4M1QA

Crystal structure of l-lactate dehydrogenase from bacillus selenitireducens mls10, nysgrc target 029814.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
312
structure length
312
Chain Sequence
TKTSRVVIIGTGAVGSSYAFSMINQNVTDEMVLIDLDKRKTEGDAMDLNHGIPFGAPTKVWAGDYGDCKSADIVVITAGAAQKPGETRLDLVEKNANIFKGIVDQVMGSGFNGIFIIATNPVDVLAYATWKFSGLPKERVIGSGTILDTARFRFLLSEYFDIDVRNIHGYIMGEHGDTELPVWSQTRIGSEPISRYMDKYKPDGSNKDLDEIFVNVRDAAYHIIERKGATHYAIAMGLARLTKAILRNEQSILTVSTLMEGEYDLDDVYIGVPAIVSQKGVERAIEIDLNDEEMKKLHHSSNTLKDVMKPIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of L-lactate dehydrogenase from Bacillus selenitireducens MLS10, NYSGRC Target 029814.
rcsb
source organism Bacillus selenitireducens
molecule tags Oxidoreductase
total genus 97
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4m1qA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4m1qA02
1Y5MA 2BFOA 1PU2A 4D43A 1YDWA 3X2FA 1T26A 1WLYA 3GN1A 5DF1A 4C4OA 1P33A 3O03A 1KY4A 2RHRA 4XYMA 2UV8A 3I9MA 5H81A 2JHFA 4Q3EA 4HWKA 3LF1A 3JYOA 3O4RA 4FPXA 3WQRA 4RZHA 4CV0A 5G0VA 2QIOA 1RKXA 4NBWA 3ZV5A 2VUUA 4PZEA 4K1LA 1H93A 4Y6RA 3KYDB 1X13A 2OBYA 2HK7A 1PX0A 3DAPA 1K0UA 2HJRA 5EPOA 1AXGA 3V2GA 2PZLA 2IEDA 1LDGA 4NJOA 3DHNA 4XGNA 1YB1A 4UAGA 1UAGA 4PZDA 1YB4A 3N74A 4NBVA 4BNMA 3MZ0A 1PZHA 3DBLA 1XWFA 1ULSA 3DZKA 1Z7EA 3TZKA 2W2LD 1BRMA 3KXDA 5DBGA 1U4OA 1T2FA 1GZ6A 4IJKA 1NM5A 1PJLA 2JFHA 4LCJA 3HB5X 1ZCJA 5B1YA 2ZYAA 3JQFC 1PZGA 3V5NA 4WGGA 3INRA 3ROMA 4LGVA 3RC9A 2DPHA 3GZ4A 3BYZA 4E6PA 4BO2A 4R9RA 4A5OA 4ZU3A 3CZMA 3D64A 3V1UA 5ADHA 3ITDA 3NDRA 3NAQA 1TT7A 5BSEA 4PLGA 3KYCA 4RVHA 1ZVMA 1B16A 2VRBA 4RPGA 1VSVA 5GZ1A 4CLHA 2Q99A 2ZIZA 1R12A 3ZWPA 2G0TA 5C3MA 1VSUA 3HSKA 4K28A 1U4SA 2Q1UA 2W4QA 2NVUB 1JN0A 3WR5A 3ZDFA 2P2SA 3UH1A 1RM4A 1LRLA 4YYZA 4WKGA 1KERA 2Y1OA 3F9IA 3JQAD 3H7AA 4EBFA 2V6FA 4J4BA 4JCOA 1EVIA 1UJMA 4YDRA 1L1FA 4YJFB 4WPGA 1YJ8A 2VUTA 1U7HA 3BMQA 3C7CB 2EW2A 1FDSA 2B37A 1BDMA 4IJVA 2QW8A 2H9IA 5FI5A 3JQBA 4MVJM 4ZQEA 1TI7A 1LDEA 1T2DA 4R1SA 2A92A 5TIIA 1Y5RA 3JQ7A 1T2AA 1XU9A 5C37A 5HS4A 4YBZA 1D1TA 4I5GA 1A9YA 4MVJP 1XYGA 4O1MA 3WLEA 4YR9A 1DAPA 3B70A 2GNAA 1MC4A 3DTTA 5EINA 3OIDA 2JJYA 2FR0A 4UVDA 4FB5A 3RU9A 5T57A 3ASUA 3VZPA 4D42A 4CM4A 1AGNA 4YPOA 4PVDA 3F4BA 3RI3A 2YHUA 3UOGA 2OOSA 4Y8VA 1B15A 4DBVO 1HSZA 1IZ0A 1NFFA 1TXGA 2EGHA 3AY6A 4OSPA 3QHAA 3W6ZA 4B79A 1TT5B 1NP3A 3PTZA 5LCXA 5KVCA 2NWQA 4NK5A 3AUUA 3LT1A 3MOIA 4E21A 3VVCA 4NNJA 3HWRA 3B20A 3SC4A 2G1UA 1NXQA 1JWBB 2GASA 4AJ1A 3TZQA 5GZ3A 4WCDA 2YV3A 2EKQA 2OGUA 3L4BA 4S1VA 1GADO 4CM8A 5LDHA 2JL1A 2A9FA 3OEWA 2XAAA 4F45A 2FSVA 3I5MA 2GLXA 4NMHA 1B14A 1C1DA 4QXMA 1G6KA 4MP3A 4XYGA 4IQGA 3VKVA 2CD9A 4UEJA 1Q7CA 2HJSA 1ZEMA 5HS6A 1A7AA 1ZSYA 1DJNA 3CPSA 3PJFA 3TL3A 3C7DB 4E4YA 5IDWA 3OJEA 3ZWWA 4NDNE 1C0LA 4XKJA 3QA9A 1UAYA 5C7OO 3GGOA 1RM5A 2C82A 4KWIA 4AVYA 3M2TA 1ADGA 4IDGA 3AI3A 1I0ZA 1YWGO 2LDBA 3JD4A 5K9ZA 3F1KA 3TNLA 3IUPA 1Q1NA 3AUAA 2EHDA 3PZRA 3TQHA 2VCYA 3FPLA 3AUSA 1LLUA 1I36A 1O5IA 2CF6A 1EFKA 2HUNA 2VHZA 5TSDA 3IQDB 4N54A 2BHLA 1N1EA 4L76A 1IL0A 2AW5A 2HLPA 4PLHA 4RVFA 3NRCA 3WNVA 2QYTA 1GEEA 2WD8A 3U62A 4JBIA 1IY8A 4D7AA 3JSAA 3S1LA 3CSDA 3G49A 5COQA 1BSVA 1I3KA 4IDBA 4CMEA 4J49A 2YV1A 1GY8A 4XRRA 3H65A 2UAGA 4F6LA 4IDEA 3WGTA 5JCXA 4IUYA 4BMSA 1NWHA 3OQBA 3ZHZA 5JLAA 1OOEA 2DBRA 4XJTA 1R4NA 4BNTA 3WFJA 4M1QA 3DBRA 3Q9NA 3K96A 4DQUA 4DA9A 2ZB8A 1G0NA 4U6SA 3LT4A 1I3NA 1WMBA 3HQ4O 4AFNA 3E9QA 1UDAA 2E48A 5HBRA 2D3TA 2DBZA 1GV0A 4BKRA 4PLVA 1ISIA 3I9JA 1PGQA 2O3RA 4J0FA 2JCVA 2E49A 1A72A 1F14A 5I7EA 1LJ8A 3LDHA 4Z6KA 1V9LA 3KLMX 5CAEA 4B8WA 2AE2A 3DR3A 3NTQA 3WNQA 3COSA 5A3VA 5A5EA 2E4AA 4FFPA 4J6FA 3JQBC 1Z45A 3LT2A 5G0SA 1HDGO 1SC6A 3TF5A 1KS9A 1Z7BA 4YXFA 2Y67A 4B3JA 1NPDA 2JFGA 5K0ZA 3V1YA 3K2BA 2NV6A 4B3IA 4CM1A 2O3QA 4CUJA 1R16A 3WICA 4MVJH 3GR6A 9LDTA 1P1FA 2P4QA 3B1FA 2X6TA 3JQCA 4D3FA 4R41A 2X1HA 3UICA 4HFMA 4DIFA 1CQIA 4AJIA 1YOVB 3QV1A 3GH3A 3LLVA 4J4HA 1M2WA 4FJ0A 4KUEA 1IYZA 1GYQA 1DBVO 2O4UX 3JD3A 3NYWA 4IGFA 2UUPA 4Q3BA 6LDHA 4YVFA 4BO8A 1DIBA 4H15A 4J3FA 3RC1A 3NT2A 3VPHA 2EP7A 1MG0A 3WYEA 1VPDA 2OZPA 3OICA 5IDYA 3P5SA 2WYVA 4YJGA 1PS8A 1I01A 3R0IA 3NV9A 4TRRA 3JYQA 5C7LO 3RU7A 1Q0QA 4EDFA 2PNFA 4RVGA 3L4BC 2V6BA 4CMBA 3DBHA 2Y0CA 2VZ0A 3QWHA 1ENOA 4NHEA 4PLPA 3FNGA 3IC5A 1QLHA 5F1PA 4HUJA 1SEVA 4QQRA 3F4LA 1A5ZA 1JA9A 4FC6A 1T4BA 2Q1WA 4GGPA 4CM3A 4N5LA 5A9SA 2AG8A 2BGKA 4MVJI 1BG6A 5TQVA 4ZVVA 3C1OA 3U5TA 3C24A 1A9ZA 1SPXA 3WOHA 2B4QA 4LSWA 3TFOA 3P2OA 1LDYA 2NLOA 4DPMA 1B8PA 4J1QA 4YAIA 3LSYA 3QWAA 5TT0A 2NQ8A 1PGJA 5KVVA 5C7IO 4U0JA 3SVTA 1CF2O 2BF7A 3QP9A 4ILKA 1YQGA 2PWZA 3N58A 2B69A 4JJIA 1TLTA 3T7CA 4GWGA 3RWBA 4ZRNA 1F0YA 1V35A 3D5QA 4OYRA 1HE2A 4Q3NA 3LF2A 1FK8A 1T2EA 4BMVA 4AL4A 5J23A 2CZCA 1UUFA 2J3KA 3WQSB 3ZI0A 1E7MA 1BVUA 2HKIA 1GPJA 2RCYA 1IE3A 5IDQA 4A03A 4PLCA 4CMEC 3HG7A 1O8CA 4XIYA 3D3EA 1R66A 1UXHA 5KNLA 2WWRA 3V2HA 2J3IA 5DOVA 2BFMA 1PQWA 5ILGA 4FOSA 1PJCA 1X1TA 2GO1A 3SC6A 3TSCA 1ZXLA 1LU9A 4W6ZA 5CPFA 4A2CA 3GEGA 1BHSA 3C3XA 2PZJA 3PJGA 5HM8A 2GUGA 2I99A 4HADA 1EBFA 1HDCA 5JC8A 3PJEA 1FDTA 1PL8A 3W8FA 3V2UA 2J5KA 3FNEA 3TWOA 4AJPA 4WK6A 4MINA 1K2WA 3U09A 2X9GA 3PFFA 4J0EA 2BGLA 1U3TA 3PPIA 5JSFA 1AUPA 1GV1A 1H2BA 4AJKA 4S3MA 3ADOA 1ONPA 4KWHA 2X5KO 1CEQA 3E48A 1ENYA 1BW9B 3PYMA 2C5EA 4DXHA 2X0JA 4GX2A 3I9OA 2VTDA 3KOUA 1PGOA 3E18A 1P1JA 1Y9EA 2FRDA 4LCEA 3S2IA 2QG4A 3RKRA 4UVEA 1J49A 1KEUA 5DULA 1HYHA 1KC1A 3ROKA 1QYDA 2VYVD 1ZMOA 3GZNA 3MWDB 4IQ8A 3MJEA 4B4OA 5CDGA 1ZK2A 4W99A 1IZ9A 3IJRA 1LI4A 2PD6A 2PR2A 4AJNA 2O3TA 1NR7A 5JAIA 5A02A 3AWDA 5K6AC 4NZ9A 2VWGA 3GG9A 2A4KA 1HLDA 4H3VA 4Y67A 3BIOA 3VTFA 5JPIA 3WYBA 4I9UA 1TEHA 2Y0DA 2CY0A 3F46A 3HDQA 3VTZA 2ZKLA 3HN2A 4RPHA 3ZNQA 2Y0EA 4HKTA 1KEWA 2HMSA 5IN4A 1YB5A 2VYNA 3NGLA 4ZICA 1YL6A 1KC3A 2V7PA 3F5SA 5A05A 4TRMA 2W98A 1YBMA 4ZD6A 4IGEA 4BIIA 4CMAA 4DLAA 2EKLA 2OL4A 2QX7A 1YO6A 2VZ8A 4ND3A 4ND5A 5G0UA 1R4MB 1A71A 4WEOA 1A27A 1MUUA 4Z9FA 1VRWA 4FFNA 3AU8A 4B3HA 4BNLA 2Q49A 4OIMA 4CUZA 4G65A 1M6HA 3GGGA 2P4HX 1EMDA 1P0FA 5KTKA 3WX0A 3IS3A 4JN6B 4NJMB 4R1UA 3VH2A 4YWJA 5TT1A 5DNAA 3RJ5A 4IS3A 1DRVA 4RGBA 4IMPA 5CEJA 4QFDA 3FD8A 4JJFA 1R0LA 2ZCVA 1HZZA 4I9NA 4GLOA 5EJ2A 5T8KA 3GA0A 5BQFA 4EGFA 1HE4A 3GDFA 1GUZA 1H6DA 2Q4BA 3G79A 1E3IA 3DZFA 4IINA 4TZKA 1ZH8A 3CH6A 5JO0A 3JQFA 4KP7A 4Z9YA 1ISGA 1SB8A 1J5PA 2YDYA 4BKOA 5L45A 4OQZA 7MDHA 3Q11A 2O7SA 1UP4A 1DFHA 4PG6A 1P74A 3HN7A 1HXHA 2FHSA 3TRIA 2ZYGA 4DREA 3FSRA 1ADCA 2TMGA 4NFSA 2WD7B 4XEHA 3WMXA 3W4IA 1OFGA 1C0PA 1LLQA 4JJGA 2VHWA 4RLHA 1MB4A 2X5OA 5JDCC 2GPTA 3T4XA 5IZCA 1U8XX 4ZJUA 1GTMA 3D4NA 1LX6A 4NI5A 1JKFA 1NPTO 2JD1A 3JQAB 4GI2A 1MC5A 2PKQO 3QQPA 4YRBA 2HK8A 2CFCA 4KUGA 4ONEA 2EW8A 4J1SA 3ZWNA 4DQVA 5MGBA 4MIOA 1DO8A 1H6BA 4TQGA 2P5UA 1N7HA 3F3SA 1ZO8A 2YHIB 3EY4A 1R6DA 3GK3A 4FW8A 5L95A 1OAAA 2XF8A 3LC7O 2V6GA 1E7RA 1X7GA 2PY6A 2I76A 2QQ5A 5DP2A 3PDJA 2YQ5A 4YAJA 4KTTE 3GGPA 5JW6A 4QTZA 4J9UE 4BOYA 1SNYA 4IBOA 2JAPA 4J2HA 3L4SO 4BUCA 3RUIA 1LC0A 1QG6A 2YQ4A 1I5RA 2O2SA 3DAFA 4Z3KA 3V8BA 4RQTA 4RPLA 1XSEA 1ZKMA 1AHHA 3WGOA 1ADBA 4EW6A 5CDYA 2PFGA 2VZ9A 1VLLA 4HNGA 4J90A 1VE9A 1GQQA 3TZ6A 2DC1A 3C85A 4CQLB 4E33A 3HDYA 4EUFA 4B4VA 3PWSA 4GH5A 3FWZA 5DCYA 1L7EA 3CXRA 2C0CA 2RH8A 4FIZA 3JQGA 1PSDA 3K9QO 1XGKA 4P4GA 1UDBA 1ENPA 3LVFO 2NSDA 2OP0A 1Z6ZA 9LDBA 1QV7A 3ENNA 3G1UA 2ZJ0A 4XQGA 3O26A 4YTEA 1ONOA 3WGZA 4E5MA 4Z3DA 1DHTA 4RCVA 1BXGA 2P9GA 4CQMB 1YXMA 1YH3A 4W9NA 3S55A 4EJ6A 4TKMA 3T4EA 1BTOA 1GYPA 1QXSA 1DLIA 3U4CA 4H7PA 3I23A 5T67A 1Y6JA 3INTA 4IDCA 5U4QA 4WCFB 4HXYA 3E6AA 1YBVA 4ALMA 1EK5A 2HMWA 1JW9B 1SOWA 1FDVA 2AHRA 3D1LA 3S2FA 4BNIA 4UUMA 3KYDA 1E7YA 3ZCXA 1DXYA 4ZRMA 3TOZA 2FSSA 4CMCA 1R0SA 2ILTA 2RAFA 5B12A 1G1AA 1D8AA 4I08A 4ALKA 3R3JA 2O3JA 3HJAA 4B8ZA 5T64A 3ST7A 1XDWA 1ZNQO 5ES3A 5A4DA 2J5QA 5T8KC 1P77A 3I6QA 2V6MA 4PFJA 1RYDA 2X0IA 1XG5A 3KUXA 4GX5A 4PRLA 1WNTA 2ZTUA 2GRAA 2B4RO 4GVLA 3U3XA 4WLUA 4CLXA 1B7GO 3S2GA 4R5HA 2Y05A 4BGVA 3I6IA 4PIVA 5F1KA 4DTIA 1S6YA 5JNLA 4L4RA 1NNUA 1EE9A 3PWZA 1Q7BA 3JQ8B 3JD2A 5DCUA 2H1SA 2NU6A 4R51A 2EP5A 1E6UA 2Q2VA 4WE3A 1RPNA 3ROPA 2J5RA 3HFGA 4F3YA 5FFFA 3QIVA 1W6UA 1KVSA 3LU1A 4RF5A 2EF1A 4E30A 5IZCC 3PYXA 3UAGA 5IN5A 2Q45A 3FR7A 4E5YA 2DBVO 2NVUA 1M6WA 3GMSA 3BTUA 1TVEA 1QYXA 4XYEA 3PRJA 2C07A 3GVPA 4B7CA 3DBLB 4FDAA 4CLDA 2NU8A 4CM7A 3ZHXA 2AE1A 2GN6A 4BNVA 1B3BA 4DLLA 4RF3A 4ESOA 1WW8A 1EQUA 4YJFA 4G81A 1GR0A 1JLLA 2OP1A 4HV4A 3AOGA 2JAHA 3GY0A 2VOJA 4O59O 4BMNA 2X5JO 3M2PA 1I32A 2ZB3A 3PZBA 1HF3A 1E6EA 3WGGA 5TLSA 3WWZA 4FC7A 3WGYA 4XRGA 3ANNA 4YQZA 4L4SA 4BV8A 4M8SA 4BNKA 1BGVA 5JE8A 4R1NA 3U0BA 1U1IA 4CV1A 1R15A 2D5AA 3AJRA 4Q39A 4WJZA 3DL2A 2G17A 4A7PA 4PRKA 1JKJA 4AJEA 1XCBA 3QWFA 2HRBA 4LK3A 1HL3A 1JU9A 4BO5A 4HNHA 4WECA 4GGOA 3WG9A 5DBIA 3QVTA 5GMOA 1AXEA 1ULUA 5I8ZA 4YAKA 5CFZA 4KQXA 5EIOA 3TDKA 5G0TA 4AJOA 1NVMB 2CDCA 3E82A 4W82A 5L4LA 2CF5A 4J1TA 5DOZA 1EEHA 2C2XA 4GL4A 5ER6A 3WGQA 2JCXA 1CETA 1M66A 3CMMA 2GD1O 5L53A 1KYQA 4FJ2A 1TA4A 1VL0A 4LSMA 1SO8A 4OQYA 4IS2A 4OXNA 5G4KB 2P5YA 3DO5A 3C8MA 1RYEA 4W9NC 1UZLA 3AW9A 1DOHA 3R3SA 2PGJA 4WOJA 1ZEJA 4BNZA 3W8EA 2CSUA 4MIYA 3H3JA 3ZU2A 3KV3O 1ZIDA 3ITKA 3I9KA 2RHCA 1HEUA 2O4CA 2X58A 3RBZA 1PR9A 1I3MA 2W8ZA 2WYUA 1HRDA 5A06A 1EK6A 2DT5A 3ZWOA 3QLJA 4RORA 4CQMD 4A26A 3OFSA 5DZSA 3WMWA 1U5AA 3RUHA 2WE8A 5BSGA 4UVIA 3VPSA 4GX1A 4DL9A 3RUCA 3GEDA 4I5EA 1EDZA 1K6IA 4FQ8A 3HDHA 3LYLA 4PG5A 4ND4A 1PZFA 4MO2A 1UXJA 3FNHA 1X0XA 2PA3A 4CM8B 4M86A 3G0OA 1C1DB 1WMAA 2A94A 1RM3A 2WM3A 1B2LA 4XGIA 2Q1SA 5BT9A 5IG2A 2BFAA 3BMOB 4TROA 4YAEA 4WLEA 4U0KA 5T6BA 1ZW1A 3RD5A 1O94A 1E3WA 3WJ7A 4DMLA 1V3VA 2OHXA 2Q3EA 2OUIA 3ICCA 1O89A 2EGGA 2GR9A 1HDXA 3DOCA 3Q3CA 4R1TA 5HRUA 3SJ7A 1BVRA 2FR1A 2Y1GA 3DBVO 4BNJA 4NG5A 3W8DA 3K31A 1ISMA 3SJUA 1G0OA 4DQXA 2G76A 1ZFNA 2PKQP 5ICSA 1X14A 5H82A 3TL2A 2UDPA 1A7KA 1EBUA 1LQTA 1VJ0A 4TWRA 4Z9XA 1HTBA 1X15A 4AJJA 3FHLA 2BRUA 3QY9A 1GEGA 1EFLA 3PGJA 1QYVA 4PLFA 4QT0A 4ZHSA 3OJFA 3KEOA 1MG5A 4A0SA 3RSHA 1I10A 3ZW9A 4KQWA 3RVDA 3UUWA 5JC1A 1X7DA 1UXKA 4ALLA 3KSDO 4TVOA 5CG2A 1T25A 1OZAA 3VPFA 3AOEA 3ETEA 1QP8A 3PWKA 1JAYA 3C7AA 1W8DA 4FSHA 1XHLA 2I9PA 4MP8A 3PHIA 3DC2A 5TJHA 4OOFA 2IZ1A 1MGOA 2Y93A 3GUCA 3ANLA 2YY7A 5AVOA 3WXBA 2GN4A 3QVOA 4UEKA 5I9LA 1ZSVA 1NFRA 1N2SA 1WAMA 3PVZA 4CR8A 3EVNA 4NIMA 1ONNA 3K2EA 4RDHA 3VDRA 3BZUA 1JKIA 5DP1A 8LDHA 4I5DA 3RC7A 1P44A 1MA0A 1V3UA 1U5CA 3H4VA 5GY7A 2J3JA 4BKQA 3H9UA 4RVSA 3GT0A 5L7TA 3LQFA 2VT2A 1J0XO 1YOVA 1UXIA 4E5PA 2VRCA 2IZ0A 3OSUA 5JYDA 1ID1A 3P2YA 2O7QA 1XELA 3ETGA 5FI3A 3PHHA 3UN1A 1GPDG 4IQ0A 2GZ1A 5EQFA 4GSLA 4LRTB 5K6AA 1DAOA 2NM0A 1PIWA 4X54A 4XGKA 1AHIA 1CYDA 1H0KA 1QYWA 3H2ZA 2OBNA 1UZNA 1GZ4A 4XA8A 2HSDA 2FOIA 3TZCA 2IEBA 4RPKA 4YEDA 2QRKA 1Y8RA 3PQFA 4J4TA 1C1XB 1GDHA 4K26A 1LDMA 1LSOA 4YB8A 2YUTA 3EVTA 5JCJA 3MJSA 4J7XA 4CM5A 4XIJA 3IL2A 2PH5A 2DQ4A 1HDRA 4OXYA 5F1OA 2X22A 1NTOA 4JGBA 3PIDA 3IOYA 1PGPA 4WLVA 4DVJA 2HAEA 1U9JA 3OA2A 4JK3A 4R16A 3VPGA 3A06A 4DYDA 2OORA 3FNFA 3GQVA 1CWUA 3MJ4A 4L74A 4R4JA 1JVSA 1B8VA 1HYGA 5GZ6A 1PS9A 2GYYA 4URFA 1IPEA 4XDZA 3EDMA 2GF2A 3ANMA 4NU5A 4RVDA 2PGDA 3BMCB 1EVYA 3U4DA 3HE3A 3D3WB 5JY1A 1QMGA 4CMHA 4R68A 2HMUA 2CVQA 3GMDA 1HT0A 5TJ9A 3WYCA 3GLQA 3ZWXA 4NFYA 3BXXA 2FY8A 4IXWA 3AFNA 3BMNB 3QJ5A 4Q3DA 1VC2A 4OSOA 3AM4A 3D5TA 4FS3A 4MVJA 4CLOA 2YDXA 1YDEA 4YA6A 2IZZA 4L8VA 4KZPA 3JQEA 4G5HA 1NQAO 2FWMX 2OFPA 2A35A 1H2HA 3NGXA 2EG9A 2GZ3A 2NTNA 1Q0LA 3SBOA 4CLRB 2CUKA 2W2KB 2ZYDA 4BNHA 2DVMA 5B4VA 3OQ1A 1H6AA 2AQKA 2IE0A 3KETA 1HDZA 2E6UX 4UVHA 4O5OA 4YT5A 4CM9D 2O2YA 3OIFA 5BNIA 3OP4A 3VAZA 1T24A 3L0DA 4P22A 5JDCA 1EUDA 2V65A 4KOAA 1SMKA 5A04A 1P1RA 4F46A 3KSZO 4GMFA 5CG1A 1E6WA 4N7RA 1Y1PA 5TS3A 4TVBA 4GMGA 4XQEA 5A9RA 3DAGA 4BO3A 1VJ1A 2O3SA 2DPGA 1HKUA 3DWFA 3EW7A 5I7VA 3L9WA 5KWEA 5KJEA 2Z95A 4BB6A 3A28A 2GZ2A 3IP3A 2HO5A 2DU8A 2RIRA 3B1KA 3AOEC 4AJLA 1Y8QB 3BAZA 3OH8A 3FBTA 2O50A 5EQDA 3ZW8A 3IDSA 1FMCA 2C5AA 4NR0A 1B3RA 1T4DA 3VH4A 4CM6A 1WDKA 3GRPA 4ZQBA 1K3TA 4NFHA 4WLOA 2E82A 1EE2A 5KKCA 1PJ4A 1QLJA 3E8XA 3QWIA 4XWYA 5AXAA 4BNGA 2DTDA 4CPDA 4DUPA 1BW9A 1EQ2A 4NU6A 3F47A 4BO7A 2B4TO 4UULA 1UH5A 4D79A 4PG4A 4LVUA 1M76A 2B5VA 4Z0HO 1GAEO 3WS7A 4CMKA 4RL6A 5EL0A 3ONFA 2AXQA 4D3SA 4FBGA 4E3ZA 1NWCA 5ICMA 3WTBA 3MOGA 5L3ZA 1NVTA 1VKOA 4CR6A 2VTEA 3O8QB 3KM0A 4GAEA 1N9GA 1FJHA 4ZA2A 2ET6A 1XIVA 4WASA 3AI1A 3H9EO 5COBA 4N5NA 4I1IA 3NKLA 4XB2A 3ZWCA 3L77A 2Q2QA 4IMRA 1BDBA 2HRZA 1LRKA 4KMSA 4MOWA 2PK3A 3RIHA 2IYOA 4GPD1 2Y1FA 4ID9A 3DOOA 5TNXA 1I2CA 4A10A 2WDZA 3WB9A 1NX6A 1F17A 5HWSA 1JVBA 5BSHA 3G17A 1C3VA 1N5DA 4J2OA 1H9AA 2JD0A 4AG3A 4EJMA 1R4MA 3DFUA 1B8UA 3AY3A 3A14A 3FCOA 4BNUA 2X0NA 3PEFA 4EUEA 1F06A 3VC7A 4BNYA 3H9JA 5AXDA 5IF3A 3KB6A 5KVSA 2D0IA 3BTVA 4E2YA 2PKRA 3EHEA 4PCVA 1PS0A 4NJMA 4ND1A 1U28A 3KZVA 4JNKA 4C7JA 1NQ5A 1B0AA 2XOXA 4DGSA 2W2LA 3INGA 1GFSA 1IHYA 3D4PA 2DUWA 4LMPA 4EJ0A 4DLBA 5JDIA 1HE5A 3PLNA 5EN4A 4R3NA 1PJSA 1ZK0A 1H9BA 4J1NA 1GYRA 3PLRA 1ZMTA 4DMMA 1HETA 4GKVA 3ENKA 5KOIA 4OOEA 4OJNA 3GC6A 3DDNA 1P0CA 1FDUA 1E77A 1O6ZA 2VQ3A 4YJHA 4CMIB 3LLSA 4OO3A 1V6AA 4WNCA 3DTYA 4ZGWA 4BGUA 4BGEA 3UKOA 3BTOA 3RUFA 2R00A 3ZU3A 1OI7A 1YVEI 2CMDA 2XPCA 3I9LA 4RLSA 3QRWA 5COAA 3E5MA 3I4FA 2WD7A 1GQYA 1NFQA 4J7CA 1IB6A 3UXYA 2PZMA 3NTRA 3ONEA 5IDXA 3LZ6A 1H5QA 4K9DA 4IDDA 2IRWA 1NASA 3JQAA 2B35A 3WDSA 4BKPA 1U3VA 3D7LA 4YT8A 3UCEA 2Q1TA 4B7UA 1CRWG 1T1RA 5I7FA 1GU7A 1LRJA 3KRTA 4R69A 4Q3AA 1E3SA 4M55A 3PHJA 4PVCA 2PLAA 5TGDA 2Q4EA 2J3HA 3I9NA 4OXKA 2YHIA 1ISHA 3ON5A 1C0KA 4MJLA 5JYEA 3NEPX 1SEPA 2ZJ1A 4ALJA 3AFMA 4WLFA 3UFXA 1EVJA 2J8ZA 3DB2A 4YQYA 1PJQA 2CDAA 4EITA 5BSFA 3KLPX 5T5QA 1PL6A 1DIHA 3Q0EA 5A9TA 4QO8A 2NVBA 3PFWO 3ZV3A 5L51A 1RWBA 4YCAA 3FR8A 1ML3A 3NJ4A 3K5PA 3BHJA 1PEDA 4EEZA 4FOOA 5FYDA 1Z75A 1DSSG 3EZYA 4WUVA 4RF2A 2Q46A 3GAFA 1I24A 1QYCA 3I1JA 1LUAA 5H83A 1MXHA 1X1EA 3FRJA 3LT0A 3AM3A 2PV7A 4NQZA 2FPPA 4DPKA 1SBYA 1K6XA 1OMOA 1CDOA 1W4ZA 2YV2A 4A27A 1E1MA 3L07A 1HYEA 4D45A 1E5LA 4IM7A 4CV2A 1YQXA 1E0DA 2VOEA 5L4SA 3MWEB 2W90A 4W7HA 3DONA 4BVAA 1KEPA 4E32A 5JXWA 1YBAA 2XXBA 1V8BA 2D59A 3ADPA 2DFDA 4PLWA 4IXTA 1JTVA 1OC2A 1O95A 1V0JA 3PHLA 1P1KA 4CLEA 3P7MA 1U8FO 4CR7A 4DRYA 1UXGA 4HBGA 4QX6A 3X2EA 4ZQHA 1ZBQA 3WSWA 3O9ZA 4CMGA 2C7VA 3DXFA 1WP4A 3EMKA 3WBBA 2EIHA 1VL6A 3U4IA 4L73A 2VWPA 5JO9A 2YW9A 3DOJA 4BKUA 4YAGA 4I8XA 3RUEA 2Q2WA 3PDUA 4GWKA 1E5QA 4WCFA 2HQ1A 1Q7GA 1Z74A 3L6EA 3ZWYA 4YACA 4CUKA 4GLLA 1EUCA 3QW2A 3VZRA 2I67A 5IFLA 3W4KA 4QSMA 4CJXA 4PLTA 2OO5A 3JYLA 3I52A 3VDQA 4ZN6A 3CIFA 2HDHA 2HMTA 3PQDA 3C1AA 3L6DA 1PTJA 3H3FA 5U9CA 1N8KA 2DM6A 1CJCA 4PGFA 4JIGA 4RF4A 3VOSA 4E5KA 3OJOA 5JY6A 1MV8A 5AXBA 2NTVA 1DC5A 1Q0HA 1NVGA 3NTOA 1DFGA 2JFFA 4IY1A 4IZHA 5TF4A 5JAZA 2Q50A 1WWKA 4NBUA 4OGWA 3EZLA 4ALNA 2O3UA 3TFQA 1H6CA 1BMDA 1BXGB 4B7XA 5JDIC 1CIVA 5MDHA 1QKIA 1MP0A 4BNXA 4YRDA 2VWHA 4UUPA 1SCUA 1JWAB 3L9XA 4I9HA 4OH1A 4DC1A 5KVQA 3JD1A 3IJPA 2EERA 3PHGA 4PG8A 2BFPA 1VJTA 3HADA 4D44A 5CDTA 3I4CA 2VYND 2PH3A 1DJQA 3WIEA 3ZHYA 2R2GA 3JQ8A 3EYWA 1XQ1A 5A03A 2R00C 1H94A 3AUTA 3NT4A 2OXIA 4E12A 3JQ9C 3BA1A 4LMRA 3KO8A 4FFLA 3RCBA 2Y68A 4M87A 4PZCA 3RROA 1I8TA 2F00A 4EI2A 3FN4A 1E1LA 1YJQA 5L7WA 2YYYA 4L75A 3UCFA 1DC4A 1QV6A 1SOVA 3A1NA 1LSUA 4J9VA 5JS6A 2WEKA 4YT4A 1XU7A 5CEFA 4Q9NA 2LDXA 2BKAA 4JXKA 4BV9A 4RVUA 3WGHA 5CEEA 1NR1A 3M1AA 4JP3A 2BGMA 3F1LA 3ONDA 1ZSNA 3GVXA 2ZCUA 5JFOA 5A5FA 2DLDA 2GDZA 8ADHA 3GAZA 3DEYX 4GQAA 2VNSA 4NPCA 4OMUA 5I9MA 4O0LA 4MIEA 1UR5A 1DIRA 1Z82A 2ZTVA 2I6TA 1YL7A 3GDOA 3H6KA 3UHAA 2GCGA 4XQ9A 1BXKA 1MFPA 3GUYA 3CTMA 4MP6A 3KYCB 4DPLA 3FWNA 1ZUD1 5JAQA 2H63A 5I8WA 3FPCA 3GG2A 4AJ4A 3NX4A 1FF9A 4GVXA 2BH9A 4II2A 4RDIA 2C20A 3GHHA 3EGOA 2X23A 5A3JA 1SAYA 4IDAA 2AQ8A 2F1KA 5L4NA 4BHTA 2YFQA 1C0IA 2AEJA 4DC0A 2NU9A 3DHEA 3ZNNA 3K30A 1Z73A 4M54A 1DDOA 2D1YA 3GN2A 3OEYA 1CERA 2FPIA 1LBEA 4ROSA 1I2ZA 3L6OO 3BMQB 4LN1A 1GUFA 4XYLA 2ZTLA 1MLDA 5FEUA 1DEHA 1VL8A 5CDUA 1PJ3A 2B36A 4K6FA 4RPJA 1UDCA 1TT5A 5F5LA 4OAQA 1VM6A 4PG7A 3KSUA 1K89A 1ZJZA 1EUZA 1QSGA 1BWSA 4KDFA 4GKBA 4N18A 4U6QA 2C29D 3KTDA 1LSJA 3JQ7B 2TMDA 5F21A 3FBGA 4GBJA 3GVHA 5G4KA 2C54A 1X7HA 3QE3A 1YS4A 2NACA 2BI8A 3R6DA 4DIOA 1ZJYA 4IIUA 3ZWVA 4AJHA 4GSKA 2OMEA 4JX8A 3OECA 3RAJA 4Y98A 1NYTA 1EVZA 3AY7A 3GRKA 1YONA 4WCFC 4CL8A 5ITWA 4QO7A 4CM4B 4CL3A 4XYBA 4WEQA 4JQCA 1U2GA 3MTJA 1W0CA 5CPBA 3A9WA 4C7KA 2PZKA 4Z0TA 4Y6PA 5IJZA 4DWVA 3RJ9A 1D7OA 2PD4A 2AQIA 3CINA 2BLLA 3VVBA 4CODB 1M75A 3OJ0A 3IIEA 4LW8A 1Y9AA 5DCWA 5CHEA 3E1KA 2Z1MA 2EJVA 3VZSA 1JAXA 3H5RA 2WSBA 1DFIA 4BO0A 2JD2A 3E9MA 1PWZA 5EMHA 2X0RA 1Y7TA 1ZK4A 5DT9A 2C7GA 4HFJA 5JMWA 4KDEA 3OIGA 3BMOA 3V1TC 3OETA 2FZEA 3HUDA 2DFVA 1HDOA 3R1IA 4CM9A 3SX2A 3CE6A 5JMPA 3DZBA 1MFZA 1ENZA 2AG5A 2AMFA 1U3UA 2UYYA 1P45A 3OM9A 1HLPA 5TC4A 3NT5A 2NQTA 1Y81A 1PQPA 3DQPA 4K6CA 2P9CA 4HX5A 4AICA 3BTSA 3B6ZA 3LC2O 2IXBA 2Y1CA 3RC2A 2J6IA 4E2WA 3TJRA 5LDGA 3VH3A 2D8AA 1J6UA 3OMLA 2I5PO 4W7IA 1ADFA 4LVCA 5L40A 5AOVA 3GFGA 3PXXA 1VKNA 3GNSA 1PL7A 3EC7A 4I5FA 1DC3A 4TKLA 4BNWA 4CMJA 5AYVA 5IXYA 5DBFA 1GQ2A 1WZEA 3AK4A 3LC1O 3JCZA 4H16A 1ARZA 1HE3A 1YGYA 3GVCA 3UCXA 4DYVA 4EYEA 1E3WB 4BO6A 1W73A 3ZV6A 3PIIA 3WFIA 4U7WA 4TSKA 2DTEA 2EJWA 3GPIA 4Y6SA 1D3AA 3QVSA 4HFRA 2JKVA 2GN8A 4MVJF 4UUNA 2QRJA 5B4TA 3ROQA 4QFCA 1P1IA 1TB4A 3DMTA 3GNTA 4OL9A 4Y9DA 4D0SA 1KY5A 3G1TA 4RO0A 4BNNA 1ISJA 1YL5A 4Q3CA 1LA2A 5KIAA 3AM5A 5JAMA 4RQUA 1LXCA 2BD0A 3ZV4A 3OHSX 1KOLA 3H5NA 3HB4X 4L4XA 4OKIA 2EXXA 3G3EA 2I66A 2VYVA 4JLWA 4UREA 1R4NB 1ZK3A 4OKNA 3DBRB 3SLGA 3ZNPA 1IPFA 3RFXA 3RKUA 4A73A 1E3JA 6ADHA 2NUAA 4FFMA 4XR9A 4JP2A 4R54A 4HP8A 4XQCA 5FF9A 5G0WA 2YFHA 2NU7A 4NBTA 1HZJA 1LNQA 4QECA 4YJDA 4E5NA 3HHPA 4E0BA 4OHUA 1I3LA 3W4JA 3BHMA 1P9LA 1D4FA 3JYNA 1BXZA 3PYLA 3VZQA 3AU9A 2QZ9A 1NBOA 3EUWA 2DUUA 4JBGA 2X7HA 1C1XA 3RASA 4WLNA 3MJVA 1ZZEA 2C2YA 1PZEA 3CKYA 3W6UA 2D2IA 1UP6A 2DKNA 3OF2A 1NQTA 3ZH2A 1NHWA 4MVJE 1WXDA 4M89A 3WBFA 3KYBA 1WPQA 1GCOA 2IYPA 3GHYA 3JQ6A 2X8LA 3PJDA 3ZN2A 1C14A 4XDYA 5KJFA 3JV7A 5C5IA 3DZJA 1GL3A 3JYPA 2VUSA 3D4OA 3TZHA 2VHVA 3UF0A 2WTBA 2Y66A 4U5QA 4RV9A 1PJ2A 4BL5A 4D3DA 1ZK1A 3BMCA 2NVWA 1E7QA 3D3WA 2QRLA 4R3WA 4YJGB 3VKUA 3RQSA 4KUHA 1Y8RB 1EZ4A 4INAA 3ETDA 2VT3A 3BMNA 3TPCA 4HFNA 1ORRA 3DBHB 1LTHR 1E7WA 3MEQA 4L0QA 4W4TA 2AEFA 5I7SA 1E3LA 1LLDA 2JCYA 1UP7A 3RUAA 2HK9A 1WZIA 5A9SB 4P38A 2O23A 4ZQFA 2P68A 4EUHA 1E92A 5KJ6A 3K8ZA 4CLRA 2EV9A 2W2KA 4J7UA 5ITVA 4M49A 3E5RA 4BO1A 4NH4A 1PWXA 3DZIA 3CMCO 3SXPA 1QRRA 2ZB4A 3OQ6A 1MXFA 3PGXA 4QEDA 4TZTA 3HZZA 4MPDA 2GGSA 1U2DA 4MKRA 3I83A 1OC4A 1KEVA 3ZU4A 2GN9A 1SZJG 4LISA 1DC6A 2IXAA 5BR7A 4FFRA 1PQUA 1LEHA 4II3A 5AXCA 5HA5A 3RBVA 1CQJA 1DIGA 1LSSA 3FTPA 4P4NA 1P3DA 3JQDA 5G4LA 3LK7A 4CLOB 2PGLA 1LQUA 2XXJA 1XEAA 3FTNA 4R9SA 5BNFA 1LDNA 3ZWMA 4RJTA 1U7TA 4E2ZA 1KBZA 5U1PA 1PR3A 2IODA 1QORA 1Y8QA 1XA0A 1E1KA 1QR6A 3M1LA 4JROA 5IXSA 1NQOA 4IJWA 1VI2A 3ZGYA 4YT2A 3QVXA 4U8GA 2YJZA 3DMYA 1GCUA 4JBHA 2AQHA 1ISFA 3WJAA 3DMTC 3GDGA 1F8GA 2WJPA 4Z0PA 5LC1A 4D41A 1GD1O 3T7EA 3DHYA 3F5QA 5L9AA 4BNFA 3EK2A 2WYWA 3ZHBA 3GOHA 3ZNOA 2FP4A 3VH1A 5AQ1A 2QZZA 1V3TA 4IJUA 2ZK7A 1LLCA 1WDMA 4MKXA 3WSVA 3EAGA 4CV3A 3WLFA 4WOKA 1R37A 1EDOA 1M67A 2G82A 2FMUA 2GSDA 3GEMA 3Q2IA 5JBIA 3WTCA 1XKQA 1KVQA 1I33A 3PQEA 3O38A 1A4UA 4FN4A 4J91A 3GF4A 4BQPA 2IDZA 3ZWAA 2ZTMA 1N92A 5I9NA 3CZRA 3O8QA 4IDFA 4XJSA 4XCVA 3ORFA 2EEZA 2Z1NA 3C1TA 3OA0A 5A1TA 2P9EA 3BHIA 3HFSA 3KEQA 2D5CA 1WDLA 2SCUA 4R5MA 4XB1A 3MTGA 4NK4A 4BGIA 2B83A 1PGNA 3STHA 2AEMA 2FPGA 4E13A 4G2NA 4NBRA 1MX3A 3K92A 3D0OA 1IUKA 3H8VA 4MKZA 1JDJA 1PJBA 3PI7A 4FFOA 4FCCA 2ZQZA 4FJ1A 1IOLA 5KJ1A 3S8MA 1YQDA 1NHGA 4BO4A 2CDBA 3QSGA 4KTVE 3K73O 2ZB7A 4YRAA 2VHYA 4XX0A 1AN9A 2QHXA 3RUDA 2G5CA 1N9GB 2B5WA 2WE7A 3IKVA 4R01A 3RBXA 3VHRA 3F6YA 5F3RA 3U9LA 1RJWA 3PP8A 4FGWA 3W1VA 1O0SA 3UW3A 3GZNB 2GERA 2H6EA 3OJLA 4QUKA 3K6JA 2EKPA 2QYSA 4E2XA 4PN3A 2FN7A 1YKFA 4HY3A 1IHXA 2VRCD 3Q9UA 5ENVA 3I3OA 4TRJA 1E3EA 2I3AA 3GPDG 3IAHA 1K5HA 4FD3A 3UGKA 5ENDA 1DRWA 3H9GA 3Q1LA 5B4UA 3ABIA 3SEFA 1NAHA 1YE3A 4CMIA 4UUOA 1N7GA 4P4LA 5TX7A 4BB5A 1UZMA 3QWBA 3U49A 2HMVA 4BS9A 1IULA 2DBQA 3TOXA 2Z5LA 3TN7A 5DN9A 1AE1A 3SLKA 1T1SA 5JCJD 3H5AA 1L7DA 2X9NA 3FI9A 1K6JA 4PLYA 1KVTA 1KIFA 3JQ9A 1PJTA 3RFVA 4D0RA 2WMDA 2X9VA 4TMFA 3PK0A 2FZWA 1X0VA 3NUGA 1DB3A 4XR4A 1HWYA 1B26A 3DZGA 1F8FA 1T2CA 2I65A 2Y1EA 4BO9A 3JD0A 2R6JA 5CP8A 3HDJA 3WWYA 7ADHA 5KJCA 2NADA 4L9RA 4YJHB 2AA3A 2POQX 2YZ7A 4GX0A 4XZ3A 2O48X 4E31A 1DLJA 2CNBA 4P8RA 4O6VA 3NJ8A 2BI7A 3E03A 3P19A 4LRSB 3CUKA 2PTGA 4WNIA 5BNTA 4MVJD 2VHXA 5IZ4A 3IP1A 3WIDA 4F6CA 3ZWBA 1FDWA 5IAAA 2ZATA 1LC3A 2FR8A 4IIVA 4AJ2A 3QVWA 2CVOA 2H5LA 3ULKA 2RBEA 1OBFO 1I2BA 1XR3A 3Q6IA 1XQ6A 2EWMA 4N5MA 4OM8A 5KKAA 3ZU5A 2PD3A 3B1JA 3FF4A 3M6IA 3S2EA 3A4VA 5EESA 2B0JA 3ZZNA 4IZIA 1JQBA 1WVGA 4RZIA 1HSOA 3DFZA 1GZ3A 3OBBA 4ZQGA 1I30A 5F5NA 1P1HA 3MJCA 1LDBA 2VNAA 1D1SA 3U4HA 3E9NA 4DBZA 4CQLA 4J43A 5L7YA 2HCTA 4ITUA 3WQQA 1KVRA 3DZHA 1J4AA 5ILOA 5G2OA 2C59A 2ZQYA 1YRLA 2BMAA 3GFBA 4ALIA 1NAIA 2UUOA 4FGSA 1FXSA 3CEAA 4IPTA 2RH4A 3AI2A 4PLZA 1A4IA 3ICPA 4O63O 4TRNA 5TRTA 2NNLD 1DHRA 4D46A 2X4GA 2Y99A 5THQA 5EERA 4DIBA 3H2SA 2BELA 2DTXA 3GVIA 5FWNA 3H9QA 2DAPA 3RFTA 3WGIA 1DIAA 2VWQA 4ND2A 3MJTA 1E1NA 1ZXBA 3ASVA 3UVEA 4CQMA 1O9BA 2D4AA 3MCVA 4EEXA 2HU2A 3IKTA 2P91A 1XLTA 5THKA 1S7CA 3KBOA 3GNQA 1P31A 2I3GA 4XD2A 3IMFA 3HNPA 2JHGA 4B4WA 1Q2XA 1N1GA 2NTJA 3N7UA 5KCZA 2Y1DA 4FR5A 1F12A 2UVDA 4UEOA 1U3WA 3NDJA 1NPYA 1RM0A 3VPXA 3Q2KA 3JQGB 4MDHA 1R0KA 1KVUA 4MVJG 5DDIP 1HDYA 3KHUA 5B37A 5CDSA 1E7SA 1DRUA 1GUYA 1KETA 4B4UA 2CVZA 5HTOA 3IUSA 1DPGA 4UVGA 3JTMA 2E37A 4EZBA 4BQRA 2VN8A 2X86A 3KVOA 5ER9A 4J16A 1SB9A 3NDIA
chains in the Genus database with same CATH superfamily
1Y5MA 4D43A 4YMSA 2ZJ5A 4DOMA 3UMBA 1WZ2A 1OWPA 2FMHA 2W58A 3GQBB 3NEAA 2RHRA 4M53A 4XYMA 5F23A 2G0AA 3RIYA 1G8AA 1G41A 5H81A 4F5EA 4YRCA 3BFKA 1W4CA 4MVWA 4TMZA 5DLDA 5BOSA 4ZC8A 1XZHA 2XOKD 3HJUA 2HX1A 2K4MA 3BWDD 1W4LA 2A30A 3JS5A 3JWJA 4RZHA 1CZUA 3EG9A 2NZVG 4URHA 4YMWA 1V26A 1WXXA 5AM1A 5G0VA 3KYJB 1ZXXA 3T5TA 4DQDA 1UJCA 4MWBA 4LYDA 2XZDA 1H93A 2XNDA 3DHWC 3T3DA 5EHXA 4G1CA 4D3XA 2WHQA 3RSZA 1JDZA 3LUGA 1VQ1A 5BXQC 1SBQA 2H92A 1KY3A 2HJRA 3A8TA 4YMIA 5DXJA 3SX0A 5EPOA 5BWBA 4URYR 1IUNA 4R1OA 5F7ZA 2OHGA 3PR1A 2PZLA 1WB6A 1EFCA 4J0GA 2IEDA 3WGVA 1T4GA 4NJOA 4ND8B 3ER9A 1U0JA 3NBQA 1EFHA 2F4VB 1CLEA 4XGNA 2OCIA 4IO0A 4P1ZA 1FC0A 5CLGA 1R5BA 1D2EA 4PFQA 1PZHA 3DZKA 4IILA 1ULSA 3X1KA 2WUFA 1Z7EA 2B8NA 4HAIA 2GPNA 1M2FA 3GP8A 1HYQA 4O4JB 3KXDA 5DBGA 3EA4A 1T2FA 3DMNA 3D0RA 1K8YB 5B2ZA 3WMGA 3H0EA 1PJLA 3S28A 3JZAA 1ZCJA 3OKPA 1O1YA 5DWDA 3LXMA 1QZ3A 2DECA 4BEBA 3TYXA 4WZBB 4BRSA 4LX8A 3EAQA 2VJDA 1M2OB 1NIPA 4CKCB 3WKAA 2DPHA 1NXWA 1EFRD 3OT1A 2BE9A 4BO2A 3QUQA 1YZGA 4BVHA 1K97A 2NU6B 2D3WA 4A5OA 4ZU3A 4X95A 2V45A 2ZVJA 5J63A 2O0JA 3D0QA 2FR8C 1VLZA 4R8KA 3T4PA 3NAQA 5BSEA 3A70A 3AEYA 4Y2PA 4V24A 1QTQA 1B16A 1HE8B 1C1YA 3QNWA 1VSVA 5IEJA 3EPPA 4LJRA 2FAXA 3K7EA 3BJIC 5ALOA 2I34A 2AFHE 3UWSA 3HSKA 1G63A 4K28A 4LNAA 1FDRA 2JIQA 3I9V6 5D01A 1L5HA 4GICA 2P2SA 3JAKA 1G5IA 3HRKA 3VJKA 2HBQA 4YYZA 4YCBA 1KERA 2JH8A 3HPQA 4NU8X 4FYYA 4UTOA 4YECA 4Q15A 1BJRE 2HCJB 3HVIA 3VYUB 4DG9A 4BLQA 4JCOA 2Y8EA 1UJMA 3DDHA 3L8CA 1L1FA 4HGOA 2MIIA 3QFCA 2BSAA 3VTAA 3WNDA 4EAQA 3NHMA 2K7ZA 3TZEA 3ZVNA 1P81A 2WFZA 5DXAA 5EE1A 3SKYA 2XNKA 3LKVA 2BWJA 3O1LA 3NPAA 3PUJA 4Q3KA 2WOOA 3GYGA 2AT1A 5FI5A 2BFFA 4ZHQA 3ENWA 3GRVA 3GDHA 4MRRA 4HPXB 1DQYA 4H6PA 3B8HA 1T2DA 1UBKS 4L08A 5TIIA 3JQ7A 2E3JA 4GM4A 4MI9A 1S9DA 3EIFA 2JHAA 4QOFA 2HGSA 4YBZA 1BA3A 1GTZA 4OXQA 1A9YA 2JJMA 3P96A 1XYGA 4O1MA 2Z2ZA 1KAMA 5FPPA 1RLMA 3EQ8A 1FUKA 1Q1AA 5TPWB 1RP7A 2PMEA 4RA6A 3DTTA 5EINA 3OIDA 2UZ0A 1LVGA 1TYEB 2GILA 4A36A 5AQEA 2ZYUX 1NDHA 1Q1ZA 1QP4A 1QHXA 2FDCA 1JKJB 3AKDA 5AIAA 5T57A 3RU9A 1NNEA 3ASUA 1XLTC 4UDYX 2JGKA 3CF4A 2XEDA 4MH0R 2LV8A 3LUPA 4WQMA 4EYOA 4E51A 3L8DA 1CT9A 3F4BA 2YHUA 2CL7X 3HJGA 2OOSA 3IDZA 3EZ2A 1M0SA 1OYYA 1W5TA 4JI4B 3AGQA 3W6ZA 4JL8A 4WW0A 1GN8A 1GN9A 1RKBA 2CLFB 4XH9B 3CC8A 1YFLA 4WI1A 3EZ7A 2NWQA 1J23A 1DDGA 5FV4A 1Z34A 3GGDA 3MOIA 1R74A 3VVCA 1HFWA 1PSWA 2C5HA 2RBGA 3HUTA 3B20A 3HWRA 3DT6A 4G25A 4M98A 2J9XB 1JZSA 3P2IA 1XNGA 3KT6A 2VBFA 1ZH4A 5FT9A 3TZQA 5GZ3A 2J0QA 2EKQA 4D9BA 3EIQA 3NBAA 4LOHA 4DSUA 3IDAA 4M0CA 4O29A 1H2AS 5AW5A 1E8DA 3LGAA 5LDHA 2NQ2C 1SK8A 3OEWA 2XAAA 4GP9A 2AFIE 4XWTA 2FSVA 2GLXA 4NMHA 3N2GB 3WYDA 4DILA 2JIBA 4G1MB 1DAKA 1G6KA 1Y7LA 2NTEA 4N82A 4QXMA 1ESMA 2B21A 4IQGA 4XYGA 4JLNA 1EB8A 3T9CA 2IYYA 3VKVA 2BTQA 3X44A 2H7XA 5F7OA 4UEJA 3PVCA 5ICFA 4EHNA 2HJSA 5BVHB 3L49A 5HS6A 4BTEA 4KU4A 3LO5A 4JUBA 3UMSA 1HFKA 1GTSA 2IH5A 3MAGA 1YVDA 1PNQA 2WAMA 3PJFA 3EGCA 3THYB 2ISCA 1FW6A 4BAUA 1I0LA 4E4YA 2IHKA 2IVFA 2C1XA 4IOKA 3RS9A 2ODAA 3PQ4A 4MZXA 1YIOA 4OQLA 2BP7B 3TLJA 5KQGA 5KX5F 1KMHA 4N40A 1RI4A 3R41A 3GLFA 3KFXA 1H8HA 1RM5A 1Y3FE 2PKXA 3E15A 2XSZD 2XCSB 2A59A 3S68A 3M2TA 1ADGA 2ZRLA 4R2KA 2A4MA 1TCCA 2DX7A 4OQXA 3AI3A 4RENA 3W78A 3MAAC 1XEXB 2Y9PB 4CKZA 4KNWA 4LWZA 4URUR 2HHLA 2DXIA 3VX3A 3WAKA 4LZPA 2GK6A 4K9NA 2EHDA 1BX0A 3SZMA 2ZRJA 3PZRA 1SIBE 3VRHA 3FHJA 4PZ9A 4Q4AA 5AKHA 4C3VA 3B1WA 1I36A 1O5IA 4P3KA 1NM5C 2P79A 1FS6A 5TSDA 3S40A 2XITA 3KJGA 3VFDA 5M29A 1W7AA 1N1EA 4K46A 5BN3B 1N78A 3VGJA 1OKKD 1IL0A 2C58A 3GJTA 4PLHA 2ZJFA 4C22A 3T1NA 3UENA 2JVIA 2QAJA 1T9ZA 1ZN7A 2WD8A 5I4IA 3G2MA 5L3VA 3LZDA 2RK4A 3QE9Y 3G49A 3GJ5A 3HSSA 5KTTA 3RJTA 3K8YA 4PZAA 1LCIA 4J49A 3LCRA 4F60A 4XRRA 1U9CA 2OGZA 3ZOKA 3Q3HA 3QXHA 1YE8A 5EHIA 4X1IA 1SRQA 3WGTA 3PB3A 4RS4A 1TEVA 1Z15A 1M73E 1OZFA 4NEQA 2P5TB 1XD8A 2DPMA 2XWQA 4QL3A 3ZOZA 1R9JA 3KP1A 5IKPA 2HPHA 4TT3A 4M1QA 4H4EA 1M9NA 3DBRA 3K96A 1QPBA 2Q4DA 2ZB8A 1G0NA 2AD1A 3UBMA 4EH1A 2R1VB 4QXQA 3KQWA 5BWOA 3MGCA 5IYZA 5KWVA 2IP2A 1ULAA 3JVIA 4LQDA 1ETHA 1NQVA 3CJRA 2N75A 1ORVA 2DBZA 2D3TA 1GV0A 2F6RA 5CT4A 2XQKA 3RFUA 3RV3A 3UAWA 1PGQA 4LYJA 5LWQA 3UB4A 1LJ8A 3EB9A 4Z6KA 5CAEA 4JH0A 3ROFA 4CIDA 1Z88A 2G0NA 2G4CA 3DR3A 1JBKA 3OUZA 3U16A 2AUTA 3GJ8A 1QHHA 5A5EA 1TADA 3K6SB 5HE8A 2P2GA 2MT9A 3JQBC 5G0SA 1VB5A 2GBPA 3LT2A 3PCXA 4NL4H 1Z7BA 1QF6A 3D54D 2APJA 4MULA 5DRTA 3BREA 3OESA 4ERXA 4KQ9A 4NG4A 1NF2A 1CUVA 1UFRA 1VDZA 4CIAA 4Q1VA 1C3XA 1SCDA 5EIBC 3F8WA 1Z4NA 1I51A 4H1UA 1ZOIA 1IONA 3GR6A 4YRGA 1P1FA 1OLSB 1TIKA 2P4QA 3DVSX 3H1TA 1L9XA 2NXNA 1Q50A 2GQ0A 1JXMA 1G8HA 1CUBA 1SBNE 3H75A 3OX4A 3PT9A 5E1MA 5EI5A 3ZXIA 2CBGA 4D3FA 3EGDA 4LQCA 3CF0A 4RK7A 2ZWOA 3S1AB 1XMXA 5EKDA 4HFMA 2QRHA 3UMFA 5HZKA 1ZAYA 4KE7A 5E2IA 2C2KA 1CQIA 1R2QA 3QV1A 3ZTWA 4C6HA 1VHJA 4FJ0A 4QDJA 1DBVO 3JD3A 4IGFA 4Q3BA 4XM2A 2UUPA 4KPGA 1GSOA 2CJPA 4OJKA 4QJIA 1CY6A 1FPMA 1RRVA 4G56A 5EWLA 3BORA 2Q6IA 3RC1A 3VAYA 3NHPA 1HEYA 4DQ0A 2E9SA 2OHHA 1L0BA 1QZUA 3ZY3A 3BUSA 5THXA 5DTEA 2BZSA 3LC0A 3P5SA 3HFJA 4AP5A 4F6RB 2E4WA 3CWCA 4MUFA 3KVRA 1YULA 2J85A 5C7LO 2NVOA 1Q14A 3CT4A 3LTNC 4RVGA 3VKHA 2J41A 2V6BA 4I2VA 3O82A 1FJGB 1U9YA 3ESQA 1JLHA 1BU8A 2LRHA 1U9IC 1V7PC 2VZ0A 2H06A 4Y0AA 3ZX4A 4RFSB 4B81A 5JEDA 2E4VA 5F1PA 3DAHA 1P8AA 1SEVA 3F4LA 1A5ZA 2QX6A 3HMKA 4MGIR 1LJLA 4YV0A 3KZOA 1T0HB 4RCZA 1W88B 4UHBA 2Q1WA 1GARA 3GD5A 2E55A 3LBIA 2C4TA 5H3HA 3WK9A 4JEUA 5IWAB 3PT5A 1YS9A 5K09A 1KTIA 2GRJA 4N5DA 4UOEA 4X8MA 3C24A 3U5TA 4LSWA 1DCKA 5LMUB 2QL6A 3UA3A 3UK2A 1I7LA 3A3OA 3P9IA 1AV7A 4N0PA 2HJHA 2Z3VA 4HDRA 3I28A 1B8PA 3N0RA 2PUFA 3JAWA 2BEVB 1I80A 3LSYA 2GXAA 2Q7XA 3R76A 4WXYB 1Y0BA 2E2WA 2GCEA 5AW8A 4UFNA 1Z0DA 5DTMA 4DM3A 5MF6A 4XWAA 4HYQA 2BF7A 2WIDA 3OO1A 9MHTA 1YS2X 1YQGA 1R27A 4IX1A 3WLAA 4ACBA 4DLZA 4JJIA 5KPJA 1U0RA 3LK6A 4MUBA 4ES6A 4G67A 5T6MA 4JYCA 3T7CA 2FWBA 4GWGA 3FY4A 5E0KB 3JZDA 4IIEA 5CFQA 4TWZA 1RXSA 4W9MC 4WNAB 4D81A 4F8JA 1GPMA 2VDJA 3LF2A 1E1YA 3NMUF 3VDMA 2Q3CA 1CKEA 5BO5A 4QJ4A 4QLOA 2V4MA 3QXJA 3LCVB 1BCSB 3PXEA 3VOTA 3UPTA 4D82A 1ND5A 1IIBA 1WR8A 2R4UA 3ZI0A 3U6KA 1GNPA 1QVVA 1Z4QA 2FG6C 1V95A 2BN4A 1WEKA 2W2VA 2WIJA 4CMEC 1YV9A 1P4JA 3NIGB 5IUNC 3EPKA 2ZJBA 3MA0A 4FBMA 4K8RB 5AOCA 3BWMA 2ERYA 4XIYA 3VKGA 3D3EA 1R66A 1UXHA 5KNLA 1EUDB 3QA3E 1TQ4A 1RRMA 4ECAA 5KNBH 4L8GA 3CH5A 3BOSA 2EX4A 1RS0A 2EZ9A 1TIPA 3SC6A 2PSEA 4Q93A 3TSCA 2VPTA 3HNRA 4IFTA 5HRCA 4X84A 2PX4A 1TA0A 4P22A 1LU9A 4W6ZA 1U3FA 4DARA 1Q57A 5E7JA 4ER6A 3GEGA 3ELDA 3M5WA 4YLEA 2C4KA 4NHOA 3M6AA 3AEZA 1OA1A 2HU8A 4JEIA 4MI1A 4H0FA 4X94A 2JBAB 3UA4A 4F9TA 1SD1A 2J3MA 3FNEA 4AJPA 2OC4A 4MTCA 3ICOA 3BEDA 1A8HA 3B1XA 1K2WA 4MINA 2X9GA 3PFFA 4AK9A 3ZYZA 3CF4G 2BGLA 1F4PA 1Y5IA 3CCFA 4B46A 3LQRA 1AKMA 1ZI8A 1AUPA 2OQIA 5JSYA 4ENTA 5C18A 3HO1A 4FE4A 1BH6A 1H2BA 2Y77A 1HK7A 1MENA 1ZJ4A 3ADOA 3AF1A 5TXGA 4KWHA 1IHDA 4I6GA 1CEQA 1UPXA 3PYMA 2OA0A 2C5EA 3T9DA 5T3UA 4OV6B 4PIMA 3T12A 3I9OA 3C6YA 1VE1A 1JE0A 3HKEA 4NMXB 5A7HA 1T3ZA 3E18A 1P1JA 2QVCA 2B7LA 4OHRA 4JEMA 1WMFA 2YWGA 1GGMA 2FRDA 3M70A 2QG4A 2J59A 2TMKA 5JTUA 2Q3HA 1N6OA 4YIKA 1UJBA 1JSZA 3UO8B 1E4YA 3ACCA 1J2JA 1L4HA 3DLPX 4DR4B 3IDQA 3ROKA 1XDUA 2YL2A 1MAVA 2YXDA 3HYTA 1B6GA 1VYTA 3GZNA 2UXDB 2DBYA 3MWDB 3P52A 4B4OA 2EEPA 1LI4A 1ULZA 2PR2A 3G13A 4FMCF 2NUPB 9GPBA 3EOZA 1KARA 3FRIA 3VR4D 4Y67A 3VTFA 2ASEA 1KAHA 5JPIA 1XXHA 1A8PA 3VC1A 1TEHA 3F46A 4BBZA 2VSYA 1ESZA 1E2QA 4I50A 4C30A 2HNKA 3IP7A 5L3QB 5FQNA 2HMSA 2C2OA 2VYNA 4ZICA 4WY8A 1ZX1A 3CJTA 4KW7A 1KP9A 1ULHA 3SYLA 4G5RA 4MK4A 1KDPA 2FJUA 4PFSA 5CB8A 4BPBA 1GDTA 3TE6A 3PSAA 4BIIA 2MYTA 2EKZA 3SEZA 4CMAA 4IIYA 1L6IA 3L7OA 3UHJA 4DLAA 3T7AA 2OL4A 1GGJA 1C7QA 5EMJA 1E1QA 4ND3A 4D3YA 3BL5A 2YKGA 1FBNA 2C5GA 2OORC 1R4MB 1PFKA 3TBHA 1A27A 1UBTS 1MUUA 5BW4A 2O0MA 3MMNA 4FFNA 1QZXA 4X3PA 5ENZA 4QUEA 4OIMA 4CUZA 2WVGA 1PFQA 3BJEA 4YLGA 4RD1A 1M6HA 1UOPA 1P0FA 2NG1A 2GKSA 3IS3A 4ARUA 4JN6B 2E89A 2E21A 3R3UA 1QOPB 3KKZA 3R5XA 2RB4A 4D5GA 2HZ7A 2NZJA 2OGTA 4FOLA 1UT8A 3DVQX 2GCOA 1KI2A 3FDXA 2FMFA 1TMOA 2RHGB 1ZITA 1SA0A 2O8NA 4LNHA 1SUAA 2RAVA 3MUOA 1R6TA 2FRVA 1TUBB 1KI3A 2AJ8A 3O21A 3N2ZB 5T8KA 4K6OA 3GA0A 2F7SA 2Z2IA 4WY2A 2XY4A 2V8OA 3QUCA 4ZZ2A 3LNCA 4NOJA 4C0WA 5C1OA 1YNSA 2KBEA 3G79A 1E4EA 3HVKA 5DYWA 2BFCB 4D9JA 3PTAA 5IT0A 1KMQA 2VQSA 4IINA 3JQFA 4KP7A 5SY9A 2H1HA 1ISGA 2HLDD 4R0NA 7REQB 3E9ZA 3EFOA 4HBZA 5HCIA 2QPLA 2YDYA 4MS3A 3Q11A 2XOEA 4KH0A 1UP4A 4JOBA 3TRIA 2V4ZA 1HXHA 1V3QE 3RVLA 1L7NA 4EG3A 1OFGA 2A88A 1FVXA 3DV9A 2A9OA 3N5CA 2P7IA 4NI5A 1LX6A 1SC9A 1LW7A 1GUDA 4AO6A 5ALFA 1NPTO 3BFJA 4GI2A 1K7FB 1BHO1 3QQPA 2A1TR 3NOOA 4JZYA 1KIMA 4L0CA 4N49A 3VVMA 1X80B 3EXEA 4KUGA 4ARAA 5L3SB 1QANA 3MRTA 4RJJA 4Q16A 3ZWNA 3BXFA 5MGBA 4I9FA 3LWNA 5TQ0B 2GAAA 2P9JA 4ZVLA 3HY6A 1N7HA 1XAJA 1ZUWA 5C1IA 1A9XB 4EYKA 1JQ5A 3PE6A 2MINA 4OMDA 5AKJA 2KE5A 3LC7O 3U6BA 1THZA 4HMPA 3UZUA 3WL6A 2VA8A 1BNCA 1YRBA 4L51A 2I76A 3GCZA 4QGFA 5BQ5A 5BSMA 4M46A 4WFJA 3PQCA 2VPYA 4KTTE 5IBPA 4NBSA 1J22A 1SNYA 5E9AA 1KQ3A 1I9CA 4IBOA 2JAPA 5LZ8A 1FQWA 1KL7A 2XB8A 2RGBA 3DQQA 4BUCA 1YRHA 2OXFA 1LC0A 2VXCA 3RUIA 3ZPXA 3ETNA 2I4MA 4LGYA 4C6SA 3I61A 3EDYA 5C8XA 2O2SA 4PSUA 5BVGB 3GLGA 3J7AC 1Y1QA 3R40A 1II8B 1ZKMA 2VNHA 3VSBA 4EG7A 3FUUA 3WGOA 2I9KA 3NONA 4P7JA 1RYNA 4DCPA 1A7UA 5E4FA 5KQLA 1P6XA 1VLLA 4IUCS 5BN5A 3UT5A 4A3SA 5EYPA 1VE9A 3ZI4A 5FPKA 3C85A 3GBVA 1QCYA 4Z4FA 4QASA 1WHSA 2YS6A 4BZXA 4B6GA 3TMAA 4LFAB 5AVRA 1V48A 1CNMA 3CKKA 3CXRA 1XL0A 4XASA 4AY6A 3P71T 1A1VA 4B3XA 1F4VA 2C0CA 2C0QA 5C5DA 4MKIA 3VMMA 2RH8A 1ECPA 1TEZA 3JQGA 2C8LA 4O1IA 1A76A 2VDVE 1BDJA 2WRZA 3BJRA 3FUVA 3NVDA 3C6MA 3OE4A 3W2TA 1Z13A 4CKYA 3RREA 4RWZA 3ZVRA 4IWYA 1JIKA 1JMKC 5FR2A 1GPNA 1E62A 2VJCA 3ZDZB 1F6DA 2G71A 3DF7A 1LTQA 2WJAA 3ENNA 5EKXA 1SUBA 4Z3DA 1BYIA 5DI3A 3A3KA 5C9ZA 3LPAA 1RSZA 3KJNA 4DNPA 1GAWA 1XRRA 3BMXA 3O7MA 3CB2A 3UV3A 1L5FA 1YH3A 2YC4C 3E53A 3NUQA 5ESXA 4UMDA 2C7QA 4TKMA 1FTQA 5C51B 1QXSA 1DLIA 2W2MA 3U4CA 1P6UA 3I42A 3PPXA 4ZT6A 3UUFA 5B64A 5M7EA 2XBLA 3CFYA 3IKJA 2Q8QA 3R5HA 1J0DA 1DAFA 3TD9A 4TXLA 1PL0A 1MHPA 1H1LA 3Q40A 2HMWA 3A0UA 1AUVA 1LBSA 2DE0X 4FMPA 1BVHA 1XCGB 2ZRIA 1EWYA 3MCWA 1Q20A 1I1NA 4YQEA 2O8DB 1KK2A 1PQ4A 3ZCXA 3CVWA 2CV1A 4GW3A 1DXYA 3WAJA 1ECLA 3K5IA 4JUCA 4EHAA 1KMNA 1Z33A 4D5EA 2EJUA 1HNXB 3BT7A 1R0SA 3KELA 1QH1A 2ILTA 3I64A 3IKMB 4WWHA 4ALKA 4ND8A 4AY5A 3QOWA 4PCUA 2ZYHA 2C9DA 1FBTA 4HZUB 2R4TA 3VA7A 4U2GA 4URXR 3HJAA 4JJ4A 1NUSA 1IBRA 1AG9A 2NZ2A 4RPIA 2WV9A 4JYPA 2X9LA 1XDWA 4AN1A 2J5QA 3O2QB 1TPYA 1VMKA 1SUDA 3I6QA 4HH3C 4O4JA 3KUXA 2GPAA 1TRHA 4QU5A 3U3XA 2ZTUA 1RABA 2GRAA 2O2JA 1WKBA 2JZOA 3EZNA 4GYJA 3WNZA 2OLKA 1SVLA 1JLKA 1VLQA 4WZBA 4DJJA 3VHQA 3ROGA 1M2OA 4ZT5A 1XYYA 1NJ2A 4LV8B 4BFXA 1BU5A 1S6YA 3OE7D 4OQNA 4R6WA 1EFUA 4DTIA 1SVUA 1QRTA 4H1TA 3PWZA 1NBEA 1Q7BA 3PGLA 5TR9A 2BM0A 5DCUA 2H1SA 2NU6A 2ZJ3A 4IJQA 3SGLA 3EMBA 3GMIA 2QE7D 4M0FA 2NXCA 4Q1BA 1OTYA 2RAUA 1SKAA 3QIVA 1C7JA 3LU1A 3D2AA 4MWTA 4E1VA 5CCXA 3PDWA 1BEUB 3M5CA 2HF9A 2ZJ6A 4NNOA 4LYFA 2M6KA 4ZT4A 4B8YA 4P3YA 3N0TA 2Q45A 1DJOA 1ZH6A 1VI6A 3E84A 5JQGB 3QMVA 3GMSA 3K0FB 3BTUA 1TVEA 3C98A 1WMEA 1QYXA 3N6RA 4INPA 3DBLB 2DG2A 5GONB 3ZE8A 4PCLA 3OX3A 3PC7A 2AE1A 2FPUA 1MF7A 2P30A 3A9UA 4MWEA 3UAZA 4JYZA 1QJCA 1Z2NX 3KCNA 3DDCA 4HUQA 3KDAA 3F6SA 2OLJA 4IICA 4G81A 3SYMA 4IVQA 3N87A 5BQXA 3GY0A 5MGNA 3UK6A 4QVIA 4PZ0A 2C9YA 4BMNA 4MDEA 3TW6A 1IEXA 4NEGA 4LJ5A 3PZBA 4KQHA 5E4TA 3SZ3A 5TLSA 3GYBA 1S3IA 1YFZA 2OFWA 3DOEA 2GM3A 3ANNA 3LLMA 1TJ5A 3W5HA 1NVAA 4L4SA 3RJMA 3H19A 3V8MA 5A62A 4M8SA 4HVTA 1P7CA 2AYYA 3DPSA 4PYKA 5HBRA 3RHTA 1PNVA 2CE2X 2QU7A 721PA 3UYKA 2D5AA 1W581 2IOYA 5TPWA 5DHSA 1G7TA 5LZ7A 4EYQA 4E4RA 1FXWF 2BDEA 3O2NA 4CZ2A 1ZQ9A 4PRKA 2OYCA 1JKJA 4OPMA 5FNVB 2BFEB 5AJYA 2IHVA 3QWFA 3HEBA 1CS0B 4EF4A 2YFYA 2H85A 4LRQA 1GZVA 1JU9A 1FRNA 2XUPA 3QVGB 4BMYA 2VIIA 4YMLA 4ZCIA 3WG9A 4PBTA 1WXHA 3TR0A 3QVTA 3UAVA 2O7VA 1ULUA 4L6AA 1ADJA 4YAKA 3IEMA 4DLNA 3JVEA 4MR8B 5G0TA 4CGYA 2CDCA 4NSNA 5JD3A 4FGUA 1ISSA 3E8MA 4W82A 1RXVA 2CF5A 2G1JA 5ABPA 5DOZA 2I6GA 1EEHA 1VE3A 2C2XA 4J3JA 4GL4A 2OG2A 3EGIA 4WTOA 5ER6A 3LVQE 1M66A 3D6UA 4MQ6A 4EFDA 2PPVA 4O4LF 5L53A 1WM1A 1D5WA 1KYQA 1NNLA 1U31A 4LV5B 4YASA 4YP7A 1VL0A 4LSMA 3TLAA 7GPBA 4IS2A 2OMKA 4GPBA 4DABA 2UVQA 5AHWA 3DO5A 3W77A 2IYSA 2E5WA 1AQNA 2AJLI 4ZARA 3GFFA 1DOHA 3K09A 2HJWA 4ZDIA 3OIUA 2PS0A 1JQJC 5A5VA 3R3SA 1X19A 2RK3A 4TV8B 4WOJA 1N2JA 2G8NA 3HCRA 2R6R1 2ZRPA 4BNZA 2CSUA 4C78A 5BVHA 3HU5A 2AUMA 1ZIDA 4Q02A 5BURA 2V3CC 2KWIA 3I9KA 4GI1A 4REMA 3KQNA 1VL1A 2O4CA 2R5NA 1XCJA 1FTWA 3L2OB 4HB0A 2W8ZA 1I3MA 2NW6A 3OFVA 5CJPA 4HCJA 3SG0A 5A06A 2DT5A 4LECA 1ZYUA 1I0IA 4L5CA 2BP7A 1KNXA 3WL8A 1U5AA 1JG6A 3TB6A 5AVJA 4W8OA 3VZCA 3K71B 3L7JA 1FSPA 1FTNA 1YIAA 2M2IA 3VPSA 4GX1A 2RFLA 3RTAA 4FMDB 1F7VA 3WKDA 3WYFA 4I5EA 2VJBA 1QJ4A 1K6IA 3HDHA 5HJ7A 5HF5A 4CCSA 4RHEA 1XEXA 3AZQA 2ACWA 3P0HA 4MO2A 1UXJA 2AXPA 2WTMA 4WMLA 3FNHA 4CM8B 2NP7A 3PS9A 5J43A 1OPRA 5JUWA 5DHPA 2OXTA 1WMAA 1RM3A 4WUTA 2C96A 5BT9A 2GX6A 3BDIA 1BEEA 4MR9B 4TTJA 1NW6A 2BIFA 1BGWA 4MDFA 4HNAB 1ZG3A 1CEXA 2PYDA 2B1RA 3PPWA 1MB3A 3WGKA 2OAQ1 3ND8A 2O5CA 1O94A 1DKLA 3GO4A 5BN3A 4DMLA 3NBYC 4M0EA 3LSTA 3G9QA 2I1VB 1O89A 4F7DA 2FE4A 1GCAA 3NBXX 3VNAA 4R1TA 3KUCA 4RV4A 3L8FA 2R6FA 3NG1A 1PR2A 1U3GA 2CNWA 2D74A 1C9YA 1KAOA 3B78A 3I0ZA 4BNJA 3L82B 4GE0A 5HK9A 4XD7D 2XIQA 1UFKA 1YZFA 1YRWA 4KQKA 1R9GA 1M6EX 3SNKA 3EPLA 1G0OA 2BHSA 1UKVY 2MYPA 1E9BA 3EVAA 3HHEA 4Z9XA 1A7KA 1LQTA 1K66A 3BGIA 1HTBA 1Z06A 3CUEF 3TTXA 3FHLA 5LYJB 2BRUA 1GEGA 4BTLA 4EA9A 4G0VA 4AUMA 4BY9E 3PGJA 2LCIA 2R97A 3C6XA 2R1VA 4FGLA 3HYRA 4MA4A 3GLIB 1NDUA 1TZMA 1NRXA 2R5WA 1UC4B 2TYSB 2VQDA 2IUEA 2SKEA 1W4BA 3KT3A 3NI2A 2PGNA 4JUFA 3RVDA 2QTRA 3AM1A 1VLMA 2VRNA 3M5PA 1DC8A 3Q1KA 4AYWA 3BB1A 3QLUC 4BEJA 2YHAA 4ETMA 2AN3A 5LIPA 4KMRA 1AUXA 1MHTA 2Z2KA 4RAOA 5ICEA 1JAYA 1IAVA 1K8XB 1THMA 2I9PA 2IYEA 2VAMA 2VZLA 3DC2A 1O87A 1RAHA 1X94A 2FPSA 3LBHA 2HA4A 3G6KA 4B40A 1CEEA 1MGOA 1SUEA 2Q7OE 3GUCA 2PFSA 3WY9A 2AR9A 4HQRA 1F6BA 1PJ8A 4KAXA 1GPBA 2R7AA 3QVOA 4UNPA 4G63A 4UEKA 3GLUA 1QKKA 1WAMA 2PA0A 4Q7QA 2IYZA 3OMXA 1ONNA 4NIMA 1WUJS 2DH6A 4EO9A 1EVLA 2QZ4A 1JKIA 2VXYA 2P2YA 3HZHA 4XWKA 2V9CA 1QO7A 1RLOA 4I5DA 4UC0A 5BRAA 4LJSA 2QJOA 3CONA 2GFHA 2HRQA 5KINB 3N2EA 3I0NA 3CB4A 2J3JA 4HQOA 4BKQA 3ZK7A 3PL5A 3QNUA 1WY7A 4RVSA 1GGVA 1W4RA 3P2EA 4Q0MA 3S1AA 3SE7A 3FKQA 4BJ1A 5L7TA 4RIGA 4TMWA 4E5PA 5J58A 1AGPA 1ZM3A 2VRCA 3KVNA 4IYRA 4L8YA 4LDAA 4QBIA 1XZNA 3P2YA 5IHPA 1IOVA 1RWXA 2D00A 4BFYA 4NESA 4DLWA 2ZCJA 2REQB 3T9FA 1YZVA 4NYJR 2QXUA 3PPVA 1D04A 3NBKA 2ZYSA 1I3CA 4Y2RA 5K6AA 5J1SB 4F6RA 1DAOA 3TJMA 1FIUA 2DYKA 4XGKA 5ECWA 4QQFA 1AHIA 2H54A 1P2SA 2R1ZA 3FNQA 3H2ZA 5INTA 2OBNA 3MD9A 3NAZA 4OG2A 4XA8A 4B2PA 3PNMA 3E7PA 1K7EB 4RV5A 4UM5A 4LHEA 1JIVA 2P2ZA 1Y8RA 2QRKA 4LRWA 5E3HA 3O83A 4BVLA 5BMOA 5J4YA 2PZBA 5JCJA 4CM5A 1KP2A 3PQ7A 3IL2A 2IU4A 1EGAA 5LFAA 3ZD7A 1NGSA 3LCUA 2AV6A 2X0EA 4AJ9A 1W88A 1KH1A 2BE7A 3WV5A 4TTVA 4FZ3A 4CIXA 1EB9A 3Q8KA 2QX8A 3GLTA 5EIBD 4CDGA 2GXSA 4A2PA 1U9JA 4JK3A 5LZ9A 4W5OA 2A5GA 4JU8A 1TKAA 4I1VA 4L9SA 2C9CA 2FOXA 1XNHA 4LG1A 1GFWA 3A1SA 3FNFA 3TFWA 2I7TA 1CWUA 3GQVA 1SOMA 1ZHOA 3CHYA 3ZVKA 1W52X 4C06A 4DCCA 1HYGA 1Z7YA 2GYYA 4URFA 1H2FA 1E2PA 2BEVA 2JB9A 4H3KB 4MUYA 3K9WA 4XDZA 5CX4A 2W7TA 3ANMA 4NU5A 3PNLA 3EW9A 1Y7IA 2P9HA 1EVYA 1X1AA 3BMCB 4QYWA 3RS3A 5EE3A 1DOZA 1QMGA 1U7DA 4CMHA 3DF9A 3M83A 1RCTE 2HMUA 3O0TA 3B12A 3GLQA 1D4ZA 3N2YA 3EODA 1ZD1A 4F1JA 1D6MA 2Z5VA 4QDKA 3BMNB 3OLWA 1VPVA 4KO1S 5J5VA 1ZM2A 1KFBB 2QX4A 3MWGA 4FS3A 4H77A 3LJKA 4O4HB 1MOPA 4P4SA 4HAZA 4WNAA 3RH0A 4CLOA 5K45A 3E1GA 1WQ3A 3KEGA 4L8VA 3JQEA 4G5HA 4HDAA 3K6KA 4WBNF 4LUCA 4LF5B 1JB1A 3FMGA 3NGXA 4JASB 4L8LA 5FA8A 1XO1A 2R11A 1EI9A 4OBXA 2NTNA 1BCSA 1T3GA 4DV7B 3SBOA 2CUKA 3FWPA 3K0EA 4GT1A 3VV3A 1QOQB 1DKQA 1XALA 2Z08A 1BZYA 2R8XA 4PZLA 2CXQA 1H6AA 1IHUA 2AQKA 1XJCA 3QEOA 4KE9A 4OK6A 1C9MA 4RX1A 2E6UX 3W06A 4N48A 2R48A 2KHZA 2DHQA 4PTYA 3V8PA 4YT5A 2JJ1D 2JEYA 1P6QA 5TY0A 1T24A 1RHUA 4RY9A 5H3LA 2AZMA 1EUDA 1GTL1 5A04A 1UWKA 1D2CA 1P1RA 4Y1RB 1QIFA 4GMFA 3R7BA 4F46A 4B85A 2Q0QA 4U2FA 1CQJB 1Y1PA 1WUKS 3HP7A 4TVBA 2JGEA 3GFPA 4UHDA 1PZXA 1WIWA 3SD7A 1VJ1A 4DMKA 5JCOC 2O3SA 2DPGA 2Z4RA 1G8JA 3RC3A 2YOHA 3LD9A 1BXRB 1Q17A 3EW7A 3M6XA 3MW8A 5I7VA 3PLAE 3N8GA 5CUQA 1NX9A 3A1VA 5LDDC 3FIUA 3A28A 1BVYF 4QELA 2HO5A 2DU8A 2RIRA 3WWPA 3AOEC 4AJLA 2JBAA 1Y8QB 3BPSA 3PEVA 2FCRA 5EQDA 4EJSB 4OX9Y 3PD0A 3ZW8A 3IDSA 4B84A 5GOZA 4I4TA 5FFNA 1B3RA 1L8AA 3OTQA 5LLTA 3ME5A 1RC1A 1AQJA 2PUBA 4CTKA 4LV6A 4WLOA 2PMWB 1SULA 1JG2A 4ZQIA 3SF8B 4G5FA 2JPDA 2QTTA 5IS2A 4XWYA 5AXAA 1EUQA 4F0JA 3EFBA 3RTDA 3AFHA 2B4TO 3AV3A 4K5QA 4J3NA 3WDKA 4KFSA 1Y8ZA 2PS1A 3MN1A 3SS8A 1RYFA 3F3YA 4PG4A 1M76A 4QEKA 4Z0HO 1GAEO 1YMVA 1NRIA 2HY7A 4PNHA 4RL6A 5DI9A 3WS7A 4WRRA 3ANTA 3AVUA 1K5PA 2PH7A 2JVKA 3U44B 2I0FA 1XZEA 2WAAA 4DJAA 4RTRA 1SHLA 3M6WA 2CXNA 1OU0A 3MOGA 3MTEA 3Q7TA 4G4IA 4HDQB 4YCNA 2ZRQA 5C80A 2PKYX 2QTWB 1VKOA 4CR6A 4GAEA 4IO1A 1QB7A 1IY2A 1N9GA 4EVQA 3MWDA 1ZL2A 4BB0A 2VTBB 3I53A 3UQZA 2WWFA 1JR6A 1REQB 2QLJA 2JGIA 2QQGA 4QHYA 4RZ2A 3AI1A 1UFOA 4WASA 2NUPA 5JNVA 1NVVQ 5COBA 2BMEA 2PQ0A 4N5NA 4I1IA 1TU0A 4EG0A 3FLBA 1O77A 3L77A 2WUDA 4GS5A 1FYXA 5JBNA 3HEAA 4IMRA 4OXXA 4AUEA 4ED9A 4GU5A 1MQAA 2J1LA 2ZSIA 4EYSA 5HIAA 5EZQA 4QDUA 1LRKA 1P7PA 2BKVA 1M1YB 3IP8A 5TVKA 4ZREA 4GPD1 3UMRA 1QP7A 3LX6A 4LHXA 1N5KA 2EBHX 4ID9A 1M1XB 4JR1A 2A5JA 2HSGA 4FP9A 3AR6A 3DOOA 4G1VA 4PSKA 4DYHA 2GAOA 5C8VA 1E98A 1ORHA 1QC5B 2O6LA 3D6MA 2WDZA 3SZRA 1XTKA 3V9PA 2XOKA 1B6TA 1NX6A 2JBHA 5EPEA 1ZMBA 4MARA 2JBWA 3K1JA 4FKMA 1P4GA 4EO7A 4J2OA 2YJTD 2GBCA 2GBGA 5DMHA 4IG4A 4LHZA 1N2OA 1R4MA 1D9XA 1B8UA 1KFKB 3DFUA 1KSHA 5F5XA 4BNUA 1GQSA 1KAGA 4CE6A 1G19A 2REXB 1PW7A 4DA4A 5DGCA 2RGRA 3H9JA 1RWNA 3T6KA 2D0IA 3GXBA 2OR3A 3EIHA 2WU4A 4E2YA 3WHIA 3EEIA 4NYMQ 4Z7NB 1FXUA 3IAS6 2HB6A 5TGTA 4EUSA 4ND1A 1T2VA 4E70A 3TINA 3KZVA 3MG9A 3M4NA 4JNKA 4LZWA 4C7JA 3L8EA 1NQ5A 1QDLB 3D31A 1B0AA 1DDIA 4DGSA 4K0KB 3DGFC 1GFSA 3D4PA 4IP0A 4LMPA 1D2MA 3G8CA 2AR7A 5ULLA 4FFVA 5LD2C 4P54A 4KR9A 3VU8A 4US2R 1GKYA 3OJXA 3EFHA 1J24A 3SZUA 4GRDA 4FYJA 1J2EA 1PJSA 1TUBA 1ZK0A 2BZGA 4RUKA 3T1VA 3UOWA 5HZMA 1ZMTA 2GJKA 4DMMA 5KOIA 1EFRA 4YRNA 4K88A 1J8YF 4EX6A 5I45A 1YJ5A 5KYNA 2BFCA 4OO3A 2PCLA 1O5OA 1MABB 2X2PA 3EN0A 3G2PA 3P2JA 1OY1A 4WNCA 1EKXA 4H6WA 1XTQA 4JQSA 1CIPA 4DMFA 5C5EA 2ZITA 3L0ZA 1NATA 3UKOA 1FP4B 3N0VA 4AMBA 7REQA 4JNCA 1S5PA 3T3PB 2O2EA 4IUBS 1C2YA 3VR6H 1DEXA 4E1AA 2R00A 3OD1A 4UQPA 1NRWA 1OI7A 2QGZA 1NC1A 3O1JC 4J2TA 3ZU3A 1AKYA 3FOCA 3QRWA 3OQOA 2X2EA 1OW3B 3HH8A 1GQYA 1NFQA 1SQ5A 1YBHA 2H5JA 3D5EA 3D8UA 2ODWA 4J7CA 4C0BA 3ZIAD 2ONJA 1EP1B 3ZCPA 1D5CA 5IDVA 1SHKA 2X77A 5DBHX 3IOMA 1HQCA 5IDXA 5C81A 2IRWA 4NAVA 2I8AA 5BUQA 3FLMA 1WSBA 2ENWA 2PU5A 3IA7A 4HO1X 1X80A 5EUCA 1OGJA 3ESDA 3GLGE 1LZLA 3IH5A 1XRLA 1E3SA 5TQ0A 1Z6PA 3LFTA 3PHJA 2J3HA 4AF8A 2F1HA 5GADl 4NV0A 1A9XA 2GPBA 3DC7A 1KZ1A 1WB4A 4MJLA 4X63A 3AQIA 1I4WA 1E1DA 1P9RA 3FUWA 4W6QA 1Z4IA 2FWIA 3A6DA 4OJMX 5E1DA 4JT8A 4ALJA 3CXUA 4BLRA 6ABPA 3KAPA 4MDYA 3GEPA 3SEQA 4FDVA 4EITA 2G5PA 2QD2A 2WWXA 4OVKA 1JIJA 4P3PA 5EHZA 2F8SA 3M8KA <