWDB 1IULA 3DFZA 4PZCA 1VRWA 3DMTA 3S55A 3NJ4A 4J9UE 2X9NA 1YOVB 3FBTA 1E7SA 2VHVA 2O3RA 4WLFA 5DOZA 4BS9A 4CODB 4L9RA 5EMHA 1DC3A 2P5UA 4HADA 1WPQA 3QWHA 1GV1A 3D64A 2DFDA 4YRDA 1LJ8A 4BO3A 5HA5A 2IODA 3KUXA 5EINA 4AG3A 3OJFA 4UREA 5B4TA 4OOEA 1BXZA 5L3ZA 5J23A 3AUUA 3K2BA 3FNEA 4HUJA 4MJLA 4BNZA 4FJ0A 4OAQA 4BNXA 3FNFA 1DIAA 1NPDA 1P1KA 1VKOA 3TQHA 1GZ6A 4ZVVA 4EITA 2QW8A 4N18A 2EW2A 3G79A 1ZO8A 4RPLA 3ZW9A 4CQMA 1JWAB 3ZWBA 1EBFA 5B4UA 1ADGA 3ASVA 2DU8A 1KS9A 4WGGA 3D0OA 4CQLB 3EK2A 1Q7BA 2PZMA 1I32A 1E3WB 3WGHA 4TMFA 3LT4A 4GLOA 3ZDFA 5IDXA 1YGYA 1IPFA 4DLLA 4NR0A 3CEAA 4CLOB 2ZQZA 4J1TA 1UP6A 3JQDA 3BMQA 2XXJA 3M1LA 4NBTA 5THKA 1PL6A 2PD4A 2BGLA 1GV0A 2DAPA 1P0FA 2IYOA 2V6BA 3F1KA 3F6YA 3LLSA 5AQ1A 1HT0A 1U4OA 3KLMX 3MTGA 2Q2QA 2FR0A 4CUJA 4OXYA 2YQ5A 5BNTA 5A4DA 4CLRB 3ZCXA 1GQQA 3VOSA 3UH1A 1R4MA 4R69A 2Q99A 2WEKA 5CFZA 2Z5LA 1HDXA 1MG0A 3E03A 3K92A 1X7HA 2BLLA 4E2ZA 2GN9A 3VH3A 1Z45A 3U62A 3RCBA 4D45A 5KTKA 2WTBA 1HDRA 4B7XA 4OKNA 4BO0A 2PKQO 1PTJA 5I8WA 3DBHA 3RUCA 3NUGA 1X15A 5GZ1A 4XCVA 4CPDA 1SB8A 2GGSA 3GUYA 3F5QA 4RVSA 5G0WA 4ZQBA 3E9MA 2X1HA 3DAGA 3GPDG 4TSKA 3PXXA 1HTBA 3PJDA 1MV8A 2ZJ0A 1MG5A 4HXYA 2F00A 3PVZA 3LF1A 4WOJA 4MIEA 4CMJA 4ZHSA 5KVVA 1ISIA 1BDBA 5IZ4A 1XEAA 1KEUA 1NVMB 3DZJA 2I66A 4OHUA 3D3EA 5KNLA 1DRVA 2I5PO 2VOJA 3H2SA 1NYTA 5KKAA 1ZSNA 3QE3A 1HEUA 1VSUA 5TIIA 3EUWA 2VYND 1WLYA 3AY7A 2UUPA 3IMFA 3KYDB 4B8ZA 3BTUA 5C5IA 1X0XA 2EGGA 2FWMX 4IDAA 4OIMA 4BNJA 4R68A 3OECA 1CQIA 1LSUA 1LDEA 4CMBA 1HZJA 1ZEMA 4AJNA 5L7YA 2EV9A 3I6IA 3FTNA 4RVDA 4QUKA 4J3FA 3H9GA 1A4UA 1T2CA 5KCZA 2W8ZA 1DC6A 5JFOA 3GZNB 2PV7A 2PD3A 3NYWA 3LK7A 3VZPA 5KJ6A 2W2LD 2Q1UA 3WBFA 3GC6A 1B3BA 3P2YA 3ROMA 3UCXA 1E6WA 1ZK4A 3AUTA 1WAMA 5TT0A 1DLIA 1YB4A 3VH1A 2IE0A 2PH5A 2DUWA 4N54A 2YJZA 2JHFA 3IIEA 1U5AA 1P1RA 1YXMA 2G76A 3RBVA 2PKQP 1IZ9A 5ICSA 2EXXA 3WGZA 1PJ2A 4LMPA 1U7HA 3EW7A 3OH8A 4J4HA 4BO6A 3GGPA 4KQWA 1OZAA 4GH5A 2AMFA 4YRAA 5IZCA 1GFSA 2PD6A 4JQCA 4LRSB 5DF1A 2Y99A 3Q9UA 3SLGA 4CM3A 1SCUA 3ONDA 3QLJA 4JXKA 5H83A 3TF5A 3GRPA 1VI2A 4HFJA 1F06A 2GZ1A 2NTNA 3GEGA 3JQ9A 5KWEA 3TN7A 3ZW8A 3RUFA 4DRYA 3IL2A 3WFIA 5F3RA 1I3LA 3OJLA 3JQ9C 3VZRA 3OP4A 1IY8A 4CM8A 3QVWA 1KC1A 4Q3AA 4J7XA 4IGEA 4NBUA 3R6DA 3JQ6A 1CIVA 2EG9A 2YUTA 3JQGB 4FGSA 1E3JA 1RJWA 1XR3A 3C1OA 4L4SA 4R3NA 1HL3A 3VH2A 3AM4A 4AJ4A 3QWIA 4YWJA 5G2OA 1DFGA 3WMWA 3TFOA 3FCOA 4UVIA 1E3IA 4D0RA 3F4BA 3B1JA 5ES3A 4E30A 3D3WA 1WVGA 4P4LA 2J5QA 3PDUA 3S2GA 1E7MA 3KEOA 1P33A 4AFNA 1H93A 2JCVA 3W4JA 4M86A 3NTRA 1OI7A 3SXPA 3V2GA 1Z73A 5IFLA 1P77A 4KUEA 5L53A 1X1TA 1ZVMA 3U9LA 3PHJA 3ZV6A 3OIDA 4QO7A 4NI5A 3FF4A 4BNVA 1PWXA 2H63A 3FPLA 5JO9A 4MIYA 1XQ6A 4DGSA 1DHRA 2B37A 4MKRA 4ZA2A 4BGUA 1YL7A 3DBLB 3WGYA 4B4WA 4J2HA 2Y1EA 2I99A 4B3HA 1LDGA 4I8XA 3ZWCA 2C0CA 2G5CA 4H3VA 1FDSA 3LT0A 4L4XA 2GO1A 1PS0A 1DDOA 1GTMA 3FN4A 2VZ8A 4GGPA 4RJTA 2EGHA 4B3JA 3CE6A 4QX6A 3ZWNA 1ISGA 2VRCD 3BXXA 1XSEA 2AEJA 4YJHA 4YEDA 3JQEA 4NHEA 4FN4A 5F5NA 3OA2A 4BOYA 1GL3A 5IG2A 3L9WA 3SEFA 4M1QA 5A3VA 3IDSA 1I2ZA 4M89A 1TB4A 2P9CA 4OKIA 1PGOA 1IHYA 1QYVA 1Q7GA 1XQ1A 3PEFA 1A72A 2YDXA 3WNVA 1I10A 1SPXA 3TZHA 3H6KA 3Q0EA 3S8MA 2OBYA 3PQDA 3LC7O 5ILOA 4PVDA 3GMSA 4XGNA 2AEMA 3QHAA 2VN8A 2Q49A 3T7CA 4D44A 3X2EA 3S2IA 1KETA 3D5TA 1MB4A 4NQZA 3DMYA 2EKQA 1YJ8A 1E5QA 4DTIA 1X13A 1U1IA 1H9BA 4WKGA 5BQFA 4J4BA 3ZWAA 1PS8A 2WD8A 3NT4A 5DBIA 2IXAA 1M76A 4Q9NA 4YR9A 3WTCA 4BMSA 3TZQA 4RQTA 4MP3A 1JU9A 3BA1A 2QHXA 5FFFA 3O9ZA 4CR6A 3GZ4A 1Y5MA 1RM3A 4MVJP 5TRTA 4NMHA 2Q3EA 3E18A 2NVUA 1SOWA 3EZLA 4IDGA 1AHIA 3ZNOA 4J7CA 4FS3A 3U4HA 3JTMA 4RPJA 3EAGA 4BNHA 2FSSA 1KEPA 1HF3A 3D4NA 1A7KA 4XD2A 1WXDA 3RASA 1LQTA 5JDIC 3HN2A 4FFLA 4OXKA 1PEDA 2VTDA 3DZGA 3V1UA 4EJ6A 1FDWA 1K5HA 4JJGA 4OO3A 3IJRA 1BVUA 4RVGA 3FSRA 2HRZA 4I5DA 2W90A 4B79A 2X58A 5EL0A 4Y6SA 1Y9AA 1T2FA 2E37A 3PJFA 4YPOA 4RO0A 4XGIA 4IUYA 4BNGA 1LDBA 1TLTA 1PQPA 4YAEA 5JBIA 4FW8A 1NNUA 1AXEA 3KRTA 1ONPA 1EUZA 1QYDA 1ZUD1 1U3TA 1KYQA 1A9YA 4A73A 4W9NA 1U7TA 3OJEA 4DQXA 3WFJA 4R3WA 1EVYA 3P19A 4W9NC 1XLTA 2DC1A 3RKRA 1I36A 2VNAA 3P7MA 3NDRA 3L6EA 4RF2A 3V1YA 2X0IA 1LDMA 2AA3A 1A71A 2C54A 4EI2A 2DBZA 4WPGA 2WYVA 3WTBA 4IDDA 3VAZA 1LRLA 2PR2A 1A7AA 3M1AA 4XDYA 5F1PA 3BMNA 2WYWA 1ZXBA 1GUFA 2FPPA 3DO5A 3VDQA 1E6EA 5I7VA 2VZ9A 4L4RA 2J3IA 1CF2O 5ER6A 3JCZA 1ZH8A 3F5SA 4MP6A 4IDEA 3LC1O 3EDMA 3HUDA 4WEQA 2GN4A 3ROQA 1D1TA 1DRWA 3CMCO 4IQGA 4K1LA 3Q2KA 4WLUA 2X7HA 3PZBA 4BKPA 3QWBA 1Y1PA 3WDSA 5LDHA 2VT3A 4CM5A 3DDNA 4CMCA 4PLYA 3GFGA 4NH4A 3S2FA 4BNYA 2C29D 4W4TA 3Q2IA 4FOOA 1ZK3A 4BNMA 3A14A 4J43A 1VJTA 3PJGA 3ZH2A 4I5EA 3TPCA 1YDWA 2GYYA 2A35A 3ON5A 5DCUA 8ADHA 3UAGA 3HDYA 1EK5A 2NU6A 1QP8A 1CWUA 2BHLA 5T5QA 2FR1A 4MKXA 1ZBQA 2CFCA 1NQTA 5C7OO 4JK3A 3C7CB 5DBFA 2C7VA 4CUZA 5FEUA 2G1UA 1VC2A 1M6WA 1N9GA 1Y81A 3COSA 2B36A 3VPGA 2JJYA 2GR9A 1YH3A 3WS7A 1IPEA 5EPOA 4XR4A 4XYLA 5TNXA 1EZ4A 3KZVA 4ALJA 4I08A 4DREA 1G1AA 4XWYA 1IYZA 5G0SA 3SC4A 1QLHA 4CQMD 5KJCA 1YVEI 3U49A 4LCEA 1HRDA 4DQUA 3MEQA 1ZMTA 4RF5A 5JAZA 3MJVA 1QKIA 2CDAA 5JCJA 4R1NA 1J4AA 4GAEA 1CJCA 3QWFA 3D7LA 3CXRA 5A3JA 4RLHA 3RJ9A 2CDCA 3DC2A 2WSBA 3GAZA 1NBOA 4FJ2A 3HZZA 3PIDA 3VPXA 4F46A 1E1KA 1JVSA 5L9AA 3KXDA 3OSUA 4O6VA 5KKCA 2GLXA 1TT5A 1ZK1A 2YYYA 3CZRA 1DAOA 3ITKA 3AI2A 5DOVA 3KEQA 4HP8A 4UAGA 2WD7A 4C7KA 3NKLA 3ETDA 1HDGO 2QX7A 4CQMB 1WDLA 2GZ2A 5DN9A 4NIMA 3OQBA 2NADA 1F8GA 3KSZO 2O2YA 3DZBA 1GU7A 3TZ6A 4B4UA 1BW9B 3MTJA 1DIGA 4FFPA 4YT4A 5B1YA 3BTOA 4BQPA 5A1TA 5ENVA 1TEHA 3QIVA 4BKQA 2VT2A 3HFGA 3M2PA 4FPXA 3CKYA 3ZU4A 5JDCA 2FSVA 2QIOA 3NDIA 4W7IA 1R0LA 1OC2A 3FR7A 5JPIA 4WCFA 4GQAA 5JDCC 1T1RA 2P9GA 3HHPA 2PZLA 3MJTA 1NHGA 2CVOA 3A1NA 3HG7A 3E1KA 3ENNA 4GL4A 1HE5A 2BF7A 3RJ5A 3RUEA 2X4GA 2JAHA 3VZSA 4IQ8A 1VJ1A 4URFA 3GRKA 3MOIA 3G1TA 2HSDA 3FR8A 1ENOA 1KBZA 3MJCA 1U4SA 2G82A 4RDHA 5TS3A 3JYLA 1FF9A 4RPKA 4J6FA 3JQAA 1O5IA 3B70A 3FI9A 3WWYA 4CMKA 1I8TA 4N5NA 3UCFA 3AY3A 4UEJA 2VHWA 5KIAA 3RKUA 1B8UA 3RC7A 4DQVA 4J4TA 4XB2A 3DB2A 1P44A 4ND5A 3WG9A 3RD5A 1ZSVA 3JYQA 4BIIA 1MC5A 7ADHA 1TT7A 4WCDA 3PP8A 4YQZA 3ZHXA 4ESOA 2JFHA 1N2SA 2ZB8A 2VWGA 3EHEA 2P9EA 1GR0A 1C1XA 1T24A 1VL6A 3ADPA 3OHSX 4BMNA 1N1EA 4EGFA 2DLDA 3DWFA 3C1TA 3DXFA 1EQUA 1ADFA 5ILGA 3HE3A 1KVRA 4TVBA 4YAKA 2Y1CA 4I9HA 1DAPA 1I0ZA 1PZGA 1J6UA 2YY7A 3ZWMA 3WWZA 4XQ9A 4Y6RA 3KSDO 1BVRA 5DZSA 1PJTA 4GSKA 2O3UA 4Z6KA 4AJHA 5JC8A 3OJOA 2FN7A 3L77A 5K9ZA 3VTFA 1GCUA 3GN2A 1B8VA 4N7RA 3UICA 1LRKA 5IDQA 5TLSA 4FDAA 2EF1A 3JQ8A 2UV8A 3E48A 5CDGA 4KOAA 5GMOA 4B7UA 2A92A 2FOIA 5GY7A 4PRLA 4LW8A 1WWKA 3QP9A 4NK5A 4NBRA 3NV9A 1ENPA 2HMWA 4C4OA 4FB5A 5CEFA 5I9NA 2PK3A 3ZWYA 1YL6A 2B5WA 4YJFA 1LSJA 5MGBA 1UDBA 4WUVA 4OYRA 4DYDA 1V35A 4W7HA 3PJEA 2X0JA 1FDVA 2TMDA 1JW9B 2EJVA 1B2LA 1R4NA 5AYVA 4EBFA 3MWEB 3AJRA 4ZRMA 4BO5A 5I7EA 2BELA 1LBEA 4ALMA 5C7IO 3VTZA 3Q3CA 9LDBA 2H1SA 2UAGA 2BFMA 2EEZA 3DTYA 2C5AA 4JJIA 6LDHA 3DTTA 4WOKA 1EK6A 1HYGA 4OMUA 1JDJA 4M55A 1IB6A 4RF3A 4F3YA 3DMTC 2YV1A 1U8XX 3I4CA 4YJGA 3ZHBA 2G17A 2ZQYA 2HO5A 1PQUA 3C1AA 3W4IA 1BDMA 2HMVA 5G0TA 3PLRA 3PYXA 3NAQA 1DC5A 2VRBA 5BNFA 3EGOA 2E48A 4P38A 2BRUA 4CMIA 4NNJA 4IXTA 3WGIA 2D4AA 5CPFA 4ZQGA 1RM5A 2VWPA 1YB1A 4J16A 4RF4A 3GN1A 4NPCA 4CM8B 4IY1A 1Z7BA 3GGOA 4PG8A 1OAAA 4XB1A 4BO9A 2HKIA 4R01A 2VUUA 4E5PA 2HJRA 4AJOA 1PJQA 4CMGA 1NAIA 2VWQA 4JGBA 3UGKA 3VKUA 1VJ0A 3H65A 3E9NA 3OF2A 1R15A 1D8AA 4RL6A 4YJDA 3ZHYA 2YHUA 1EDOA 4RV9A 1U9JA 1BGVA 1L1FA 1GCOA 4AJKA 3IKTA 1C0LA 1HXHA 1P1HA 1ZK0A 1J0XO 3EVTA 4RGBA 4BV9A 4UVEA 3ZHZA 1SEPA 1W4ZA 5K6AA 4YXFA 3EZYA 4JNKA 1T4DA 2XF8A 3ZGYA 4YA6A 4ITUA 1BXKA 2Q2WA 1TXGA 4PG6A 4XIJA 3WOHA 2NQ8A 4U7WA 1E3LA 4GGOA 3HSKA 4ROSA 3GG2A 3AUAA 1G0OA 2X5KO 4NJMA 1E1NA 3S2EA 1HSZA 5G4LA 4CM9A 3G1UA 1ZIDA 4B4OA 4WNIA 1PJCA 3VHRA 4D7AA 4ZQEA 3I9NA 2Q46A 2WJPA 3ZV4A 3U0BA 4YB8A 1GEEA 4I5FA 2OORA 1X14A 4JROA 4RZIA 3OFSA 2RAFA 4IBOA 1TVEA 2O3JA 3VC7A 4J2OA 4YJHB 1ONNA 4LRTB 1U2DA 4ND3A 3AWDA 4BMVA 4DPKA 3LZ6A 3WNQA 4WE3A 4PCVA 4BNLA 3I52A 1JKJA 3ZU3A 1VSVA 1EVIA 1U3VA 4YT8A 2JHGA 1R37A 3AUSA 1QMGA 3R3JA 1W8DA 3HDQA 5I8ZA 1E0DA 4LK3A 2OBNA 1ARZA 4NFYA 4O1MA 3WQSB 3H9EO 2H9IA 5JMPA 4XZ3A 3IAHA 3LU1A 1SZJG 3QW2A 4I9NA 2NQTA 5CDTA 2A9FA 4UUMA 3TFQA 4Z0PA 1K2WA 1U8FO 5LC1A 3DZKA 2ZYDA 1KVSA 3INGA 5FWNA 5IAAA 5BSGA 1LLUA 4MKZA 4EUHA 4R54A 3L4SO 4UUPA 1C0IA 1G0NA 3KTDA 2J6IA 1EDZA 3PWZA 3GEMA 4GWKA 1LDYA 2HK9A 3FTPA 4QSMA 2B69A 1NWHA 2Q4EA 4BO8A 2C82A 3GVHA 4ID9A 3RBZA 5HS6A 3WGOA 1YL5A 1EVZA 2DPHA 1DRUA 3MZ0A 1PJLA 4J90A 4P4GA 3F3SA 4KWIA 1GEGA 2EHDA 1F17A 3Q11A 4E5NA 2NVUB 3KHUA 1H5QA 4LN1A 2FPGA 3GAFA 4YT2A 1FDUA 4GKBA 1ML3A 1P45A 2XXBA 4Y98A 2IZ0A 1A9ZA 1M2WA 1X0VA 2YFHA 4JIGA 5U1PA 1I3MA 3KSUA 2AW5A 1ZZEA 3V8BA 2P68A 3IC5A 3W1VA 5DDIP 4DC0A 2ZTMA 1N7GA 4GLLA 3WSVA 1Q0HA 1VPDA 4GI2A 3NDJA 2NTJA 4IZIA 4UULA 3ABIA 2YW9A 1T1SA 1NPYA 5EERA 1Y8QA 1Z82A 3W4KA 3PLNA 3PWKA 3Q6IA 1QORA 1P1JA 4J0FA 3C7DB 4BVAA 1SEVA 1QSGA 3P2OA 3OEYA 3KV3O 2X86A 3U4IA 5IJZA 1R0SA 3QSGA 4KDFA 5EESA 2QYSA 2JD0A 1GPJA 2Y1OA 3GVXA 2W4QA 4XIYA 3ST7A 4YDRA 3ZWOA 4WLVA 5IXSA 3M2TA 2HK7A 1Y5RA 2QRKA 2OO5A 4P22A 4E2YA 1CETA 3UOGA 3VVBA 2DFVA 2PGDA 5IZCC 4BGEA 4D46A 2BGMA 1T25A 4A2CA 5A9SA 3OQ1A 1ADBA 2AG5A 1KVUA 1Y8RA 3SJ7A 3D1LA 1JAXA 1LA2A 3OM9A 1K0UA 4EW6A 2O4UX 2ZB3A 4RCVA 1CRWG 1K89A 1PR3A 2Y68A 5DULA 2VHZA 2O7QA 3G0OA 4LVCA 4MOWA 4OL9A 2EWMA 4FFRA 1BMDA 2E6UX 3BMNB 4AVYA 3L9XA 4PG4A 3WJ7A 3H7AA 3HDHA 3ONEA 4XQGA 3C85A 4HBGA 4OQZA 3I5MA 1JWBB 2DTXA 1MP0A 3WXBA 4LMRA 3WX0A 2AQHA 1YO6A 4Z0HO 1I5RA 1ONOA 4HKTA 1OBFO 1PQWA 1YE3A 3CH6A 1V8BA 1DIBA 2O2SA 3D5QA 1WNTA 4TQGA 1KY4A 5A5FA 1E3SA 2O50A 1I24A 1UDAA 4CJXA 5F5LA 4CUKA 3HWRA 3OETA 1KIFA 2NACA 4Z9FA 2ZB7A 4L8VA 5JCJD 4BL5A 2X23A 1ZXLA 1NWCA 3DBVO 1C14A 2IEBA 2DTDA 4P4NA 2DVMA 2AXQA 2B5VA 1YBAA 1OOEA 3ROPA 2PGJA 3KYBA 2X9VA 1E7QA 3E6AA 4KUGA 1DLJA 2QG4A 3GDGA 4GX2A 5F1OA 3ZNNA 1Z75A 4B7CA 4QT0A 3RFTA 1N9GB 2I3GA 4II3A 1WDMA 5BSEA 2I9PA 3B1FA 4RVFA 2PY6A 5LDGA 1E92A 1BXGA 4BO1A 4E6PA 1GUZA 1FMCA 4OOFA 1K6XA 3QVOA 3EYWA 1XDWA 2V65A 1JLLA 2UVDA 3QVSA 1B26A 4U0KA 3TNLA 2JKVA 1KVQA 4HY3A 4RLSA 3TOZA 3EVNA 3ASUA 3HNPA 4CLXA 2AEFA 1F8FA 2RCYA 2C7GA 3I9LA 4PRKA 4FCCA 2Y93A 4JN6B 4JBIA 4FC6A 3H5RA 1UUFA 1M6HA 3CINA 1HE2A 1TT5B 2YQ4A 3VKVA 2A94A 4E5KA 1H2BA 2WD7B 1I30A 2GN8A 2PWZA 3CPSA 4ZJUA 2ZTUA 2NTVA 4IM7A 4ONEA 2BD0A 2E82A 2AQ8A 5TX7A 4WLEA 4XJTA 3JQCA 5TJHA 1XIVA 3WQQA 3QVXA 1UJMA 1NVTA 4A0SA 3CUKA 4UVGA 2ZIZA 4CLHA 2I6TA 3DHEA 5FF9A 1MXHA 4MVJH 4BO7A 1K3TA 2OGUA 3IKVA 3BIOA 1JTVA 2BI7A 3JQAD 3N74A 1PSDA 4UEOA 3TZKA 4R1SA 2O48X 2IYPA 5COAA 8LDHA 2WM3A 1CQJA 4ZD6A 3VVCA 3FNHA 4WCFB 4FGWA 1E3EA 1X7GA 4JBGA 1W6UA 3ANMA 4E2WA 1LUAA 3NT2A 3OA0A 4XEHA 1O89A 4TWRA 3GQVA 1H2HA 3I1JA 3ZU2A 6ADHA 3QVTA 2O3QA 3PTZA 1U3UA 4O0LA 1JQBA 1UAYA 1RPNA 4NU5A 1EE2A 5COBA 4CMEA 4CV0A 5CAEA 1V9LA 1WP4A 2EP7A 3JQ7A 1N1GA 2HMSA 3P5SA 2YV2A 4CLDA 1O0SA 4CMEC 1PJSA 1B7GO 1V3VA 2QRJA 3JQAB 3MJ4A 3KOUA 3I9MA 4PLZA 2AG8A 4CMHA 1XKQA 1AXGA 4YTEA 4XYGA 1SMKA 3L0DA 3JD4A 3GZNA 4RVUA 3JD2A 4NFSA 3PYLA 3LSYA 4YVFA 5F21A 4IGFA 3SVTA 1EUCA 2I3AA 5G0VA 1AUPA 4IZHA 1P3DA 2X8LA 2XOXA 3LYLA 4U6SA 3GY0A 4JBHA 4R4JA 3U09A 1KC3A 1E77A 2A4KA 4MVJI 2Z1NA 2QRLA 1P9LA 2CUKA 3O38A 2CF6A 2JCYA 2IZ1A 3WLEA 2VCYA 3AU9A 3U4CA 4B8WA 3IP1A 3VPHA 4DA9A 2EW8A 1T2EA 2ZKLA 5ER9A 1Q0LA 4IDCA 3TOXA 1Z74A 2NU9A 2VHYA 3AK4A 4EZBA 3GNTA 1YQXA 5FI5A 1ZSYA 4E13A 4TZTA 1QR6A 2ET6A 3V1TC 1E7WA 1VL8A 4FSHA 5ICMA 3GDOA 4ND4A 3ZNQA 4NBWA 3D4OA 3DOOA 3JQ8B 2J8ZA 3KO8A 1MLDA 4DBZA 3JSAA 3W6UA 4DIFA 3AOEA 1MGOA 1V3TA 2OFPA 3HDJA 4LISA 1HYHA 2O23A 1YJQA 4BNUA 1EUDA 5JYEA 4BKRA 4D3FA 5JW6A 2JFGA 2W98A 2D1YA 2AQIA 4YJFB 5F1KA 4WEOA 2YFQA 1HKUA 3F1LA 1ZCJA 4BNKA 1J49A 1GYPA 1R12A 2B4TO 2GZ3A 4DIBA 1R4NB 9LDTA 1GDHA 3ZV3A 4CV3A 4Y8VA 3WR5A 4WNCA 1U5CA 1M66A 4DC1A 2RIRA 1LQUA 3GHHA 2FP4A 4GX5A 3JQFA 3IJPA 4YCAA 4ZN6A 3BMCA 4BNIA 1HSOA 1FJHA 1NM5A 3VDRA 3UW3A 3ROKA 5JXWA 4J91A 4Z9YA 3K6JA 4Y67A 1Y7TA 4XQEA 3K30A 1NR7A 5U4QA 5IDYA 2E4AA 4HNHA 3PRJA 3NJ8A 4CMAA 4L75A 1AHHA 4FC7A 3R3SA 3UN1A 4FIZA 2R00A 4CMIB 3WIDA 1DC4A 1T2DA 1VE9A 4PLGA 3KM0A 2J5RA 3DBLA 4FFNA 3DBRA 1LTHR 3HADA 1HDCA 3ZWWA 1H6CA 2NVWA 2B4RO 4GMFA 4OM8A 5ADHA 4TRNA 4PGFA 4WLOA 1H94A 2OOSA 1JAYA 1NQOA 1HE4A 4JP2A 4AJ1A 1ZNQO 4DPLA 5C3MA 2NVBA 4PG7A 5U9CA 4NJOA 2FZWA 3TL3A 1KVTA 1LSSA 3PIIA 3GDFA 1PIWA 4AJIA 1WZIA 4CM9D 3F47A 4GSLA 4BNWA 4M49A 2Z1MA 3QA9A 3JD1A 4CM7A 1Z6ZA 3IP3A 1KOLA 1I01A 4E3ZA 4HNGA 4BNFA 2JL1A 5AXCA 1XCBA 5A02A 1SO8A 1SBYA 3ORFA 4DLAA 3LC2O 4U5QA 2BH9A 3O8QA 3WJAA 1EFLA 3BMQB 4ZQFA 4D3SA 4II2A 2OHXA 1PGJA 3UUWA 5G0UA 1TI7A 4TRRA 3BAZA 4NZ9A 1BWSA 1I2CA 3T7EA 1F12A 3GVCA 3L4BA 5IN4A 3GFBA 1O8CA 4IINA 3BYZA 3QQPA 4NJMB 5L51A 2J3JA 2P91A 3PHGA 2GN6A 4Q39A 4Q3BA 3I3OA 1ISMA 4WCFC 4E33A 4EDFA 3W8FA 1WW8A 4N5MA 4ZQHA 5BR7A 5AXDA 2X22A 1CERA 2ZCUA 1SB9A 2BFAA 1R4MB 1MA0A 4QEDA 2D3TA 2DT5A 2EP5A 3A28A 4CM4A 3FBGA 4S3MA 4L74A 3QWAA 3MJEA 2ZYAA 3ETEA 3LLVA 5BT9A 1HYEA 4RVHA 3W6ZA 1RWBA 3LQFA 4J1QA 5B37A 2CNBA 5I7SA 2HLPA 3DHNA 3NGLA 4ZGWA 3JYPA 3C24A 4J7UA 5JAQA 4OSPA 1P74A 3DBHB 4MVJE 1K6IA 2V6GA 4IDFA 3Q1LA 4ALNA 5JSFA 1PWZA 1YWGO 1YQGA 3TZCA 4S1VA 1M75A 4CM6A 1GZ4A 1GQYA 1PGPA 3OMLA 4Q3EA 5BNIA 2PFGA 3PQFA 4XRRA 3TL2A 1NHWA 5IXYA 1HETA 2FRDA 3CSDA 4DL9A 2NUAA 3SJUA 4Y6PA 3B6ZA 4TKMA 1LSOA 1EE9A 2FHSA 4NBVA 4XYEA 2UYYA 4HX5A 2X5JO 1ISHA 2HJSA 1B14A 1JVBA 4H7PA 1ISFA 2FZEA 3KYCA 4KQXA 2Y05A 1BHSA 3FNGA 4PVCA 1ADCA 3I9OA 3LVFO 2Q1SA 5IN5A 2UDPA 3MOGA 3H5NA 1H6DA 2JAPA 2GNAA 3A06A 3BHIA 3H9QA 3RWBA 3DOJA 4BGIA 5JS6A 4D79A 1ENZA 4IS2A 3WIEA 2Y0DA 4KMSA 3G17A 5MDHA 2X0NA 2V6MA 1DFHA 4NFHA 3RUIA 4QTZA 1ULSA 4Y9DA 2CDBA 3ADOA 3GH3A 2DBRA 1RYEA 3KVOA 4MVJA 1R66A 4MVJF 1O6ZA 3JQBA 1NVGA 3D4PA 3H9JA 4WLNA 5DP1A 3TDKA 4DXHA 1TA4A 5A06A 2PLAA 3DZIA 3JQBC 5TC4A 3U5TA 4O63O 4J1NA 1G6KA 4RPHA 2VZ0A 2DM6A 2EERA 1B15A 1MXFA 1UXIA 3PZRA 3WYEA 5BSHA 5EJ2A 3G49A 4NG5A 3I6QA 4L76A 2PNFA 1XU9A 2EIHA 4GX1A 4G5HA 1YS4A 5A9TA 1GAEO 1GD1O 3PI7A 2VUTA 3PPIA 1EBUA 1L7EA 4I5GA 1NQAO 4QFDA 4YQYA 3KLPX 4BNTA 2FY8A 4UUNA 3HJAA 3JYOA 4IMPA 5A9SB 3O26A 1U28A 4AJJA 1Y8RB 1N5DA 3BTSA 3ZWXA 4PZEA 2D5AA 2GD1O 4XDZA 1PJBA 3RU9A 4FOSA 3PHLA 2OZPA 2OUIA 1GY8A 4YT5A 1F0YA 3AOGA 4N5LA 2HU2A 2Y0EA 3E9QA 1Z7EA 3JV7A 3GGGA 2Y67A 5KVSA 4MIOA 1UXHA 3S1LA 1W0CA 5CPBA 2D2IA 3DONA 3EMKA 1LI4A 1ZW1A 3TJRA 2P5YA 2X5OA 2VHXA 5CEJA 4XGKA 3BMOA 5JCXA 1SNYA 2Q50A 1IZ0A 1H0KA 2GDZA 1E5LA 1ULUA 3D3WB 3NGXA 1ZJYA 2I65A 4OJNA 3ZZNA 2VOEA 3DR3A 1Q0QA 4E4YA 2LDBA 1AGNA 1PGNA 1UR5A 1V6AA 1E1LA 2D0IA 2DBQA 4PFJA 4TKLA 5L95A 4W6ZA 1LRJA 4EYEA 2HCTA 4CL8A 3RROA 1ZJZA 1DSSG 4A27A 5K6AC 3L6OO 2PZJA 3PFFA 4ILKA 1QXSA 2OMEA 3UXYA 3OEWA 1JKIA 1OC4A 2B0JA 3GVPA 5JE8A 2R6JA 4YAJA 2O3SA 3MJSA 3OIGA 2H6EA 3NTQA 1AN9A 3DL2A 2GUGA 4JCOA 5B4VA 1NP3A 3NTOA 3AI1A 4AJEA 1BW9A 2OXIA 4BO2A 4LGVA 2DTEA 5ITVA 1Y9EA 4FFOA 1AE1A 1B3RA 3CMMA 2EKPA 3X2FA 4AJ2A 4KDEA 4NDNE 2ZB4A 2H5LA 1JKFA 1BXGB 1DPGA 4RPGA 2AHRA 3RFVA 4YRBA 1OFGA 2Y66A 3IS3A 4CV2A 4OH1A 1E7RA 4KUHA 1QV7A 5L7WA 4NK4A 4MVJG 4A10A 1KEVA 3I4FA 1KERA 5IF3A 1T4BA 5T57A 4A03A 3FWZA 5G4KA 2Q1TA 2YV3A 4Z0TA 1XGKA 1YBMA 3PQEA 1PZEA 2P4QA 5KJFA 1WMBA 4RDIA 3PYMA 1NQ5A 2HRBA 3V2UA 3GNQA 1IE3A 1ID1A 2VNSA 3DAPA 4R5MA 4BGVA 5A5EA 4MDHA 4ZRNA 3WICA 4H15A 3DQPA 5TSDA 1DO8A 1HLPA 4CLEA 1VM6A 2PA3A 1T2AA 4QXMA 4IJWA 2X9GA 1QV6A 2Q2VA 3IOYA 4XA8A 5TGDA 4GBJA 4PIVA 3E5MA 3HN7A 4R41A 5HM8A 1C0PA 1HDYA 3OQ6A 1B16A 4XYBA 1C1DA 4QFCA 4FQ8A 3NT5A 4XQCA 4RORA 2WE7A 2YHIA 2Q45A 1VL0A 1YONA 3AM5A 3R0IA 4CL3A 3BTVA 4Q3DA 1J5PA 1CEQA 3IUSA 2EKLA 1FXSA 4XX0A 1XG5A 3GEDA 2W2KA 2RHRA 1ZFNA 1RKXA 2VYVA 3GR6A 1YRLA 1MC4A 4UVHA 4B4VA 1V0JA 4YAIA 2Y1FA 3WGGA 3JQ7B 5DNAA 2O7SA 4PZDA 3K9QO 5TT1A 5JAMA 4BB6A 3SLKA 3QRWA 3LF2A 4FFMA 3ZWPA 3GA0A 4E31A 2QZ9A 5ENDA 3R1IA 5CEEA 3E8XA 4TRMA 3H3JA 2BFOA 4A26A 3WMXA 5L40A 4KZPA 3GT0A 2IZZA 1M67A 1NX6A 2Y1GA 3F9IA 1LNQA 4E12A 2PZKA 5TJ9A 1R0KA 2BKAA 5JC1A 1UXGA 1UP7A 1ZK2A 3G3EA 4Q3CA 5DT9A 4RZHA 5L4SA 5CP8A 3WYCA 1PGQA 3QV1A 1ZKMA 5DCYA 4JX8A 1PR9A 3A9WA 2Q4BA 1DJNA 4ND2A 5L45A 1UZNA 4JJFA 3GNSA 4R51A 2WE8A 4O59O 5CG1A 2AE1A 4OXNA 4OSOA 2VUSA 4ZICA 1PJ4A 3JD3A 3PFWO 1SOVA 1YOVA 2B83A 3H2ZA 1HLDA 4DYVA 4E5YA 1Q2XA 4XKJA 3KBOA 3HQ4O 3TWOA 4E0BA 3GPIA 1NR1A 3JD0A 4KTTE 1N92A 3GHYA 3VZQA 3C3XA 5COQA 4F6LA 1ZMOA 2BFPA 2QYTA 3WGQA 2NM0A 3DHYA 5T64A 4E2XA 2Y1DA 4H16A 4GX0A 4HV4A 4INAA 2R2GA 3OIFA 3I23A 4LVUA 1ENYA 4BO4A 3RC2A 5FYDA 2HQ1A 2CSUA 4K9DA 2X0RA 3E82A 2PTGA 1VLLA 3HFSA 4M8SA 1VKNA 3F4LA 5I9LA 1C0KA 2D5CA 3FPCA 4CV1A 3Q9NA 1GADO 4TZKA 4CQLA 2ZTLA 5JYDA 1E3WA 4R16A 1E6UA 3GOHA 2FMUA 4OQYA 1UXKA 2ZTVA 3RFXA 1LEHA 4XYMA 4CLOA 3BMCB 4W99A 3U3XA 1PZHA 5ITWA 4K26A 3B20A 2D8AA 4RQUA 1PL8A 1DHTA 1MFPA 5A04A 4PN3A 1XELA 1YKFA 4W82A 4YYZA 5HBRA 3NEPX 3I9KA 4QECA 2DBVO 3OICA 5KVCA 3DAFA 4PLVA 4YBZA 4QO8A 1KEWA 5A05A 4CLRA 3DBRB 1U3WA 1CYDA 2IDZA 1NFRA 3UCEA 3ZNPA 2PKRA 3GG9A 5H82A 3RI3A 3UKOA 2I67A 5LCXA 2SCUA 1HDOA 4XRGA 4BQRA 4WASA 2HAEA 1LX6A 3VPSA 4DIOA 3I9JA 2GF2A 2V6FA 1E7YA 3ICCA 2CZCA 1WMAA 3IQDB 1PZFA 5AOVA 2RH4A 1NTOA 3RC9A 3RU7A 1PL7A 4MPDA 3PHHA 4A5OA 3GMDA 2GASA 3VPFA 4PLHA 1YQDA 4JLWA 5CDYA 3HB5X 3DEYX 1ISJA 4AL4A 1NFFA 4Z9XA 3RUDA 2DPGA 4AJLA 3AM3A 5K0ZA 3O8QB 1GYQA 1LC0A 1O9BA 1P31A 2OP0A 2RBEA 2UUOA 5AVOA 2EJWA 2ZYGA 4LSWA 3H3FA 5A03A 2B35A 3K73O 4IIUA 1ORRA 1LU9A 4I9UA 4IQ0A 4F6CA 5THQA 3NRCA 2VTEA 2C2XA 3PGXA 4XR9A 1LLCA 3E5RA 3UF0A 4GVLA 2JD2A 4EEXA 1H6AA 1L7DA 3SBOA 4GWGA 3VH4A 3UHAA 2J5KA 1RM4A 2C20A 2DUUA 4EJ0A 1A27A 3C7AA 3KYDA 4CM4B 3K96A 1EQ2A 3RVDA 1GZ3A 2O3TA 1UH5A 1D3AA 1UZMA 4AICA 4IXWA 3INTA 3QJ5A 4D3DA 4EJMA 1QYCA 2ZATA 3AY6A 3GLQA 1JN0A 1IUKA 3L6DA 1MFZA 4ALLA 4K6FA 3OBBA 1MUUA 3JYNA 1QYXA 3I83A 5JDIA 1GPDG 4GPD1 4PG5A 4O5OA 3WYBA 2HMTA 1IOLA 4BKOA 3SC6A 3WBBA 3PGJA 2CF5A 4GVXA 1R6DA 2WYUA 4LCJA 4CM1A 1PS9A 2BGKA 5JMWA 2QZZA 3K31A 1C3VA 3FRJA 3ZV5A 3LT2A 4HFNA 5JNLA 4E5MA 1SAYA 3HB4X 3INRA 3T4EA 4KTVE 2RHCA 2VYNA 2Y0CA 5H81A 2NV6A 2WMDA 1C1XB 2LDXA 4G2NA 4D41A 4UUOA 2C2YA 4YAGA 5KJ1A 1RM0A 1UXJA 2X6TA 3O4RA 3LDHA 5KJEA 5C7LO 1DEHA 1XHLA 1MX3A 4C7JA 2QQ5A 3WB9A 3W8DA 2IEDA 4DMLA 4D0SA 5TF4A 2J3HA 4MVJD 3WSWA 3KYCB 3RIHA 2GCGA 2W2LA 1HZZA 1GYRA 1N7HA 4YACA 3EY4A 3RBXA 5JY6A 3U4DA 3QY9A 2PH3A 3H9UA 2D59A 2NWQA 2BI8A 5CDUA 4CR8A 1D4FA 3N58A 4AJPA 5DCWA 3UVEA 5T8KA 3H5AA 4FBGA 3AOEC 4E32A 1DIHA 5EN4A 4J0EA 3JQGA 4P8RA 3EC7A 5T8KC 2AE2A 1FDTA 3ULKA 5AXAA 4R1UA 2BMAA 2DKNA 4F45A 4FR5A 4PLCA 3ANNA 5HRUA 4GKVA 5L4NA 4BV8A 2RH8A 2GERA 1YB5A 2GRAA 2HUNA 3RC1A 5T6BA 2FR8A 3NX4A 4K28A 4FJ1A 1BRMA 4ALIA 2OP1A 5AXBA 1WDKA 1DBVO 1EEHA 2IXBA 3AFMA 4DUPA 4GMGA 3TRIA 1I33A 1WZEA 1LC3A 2C07A 1O95A 4MVJM 4YJGB 1UAGA 3H8VA 5HS4A 4FD3A 1SC6A 2I76A 1UP4A 3JQFC 3RUHA 1R16A 3ZWVA 4J49A 4CR7A 1XWFA 3GK3A 3GVIA 3UFXA 1S7CA 3H4VA 2JFFA 4MO2A 1D1SA 1X7DA 3GF4A 1RYDA 2XAAA 4I1IA 3AI3A 2ILTA 3O03A 3KB6A 3PWSA 2AQKA 2R00C 2DQ4A 4BB5A 4IJUA 2HK8A 5JLAA 4X54A 3WGTA 1QG6A 5B12A 4WECA 3RQSA 5FI3A 5CG2A 2G0TA 5GZ6A 3DFUA 1K6JA 1OMOA 5DP2A 4MP8A 4U6QA 2Z95A 1DIRA 3BMOB 2NLOA 3M6IA 4U8GA 3T4XA 1UDCA 4IIVA 1PX0A 1GUYA 1YDEA 4IMRA 5EIOA 1KY5A 4OGWA 3MCVA 1F14A 2P2SA 2TMGA 2JCXA 2CVZA 4UEKA 1P1FA 2CY0A 1A4IA 1Q7CA 5TQVA 3SX2A 3PHIA 3BZUA 1QLJA 5DBGA 3FHLA 3LT1A 1HWYA 3L07A 3WLFA 4Q3NA 1FK8A 4IPTA 1NXQA 1LLQA 5KVQA 1PU2A 4R9RA 1X1EA 4HFMA 5L7TA 1BSVA 4ZU3A 2VRCA 5CDSA 1D7OA 2Q1WA 5BSFA 1B0AA 1EMDA 2VWHA 1E1MA 4PLFA 1HDZA 2IRWA 3WQRA 4Z3KA 3L4BC 4PLWA 4IDBA 3RAJA 3DZFA 3IUPA 4G81A 3ZI0A 4EEZA 3ICPA 1BTOA 1W73A 1B8PA 1XA0A 2ZCVA 4IS3A 3PDJA 4EUFA 1IHXA 1CDOA 1DFIA 1HE3A 4WK6A 1Q1NA 2YDYA 3KETA 4DBVO 3ETGA 3F46A 3CTMA 2OL4A 5HTOA 2VQ3A 3RUAA 4DWVA 2CD9A 1LDNA 4R9SA 3V5NA 1NAHA 4PLTA 4TROA 3FWNA 4HWKA 5IDWA 2ZK7A 1U2GA 2YZ7A 4LSMA 4DVJA 5EQFA 5G4KB 3B1KA 2NNLD 4QQRA 1LLDA 2C5EA 3AW9A 3C8MA 2C59A 2V7PA 4BNNA 1ZEJA 7MDHA 3ZU5A 1XU7A 3N7UA 3PK0A 1BG6A 5C37A 5JY1A 5T67A 4L0QA 2PGLA 2VYVD 3GUCA 4J1SA 4BUCA 2E49A 4J9VA 3DZHA 2HDHA 5A9RA 1T26A 5I9MA 3DOCA 4NU6A 2CVQA 1PJ3A 2B4QA 2FPIA 3RSHA 4D43A 4DPMA 1H6BA 5CHEA 3BHMA 2JD1A 3ENKA 2O4CA 1C1DB 2POQX 4JP3A 1UZLA 1V3UA 3CZMA 3K2EA 4KP7A 4K6CA 3W8EA 1EVJA 2GSDA 1JA9A 2YHIB 4E21A 2CMDA 3ANLA 1YBVA 2P4HX 2WDZA 4D42A 4XJSA 1DB3A 4L73A 4R1TA 2GPTA 2W2KB 4ALKA 5HWSA 1I3NA 1H9AA 1EFKA 1QRRA 3K8ZA 3K5PA 4Z3DA 1NFQA 4TRJA 5JAIA 4BHTA 1S6YA 3AFNA 4U0JA 5JO0A 3CIFA 3ZN2A 1O94A 1N8KA 1DXYA 1Y8QB 2XPCA 4B3IA 3ONFA 1I3KA 1P0CA 4M54A 5KOIA 4R5HA 2NU8A 2HMUA 4PLPA 1XYGA 4G65A 2NSDA 2NU7A 4BKUA 1P1IA 5I7FA 4EUEA 3AU8A 4WJZA 3OJ0A 2ZJ1A 3TSCA 1DOHA 1QYWA 3ITDA 4HFRA 4MINA 4M87A 2F1KA 3STHA 1Y6JA 5L4LA 4DLBA 4DMMA 5GZ3A 4UVDA 4IJVA 1I2BA 3V2HA 3FD8A 1A5ZA 1NASA 4TVOA 4IJKA 1GQ2A 4A7PA 3BHJA 2J3KA 1LXCA 2WWRA 3A4VA 5EQDA 1IL0A
chains in the Genus database with same CATH superfamily
3ORQA 1Y8CA 2HFKA 5DHRA 1Z4IA 3SBXA 1DJQA 3O8DA 4TT8A 2KYRA 1W1IA 1IULA 1Y8AA 2XNCA 2YVLA 1VRWA 2X40A 3I2GA 3L1IA 1UFOA 2AX3A 3P52A 4JLMA 3B7WA 1YR3A 3VHXB 4EECA 2QVXX 3DAYA 3WZMA 1RQGA 4BAGA 5CD1A 3E58A 1SC4A 3B36A 3EJWA 1J8MF 2W6PA 1W36B 2EQ5A 2WWWA 1CU1A 3SU8A 2O3RA 1UWKA 1C8BA 3C5HA 3LCRA 3AF3A 4WLFA 1IHOA 1PD0A 1R9GA 1Z6YA 2ZWPA 4I4LA 4MLPA 4Y6GB 1UANA 3HEMA 5DK4A 2WW8A 4ER3A 3PA6A 3ZKAA 4DV1B 5DNWA 1ORHA 2COEA 1JJVA 2P5UA 3DLPX 1WPQA 2ZZNA 3IE1A 1QHEA 2R68A 3H84A 1L5ZA 2IODA 4K9QA 4BAUA 5KNDA 2XGJA 3MUNA 1XD9A 4UASA 2RH9B 1NRIA 4OOEA 3RT1A 3JWJA 2XE8A 3P9XA 3AUUA 3IBYA 3K2BA 4MIKA 5L3ZA 1W0JA 1SM4A 2XITA 4BX8A 1AA6A 1GITA 1YCGA 1VE3A 2O2CA 4ZO9A 3TEJA 3HVHA 3QFHA 4BNXA 4UATA 1NPDA 4HATA 4HOYA 3VJKA 1XC7A 1GZ6A 3R5SA 6REQB 4O08A 5AVSA 3T3OA 2NUTB 3L04A 2QJTA 2VJQA 2ERCA 1W581 1FY2A 1GNVA 1SXPA 3LG2A 1OKKD 4CQMA 1ADJA 3WMEA 1ZW6A 1T8WA 2HGZA 2DU8A 3ASVA 3GFSA 1YR9A 4IHAA 4DSTA 3OCYA 4CQLB 4EB3A 5I47A 3QI2A 1I32A 3QPVA 4LNUA 1G9TA 1YR1A 2ABWA 3LT4A 1CY7A 4RKRA 4UHJA 3ZDFA 5IDXA 1YGYA 1A50B 1IPFA 1KIAA 3DZDA 2P5TB 4I4TA 4GOND 2FPSA 3ABRB 3IIIA 4NR0A 4UJ5A 4CLOB 4J1TA 4CU2A 4ABTA 3JQDA 1R8JA 4GGMX 1JALA 1W0KD 2WPDA 3M1LA 4QJBA 5AI0A 5DTJA 1KPHA 5EUBA 5AJWA 2PD4A 2RJ3A 5DMXA 4C78A 2ONYA 2W6IA 1GV0A 1I0IA 5DWQA 1XNJA 2DAPA 2J46A 3F6YA 1YC2A 3F1KA 4G6ZA 5KYTA 1R0YA 1JIQA 2NQ2C 3SICE 1SU7A 1FIUA 2XXAA 1HT0A 2Q2QA 1TC2A 4YJ2B 3BRSA 5KQGA 1QO0D 5A4DA 1C7ZA 5TMPA 1XTBA 1JTEA 1RFLA 1B93A 2VAPA 1Y6QA 3SCZA 3FXAA 5LD2C 1RSZA 3BFVA 3NO4A 2OG1A 2WEKA 1OREA 3OOYA 3WGNA 4E5VA 3IBGA 1MG0A 2FZVA 3E03A 3TR0A 2H2HA 2P65A 1L4HA 1LBIA 1Q22A 2GN9A 3LVBA 3OT5A 4OB8A 1G2IA 3VH3A 5K3AA 1R8QA 1PNRA 4OA5A 1Z45A 2FMKA 4PZ9A 3UY4A 3U62A 1C3XA 2DPLA 4URZR 3IO5A 4P83A 5CNMA 3GAAA 3IQEA 5KTKA 1JH8A 3N07A 4J8PA 1HDRA 2CLSA 5JPDA 3BIXA 5I8WA 3F3YA 3DBHA 3RUCA 4OA8A 1Z2CA 3SAJA 1X15A 4MS3B 3CX6A 3QF7A 5AUOB 1LPAB 4DNFA 4JVOA 1CRPA 1UIRA 1ZOLA 1JB1A 1SB8A 1SKYB 1IUPA 2DWQA 4RTJA 2GGSA 4QDUA 3QKRA 5G0WA 2PIDA 4OLBA 2UXBB 2IEIA 2X1HA 4KE7A 3DTVD 1ZJ4A 4TSKA 3ZZTA 3U80A 4O8CA 5E4YA 4X93A 5ED0A 1JJIA 1HFWA 3H1GA 1C9KA 3LF1A 4NNOA 4WOJA 3THXA 1REQA 4IFBA 5ALSA 4U3JA 2IPMA 3N8IA 2RGYA 2PBZA 2X14A 5KNLA 2Z30A 1B76A 1I7DA 2KBEA 3V3KA 2VOJA 1I1QB 1J9ZA 1ECFA 1T36B 2YJGA 3FX2A 4RTLA 1T4CB 2QAGC 3KKOA 3QE3A 1RWXA 4LTMA 4MWGA 3W9BA 1Z68A 1EXNA 4HS4A 1HEUA 2AKAB 3M4NA 5IEJA 3T1YB 4JLJA 2P2DA 5LSAA 5TIIA 3EUWA 2VYND 1WLYA 5C5IA 3Q98A 1VLJA 3TKAA 1DBSA 2AZDA 2ZJOA 2FWMX 4R84A 2RGRA 1QM5A 3DTVB 5D51S 1F8YA 1RU3A 2OBLA 2FN9A 3LPLA 2LVBA 5EMLA 4BRSA 1XTSA 3GELA 3LWDA 5ECDA 5JVDA 3T1QA 3UUGA 1K9VF 1VL1A 1YA4A 1OX4B 3B5JA 3FOBA 4AWBA 7REQB 3U4AA 5A0VA 4QUKA 2JJ2D 4R2HA 2ZRQA 1U2SA 1T2CA 3F4KA 3AKEA 1DC6A 1DBRA 2PU5A 5SZIA 3BFXA 1Q50A 2GK7A 5DGCA 3SEAA 1KPGA 2A88A 3HWSA 2Q1UA 1C4KA 3UOAB 1XKXA 3LHDA 4E1AA 2OG2A 1ZJJA 3AUXA 4TV9A 4JP8A 4DDTA 3RAEC 3I8XA 2Q5QA 5ALMA 3AUTA 4JL8A 5KMGB 1DLIA 2BONA 2MU1A 5FFMA 3U7QB 2NZUG 1JDSA 3RTBA 1AU9A 2YJZA 1YSCA 2PS0A 1P1RA 4JMPA 3RLIA 2G76A 4DXAA 2QPAA 3UKDA 3I6ZA 3VPDA 5H0IA 4L57A 5J2TA 4IDPA 2FFRA 1QKKA 5TQ2B 3WGZA 3PEYA 1QLWA 1U7HA 2ERYA 2OENG 3OH8A 4U8HA 2NU9B 4GH5A 3K0HA 3MIIA 5IZCA 3VRHA 3AUJB 2ZVPX 1PUXA 4FFBA 3VZDA 4TYNA 3UT0A 4LRSB 1G16A 1MAUA 2CCGA 5DF1A 4DS3A 2Y99A 3DKIA 3SLGA 4DCSA 4CM3A 3QLJA 4LKOA 2AOTA 3T34A 1VHLA 1CIPA 1XTZA 2NPOA 3QU5A 4MW5A 4N03A 2BM1A 1N2HA 3SXUB 4D4MA 5LP6F 2REQA 1A98A 2XVZA 4HFJA 3TSAA 3JQ9A 1Z8NA 1ZN9A 5LU9A 3NRJA 1N0HA 4B7AA 1S9HA 4IF6A 3OJLA 1MAWA 2MSLA 4HRAA 1E62A 4FIDA 4TQ9A 5FPYA 2TECE 2R1TA 3GJ8A 1KC1A 4LZWA 2G09A 4X1YA 4J7XA 4H6VA 2EG9A 2Z09A 1R8XA 2P6PA 2VR1A 1NVKA 4FGSA 5HXAA 4MI3A 2JRCA 1F8UA 3C1OA 4R3NA 4MARA 2GSWA 4Z8XA 5AWFC 3VH2A 1GTRA 2PUWA 3LHKA 1AQYA 5LYJB 3NLLA 3HO6A 1DOZA 1SC3A 1T35A 1DFGA 2EZTA 2Q6IA 5G2OA 3WMWA 2HU7A 4DLTA 2QQ0A 4LXHA 1X1BA 5EIEA 1SXJC 2VLIA 5D5HA 1L8QA 3F4BA 3FB4A 3G5AA 1OXTA 4R98A 3MYRA 5GJBA 4P4LA 2JJMA 3H5TA 4R2MA 1ODJA 2Q3BA 4QU9A 4UTOA 3PDUA 4JI5B 1LW6E 4D81A 4G25A 1HNWB 5TMDA 1C30B 1QJCA 1OR8A 4X1OA 3NTRA 3V2GA 3EG5A 2C96A 1KXZA 3OQJA 3WLRA 1S4QA 5CBKA 3KJFA 1UMBB 2YJ4A 3LHIA 3RAPR 3TRKA 3DD5A 1W5BA 1WMDA 3GARA 4H7EA 4NI5A 2X7JA 4LX0A 3FF4A 4BNVA 3MTQA 1JZSA 2O5EA 3CX8A 4YY3B 3BT7A 1BHQ1 3ZIDA 1BMTA 1NXWA 2AD5A 2NSHA 1DHRA 3MOSA 3EGVA 4MKRA 4P81A 3SN6A 4BGUA 2GQ0A 3EIQA 3ZBPA 1RNLA 2OWDA 1V7QA 1Z2EA 4M9XA 4Z0NA 1TQ4A 1V41E 4WZ6A 1PG5A 2I99A 2Y1EA 3RUPA 3RTDA 2FUG6 1LNZA 2VQ6A 4XFDA 1YK1A 3PT5A 5BV7A 2G5CA 3GFFA 4H3VA 5EMMA 4L4XA 1G3QA 4HAOA 4C4YA 4X41A 1GJRA 1EJ6A 3FN4A 2FI1A 2VZ8A 4YMIA 4ETNA 4B3JA 1Q6YA 4JXJA 1HV8A 4QX6A 3ZWNA 2Q7XA 4X94A 2KHZA 1TYBE 3CLRC 4LZZA 5FBVB 4JR2A 1X80B 5EZQA 1E94E 2BJVA 4EB6B 3K6KA 4ZAXA 1BHJA 1GL3A 3L9WA 4LJ6A 3HVUA 3IDSA 3NCHA 4OKIA 4M89A 1EJ2A 4Y1EA 3JASA 2O8BA 1QYVA 1E9VA 2YDXA 2P5SA 1I10A 2QRVA 3RNOA 3OQMA 1FDIA 4S2EA 4AXXA 4DCMA 1A5SB 2JFYA 3HSYA 4KJXA 4C4PA 3Q0EA 5CD9A 5EMJA 5FUBA 5YASA 3PQDA 3LC7O 4Y2UA 4PVDA 4RNCA 3GMSA 4QDZA 3QHAA 1APBA 4QM6A 2Y4OA 3OX4A 4A6PA 4D44A 3O1LA 5FOQA 4BWYA 1PO7A 2O9JA 4KV7A 1J33A 3BC1A 3AVTA 2HIGA 3X2EA 3IV9A 5ALJA 3VNBA 2JLZA 3IDAA 3MTEA 4GMHA 1NU6A 3DMYA 2C98A 3FTEA 3GJTA 4ND8B 2PL3A 1WV1A 1YJ8A 4ATNA 1U1IA 1H9BA 4WKGA 1KI4A 3WLHA 1UPBA 1T5SA 3NT4A 5G02A 2IXAA 4LYAA 1DT3A 3TZQA 1U9YA 3VM6A 4KQ9A 3WMFA 3BA1A 1DAHA 3P9CA 3O9ZA 3W04A 1F51E 2MSEB 5I3ZA 4L5YA 5E9AA 4EW3A 1RM3A 2G9QA 5TRTA 4NMHA 5EIXA 4LTNA 3SQNA 1VG1A 4Q4AB 1H3FA 3AINA 5DHTA 2E87A 1R3UA 4KO2S 1F2TB 4X1KB 4FS3A 4ND6A 4GG1A 3BRQA 4UTVA 4JASB 3COPA 3EAGA 3D4NA 1YDFA 4DN6A 4ASUA 4MUBA 4CL2A 1ISPA 3DMFA 4MA5A 4OU5A 4NJEA 1IQPA 2WUVA 5FO0A 2W70A 2XMRA 3S8EA 2R6CA 3HMQA 4DR6B 3QLVA 3GP5A 3R20A 4OXKA 2RBKA 3DZGA 3KU4A 4WVFA 5M3BA 4FDLA 2Q5FA 2QTZA 4OMFG 5JZSA 2ORVA 3VDXA 5JASA 1QVZA 3THRA 2LKDA 4QPJC 4F8EA 3FSRA 2NW6A 2ZJ3A 1UK9A 3M9XA 4Q66C 4B79A 2X58A 1WX1A 5HYVA 3WWDA 4U7PB 3W1WA 2W2OA 1A5AB 3MPUA 3ECSA 4MV1A 4PC2A 3W5VA 3N2EA 4C7OB 2QUJA 4XGIA 4BNGA 1LDBA 1Y6RA 4YAEA 1PEKE 1H1LA 1HRKA 1RLIA 3BIJA 1IWOA 3TDNA 3IPCA 1O94D 3GPBA 3OHMA 2QRMA 1O03A 3N8NA 4BB9A 1KYQA 1HZZC 2O7VA 3T3PB 1SVUA 1WCXA 2HBZA 3HO8A 1M73E 4EL0A 1BVHA 1MVOA 4RY9A 2I4RA 4R3WA 1O96B 1EVYA 5IHXA 1GG5A 4MWOA 1XI2A 4W9NC 4JS0A 4BQOA 3C15C 1J5EB 1EZ1A 4RF2A 3S7ZA 2AHOA 5JS2A 1N0IA 5LM3A 2PL1A 3PLAE 3D5EA 1A71A 1KWGA 1OH8A 3RS3A 2AF3C 1TF7A 1XLTC 2H7VA 1PT7A 3F6CA 4DMHA 3WTBA 1ZUNB 1Z0ZA 3LHFA 1VMAA 4IDDA 4JP5A 4XDYA 3GLHB 5JVDB 2WYWA 4EKGA 1Y5LA 3CH5A 3LZDA 3CZ9A 2Z1DA 1XTPA 1E6EA 5E6RB 3VDQA 2P3LA 3DVAB 1DBQA 2IU3A 5CH8A 3CHYA 1QIMA 3HGQA 4MP6A 4MAFA 3A37A 3EDMA 4WFQA 1UMDA 4M7OA 3IURA 3LX5A 4RUKA 3EZ7A 4MYCA 2LE0A 2OB2A 1EWQA 4JYMA 2P62A 3Q2KA 1LPNA 1HURA 3KHTA 1JYFA 2QZJA 3QWBA 2V8OA 1KI6A 5E6SB 2Q5LA 2FR8C 2W6NA 3DDNA 3S2FA 3ZGVA 4BQEA 3L1KA 4S35A 2C29D 2JI6A 3OU7A 1YR2A 1YZVA 3Q2IA 2R6HA 1ZK3A 2P2YA 4TLCA 4BNMA 2PT7A 3JVIA 1VJTA 5KAPA 5B7PA 2GCEA 3THWA 1PFWA 1O95C 3ANXA 3E3MA 5H80A 2A35A 2D5BA 2F3QA 1ZVVA 1M1UA 3DR5A 2DR3A 2I2DA 2PMFA 3LBNA 1TYZA 1CWUA 4B3DA 1RRMA 2PL9A 1EUCB 1CIJA 2FR1A 3J80A 1Y4SA 1U04A 3OAAD 3TQIA 3UJDA 4ENRA 5CU7A 1W4BA 3LMKA 1W52X 3OU2A 5HF9A 2WFLB 2BV3A 3BH6A 1C3OB 3N59A 4NCAA 3S1AA 1XJWA 3QKTA 4HDSA 3AETA 2C84A 4CUZA 2C7QA 5BSMA 4QNRA 4AUNA 1AT1A 3KJIA 2DJ5A 1PNVA 1M6WA 1ODTC 1Y81A 1R0ZA 2J3LA 2ORWA 3R5TA 3M82A 3K1ZA 2JJYA 2RB5A 2ZIUB 1H3NA 2GAIA 5JSYA 3WLMA 3WS7A 1HH4A 2DX7A 4XR4A 1MQSA 3QK7A 3TJZA 1QHIA 1EZ4A 5TNXA 3UK0A 1G1AA 1ORTA 5G0SA 3UG6A 1PRYA 1SXGA 2ZANA 4KIJA 3M6AA 1G8JA 4TVSA 5KJCA 3U49A 4AX8A 2H52A 3NIDB 3MJVA 4POAA 5JCJA 2CDAA 3MTDA 2CYAA 3LFHA 2I8AA 1IAQA 4R1NA 3ITNA 1J4AA 1RHMA 4REOA 1EM8B 1E1YA 1EJ0A 1SUIA 5K2OA 1OH7A 3D7LA 2WK1A 2L82A 2J08A 1UJNA 2HF7A 3HKCA 3ND6A 3DC2A 3NNNA 4RLHA 1FFGA 3T3MB 1N9KA 2VIIA 1UFQA 3KALA 3W2EA 3T54A 2WJIA 4H0FA 3AEUB 1N8TA 3VPXA 1I80A 4FMCB 1JVSA 4HQOA 3KXDA 3QU7A 1KH2A 2ZYSA 5KKCA 2Q3MA 2YYYA 3CZRA 1ZHFA 5FWYB 4CHTA 2RGCA 2OCDA 4Q15A 2VUIB 2WD7A 3GLFB 4GL2A 4TM7A 3ND8A 3NKLA 3C3CA 2QX7A 2IYSA 2G9NA 3ZZ1A 4DLSA 2GZ2A 5TDHA 4LWOA 1BDHA 2P9QA 3H3XA 1KP3A 3WRXC 2NADA 1F8GA 3O4JA 4LC1A 4CKEB 3H75A 1K5GA 3PNSA 3L1VA 5IJ0A 1Z0IA 2CGEA 3PRKE 4OGGA 4HEHA 3TZ6A 4EJ2A 4LJKA 1JQ3A 5DTEA 3SDSA 1SQ5A 5B1YA 5AVZA 2N1BA 3BTOA 1MAHA 4AKEA 4BQPA 4XWOA 2FEMA 1E99A 2I6SA 2VT2A 1V3QE 3MT7A 2JGKA 4R2JA 1SVNA 3B52X 4L9WA 1ULHA 3VOAA 2OCKA 1ZOIA 4GQAA 5LJLA 1T1RA 1CR1A 3PL1A 4DR3B 3MJTA 1F4PA 1NHGA 4QXOA 2HB6A 3U7FB 5DXJA 4DIMA 1XZNA 2J07A 1TRHA 2O1WA 3IAS6 3ENNA 3PX3A 4ZVTA 4DSOA 1ICEA 5LD2B 3VJRA 3QI7A 1KZYC 1HE5A 2BF7A 3RUEA 1DCFA 1NLYA 3JRXA 1IMOA 2JF0A 2X4GA 4PPGA 4EO4A 2JAHA 4EY5A 1SCBA 3VZSA 3H4TA 4U39A 2LD4A 2C9OA 3MOIA 1J07A 2D1TA 3DMPA 3G1TA 1E5DA 3CLSD 3NR2A 5AJYA 1TZKA 2HSDA 1Z25A 3MJCA 1XE3A 2KLHA 4O4JF 1C4XA 1DEOA 1U4SA 2G82A 3LYHA 3JYLA 3L82B 2PVSA 1NUHA 3FI9A 2OCYC 1I8TA 2PLWA 3OI7A 4A0QA 4N5NA 1FNMA 4MX8A 3UCFA 4K0KB 4HAXA 5DBHX 1E2IA 4RXTA 4FBMA 1YI0A 3RC7A 1SZDA 4X6LA 5LBIA 1EPUA 3DB2A 1OGYA 5DHQA 2XVMA 3RTGA 3NIBA 3D7MA 1WO8A 3DLBA 1E60A 4AP6A 4TX1A 2Q28A 1WOYA 2I7DA 5D1HA 1P44A 1XEWY 1ZSVA 3OX1A 3I04M 1MC5A 1JILA 2OE2A 3BK1A 1IBMB 3VV3A 1AQJA 3BWVA 3E0XA 2FHPA 4KAFA 4YQZA 2L2QA 5ULLA 1N2SA 2EX0A 2ZB8A 3EHEA 4F3RA 1GNPA 2P9EA 1MB9A 4EGFA 4CF4A 2HSWA 3OHSX 2P11A 5IANA 4OHFA 3MWGA 3U7HB 4N01A 2CB0A 1P5RA 2XLBA 3M9WA 2QUBA 4PPQA 4Q1EA 4BU0A 3BMXA 3C5WP 3JZDA 1ADFA 1UKBA 4LHEA 5ILGA 5D3MB 4YAKA 4TVBA 3DV0B 2QAGB 1N5RA 5AVQA 2WLSA 4G56A 5CITA 3BILA 3RPEA 3THYB 1AUQA 1PZGA 4BRWA 5DTIA 2E4XA 3GA5A 1J6UA 3PQ2A 5DM2A 4NYMR 4RTQA 2BM0A 3KSDO 1BVRA 5HRCA 2O3UA 2JIRA 4J0KA 4YALA 4L5CA 1OTYA 3DFFA 3ZE6A 4MV6A 1B8VA 2R66A 3NP7A 1D03A 1LRKA 1H5UA 1T6NA 4FDAA 1U0LA 3S4YA 5HRAA 1G8FA 4AMUA 4MCJA 5CDGA 3EMBA 4D6PA 2GBCA 2ZI6A 5JWRA 2FOIA 1P75A 2RC6A 1TVKA 3KUUA 1E4EB 4LW8A 3NWPA 4FLMA 4NK5A 4OI2A 1MHTA 1NF3A 4NBRA 1PV4A 1UK8A 5BSTA 4ZQIA 1TVCA 2Q9CA 5I9NA 2J9FA 4TWJA 5CEFA 5MN4A 1NXPA 4D6XA 2IBTA 1J90A 4UTPA 2B5WA 1X70A 1Q3HA 1LSJA 4WUVA 1HYBA 2W2TA 5EJGA 4RLQA 5GONA 4YRPA 4DYDA 4E1VA 3GBSA 3N2NA 5CB4F 1XVLA 3M5CA 1EXDA 1JW9B 2EJVA 2X2FA 2IBSA 4QKQA 2WU1A 1U7XA 1NQXA 4B6EA 3SQWA 1ZM4A 1M7GA 4HZIA 1OIVA 4CKWB 1AKMA 5C7IO 3C70A 3QV2A 4H7FA 4O02B 3VTZA 3DDSA 9LDBA 2EEZA 3DTYA 4RK0A 4OKSA 1MAVA 1JDJA 1G7RA 2WIFA 1IB6A 3HZHA 5LUBA 3DMTC 3LM8A 1G5IA 2F3TA 1Z2PX 2PHZA 5DLYA 4R71A 1SXJD 2B99A 1XQYA 2QSYA 1IAVA 4P3OA 5AIAA 3WLNA 1V8OA 1T3GA 1S96A 4PX5A 4ZHQF 3JWPA 3ZHVA 4ZYZA 2ZI9A 1JDZA 1P9NA 2V96A 3NYIA 5G0TA 4A8JA 4O2LA 3BFPA 3NAQA 2BHTA 4OHWA 1DC5A 1GKUB 1RXSA 3AB3A 3ZE2B 1E6MA 3EDQA 4NNJA 4L22A 5CPFA 4C0BA 3OFKA 3T9CA 3VGJA 3T5DA 2VWPA 1YB1A 3FMOB 5H1YA 3OQOA 4OI1A 4WQMA 5HKAA 1Q3TA 1NY5A 4NPCA 1C9EA 1E66A 4AP9A 1NP7A 3AXSA 1IG3A 3IIJA 4PG8A 4MVCA 1XVTA 5F2NA 4D02A 2QR5A 2HJRA 4K8OA 4YRNA 4CMGA 4C6TA 1SXJB 3QH4A 2M6RA 3GLVA 1DS6A 4YJ3B 1TADA 4D9HA 4R1PA 3PQ6A 1OQAA 5FNVF 4D9GA 3PQCA 1KA9H 1M34A 2E3JA 4IF4A 2ZRJA 2VH1A 5CDFE 2YHUA 3G9XA 1EDOA 2YY5A 4MEBA 2OA0A 4N6NA 1U9JA 1IOWA 1YRWA 1GCOA 2V3WA 2WAMA 1ELOA 2GD6A 1PLKA 1L1FA 3GUVA 2VYCA 1J0XO 1X7ZA 3R76A 4RGBA 2V7WA 3QEOA 4UVEA 4J76A 3CLRD 1N5OX 5K6AA 3AMVA 3PNBA 2XD9A 4NRDA 5JRDS 4MB0A 1ZN8A 3AEQA 3ZGYA 4RAQA 4YA6A 5FTWA 4ITUA 1HOTA 4ZC8A 1MIHA 3BXGA 2FJPA 4AN1A 4C03A 4XIJA 1OWPA 3NH9A 3SZOA 3LPDA 1W34A 4EK9A 4ROSA 1Q1AA 1G0OA 3DDZX 4XPIB 3R0VA 1XRPA 4UDOA 3EIWA 2OXEA 4HAZA 5KSWB 2PGAA 4ZTZB 4ZK2A 2XMBA 2H5JA 3OJXA 1ZIDA 1PJCA 1QBGA 1ZRHA 1Y7HA 2QAIA 3LWNA 2BE9A 2QD4A 1YZHA 4ZQEA 2WJPA 5K0LA 4CIBA 4HQLA 2LWIA 1ZNYA 2AZTA 1Y4UA 2VXOA 4EY8A 1QR2A 2FZKA 2ODBA 4FHEA 5H02A 1K8ZB 5I7RA 1O0CA 1ZGJA 5ALTA 3WK9A 4RZIA 1W88B 3PUVA 2RAFA 2HW8A 4JU9A 1V11A 5JLJA 5JXIA 1GRQA 3N86A 1KZ4A 1QHXA 1ONNA 2OHJA 4J2OA 4OK6A 4MQUA 4IJMA 4IV0A 3TPZA 3TSWA 1QQAA 1T6YA 2P27A 4AZ0B 1E5VA 4AURA 3SQDA 1RP1A 4KBGA 2CFRA 2DE0X 1PEAA 2J31A 2JHGA 4H0NA 4BJ3A 3AUSA 3HDQA 4PYMA 3PI6A 3LOQA 2V0GA 3ZPXA 4FDMA 4NFYA 1GNLA 2PX6A 3CG0A 3H9EO 2GF0A 3KB2A 1L7BA 3UJ7A 3FRHA 4QUGA 3BK7A 5FA6A 5LQAA 1H22A 1TQ6A 3D54D 3I64A 3QW2A 1B2RA 4B17A 1UZAA 4P3YA 1Q14A 2A9FA 5B30A 2OD2A 4KYTA 4MGEA 1U8FO 4HNRA 5LC1A 2YW2A 3LPMA 3R7DA 1XXHB 3FDZB 1JSZA 1U1FA 2DULA 1ECLA 5IAAA 1Z13A 4M1EA 3BREA 5BSGA 3ZJVA 4GP6A 1PLJA 2P9TA 2ZJ7A 5KC8A 2F64A 3OCWA 2FJUA 2H2WA 3L8EA 4ZYVA 1K4MA 2QLTA 3N0VA 4YWHA 4YXWA 3T7JA 3TLGB 2IC5A 2B69A 4JY7A 3GT3A 1Q83A 1KKMA 3CF0A 1W25A 1CS0B 3ACBA 5DGDA 2GKGA 2R1VA 4KB5A 3HFRA 1I51A 2BEUB 3C6KA 2BKXA 1PJLA 2VTBB 4KWIA 4LJRA 2P67A 4HQKA 3Q11A 2EQAA 5JNRA 4DM3A 5KOJB 4QZVA 1IY2A 4CF7A 2YFKA 5LLDA 1P45A 2WT8A 1SQSA 3LWBA 3OOSA 1C0EA 4UHDA 4YRJA 2IZ0A 1YC5A 4P2GA 4D4KA 1WPXA 2PS9A 1MDBA 1QX4A 3LKZA 4Q02A 4QLOA 5K20A 3BQ9A 3WKBA 4GLBA 3PNPA 4X7MA 4OVKA 4HNQA 4B9AA 2PGXA 4DC0A 1PFUA 1N7GA 3AJAA 4DDWA 5JD5A 4Q3KA 4WN3A 1JTFA 5A5GA 1Y89A 2ZAGA 4RMNA 5GGXA 1FZQA 4MYTA 1ESMA 1GG8A 3C3AA 2JI8A 1H2YA 1GGHA 2YW9A 4UULA 1FA9A 1E9AA 3JWIA 1Z82A 1ZL0A 2QRHA 1RPAA 3LGXA 4IIBA 4HLCA 3W4KA 3PLNA 3K9CA 1NVUQ 1PNOA 4JA2A 3AG6A 3Q3VA 1P1JA 1KO4A 4A82A 3OEYA 1JYEA 5CLHA 4HNVA 1R0SA 3A6FA 5UKDA 4XVHA 1Z37A 4WOBA 3PHCA 3GVXA 4FSDA 1OYWA 4XIYA 4KLRA 3HRIA 1X1SA 4J7AA 4WLVA 3NBAA 2O8EA 5FEMA 3O75A 4BRZA 2V3VA 1X8JA 4ENTA 2EYQA 3FFWA 4I1UA 4V39A 2QPOA 2QRKA 3IEPA 1XLWA 3A9TA 2OO5A 3IJ5A 4LS3A 3UOGA 5ADVA 4MVWA 4NFLA 1ZOSA 4BPBA 1TQHA 3L46A 4L8WB 2ZE7A 2F90A 2XGOA 2DECA 2AG5A 3SJ7A 3V48A 4FZVA 1K88A 5JI3E 2VPYA 2W71A 1L8OA 3BE8A 4ML3A 5EIAA 1IEXA 3H2BA 5AO9A 1DG3A 1JLSA 3MBOA 1I7QB 3CH7A 2Z43A 2O4UX 1K89A 5DULA 3BULA 2M1ZA 3IAS1 3M81A 2O19A 2O7QA 4GOMD 2IYEA 2KM1A 1PWEA 4E51A 3W5AA 4OL9A 4DA8A 4FFRA 4IRMA 4BATA 2FEXA 1M0EA 3L9XA 1SN7A 2BFFB 1Z6AA 2VFAA 1PW5A 1R5JA 3WJ7A 3PFGA 1HE8B 4L1KA 4F4CA 4N8EA 4B3GA 2XH8A 4RC9A 2E5FA 2HHJA 3HDHA 2WAOA 4B9EA 3ODPA 2B9EA 1I2MA 4LBWA 4MUEA 1E2JA 4R9UC 5CXSA 2I8CA 4RJLA 4XVCA 1HG0A 2I6UA 4TKVB 4Y2PA 4RMHA 1AS3A 1V1MB 1QHFA 2DTXA 2YICA 1MO2A 1CF9A 2AQHA 4Z0HO 5LU8A 2EZ9A 2WMNB 1OBFO 1YE3A 1V5FA 2OBMA 2Z4SA 1NNSA 2J41A 3LH5A 4EWLA 2WQ6A 2XKJE 3DFIA 4R2XA 2F8LA 4B6GA 3E81A 1WNTA 4PC1A 2WB2A 4L0DA 5CIQA 2CDRA 1E3SA 2OAGA 4DJJA 2OCXA 4JLBA 3KQNA 1J06A 1ZD1A 4CJXA 4R0VA 1E4OA 5F5LA 4U9HS 4MJ7A 5CA1A 1JH9A 4PYRA 1ZAYA 1WDWB 4L8VA 5LYYA 3U7GA 3FNIA 3HCEA 4I55F 3B82A 2PYDA 4YRCA 3UXHA 4RQBA 3ZE8A 4CCSA 1EVEA 1SA0B 3ETNA 5FXMA 4AY6A 3OEED 5EP2A 1BZYA 4F5YA 4P9NA 2Q9UA 4GM1A 4WN9B 5F12A 2OFWA 4K5QA 3GGJA 2X9VA 4B7CA 5HGXA 3ZNNA 1NJGA 1C9DB 3DOUA 3CZQA 3NAGA 3RFTA 2LP4Y 4GNRA 3B1YA 1F60A 1HLFA 4PICA 1G8SA 1ZESA 1T29A 2P90A 5LDGA 4RIFA 1E92A 4ICIA 1BXGA 3OCXA 1GUZA 1K4YA 3FUWA 4F85A 3OZSA 1K6XA 4UCFA 5GWXA 4NOKA 4ZK6A 3N8GA 3EYWA 2UZ1B 4V1CI 1GO2A 3NBFA 4S1OA 5CFQA 4CG1A 2JFVA 3DHVA 5JNVA 1WCYA 3Q6NA 1KVQA 3E3NA 3TOZA 2YYAA 3ASUA 3HNPA 4HL6A 2IWRA 3MAAC 2R6ZA 2QI9F 2XODA 1CDDA 2FE1A 4ZVRA 3I9LA 2Q5IA 3RC3A 4U6NA 1PFGA 4CKZA 4TUYB 3H5RA 3L43A 2J7KA 4L4YA 2W7TA 3NHBA 1XA4A 4C0KA 1YIDA 4ZQCB 2J3DA 2XNKA 1TT5B 3A4MA 3A6GA 1UDWA 4JBLA 3TSZA 2WDPA 4AIIA 4PYQA 2A94A 4E5KA 4ANFA 1I30A 3FUXA 1KJ8A 3KTAB 2N42A 3D43A 2GAAA 4RCYA 4A6XA 2ZTUA 4IM7A 3WLPA 1NSFA 5A71A 1TZBA 2E82A 3PGMA 4H31A 4P4SA 4WLEA 3P8ZA 3RS9A 3ZE0B 2ZR9A 1XIVA 3GEPA 4PSVA 1KJNA 4NYMQ 4UCQA 3ZE9A 1P6XA 2VT6A 4UVGA 1O6CA 4JLAA 3NU1A 3WLOA 5FF9A 1MXHA 1GZSA 3EBOA 3LOUA 1R2QA 2XOEA 4UHBA 3M6WA 3BIOA 3HZRA 2BI7A 3JQAD 3NHKA 3NEYA 4RABA 3N0RA 5D3ZA 3TZKA 3UFBA 2JIQA 3B89A 4N1AA 4ZD6A 1X87A 1BEUB 2CNWD 3ZIUA 2EJUA 2H1HA 3FJYA 5GP1A 1YTUA 1MHPA 2BEWA 1TC1A 1LUAA 4IFTA 2RHOA 4HGYA 2WQZA 3WWCA 4D8XA 2JFZA 1U7OA 4NTZA 4DCJA 3LUBA 3HKDB 3ZU2A 4W1RA 3K5IA 4XVQA 1VJ5A 4LG1A 4KO4S 1EE2A 2WHRA 5CAEA 3R8CA 3TZBA 3MILA 3M33A 3NTXA 3FCAA 4G1BA 1QAQA 3EZGA 3RHSA 3AW8A 1O0SA 2NT3A 2O8DB 3MRXA 4EF6A 1B7GO 1V3VA 3HKEA 3JQAB 3MNFA 2QQGA 1FXWF 3I9MA 4JSYA 1ZLYA 3U7RA 5KOYA 2AG8A 4NQRA 1JJBA 3I6BA 1WBJB 1XKQA 1W6RA 1Q21A 1ZS9A 1AXGA 3HCRA 3U3MA 2JVIA 2J9XB 4I50F 1E5XA 1SFRA 3EBPA 3GZNA 1DEKA 2GPSA 1YE5A 2I2AA 2B78A 3JD2A 4TV8B 3L49A 3WP1B 4HBZA 2JDIA 1R64A 4IGFA 4OQDA 1RWVA 3PV0A 3SVTA 1JR3D 4XVUA 3A6ZA 3BWDD 1A8PA 2VO1A 1P8JA 2G4LA 2W2NA 2FPIB 1AUPA 4I1YA 1VPWA 3UO8B 3GNLA 3UMRA 2XOXA 1OI3A 3GY0A 4BCCA 2GBIA 3QF4A 3U09A 1FFDA 1CV2A 1KC3A 4W1SA 4RM2A 5DIZA 3OESA 2Q0XA 1V2GA 4DOMA 1EESA 4PBRA 4F2HA 2GXSA 4I2NA 3RSLA 3WLEA 3AU9A 1JHYA 1N8NA 1PR4A 1VL2A 4LJLA 3Q8LA 4DA9A 2PWPA 2ZKLA 1T2EA 5ER9A 4UBNA 4RTKA 1Q0LA 5ELMA 3DT8A 1VLQA 2Q2NA 2I87A 3TOXA 1Z74A 2VHYA 3AK4A 5IM5A 3MXTA 3T4UA 4EZBA 5CFRA 2P35A 1QOPB 1ZSYA 4FGKA 1H05A 2G0AA 4UFNA 5FI5A 5LN1A 4TZTA 1PL0A 4PPFA 4UU7A 3IB6A 2HJWA 1DJMA 2JCGA 2XI4A 2ZM6B 3F7OA 1E7WA 3SPXA 1B1CA 2OHGA 2FX2A 1JXMA 2W48A 2BFNA 3GDOA 4NBWA 3RO7A 2YWJA 3CCFA 2X0DA 3OTIA 3B7PA 2J8ZA 1RP7A 2GZMA 3JSAA 3LLMA 4DIFA 1OA0A 3GRCA 4HX9A 4LISA 3RFCA 4HYYA 4BNUA 5LMNB 4BKRA 4D3FA 1JG2A 3R40A 5IYZF 1G8GA 3CVJA 5JW6A 2ZSAA 3M4JA 1IBCA 1KDPA 2W9XA 2FPKA 3AFIA 2UYHA 1BCRA 1VCNA 3I5UA 4WEOA 3RWMB 3PG5A 4MTLA 3JXEA 4D9EA 3F1LA 3N5CA 3OTGA 2H1CA 4BNKA 1GYPA 1OA1A 1R12A 4DIBA 1R4NB 1F0NA 4HG2A 3R7AA 1MRSA 1GG9A 4L8FA 2OHVA 3JZFA 2BM9A 3FCUB 5K3CA 2G5TA 3CO5A 4WNCA 3LS2A 1M66A 1Z12A 3KT0A 2Q0SA 2BN4A 5LP1A 3K4PA 3H5VA 4OBEA 4P7GA 3MCUA 2RIRA 1RADA 1P0QA 2FP4A 3LTNC 3IJPA 1YDMA 1XMPA 1QC5B 2H48A 3IT2A 5EP1A 4UNIA 1ZH6A 4RZSA 2XYHA 4Y67A 4C3VA 1DMSA 1ODCA 1NR7A 1G6HA 3CR8A 2G1JA 3L0YA 5U4QA 2RK6A 2EYUA 3GXBA 4HNHA 4P5EA 4JYCA 3EHDA 1LBTA 3MTAA 1TCCA 1PKXA 4S1WA 2MT9A 3KKLA 3LRXA 5IJAA 4Z2YA 5AKYA 4HZUB 4L75A 3T38A 4CMAA 3R3SA 4FIZA 1QHSA 2R00A 4AP5A 3GRZA 1T2DA 5E6UA 3DBLA 3IHTA 5I45A 1NV8A 2GEFA 3QX3A 4HQFA 1SURA 1LTHR 2JEZA 1MQ9A 4Z86A 1IRXA 1T6XA 3EZ9A 1DMRA 5ALZA 5FPTA 1DJPA 1KTIA 3FMVA 4GHWA 2JBAB 3PF9A 1HEIA 5E95A 3G5TA 3WNDA 4KIGA 1EU1A 1OBCA 2OOSA 2Q5OA 3ZLUA 1T0BA 4B6PA 4F21A 5C3MA 1QRDA 2O2JA 4W5TA 2ZIAA 4QFMA 3M8KA 4KPYA 3ZBUA 3FIUA 4UPVA 2FK7A 1KVTA 1LSSA 3W9YA 1UAAA 1VYUA 5FNVB 1QFSA 3GDFA 1Y3HA 3I1IA 1GILA 4X62B 1OIXA 2Z6UA 1OXKB 2KS6A 2ZR0A 1XMSA 4OH7A 3VI4B 4BNWA 2IPNA 2OBBA 2C5SA 2Z1MA 3BDIA 3ENWA 2V8BA 4JJ7A 3JD1A 4CM7A 1Z6ZA 4YO7A 1I01A 3I0ZA 5I4CA 1IN6A 1PG0A 3L7IA 4MS4B 1SBYA 1KKUA 3ORFA 2Z2YA 3LC2O 2X0FA 3UW1A 1PFQA 4YH1A 2AL7A 1RKUA 1F2VA 4GU5A 3RRXA 2FSUA 1P0PA 3A6DA 2VS1A 4MUKA 1EFLA 4ZQFA 3NOOA 4KEAA 4F04A 2OHXA 1PGJA 1W5AA 5G0UA 3U2QA 3M4YA 4TPKA 4TRRA 5D84A 1SBTA 4Y9SA 3EGXB 3GROA 4H3SA 2FSVC 1LJUA 4DJTA 3QQPA 1TZMA 1YS9A 4Q3BA 1JVNA 1J2RA 1WPRA 1E63A 2FEPA 4D2IA 4E33A 4Z51A 3FCXA 3KP1A 2IXDA 1VMDA 1PTKA 3URMA 1YR8A 3H04A 3CBGA 3PT9A 3LDUA 1OW3B 2HBYA 2OK8A 4U7TB 4F06A 4NULA 4B3XA 1NMSA 2DT5A 1FS5A 3A28A 4KN8A 3S3TA 3GLIE 1CZHA 2I22A 4F3KA 2GKSA 3QXHA 2D3WA 1J00A 3GDHA 4IX9A 2PJZA 1T5TA 2FOLA 4ZO8A 1ZD4A 3SYLA 3LLVA 5JYBA 2E5LB 3AVXA 4N39A 3W6ZA 4RDXA 1RWBA 3LQFA 5I7SA 3NGLA 4FQ5A 1NNEA 4ZGWA 3QA3E 1T3ZA 4BQNA 4J7UA 5JAQA 3CKLA 1ZBDA 4JZYA 3AF1A 1QZZA 3BRWA 4IDFA 1Q44A 4Q93A 3ZCSA 5JSFA 5K3FB 1PWZA 4NENB 4B45A 3NHYA 3PVCA 2FDRA 5LKAA 1GZ4A 3OE5A 4X6YA 5BNIA 4OYYA 2ZAMA 2PFGA 1X1CA 3Q3EA 4DIUA 5KWJA 1UKAA 1Z2DA 4JOBA 5HMLA 3ZWKA 3LP8A 1HETA 2FRDA 3VNAA 2W6JA 5LNK6 5DNEA 2D1QA 4IIYA 3U40A 4HNAB 2GXQA 3WC4A 1LSOA 4CL0A 1QCDA 5I3CA 1EE9A 2I33A 2FHSA 2HEIA 2I29A 1ZUIA 4JBXA 4UMVA 2WU0A 1FP6A 2HPHA 1ISHA 2R87A 1B14A 5E1OA 1JVBA 5C81A 4H7PA 3KYCA 2FZEA 4B74A 1JEQB 1CUZA