1P1BA

Guanidinoacetate methyltransferase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
193
structure length
193
Chain Sequence
RWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanidinoacetate N-methyltransferase
publication title Monoclinic guanidinoacetate methyltransferase and gadolinium ion-binding characteristics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 58
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2003-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1p1bA00
4KVZA 4PIPA 2PT9A 5DRYA 2AN3A 5LQRA 4ER7A 3GIWA 3QOWA 1YFJA 3M4XA 3ORHA 4GUAA 4FGZA 5ERGB 3V8VA 4ER0A 4G56A 3FYCA 5HIIA 3VSEA 5DXAA 5CVJA 3GWZA 2OB2A 4AZVA 4RVDA 5E1MA 3G8AA 4GEKA 5KQSA 1QAOA 3NVMB 5DM2A 1XTPA 1WZNA 3FUXA 1X1CA 3M70A 3OFKA 3JWGA 2Y1WA 4QVGA 1ZGJA 3P71T 3HCEA 3KQYA 4PWYA 4DZRA 2HWKA 3BWYA 3UJ8A 4R6XA 4XUDA 5K0EA 1IXKA 3SXJA 3P9NA 2G1PA 1V39A 1FP2A 2CKDA 2P3LA 3VC2A 5K0JA 4X41A 1RJDA 2FHPA 3GRZA 3CBGA 3PB3A 4OBXA 4Y30A 2YXLA 3G5LA 3UA3A 5ICCA 3KPJA 3ERCA 2AOUA 3HA7A 4RTOA 2B3TA 4OA5A 3P2KA 3A25A 2V7EA 3A26A 4HH4A 4RX1A 3LBFA 3WSTA 2Z6UA 4P7FA 1JTEA 3DUWA 4E33A 2PSSA 2ZCJA 3BGIA 3KQWA 1G6Q1 2ZIFA 5GP1A 2YXDA 1RI4A 5GM1A 7MHTA 3JWHA 2IH5A 4FSDA 1L3BA 1I1NA 3NWBA 4OQEA 2JH8A 4OA8A 2C7RA 1KYWA 5GINE 5ICFA 5KVAA 4GOMD 1JSZA 4PYNA 4QTTB 2FCAA 4BLVA 1KR5A 3OFJA 2QRVB 1PJZA 2YR0A 3MCTA 4O29A 5G02A 2IH4A 2ZW9A 5FHQA 4AZWA 2YX1A 5EC8A 5EPEA 2OYRA 1X1BA 5EIWA 1SQGA 2VDUE 5GWXA 3HCFA 2XYRA 3FUTA 3OU7A 2XYVA 3EVEA 5DM4A 1U2ZA 4KDCA 2UYHA 4GF5A 4RV9A 2ZFUA 2WK1A 1RI5A 1P1CA 1JQEA 3DXYA 4KW7A 5HIJA 2FRXA 2IDKA 3EVCA 3G7UA 5DX0A 2YTZA 4MQ4A 5EQJB 4WXHA 2JHAA 2R3SA 1RJGA 3HCCA 2I62A 3CGGA 4QPNA 2CL5A 3HNRA 5FCDA 5FTWA 4R8SA 1KHHA 3KQPA 5HIKA 2ZZKA 1XCJA 2ADMA 3FUWA 3LGAA 3R6TA 4RVFA 1HMYA 1JR4A 3FTDA 3GRVA 4C08A 4E31A 3B3FA 4C04A 1QAQA 4HTFA 3OZSA 2ZIGA 1T43A 3FTEA 1ORHA 3R0QA 1X1DA 4P58A 3ER8A 2EFJA 4DCMA 3KQVA 3F4KA 4X60A 1N7JA 2P8JA 3SSOA 1WY7A 3PTAA 3KQSA 3R24A 4LWPA 4RTSA 2PXAA 3G8BA 3UA4A 3M6XA 1YB2A 3EVDA 5HEKA 3HCBA 1D2CA 5LQNA 3A7DA 2B9EA 3SM3A 3OU6A 5CCXA 4EQZA 5DTRA 3I53A 4DQ0A 1RJEA 3UJBA 2P7HA 2NXJA 1G38A 5FA8A 2WA1A 4E2YA 4M38A 5EZQA 5HOQA 3X0DA 3OZTA 4M37A 3A7EA 5HILA 2NP7A 3M6UA 3HVJA 2P40A 1DL5A 5LQCA 4RTRA 3B3GA 3HEMA 4BP3A 1NW3A 2HMYB 4PONA 5EIFA 2GH1A 1R18A 3NTVA 1XVAA 4KRGA 4MHTA 2EX4A 3SVZA 4C03A 4MTLA 4CKBA 2H11A 3PX3A 3EGIA 3LECA 2BR5A 5CVUA 4DM3A 2A14A 3FPEA 2P41A 3LKZA 1BOOA 4PYMA 3CJTA 4BLWA 5F2OA 4ER6A 1YZHA 4GQBA 3NDIA 1KYZA 3VYWA 3LPMA 2B78A 3G88A 3PT9A 2PBFA 4MIKA 4QPPA 3TM5A 1AV6A 5FQNA 3FPFA 1XJ5A 3E8SA 2ZTHA 2AOUB 3TPZA 3KPUA 2G71A 2ERCA 4GOOD 3IYLW 3HA3A 4PCAA 4JXJA 4PYLA 3L8DA 2OKCA 4F84A 4NECA 5K0CA 2VP3A 5LQUA 4R8RA 4HG2A 5DSXA 1QANA 5DLYA 3HCDA 2R6ZA 1JG2A 4QQKA 3KU1A 3HVKA 1HNNA 1KPIA 4KWCA 1O9GA 4H0NA 4RSRA 1XDSA 3FUVA 4PNEA 1VLMA 2AN5A 4K6MA 4C07A 4XCXA 5JUWA 5E9WA 3FTCA 4A6DA 1WXXA 1SUSA 2AOVA 1G55A 4Y2HA 1X1AA 3MB5A 2NYUA 3FZGA 3MAGA 4PCLA 3NWEA 3TKAA 1JQ3A 3G2MA 3NMUF 1SUIA 5K0FA 2IP2A 1F38A 2FPOA 4DKJA 3PVCA 3TOSA 5GIPE 1ORIA 3T7SA 1M0EA 5LSAA 3O7WA 5F2NA 4B17A 4E70A 3SSMA 5FHRA 1BKYA 2PX5A 3BWMA 3BKWA 1ZHFA 1NW7A 1XDZA 4AX8A 1UWVA 4P7JA 1M6YA 2OY0A 2ZBRA 3A27A 3QOXA 3BXOA 9MHTA 4RVHA 5CIYA 4MWZA 2ONYA 4XUEA 4YMGA 1RJFA 3KPYA 4L7VA 2PJDA 5CCBA 1KPGA 1VL5A 5EHGA 3BUSA 3P9IA 4M7RA 2BH2A 2JHPA 3HVIA 2IDJA 2JJQA 2V74B 5E1OA 5T64A 4HTFB 1JG3A 2BZGA 5FULA 5FWDA 2GS9A 1NV9A 5K0GA 3EVAA 4QDJA 3TFWA 5K8VA 2Z6AA 5T6BA 2VS1A 4ZTBA 1D2GA 2VDWA 3V97A 3HVHA 3LCCA 1IY9A 5B1SA 1Q0SA 2PX2A 2ZVJA 3P97A 3GDHA 5H02A 5GOZA 1P39A 2VZ9A 1N7IA 3KPWA 8MHTA 5E2AA 4ISCA 4C06A 4CKEA 1JSXA 4KIGA 2QM3A 4CTKA 1L9KA 2BM9A 3OPNA 4EKGA 4OX9Y 4PGHA 1KIAA 3D2LA 3HM2A 3DP7A 1VP9A 4KIFA 1XXLA 5EHIA 3ER9A 3IEIA 2NXCA 4F85A 2IH2A 2WA2A 3DH0A 5EZSA 3VC1A 1TW3A 3AY0A 5EGSA 4X63A 3SX0A 3C3PA 4CKCA 4V0RA 2XYQA 1N2XA 3Q7EA 2CMGA 2IGTA 4X61A 2NNWB 2ZBPA 2P7IA 1X19A 3E05A 3KR0A 2PT6A 4OBWA 3MQ2A 4PINA 2ZBQA 3M6VA 1WG8A 3T0IA 3PFGA 5HZMA 3GRYA 3NW9A 1VQ1A 1VP3A 3KQTA 3RODA 4EKIA 4YUXA 2FYTA 5HIMA 4GC9A 3TQSA 5BXYA 2ORED 3LBYA 3CKKA 2Q41A 3EVZA 5EEHA 4R6WA 3TRKA 5DSTA 1FJXA 3AWIA 2JHCA 4FP9A 3DMHA 3FUUA 4PYQA 5LQKA 4YV1A 2JH9A 10MHA 5EMJA 1OR8A 2PWPA 4AUKA 5JR3A 3ANXA 1SVUA 3O31A 3CC8A 3P9KA 4PYIA 5CVVA 4RTPA 2H1RA 4HSGA 2PWYA 1JQDA 5CVEA 2ZULA 3FRHA 3CCFA 4IV8A 5IKMA 2ZIEA 3UJDA 1INLA 1EIZA 1JG4A 3KQMA 3DLCA 2QE6A 1KP9A 3C0KA 4PYJA 1DCTA 3KQQA 1WS6A 5KQRA 5E9JA 4RTKA 1IM8A 1ZGAA 2G72A 3B5IA 2GB4A 4U7TB 3NDJA 3G2PA 3GCZA 1TW2A 1M6EX 3GJYA 1FBNA 2P3QA 2NXNA 2CWWA 2G70A 2AZTA 1NW8A 5C9ZA 5CM2Z 2ZWAA 3R9XB 2XVMA 4FT4A 3ME5A 1UIRA 1QZZA 3DOUA 4YUVA 3TKYA 1YZ3A 1XDUA 1YUBA 1EQAA 4E32A 1EJ0A 4DA4A 2KW5A 1NBHA 3C6MA 3LKDA 2AOTA 3ELUA 3PFHA 3S68A 5BW4A 1NT2A 3P2IA 3LHDA 2PY6A 1DUSA 4IKPA 1NKVA 4QVKA 4AZSA 1R74A 2PV0A 2B2CA 2OB1A 2YVLA 3AJDA 2Y1XA 5KS2A 2C7OA 3AXTA 1EJ6A 3P2EA 5K03A 2AVNA 2AR0A 2UYOA 3B3JA 3KR9A 2PLWA 2DULA 2EJUA 3FRIA 4QQNA 4XUCA 3LDGA 4GOND 1MJFA 1VBFA 1P1BA 1ZG3A 3RIEA 4E30A 3K0BA 2ZLBA 1D2HA 3KR1A 4IV0A 3M6WA 5MHTA 1XCLA 3DLIA 3OCJA 4YMHA 2BR4A 4QDKA 1AF7A 3EGVA 5E1BA 5BW5A 1NW5A 3G2OA 3DR5A 3MTIA 4RVGA 5LR6A 4LWOA 3LCVB 3ELWA 4CWAA 2HTEA 1P91A 5HFJA 1R6AA 3MTEA 1FP1D 2PXXA 5EEGA 3JWIA 3FPJA 1BHJA 1NBIA 2PXCA 3THRA 3QV2A 1YFLA 1B42A 2O57A 1H1DA 1NE2A 1O9HA 1RI1A 5K01A 2I6GA 1TPYA 3P8ZA 4V0QA 2LD4A 2G8NA 2O05A 3CVOA 4PYKA 3TMAA 2UYCA 5E1DA 3UJCA 3DTNA 1L1EA 2AN4A 3BZBA 3DULA 3REOA 3NVKI 3TLJA 3B7PA 3K6RA 4M36A 5K0LA 3LX6A 1G8AA 2GLUA 3BWBA 5IH3A 3SSNA 4C05A 3SMQA 5M5BA 3G2QA 2AOXA 3FPGA 3HTXA 1RI2A 2P35A 5EKXA 4X1OA 2PVCA 5EKUA 2IFTA 2O06A 2QYOA 4DCGA 3JWJA 3PX2A 1VIDA 3ELDA 1I9GA 5CUQA 2QY6A 3DXZA 3I64A 1NV8A 1VE3A 3CJRA 3KR2A 4EK9A 3KKZA 3DXXA 4F86A 3BT7A 5K09A 1EAMA 5D1HA 4ER5A 4GOLD 5E8RA 5C1IA 3DMGA 2CMHA 3MERA 2ZSUA 3G5TA 4ER3A 3LL7A 5EVJA 3HA5A 3BGVA 3DMFA 2I7CA 4WVLA 5DTMA 1WXWA 5DM0A 5DX8A 4RTJA 2PGXA 1R8XA 1R8YA 3UFBA 3UJ9A 1AQIA 2DPMA 3FPHA 2OBFA 3LCUA 3FYDA 3A4TA 4RYLA 3HCAA 4BP1A 2HR1A 3R3HA 1AQJA 5GIOE 1Q0TA 1Z3CA 3OZRA 3E7PA 4RWZA 5F2KA 4CXMA 2EG5A 1MHTA 1RI3A 4GBED 3UJAA 5DXJA 2IBSA 3LDFA 3SGLA 3UWPA 5DPMA 2AOTB 3UJ7A 1L3CA 2IBTA 5P8WA 3T7TA 4ATNA 2C7QA 3UBTA 2K4MA 3EVGA 3GXOA 3HP7A 5ICGA 1FPQA 1YF3A 3GRUA 4A6EA 2I9KA 5D1NA 1L3IA 3EEYA 5DWQA 3T7RA 4HC4A 2ZZNA 3EMBA 2H00A 1BC5A 2AOWA 2ZWVA 5ICEA 2JG3A 2IIPA 4BY9E 2YXEA 3EVBA 4LG1A 3RW9A 4RTMA 3GU3A 4FZVA 3MGGA 3EMDA 3PS9A 4FR0A 5FADA 3BWCA 4C4AA 4PYOA 5FUBA 4DMGA 4YUWA 3LSTA 1SG9A 2OXTA 2PKWA 4YV0A 4Z2YA 2OO3A 4RTQA 3EEOA 2BM8A 2BR3A 2N47A 5DX1A 5DM1A 5EMKA 2NP6A 2F8LA 3Q87B 5DT2A 1Y8CA 3P9CA 4EMSA 4IWNA 4RTLA 5E8JA 1JTFA 3AXSA 2NXEA 5T67A 5DTQA 1KPHA 2UYQA 4PGGA 4P7GA 5EMMA 1SKMA 3OE4A 4OQDA 3IHTA 1EG2A 2GAFA 1VPTA 2AVDA 1G8SA 5EMLA 2UZ4A 1NW6A 3EPPA 3G89A 2PX8A 1ZQ9A 4P7KA 2QRVA 5KYGA 4E2ZA 2O07A 1PRYA 1SQFA 3GRRA 3EGEA 4UOEA 5K05A 3E23A 3I5UA 4HGZA 5U4XA 1QYRA 4PIMA 4POOA 4HRAA 2OPBA 2XBMA 4CTJA 3O4FA 2OZVA 2YUIA 3KPVA 2FK7A 2YQZA 3FTFA 1G60A 2XVAA 4BLUA 5BP7A 2FK8A 3B89A 2HNKA 3OU2A 2E5WA 3GNLA 3H2BA 3ID6C 5FWAA 4YUZA 2GPYA 2C7PA 3TR6A 5FA5A 1JG1A 2O0LA 2Z6QA 2B25A 3NJRA 3BKXA 5K0BA 1QAMA 4FSXA 4RTNA 4U7PB 1UFKA 3GO4A 4FS8A 5E9QA 1R00A 4AZTA 5GM2A 1O54A 4R05A 3C6KA 5EOVA 2ONZA 2PX4A 5C0OE 3UJ6A 4EVIA 3U81A 3UZUA 5LQAA 3BGDA 2VDVE 2HV9A 3I58A 3M33A 4GC5A 3MCZA 4YUYA 3ELYA 1F3LA 4QTUB 2GA9A 1I4WA 3KQOA 5LQJA 5CD1A 2IPXA 2ZZMA 3C3YA 3I9FA 2ESRA 4HGYA 1KXZA 5DRTA 5K0NA 3PLAE 4E2XA 4LECA 3GGDA 4DF3A 3IV6A 5FQOA 4KDRA 5CVDA 3KHKA 2P1DA 5EG5A 3CJQA 5E2BA 3THSA 4YV2A 3MHTA 3SR4A 3TM4A 1ZKDA 3EVFA 2EJTA 4FT2A 3LDUA 3OE5A 2AS0A 2P3OA 4E2WA
chains in the Genus database with same CATH superfamily
4WK2B 1QRDA 2HSWA 1VRVA 1L5ZA 1GDTA 4MVJP 2P91A 4F06A 3MQ4A 4ITVA 4AJ9A 5LU9A 2H52A 4HLUA 4IUCS 4RFVA 1F0YA 4QJ3A 1N78A 4V0OA 3ZY3A 1T8RA 3IL2A 5KIAA 3ESCA 3RADC 2G5TA 3IXMA 3QKRB 1IUPA 2VFAA 3LX8A 1LDNA 1T35A 4JQYA 4I1UA 2B7CA 1PL0A 5KQSA 2OM6A 4KYUA 3IKJA 4K8OA 1IVNA 1I3CA 5COBA 3SXPA 3VTFA 1XMQB 3JWGA 3ZHVA 1ORWA 5GGYA 1GILA 1NVAA 2HA2A 1ZSNA 3V8MA 3WQHA 5I7SA 4L4RA 1BEEA 2GZ3A 3UJ8A 2JKVA 3T5MA 4TV9B 1E2MA 4C6TA 5CLJA 4S1WA 1UXOA 1URPA 5JROA 1EUCB 3DLPX 3ZE8A 2HY7A 2D5CA 3QITA 4IRXA 2D0OB 4MB2A 2EFYA 2G7MC 4A27A 5EIEA 4RTOA 4NP6A 2XNKA 5A62A 3EHEA 3LLUA 3OEED 2PUDA 2FI1A 2GNAA 1G6Q1 3WA7A 4HQFA 1EFKA 3JWHA 3S8MA 4IW3B 3CA8A 4I55A 4ND8B 5DO9A 2VSQA 3ZWMA 2VQEB 1MO5A 4J7UA 4OA8A 3VAAA 4HXYA 2PZAA 4MMYB 4AN4A 5I51A 4LF6B 5EIXA 3NHWA 4EB6A 1PFUA 2VEDA 2Z8YM 4MUAA 2NZXA 5HG0A 5HFNA 5D87A 3PNVA 1TMGE 4HUJA 2ODTX 4KQEA 4N49A 2Y67A 4GRIA 1HQDA 4ZREA 1DMRA 3PDHA 2OYSA 2OEPA 3A6EA 5DEOA 2GXUA 2PD6A 2VDUE 4P5EA 1E6MA 1EQ2A 5DM4A 1VTKA 6YASA 1KNXA 5AHOA 4B1FA 1RWNA 2Z95A 1CRZA 2C1ZA 1MVLA 2W22A 3PQ2A 5HE8A 1W4ZA 4DR5B 3BICA 1JDZA 4EECA 1WV1A 4DQVA 3T15A 1WXHA 4YP0A 3L43A 1RADA 4AFNA 4HNGA 1Z8HA 2OECA 2HIAA 1Y81A 2PG3A 2CMDA 4UQPA 1UQUA 1CERA 1IN1A 4O4LF 3LI2A 3KQPA 3O73A 1RAGA 3U1BA 1DTWB 2EF1A 4QYTA 1VHJA 1JHRA 1IY1A 2ECQA 3OC6A 1F7UA 2CT8A 1EINA 2IT1A 2QF7A 4X7MA 3WJ2A 1SXGA 1U7ZA 4FGKA 1J4AA 1K6XA 2VJCA 3QUCA 2EGUA 4EUSA 3ZNNA 2JFUA 3TS1A 1SUPA 1XA4A 1FDIA 5KYTA 3AK4A 3DO6A 1DUVG 1N7JA 3AEUB 3LWNA 4INPA 4MLPA 4U6QA 2CE7A 1EBBA 2WF9A 1HNXB 1P4RA 4FNAA 3N5CA 4LY9A 4PQYA 3UAWA 2BFMA 2ASVA 3FSRA 3QEOA 1U1EA 4JQZA 3WGIA 5LQNA 3AU9A 5EJGA 2GWHA 3KYCB 2DGDA 7MDHA 1LUAA 5E7MA 1N92A 1V8ZA 3VISA 1G38A 1ORRA 4F5WA 1N2BA 1TZJA 2H5JA 2W83A 3F97A 1FFEA 2AG1A 3Q2IA 4FOPA 4I50F 4RKEA 4DUYB 4KOEC 4UCWA 3A7EA 3CEMA 5HILA 5IU6A 2WJHA 2GM3A 3UB2A 4BMOB 4E5SA 2X3FA 1PKXA 2IEGA 1K27A 5FOWA 2JD2A 3SDSA 3SEQA 3AVWA 3IPCA 2RD2A 2D5BA 3OIUA 4GPZA 2A9FA 1XVAA 3UT6A 3KE8A 4EF6A 4Q1BA 3P26A 5JUWA 4LHYA 4ZO6A 3EGIA 4KFTA 1Z8FA 4OK6A 1EXWA 1NXSA 2W2VA 5A3SA 2G1KA 4MCAA 2DKOA 4GDMA 1PVDA 5BSEA 2DUMA 3VNVA 1Z0UA 3IT1A 3GEMA 5EIBD 4ED9A 5B64A 1Y1QA 5DK6A 5F3RA 1E1DA 2CWDA 2PQ6A 4GMFA 3A1NA 2VO1A 4DDTA 2V0GA 3TPZA 3KPUA 4X93A 1O4WA 1CEYA 1WSAA 3OCXA 1GCIA 1T6NA 4QGFA 4ABTA 1JBEA 2Y0EA 2OCBA 4MW7A 2P78A 4YPFA 3WRYC 5AM0A 4AIIA 5EWLB 4NWIA 1I14A 4UBMA 1K4KA 1LTHR 2QZ4A 5M7EA 3SS9X 4DWOA 5BQ3A 1YQWA 2C8JA 4NCXA 4LOIA 4W7IA 4D8XA 1ESEA 1NULA 4AF6A 1CZRA 4NU0A 3REQA 1YCGA 3EWNA 2Y71A 4EEXA 3MHPA 5BMOA 5JMWA 4P4LA 4V0NA 4KFUA 3D7SA 4PLPA 3IESA 4A6DA 2EOAA 3ECAA 4YMUA 1Z7EA 4E13A 1SUIA 5IDQA 3OPYA 3OJCA 4FMDF 3N8GA 4BZXA 5B3AA 1O58A 1YAHA 1ND5A 2ZB7A 4E5YA 1U1FA 1GXSB 1UPTA 3DWGA 1RTKA 3RVMA 3WA6A 5LP6B 2B8JA 2NM0A 4UBNA 1IHXA 4XD2A 5DASA 3RTEA 2UZ1A 3R3ZA 4FGUA 3WK6A 3O21A 4MWOA 4P3YA 1Z6TA 3OQOA 2FZKA 1RM5A 1EDOA 3RAFC 2VUUA 3SHFA 1MMFB 2AR7A 2PR7A 3EOZA 3BXOA 5FOTA 3SR3A 1LS1A 3HRIA 4OKSA 4MKHA 5DBGA 4Z2AA 4QM6A 1F06A 2XMBA 3L9XA 1DAIA 3PFNA 5LDDC 4C1BA 2QL9A 2IHVA 4HAZA 1SU6A 4M1SA 4PLVA 5C7YA 3T7DA 4AP5A 2C2BA 1II8A 5K8VA 1G5PA 2OV1A 4ND2A 5EJEA 3N0WA 3JZMA 5C81A 4ARZA 3BJIC 2PSFA 3LY5A 4ZTBA 2HA5A 1RRMA 3UHPA 1CVIA 1UUFA 2VPTA 3K53A 3MLAA 3O93A 4TVSA 1FNCA 3LNCA 3M89A 1TTPB 4GBJA 2YRXA 4RNCA 3Q3EA 5IXSA 3ETHA 1A9XB 3BXXA 3M4JA 1JWBB 4ISCA 4KQXA 1QC5A 2EIXA 4NZNA 5B58T 2QM3A 4CNQA 5CEJA 1KJZA 4DV2B 1LI4A 4R84A 3RAGA 621PA 2GVDC 1S9DA 2B98A 1MW8X 2QAGA 4O4HF 4RPCA 3A58B 4F93B 5BSGA 3CVWA 3D8TA 1FQKA 2WA2A 1VI2A 1S7GA 3GGGA 2Q49A 4FMPA 1BSVA 3CZ5A 4PR3A 3ETLA 4A2QA 2W43A 4IMIB 2WSMA 3VJLA 2JFFA 3Q7EA 2QMHA 4C6HA 3OWHA 1DS6A 4IFIA 4OBWA 3MQ2A 1G7SA 3H17A 2CBXA 1WG8A 1I5OA 2EHDA 3MT0A 4PINA 3DEFA 4FQ5A 4EKIA 1XDBA 3FPSA 2ZT6A 2VF4X 4IVNA 3EPKA 1KBOA 3IHLA 3NBUA 1Z83A 3H3FA 2G9ZA 1Q11A 3AWIA 1Z13A 5ESDA 3DWFA 3KWJA 1RRGA 2FMIA 2WZCA 1IHDA 2PWPA 1VIVA 1F8GA 4IX1A 3BGOS 5FWXA 1N2OA 3ANXA 2ZATA 2ZJ2A 4XJVA 1PLLA 4D8YA 2BGWA 2AKYA 1TD1A 2C0QA 3A4NA 1B41A 4WASA 4E2FA 2Z1MA 5JSKA 5LYJA 3B9RA 2SKDA 2W6QA 1QSGA 3OY2A 1INLA 4GMKA 3KQMA 5BRJA 4Q4LA 4TV9F 4YJHB 5AUPB 4BU1A 1KI6B 2NYAA 3U4GA 3JQ9A 1Q12A 4N0EA 1TU0A 1U4NA 2GJ8A 4R9VA 3MJRA 4KQIA 1G17A 3ONVA 4UHFA 5M2QA 3RC9A 5K3FA 1MJNA 1VA4A 2QRQA 1W76A 2XZTA 1DCFA 2PS9A 4Y1GA 1K5HA 3CR8A 1JFLA 3OECA 3QMPA 1G63A 1E8MA 5A5EA 5JDCA 2QP3A 4A6PA 3OI7A 3TOVA 1YZ3A 3GI1A 1MQ8B 1G8JA 4DA4A 1THMA 1TC2A 2GN6A 2I7DA 4R1LA 4LF4B 4XOUA 5BW4A 4EJSB 3KDAA 4R2JA 2W5UA 2XF8A 3N74A 2VQFB 2VLBA 3RWOA 1UC4B 1G3UA 4K9MA 3PRYA 2RCYA 4LRXA 5L3RA 4C01A 2X0FA 5DNYB 3IRUA 1SPXA 2HRCA 2QI9F 3UWMA 1R74A 1Z4KA 1EFRA 2M1ZA 1AQLA 3GT3A 4IIXA 1HE3A 1TA0A 2Q3CA 3O8OA 2K2QB 3PC3A 5TMEA 5JFGA 3LRXA 1HOXA 1ZIDA 2FZWA 1NR1A 3GLVA 5EPUA 3UKOA 3V9PA 3PTZA 1FDSA 1JXOA 3ZKAA 4OYHA 4H27A 1XLUA 4II2A 2PYDA 3FWHA 3M0EA 3TSWA 2QU7A 2HA7A 1YHNA 3EGDB 1JFSA 2W93A 1OI3A 1XQXA 4F38A 1QOQB 1E3WB 2GDZA 5JO9A 4YROA 1EJ2A 2ZLBA 4DHEA 3I6YA 3KR1A 2KB0A 4OM7A 3NG1A 3M6WA 4N7RA 5E4TA 4FE7A 1THTA 4C3ZA 4G4GA 2IIVA 3QYJA 2F9MA 3P52A 4A23A 4CDNA 1RABA 2F1KA 3EPHA 4PFJA 2H6EA 1UKAA 3QWBA 3GQBB 1SBIA 1NJ6A 3E0XA 3H18A 3T0GA 1K6EA 4F8JA 4LE1A 3RRYA 5E2IA 5HX7A 1KY5A 3IAEA 4HN9A 4UM7A 3GVPA 3ZHQA 2VG8A 2PFKA 3I5XA 1Q7RA 3FPJA 1MN6A 1BHJA 1I0LA 4M6WB 3RHZA 4YACA 5KOHB 2P4EA 1AKEA 3CLUD 3NHBA 3PR2B 2H1VA 3V2GA 1NKSA 4F72A 1W59A 3RAPR 5K01A 4EI7A 3A6ZA 5DSZA 3TKLA 4PCUA 3BXZA 4BE4A 3F6EX 2UYCA 3PPIA 1WULS 5E1DA 4HEHA 2QRPA 4QARA 5MN5A 2GI4A 4F4HA 3A4YA 1XYYA 4D9KA 2R6JA 2CCKA 4KGXA 5E6UB 3CSSA 1B0AA 3E5HA 3QELA 3K6RA 1C7IA 4GFDA 4LV8B 5D6OA 4BMSA 4BO2A 4ACBA 2GK7A 5BR1A 1MKYA 3GFFA 4JUCA 4LEIA 1UEJA 2ARKA 2Q45A 4MGEA 5EKXA 5JDIC 3WKCA 1L4UA 2VIIA 4UTNA 2IFTA 1Y8RA 2O06A 4PZPA 4YASA 1OTHA 2PM8A 4U6NA 5KTKA 3DE1X 3EZFA 1FX0A 1YTLA 3FLMA 4LOHA 4BO4A 3E9ZA 4J0EA 4OQMA 3NKFA 4F86A 4M0MA 4J2OA 1KJQA 2ZRQA 1XZMA 3F4BA 2H16A 3KZCA 3OTGA 3VSBA 4TYWA 1W6UA 4MGHA 2GLXA 2I4MA 4DNXA 4CMCA 3WJ1A 3MERA 1JR2A 3MJFA 4EW6A 1EE2A 3PJDA 4WVLA 4ZDJA 1RC1A 3KQNA 1JHAA 4AURA 2H1CA 1SCNE 3ACBA 1OLSA 1JDPA 4G4SO 4G5RA 2Q99A 2JANA 3R0IA 3CUYA 3R3UA 3C6QA 3TZKA 3B70A 4Z53A 1I6WA 4AS3A 5KDDA 2H1LA 4O8CA 4X6UA 4ZQCB 4FILA 1M8PA 4GX1A 5FUVA 1YHZA 4FFVA 1C1XA 3EJWA 1WETA 1X8LA 4XWGA 4Y2GA 5DP1A 1NPYA 2YQ4A 1E2QA 3O2SB 1L3CA 3AX6A 1KDPA 4LC9A 1G8FA 4QBIA 1D1QA 2JCVA 5HVNA 3CLTD 2HF8A 4B3GA 2WJVA 4J0IA 1RKVA 4B3FX 2I7XA 5HA5A 2B1QA 1VLQA 2V0NA 1R0LA 2FPGA 1XRJA 5ICGA 3KKKA 1DFHA 3MLBA 5D1NA 2A4MA 1IJKA 4BNHA 1RQXA 3DB1A 3PGA1 1DXHA 2E85A 3WP0A 2WJ6A 2ZIWB 3L7YA 2FVYA 2GPAA 3WLQA 5B3KA 1U90A 1YT5A 4F4FA 5LP6F 3EVBA 3QFCA 4UMEA 1KDZA 4URFA 1ML4A 2WPDA 3CIOA 1E9CA 5A5VA 4PYOA 4J4HA 1ZY2A 2DFTA 3DE5X 1L7DA 2DKFA 3KT0A 4FYIA 2C97A 4L57A 4UM9D 5EP4A 3M81A 3D1JA 5JEDA 4BJ5A 5F12A 4K86A 3V33A 1Y8CA 4M98A 5L7YA 4NV3A 2Q0SA 1ZAYA 2RHTA 1MPXA 4ZO9A 3K0CC 4H7JA 3RF6A 4CM9D 6PFKA 3DC7A 2ZYWX 4HDRB 2P0EA 4IHJB 3K2BA 2P79A 3MGKA 1D0SA 4F6LA 1PTJA 3WYNA 1Y3DE 1LX7A 1JKMA 2VXBA 1EEHA 2N9UA 2XCIA 3G89A 2B99A 1J07A 4LDNA 4EG0A 4OLAA 1G8HA 2IXBA 3I23A 4P7KA 1BCRB 1XA0A 4H15A 4RL4A 3SIRA 2YMLA 4B09A 5J4HA 3E23A 1I3OA 5DFAA 2GZHA 3GFSA 3JAKA 3CRVA 1EFRD 2BHSA 1SXJC 1C3EA 1CJSA 1G5FA 1U8EA 3PYLA 1OA1A 4DMMA 1XG5A 5JAIA 2NMVA 2JEZA 5J1TB 1KZ4A 2WV7A 3DOCA 4BO3A 4YUZA 2H17A 2ZRMA 5EPOA 2QW1A 1SU7A 1PJCA 4KJXA 1O94A 3K9BA 1JP7A 1EE9A 1FX1A 2NUPB 2HDHA 1BXGA 1JN0A 4YH1A 3MCVA 4W9RA 4RD4A 3EXG2 4GWKA 4MQUA 1VLVA 4KR7A 1KIFA 1Y7TA 1DXOA 4L15A 4M0FA 3A3OA 1O6BA 4S0XA 3TIXB 1RD4A 5B53A 3WRXA 3THXA 3VR4H 2FEWB 1GAEO 4ZOCA 2ZDQA 4XIJA 2I6SA 3UVEA 1QIMA 1NY6A 1IM5A 2Y99A 3Q85A 4HNHA 5ARBA 5LQJA 2D00A 1U0OC 1KAEA 3OZCA 1X0XA 3HU1A 4LC0A 3ORFA 2R66A 4NULA 1JLMA 1I0IA 1KXZA 1VL6A 2W58A 3A1EA 1OZGA 4V3BA 2HLDA 5K0NA 5DN6D 3KQKA 1D8AA 2WP8J 2ZRJA 2JGNA 5BOVA 5CVDA 5L3ZA 5LQDA 1VG9B 1M2GA 3MS7A 4RVCA 3GLFB 1ZKDA 4IV8A 3KB1A 3MPOA 1DIAA 3AUJB 4GR9A 3C1OA 3KWMA 3P27A 1R0CA 3KD2A 2H63A 1JHVA 3CUTA 1WHTB 4K26A 2A9VA 2RHBA 2C1EA 2XMZA 3ORHA 3IUNA 4GUAA 4LXGA 1Y34E 5ERGB 5HIIA 4JJKA 4GXRA 4KN9S 1PWYE 4ZK6A 5AI9A 5C8XA 4A92A 3GWZA 2AI1A 2ZR8A 2BKVA 2WKQA 4F2PA 1O0CA 1UM9B 1RXIA 2B4KA 1D1TA 3E81A 1P0IA 4HH1A 1W19A 5EQTA 1JDJA 2JAXA 5B1YA 5TT0A 2I4OA 2G28A 3GEHA 4F7DA 3EQ2A 2WFZA 4RZHA 5I7WA 4H6WA 3SU8A 4D74A 3HN7A 2FPXA 5KVCA 4RY0A 4WIAA 1FP2A 2V5AA 4NBNA 1RYYA 3GYBA 1NUQA 4PTYA 4OBXA 2G1JA 2R751 2LW7A 3G17A 4MS1B 3PR1A 1ZIYA 4UUNA 2XNCA 4LW8A 3HKEA 2W6PA 1M2OB 3B3QA 3C5WP 3P2KA 4B34A 2V6BA 5FV7A 2QU8A 5FFFA 1UAAA 1J2UA 1NLMA 1M6HA 3BFVA 2WKPA 3HFSA 4BNTA 4CKXA 1Q3TA 2XVXA 1WSBA 3QEBZ 4G1VA 3KOOA 3UN1A 1E1NA 1LNSA 3I1JA 3BCUA 1I6MA 5DHRA 3PXAA 5BNFA 5JADA 1X9GA 1VE6A 3ROEA 3CINA 1CNFA 3WL5A 5DLPA 3CTPA 2PD4A 1QZUA 3VDXA 3W5IA 4O29A 2P75A 2ZW9A 4DS3A 2FX5A 1XEXB 3OHMA 4AJ4A 4RIFA 4NI5A 3AFGA 3NTUA 4FGLA 3JQPA 4E1AA 4OJTA 3T4EA 3C7AA 3F2IA 1BCSA 1TT7A 1O5OA 1KHTA 2XIQA 3GQVA 2Q3JA 4NCHA 5EJ7A 2WWIA 2D8MA 1E7RA 1V37A 1FXSA 4LGVA 2WPDD 3TZEA 1YB1A 5BR4A 5HIJA 5AVKA 2W70A 3VR3A 1NN0A 3I09A 3JQBA 1Y6RA 2TRSB 4Y18A 3U3OA 5GJCA 4FDUA 5B6JA 1ULUA 2R3SA 3BQMB 4X24A 5FTNA 3VZCA 3INRA 3LFUA 1EXVA 3HNRA 4G84A 1E5QA 1QO0A 1TJ5A 4HWTA 2JS7A 2Q5FA 4QYSA 5DW3A 4DVGA 5C7LO 4G5GA 3CSUA 5K8TA 3HCPA 4RESA 1WW8A 1JG7A 3NNSA 1U3GA 3ZV5A 1KO4A 1ABFA 1FMCA 3CNEA 3E7WA 3FBWA 3OZSA 4JBIA 3OZXA 5LDHA 2BGRA 4Q4AB 3COWA 4G36A 4XCVA 2NV6A 1LLFA 1YWGO 3W34A 4Q4JA 3K92A 3FB4A 1T9AA 2O50A 3ANMA 4QUBA 5C5IA 3PTAA 1F5NA 4HYYA 4K03A 2C94A 2EYUA 3I5AA 3BGSA 3SE0A 2WJ3A 4BLTA 1YB2A 5HGXA 3RVKA 2IPAB 3H0KA 3OE1A 4C5BA 1TVKB 2XNHA 3I04M 1IEWA 1F0KA 1ELOA 1UPUA 3RH0A 2VDRB 1E8DA 2MYNA 3ORQA 4QU0A 1EWTA 2ENWA 4MJXA 4NARA 1EVZA 3THWB 3DMTA 3LA8A 2W6ID 3HYLA 3JD3A 2RGNA 3KJEA 4YQZA 1NMYA 5BV2P 4D45A 2GHIA 3OT4A 4GZMA 2CNKA 1O94D 2GCEA 2QUKA 2X41A 3TZCA 2Q3LA 5LQCA 4LNUA 2C4NA 3DCJA 3S28A 4DV1B 3IAS6 2QG6A 3M9WA 5BN5A 4B6RA 4U00A 3I0MA 4WPGA 1DKNA 1F14A 4ISBA 3AV3A 5J40A 4WI1A 1CR1A 2Z2YA 3SWWA 3QY9A 3K1ZA 3FPEA 3CJTA 1GL9B 4RK7A 1M1NA 2ZSEA 4GQBA 5LNK1 4UE6A 2DYKA 3LPMA 4MIKA 2PBFA 4RDXA 3TTWA 4BV2A 5MFPA 4QM7A 4BTEA 2ORIA 1NN3A 2AOUB 4UDNA 1E2GA 4K9DA 3MJTA 3TI9A 4K9QA 3WLEA 1HLGA 4IDGA 3KVRA 2OAEA 4PYLA 2IU6A 4OFXA 2G0AA 4LJRA 3TTYA 4JBLA 3NAZA 1S2IA 4TLLB 2J87A 3OLVA 4XQGA 5DLYA 2FDXA 1K5DA 1SCIA 2OHVA 3L8YA 3OM9A 1YZUA 4KYVA 4XM1A 4MRRA 4CL8A 2NSHA 5HYVA 5TMPA 5F1PA 2HMVA 3T35A 1WUIS 1YZKA 3HGTA 4JVLA 4K6FA 5FEUA 4K6MA 2FZ4A 2NTNA 4MYCA 3G2IA 2H7CA 5F9MA 3AEYA 3AOEC 3TEFA 1QDUA 3RVBA 5CYGA 2NYUA 4IHJF 4NEQA 1TL7C 5CM8B 4Z99A 4FMBB 3ZCUA 1ZK1A 2CEKA 2CFOA 3KAPA 3RFFA 3O92A 4UXIA 3ED5A 4N41A 1HE4A 2ERYA 4IM7A 4TXMA 3O1IC 5J1SB 2AUMA 4R3NA 1PGNA 2J9ZB 5HOEA 1U2GC 2BM0A 2JJ2A 1SZJG 2G82A 2OAGA 6AT1A 3OCCA 5LKRA 2CLDX 3ESYA 1CJBA 1LF0A 4M0LA 4LPSA 4TWBA 1TYEB 4AKEA 3K1AB 3TO5A 3BZUA 4BFZA 3G59A 3OETA 2FKNA 2RK4A 4N7JA 3BXEA 3TE7A 4RVHA 2V45A 4JWKA 1W2GA 4D4KA 2SNIE 1JYEA 2ZIVB 3FG9A 1HG1A 1RWOA 4QLBA 2R5WA 2N46A 3WTBA 4J75A 4MEAA 5KHAA 3AEQB 5F78A 2AEEA 1G42A 1QG2A 2NO9A 5MFZA 5J2UA 3MVEA 4JITA 5JNTA 2VNIA 5JRZA 4ZVRA 4OB6A 2ZREA 2ZJ0A 3LCCA 4DQUA 4XDYA 1U2RA 3QLVA 4JBXA 4K6GA 3PIRA 3L4BC 4RD1A 1D2NA 1HY3A 3DZJA 4NZ9A 4Z9XA 4RVNA 2VEOA 1VBNA 3WGUA 2AMVA 3OEHA 4BQIA 1I2BA 2DSTA 2HHJA 4F2DA 2AQIA 3DVAA 4AULA 3R9KA 5BNWA 2NQ2C 2NTJA 3Q2OA 4OFBA 1XVTA 3BWEA 3IEMA 4E09A 4HX9A 3ER9A 3CLRD 5EHIA 4WZBB 6ABPA 5IAAA 4UAUA 1C0LA 4BRUA 2IH2A 3JATA 4TMWA 5F9HA 4V0RA 3VR3D 1DINA 3EDOA 2NNWB 4MDEA 3S1AB 3V7FA 1P81A 3RS8A 1T8SA 3EQZA 2O2YA 1QO0D 3JD1A 4NYJQ 2H48A 4ZZ0A 2XCRB 2EARA 3JASA 4EG6A 1K7XB 4EY6A 2P4SA 5F1YA 2X3YA 3V00A 3FFBA 3FVVA 1QQ5A 3NT5A 1SCUA 1G8YA 3S55A 4OU4A 4EENA 3EZ7A 3P2JA 2EW2A 3SHWA 3VNQA 3CC8A 3VVMA 4A0RA 2PSJA 2H1RA 2OQ2A 1E4EA 4HSGA 3GFGA 4B6QA 3FRHA 1UWKA 3GIDA 4D9IA 1R12A 4MUIA 1NMEA 4DMFA 1NSTA 5LIPA 3QKIA 3DLCA 2BFBB 1NAHA 2R25B 1UOEA 5IABA 1W9HA 4OHYA 1DCTA 1KZ6A 3A9WA 2GKGA 4RTKA 1FFHA 1U28A 3BXGA 1Z7YA 2P9JA 3AI3A 3G2PA 2H06A 1M6EX 4PLTA 4S2EA 4URUR 5T4FA 1TQ8A 2QSZA 3IRVA 1SBZA 3KFXA 5DEIA 2ZWPA 3EFHA 4FLMA 3CLVA 1NW8A 4HVTA 5CM2Z 3VI4B 4D6PA 1J2EA 3G1UA 2XKKA 4RU1A 2HJRA 3VXKA 4IPTA 1T6XA 4PO1A 1GR1A 1YUBA 2XUFA 2V5UA 2YHSA 3GJXC 2QVYX 4IJ6A 2GBLA 2NOAA 4L6IA 4L8VA 2F55A 1AGXA 4DZTA 4WN9A 1UF9A 4UAJA 1R88A 2AEJA 4GG1A 4UE3S 1GZ5A 2A0UA 5AIAA 4BB9A 4OHUA 4F46A 2B69A 3ZJVA 3HSYA 3IOBA 3JRWA 3TSOA 4U2FA 3B2QA 3NTLA 1Q3KA 2YJZA 4GLJA 3E9MA 5EP2A 2EFCB 4UAGA 2B3DA 2V6FA 4DCUA 2A33A 1CDDA 1YRYE 3V8EA 1WABA 2AVNA 4WNYA 4BQFA 2MINA 2R1TB 1XLTC 2GBGA 5HUQA 3S8EA 4G1EB 5E4YA 2FJPA 3H87A 3EFOB 1IEVA 1GAJA 2XYGA 2Q3BA 2RG1A 2PU5A 2ZRHA 4D9NA 1RXYA 2OO5C 1ZR2A 3O2NA 4ARCA 5FLKA 1ZI9A 3B36A 3S2IA 4MQMA 5CLGA 1BO6A 2QRKA 4EKNB 1GZ7A 2R7KA 2I33A 2PLAA 1BMQA 2Q7XA 1CW2B 3D54D 4M1YA 4CLOA 2F8TA 2C20A 2ILVA 2F48A 3OJXA 1G8GA 3JQAB 1CUFA 1DLJA 2GRJA 5JU6A 3KOMA 1HDCA 3KEOA 3FWYA 4K6OA 2BUBA 2YL2A 2H3EA 3ELBA 2F3TA 2PUEA 4QPJC 4PXSA 4P6VF 2B8TA 4PSAA 4DAOA 1KTIA 2JBHA 3JWIA 4Q00A 1JLLB 1XGKA 4QT0A 5EERA 2JJ2D 3WLLA 1WB5A 3CPEA 4DPKA 1B42A 3E9RA 1T26A 2IE0A 5AQEA 1RI1A 5TF0A 2OK7A 4CFZA 3FGNA 3FVRA 4WKGA 5JARA 4JT2A 3ITDA 2NN3C 1RMYA 3JAWA 1L1EA 5ITSA 4B6GA 4F4DA 4J90A 3OF3A 1JQAA 4H6XA 3NOOA 1U7WA 2PZEA 3TLJA 2OHJA 4PZDA 4LJLA 1U0HC 1TEXA 4M36A 4C05A 2QTHA 3WP1B 1Z68A 4B84A 5A5FA 3QX7A 2ECFA 3G2QA 1YJXA 2FSSA 3PWTA 1RMTA 2O2SA 4EPWA 1ZJZA 5EKUA 3GFTA 3IT0A 4BFYA 1C80A 1NJ1A 2PSHA 2QUIA 1I9GA 3EXG1 1Z16A 3UFXB 2X7JA 2B9VA 4BMYA 1YMVA 2P0YA 4CCYB 4JI8B 2QQ0A 4TZ0A 5KNDH 5KYWB 5JTTA 1TKCA 2QX7A 1T2AA 1GPH1 2YZMA 4C14A 4UHDA 1JALA 2O14A 3FMPB 5LQSA 4YWJA 1OWMA 5DHAA 3OEHD 4ER3A 5KX5A 3WB2A 5K8UA 2ZJBA 1E92A 5ER6A 4C87A 1VB3A 2NLOA 1V2HE 3OX2A 4DKXA 4JIGA 4BP1A 5LJIA 1GUFA 1G9XA 1OILA 2JFBA 3SNKA 5BN4A 2ZB2A 4FR5A 4RKWA 3NRJA 3K8YA 5ALQA 4ZT2A 3SE7A 5ECWA 2IBSA 2OCPA 3AUKA 3L2OB 1KKLA 3UMRA 4TL7A 4B7XA 2CD7A 2TMYA 4RY8A 2AOTB 4MW0A 4V03A 2QM0A 3V6LA 4COOA 5F51A 4V1CA 4C0QC 4BEVA 3UBTA 1NASA 4BZZA 4C5AA 1C8BA 1O89A 2QPOA 3PHBE 1PR3A 4RHCA 3UWOA 1YF3A 3OJ0A 3KSZO 1AKRA 4HEJA 3OP1A 4AP9A 1FTWA 4D26A 2AI3A 5FJIA 4A2PA 3P0FA 2H65A 1GGHA 2C83A 4D9HA 2YXEA 4ZCSA 3GUUA 1MENA 3K32A 4TWRA 4EBBA 2WIFA 5GVSA 1U7DA 5FUBA 1JDBB 1SG9A 1Q3HA 1TAGA 1N2IA 2OZKA 3D59A 2OO3A 3NRCA 2Q4RA 3EEOA 3KEGA 3TNYA 2M2IA 3QE2A 3OQVA 4GUDA 3RYCA 1SY7A 2FDCA 2X8LA 2YJ3A 2AJBA 4KO8A 4Y67A 4UOZA 4UATA 2NQ8A 3CW2A 3L7CA 5E8JA 4U9UA 2BP7B 5ALSA 1KPHA 3ORSA 1TB4A 4P7GA 1QQAA 3IOMA 5JPCA 3BVPA 4LJKA 4BLOA 4FHFA 4J2HA 3W1EA 5K0CA 4OHMA 2VRWA 4W5JA 3R4CA 1A8QA 5C8YB 1FP6A 3WGYA 1S2LA 3WBJA 4BPBA 1KEEB 2J48A 1JR3E 3TW8B 3WQBA 2UXCB 1CUGA 4KQ2A 5HF8A 3RC2A 4D81A 4BDSA 1S8NA 2GN8A 3GRRA 4TTIA 1O0BA 3AHEA 4GPBA 3LQQA 3TLEA 4F04A 1FYFA 1E8NA 2PAFA 5BUCA 3TOXA 1DV1A 4R9NA 2WE7A 1C30A 2H4HA 3HI4A 2FOIA 1RBMA 5HKKA 1YCDA 2OGTA 1DV2A 3S27A 4LYJA 3T5GA 1NBME 4G8CA 1X7YB 4PGFA 4RZ2A 3CTMA 3K0AB 2FWJA 4A8JA 3HABA 4RD2A 5IWCA 1QAMA 2IZ1A 1Q7EA 1UFKA 1TZBA 2O8VA 1KKMA 1R00A 3D81A 3GZNB 1HUQA 3DDZX 1II9A 3KT6A 3NBKA 4AG5A 2ZM6B 1A69A 1SUCA 1N4DA 3HB4X 2Z8ZA 2IWHA 1P7WA 3OD1A 1ULHA 1PT6A 4QRDA 4ZD6A 4RZ3A 4HYTA 1E9RA 1EGMB 1I4WA 1XWWA 2NV0A 4RADA 4YYEA 1JB1A 4RD0A 4JI3B 1PHRA 4MVJM 5KWJA 2R5FA 2AJCA 2ENUA 1X8JA 3PUJA 2MWMA 4K3UA 1SXJE 2BRUA 3RUIA 4N47A 3MW8A 4NIMA 1JNXX 3OWXA 3RKRA 3MT9A 3CJQA 1XMIA 5E2BA 2BEVA 3N0VA 5FXMA 1DI0A 1WLSA 5CT9A 1M3SA 3QE3A 2VK4A 5EKSA 3LQYA 4N18A 2ZRIA 1SVNA 3ZQJA 1WBBA 3QVLA 2OGWA 1FDVA 2C7BA 4PG5A 1R4ZA 3V4ZA 3EDRA 5IKOA 4BNLA 2HHCA 1XKLA 1ODTC 2IYLD 4OAPA 2KQUA 1YOBA 2QX9A 1HDEA 2QZ9A 2XUHA 2JJYA 1U5BB 3K73O 5IAEA 1J90A 2ZUTA 3G8CA 1P1KA 2CXNA 4Q1CA 3RHTA 1QAOA 2RHJA 4G5HA 4WXYB 4F9EA 2UVDA 4Y1FA 1SVMA 2F2TA 4WKPA 3I34X 3TZBA 2CYCA 5EJMA 1TEVA 3V8RA 2E5LB 1AXRA 1FUUA 1ZGJA 3I9LA 2A84A 1SG0A 2HWKA 2Q6IA 5T57A 1ADBA 2H4XA 5IAOA 3AFOA 1V95A 2A1UB 3HWSA 3IOEA 2A9OA 3LHSA 1B26A 3NC4A 4I4LA 3GRZA 3AQ4A 2BGNA 1W30A 2MSDB 1Z5UA 4LHVA 4A03A 1JVNA 2AFRA 2GK4A 3A9RA 4NK5A 5KU7A 2WW8A 3F3MA 3QMMA 5AJYA 3STTA 1RWBA 2GCOB 2EQAA 5G4KB 2XE4A 1K2WA 1PS8A 3KQWA 4B48A 2ZIFA 3N2ZB 1ZH6A 3QKSB 5GM1A 1V6CA 1UQRA 7MHTA 2R85A 3KOUA 1K66A 4BMDA 4TSFA 3KETA 3TX2A 1NDHA 2JH8A 4IJUA 4CEJA 2WQ6A 3DDHA 3DVLA 4ENRA 3F3KA 1VE9A 4YJGA 1H22A 3U56A 2JD0A 4D9GA 2BEUB 3UCFA 1Q57A 3S5UA 2VTBA 4F4UA 2D1YA 1EZZA 4MUEA 3X1DA 5D6NA 1V4NA 4A0SA 2YX1A 1US8B 3LWDA 2XGMA 3PDWA 1JA1A 3HCFA 3PXEA 2YHBA 4FX2A 2JZNA 3FKQA 1A2QA 2C7GA 4PX9A 4WTOA 1AHIA 4AO7A 3K9FC 1IWOA 1GRRA 3M9XA 3SZOA 1SCBA 3QPAA 2AW3A 1T6ZA 3R0XA 3FIUA 2R2GA 1N5MA 4D56A 3IDFA 2BLNA 2RBKA 2PGLA 1VHTA 1WXGA 1Z4IA 4MQ4A 3G0OA 5FBRB 3VYTB 4Y3UA 1IZYA 4AT1A 4GPAA 3ZDDA 1ZUWA 4ZCLA 3BS4A 3C5EA 5JNUA 3IP8A 5FCDA 2CVPA 1KSGA 1V1MB 1ADGA 4A0QA 2HSGA 1N6KA 4H18A 4JL6A 2PKYX 3GRVA 2JFVA 5CPFA 2JLXA 1DJOA 2GVZC 2SECE 3LH5A 1C0KA 4PZ9A 1WHSB 4KWIA 4FC6A 4TV8B 3SX2A 1GNPA 4P58A 2OKGA 1TM1E 3KQVA 3CH5A 4OUDB 3KLMX 3RRNA 3R74A 2JFZA 2H5IA 5HUHA 4HDMA 2WZBA 3FFAA 1PV2A 1RPNA 3DBRA 1CUAA 2ZUVA 3P9XA 1I33A 1KI4A 3HCBA 1F0NA 2OHFA 2VZLA 2YWHA 2ODEA 1IONA 4L8FA 1EP2B 1S3SA 3F6PA 5TVGA 2VF2A 1CBUA 2R44A 2M9MA 4YT4A 2PEYA 1K7FB 5DBOA 1SRRA 4I66A 2J46A 4N39A 4R5HA 4EHFA 1NW4A 1ADJA 1J5XA 1KVSA 5DNEA 3GVIA 3R5HA 3JQ6A 3KRTA 4DIFA 1QPZA 1G6HA 1DL5A 4RTRA 1C1DA 1P0MA 4JMPA 4L02A 3BD9A 3GUZA 2VHUA 4Z4GA 1IDOA 1LS6A 3ETJA 3PHLA 1T3SA 2PJUA 3L1HA 5GJVC 5TIIA 4UHKA 5CCBA 4MQLA 1ENOA 1NSFA 1Y33E 5A05A 4ER6A 3PK0A 1Y6GA 1JSCA 3NDIA 1SXHA 4UXHA 2AYZA 2WILA 2ZAOA 3FPFA 4WLVA 1UOQA 4B35A 5JCPA 2FP4A 3HCOA 1YJQA 1Y4AE 1KRWA 3RYIB 1OBVA 2GF0A 2ES4A 2PRYA 5KOYA 4MB6A 4U7FA 3R23A 2QQ5A 5D5HA 4AQDA 4F84A 3TZ6A 5AFSA 1NI5A 4RGQA 2VP3A 2I2XB 4P98A 4NZYA 3ETDA 3JARB 1VDMA 2BKLA 2KPOA 3HCDA 3KU1A 1XN4A 1KRXA 3NT2A 4YMTA 2GUGA 1EX7A 3KZKA 1UJ2A 4I55B 5BRNA 1XTQA 5JWOA 4XWWA 3I01A 1K08A 1KOLA 5HTOA 3X1JA 2AX3A 2PE5A 1E3TA 1B6SA 4EB6B 1SHLA 1O96A 1F2UA 4FGJA 3S1LA 1ADFA 2VP4A 2PUCA 4MR9A 3ZWVA 5HR5A 1VKNA 4X62B 1ZMOA 3I2YX 3KCNA 5C8YF 3IHWA 1QHYA 3SR0A 3TG2A 1RLUA 1T15A 1KZ1A 2YIVX 1XTTA 1OLOA 3A36A 3MUEA 2B82A 2GCGA 3EEIA 5ALUA 5JD3A 5LKAA 3UWDA 5E3HA 5FHRA 3ZCVA 1FXUA 3FFTA 1FE8A 1HWYA 1ZFNA 4PGAA 3IVXA 2JNWA 2QX6A 2C9YA 3PU6A 1EK0A 1PJBA 3ILVA 4S35A 3ZE6A 4D0RA 3EPRA 4E5UA 4HFMA 1Q16A 4LF8B 4XUEA 3U19A 4EO4A 2BBWA 5F1OA 4AVYA 3D3QA 3U16A 3ZXXA 1SVIA 2ISCA 3PUWA 5TS3A 2FSFA 1CYDA 2XRFA 2YVQA 2VHWA 4L51A 4QO8A 3TB4A 5FV4A 2BZGA 5CLLA 1KYXA 4FIZA 4F4IA 4TSFD 5K0GA 3KV1A 2Z6AA 1XZHA 1NURA 3V97A 3I1FA 5AJXA 2XQVA 4OP2A 1TXGA 3DE2X 4BV8A 4UNRA 4US1R 3PD7A 5GOZA 4M21A 2PJZA 4RK6A 3C43A 1R3UA 1WR8A 5J5CA 2YZGA 3OTIA 4YP7A 1FJGB 3I9OA 4ZICA 1B0UA 3FZQA 1YH3A 1P44A 2X1HA 3C2QA 4M9UA 3EF0A 4PSKA 3N58A 3IVGA 4BATA 1YR8A 4X45A 4RZXA 1DAFA 1F2TA 1TIBA 4KLRA 1B73A 2E4ZA 1T9GR 3K9GA 3MK31 3O4JA 2PV7A 4ZI7A 3LC2O 4EGCB 3GYGA 1BFUA 4PBRA 4BTLA 1EGHA 4GWLA 5ALJA 3E8MA 5F4ZA 3C14C 4X61A 4F3CA 1VI6A 3F6YA 1AK1A 1Q95A 2BJHA 3KR0A 2PZBA 2IZ5A 2G4VA 5LBTA 4JBYA 2B30A 3RHFA 2OC4A 3D4PA 1AGPA 3ZW9A 3KQTA 2ZSJA 4WZAE 3RR2A 3L06A 1VHQA 1KL7A 2FYTA 4IJQA 5MN6A 1U02A 2J7PA 2NAPA 2Y0PA 4PRLA 1JVBA 1EA7A 2HBQA 2WIAA 4PZUA 3NALA 3FUUA 3HDHA 1HFEL 5LA6A 4FKBA 5J47A 4GPTA 3WYAA 1EI9A 2GASA 4PFKA 4DCJA 1U9JA 3N0RA 5HBRA 3FAKA 1C3OA 5CVVA 4YCBA 2GM4A 1M2WA 3G9TA 4DLWA 4ITUA 2O0HA 4MQBA 1G3QA 4O2BA 1JQDA 4IYRA 5FLEX 3V55A 4M83A 3CCFA 3OMWA 4RPKA 3R3XA 3RUAA 2WAXA 3I2GA 3QVOA 1PR2A 3TFQA 2YCBA 4YLEA 4LWQA 4BO0A 3IHKA 3NC1C 2CVOA 4GSLA 3GJSA 1A8HA 4I46A 4EHNA 5G0UA 2RMKA 5E9JA 4MINA 4JX8A 3K0FB 2GB4A 4M0UA 1K8YB 4BQQA 5J4YA 4R31A 3K0HA 5D5PA 2G70A 3QX9A 2VJYA 1YNOA 2P4HX 5ALMA 1Y5NA 4Y0VA 4WJZA 3HLTA 4LRQA 4RJ2A 1CSEE 1VSQA 1XRSB 2JGDA 3AF2A 1JIXA 2H3HA 5KWSA 4D80A 4WCFA 5BPHA 3WFIA 2FPSA 3H7AA 5HJ7A 3EIXA 5CVCA 4Z3DA 3W5AA 3S68A 2A5FA 3OIYA 5A4FS 1ZVQA 1QE3A 2LR0A 1TNDA 1FJHA 3FAZA 1FNDA 3SQMA 1KZYC 2ZYGA 3AKZA 2QP4A 2UZ1B 3MMNA 3DL0A 1DWUA 3ILYA 5JJCA 1S3FA 2CW5A 1U6KA 2PV0A 4XLZA 1YQUA 3SDZA 2FFQA 1IULA 3FHOA 3I6BA 3SVLA 4KO3S 3IEVA 1GCUA 4LBZA 3FR7A 3KP1A 4UVIA 3HBLA 3KSAC 4MIOA 3FWNA 4L2IA 2AR0A 4EUNA 2OZPA 3JYHA 3FIJA 2GZAA 5AK3A 4EO7A 1NN5A 2ONKA 1GG8A 3F8TA 4JUAA 3D02A 1L7EA 2SKCA 3JRNA 1II8B 1NJSA 2XBLA 4IF6A 2PZGA 5AI5A 1WD5A 2KX7A 1JJIA 3IUBA 4DANA 4MVJI 4ARZB 5IFLA 4ILEA 4TMKA 2HT6A 1FLNA 4HQNA 4X1YA 4FOLA 2V96A 1ZK4A 3LLMA 4M86A 4YNBA 4B0OA 1HYBA 5E1BA 1NPDA 3CZQA 1ORDA 3BFKA 4MW4A 2G4CA 1ZD2P 4TV8F 4X20A 3P19A 5T4EA 4H3VA 4AMBA 1QC5B 2X4DA 2GF9A 4DV4B 3B60A 3ELWA 3K6JA 4JZYA 1UK9A 1P9RA 4MYUA 2QN1A 3N53A 4XJTA 1AF4A 4I2VA 4NJOA 4W1PA 3SOPA 1L4NA 4WK6A 2QAGB 4EOGA 3C3BA 3V1NA 2LCFA 4GLOA 1H1DA 3UG7A 3QPUA 3OQHA 4Y1EA 5A7HA 3X43A 1RXWA 4BLRA 4E94A 1PTKA 2IHUA 1VOTA 4ZKEA 1E0JA 2IYEA 1ZEMA 4ENPA 1Q0RA 3EQ9A 2KBFA 3AIMA 3X2EA 1LB1B 3WMEA 3AUXA 3QE4A 1WIWA 4Q3EA 3G5AA 4F85A 2ZM5A 3U9TA 1BKSB 3K4QA 1Z2NX 3FM9A 1SCQA 3B6JA 5IS2A 3H9JA 2ZDGA 4FKMA 1ZKMA 4N9WA 1V26A 5TRTA 1VIDA 3ELDA 3HUDA 1RSZA 2A2ZA 2O2CA 3IA2A 1K88A 1NV8A 2XR1A 3KR2A 5TGZA 1QIGA 4AX4A 3L0BA 2V6JA 4KK3A 3VNSA 1EAMA 3NONA 5KEIA 2CV0A 3Q8XB 5AICA 2VYVA 3LRPA 4ETMA 5E8RA 5GZ3A 5LYJB 3HCNA 4KE6A 4ONEA 2O2ZA 2OFOA 5IEJA 5EVJA 4DIKA 4MW1A 1SCAA 3DMFA 1Y82A 4KR0A 4P32A 4W6ZA 1Z63A 5DX8A 1RWWA 4IWXA 3D5QA 3HN6A 3DA8A 2H4WA 4U2EA 4UZSA 2R6DA 2XTMA 4IMPA 5HK9A 3E5RA 1VL8A 1A76A 1BNCA 1Z4PX 2A86A 3HCAA 3R6WA 5K3FB 2HR1A 1F8UA 2ZVPX 2DG2A 3S2SA 5JFOA 2NTYC 1J33A 3R3YA 3SOZA 2MR5A 4I55F 1C0PA 2OGZA 4U2KA 4OFWA 3E35A 5HJ2A 1PJ8A 1GSAA 4YK7A 5DPMA 3QW4B 4FOSA 4P5PA 4QVIA 1VJRA 3IIKA 3O0TA 2GJ9A 3W78A 2IZOA 1T9KA 4HAUA 3ZI7A 3E6AA 4EW2A 2J7PD 3C24A 4EFKA 4JI1B 4C3UA 4LXTA 1B8OA 2B4RO 1XZ8A 1R0RE 1ITZA 3SVTA 1A9QA 1WTCA 3VYSB 3ZG6A 5KWIA 3O8OB 3ROQA 4BBJA 3SF0A 1L1QA 1RBZA 3WLTA 3RW9A 5JH7A 5IVHA 2H57A 2BKEA 3VKWA 4C4AA 2XITA 4YUWA 2QI9C 4NEGA 3GEBA 1C9MA 4YV0A 2A5JA 3CB4A 2UUBB 3NIBA 1DEOA 1JYFA 2ZK7A 3Q5EA 3Q87B 4IOLA 4LOLA 4MITA 1ZLXA 4Q9LA 3WG9A 4DG9A 4YCMA 4DUPA 1U3CA 4H59A 4B5LA 1E4VA 3K16A 5FPPA 1AIPA 3UMFA 3GLHE 1Z7BA 2RH4A 3G2NA 1QM5A 2A59A 4WJKB 5FF9A 5EMLA 1YASA 3V9AA 1G8SA 3VVCA 3D6VA 4AWXA 3EPPA 4F12A 2Q1UA 2DHEA 2QUAA 1NZJA 1TJ3A 3BH7A 3GAZA 5FNZA 1HFJA 4JLNA 3UHAA 4MWCA 2L18A 4D79A 3MWEA 1AHPA 1FFWA 1DWOA 1U3WA 5JD4A 4KBFA 4DA0A 3A9VA 4L8WB 2R7LA 3M1YA 2IUTA 4FBLA 5HRCA 1IOZA 2B5WA 1XJ0A 4V0LA 4UOQA 3AG5A 4CQMA 3O4FA 1RWXA 5DNCA 4CGZA 1FFYA 6LDHA 1KK0A 3SY8A 3FTFA 4RQAA 4ZOEA 2GJKA 2V7TA 5AKEA 2FK8A 2O8DA 3HU2A 3QELB 2GK6A 4PVDA 4ARBA 4ARVA 1KMNA 3NTQA 3EVNA 3PQ4A 4Y2PA 1EX9A 4XIYA 4B0PA 4G2TA 2WAOA 4KPFC 4BXOA 2DF8A 3NJRA 1LPNA 2C98A 5KMGA 4FHGA 2LGJA 2BFDA 2QN8A 1FNSA 1Y8RB 4ASUD 4BYMA 3I5MA 2H8GA 1FX0B 1LTQA 4GX0A 5C0OE 3OM8A 3VU8A 3VVLA 4CIVA 4F8YA 2ORYA 2BMFA 1MZPA 3ZXIA 3Q8LA 1JV2B 3GVHA 1NATA 3CQ9A 4MJLA 1TYCA 2IYTA 4DSZA 4BOYA 3M33A 2NQTA 4PW0A 5AJVB 3MRSA 3ANSA 3KQOA 3NAGA 1TT5A 1ZGZA 2O6HA 3BK1A 4DJEC 3V7WA 5ADWA 3KQLA 4LJYA 1ORTA 5D3KA 1QRUA 1OLSB 4C4YA 2YV3A 5KNBA 5ESXA 1OFUA 2CFRA 1F4LA 5LZ5A 4EGQA 5AM3A 1OE0A 3L4EA 3WAJA 2H59A 3LXXA 5D01A 2QUBA 5BWNA 4BASA 3CX3A 4B6OA 1OXMA 1JXAA 3I42A 2MSWA 1AZLA 4ER7A 4F1JA 4BVJA 2ZTUA 1V25A 3M4XA 1XALA 5D7NA 4E5NA 2ZS8A 1IOWA 4LGMA 1EKXA 4IP0A 4LFCB 5BMVA 1RYMA 2PMDA 3HGMA 3GDFA 4FD3A 3GGCA 5BSRA 1NMQA 2WT8A 2FPGB 4UU0A 4Q3OA 2BPOA 2YDYA 1WSDA 5JJIA 3Q6NA 1GSIA 1F1BA 4MUHA 2FMTA 5TJ9A 2CY0A 2OM2A 1DQNA 1EXMA 2Y1WA 3Q7SA 4AMVA 1VCNA 3OC0A 1E61A 2IQ5A 4G25A 4FNGA 3AJRA 2ZCUA 2G1PA 2I8LA 2JRLA 5K0JA 4G1BA 1RJDA 1D1PA 3CBGA 4TQAA 4UUQA 2C00A 4Y30A 4IX9A 3HA7A 3C1TA 3GLTA 3IE2A 1IY0A 1NX9A 4TXHA 1JFRA 1W94A 4JLOA 5EL0A 5LP6C 4TLMB 5AM2A 1JTEA 1XZEA 2CXUA 4MKZA 5IFKA 2HX1A 1RACA 3QFRA 3IVAA 4M22A 1CUIA 4IHQA 3O8CA 1KJYA 4QYIA 2WMDA 1ZN7A 4CQNA 1KYVA 1G291 1NNUA 4FSDA 1XNQB 1L3BA 2OLJA 4I6JA 2RGEA 1UMDA 2UYGA 3UQYS 3V4RA 1U1IA 1K5PA 1X77A 3CKLA 4JJ6A 2IHBA 2PUWA 3OOYA 3UOWA 4H3HB 1A7KA 1FTNA 1PZHA 4QTTB 5F5NA 4NXNB 5CLQA 4QBFA 2IOFK 1LJLA 2QZJA 3AU8A 3EAFA 4X8HA 1TJNA 1CF2O 1QV9A 5FHQA 4C9BA 2ZSDA 1LI5A 4Z54A 3U7HB 1SQGA 3JAKB 4TQGA 3E27A 2C5FA 3GMSA 5ETJA 2D1TA 4Y7CA 1D5WA 3B2NA 3BM5A 1XF1A 4BVBA 2X5XA 2A88A 1F17A 3L3BA 3MFQA 3YASA 4H7FA 1RP1A 1GPDG 1DC7A 3G1WA 3KK0A 4QOHA 4KW7A 4M9QA 5FPTA 2AFHB 1YL6A 2K5UA 3BAZA 3KHUA 4HLCA 3U3XA 2JRCA 5AQ1A 6CHYA 1H9CA 1BXGB 4B4VA 1S7CA 3HCCA 4CT5A 2R8RA 3OJFA 4QXAA 4X3CA 5HIKA 3W7BA 1MVOA 5BV7A 5AVSA 1IZ9A 2QTNA 2RGUA 1E3EA 3O2QB 4ZVUA 4G67A 3U1TA 4HH3C 4XWAA 5KSPA 2QSUA 3WFJA 4O0LA 4C08A 2EZ8A 1C9YA 1Y4SA 4LTNA 1U9ZA 2QEQA 2QOEA 4B7AA 3BTVA 4D44A 3C6BA 3R0QA 2QS9A 4WDQA 1F8YA 5DYTA 3H05A 3EXAA 3UT5A 4XGKA 4JC5A 1W5BA 3P4YA 4OI4A 4CM1A 3RB8A 1JRLA 4J0QA 4O2RA 3HDQA 4GSYA 4MVXA 3FTPA 3QUTA 4EPXA 4DCTA 1R15A 1DT5A 5LYJF 1WMDA 1E1CA 1HDXA 1M76A 1QFSA 2E4WA 4K87A 4MPDA 4C2TA 4UDOA 4PLZA 3NH6A 3G0HA 3FZEA 4RO0A 1RJEA 1RR6A 3V4FA 1J8VA 4D0GA 2XB9A 4CQMD 2Y6UA 2P4UA 1WDMA 2X77A 4Y6RA 2HHAA 2QR2A 1KQFA 2GD2A 4EB8A 1ANKA 1ZRSA 2D3TA 2XBUA 4MQEA 4PM4A 3TD6A 5LLDA 2P6NA 4FONA 4L4UA 4OHVA 2E37A 2CZCA 3PGJA 4D41A 5CFMA 2GM5A 1IAQA 3IAHA 3E9CA 1P61B 3QU4A 5FFMA 3FOCA 1DJPA 3BD8A 2QM8A 2LDBA 1HDIA 2YJNA 4ZXPA 3JPYA 1VHLA 1BW9B 2Q4DA 4A8HA 5HHTA 1KH1A 2BLLA 4HAYA 1TZCA 2UUOA 5CR9A 4ARSA 1GRVA 3PFIA 1BE0A 2R11A 1GFSA 2BR5A 5G53C 3GAMA 4BLWA 1GDDA 4OI1A 5AVVA 1BOOA 1DAPA 1Z28A 3J81A 2C5GA 4BZQA 4ZTUB 2GTHA 3I9NA 1K6JA 4RUKA 2GN4A 3B9PA 3GV0A 3M1IA 3QE0A 4G4JA 2Z8YA 4WKNA 5DN9A 4ZAVA 2XUIA 1TK3A 4BFSA 4BFTA 1AV6A 4CUKA 4E03A 3E8SA 4N5LA 4UBJA 5FTJA 5ER9A 1R16A 3HKEB 4EJSC 2ERCA 1F20A 3TIFA 1MAUA 1Z6GA 5KNBD 3BOSA 1EP3B 1NR5A 2BZ1A 4NECA 1AQNA 2ZBFA 2ETVA 1QANA 4QQKA 1KU0A 2AMYA 2DR3A 3P5SA 3ZIDA 1JF8A 2PIDA 1QNFA 2YHUA 4Q15A 1HYHA 2LKDA 1E2KA 2CVHA 1LLDA 1NOJA 3B6MA 3FOEC 2GTPA 3RBVA 5CX4A 3TOSA 3EWIA 4EG8A 1C9NA 1VPVA 1G55A 1A9SA 2JC3A 4XRGA 2ATVA 3MB5A 4I9UA 4B8YA 1AMOA 4MWDA 2I6QA 3DONA 4IEEA 1OPRA 4FFBA 3VZBA 1T4CB 3M34A 4KODA 1T1EA 2NU8A 2Q3FA 1V6AA 1BCSB 2FG7C 1NXOA 4BMCA 2BI4A 3EFEA 1A0OA 2NVBA 4IEIA 1AV7A 2A57A 3OQMA 3OSUA 2ODNA 1Z0JA 3ZVLA 3TNJA 1CJMA 1BFKA 1FFCA 1MIOB 2CXXA 5FUQA 1NW7A 3IIEA 1MGPA 1ZGCA 3H1FA 1P62B 1G1MA 4P7JA 3WADA 3SYRA 3LPNA 5DXFA 1CD5A 3IX7A 3QOXA 4Y98A 2AZDA 1AUOA 1H65A 1I7NA 1OXTA 2WUGA 4L95C 4M1EA 2PX0A 4AO8A 5AVYA 2BH2A 2FPLA 5EHGA 1GL3A 3WFZA 4ZQEA 3VOTA 4AJJA 5IMSA 4X9XA 5T64A 1E2UA 3ESQA 4I9GA 3DBIA 3A3YA 1Z6AA 4KRYA 1U0GA 4C0AC 5T6BA 1PQYA 1QIHA 4JJ8A 2ZJAA 1DAKA 1D9XA 1W581 2P30A 1YR7A 4Q4JB 2Q5OA 1L8OA 4EA8A 2E0IA 2IUFA 4PQEA 1FTGA 5K7SA 3T7IA 2R8ZA 4BLSA 3TG8A 3ZCSA 2W2QA 1H42A 4O08A 4Y6QA 4B3HA 1EIWA 1X94A 3VNUA 1DXYA 1L5VA 5I9BA 4KIGA 1RRVA 2KLHA 1A04A 1H6AA 3NBQA 4IUYA 4JN6B 3GXBA 3K0SA 3ZDBA 3U7QA 4P2GA 3DAOA 2O1SA 3LBNA 4QIHA 5FUWA 3VO1A 3FDJA 4NMLA 4I1OA 4CKCA 4TN5A 3W04A 4C2UA 1NBAA 4NPCA 4HD8A 2WUEA 4MHOA 3W7AA 2MHCA 3K70D 4LNUB 2YINC 1X19A 2PT6A 1KERA 3U4HA 3C4QA 3UF0A 3EXIA 1IHOA 1KFBB 1VP3A 4D7AA 5KNCH 2JAPA 5JHGB 5KZMB 4FX5A 5A4KA 1DC6A 3Q3GE 1WB6A 2HJHA 1M1NB 1I1QB 3G9QA 3QU2A 4JHLA 4MGKR 4LSGA 5CCDA 5JR3A 4I4IA 4ZQHA 5FYQA 1U9IC 2VJAA 4PLCA 1RWKA 5AT1A 1RXSA 4GHWA 2JJ8A 3JWPA 1W4BA 3MBKA 3PUYA 4Q7LA 4X3PA 1D0VA 4WFKA 2AWNA 3IT2A 4QG7A 3ZEAA 3TZLA 2D2FA 3U44A 2VAMA 3GG2A 4KYTA 2QE6A 1KP9A 4C0KA 2D54A 2XUDA 3KOXA 2JARA 4Q16A 2XTJA 2J9FA 4U4AA 1Q17A 1D2EA 1P8AA 5JYEA 4J8PA 3KJXA 3P0EA 5DYWA 2CWWA 4Z9AA 5IDVA 3K7EA 5PGMA 3U2QA 2VLIA 5AKHA 4W8GA 5D86A 3IUJA 3D2AA 2IEBA 2X6RA 3MTJA 2KS6A 3TLXA 3WWPA 2NYRA 4TWJA 4J0KA 1NBHA 2AK2A 2O8BA 4KKXB 4IDPA 1XELA 5IT4A 3T3EA 1K5GA 5CDTA 3L18A 1NMSA 4G26A 4U6SA 4WOPA 1RVV1 3VSCA 1I0ZA 3L77A 1L7VC 3T6KA 1EDDA 3I4FA 5ALHA 1ADYA 1ML3A 1CE8B 4MI3A 3TX6A 1QP0A 3PLNA 4MYSA 3TNLA 3WGTA 2ABWA 4D9JA 3MIZA 3LDAA 2JEYA 4OKIA 2Q0QA 5EIAA 3G6WA 3QBVA 4YHHB 2ZEJA 5F1KA 4BS9A 3U3RA 1YO6A 2BCJQ 2DULA 2MU1A 1GN8A 5B4VA 3QI7A 2YS7A 4OH7A 1BJTA 4LKRA 3KXKA 2EGGA 1XDWA 3N6XA 2X7XA 3E18A 2CHQA 4B3IA 1D6SA 1Z34A 5J2UB 4BN4A 1LNQA 3LBAA 4BEWA 2FUG6 4ZEMA 4JZKA 3A3NA 5JPDA 4ZRDA 1XZLA 2PZ8A 3C5VA 1T2NA 1SM4A 2Y0BA 3DL4A 4F71A 1U9CA 1PUXA 2OCYC 1HT3A 1TZKA 1I4OA 3WKAA 1KEZA 1ST3A 1XA3A 4EG4A 2PZLA 3GLUA 1Z26A 3KVNA 4GLBA 2G67A 2HCFA 4MAMA 16PKA 1D6JA 3DVAB 3U5TA 3WSVA 2C2OA 2F3RA 3DNMA 1G4UR 1Z29A 2XTNA 3MTEA 1XJQA 4KV9A 4CQJA 3GR6A 5DYYA 3VYRB 2HH9A 5CGZA 1H4SA 1QGZA 5JAZA 4CGYA 4J1SA 2BBOA 3B1KA 4WY2A 2I6GA 3JATB 2WD9A 1AJEA 4J0CA 4CR8A 1U4SA 3FVTA 3IJPA 4HGQA 4LZOA 1GPNA 1TUGA 1KMQA 2XA1A 2XHEA 1GT6A 1U11A 3DAFA 4M8NE 3NVKI 3P94A 2BMEA 3PTLA 1MU0A 5ANRB 3GGPA 2W2PA 3WGOA 3GF4A 3GJ6A 1TIKA 4ZDWA 1NBOA 1E96A 3PNMA 1FFXA 4A91A 1SUFA 1Z88A 2NUBA 3RVQA 2Z1DA 1GNQA 1YBVA 2QY6A 1ZM7A 2VHYA 4FYJA 3ULKA 2F1IA 4RLQA 1E4EB 3KB8A 1YBAA 4PS0A 1DX4A 5BQOA 3ZWBA 2FDRA 4YCAA 1M73E 4JJFA 5LC1A 1QTNA 3DMGA 2IHTA 3DDUA 3M2TA 1SPBS 5ITVA 1SC9A 1GQQA 4KSCA 2I7CA 1Z47A 3BA6A 2Q1TA 3L41A 2Y92A 2BYTA 3DBVO 4ZI2A 2J9RA 2F3PA 1EHYA 4ZV4A 1L7AA 3A1FA 3T1TA 5A0FA 4PC2A 2XTZA 3A4TA 4N3CA 1WEKA 2VNJA 4N8DA 1TRKA 1Q0TA 1I7QB 1XNHA 1Q6YA 3G0GA 2JLWA 1EZ4A 4CG1A 3PL5A 1T1RA 4X1KA 2HK8A 3LW7A 4HNRA 1NQUA 4GBED 1KAHA 4QDXA 4R81A 2B8WA 5G40A 2OGSA 2RGDA 4M4SA 1RFLA 3N07A 1IVYA 1M5TA 3DZIA 4Q3NA 1IOLA 3UJ7A 4WX2B 3FBGA 4WN9B 1U8ZA 4C0XA 5B2ZA 1USGA 3H9UA 1VSBA 1E2IA 4EW3A 1TCVA 1PS9A 3GZJA 2GBIA 7GPBA 1KSJA 3W1VA 1KZ7B 5J43A 2AKAB 1PGJA 1Z7WA 4BV3A 5HJEA 5EUMA 3MELA 1R27A 3BIJA 1AT1A 1A5BB 2AH5A 1NRJB 2J08A 2ONCA 2YMQA 3C87A 1J8QA 4JYMA 3UNXA 4BNVA 3BA1A 2BTQA 2FWNA 2AD1A 1JQJC 2JFYA 2XQJA 3BBLA 4FGWA 4QXOA 3SICE 4ZJZA 2MINB 3IOYA 4RVSA 1GCGA 4QYMA 1XEWX 1N7HA 2HU8A 2PWAA 3BWCA 3G0BA 3TAUA 3I9V1 1DO2A 1TM5E 3LSTA 2V0CA 1U2DA 3PUZA 4CN8A 3BDIA 4ZV9A 1O97C 1VECA 4JP1A 5CX1A 3OCYA 2NP6A 2WICA 1K7CA 4XB2A 5DM1A 3RNLA 3B2EA 5DT2A 5CXSA 4B7UA 1BRMA 4R1MA 2HEIA 2OENG 3SFZA 3VH1A 4Z4QA 2F8SA 3WK7A 4RPGA 2VSXA 4XB6B 3LF2A 5FL7D 3R20A 3WLJA 4WZZA 3A6HA 3L7AA 5I7EA 5JLJA 4GRAA 3QGMA 1QZ3A 1I36A 3D4IA 5K6AA 1GAXA 1F2VA 1MOPA 3TSCA 4UTOA 1EUYA 1K8QA 3DC2A 4NCKA 5SV2A 1KAMA 3ZWXA 3W77A 2CD9A 4LHWA 1ZVMA 4IFTA 1YDFA 4MW6A 2XQKA 4J3JA 4OM8A 3I5UA 2BMWA 2C95A 2GZRA 3EW7A 4HGZA 4OUKX 1R50A 4QDTA 5LLSA 1MXFA 3WE7A 3GRCA 1EG7A 5LNK6 4MS4A 1TKBA 2FK7A 2H9AA 1HG0A 2PEZA 3AJAA 3ASUA 3JAWB 1P5RA 4LRUA 1N33B 1NP7A 1QHXA 1CLEA 2DCUA 2BEJA 3ID6C 1T5HX 3QVXA 1FP7A 4OYYA 2NVUA 5JCOA 4FN5A 1KWKA 4MXDA 4OD0A 3LK7A 4FSXA 3ZV6A 1Z0ZA 1W93A 4AZTA 4DLRA 3PXGA 3C6KA 2W2OA 1MOQA 3SZUA 4H6PA 4EPTA 2V7VA 3KJQA 1KMCA 4PPFA 4RAQA 1RKUA 3VTZA 1RCFA 3DQZA 3MUOA 2QL7A 1DQRA 1O95A 2J31A 2WNHA 5TQ0B 5K4HA 4GDFA 4UMVA 4ODIA 1IHUA 2R1UA 2GA9A 3EGCA 1ZNXA 2V03A 4G0YA 3WV5A 5LZ2A 1NVFA 2QDKA 2AUTA 5CA1A 1UXKA 2W2TA 1E3LA 3L8EA 4MW9A 1SD1A 3K0EA 2Z2KA 3B51X 5I9TA 1Q83A 5I3CA 2XMDA 3KX2A 1WAMA 2PKQP 1L7RA 2G80A 1QIIA 3B7GA 3WZMA 3SQXA 4QDUA 1N2JA 1PZEA 1MW9X 2EJTA 2EV9A 2RDMA 2XQGA 4U3JA 1BWRA 3VO2A 1BAPA 1YDEA 3LVBA 4QUIA 1NT4A 2P2DA 2AN3A 4Q7QA 1HDOA 1S01A 2B1JA 3ETGA 4XKJA 4WL0A 2VJNA 4F5YA 4MVWA 4BRZA 3DEYX 2I4NA 3HHEA 4YIHA 1ULSA 3SKYA 4QECA 1E3SA 4MKGA 4V1CB 1MAHA 1VBKA 1K8ZB 2DHDA 1VJDA 2JI7A 3BJEA 4FXPA 3H2SA 4IIUA 2WNIA 4XFJA 2HD4A 3E2IA 2J09A 3D4BA 3CNOA 1K0UA 3D8RA 4CQLA 1HM5A 2W90A 3BB3A 4R2KA 2RI0A 3F74A 4KQ6A 1RAHA 3NPMA 3DDWA 5KQPA 3KQYA 4YP1A 1COWA 3TUIC 4RKRA 5BY2A 1WO8A 2BV3A 3ZU6A 1QVVA 4GYKA 4TZ6A 2GARA 4I4CA 1W0JA 3STWA 4EKDA 4ALLA 3EZ9A 1QMPA 2ODWA 3RS2A 3DBLA 2PZMA 3G5LA 5EJ2A 4AJKA 3PX7A 3SBOA 5I6DA 1E98A 3LT2A 3WSTA 3J7TA 4FDMA 3RYCB 5AKZA 4H08A 2IWRA 2X19A 3CURA 3DZHA 4DUGA 2I3ZA 4G01B 3CH6A 5DGHA 4G0UA 4KAAA 4BCBA 3X1YA 4I1PA 1KQPA 3ZWAA 2XUQA 1BS1A 2AW5A 4HAWA 2FFRA 4N12A 4ZGWA 4GYYA 4JI0B 3R3SA 5J2UF 5CDYA 1RRCA 2HJWA 3GCGA 2FP3A 4PLWA 3ZHYA 4OLBA 1N3LA 2VA9A 3MB8A 4M9CA 3OCZA 2FCAA 1H0HA 1M34E 2CFCA 4BGIA 1PJZA 4D3ZA 1DBPA 2YR0A 4OHWA 5G02A 2IH4A 3P20A 1FYDA 2IU4A 1QH9A 1C8LA 5EPEA 3VGPA 4QTYA 5KC9A 3LIPA 1ISHA 4LQ4A 5H7XA 1U8FO 3LY8A 4MCHA 4MRAA 4C30A 4JWTA 2XYVA 2G07A 3PC6A 1T4DA 3ND5A 1C30B 3GAFA 5AW0A 4L85A 2BKAA 4ZZIA 1PLKA 3F46A 4CLRA 2MSEB 3TLYA 4GP9A 2FRXA 4OLJA 5FUYA 4A8JB 2B0JA 3B1WA 1IYZA 3JZIA 4PX5A 2RE8A 4KQGA 3QTBA 3OLWA 4R8SA 1XTBA 3N76A 3O91A 4AXBA 1CUUA 3I72A 3UMVA 4UMDA 1RRFA 2H07A 5L3SA 4JLJA 3KTFA 3GP3A 4NMWA 1YZTA 4HTFA 2UZ3A 3L8FA 4X71A 1GU1A 3FMGA 4R1QA 4AU1A 1AMUA 4D3DA 2PKCA 3DEJA 3EGXA 1X1DA 3KFLA 3LW8A 3ABIA 1J06A 2VH1A 3C5CA 4ZEVA 4P3NA 2D6FA 1ES9A 1M8KA 3GEDA 2C42A 4NENA 3W6ZA 4AYXA 4D0LB 4K6CA 1OB2A 4KPUA 3M6XA 3TQQA 1GQRA 5I4CA 3LX4A 3MS4A 4RVOA 1EMDA 2BEVB 2HBRA 3QIAA 4EFDA 4YRGA 5KTPA 2A78A 1HC7A 2ATIA 4NEHB 3ADBA 4EB0A 4PSVA 3BZWA 2FMKA 2VRCA 1JU3A 4ITRC 4X65B 3A14A 2HJVA 4WFQA 4KV7A 2B1IA 3N28A 3VU9A 1JFFA 8OHMA 1ETUA 1XMPA 2I2FA 2XSZA 1FDUA 4LGCA 3INTA 4FW9A 3UPDA 3Q88A 4LCBA 4AB1A 1JAZA 4XLTA 1VCIA 4EHBA 4EYQA 2WINI 4YQEA 1Z36A 3MIIA 4DN6A 4RPIA 2WSSA 4A82A 1HE5A 2C3OA 2HCBA 3UWSA 1PYDA 1JLHA 2QG9A 4NBTA 4YCNA 2YIDA 3IDZA 1QX4A 4WAUA 4Q1AA 3ZE1B 3BK2A 3BTUA 1O95D 4JDUA 1AXEA 1Q77A 2C2KA 4O63O 2BHNA 3DF9A 1JW9B 1CR6A 1P5ZB 2IQIA 4OHFA 2ZWMA 1GPLA 2CF5A 4YQFA 1EGQA 5GONA 2QK4A 1XJ5A 5I7AA 1XMOB 1J42A 3S2EA 3NEJA 4FCCA 3A05A 4KMSA 3SX4A 2L0XA 4HO1X 2FEXA 1GNSA 4JXJA 5BWMA 1KMHB 2OKCA 5K3DA 3W5BA 4KNWA 2P9ZA 2H8KA 4INZA 2EWWA 5DCWA 5ENVA