1P1BA

Guanidinoacetate methyltransferase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
193
structure length
193
Chain Sequence
RWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Guanidinoacetate N-methyltransferase
publication title Monoclinic guanidinoacetate methyltransferase and gadolinium ion-binding characteristics.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 58
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2003-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1p1bA00
5EHIA 2EFJA 5DXAA 3UJCA 2YXDA 3C3PA 1PJZA 4PYJA 3M6VA 4YMGA 2G1PA 4PNEA 3FZGA 4RVFA 5U4XA 4FT4A 3I53A 3DR5A 3KPJA 1I4WA 2ORED 3FPJA 5DWQA 4U7TB 3UFBA 1JQEA 4IV0A 2UYQA 3B5IA 4GEKA 2ZZNA 3ANXA 3HA3A 3M6WA 3EVBA 5IH3A 2PX2A 4DKJA 4PCAA 4ER6A 4YUXA 4XUDA 2IH4A 2CL5A 1XDZA 3PFHA 1RJGA 2NXCA 3OFKA 1IM8A 5DXJA 4CWAA 3GWZA 3C3YA 4GOLD 4PYMA 5CCXA 4PGGA 3OPNA 3U81A 1QAMA 2IPXA 4XUEA 3IEIA 1QAOA 5EMMA 2YTZA 3GIWA 1JG4A 4JXJA 3FTEA 10MHA 3HM2A 5DTRA 1NV9A 1V39A 4YUVA 2YQZA 4BLWA 5EPEA 3JWIA 5DM0A 4BY9E 3KU1A 2H1RA 1T43A 2PY6A 1L3CA 3RIEA 1SUIA 5JR3A 2OKCA 4E31A 5KQRA 3R24A 1RJEA 4C06A 2IIPA 4OBWA 5E9JA 2NYUA 2ONZA 5KQSA 2AN5A 3MERA 1N7JA 2XYRA 5K8VA 5GINE 1DUSA 2GA9A 4E2ZA 4E2XA 2ZFUA 5K0BA 2DPMA 3CJRA 4X61A 2ZULA 3T7SA 3O4FA 3H2BA 5DSTA 1P39A 2HMYB 2O57A 2ZVJA 5FA8A 3THSA 2HV9A 5HEKA 4QPNA 3HCAA 3MQ2A 4X63A 3NW9A 5CVEA 3HCDA 5HILA 3FPHA 4GC9A 4HC4A 2NXJA 1P1BA 2AR0A 4HTFA 4PCLA 3TRKA 5LQCA 3D2LA 1M0EA 3B89A 3KPVA 3OU6A 2ZIFA 4Z2YA 5LQKA 2ZBPA 1NW5A 3E8SA 3LDGA 2FCAA 2IH2A 3PS9A 4FSDA 3EEOA 5T67A 4AZWA 2PT9A 5EHGA 3P9IA 1EIZA 3NDJA 2AOUA 3KR9A 5DSXA 2Z6AA 2P8JA 4QTUB 1FJXA 1JQDA 3NWEA 4PIPA 1KHHA 1KYWA 2VZ9A 4KDRA 2JH9A 3I5UA 3A4TA 1Z3CA 3EPPA 2PX5A 4F85A 5DRTA 4EKIA 3GRVA 4YV1A 3PX2A 1B42A 4C05A 1YUBA 3LHDA 3I58A 5LQRA 3PT9A 3TM5A 3S68A 3CC8A 2JHPA 3EEYA 3LKDA 4OQDA 4DQ0A 3ER8A 4HGYA 4HRAA 3M4XA 4EQZA 2OXTA 3VSEA 5CVDA 2AOXA 1VE3A 5F2OA 5EOVA 5FUBA 2DULA 3TOSA 4AZVA 4AZSA 4RTNA 3HTXA 3B3JA 2JHAA 2BM8A 5FWDA 2HTEA 2XYVA 4E32A 5FULA 1X1CA 1KYZA 1YF3A 2OPBA 2I9KA 2O0LA 2YVLA 3AJDA 3KQMA 1ZQ9A 3UJDA 5K0GA 4PYNA 3HP7A 3TFWA 3JWHA 3UA3A 2PKWA 1R8YA 2AOTB 1UFKA 1FP2A 3G8AA 4PYLA 4XCXA 3DMFA 4BP1A 3CBGA 1JR4A 3RODA 8MHTA 1XTPA 2GLUA 4M7RA 2ZIEA 5DPMA 4KW7A 4RV9A 3MGGA 3BGIA 5LQUA 5B1SA 2ZTHA 3M6UA 4R6WA 5E9WA 3RW9A 2BR3A 4YUZA 5LR6A 2VDUE 2PX4A 3OZRA 3G2QA 4O29A 3FUWA 2N47A 4IV8A 2K4MA 2EG5A 2PLWA 3GO4A 1QYRA 2Q41A 1ORHA 1EJ0A 1M6YA 2AOVA 3REOA 5K0LA 3IHTA 3E05A 1D2CA 3KKZA 5BW5A 1L9KA 5F2KA 2OZVA 1AQJA 1FPQA 3GDHA 5EMKA 5GIPE 4RTPA 3LBFA 3P71T 3GRZA 4LWOA 4E33A 4LG1A 4RVDA 3V8VA 2P3QA 1YZ3A 3DP7A 3WSTA 3DXYA 2GPYA 3MCTA 5DM4A 3KPWA 5P8WA 4AZTA 5EEHA 3KQVA 1I1NA 1SQGA 2CWWA 3O7WA 5HIMA 5GIOE 4CKEA 3LDUA 5JUWA 2FK8A 2OO3A 4R6XA 5FQNA 4A6EA 5K0FA 5E1OA 1EQAA 2XVMA 3A25A 1NW8A 3BKXA 3QOXA 5H02A 5ICCA 4DCMA 5K05A 4RTJA 1JTFA 3MHTA 1MJFA 3R6TA 3EVFA 1VLMA 3G89A 3P9KA 3KQYA 4E2YA 2ESRA 3BUSA 2NP7A 3P97A 3BKWA 5K01A 2ZSUA 4X41A 5FWAA 2ZWVA 4ISCA 1RI3A 4YUWA 1JTEA 5D1HA 4C08A 1XJ5A 2BR4A 4MTLA 5C0OE 5FHRA 5K09A 4GUAA 3SM3A 3BZBA 3M70A 4QDJA 3PLAE 3LSTA 3E23A 2G72A 4PYQA 1JG2A 3B7PA 3EGIA 3X0DA 2F8LA 4P7FA 2VS1A 4RX1A 3EVZA 3UJ7A 3GU3A 3SMQA 2P41A 3THRA 2PWYA 4L7VA 3KPYA 1H1DA 4CKBA 5CD1A 4E30A 4HG2A 3ID6C 4RTOA 1XDSA 1L1EA 4RTRA 2B9EA 5CVJA 1QANA 4DZRA 3L8DA 5ERGB 4C07A 7MHTA 3A27A 5EC8A 5EKUA 2AVDA 1JSZA 1BOOA 3UA4A 4P7KA 4QVGA 3SX0A 3Q7EA 3FPFA 3OCJA 4PYIA 5EQJB 5HIKA 4WVLA 2NP6A 5GM1A 1KPIA 1P91A 2GH1A 1SVUA 1NBIA 2AN4A 3BWMA 3T7TA 2G71A 2JJQA 3DLIA 4GQBA 3DMGA 4ATNA 2XBMA 4ER0A 4EK9A 5IKMA 5HIIA 4RSRA 1WS6A 4QVKA 5GWXA 1XXLA 3QOWA 1X19A 3HA7A 3UJAA 4C4AA 3UJ6A 4RTSA 3UZUA 4QDKA 5HFJA 2IH5A 2R3SA 1TPYA 2FYTA 3NJRA 3HVIA 3O31A 1KIAA 1Q0SA 4HGZA 1SUSA 4B17A 4GOND 2ZCJA 1M6EX 2BR5A 3F4KA 2UYOA 3DLCA 3EVAA 3SSNA 1ORIA 3I64A 4RYLA 4V0QA 3K0BA 5FHQA 4R05A 3BWYA 5DTQA 5EMJA 4ER7A 4DA4A 3BT7A 5BXYA 3PX3A 5FADA 1XVAA 5MHTA 5D1NA 2ZWAA 4LECA 1VL5A 1ZKDA 3CJQA 4EMSA 2P3OA 3FUVA 1BHJA 4GBED 4E70A 3A7EA 3M6XA 4QQKA 2UYHA 2ADMA 4PYKA 2VDWA 4RTKA 2QRVA 2O05A 1KPHA 3HCBA 4V0RA 1BC5A 2OY0A 2ZZMA 1D2GA 1RJDA 3Q87B 3ORHA 3SSMA 2JH8A 1ZHFA 3CKKA 3TR6A 5K0CA 2IDKA 4GOOD 2C7QA 4MIKA 2ZW9A 5LQNA 5EZSA 5DM1A 1YB2A 3FUUA 1X1DA 3PB3A 1G8SA 3BGVA 3CJTA 3EVEA 4QPPA 2YUIA 5LSAA 4HH4A 3GCZA 1JG3A 2YXEA 2I7CA 1FBNA 2GS9A 1TW3A 2GAFA 4FZVA 2Z6UA 1KXZA 1L3BA 1NW7A 3BWCA 3MTEA 4MHTA 4XUCA 1UWVA 4KIGA 4F84A 3R0QA 4Y2HA 1WZNA 4OQEA 5K0NA 5K0JA 2ZBQA 3CVOA 2FRXA 4M38A 2QM3A 4OBXA 4IKPA 1O9GA 3HCCA 2PGXA 3M33A 3ELDA 3MCZA 3MB5A 5DT2A 3LDFA 4BLVA 3FTFA 3PVCA 1EAMA 1INLA 2PV0A 3FTCA 2OBFA 3HVJA 2QY6A 5DX1A 5FQOA 4EVIA 5BP7A 2IP2A 3OU2A 2V7EA 3B3FA 3NDIA 4HTFB 4R8SA 2CMHA 1WXWA 5CVUA 1O54A 3GRUA 4RWZA 2IBSA 4C03A 3TKAA 5EZQA 4YV2A 3ER9A 3P2IA 1AF7A 5DX8A 4AX8A 4ER3A 1ZGAA 2OB1A 3DXXA 3GXOA 2ZBRA 5EG5A 2PX8A 2E5WA 2EX4A 3KQWA 1R00A 4PYOA 5LQAA 2UYCA 3E7PA 3LCVB 4EKGA 2AOUB 3FYDA 4FR0A 3HVHA 1IXKA 2R6ZA 1SG9A 5E2BA 2AS0A 1NW3A 3SGLA 3NMUF 3AXSA 2WA1A 1KPGA 3BWBA 4PIMA 1R6AA 3LBYA 3KQQA 3LPMA 3R9XB 5CIYA 1SKMA 2YXLA 3OE4A 5E1MA 5GOZA 2QRVB 2B78A 2B25A 3NTVA 2XYQA 1VP9A 1Y8CA 1N7IA 4GOMD 1JSXA 2Z6QA 5EIWA 1AV6A 4MQ4A 2PSSA 1KR5A 4KVZA 4OA8A 4P7GA 4LWPA 2C7RA 2O06A 5ICEA 5CUQA 1WY7A 4X1OA 1EJ6A 4OA5A 1X1AA 3TPZA 2PVCA 2IDJA 3FTDA 3SSOA 3LECA 4M36A 1QAQA 4GC5A 1VP3A 3P2KA 3T7RA 3KPUA 3G5LA 3OFJA 3NWBA 3QV2A 4HSGA 3EVDA 2NXEA 2AZTA 2JHCA 3HA5A 1XCJA 2GB4A 3HNRA 4KDCA 4R8RA 3G5TA 5E2AA 1R8XA 4P58A 5EGSA 2P1DA 1FP1D 2CMGA 1QZZA 2WK1A 1EG2A 4RTMA 5DLYA 5E8JA 3ELYA 3NVMB 2IBTA 2Y1WA 4IWNA 3G7UA 3EMDA 4F86A 3DOUA 1NBHA 2Y1XA 3DH0A 2FPOA 3SVZA 3P8ZA 1ZGJA 4ZTBA 1RI1A 2ZIGA 1F3LA 5GP1A 3KR0A 2HNKA 3OZSA 2P7IA 3EMBA 2AOWA 3OE5A 3BXOA 3KR2A 2H00A 4YV0A 3IV6A 3FUXA 2FK7A 1KP9A 3HCEA 5T64A 3I9FA 2I6GA 3A26A 2B2CA 3P9NA 5BW4A 5K0EA 1YFLA 4RTLA 2P35A 5CM2Z 1WG8A 1G8AA 3K6RA 1P1CA 3HEMA 3LCCA 3G88A 4FP9A 4FSXA 5E1DA 4FT2A 1NT2A 5ICGA 2YX1A 1ZG3A 5E8RA 3EVCA 5FTWA 1F38A 1U2ZA 2HR1A 5C1IA 1R74A 4OX9Y 3CCFA 3KQOA 4H0NA 5LQJA 3FRIA 3C6KA 4G56A 5M5BA 2JG3A 4PONA 1DL5A 2G70A 3ERCA 2BH2A 4A6DA 5KYGA 3MAGA 4U7PB 1RI4A 1RI5A 4FS8A 4E2WA 2PT6A 2H11A 3KQSA 2FHPA 2IGTA 2VDVE 3A7DA 2AOTA 3FRHA 1Q0TA 1O9HA 1VPTA 3EGVA 3ELUA 4GF5A 4K6MA 2PXXA 1AQIA 2PXCA 3P2EA 3DMHA 3GRRA 3LX6A 3GNLA 5HZMA 5E1BA 4UOEA 5F2NA 4M37A 5DRYA 1PRYA 3MTIA 4QTTB 4PGHA 1TW2A 3DUWA 5KVAA 4CXMA 2A14A 4Y30A 3UBTA 5DM2A 2KW5A 4P7JA 3FUTA 3LL7A 4PWYA 3SXJA 3VC2A 2C7PA 2ONYA 2VP3A 1WXXA 2ZLBA 4KRGA 3HCFA 5EMLA 2C7OA 2QYOA 2NXNA 2OYRA 2V74B 1VQ1A 2PXAA 4KWCA 4DMGA 3PFGA 3SR4A 5K03A 1OR8A 3CGGA 3LGAA 3UJ9A 2WA2A 3AXTA 2BM9A 3IYLW 3UJ8A 2IFTA 1G55A 2AN3A 3TM4A 1X1BA 5GM2A 4RTQA 3KHKA 4YMHA 2EJUA 5HOQA 3DXZA 3GGDA 3FPEA 5FCDA 4CTKA 2P40A 1NKVA 3AY0A 4WXHA 1DCTA 5EVJA 3BGDA 3TMAA 3JWJA 5EEGA 4DM3A 3VYWA 3KQPA 3C0KA 1BKYA 1XCLA 3ELWA 4DF3A 5T6BA 4BLUA 2I62A 5G02A 1VBFA 2CKDA 1G60A 1SQFA 3OZTA 5HIJA 2PBFA 9MHTA 1UIRA 3DULA 3KR1A 3V97A 2PWPA 4RVHA 5KS2A 3LCUA 2XVAA 3KQTA 3ME5A 4BP3A 5E9QA 2EJTA 2B3TA 4AUKA 3LKZA 3B3GA 4NECA 1R18A 3GJYA 1HNNA 1I9GA 2P7HA 3R3HA 4CTJA 2ZZKA 2AVNA 3DTNA 1D2HA 2O07A 3G2OA 4X60A 3FPGA 5EIFA 5EKXA 1NV8A 3AWIA 2P3LA 3VC1A 1N2XA 1G38A 1XDUA 3OU7A 3UJBA 1YFJA 1VIDA 1RI2A 4KIFA 1RJFA 5ICFA 5C9ZA 1NE2A 1JQ3A 3NVKI 4POOA 2YR0A 3GRYA 5FA5A 5DX0A 2LD4A 3C6MA 1MHTA 2UZ4A 3EGEA 4C04A 5CCBA 3EVGA 3TLJA 4PINA 3JWGA 1G6Q1 1YZHA 2HWKA 2ERCA 5DTMA 3PTAA 3G8BA 4FGZA 3HVKA 3TQSA 3FYCA 4YUYA 3UWPA 1JG1A 4CKCA 2BZGA 2NNWB 4QQNA 4DCGA 1IY9A 1NW6A 2G8NA 3G2MA 2PJDA 4RVGA 4MWZA 5CVVA 2QE6A 3T0IA 3P9CA 2OB2A 1L3IA 3G2PA 1HMYA 4ER5A 3TKYA
chains in the Genus database with same CATH superfamily
1CY4A 2JIQA 2PRJA 4A8TA 1M10A 2C4WA 2XB9A 4TRRA 3RRMA 1W5FA 4MW5A 3ANTA 1O0SA 1EFPB 3INNA 4M6WB 3IT1A 2A9QA 5LLSA 2RH9B 1NR5A 2O1EA 3FXAA 1N1DA 1PV4A 3E5RA 4NV3A 2E48A 2EFHB 1PX0A 2O8DB 4AJ9A 3B5IA 1PJQA 2HA5A 3G2IA 2OBBA 1WDWB 3EVBA 2RHHA 3SI7A 1EFUA 1IBRA 1Z4IA 3M4YA 3PDIB 3HYCA 3R0VA 2AG6A 4XQ0A 3IDFA 4YO8A 3K0CC 3T3PB 3U09A 1YU6A 2CNWA 1HDCA 2ADOA 2Q6VA 5DXJA 4PYMA 4ESVA 3U81A 2ZIZA 1JHOA 1QAMA 3R6GA 3SKVA 1GUBA 1ZMTA 1T2VA 2KPOA 1EBBA 4JT4A 1SXIA 4IO1A 3VZRA 1NXSA 3DZCA 3GVIA 3GJZA 3C97A 1GGFA 3QJ5A 2XMDA 4L0CA 2X40A 3H75A 2VWHA 1VKRA 5TPZD 3X44A 5BSKA 1NWCA 3GY0A 4C76A 1M2OA 5ITWA 2FG7C 1TT5B 4OSPA 4S24A 3SC2A 1JWAB 4U7HA 4FFBB 3KOWA 1YTUA 3GCXA 3D1JA 3G6KA 4UARA 1T4CA 1AN9A 4R2MA 1FUKA 2ECQA 2X5JO 1UDBA 5BNFA 5EJ5A 5LWHA 3PR2B 3A0RB 2O50A 2OCIA 2VBCA 4LF7B 2H1IA 2ZULA 3UV6A 5DSTA 4D3ZA 1ND6A 2JFUA 2V54A 3UC9A 1FXUA 1GVHA 4X9XA 4BQRA 1EIWA 1WB6A 2VNSA 1V71A 1E96A 3AR9A 4DC1A 2RGNA 4YALA 4NBTA 2QTHA 3BK7A 2I2DA 1VGQA 4I1OA 3UICA 1PVVA 3HNPA 4Q48A 5LQCA 4K9PA 5AKKA 1DO8A 1GRVA 1RQNA 3I9JA 3KPVA 4FHEA 5DYNA 4Z2YA 5LQKA 2XDWA 5G1OA 4DDTA 1RIIA 1T1EA 4QJIA 3H7AA 4XFDA 3OCYA 2AFIA 3BWXA 1IONA 2MU1A 5BV0A 3U1BA 1BNCA 1GRNA 1B4DA 3K53A 3V2GA 4NAUA 4WRRA 4X44A 1ONOA 1UJMA 2VDRB 4BO6A 2YDXA 2O5RA 1E7RA 4US2R 3H11A 1EH5A 4GPAA 3V4OA 5HFAA 5DTEA 4DIFA 2ZYHA 3N2LA 4F85A 2LKDA 1DWPA 3BCSA 1TM4E 1JALA 1TRKA 2UYYA 1X3LA 4QUHA 4XSGA 1IIBA 2ZKLA 1XZ8A 3K1ZA 1I6KA 3QNUA 4GOKA 4OQDA 2GYUA 1H6CA 1GPLA 1SCUA 3GLVA 4HGYA 3ZK8A 1AX9A 1XZMA 1E3JA 1WMEA 2LR0A 1PP4A 4PZDA 1GZ4A 3PNOA 3ZWBA 5F2OA 3G49A 5FUBA 5GAJA 5AVOA 1GUDA 1WXQA 4BFZA 2OO5C 1RM0A 2PL3A 4H17A 1OBCA 3I9OA 1P4SA 4RH3A 3BORA 2PH5A 2VNIA 1DEAA 1KZ4A 2F7SA 2HADA 1KZ6A 4QREA 2GSDA 4TUYA 4QVIA 4XW2A 2H0QA 4LIPD 3OKPA 1QF7A 3JWHA 2GCGA 1ZXLA 4X7RA 1O3YA 1JQJC 1LI5A 3VJKA 3QEAZ 1FFAA 2GJ4A 2C54A 3B36A 4HXGA 4EEKA 1NDQA 2GX6A 3EC7A 3OAAA 3VR3D 2GLUA 1K2VN 1T9CA 3JQ9C 4YDHB 2WTUA 1UMCA 3DL2A 1KMIY 3C14C 3VR2A 4YUZA 4H60A 4M46A 3OZRA 2VWQA 4O29A 5I4IA 1WCWA 1H9CA 3KJXA 4Y1FA 3UTDA 1FJGB 4P3XA 3A4LA 2XDAA 1YU9A 1H0KA 1KI6B 1JBEA 2Q41A 4Q24A 4C1BA 5JI3E 3GBPA 2UVPB 3IHTA 1BEUB 2QTVB 5KTMA 4LZPA 1WLYA 2QVYX 3V9AA 3PDWA 3VO2A 4C7MA 3HBJA 1P1JA 1YQUA 1U1FA 3PTLA 1GN8A 1Y7PA 5DM4A 1ANKA 4ZU3A 3TJMA 1OYOA 1UXOA 3MUNA 5EJIA 4RA9A 1ZAYA 3KQVA 4QWWA 1U3UA 2QMUA 4PZ9A 2SKCA 1GNRA 3RG2A 2JFYA 1N2JA 2PRZA 3FA2A 3FH0A 3H5AA 4YONB 5IJ9A 1YH3A 5C52B 4QPDA 5E1OA 4JUCA 4MV0A 1ZXXA 2C61A 3BMOA 4I4LA 1F1BA 4RVNA 2X9NA 1P7CA 3A25A 3IBYA 5CLQA 4I4TF 1JN0A 2H07A 2KHZA 2W7TA 4RW0A 4J3FA 1SOWA 4WDQA 4DCMA 4YGYA 4I66A 5IDWA 4O4HF 3AF4A 1MJFA 2WIDA 4J1TA 2IEAA 1JAZA 2X3YA 2I1WA 5KI6A 1KQGA 4RPCA 4X95A 4NMHA 5K8CA 5JTTA 2BI8A 1Z6ZA 4OQLA 3IXMA 3K9NA 1UZAA 2ODWA 1SZCA 5AWFC 2ZSKA 4QE3A 4NC9A 4QSMA 4BJ3A 1KMHB 1FIUA 4JLDA 3S28A 1YC2A 2XV1A 3K6JA 5AH0A 1XLTA 1T0PA 2CYAA 5JCOC 5B6PA 3UK6A 1Y5RA 1HQDA 2FDXA 2QRUA 4NOMA 3UMJA 2BJHA 3IDOA 3GU3A 1NFFA 3GVHA 1VC2A 4I1RA 3Q10A 1NIJA 4D4GA 1DDOA 1PZHA 3ITDA 1LW7A 5HJEA 1T2AA 4DV4B 1GTVA 3KRTA 4PFSA 1OIVA 3OLVA 3V2IA 1PJAA 3SX4A 5KOJA 5ERGB 2J3MA 1FFCA 1T1RA 1Z16A 5EE0A 1NVBA 1Q17A 3ABQB 4UPEA 4NXMB 1C0PA 1U5BB 4HKTA 3WAJA 1WW8A 2JFNA 3CF0A 3FI0A 3AHGA 1SUWA 3RJZA 5JAHA 3ZLTA 1T26A 1ISRA 1W4ZA 4UTNA 2J9ZB 2V7PA 4K46A 3UXHA 3A1DA 3QX3A 2G17A 3OQVA 5D5PA 2OORA 3IDAA 4U7FA 2DOKA 3EDOA 4U2GA 3KYBA 1NRXA 4XGIA 3VR6H 1EHYA 1OZAA 2BEKA 1EQUA 2YJTD 3QFFA 3IAFA 1QNFA 3PJRA 3QLJA 1Z63A 1A4RA 4KNWA 1VMIA 5PNTA 3KE9A 3Q8LA 2CJPA 4Z3KA 4D4LA 1N3LA 3I5XA 4RPLA 1MXHA 5D7BA 1WLSA 1FU7A 1GAJA 1ZEMA 2J3KA 4NBUA 1K75A 4LZZA 1BW9B 1J9GA 1VL5A 3HA2A 2FHSA 4U39A 4BQNA 5AFSA 4XD7D 5ALWA 4ZRMA 5JS7A 1P6QA 2R68A 4QELA 1FRFS 4BX9A 1G3UA 4GMXA 3ZGZA 2O3SA 4KSCA 3KSRA 4N8EA 3QQ5A 5CLFA 1YFKA 1R8QA 3RBZA 2P6OA 4TMFA 4EDFA 3KB2A 2GARA 3NTQA 2D1YA 4OK3A 2QTNA 2Q49A 2XUFA 3VX4A 3VVBA 4QARA 1C9KA 5JV5A 2YJ6A 2QY9A 1B16A 1ZJ6A 4PSKA 1YB2A 3DS8A 2Q3BA 4D3SA 1OTXA 3DTYA 4LK2A 3R7BA 4JLAA 3MJVA 1W59A 3JQPA 4TKUA 4WZZA 4MGZR 2YYSA 4FZVA 4ZANA 2Q62A 4IQ0A 3CE6A 1KXZA 1K6JA 2NQTA 1Q16A 3X2EA 1CB7A 2X9VA 3A31A 1UXIA 4UMDA 2ZJ0A 3CMMA 3Q2IA 4US0R 2KLBA 4H0CA 4R4JA 4MVJH 4WH0A 3VRHA 4TVSA 1FSPA 4XGKA 1GL6A 3FBTA 4BMOB 3AP3A 3MCZA 2YIJA 3MB5A 4QU5A 5DCLA 4YJFB 2FH5B 1FRZA 1RWQA 3F3YA 3OFNA 4D4MA 2HI0A 2VHEA 1OXUA 3KKPA 3OU2A 4LXXA 4MW0A 4HNVA 3B2NA 3WYFA 3P0JA 1DO2A 1V48A 2NYRA 3MAAC 2BOVA 3AQ4A 1NKSA 1R7RA 3PNQA 2ZYRA 5DX8A 3R3SA 4PYJA 5J58A 3TFQA 1V8DA 3HCRA 3D4NA 2YWDA 3PTZA 3AM5A 1EFHA 2OLKA 1QBGA 1PF7E 1I24A 1XMSA 4LFCB 1L4YA 4KNVA 4URVR 1MEJA 4GKKB 5LIPA 1IXKA 1U0GA 4JASB 2EYQA 5KYXA 3MIZA 2VJMB 4J0FA 4KXNA 4YJ3A 2AS0A 1FYDA 3LQRA 1NW3A 1DTEA 3DGEC 4CQJA 4DLPA 4CM5A 4PIMA 4PZYA 1R6AA 4F06A 2ZWOA 3RTBA 1TUGA 2Z3ZA 4MV9A 3B60A 5FR2A 2FI1A 4OHOA 3X1JA 2R11A 5D00A 3PUHA 4QM6A 4KIUA 4I4TB 2Y8EA 1G63A 1RFGE 1SU7A 2DKFA 2VT2A 3TLCA 2JVKA 2QRLA 1JSXA 3L6RA 2Z6QA 1ISHA 3FMGA 1NP7A 2FWRA 1EJ6A 1T5TA 3AEQA 3GUCA 4IMRA 4YRIA 1TL7C 3QFCA 2VLIA 3WV5A 5KVVA 1VP3A 3MYRA 4J2OA 3QV2A 1MAWA 1ONPA 4NNOA 1XWWA 4KDCA 4RK5A 5FNVB 1LDGA 4GHWA 1JH8A 4PE5B 4R8RA 1LD3A 3H86A 3IERA 4L51A 4AYWA 4NCBA 3TLMA 2OLEA 3NB0A 2C3OA 4D2IA 3THXB 3IQHX 1E4VA 3UOWA 3G7UA 1XRSB 3L7DA 3DH0A 5B7GA 1N0UA 4TS9A 3OVMA 5CB0A 2WNIA 3JZMA 5JEDA 3ZIUA 1BDMA 4HNHA 1LDBA 2EOAA 2HH9A 3ESRA 3BH6A 3QW4B 2QD4A 4OIFA 3PJDA 3VU3A 4HNTA 1XNRB 3A4VA 4QGBA 3UENA 2XWBF 3KIPA 4RMIA 1OV6A 3RAFC 1HT1E 2IYLD 1QH8A 2XCUA 3PQDA 4ZDKA 3HCEA 1GUAA 1R0ZA 1RYEA 3CG0A 1YL6A 3A26A 3PNYA 3SIWA 2WG2A 3FBWA 1O96B 2PBZA 3K6RA 2OK7A 4FSXA 5E0OA 2OFFA 2J4CA 1JR3D 5E1DA 3I05A 4LVNA 3BF8A 3RRYA 4C2AA 5KTKA 1SC1A 3OWHA 5FTWA 5DULA 5HKBA 4CM9A 2G08A 2ZSJA 4JWTA 4MB0A 5BSVA 5U1PA 3H8SA 3IJEB 4P6VF 3EOBI 4NCKA 1EWTA 1JHRA 1C9YA 1Y3IA 2GZ1A 3EBLA 4A82A 3PQ3A 1W581 4CM3A 5KC8A 5F3WB 1VA4A 4A0RA 4EHNA 1FYWA 4BV9A 5YASA 2HXYA 4V2IA 4CL2A 4JLPA 2GFQA 4L2IB 1YKGA 1U0HC 4FS8A 2CD7A 2EKDA 1RFLA 4HBGA 2VDVE 3I5MA 4NU8X 2YZ2A 2OVFA 2QLMA 3CKYA 3INRA 1AUXA 1NBOA 1RRPA 4KQWA 5BRJA 3C5CA 3FMIA 1PQYA 1PFYA 3TOVA 5H83A 1HF3A 1HKHA 5JVDF 1J2TA 2HQ1A 1J00A 2WHEA 1SKYB 1XZDA 1JXAA 1KH2A 1NM5C 3LX5A 2QLLA 1AURA 4QBHA 3WQBA 1BVUA 1R9GA 1ZH2A 2HWXA 3GXBA 3Q15C 3HHPA 3SQOA 1OI2A 1F0YA 1Z3IX 2C78A 2GNOA 3IIJA 3WIUA 4KRGA 3AHIA 3ZZNA 2WJZB 3HCFA 3MJDA 3WVNA 5JS8A 3HHEA 4UE2A 4DR5B 1OWLA 3NHBA 3H9EO 2JFWA 5K4AA 1OAOC 4H15A 1NYTA 1IAQA 1ZA1A 3BSWA 2XUQA 2ZRJA 4CDGA 4D6PA 1QO9A 3F2VA 3BOSA 3SHFA 3AGPA 3PGXA 1THTA 2EJUA 2I78A 1GEEA 1PD1A 4ZV7A 1XMXA 3TRFA 4EF4A 1IHUA 2L42A 4WXHA 1QJ4A 4G89A 4M8LA 3PE6A 1XMQB 1C9DB 4GP6A 4KRFA 1R12A 1HEYA 3O8CA 3SSAA 3TRIA 4RD6A 1GIAA 1M66A 1BU8A 2YZGA 2Q6IA 4ZXPA 3SYTA 5G02A 1NXOA 1FP6A 3BCHA 5BNWA 3DULA 2V0NA 5TEWA 5B4UA 1WCIA 1UBSB 4G4JA 1OY1A 4RHCA 2VRBA 4TM8A 3VUEA 3FGZA 3LHIA 2XVAA 1EKXA 3WFZA 4E1AA 2C88A 1L7EA 4DEYA 1NF9A 2JGFA 4OFBA 2XSZD 4F2PA 5JH7B 2C0CA 1PFWA 3TUZC 1YRWA 1I1OA 2GZAA 1HNNA 3K0FB 3X1XA 4HVLA 3WGHA 4A2PA 2AQHA 3L7AA 1J9EA 1SKBA 3KAJA 3O0TA 4GBMA 4OHWA 3K4QA 4UBLA 5DLDA 3BE5A 3CWCA 3WNQA 3GPDG 2I3GA 4EHKA 1CHDA 4F2GA 1L4BA 1Y7LA 4TTQA 5EP1A 4KXFB 3ZJ5A 2FP4B 2X86A 3IQGX 3WGMA 1UL1X 3DAPA 1GM5A 3L82B 4NPHA 1N4AA 2CE2X 3QTLA 1NXPA 2WF9A 3GRFA 2N46A 1POWA 1BQ4A 4M1YA 1E69A 3TSYA 2L82A 5AOCA 3E9YA 1EWRA 2CVHA 2FPXA 1C1XB 2GGSA 2LNDA 1OX4B 3A9RA 3QF4B 4UBMA 3ULKA 3K70B 2O54A 5LJLA 2X8JB 4DEVA 3LK7A 3E7DA 4TS4A 3U9SA 3B7GA 1KEVA 5BSWA 5KREA 3CH6A 3S2SA 3OQNA 3QXHA 4OHKA 3NT2A 3NKLA 1DADA 5LXTA 4D4HA 1K27A 2QZJA 5CAEA 2TECE 3RM3A 4QKQA 2VTVA 3IEPA 4MVJF 3OOSA 4U2KA 3R44A 2PLRA 4WK0B 5H16A 1E3MA 5KTPA 1JFVA 4XM0A 3ZX4A 4DQDA 1G1AA 1ZPDA 3PEYA 4OGFA 2X1MA 1BMTA 3KHTA 3FROA 2CN1A 3F6SA 3TB4A 1U80A 1Z0FA 1H69A 3IDQA 3KBOA 4QNMA 3L05A 4HWOA 2Z4SA 1C80A 5LZ9A 4GR4A 2IRWA 3ASVA 3KD3A 3P5BA 1BXGA 4JD5A 5JTUA 3L0CA 3VNAA 3FKSA 4XB2A 2IHJA 5HX7A 2ZZNA 1BE1A 1JDVA 1QMPA 3V8NA 4R5MA 4DSNA 3U5ZB 3O94A 2BFDB 2GWHA 2PUVA 3VPBA 3Q8MA 4PLPA 3ROKA 2QR5A 3T1QA 5SZJA 2GDZA 1RXEA 5ERYA 2M6KA 3N7TA 4LJLA 4L8LA 1WPQA 3LKVA 3K2QA 3ZY5A 1JA0A 3FFBA 3AZOA 4JSTA 5BUCA 5KTOA 6ABPA 2HUNA 1EFAA 1CIPA 2JLWA 1HLDA 5CT6A 3ZNQA 3QVTA 1ESNA 4JXJA 3PIDA 4X20B 1ZRNA 1G20B 2X6TA 3MAJA 1F5NA 1TZBA 1PL7A 2L17A 2OT3B 3DHYA 3NALA 3ZHZA 4GDFA 2Y05A 3E27A 3D1LA 2NO6A 4REQB 1RCUA 1IG3A 2ZSAA 3SPXA 1RAFA 2V4UA 1ISIA 4LBZA 5AM1A 3X2FA 2XJ9A 3TGPA 3TZEA 2I0FA 2Y0PA 1NJGA 3L18A 4MYUA 1CZUA 4Q4AB 4MDEA 4K03A 3TK1A 2BGIA 4X3CA 2BZ0A 1RHJA 2COUA 2NWQA 3TD2A 1TK9A 3SIXA 5JPDA 4X6LA 2ONZA 2ZXEA 4CL0A 1UP4A 1QLJA 3IT2A 2LZ0A 2DPMA 5HTKA 1TKBA 4YLGA 4CU5A 3U6BA 3W5CA 4LFBB 3CLUC 1RRMA 1E20A 1NAHA 2WIFA 1ZKMA 4OP1A 3HCAA 1P81A 4US1R 3H87A 1DXYA 1SBTA 1JW9B 4FN4A 2PTHA 3SS8A 2AG1A 1AB5A 3A6FA 3ZCSA 2QGNA 4NEQA 2IY9A 1QFYA 5TMDA 2JLUA 1QZUA 1KK0A 1R1DA 1E3WA 3ND5A 4M8IA 3WFIA 2FCAA 3WJAA 2P9HA 2IH2A 4WESA 4JC0A 5K1ZA 3ZDDA 3ESBA 1V37A 2H3HA 2PT9A 2IZ0A 2WWXA 4NVRA 4RTKA 2YIVX 3GZJA 1JQAA 1JQDA 3EIEA 4UNIA 1JEQB 1KYWA 1P29A 4CKXA 2AEEA 3A37A 4QFMA 3GP5A 4D81A 3I5UA 1SKQA 3JZAA 3TW8B 3UUWA 3GB9A 3TEJA 3PVSA 3HB9A 3EPPA 1IN7A 3MC1A 3P5SA 2GM4A 1S89A 1BH2A 1B1CA 2D13A 3AR7A 3I4LA 4YN3A 4N5HX 3SF8B 3T4UA 1SGWA 3B1JA 5KZMB 4A0SA 4G1MB 3SJZA 4X24A 1F5SA 1NDUA 1Z7EA 3GFOA 4LJ9A 4FFSA 3TLGB 3CC8A 5A71A 3K9WA 2EP8A 3A6GA 3WA6A 5C5CA 3L6EA 4O2BB 1R37A 3RCBA 2J41A 3ZTYA 2AFRA 4Q3DA 2WUEA 3CXRA 1XRNA 1PEKE 2V8OA 3K09A 2GYYA 1ZSNA 3IS3A 5DBGA 1T1SA 4W9MC 1QF6A 2WZQA 1IDOA 2R2GA 1IOVA 1SULA 3M2TA 1R10A 4HWKA 3TNJA 4ANFA 5FULA 1P0MA 1M1XB 3MLBA 5JRDS 1D0IA 4YRJA 5IDXA 3L6OO 4R69A 1YF3A 1ID8A 1LWNA 1OTHA 4DM4A 5M3BA 3FY4A 3I1IA 1BAPA 5GOTA 1BGWA 4PYNA 2R47A 3VH2A 4RLQA 3HI6A 3RU2A 1U0LA 3FKJA 4EW6A 1Q7TA 2C9OA 1ICEA 4WIAA 4BVAA 1SUPA 1H8ED 4NSNA 2X8AA 2XQIA 2DG2A 3JYHA 2GM5A 3ZDQA 3IEXA 4BMDA 4KR7A 2N1BA 2ZIEA 2HPVA 1E1LA 2IYZA 4HAZA 2E49A 3DZGA 5FORA 1UFOA 2XF2A 4B6PA 3DVSX 3ZQ6A 4NESA 1CRQA 1UXKA 3Q3CA 2B4YA 1KRWA 1U3WA 3TTXA 2JDIA 5JLAA 3WAKA 3KHUA 1BJKA 3WNCA 4KWHA 4CV3A 2C07A 3TZKA 2OQIA 3BRSA 3OCUA 4S3MA 2FEPA 2YWFA 3DVQX 5KAMA 2V7XA 4AZTA 4CDNA 4CL3A 4RTPA 1GPDG 2IC5A 1II0A 2GK6A 1UP7A 1LK0A 4GI1A 3DP7A 3ZGLA 2GJKA 1WUHS 5IPFA 5DYIA 2NO1A 3VBEA 4GRIA 2AKEA 4Q5IA 3TNFA 5B6JA 3GAZA 1JHZA 3AEZA 1DQNA 3K9GA 3KYCB 2OO3A 4G1VA 2CB0A 3QRWA 4EUKA 3AVTA 4E6EA 3PQ8A 3V9PA 1EX7A 5L8VA 4MQFA 1MQ9A 3ZYCA 1UC8A 2WKQA 3LLVA 4S12A 4LQDA 2KI5A 1M2GA 1NWHA 1HZJA 2QJOA 4ODIA 4ICIA 5ECGC 1RWPA 3P9KA 4ETIA 4JOBA 3Q3IA 4Q47A 3CVWA 3P0FA 1BDIA 3FSJX 1LXCA 1AHPA 3AFIA 1N6RA 3NXSA 3OZWA 1V4BA 5TPWA 5IJAA 2H2FA 1KVUA 4L9WA 1GG9A 3VBCA 1XZFA 1PSZA 3SM3A 2BTEA 1DAFA 1J21A 2B8NA 2XRFA 1S01A 5LWQA 3ZV5A 1VB3A 1HYQA 2FR8A 1R15A 5IDVA 3CINA 2GAOA 1EXDA 1MEOA 1COZA 2BKAA 2GVZC 2QXTA 3DF7A 5ARBA 3UH0A 3COPA 1L1EA 3WOVA 4G8DA 4WZBE 5CVJA 2I65A 3D7NA 4UTXA 1N57A 2Q0SA 3HN7A 4DZRA 1G8FA 1J0EA 2ZRBA 3HZRA 2BEVA 7MHTA 3AVUA 2XQKA 4UHFA 3WHPA 2VF4X 2VP4A 2VAWA 1UDAA 1D5WA 1HURA 5D85A 3UOAB 4NYJR 1F0NA 1LWOA 2HB6A 3IT0A 3W5SA 4A3SA 2AWNA 1P5RA 4XASA 3TOCA 2RGEA 1P8JA 4LPKA 4EI9A 1F17A 2PDAA 2VNAA 5EFZA 3IPLA 4WXEA 1YI1A 2QI9C 2RCNA 1WS6A 2D2EA 2V5UA 3VR5H 1BRTA 1PJ4A 3T7RA 3R5FA 3IOEA 4RU1A 2ODTX 1VLJA 1W52X 4X7MA 2ORYA 2IYTA 1I3KA 2FR0A 4FUQA 2ZYTX 1R0LA 2FPUA 3THYB 3BB3A 1E4EB 3LP6A 4RM3A 5IKXA 4UVHA 1KIAA 2J3QA 3DMYA 4V0KA 3U7FB 4ND4A 3DDSA 3WL3A 3L8HA 4WFQA 1A5AB 3L0ZA 3B1KA 5HS4A 3W79A 1M33A 4OXRA 4YRNA 1QG6A 3T3IA 4EI7A 4LMAA 2OOKA 4KH1A 3G85A 1ORTA 4N7BA 4KLRA 2JVIA 4PSAA 4TVKA 3O3NB 1RR6A 1U1IA 2H9AA 2VYVD 3HJUA 2WU4A 3ANNA 3NR2A 3I30X 4GI2A 4DYVA 1VJDA 3OFVA 3RS9A 1GAXA 3QXXA 4DV3B 1WMAA 1CB0A 2QT9A 3MJTA 2H2WA 2Z30A 4Q16A 1C1HA 5C5IA 3HJTA 1YGYA 4Q9LA 4L15A 4DCCA 2JZNA 3GGPA 3Q87B 4DILA 4ZHQF 1IPFA 3PR3A 5KB3A 2YVKA 5AKLA 3V8PA 2UUBB 1GNQA 1JS1X 3WDSA 5B30A 5JI2E 1TKCA 3R7WA 1N3YA 4ITRC 3FUUA 2AQ8A 3ZWDA 2QRKA 2QRHA 3RARA 1P2TA 2P68A 5D5HA 1JV2B 2Q21A 3KQNA 3PCXA 1PDOA 4H3KB 4P9NA 4QUAA 4WCFA 2Y1EA 2RGDA 1P9OA 1WNTA 3JPWA 3BFVA 3CRQA 4I5FA 3RF7A 4DBLE 2WD8A 3T7CA 5C8YB 4KIGA 1D1QA 1YMUA 3EEIA 4Q9AA 4QLBA 3P96A 4J3NA 2C3YA 4OBXA 1WOMA 4Y6QA 3SYRA 2J5QA 1O9GA 3E18A 2WUWE 3K73O 4UNQA 4ETWA 1XMIA 3HFGA 3UTCA 721PA 3FOWA 4YRDA 4JJ8A 4QYTA 1I2DA 2OBFA 2QUZA 5KSYA 5FQOA 4EVIA 3SEAA 3CN9A 4HH3C 1TQDA 2JD2A 4R8SA 5CB6A 1MZVA 2X4IA 4B3HA 1E6UA 3VGJA 4QATA 4E7PA 5DP1A 5EWMB 2AG0A 4RZHA 3A6EA 1Y1TA 2FF5A 4EY7A 2FOIA 4CMKA 2HMTA 3BWDD 4BNWA 4XYBA 3COVA 1IHYA 3LCVB 1N2SA 3LMKA 3TR0A 2B4QA 2R6ZA 1QIGA 4L85A 3WQHA 1EYZA 1R64A 2E55A 3AKYA 3KVYA 4O4JA 2VPPA 2EEZA 3FOEC 1J1UA 4D43A 1YAHA 3PXGA 3V42A 3BWBA 4D8UA 1Z4KA 2G5GX 2D5AA 5CA0A 4IH9A 4Q0MA 5LMCA 4NU6A 1NVAA 2PYIA 1E0DA 3LPDA 1FQWA 5CIYA 2PPLA 2OGWA 4R0MA 1ZUNA 4IGAA 5LYYA 3T5CA 4G0UA 3AHEA 1GZ3A 2W6PA 2F55A 3DMTC 1V4NA 4KVZA 4MKIA 4RC9A 1L5WA 3HYLA 4FE3A 3MHPA 5E7QA 1LS1A 3AJ9A 1CQWA 4OA5A 3ZKWA 5JZBA 2VKQA 1MJGM 1ICIA 2AD5A 2D2XA 4EDHA 2RKOA 3U7GA 2O2CA 4I08A 3TYXA 3NAQA 3EIXA 3OOWA 3RYCB 4UTVA 3Q3EA 4L0QA 3NGMA 1XCJA 5EN4A 4XEUA 5EGSA 4G0VA 5B37A 4KGDA 2XKJE 3PZBA 3I12A 1VDMA 1WJGA 1Z4JA 5KCMA 1XMJA 3EMDA 4IIJF 4Q7EA 2V0GA 2YW2A 1BS9A 1UZLA 1U0FA 1HT2E 1MT3A 1XK7A 3H04A 3A1CA 5DNWA 2OQ2A 1ZISA 4RY2A 4JMPA 4HN2A 3G3EA 2BISA 3MM4A 2DKNA 4KR3A 1SUFA 2VFAA 3IAUA 1I80A 1M73E 3CMCO 3KO8A 3WBFA 5J4HA 4KNYA 3LLMA 2B94A 4KO8A 4LRTB 4NARA 5AXAA 1JRLA 1WG8A 1G8AA 3QLUA 2YV4A 2HK7A 3N8GA 4J1QA 3ZWCA 2B21A 3E8XA 3OIYA 3C24A 1X7DA 3PWSA 1VJ5A 4JGGA 4CEHB 4C3ZA 2JIMA 5TQJA 3JQ8A 1IMOA 3T35A 3ZG6A 2A7XA 3K1YA 1OWOA 3V1TC 3HJHA 3A6HA 4H0NA 4NZ9A 4RF5A 2IV2X 1OLUB 1M6VA 5HM6A 2EU8A 1EUCA 1WY5A 4EHHA 4LNUA 1DQPA 1RI4A 2CKMA 3C3KA 3U9TA 2VCEA 2ODNA 4OV6B 2YY5A 3K0HA 4HQKA 3PKIA 4RFLA 3ELUA 3ACCA 3WMFA 3DD5A 5HZMA 5AW0A 1DLIA 1E3IA 4ZGWA 2WFAA 3R7DA 4Y2JA 1VG0B 4UNRA 1GO2A 4FOTA 1XRPA 1GV1A 3IE0A 1G98A 4RULA 4YCNA 3P4XA 2YKGA 2YNMA 3NJ4A 4OU5A 1T9HA 3AUAA 4ZIRA 1K3UB 2J07A 1TLTA 2X8WA 3QU2A 4P35A 3KWFA 2CCKA 4PWYA 5CP8A 2VQEB 4XYEA 1L7QA 3BMXA 4C4SA 3ZHQA 5KYTA 5H9VA 1L7OA 1IQ0A 1DRUA 2C3PA 2Q4OA 2NUBA 1Y8RA 2EJVA 2W4MA 4L4ZA 4W1PA 5DNVA 1DKRA 5BRNA 2HRRA 2FUG6 1XTVA 2WG1A 1G55A 3H1TA 2KS6A 3TM4A 5TT0A 4PG4A 4HYTA 1IATA 4ZI5A 1N8SA 1M2NA 1T5DX 3ZDEA 3K7EA 1UKVY 2HDNB 4CL8A 3H0KA 5HPYB 1N6LA 4M0UA 3HY6A 5EVJA 4IG9A 3C3WA 3CX4A 4LXYA 2Q7DA 1ZJJA 3RWBA 2QRNA 4C0WA 4CHGA 2XT0A 1ADBA 2K5UA 4G6ZA 5MGBA 4ZQBA 5KDLA 2OXCA 1KDVA 1X70A 2K2QB 1HG0A 2Q2WA 1IVNA 4ARBA 5CXXA 5A7HA 1QOZA 4R7TA 3SJBA 3VH4A 4IM7A 2GEBA 1C8BA 4ZVSA 3FPKA 3JY6A 1PQUA 4HCJA 4EP1A 1XL0A 3SR3A 4E3ZA 3QYAA 1FFEA 4OBEA 4DR3B 1JLLA 2Q8QA 3DW1X 1QRTA 3E35A 1T0UA 1L5ZA 3GLTA 1WUYA 5I7EA 4RCVA 5DIZA 1FFYA 1RT9A 1XRMA 4R8VA 3AF0A 5J23A 4LZAA 1F8YA 1EVLA 1A8PA 1J2RA 3F71A 3BQ9A 1RI2A 4MUEA 3D64A 1EXVA 3GCGA 1EFDN 4R16A 3C6MA 3GG9A 3U4QB 1RC1A 1TAQA 4U6QA 4DDVA 4DVGA 2WNSA 2ZB2A 1Y4SA 2FLKA 3PCRB 4HDSA 5IH7A 4J7UA 5KHOC 1J8YF 4MYCA 4CCAA 5L6MB 3OM9A 3FDFA 3NU1A 4H27A 4M9QA 5JVDA 1VBNA 3G8YA 4NH0A 3PFWO 1YJBA 3OPYA 2Q1YA 5IDQA 1N8KA 4UCXA 1MPXA 4R1MA 1BE6A 2FFRA 3CRW1 4LRWA 3QKIA 1U0TA 3RK0A 4PS1A 4Q9IA 4PF1A 2RDMA 1XIVA 4WBNA 1BHSA 4W5OA 5ALQA 3MWFA 3DBHB 3RVJA 4R1OA 5DISB 1E1NA 4EVRA 5JFTA 3AVVA 3M9XA 2NQ8A 3AP1A 4LHSA 4ZT6A 4X66B 3ETNA 1K8QA 1UBGA 5ELMA 4YMUA 3U56A 4HVCA 3JVEA 2MSWA 2W5UA 4ZCSA 4DLSA 2DGDA 1I5OA 4X1IB 3I83A 4I50A 2PIDA 4FEYA 4RAOA 2R6AA 4LTDA 4ON9A 4IUBS 1JQEA 1BIFA 2GEFA 3WHKA 1RMYA 1V4VA 3CPSA 1UUFA 4IBOA 2QB5A 1JAXA 1XAHA 4Z7QB 3HA3A 2PFKA 4EFLA 2W11A 5AVXA 4DCJA 4CG0A 1UK9A 2WAAA 3SF0A 1T9DA 4RZ2A 4GSLA 1DCKA 1XDZA 2YYZA 3WGKA 4K2AA 4ASUD 2LWIA 1CUCA 3OFKA 1L0BA 4GPTA 4ENRA 3UY4A 4BLQA 4PR0A 1WA5A 1Z15A 2RGUA 2SCUB 3T9AA 3R9WA 2OSVA 1H4SA 3FNFA 1JG4A 5AVRA 4F4FA 10MHA 3GJ0A 2E2WA 2PYDA 5A9TA 2QD1A 2AIRA 4TV9F 3IIKA 2ZUEA 2VKTA 2X0EA 3IMEA 4C0XA 4FCVA 2BSAA 1T43A 2Y6VA 2KBFA 3AUFA 5GZ1A 1TMYA 2EJWA 4GR9A 4JBXA 4UTRA 4F8EA 2FZKA 4U7JA 4KBGA 1M72A 5U4QA 3VAAA 5BQ3A 4I8DA 5KQRA 3EXAA 4AICA 1RXVA 2CXXA 1C30A 5ER9A 4Z9AA 5IM4F 1ZMRA 3CA8A 2VH2A 3X3HA 2ZRIA 5DI3A 1ONBA 4DLNA 1W48A 4X62B 4JLOA 1ZINA 4OB6A 1OZGA 4WY8A 1GA1A 1UKBA 3OG9A 5HEKA 3QGMA 1ULAA 2H4JA 2P9ZA 4YMLA 3SC4A 2IW3A 3EWSA 5HYVA 4TQGA 3D3JA 3ZI4A 3ZWXA 3L2OB 2E37A 3H3JA 3NX4A 3PDUA 4HDAA 5FJJA 4F4JA 1TK3A 2H1OA 3TRKA 1X7HA 4CODB 2HIAA 3GGOA 4OI0A 2ISSD 3FETA 1U8YA 4Z1OA 3RUCA 1QO0A 5H3HA 3OZCA 4O4LA 5ALVA 1YJCA 3UAVA 3UMSA 1KH1A 3ZH9B 4GXRA 4BASA 5DSXA 2PUEA 4ZKEA 2G25A 2WF7A 3Q7PA 5BN3A 3ED5A 4M1OA 1ID1A 2GJAA 1T8TA 4UUMA 2FPPA 3MWGA 4M1MA 2IX9A 4BVEA 3W5JA 3QEKA 1EBUA 1PT9A 1ZL0A 4PPGA 5C8XA 1P73A 3UCXA 4POAA 4BTVA 5DHQA 4UCWA 4QEZA 1TD1A 1RM3A 1GZ7A 2DM6A 1CUEA 2CNWD 5JARA 1RWMA 4L5CA 3QBVA 3UT6A 2EP7A 1KO1A 4BFXA 1Z0JA 3EEYA 2ZJ2A 1YS7A 5EPOA 3SBXA 2Z0MA 4L4UA 2YICA 1ENPA 1P72A 2EF1A 5DHTA 1QE3A 2JEOA 4PPNA 3TOSA 2A57A 3B3JA 4YA6A 1V5EA 1R4ZA 2ZI4A 1MT0A 3IVCA 4KPUB 4AY4A 1V6CA 2RHGB 4HGPA 4U1RA 4OIMA 1QYCA 5F5NA 4TYYA 1W75A 5DP2A 3MS2A 4L76A 2W6MA 2WYIA 4EVSA 1U6JA 1FMJA 1CRLA 1GD1O 1BQEA 2QMZA 4CCYB 3OZVA 1N2IA 1F6WA 3DVAA 4XCXA 3CR3C 4RMHA 4Q15A 3KKMA 1G21A 4M7RA 4U2CA 4KHZA 3UM9A 1OKKA 2HFKA 2MIIA 3VJMA 4BUZA 4LSMA 4D8TA 2D62A 5ALNA 5AI9A 1V11B 4A6PA 3E70C 4A23A 1ATIA 2R6R1 1I13A 3Q6MA 2JFFA 4RKFA 4ZMRA 2ZPTX 2AOVA 3U62A 1XL1A 1XLUA 2PUAA 5ITSA 3CLTD 4KQFA 1FPQA 1KARA 1SXJD 1JI0A 3P9ZA 1Y9EA 2XMZA 3D5QA 3FG9A 1Z8NA 3KPWA 1OTYA 1LEHA 1KK2A 5SZHB 1V1RB 2W2TA 2NU8B 1L2TA 2XE8A 1MB9A 3FUCA 3O7WA 4C4XA 4D25A 3RYHA 3H5VA 1RAIA 4YVFA 3H4TA 4OQZA 5JO0A 1UAGA 3ZPXA 1XXHA 1WDMA 1Z0DA 2HLDD 5EFOA 5GADl 2UXDB 2NUPA 3HRHA 3GUHA 3QPAA 5DMHA 1T6BY 3BKXA 2GBFA 3B70A 1Z2DA 4EY4A 4N01A 1I2ZA 3B3QA 1SIBE 3SJUA 1CNMA 1KXJA 1D2AA 3D43A 3RT1A 5BPHA 1C41A 3KQYA 5FUYA 4JJIA 3LC1O 2REXB 5EIBC 3TQOA 3VKGA 1N6HA 1SG0A 4AROA 4AXBA 3W5HA 5C3MA 5CFQA 2OO5A 1K92A 1AHNA 3H0CA 3K0AB 3NH6A 5FHRA 1T0JB 3LZ6A 1YMQA 2GT1A 3KUXA 3LPLA 4LHYA 4OOFA 2LCIA 1XNJA 5A4FS 1ST2A 2VSFA 3BS4A 4MHOA 4U7WA 1E66A 4P7FA 1B74A 3UBMA 1BHQ1 3DMPA 3A6JA 4PG8A 5AXDA 2GFHA 3JAKB 3PC8A 4FLFA 1L5VA 4QGSA 2WJAA 5IZCA 4XD2A 2V1XA 3JQ9A 3N6RA 2BPOA 3OAAD 1KVSA 2IELA 4QPZA 5FBHA 4DSAA 4DJTA 2HHCA 1LBEA 3C3XA 3T7DA 2XUZA 1ZX1A 4U6SA 3VR2D 1II8B 1Q1NA 1MV5A 1JDNA 1NQWA 3KJGA 4M98A 5I3CA 4UDYX 3VDMA 2ODQA 4D7AA 1WTAA 2B36A 3Q7EA 1ZL2A 3KQLA 4DIOA 4RD4A 5JJ5A 2JLVA 5DM70 2QJFA 1UXJA 3O1LA 1JA9A 2AYXA 1E6KA 1QSGA 2E21A 3BFKA 4O1MA 3DONA 4ZOLF 1WETA 4NXNB 3DVRX 4KYTA 5IWAB 3LZDA 5EUQB 1N8NA 3I6ZA 2C4TA 3OJ0A 4ER0A 2ZB4A 4RSRA 2CNBA 3A36A 4UBIA 3BBLA 1YL7A 4LEIA 1YQWA 2A0FA 1M34B 2VLBA 3HWX1 3TQIA 1CC1S 1AUQA 1IBMB 2PAAA 1UMBA 4LOHA 2D6FA 3IUSA 5LB2A 5FLXA 3EZ2A 1MA3A 3NJRA 5B58C 1HDRA 3OT1A 1ZVKA 2VRNA 3I04A 5G3ZA 2ZCJA 2ALJA 2YN4A 3F4KA 1EB8A 2A5JA 3MTJA 4NEGA 2O1WA 4DW8A 1PK7A 2VXBA 1NQUA 1Q21A 2GCOB 4W82A 3OJOA 4YDRA 4ALIA 4H7EA 4RD3A 3WISA 3WLHA 5A5EA 6PFKA 2OCAA 2KM1A 2WI8A 3PX3A 1QVVA 4IDEA 4NBSA 5FADA 3A3PA 1JUDA 3F96A 1WHTA 3C39A 1ZIDA 4H1VA 3VR1A 2IV7A 4GI3A 4JL6A 4PSCA 1NYLA 2X0DA 4BLRA 1IJBA 3IP6A 3RK4A 3NBXX 2J7KA 2VDJA 3MGKA 3V1LA 5KNDA 3GQBA 3LUKA 5HDBB 1BC5A 2ZZMA 1GQYA 2R1ZA 4UUBA 1IN1A 2MR5A 2X6QA 4RPKA 4DCPA 3HLKA 4H18A 1CLUA 1L9XA 3TR6A 2DLCX 4RD2A 2M98A 2C7QA 1GU7A 4BQFA 5KSOA 1UJNA 2ZAYA 4EO4A 4LF9B 1T0HB 4JJ6A 4LVCA 1K4MA 2CDCA 2FRDC 4OO3A 1YJXA 2PRYA 3NEPX 3ZV6A 4PN7A 2ZBDA 3OPMA 3GCZA 1ZOIA 2CLSA 3SG0A 1BHO1 3DBVO 1PGOA 1R6UA 3UK2A 2C42A 5B3JC 1B6TA 1MIHA 5BUZA 3QEJA 3NBZC 2CLCX 1Y8QA 2BGRA 2QMOA 4EJ0A 1MCZA 2WF5A 2QN9A 3AC0A 1GTRA 1KEWA 4MHSA 4MRAA 5KHLB 3ASYA 4JB0A 1CJBA 1UWVA 5D01A 4TLAA 2O0MA 4IJMA 2PGIA 3DVLA 3OQIB 3O47A 1IHPA 1NBEA 1WSDA 2X9QA 4IKPA 1ITZA 3AJRA 4IHQA 2JK1A 4X54A 5JANA 3ORQA 4EY8A 5JSZB 4BLVA 1UOPA 3PVCA 3FTFA 3OZ7A 2F3RA 1QH9A 4QWMA 3HVJA 4UFNA 4KWIA 5DM1A 1W8DA 3GLUA 2BSQA 2DETA 4CMEC 2HHJA 4JOCA 1DRVA 3DQQA 1ZZEA 1PJTA 3PLRA 3D8RA 3QPBA 3FGPA 4GEGA 3ZOKA 4HRXA 1ZM4A 1Z0SA 4O5AA 2P4SA 1N5OX 2QSJA 3KZKA 5A7GA 1SFRA 2PX8A 4L08A 3V4LA 2WSMA 2IOYA 3HY4A 4GE3A 1NMYA 1KQ3A 1O6BA 1GPAA 4LHXA 4TROA 2XUGA 5LA6B 1RXUA 1A7KA 4QIHA 3TAXA 3BXZA 3OEED 5KX5F 5LMNB 4JMLA 3I01M 1NF8A 4MVJE 4R1SA 2NZJA 1MHPA 2CEAA 3VVCA 3PFKA 4BRWA 2OEPA 3KEOA 5L9AA 1LVUA 2AEFA 3LPMA 3OIUA 3S55A 3GZTB 1N2CE 3MRXA 1HDZA 2CXTA 4RA6B 4H08A 4GP7A 1UCFA 1XQ1A 2QAGC 1M1NB 2REQA 2ZBVA 3PFIA 4HEQA 4WERA 1FDRA 3TSOA 3U44A 4Y0AA 3B1FA 2V1UA 2G5TA 2FZ5A 2F3QA 2Q3MA 2UUPA 2H5IA 2ZIXA 4JR1A 1N5MA 1JA1A 2CDBA 4W5JA 5HKAA 3EUFA 1XAJA 3WLLA 3AR6A 1J2UA 2IY7A 4TX1A 1OWPA 3UXYA 3TPZA 3F73A 2GI4A 2ZUWA 4N7RA 1U90A 4NPAA 1RYNA 3QELB 1S2IA 1TJPB 3LECA 1AC5A 3UAWA 1A8SA 4OHPA 1SRQA 3F6PA 3BMQB 3G5LA 3BJIC 3M5CA 2VPYA 3AIMA 3ZCVA 2BE7A 5L4LA 1GGKA 4RSHA 4BC1A 5FV4A 1XU7A 3A9CA 4ZAFA 2WK1A 5FLEX 3V3TA 4R9SA 5DLYA 3BXGA 3ELYA 1AS0A 3CVXA 4F86A 2H1LA 1T15A 2FQXA 3VYTB 3ADCA 1QHNA 4H7JA 1KL7A 4J0DA 3O8OB 4ZVMA 2NT3A 2X42A 3CO0S 4WCVA 2JI4A 3O90A 5G4LA 3IR7A 1J7JA 3AR2A 4N5IX 1H2BA 1VCHA 3KR2A 3RDPA 1SBQA 1TUBB 5K0TA 2AMYA 1G8PA 5CHEA 2M6RA 3DCYA 4DLTA 1UF9A 4UU1A 5BW4A 5CFLA 2R6CA 4M49A 3P27A 2X0IA 4J0QA 2ODAA 3ETCA 4RADA 4BAZA 2YX1A 1VHWA 2VHTA 1YBVA 4B2PA 2D00A 4D41A 1S9HA 4ZOQI 2GPJA 4C2UA 2V03A 5EWJB 5HQ3A 2ZITA 2H92A 1BEEA 2GBPA 1KQPA 2I3DA 4Y18A 4ZRDA 5A9SA 5E6RA 4XE5A 3TDNA 2A3RA 4HYEA 3PE4A 3T9FA 2XUDA 4JL8A 1U5CA 3EFBA 2OXIA 4RD1A 1EFKA 2XECA 1WEHA 1C7IA 4KLNA 1I1HA 5C8VA 3R7FA 3W3AH 1GA6A 3TRHA 2QNBA 1I5RA 2PT6A 4JI1B 2BDUA 2SNIE 3KQSA 1L7RA 2ZI3A 2IGTA 1RYDA 2CLDX 4WOBA 3EGVA 1VPTA 4GF5A 5FYQA 3L93A 4UZFA 1RLOA 2PXCA 3BFJA 2EFCB 4O4IF 4QG3A 3Q7RA 2H31A 2XGMA 4PC2A 3ZU3A 4IOJA 5GMOA 4EFKA 4GXTA 2O0HA 1JDZA 2B83A 1URPA 3MQ4A 5E3JA 1JMKC 5EI5A 4AZ3A 1R9NA 4IEEA 5T4BA 4ETNA 3RG8A 3U3DA 4Q3OA 2ZIUB 2I6QA 1QZ3A 1NVMB 3ZNNA 4MQEB 3QTTA 2WFZA 3IKJA 4O3FA 3W8NA 4P7JA 4BRUA 4MS1B 1JEYA 2A30A 3H65A 2CYCA 4ARZA 3GLQA 4P22A 3V4SA 1ADFA 2OZLB 4DIEA 5P21A 5BQ5A 3L4JA 4DN6A 1SBIA 2B8TA 4EMTA 2BI4A 5FBWB 1KO5A 5C81A 3UMYA 2HF9A 2PA3A 3DC7A 2HK8A 2BM9A 4TMVA 1RKVA 2AN3A 1UDRA 3FX2A 5DYTA 4DJJA 4JLJA 4M0LA 1S2GA 5E9AA 5FCDA 2BFMA 3U4DA 4HO1X 1BFUA 1RRVA 1KEUA 4DADA 3SJCA 5IARA 3HVUA 3I61A 5EEGA 1FQOA 1VL6A 4WQMA 2GBIA 2X4DA 3GT3A 1D2EA 4TL9A 1ZD8A 4EFDA 5G0VA 5F7JA 3PEVA 1U28C 3LWZA 4HUJA 3BXXA 5ALYA 3WJ7A 1ODSA 5I9IA 2QK4A 2XCSB 3G5AA 4CMCA 2D5BA 3M4NA 3LUJA 3CF6R 3P2JA 3NTRA 4F5DA 5ALSA 4C3UA 3QEOA 3ME5A 4MB6A 4XWAA 1RLMA 2QTFA 2EJTA 2MDTA 4YJ2B 1PR0A 4TWIA 1YBHA 3ZXSA 5BORA 4MRMA 5JZSA 5F1PA 3GJYA 4N8DA 4YAIA 2HGZA 4LJ6A 4MRVA 3E9RA 2FVXA 3DUFA 3CIFA 5TQ0B 4YMTA 1JB9A 2W2XA 4P4GA 1XK6A 1WMDA 5EIFA 3ZR4B 3FSEA 2KYRA 2R5WA 3K6KA 3BQMB 5GONF 4BNDB 5HFNA 4JELA 2G28A 1JDBB 2YQ4A 4Q3EA 1KDZA 3NETA 1O95A 1UINA 3AFNA 3F1KA 4V3BA 1V1JA 4L78A 5CIWA 4F5ZA 4AKGA 1ESEA 4FHZA 5I7RA 3A2KA 1JAHA 1XTTA 5KKCA 1QB7A 1MUUA 3FJ1A 4XJTA 5H4GA 4M0KA 4H6XA 2M32A 4QX6A 3LVFO 1MDBA 4FGZA 1G8JA 4RXUA 4RIIA 4R9UC 2P62A 2J6CA 3GLIB 1V8FA 1NSTA 2HX1A 1CEXA 5HJ7A 5LOVB 3TZQA 1XRRA 1D6NA 4IVRA 4D79A 3OY2A 2GRUA 5CVVA 4RACA 2GVNA 1ZJZA 1OH8A 2BELA 2PLAA 3RVOA 4RPJA 1RMTA 2NSHA 1K7CA 2PKYX 4MXDA 4YR7A 5JMWA 2V8BA 1BQ3A 1PNTA 2EFJA 2O8FB 3LF2A 3FF4A 1AGNA 1MNAA 1Z7WA 1DI0A 2RHWA 3KWJA 2FXIA 2OMKA 4FMDB 5ESDA 2FJPA 2ZCVA 5GVSA 2JARA 3OX4A 4ZODA 2FAXA 3G13A 5LQDA 3FPJA 4RHYA 4Z2AA 3NAGA 3D9QX 4HN9A 5L3QB 5IS2A 2Q07A 2VK4A 4V0LA 2R1TA 3ANXA 1VJ1A 5JISA 2Q2OA 4JLNA 2C2OA 3RROA 2IKQA 2B4TO 1P4AA 2C1ZA 5HMLA 4TZTA 2W22A 4P3OA 3ST7A 3O82A 3JU3A 4BE9A 2W70A 1IM8A 2KMLA 3UK1A 4E1VA 1IXSB 1KU6A 5BSGA 1Y3DE 2CBGA 4B3CA 1ZH0A 4MGYR 2PRIA 5JBIA 5LPNA 3HDYA 3UF0A 4F3TA 1IH8A 1KVRA 4FXOA 2YBEA 1Q11A 3Q0TA 4G5OA 4I55A 4RKYA 4CZ2A 3OTOB 5DTRA 1NV9A 3OETA 1SB9A 1N8TA 4NCAA 2JRCA 1PR3A 1ODCA 1MV8A 1WXHA 2FQYA 3F8TA 2X41A 5KYUA 3TPCA 2XQGA 5B1EA 2W37A 2GZSA 4IIVA 1L3CA 1NPYA 1FUYB 2EHJA 2HMUA 3ZS9A 4ZHSA 1XYYA 1UOEA 5A0FA 1XCBA 4M0CA 1RP1A 3JQGA 2BGTA 1AQ6A 2ZSEA 2AKYA 3EXHB 4JIMA 3WWZA 5BOSB 2IIPA 1TQ8A 4HUQB 2WU3A 2MSNA 1DFGA 1DIBA 1XD8A 5K8VA 2Z8ZA 1O94A 4KGZA 3T7SA 1WZ2A 1FRNA 4EPXA 3FGNA 4ZDIA 1DG9A 3T1TA 2Q29A 4UBOA 1CRPA 3D4BA 5KSZA 4ADSG 1S7CA 1V16A 3NBAA 3RFUA 4QRHA 4O3MA 1QLHA 1OFVA 1THZA 2C96A 3LFTA 3UO8B 3H8JA 2HHAA 4GAEA 1VA5A 3PGVA 1OC2A 1YGPA 2QAIA 2QJTA 1N3BA 2GHTA 4P82A 1FPMA 2V7TA 1RJ9A 3BCUA 3M5WA 3IP9A 3NEYA 3R5KA 4KQGA 4MUKA 4QLOA 1IC6A 1BX1A 4AW9A 2IDMA 4I4NA 1R8SA 2PKQP 5EHGA 13PKA 3NBKA 3CX8A 2R00A 2AOUA 3NDJA 4BFUA 2NV0A 2O7SA 1UM9B 3G0IA 3R77A 4K9QA 5AIAA 3AKEA 4ZO8A 5ER6A 3ZZ1A 1OXMA 2Q5EA 5I7SA 3FKSD 2JC3A 1A77A 3V5NA 2HJRA 3A4TA 1EUZA 1Z3CA 4OFWA 3B1ZA 1DKNA 1Q77A 1X8LA 1ZFNA 2B4AA 4R41A 4F91B 4V0OA 4EKIA 4F3CA 4KPEC 1W0CA 3O4GA 1I1QB 4FTWA 1FRQA 3C16C 2I1LA 4HDRB 1BXZA 5COQA 3AR3A 3OBIA 5K3DA 3QXGA 3HLTA 3N9IA 4J0EA 4L74A 1QKKA 3A6KA 4ZEVA 2R4UA 1NUSA 1CFZA 1M2VA 4N0QA 2XIQA 1SIWA 2M6LA 4EKDA 1S8NA 2JGIA 2TMDA 4R40A 3SHOA 2Q9AA 2GN4A 1JDUA 1XEWX 3TDMA 3HB4X 2RGRA 3CUVA 2FPKA 2ZUVA 1L8XA 3FFWA 3PI7A 2DR3A 1J09A 1MAVA 1M8GA 4CUJA 4JI7B 1XNQB 2HIGA 2W43A 3IPAA 1U3TA 3DJFA 3AJDA 3H4MA 2AUMA 3KQMA 5JYDA 1I94B 1AZSC 3AEUB 1VRWA 2GD0A 2C1EA 2JGMA 3DMFA 2F1JA 3CH7A 2CLHB 1F7VA 3RODA 1IM5A 2NXWA 5ELXA 3FDZB 1AKMA 3LT5A 3MGGA 3BGIA 4KFUA 4KQ6A 3I32A 2G9VA 3KFLA 4K6KA 1BX0A 1FJHA 1NY5A 3UN1A 4PO8A 4CLRA 2JBAA 3FUWA 1V7ZA 1MG5A 1VE5A 4G0XA 4KLAA 4PCUA 3V7WA 3OMLA 1RU3A 2XWJI 4IXTA 1YAJA 5K0LA 4XUGB 3CEMA 3RBXA 3G0GA 4W63A 4DPMA 1K0UA 2DBRA 1DJLA 4MR7B 4I9GA 4B2IA 1JLSA 4E33A 1A4IA 1BVYF 4ZCTA 1SXJB 4AYXA 4IMJB 3PVZA 2P3QA 4OHBA 4RE5A 4RPHA 5K8IA 1V3UA 2WWYA 1BCSA 3EGWA 4P3YA 1ZOOA 1L7VC 2CFIA 3UJPA 3FYUC 1L8LA 4QXRA 3FCCA 5I9LA 3NTXA 1KOGA 3BTOA 1KY2A 2WOOA 3RYFB 3AF2A 1YRYE 5CFPA 3KHSA 2WFMA 4NBVA 3W4JA 1E7YA 5H81A 1X7YA 2QQ0A 4Y2QA 5C2JB 3F5QA 2Q9CA 2Y1KA 5AJZA 1LDEA 3MQFA 3NHJA 1P4HA 1WKVA 4Z1MA 5CA1F 3BFPA 2COEA 3IUBA 2WKSA 4HHEA 4E1BA 5KYWB 3CONA 5I8ZA 3W34A 4F72A 1M1YA 5K09A 5DWVA 2O8BB 1PLKA 3QJGA 1AGXA 1FMTA 3OP1A 4GUAA 2QSZA 5TF0A 1X2BA 5BMVB 3T1NA 4NCIA 3PLAE 2G9UA 3VZCA 3LSTA 1P5FA 3K94A 1DXOA 3G0DA 4UAUA 5L7WA 1M9NA 4H7KA 3B7PA 3H9GA 3GR6A 2F8LA 3VNQA 2BFCA 1GGMA 1JAYA 4RFSB 3UJ7A 3HC7A 3SDZA 1FS5A 1M8JA 2ZR9A 3I9KA 3VR4D 5AVYA 4QYWA 4ZT7A 4PLCA 1RWNA 1VTKA 1WU8A 4GT1A 4OYYA 3V00A 1RWBA 1YK0A 2G36A 2B9EA 1XTIA 4M2LA 5LQSA 1B76A 3U4GA 3LQ1A 2B82A 2G9RA 2O3RA 1R6VA 3RVRA 2PR2A 3TQHA 3IUNA 3BM5A 1L1RA 2JDID 2H0RA 3GZ4A 3VU9B 3S8EA 2AQKA 2EXXA 2YMLA 1J2YA 4IR7A 3IQZA 1GLVA 2W2QA 2Y27A 3JATB 4RQUA 4XQ9A 2IT1A 1GPYA 2Z1MA 1W6RA 1BA2A 3U7QB 3JWPA 5KO2A 5CDGA 5B1IA 3VH1A 1P91A 5CH3A 1SVUA 2Y67A 1I4EB 1CUSA 1TT7A 1OD6A 4WN9B 4LAFA 1QTNA 5I48A 1Y89A 5CM9C 1LQ2A 3EBPA 1G9SA 1CP2A 4E15A 3F1LA 1YCGA 4C4AA 3UZUA 2C2YA 2FSPA 5EA2A 4UZEA 3N7AA 2RHJA 3NNNA 4PSUA 4WI1A 4KITB 3EN0A 1YVUA 1F60A 2UZ1B 3IVAA 1M3SA 2Q7OE 3RASA 1DJMA 1R0BA 4RH1A 5JSYA 1YDEA 3ZGVA 3RSZA 1TCCA 2G9ZA 2OC4A 3QWAA 2B8WA 4JEHA 4XM1A 4BFSA 2MSKA 5FOXA 4IZHA 4HVAA 4YHBA 3RKRA 2GILA 1ECLA 3BMNB 3NC1C 1TVKB 3V8MA 4BE7B 4E14A 3U3XA 3RI3A 1LLCA 4IZ6A 4ZYWA 2A1TR 1JSRA 3NP9A 4RJKA 5C31A 2QRMA 2WJJA 3ZJVA 3WLAA 4W7SA 3GVPA 3FUVA 2DEUA 2JANA 4D8XA 1FY2A 1N5JA 3S5JA 2G4CA 2CXOA 3Q88A 2C2WA 4PYKA 2BGJA 4B2YA 1QYXA 1LV8A 3NWJA 4QPJC 5GVRA 5K51A 1ZK3A 2I4TA 1X9GA 1IVYA 2KWIA 2OY0A 3QVGA 4QU8A 1L5KA 3M5PA 3CKKA 4IHJB 4LBVA 3N76A 3QA3E 2DJIA 2O2JA 4P86A 1P2DA 4EB3A 5CPFA 4N41A 2ZU0C 4RHFA 4U5QA 2WSSD 1ZIOA 3LBAA 3Q2KA 2B7BA 4HH4A 3KXLA 4PTYA 4RIEA 5B3AA 2B0JA 2ODEA 3T7EA 1OC4A 3DAGA 1S8FA 2CDAA 4JQOA 1NASA 2GSWA 4P80A 3SC3A 1QGDA 3N07A 3PRKE 4LGVA 4RCZA 4KDEA 3Q8KA 2ZWMA 3H3XA 4Y2HA 4M6WA 1EFPA 2JZOA 3WGVA 3D31A 4OQEA 4YDSA 3MPUA 2FN9A 4IJWA 3RAJA 1KC3A 2Z1NA 5SICE 4ES6A 1FUUA 3C6BA 2O8DA 1PV1A 2GTIA 2WE8A 4KPFC 3WMGA 3O73A 1WR8A 1EAMA 2EZ4A 1JJ7A 1A4UA 1MVOA 1DJQA 4UAVA 2ZOSA 4KC0A 4NE7A 4OJYA 1K2WA 2CMHA 4EUNA 5EKDA 1Y0BA 1KKMA 3PDIA 3SQWA 2B8JA 2XMSA 3DAFA 4JVSB 3A14A 2Z5GA 3WIEA 1SVWA 1T5BA 2J09A 2P2ZA 2AJTA 1MGOA 3AEXA 3TKLA 4MUYA 5EG5A 2E5WA 2EX4A 4NABA 1V7QA 3I5YA 1WE2A 1A95A 2J33A 2D3WA 3NHRA 3E7FA 1Z5ZA 2RCYA 3V1NA 3HVHA 2MCFA 2LKCA 1PKEA 1TNDA 3SGLA 4JXZA 1HOXA 3UATA 2I6SA 2ZSFA 1JIIA 5FNZA 1PYGA 4E6PA 3A6DA 1TT5A 4HPWA 1KJIA 1D6SA 4FFBA 1HFKA 2IK8A 4NATA 3BVPA 4C9BA 2D4AA 4HEA1 4P31A 1X80A 2EL7A 4DRXB 4TQ9A 1K5DA 1CCWA 1W9MA 1DPFA 5TIIA 2WLSA 3AI7A 3HO6A 4DJFC 3FMFA 1MC4A 3EXFB 5AYVA 2O06A 3PXAA 1UBOS 4PBRA 1QRDA 5EE3A 3OLQA 1AQUA 5CJPA 1CY1A 3GYBA 1KWKA 1GU0A 4X71A 3E03A 1AGYA 1RMQA 1RACA 1UDCA 4R98A 1JGTA 3H5WA 1FNBA 5L7TA 1W76A 2YVUA 3GNTA 3N0TA 3N58A 1T9AA 4MRPA 5C5EA 2Y1WA 1NTRA 2PUDA 1VE6A 3N75A 2FSHA 2JCXA 2ZBUA 4F71A 2FQQA 2VRCD 4H6PA 4HLQB 2P7IA 2HEIA 3C3DA 4Y6GB 1F8XA 2PD3A 2AQIA 3AJEA 4Z0NA 5CGZA 4ARIA 3IP1A 4YLEA 5H9WA 3BXPA 3C6XA 3FZQA 3O9ZA 2VJDA 1VYHA 1YULA 1AV7A 2G77B 4ZYTA 3HZOA 4R68A 4I3GA 1KE2A 4DMUB 1C3OB 2DHCA 1LX7A 1E2KA 1MNQA 4WLVA 2FWJA 2MYUA 4R84A 3QU5A 1DC6A 1T0BA 3EVCA 2W2OA 1L5YA 3IJ5A 3NBYC 4J7XA 5DGCA 2I2AA 3MCWA 3RR2A 3W3ZB 1VSTA 1U2ZA 2GPTA 4JBGA 5C1IA 4EB0A 3OICA 1M1YE 4YLYA 3E5HA 1N4DA 3C6KA 1L5GB 2PFSA 2AXQA 2P75A 2YXBA 4LC0A 4ND5A 3M89A 2V9ZA 3RIYA 4CLOB 5H7XA 3ORSA 1JG6A 4BFWA 1ONNA 3UWKA 1UZMA 5LL6P 3K4PA 1PFGA 3EMKA 4JJEA 4YP7A 4DLWA 4E2WA 4AAYA 1A9YA 4IKEA 4EBBA 2ETVA 1HE4A 4PLYA 5F9MA 1GQSA 2G0NA 1U7DA 4BWVA 2VQ3A 3WBBA 5F2NA 1HXHA 4DQKA 2NZ2A 3NFRA 4IICA 4F97A 3ABOB 5HE9A 5HGJA 2QWXA 2M9MA 4MDFA 2C94A 2H2IA 4DREA 1I7SB 2ZGVA 1YCHA 4IVQA 1BMFA 1KI6A 3UBTA 4NZMA 1EDOA 1RPNA 1ACLA 1U0NA 2UVPA 2WYVA 3ANYB 5FIUA 1KE1A 3WBJA 3EVTA 1CHNA 4UXIA 3WRVA 1V5FA 3A32A 3BFXA 2IHYA 2MSLA 3GC6A 3M8KA 2C7OA 4JI0B 4AKSA 4YCBA 1RHUA 4MINA 4DMGA 1EUYA 1XE3A 1CZOA 1OR8A 2HJGA 1UEXC 2R5NA 3NG1A 5HBGA 3UYLA 4BRSA 4A9AA 5KTTA 1CQIB 1ZMOA 5FO0A 2Q4TA 5GM2A 1UT5A 2B1JA 4V0MA 1EP3B 3IH5A 1Z4LA 1W2HA 2ARKA 2CLEB 3WZLA 4PZAA 4ZT5A 4QYXA 3D2CA 4OMCA 4LCBA 4RQBA 3VC7A 4B1FA 4EYGA 5KDDA 4PHHA 3CUEF 1VZ2A 2Y1CA 4R8MA 4R8KA 3U3RA 1KYTA 2GZ3A 2J9XB 4OL0A 4R0VA 2YASA 3T3NA 3L41A 2RAPA 4ACAA 4AJOA 4Z4QA 4O0LA 1FS6A 4EX7A 4D80A 1RRCA 4I6GA 2V4MA 4LSZA 1YIDA 4ZDWA 4AB1A 2QVZX 1BWQA 2TSYB 2G06A 5CXQA 3FOBA 2ECKA 2F9FA 4JITA 4W6ZA 4B33A 1KMHA 2FLWA 3HDGA 4MROA 3AHDA 2HMVA 3CVYA 4NECA 2VP6A 5FPHA 1CUHA 4BX0A 1A50B 2YRXA 5IHPA 1ONSA 2Q4RA 4S1WA 4ZVLA 1I9GA 4E4TA 2K7FA 2J5XA 5LU9A 4JI4B 4MYDA 1L5MA 3DBIA 3SE0A 3F97A 1UBTS 5EZYB 3HLYA 4UQOA 4B0OA 3HFJA 3L0OA 1X38A 1A8IA 1Q0HA 2P0YA 2FFBA 5FA5A 3RRNA 3Q5GA 1CTQA 1GPBA 1I33A 2C2GA 1MHTA 5CCBA 4BO7A 3NHKA 2YNMD 2C2XA 4W5RA 3CNHA 4GPBA 5IXSA 1U5BA 3ZV3A 3FYHA 1RQXA 2IL1A 2RBKA 1P9WA 5CT8A 5KVQA 5JHHB 5ENZA 4N65A 4YFVA 4NDNE 4E88A 1F2VA 4RHXA 2OV6A 1GXSB 1ZLXA 3GCWA 5EZ5A 3STTA 3RHFA 1NBMD 1IY9A 2GZDA 4FYHA 4RVGA 2PJDA 4BWFB 4HDMB 5DN9A 3SU8A 1PFQA 4KXUA 3D3EA 3ZHXA 4QJ3A 4CF4A 5DCUA 5LDDC 5CDUA 4DA9A 3Q9LA 3MBOA 1I4DD 2P0AA 2H17A 5SYNA 3DCJA 1LUAA 1CV2A 2P6UA 4TSRA 5H4HA 3DDWA 4IRMA 4JVOA 1X0VA 3DWGA 1YT5A 4U9HS 4RZIA 3BX1A 4ZEWA 3KPJA 4XDYA 1I4WA 1SUBA 3AIOA 1WX1A 3UHAA 1B0AA 1YHYA 3QMWA 1BW9A 3O83A 3UH1A 3KJZA 3M6WA 1MB3A 1WCIB 1EA7A 2NVBA 2PX2A 2Q5OA 5DJ5A 3SCZA 3L7MA 4GG1A 1FDSA 2AZ4A 2BMJA 3LOUA 1T2EA 4M1EA 4PPQA 1CUFA 5EUBA 3T3GA 3WX0A 1A9TA 1GG2A 3MXOA 1BKDR 1M67A 3O26A 1D5CA 3I45A 4JLKA 4OLBA 4TXLA 2C82A 3AKCA 4I5IA 2IPXA 4RZ3A 5IEBA 5A2QA 4PN3A 1KSHA 2OA0A 1DAMA 2J5RA 2JVJA 2WM2A 1J33A 3DE2X 1OBVA 2NTYC 3L01A 4QECA 3EE6A 5E7JA 3FVRA 3U26A 1GTZA 1A9OA 1C2TA 3D81A 1SK9A 1VECA 3P2MA 1WSBA 5LKAA 1K8XB 3LUBA 3T5TA 3WGZA 2JLRA 3VI4B 3NCTA 3EIUA 2XVXA 2RD2A 3ANSA 2XZDA 3CUTA 2Q1SA 1O97D 4KRXA 3T54A 1J24A 2FGJA 2NYUA 2JGJA 2RJ3A 3ADPA 4CN9A 3JVDA 1FZQA 1H4VB 4G09A 3RREA 2D1TA 1GVNB 4CMGA 4IF4A 1OHHA 5ADVA 4PXAA 3V7YA 3A8TA 3C3MA 4J07A 4LE0A 2IYRA 1UOOA 1JQ5A 1YIAA 3DXFA 4ZA2A 4F1KA 4FSHA 5IRCD 4BIMA 5CAEB 4Y1EA 1NVWQ 2A94A 2MSCB 2X3FA 4YJFA 4MCJA 2X7XA 4DS3A 5MN5A 1W36B 4P4TA 3EZ7A 2J4FA 4BBJA 1GNSA 1IHOA 2V6GA 1PNQA 3N8IA 2ZT6A 1Q12A 2ZROA 3HDTA 4H35A 3NV7A 3E8SA 1CR0A 4ZO4A 4O59O 2ET6A 5IBPA 1VIYA 4QGAA 3UAZA 3ZTTA 5DLQC 3QUBA 1TC2A 3WWPA 4HJRA 1LVGA 2BBOA 2YWHA 2E4AA 2ZP1A 4KQIA 3IC5A 2DTDA 4YROA 1RYZA 5BSMA 1RKBA 9ATCA 2VJMA 2GEJA 4YAJA 1EX1A 1N2GA 1PQPA 1XROA 2AJBA 2X2PA 3EG5A 4RGBA 3G2LA 3KLNA 5EIAA 5CFOA 5AJYA 5IJZA 4PGMA 1CNEA 2FOXA 1M5TA 3ZGNA 5ECYA 5K4HA 1N36B 3EEBA 4EMBA 2B99A 3DB1A 2XDYA 1KAOA 1B42A 4OB8A 1Y3AA 1MOZA 3D8SA 4QFDA 2FFHA 3PT9A 4I4TA 4LZJA 3TM5A 2PSHA 3Q8WA 4OQXA 4JR0A 4S2EA 1JPVA 3M4XA 4BLTA 3M3HA 2I80A 6CHYA 1XZBA 1BGVA 4AJ4A 2OFPA 1EXMA 2JI7A 3SR0A 1PWXA 4PV7A 5JJIA 3FAKA 1NU6A 4B7UA 2JHAA 4JNKA 4QOJA 1ZK1A 4AKIA 4ZI7B 1D1SA 2HR1A 9LDTA 3B7WA 2QTGA 1U3VA 5FNVA 4OYLA 5I7OA 2YVLA 4JL5A 4A91A 1EVEA 1ZQ9A 3MGBA 2WZCA 5BSUA 4MUMA 2CJWB 3LW8A 4YRCA 1UFKA 1R8YA 5DASA 1KQNA 1IZZA 1XF9A 3EDQA 3JRXA 4L1KA 2E4ZA 4Q9HA 4EY3A 4TL6A 3FDJA 2I34A 4C6SA 4HFJA 4D9NA 4Q6BA 4R6WA 1AKTA 3FZNA 5ECDA 5FDFA 1K88A 4V0ME 4EYQA 2ASEA 4S1VA 3NOQA 3UYKA 1QYVA 3ESDA 4ZAVA 3T3DA 4AIIA 5ALUA 4DB4A 4R81A 1KMQA 3LNTA 1A04A 2PLWA 1QKJA 1TZJA 5J40A 3KV3O 1B8VA 1BA3A 1E3WB 1EHIA 4TV8F 5H80A 3WADA 2IX3A 1QTIA 4MAFA 1QO0D 1N33B 1ZICA 4CCWA 4HXYA 2XWPA 1O0BA 4RV4A 4KBYA 1L1QA 3FCOA 1XPJA 3LX8A 3PCTA 3O95A 1OXKB 4LZNA 5F64A 3TNYA 4F2WA 2GEUA 5BMOA