1P1BA

Guanidinoacetate methyltransferase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
193
structure length
193
Chain Sequence
RWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanidinoacetate N-methyltransferase
publication title Monoclinic guanidinoacetate methyltransferase and gadolinium ion-binding characteristics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 58
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2003-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1p1bA00
4PCAA 5LQKA 1XVAA 2I9KA 4DCGA 4E2YA 4UOEA 4DZRA 1F38A 1WS6A 3I64A 4FS8A 5CVJA 3I5UA 2H00A 1NW6A 3BWBA 3HA5A 2PX2A 4RTSA 5E1DA 2ADMA 2PKWA 2IH2A 1VL5A 1NW8A 2CMGA 2FRXA 2Z6UA 2ZWVA 3DMFA 5FWAA 5EZQA 1TPYA 2B3TA 4QDKA 2EG5A 4WVLA 2QY6A 3B3GA 1P1BA 3SR4A 2P3LA 3SSOA 3HCEA 4X63A 5K0GA 5LQCA 5CCXA 3I9FA 3GDHA 4M36A 3UJ9A 2JJQA 3TFWA 1EJ6A 3OU6A 3KPJA 3GNLA 3KQSA 5E2BA 3ELUA 2WA1A 3MAGA 3IHTA 5JR3A 3P2KA 3O4FA 1RI5A 3ELDA 2IP2A 2WA2A 1G6Q1 2PXXA 4YUXA 2AOVA 3HM2A 4AX8A 5K0CA 2NXCA 1T43A 2XVMA 3G2PA 3QV2A 5DT2A 1IXKA 1JG3A 1ZG3A 4RYLA 2ZULA 3OCJA 5CIYA 1NT2A 2E5WA 2ZSUA 1D2CA 2B25A 2IIPA 2FHPA 3NWEA 3WSTA 1RI1A 3EGEA 3HA7A 2OPBA 4HC4A 4OA8A 4FT2A 5U4XA 4EQZA 1P1CA 2OKCA 3HP7A 3P97A 2C7OA 2AN4A 1X1BA 1FJXA 2PWYA 2I6GA 4F86A 2AS0A 1R8YA 3LDUA 3FUTA 4O29A 2PX4A 3MTEA 2ONYA 2ZCJA 2NXNA 4AZSA 1IM8A 1D2GA 1U2ZA 5CUQA 3B7PA 2K4MA 1RI2A 3X0DA 1FPQA 5EMMA 4QVGA 2NNWB 3CCFA 4G56A 5KS2A 4M38A 3O7WA 3OU2A 1XCJA 3OZTA 3P8ZA 1VP9A 1XDUA 1DL5A 3DH0A 1NW7A 1M6EX 3FUXA 3A4TA 3LCCA 1N7IA 3PT9A 5DWQA 3ID6C 3UJCA 3GRZA 3B89A 1JQDA 3S68A 3TM5A 5LQUA 1AF7A 3AJDA 1RI4A 2CWWA 4GOLD 2P7IA 2VZ9A 4ISCA 3SSMA 1KXZA 3TRKA 3B3JA 3MQ2A 3H2BA 4E30A 4RTLA 1HMYA 3A27A 4PWYA 2OY0A 2R6ZA 2QRVB 5CVUA 5M5BA 2AR0A 2IFTA 2IH4A 3TKAA 5CCBA 2ONZA 3ER9A 4V0QA 3OFKA 1O9GA 3EMBA 3G88A 4LWPA 5EMJA 2R3SA 3CGGA 4CXMA 1KPIA 5FHQA 2B78A 5D1NA 3T7RA 2YVLA 5F2OA 1XCLA 4RVFA 1X1DA 2ZFUA 3FUUA 3HVHA 5DSTA 4DM3A 1DCTA 2PY6A 5GM1A 5HEKA 2IDJA 3KU1A 4PYOA 3KKZA 1P39A 4DKJA 3Q7EA 3G5LA 1JQEA 3M70A 1JG2A 3E23A 5KYGA 3EVFA 4K6MA 4RTNA 1NV8A 3BKWA 3P2EA 5K09A 1BHJA 1IY9A 4PYNA 1G38A 3R9XB 5EVJA 4OX9Y 2H1RA 3DXYA 1UIRA 2HR1A 2PV0A 2AOXA 2UYHA 3EVZA 5EHIA 5DTMA 1R6AA 3BWMA 1RJGA 2AOUB 1EG2A 1EJ0A 3EMDA 4MWZA 3KPWA 4KIFA 5EQJB 1VQ1A 1RJDA 2CMHA 2P1DA 5T64A 3G5TA 4BY9E 1SUSA 3OU7A 3C6KA 5K0FA 3GRRA 5DX1A 1O9HA 1WXXA 2A14A 2PX5A 3F4KA 2ZZMA 3UJBA 1EQAA 1XDZA 2EJUA 2O0LA 3CJTA 3DMHA 3HA3A 1ORIA 2JH8A 2PXAA 5HOQA 3E05A 1N7JA 1VBFA 2O06A 4M7RA 5HIJA 1SG9A 3TM4A 4BLVA 4PNEA 5DSXA 5P8WA 5DM2A 3HEMA 1SQFA 3UJDA 4R6XA 3P9CA 5EEGA 3GU3A 1BC5A 3NWBA 4E33A 4HH4A 4OBWA 2UYQA 2GH1A 3MERA 3LCUA 5DXJA 2P8JA 5F2KA 3GJYA 4RTRA 1G8SA 1NV9A 4M37A 4RWZA 5T6BA 4YUWA 3K0BA 5EZSA 4PYJA 3LCVB 3B3FA 3DLCA 3MGGA 2AOTB 4PGGA 3UJ6A 5LQNA 1JSZA 4F85A 4C03A 4C08A 3OE4A 2UYOA 1RJFA 2YR0A 1ZHFA 5DPMA 3ER8A 2Q41A 3R0QA 5DM4A 5E9WA 4FSDA 5T67A 5E9JA 1JTFA 3K6RA 1WXWA 5LSAA 2NP7A 5LQJA 3CJRA 3G8AA 1NBHA 3FTFA 1HNNA 2I7CA 2NYUA 3LGAA 3EEYA 3C3PA 4GF5A 4EKIA 4EKGA 5DX8A 3SGLA 4LWOA 5HILA 3LHDA 3LL7A 3IV6A 2ESRA 5CD1A 4H0NA 4QQNA 5H02A 4Y30A 5IH3A 5ICGA 5GIPE 3GWZA 1QAOA 2BR5A 3CJQA 5DM1A 3FYDA 5EMKA 2NP6A 4XUDA 1VLMA 2OYRA 1QAMA 5LQAA 3PS9A 2Z6QA 2JG3A 2VDVE 5FQOA 3FYCA 1R8XA 4X60A 2P7HA 3KR0A 2YUIA 3KQVA 1VPTA 2HV9A 2O07A 3BGIA 3GO4A 5HIMA 3MTIA 4KW7A 5E1OA 5G02A 3UZUA 3PFHA 4AUKA 1BKYA 5K0EA 3HVKA 2ERCA 2ZIFA 4HSGA 1QYRA 4XUCA 4IV8A 5DTRA 3ERCA 4BP3A 4GOOD 3M6UA 1SQGA 3FZGA 4PINA 3GIWA 5EPEA 2P3OA 4V0RA 2FK7A 3BWYA 4FP9A 4PYLA 2GPYA 1YZHA 5EIWA 4MQ4A 1RI3A 3ELWA 2DULA 1XDSA 1L3IA 1N2XA 4MHTA 1PRYA 2G70A 5BP7A 4HRAA 5ICCA 4PYMA 2PBFA 4LG1A 3T7SA 3T0IA 2GS9A 5LR6A 5GIOE 3PTAA 1MHTA 3LECA 3MB5A 4IWNA 5GOZA 3FRIA 5ERGB 3DTNA 3KPUA 3MCTA 4JXJA 3T7TA 4EVIA 3EPPA 3SMQA 3G8BA 2HTEA 1EAMA 3DLIA 3LDFA 4B17A 10MHA 3D2LA 4ER5A 4E32A 1Y8CA 2P35A 2V74B 4FZVA 5FULA 2ZWAA 2G1PA 1JSXA 3AWIA 2OZVA 4AZTA 5F2NA 5GINE 2AZTA 2ZIEA 3NVKI 1JTEA 2VP3A 3A7DA 5E2AA 5FA5A 5C0OE 4A6EA 3EVEA 4P58A 3AY0A 5EKXA 5EOVA 2P40A 3NMUF 1MJFA 3A26A 3I58A 1QAQA 3R3HA 4KWCA 1UWVA 5K0NA 1NBIA 3GRUA 3KQOA 2G72A 3EVDA 1KYWA 4CTKA 1L9KA 4OA5A 1NE2A 5K03A 3KHKA 4GOND 3TOSA 3KR2A 3PVCA 2YTZA 2B9EA 3KQQA 5EHGA 5HZMA 4RVHA 4P7JA 1VIDA 3BUSA 4RSRA 2FK8A 3R24A 1KPHA 5JUWA 2IBTA 2QYOA 3CVOA 5FA8A 3RW9A 3A7EA 1P91A 3FTCA 5KQSA 1JQ3A 3KQYA 3P2IA 4KVZA 5C1IA 1ZGAA 1B42A 1KHHA 2UYCA 4HTFB 2HMYB 2EJTA 2PT6A 3DP7A 4R8RA 4X1OA 4C06A 4RTPA 5MHTA 2QRVA 2XYRA 3G7UA 4QVKA 5HIKA 2Z6AA 1FBNA 1G8AA 1JR4A 5DM0A 3VSEA 3SVZA 3GRVA 2C7QA 4FSXA 3U81A 2GA9A 3M6VA 5E8JA 4YMHA 3EVGA 4GUAA 3TMAA 3NJRA 4CKEA 5IKMA 2YQZA 2Y1XA 3C3YA 4GBED 3NDIA 3OFJA 4XCXA 4Y2HA 3FPGA 2IH5A 1UFKA 1V39A 5DRYA 3FRHA 3EGIA 4R05A 1G55A 5DRTA 5GM2A 2BM8A 5K0JA 3MHTA 1YZ3A 4DMGA 1XJ5A 3A25A 4ER7A 1R00A 2IPXA 1QANA 3SM3A 1YFLA 2UZ4A 2NXEA 2XYQA 3LSTA 3M6XA 4F84A 3THRA 4FR0A 2O57A 2GAFA 3HVJA 1WY7A 3EVCA 4MIKA 4PIMA 4R8SA 2VS1A 3CBGA 2FYTA 3KQWA 3LPMA 4ER6A 2QE6A 3BXOA 3LBFA 2JHAA 5E1BA 3GGDA 3V97A 2PGXA 3AXSA 2BZGA 4QPNA 3GXOA 1RJEA 1M0EA 4YUYA 2BR3A 5E8RA 3FPHA 3TQSA 1KR5A 1EIZA 5GWXA 5B1SA 3REOA 3RODA 3DUWA 4RTKA 4BP1A 3FPJA 3PX2A 3KPVA 4YUVA 2FCAA 4RTJA 1I4WA 3FPFA 2HNKA 4KRGA 3HCCA 2PWPA 2ZBRA 5BW5A 2EFJA 1L1EA 1NW3A 2OB1A 4QTUB 5LQRA 1KPGA 4PIPA 2PLWA 3EVAA 1VP3A 4QDJA 5E9QA 2OBFA 4IKPA 2AN3A 2ZIGA 3L8DA 2PXCA 2AOTA 4DQ0A 1KYZA 3CKKA 1I1NA 5EGSA 2H11A 1SVUA 2AVNA 4OBXA 2FPOA 1L3CA 2BH2A 1AQIA 1OR8A 3DMGA 3THSA 1I9GA 3B5IA 3M6WA 4YV0A 3UFBA 3ME5A 3VYWA 2P41A 4C4AA 4KDRA 4RX1A 4U7PB 4RTOA 2QM3A 3JWHA 3HNRA 3BT7A 3KQPA 2V7EA 3ANXA 2Y1WA 4FT4A 4PGHA 4FGZA 3TR6A 4AZWA 1ORHA 3LKDA 2LD4A 2G8NA 2JHPA 4RV9A 1KP9A 3G2QA 3JWIA 1WZNA 1TW2A 3KPYA 3BGVA 2G71A 1FP2A 1M6YA 4EMSA 2HWKA 2VDUE 4X61A 5EIFA 4YV2A 1YF3A 2EX4A 4KIGA 2ORED 1JG4A 4QQKA 4X41A 2I62A 4GOMD 3HVIA 4POOA 1ZQ9A 2ZVJA 3Q87B 1JG1A 1XTPA 3UWPA 4ATNA 9MHTA 3R6TA 4E70A 7MHTA 5FADA 4QPPA 1SKMA 4HGYA 3TKYA 4BLWA 3TLJA 3EVBA 4A6DA 3KQMA 5D1HA 1DUSA 3QOXA 4RTQA 1AV6A 5K05A 3P71T 3DOUA 4E2WA 4P7FA 2DPMA 1NKVA 3RIEA 3G89A 3DXZA 1YUBA 5EEHA 3M33A 4YV1A 3BWCA 3HCAA 3I53A 4AZVA 5EMLA 2CKDA 3FTEA 1H1DA 3P9IA 5EKUA 1L3BA 5FUBA 4GQBA 5CVVA 1F3LA 2N47A 2KW5A 5DXAA 3PB3A 2YX1A 5EG5A 4CWAA 4OQEA 4NECA 2YXEA 3PX3A 1X19A 8MHTA 4YUZA 1ZGJA 2C7PA 2XVAA 1INLA 4R6WA 3UJ8A 2AVDA 1R74A 3HTXA 1XXLA 2ZZNA 5K8VA 2AOWA 1TW3A 1PJZA 5FCDA 1X1CA 3GCZA 1Q0TA 5CVDA 5FHRA 4DA4A 2WK1A 3KQTA 2NXJA 5KQRA 4P7GA 4EK9A 1FP1D 3C6MA 3LDGA 4KDCA 4RVGA 3NTVA 4HG2A 2IDKA 2YXDA 3G2OA 2OB2A 4PCLA 3GRYA 5DTQA 4C04A 4XUEA 5HIIA 3KR9A 5E1MA 2PSSA 3V8VA 5HFJA 3AXTA 3IYLW 4GEKA 3ORHA 3EEOA 2ZZKA 4WXHA 4RTMA 3FUVA 3G2MA 1BOOA 4L7VA 3M4XA 4Z2YA 3C0KA 4PYKA 5EC8A 5FTWA 5DLYA 3TPZA 3DULA 1YB2A 5K0BA 2XBMA 2GB4A 4DF3A 4MTLA 1X1AA 2PT9A 4HGZA 3VC2A 4P7KA 5FQNA 4E2XA 3NVMB 5ICFA 2OO3A 3BGDA 2PX8A 3PFGA 3O31A 5BXYA 1AQJA 3E7PA 3FUWA 3HCBA 2P3QA 5CM2Z 2ZBQA 1R18A 3CC8A 3E8SA 2B2CA 4U7TB 2F8LA 3SSNA 1WG8A 2BR4A 4HTFA 2PJDA 3LX6A 3P9KA 4PYIA 4CKCA 1ZKDA 3QOWA 3ELYA 2IBSA 2BM9A 3OZSA 5DX0A 5FWDA 1Q0SA 5K01A 3BZBA 4GC5A 3DR5A 3NDJA 3UBTA 2YXLA 2OXTA 2XYVA 4E31A 1KIAA 2GLUA 2ZTHA 3EGVA 3DXXA 3JWJA 2IGTA 5ICEA 2AOUA 4DCMA 5K0LA 1NW5A 2JH9A 2AN5A 3OZRA 2VDWA 4E2ZA 2PVCA 1O54A 1QZZA 4IV0A 3UA3A 4ER3A 3MCZA 5BW4A 4YMGA 3OE5A 3P9NA 4C05A 3BKXA 2JHCA 3IEIA 4PONA 1VE3A 3UJ7A 3LBYA 3SXJA 1D2HA 2ZLBA 3KR1A 4CTJA 2ZW9A 3LKZA 2O05A 4BLUA 4PYQA 5KVAA 2CL5A 1SUIA 5CVEA 4QTTB 3SX0A 4ZTBA 3HCFA 3FTDA 5C9ZA 4LECA 5GP1A 1Z3CA 3OPNA 4RVDA 4ER0A 3PLAE 3UA4A 2ZBPA 4C07A 3NW9A 3UJAA 4OQDA 1YFJA 3VC1A 3JWGA 2C7RA 3HCDA 4CKBA 4GC9A 1G60A 3FPEA
chains in the Genus database with same CATH superfamily
3MS7A 4OLHA 4RQUA 2XZTA 4GXTA 4KGVA 5LLSA 1VPLA 1V8FA 5HM8A 2GCOA 2C2MA 4RZQA 4QAQA 2POQX 4DR2B 1WS6A 4HWRA 3P4XA 2H00A 3QKIA 1DUIA 1SBTA 5F64A 5A7FA 4L50A 5IXJA 1SZPA 1FQJA 4OQPA 2FR1A 2VATA 2V7QD 4M88A 4OKNA 1QFMA 3EEFA 5A05A 3H04A 4AIIA 2JFPA 4N8EA 4P0QB 2OMEA 3OBIA 2FWBA 3K05A 3ZWAA 3PR1A 2PM8A 1Y4SA 1CIVA 2R60A 1QP7A 1CZOA 2ANBA 3KQHA 4Q3DA 2H7CA 2TRSB 4I9GA 4CM7A 3AF1A 3BIOA 3DJYA 3RSOA 5AM2A 2WMDA 3EPHA 3USCS 3O8DA 4RL4A 2GN6A 3QPDA 4RVSA 4ZO8A 1JKJA 4QDUA 2VEOA 3F78A 3I83A 1P2DA 1T8UA 3OIYA 3A28A 4X1YB 5GONF 3TZHA 3GJRA 1RKBA 1UXOA 5LJIA 5AI0A 4Q18A 2AIRA 4KI0A 2PUTA 2VDNB 4C0HA 1KSGA 1HE1C 2PKRA 3DDZX 5AK0A 5LB2A 3JQFA 5F98A 2R44A 1Y3BE 2HQBA 3IP3A 2R6HA 4WY8A 4LFCB 2EX1A 1E3DA 2GCNA 3RH0A 2M9MA 1A9PA 3WO0A 1Y37A 3IT1A 3EAFA 2PX4A 3OJXA 1PR0A 1HLDA 1LPNA 1RKUA 3O21A 1BJKA 4HQOA 1FVFA 1FFBA 1SFRA 2K4MA 1JR3E 4MUJA 2EARA 2IC5A 5DEOA 1XDBA 4NFYA 2YMMA 1E4OA 2I71A 1O96B 5KS2A 3I9V1 1N1EA 3OZTA 4O5AA 3P45A 1MW9X 2ADOA 2GYYA 4PAWA 2M6LA 1X77A 2IWRA 3T6KA 5JPCA 3ZLTA 2B4AA 3UTDA 2YMQA 1NIJA 1AF7A 2WAYA 3NI2A 5A03A 4YGXB 3B13B 4R1TA 2JW5A 3G2KA 1JHPA 4RTLA 2FB9A 4JKYA 2CXXA 1VHDA 2DTXA 3ACBA 5DW3A 2AH5A 1TNDA 5B64A 1S6YA 1LBEA 3VR6A 3TTYA 3CM0A 2PJRA 3LFHA 1O9GA 3T3PB 1R0KA 4TV8A 3TOXA 4YCMA 1US8A 5JSZB 5F2OA 3LPNA 4CODB 5KC9A 5D87A 4TQ9A 1R6UA 5IXYA 1XCOA 2YZ2A 1C8VB 4US1R 3QFSA 3FKJA 3LAWA 3KZXA 3UOAB 4Z3KA 2IDJA 3K4PA 4JV5B 4HRVA 1FSGA 3B6IA 4JODA 5A0TA 1II8A 5KYGA 5CTJA 1LQUA 4WLOA 2YV3A 5JAMA 3HBLA 1EFPB 1IHPA 3I6BA 4PZZA 3R9XB 4MPJA 1U6JA 4ENTA 1IUPA 3E7FA 1NNEA 3O82A 4G65A 2DTDA 2J67A 3KELA 4NLLA 4JLSA 3ZWKA 5EHIA 3FR7A 3FVRA 4NHEA 5JYEA 2Z3WA 3G17A 1W49A 4OI2A 4PLFA 3KAJA 3B82A 2A86A 4Q1BA 4TSFA 4TLMB 3PDHA 4XARA 4P86A 4RABA 1IH8A 5CK4A 5JNUA 4EZEA 2B9VA 5AI9A 3TQIA 4ZGBA 3HVRA 4X92A 2J9RA 3FLAA 2P2YA 1OLUA 3ZIDA 4YXWA 1EWTA 4ZKEA 2FZGA 1N7JA 1VBFA 2O06A 2Q1UA 2VO1A 3EWIA 3GXBA 3L07A 4LMRA 1MA3A 5DNUA 3LWNA 1P61B 4J0IA 4LAFA 2Q5LA 2OQVA 2P9ZA 4AKTA 1UAAA 2J5RA 4TWZA 4L5BA 4EZIA 4YECA 4Z4HA 4IIUA 4EY6A 3PTZA 4XCQA 3BQMB 4PRZA 1NFQA 1E1DA 3H5IA 4JQYA 2QNIA 2C58A 1MO5A 1ZUNA 4RPJA 1UPUA 2GZMA 3IBYA 4D56A 2JB9A 1IWOA 4AYTA 2ZWPA 4Y3UA 1XDGA 3VH2A 4BEVA 1G9XA 1N7GA 3MJTA 3AIMA 5CT9A 5EXXA 1TT5B 5KWJA 1TZMA 2O8BA 1JLLA 3L6EA 4IQ8A 1XPRA 1KERA 5LQJA 3CJRA 3FTFA 1GR1A 3O6VA 4RGBA 1DQSA 2VF4X 3EQZA 2VQEB 1HQYE 1DAOA 4HNTA 3SGLA 3GCDA 2CC2A 2QVBA 2RHBA 4L9WA 5G0TA 3WYNA 4BNVA 2C9CA 5CD1A 4Q00A 3RSZA 2GSDA 1Y3FE 1MO6A 4YBZA 4RDIA 4ND8A 4RLFA 1KU0A 3DKPA 4FBGA 3DF7A 1P2TA 2I0FA 3DF9A 1V8ZA 3GP3A 4PE5B 3VO9A 1UDBA 2JBAB 5IASA 1OSNA 3WQSB 3TLXA 1Q11A 3FYCA 2AG0A 3LC0A 1NMXA 4W99A 2HLDD 5L51A 5LFAA 1N78A 3A1DA 3WKCA 3FM9A 4D8WA 2ZIZA 2G36A 2CXTA 4XYBA 1PVVA 2IEDA 3C3CA 1JJIA 3HKDB 4Z4CA 4RPHA 1CUJA 3M9XA 2WIGA 4AX4A 1YQWA 3N7UA 5B7GA 2OAQ1 5I3ZA 4B2PA 3GBVA 5EY5B 4N76A 3M6UA 4NMMA 4PLTA 3T1TA 1FMCA 2WYHA 4QBFA 3NBZC 3QMVA 2O5RA 5EIWA 1LF5A 1TVKB 2EFEB 1ZSNA 3KEFA 2AGVA 1LWNA 4OREX 5C7IO 5BR1A 3UC5A 1L1QA 1JDPA 1W85B 3RROA 1NBWB 1J8QA 1MX3A 4K88A 3T7SA 2QZJA 2C9DA 4L07A 4R40A 2FE1A 3H42B 3C8ZA 3KTAB 3ZXIA 4ECEA 4MI6A 2JCBA 4FGJA 4FWTA 1COZA 1IFXA 1HEYA 4KXUA 5ERGB 1JHYA 3DTNA 3ESAA 1CQIA 3ZI0A 3AF0A 5HZHA 1M33A 3OFVA 4HNGA 3LUDA 4MR8B 4YRQA 4CIXA 1EAMA 1QHSA 4EGCB 3QG1A 4MV1A 2NU7A 1ZUIA 3D6FA 3MYRA 4LQLA 4TLDA 3W1VA 4F6CA 1Q57A 2ZTMA 5C1DA 5CFQA 2XUZA 1HDEA 3T41A 2YKGA 4YASA 1W4BA 4XX0A 2TMGA 2NO5A 3IERA 2JBHA 4FCTA 2RHTA 4D9GA 1E4VA 2PNFA 1ZW1A 2PQ6A 3CUVA 1QNFA 3H6GA 4MUAA 3T7DA 2NO4A 3DE6X 4LBZA 3VO1A 2NZ2A 5CLQA 3BMOA 3U62A 2VNJA 3WK7A 4AXBA 1M5TA 5COAA 1Q7RA 1Z4JA 2WSSD 5EWMA 3NAGA 3QX9A 5MGBA 3M1IA 1MPXA 1WBJB 1IBRA 3LOPA 5K03A 1U1DA 2CNWD 1AE1A 3KHKA 1GG8A 4U63A 1J49A 1K06A 1L4FA 2X19A 2PANA 4MV6A 5ALXA 4ZFNA 3F5FA 1V95A 1DE0A 5MF6A 1UBNA 3CONA 5EP4A 1ZPDA 1Z0KA 4U2BA 4UUPA 3BZUA 1XP8A 4G9BA 4PGMA 4PCUA 4KVZA 1EK5A 2REBA 4NBNA 4DSAA 4QWMA 1B42A 2AJBA 5FWYA 1WUYA 5AM3A 1YE3A 4B8YA 2QM8A 3V4VB 2XYRA 1M1NA 4YJ2F 5HIKA 2W2VA 3RM3A 3B85A 2JCGA 4XM0A 4D0RA 1PV4A 2JLSA 3V34A 3D7SA 5IUKC 3QEMB 3OTHA 2GN4A 4JNCA 3CSUA 5ALKA 1C9YA 5IKMA 1SU4A 1WCIA 4RK4A 1VDZA 2DCUA 1C7ZA 1J06A 2OK8A 1XQWA 3QXGA 5IM4F 4WCFB 3DO8A 3M4YA 5B53A 1N2ZA 2ZKLA 3ZCUA 2P2DA 3I05A 5K0JA 2IVZA 1ZN2A 2BM8A 1E1MA 5DCWA 4ER7A 2I4RA 4BNWA 4ESHA 3L92A 4ETMA 2J46A 1QIMA 4Y67A 3NQ41 5K0SA 1EUCA 1YJBA 1A8QA 1UBKS 3AZQA 3CZRA 3RVBA 1CUIA 4B32A 4LRWA 2FZEA 3VJMA 4LHXA 4PTYA 1GY8A 1WY7A 2RGDA 3IJPA 3GP8A 4US2R 3E48A 4PO9A 3V33A 2XECA 1WBBA 1J70A 3PGVA 2X9GA 2PT7A 2X0DA 4UPEA 2PH3A 4RD0A 4IEEA 2GM9A 1P8AA 4KEAA 2WUEA 4IHAA 5A5DA 1ZH6A 2IX9A 3IPAA 1S3FA 3OPYB 4OTZA 4QOFA 2CHEA 2XT0A 3ZJVA 4JA0A 1FQKA 1OUMA 2B61A 5KSOA 1PHRA 3BFXA 3GJ4A 1JQBA 1ZRNA 2DECA 3LKBA 4FE7A 3GARA 4Q3OA 1E32A 2VRWA 3FH0A 5BMOA 4CCWA 4Z0NA 5C5DA 4MKRA 2XSZA 1L1EA 4IG4A 5FORA 5A4IS 3F9RA 4LJLA 4Y1FA 5DGXA 4ZWNA 1C2TA 1HTTA 1HT2E 2IPNA 2PGIA 1JG6A 4WDQA 1A5TA 4FYPA 4QEZA 5DHUA 3KTOA 3RC9A 4BFSA 1U7OA 3KSAC 5K3BA 2O8EA 1JRLA 4ZYXA 2R8BA 5EGSA 3EGDB 3IVXA 4BBZA 4YB8A 3GLFA 4MJ7A 3NYIA 4MYDA 4TKLA 4CCSA 1V5EA 5J4VA 3KWJA 4ENRA 2XRZA 3E7DA 4K6HA 4OFXA 2X7JA 2OMKA 4R2HA 2DPLA 3UPTA 4OBEA 1OYVA 1LDMA 3CH6A 1CWUA 3BMCB 4MNTA 5TQJA 4YI3A 3K5IA 2LD4A 2QX6A 3OM8A 4F1WA 1G8KA 2DBQA 2RGNC 3ESBA 3ZBPA 3VR4A 1RM5A 1TW2A 2VRBA 3QPCA 4BV2A 5A3JA 1SPBS 2IEGA 4A8JC 1W36C 2VTEA 1U8CB 4DARA 3ZHTA 1M6HA 4M9ZA 2JK1A 1T1SA 2C1EA 2XAUA 3NTXA 3UUFA 4UTVA 1TO1E 1PG5A 2UV8A 5IJXA 3FLMA 4EPWA 1BHSA 1W8IA 1JT9A 3DBHA 2FMKA 1HFWA 2IYRA 5EL0A 3TLJA 2ZSIA 4G5QA 1C4WA 3QE0A 1ZD5A 3OF2A 4L9AA 2OHHA 4WVFA 2QY9A 3RC7A 3R9WA 1Z0AA 3N0RA 3RG8A 4LJ7A 4CQLB 1USIA 4TMWA 1YASA 5ALVA 4JLBA 4YV1A 2FLWA 1IN1A 2VYND 1Z8DA 5FAXA 1FMFA 3H5WA 2HLNA 4AJHA 1DIGA 1GPH1 3AP3A 2Q2WA 1T15A 4HYQA 4C2BA 3N5CA 4UARA 1K7XB 5DXAA 3JVIA 1T9CA 2VJOA 2BFFA 4FR2A 4B76A 4DNXA 3TIIA 1GXSB 2NTVA 1E9VA 2QX8A 3FB1A 3B2EA 1YDMA 2BE9A 1BKSB 2XVYA 5FIUA 4G5GA 2G40A 3VPSA 2QN6A 1WMAA 2ZB8A 3LOUA 2DWPA 3HMQA 1THTA 5AYVA 5HK8A 4WESA 5A6SB 5JAHA 2AQ8A 5DBIA 1Q92A 3OTOB 4W8OA 3RUHA 1QSGA 3RUIA 1E1LA 4EK9A 4QECA 1KQOA 1HETA 4BFWA 2IBMA 4EITA 5EQFA 3WIOA 2C0PA 4FYWA 5ULLA 3R40A 4DXAA 1HO3A 3EJWA 2XUGA 1T5OA 3G2OA 3PUWA 3B12A 4R8KA 1PWHA 4WFKA 3X1JA 4AMUA 1MQ9A 4X9XA 1VCNA 5HFJA 5CDSA 2YS6A 5J47A 3GG2A 5JBIA 1RCUA 3HKBA 1W44A 3NEYA 4Z2YA 2WG2A 2NOAA 4ASUD 5DLYA 4M9UA 1JAHA 4ZQHA 4XI9A 4A2QA 4P34A 1PTJC 2Z2KA 2RHLA 3B2NA 5I48A 3E9QA 3NVMB 1LLQA 4DR7B 1OXUA 2A58A 3HJFA 2FVYA 3QEKA 3IIMA 3FUWA 3V1LA 4S1OA 2B1RA 1KI9A 4KGXA 1JXMA 2ORWA 3TR5A 1XZGA 2WM8A 1BD3A 4AMVA 5BSFA 4AMYA 3EFOB 3JARA 2XKJE 2Y9PB 2FZCA 5BRNA 4A10A 4Z53A 2F48A 3FTQA 2CLSA 4CKCA 5E0KB 2DYKA 2CDRA 3GYBA 1TMKA 4PCVA 2XB4A 2AN1A 5A1JA 3LXXA 4JYAB 4DM4A 1XEAA 4DSNA 4ZGWA 1V3QE 2BGMA 2JJ2A 2X4IA 2EL9A 3CMCO 4LI0A 1BMFA 1KKLA 2OQRA 3K2BA 2FFBA 1DCFA 4RK5A 4TN5A 3DL0A 3KVNA 3QHPA 1OLXA 2ZT7A 4B71A 2DU8A 4G8DA 4YP5A 4F6LA 1P5FA 1QIDA 3BE8A 1O54A 1QZZA 1J0DA 1SXHA 1T2DA 2FZKA 4JENA 4Q6BA 5EXPA 1Y6GA 3C3DA 3GT3A 1EUDB 3QXXA 1AJEA 1WO8A 4C05A 1XGKA 5C7OO 1ADBA 5DO9A 1MEJA 1WMBA 3MMPA 1D2HA 4PVDA 4ZI3A 3HDVA 3L6DA 4RPIA 1FW8A 2D06A 4JP5A 1BN6A 2H0QA 8ATCA 3DE3X 3QVUA 5T6MA 1FU7A 4U6NA 5FUYA 4KQCA 3ADKA 5KWEA 2VZ8A 5MFPA 2FUKA 3I34X 3LFUA 4HEA1 4QPCA 2E21A 4KIWA 3DV0B 3LC7O 1I3NA 4EPRA 4BC0A 1OREA 4S0XA 4KQKA 1BRMA 2GZAA 1V2HE 4CDMA 2VFAA 4KRYA 4BLTA 5JARA 4RY2A 2QI9C 2KLHA 3WB1A 1YFJA 4HYEA 4S2UA 4E08A 4X6XA 3D3WB 1V3TA 1FRFS 5ALSA 4MCIA 1K8YB 3IAM1 4XX1A 2VJAA 4NIMA 2OXRA 5HTOA 4ZVVA 3VTKA 3SY8A 2VAMA 1UQRA 1DOZA 3VYTB 2SKEA 2V0CA 1F38A 3U4HA 4YACA 2X1HA 2P90A 4DLXA 3ORSA 4ECAA 3MCWA 2PX2A 3LUFA 2DKNA 5IT9A 3EAGA 4CGYA 3C5CA 1IM5A 3C6XA 4XVRA 1LVGA 5COBA 2EBHX 1ZK0A 2ES4A 2OHOA 3FETA 1MIOA 5IAKA 2HREA 4P3PA 4Z99A 4EKDA 2GNPA 2ZCUA 3QRWA 1MJ5A 4Q5IA 4DV2B 1P1BA 2C4TA 4AWBA 1DIAA 3MAJA 4C0AC 5KVCA 1MG5A 4OFZA 4MQUA 3FOWA 1RE0A 2PKXA 4X54A 1P5JA 1ULUA 4JCCA 3TFWA 1PJ3A 1JR3A 2HADA 3JD1A 3NLLA 5H3LA 4CDNA 4DXHA 1SU8A 5CBPB 4JL6A 3TE7A 3PUZA 4JYPA 3ETNA 4QOJA 3RS5A 2D1TA 2ZUFA 1HBJA 3R7NA 4UQPA 3SZMA 5L4SA 1WB4A 2PMBA 5TQ2B 4GQAA 1E7WA 4PANA 4AX8A 2NXCA 3PC2A 3NJ4A 5TS3A 4R2XA 4BWYA 4IDOA 1DFHA 4F3RA 2ZU0C 1RPZA 3A2KA 4EY3A 4RZXA 4LQ4A 1VDMA 1K66A 1W0KA 1I7PA 3BVPA 3NWEA 3PFCA 3SAJA 2C31A 1HEUA 1QO0A 2OPBA 5L95A 3BOSA 4JVOA 1RAIA 2IPLA 1VKJA 1P0FA 1YH3A 1FJXA 4QXAA 4IS2A 3RQSA 4I50F 1X14A 1QYWA 1UDRA 4J7XA 2X14A 3FYUA 3NYRA 1J8DA 4U7HA 4LK2A 4BNTA 2BSXA 1J09A 2G67A 2G6BA 4P8RA 4R2MA 2ZCJA 1D2GA 1U2ZA 3RBAA 3NUGA 4HDMA 3AF6A 2JC3A 3DCIA 1E1QD 4IGFA 4LUCA 4F5WA 3U60B 5K8IA 1L5YA 1V25A 2WW8A 3R3SA 4KQWA 4LZNA 4OQ4A 1O6GA 4M38A 1ORDA 1UBCA 4FOTA 2B8WA 3B7GA 1SUPA 1NW7A 2B8EA 3QTLA 4J29A 1DFIA 5FPSA 2DX7A 1H2EA 3SDBA 2WHXA 3ID6C 4PFSA 4TVOA 1V16B 4Z9AA 1B1AA 4RMJA 4TSKA 1GZHB 1QH1A 2WTMA 3NRCA 4MRRA 3CXRA 3WYFA 1TUBA 1AOXA 1AQLA 2DQYA 4ZYWA 2D4AA 3NO4A 2F8TA 3LC1O 4LYEA 4B6JA 2MR5A 4BN0A 3UBMA 4MV7A 2H54A 1H4QA 1OPRA 1VIYA 3NS7A 3T35A 1XG5A 1NSFA 3FAKA 3PJEA 5HBRA 5ERXA 1F48A 3WC4A 4HVTA 3T7RA 4AZ3B 2PX3A 2WT4A 4CKEB 5AJHA 4ZHQB 2Q9CA 2ZFUA 3HVHA 3MJVA 4R8VA 4OI1A 4IYRA 1OV6A 2Y1DA 2GMWA 4P4NA 5CT6A 1M67A 3DYVA 3R4CA 4IRMA 1E8MA 3WLSA 4Z51A 3TSCA 3QX7A 1JHMA 1T0JB 3M70A 4WXPA 4G24A 4XASA 3ZK9A 5DBEX 3U09A 3P2EA 4KN5A 5LU9A 1GZ3A 2N1BA 1AURA 3R0XA 4I7EA 2BM1A 4Q7MB 5G0UA 4RZIA 1VA5A 4F8YA 3W1EA 3BIJA 4G5OA 1ONPA 1K27A 2ET6A 1JMYA 3CKLA 4GNRA 4ZXFA 4PSDA 4FDVA 4BNXA 2GBLA 2PTGA 4LJ4A 1PFGA 1UFOA 5E95A 3Q0IA 5LDDC 2C4UA 1I3LA 2Z95A 5A2GA 1EBFA 5T64A 1TU4A 2GTHA 2FWNA 2P1DA 1CUCA 2X5JO 3DB2A 3JVUA 1HYGA 4ILKA 3AR6A 4KPFC 3C6KA 3ZGXA 2WU8A 4BVEA 3DEZA 1PR5A 4BXOB 1XVLA 3OZAA 4C4SA 3GLSA 1UFVA 1T36B 2CZGA 2XUDA 2YJ5A 2IYNA 2IT1A 3GP5A 3DVRX 1T3HA 2VXOA 5DN6A 3AEUA 4Q3CA 2TS1A 5PNTA 4GDFA 4IEIA 3WKBA 4CMHA 4B9EA 2AHRA 3P9CA 1N5RA 2NGRA 4LFAB 2WJVA 1JFRA 3VR0A 1XTBA 2XLBA 3IIJA 2IUFA 2BVNA 2RGUA 2ARKA 2B35A 3EH1A 3N2KB 1AKQA 3F6RA 2DKFA 5EIBD 3TTVA 3UK7A 3VBCA 5IK2D 4O3MA 3TFOA 1YR3A 1T3ZA 3FFTA 1G98A 3BXXA 3H6KA 4NX2A 1BDMA 2D5CA 3G2JA 4OXXA 1Q20A 2IYPA 5G0VA 1VE6A 2CVZA 4UUQA 4FSDA 1K5DA 5E9WA 4AJ1A 3PNSA 3FCSB 3T5AA 4R1UA 2A0WA 3CISA 2B98A 1Q44A 3G0GA 2WUGA 2H1WA 1DTWB 1UKYA 4MS3A 5I7WA 3M0EA 3P26A 3SC3A 5DM1A 1TM3E 1ZITA 1ZINA 2B5WA 2VK4A 1HDXA 2EL7A 4JQSA 4JJ6A 1I30A 4KV9A 3E4DA 4QFMA 1ID1A 5DGCA 3UK2A 2NT4A 1P0QA 3O8QA 1XLTC 4V0KA 1DHRA 1R50A 2JG3A 2FUNB 5AUQA 1F14A 1T3LA 4UMVA 4B6OA 4XDHA 2PIAA 3WLKX 2FOLA 3KSBC 2P5UA 2ZRDA 3ILYA 1CNEA 3UFXA 2F9LA 3MJ4A 3N5KA 4O2BF 2UVQA 2ZIWB 1ABBA 5JECA 2UDPA 4AICA 2O5VA 2VWQA 2BLNA 1WPGA 1CEQA 3EXIB 3GIWA 4JBGA 4O8ZA 5CEEA 3GLIB 2C9YA 2H1HA 2JEOA 1YZHA 3K0SA 4BZPA 3HY4A 4FTWA 2LBPA 3GJ6A 3KKLA 3N0TA 2EYQA 4U8HA 4CU5A 3GZTB 1R0BA 1UJ4A 5EJAA 3CF4G 3L4BA 5CB6A 3AY7A 1OLOA 5LWHA 4OIFA 2ZPAA 2XQFA 1LV8A 1Y9AA 3A1TA 1W2WB 1ZRMA 1XE3A 3E1SA 3H5RA 3KEOA 2V65A 4QUHA 3PTAA 3SQXA 3JZIA 1X2BA 1PV1A 2O3RA 4G0XA 1RHRA 4EI2A 1XKTA 1CJSA 4IHQA 1LPBB 2EHDA 1GJRA 4BX3A 4MUHA 4LW8A 1UL1X 3WGOA 3W5AA 3DLIA 1N2GA 5TIIA 3G1WA 3H4IA 2C84A 2WWXA 5KOHA 2V74B 2WAOA 3ED1A 3K9FC 3AL3A 1TO2E 1U8EA 1U65A 5JJKA 2VK1A 1PI3A 4WN9A 1HA3A 1HOTA 1A4UA 1QHEA 3LVBA 5HXAA 5E3JA 3DZIA 1ZSYA 4WT7A 3SJBA 4GR5A 4KYUA 1U98A 1WQ4A 3EOZA 5JO9A 4GKKB 3L1IA 4XFKA 2QJTA 5K8JB 521PA 5FBKA 2VP5A 4Q02A 1XLWA 3O84A 2XVXA 3AVQA 3PWKA 5A3SA 4AUEA 4WPGA 5LZ8A 3MMZA 1Q1ZA 4LY0A 3COPA 1NE2A 2A7QA 5T5QA 3N2LA 2BTQA 3E3MA 3ZY5A 2EZ9A 2VRNA 4LEIA 3OX3A 1JQ5A 3HY6A 4ZU6X 3I2YX 1WV1A 2QL7A 3NGMA 1FFXA 1AGNA 3ONDA 1IK6A 1M8FA 4TV8B 2UZ1A 2FK8A 2YRWA 1QE5A 3V2GA 4ZZ0A 5CDYA 4YRCA 3RYFA 1IZ9A 1O03A 2GERA 1L7MA 1VBNA 4D9HA 3IL2A 4O4LB 1WHTA 2XITA 3F5QA 4NQRA 4R8MA 4WA7A 5AXDA 4ZDIA 1YRYE 3IP9A 4JVSB 4Q4JB 5JAZA 2HMYB 4FDAA 3RVLA 4WZAB 5M7EA 1DWUA 4ZAXA 1B4DA 1OD6A 1T0HB 3CNQS 3EIEA 3H87A 4FWIB 4KHZA 4M1ZA 5FOUA 2ZRJA 3H05A 1NKSA 1O2DA 3BCUA 5A04A 3N6VA 2PX6A 1JPUA 1ACLA 4JZYA 5FV4A 2O1XA 4GICA 4JL8A 4KMOA 4D6PA 4NXNB 1GAJA 3EB9A 5TGTA 1CR1A 2ISSD 1E0JA 2II6A 2VDWB 2W4QA 4NU6A 2GN8A 5DRYA 5T3YA 5JJ5A 4CFYA 3AI7A 4URWR 1EXVA 1RBZA 2PUVA 3SM9A 3VUFA 4CL8A 1EWKA 2KMLA 5D7NA 4LTNA 1KR2A 1ZGZA 4OQYA 3TINA 5KQMA 1OLUB 3GAAA 4DMKA 4BMYA 2WVJA 3QF4B 4GLJA 1KSJA 2AK2A 1UPXA 3FGZA 3C4JA 2JAPA 3BH0A 1BDJA 3RLFA 3UCEA 1Z22A 1IAQA 3IOBA 1D8AA 3KFVA 1Z5VA 4I1IA 4ER6A 2H1VA 2VPYA 2W6ZA 3VNAA 2X7XA 4J43A 2ZUUA 4ZQBA 2YS7A 2W70A 2PGXA 5JYCA 3ZJTA 1GADO 3PT5A 3P96A 3A6GA 1EIZA 3JVEA 4OCZA 2Q6LA 4KRXA 3CN7A 1WNFA 2QPAA 1Y4DE 3TE6A 2FX2A 3ND8A 3WOVA 1E6WA 3WTCA 1ND6A 2DFKB 2I2DA 3H65A 5LN1A 4HQFA 4D25A 1GZ6A 5LA6F 1ICIA 3FWKA 1DP4A 3IGFA 3ITEA 3D7LA 2HNKA 3D43A 3O38A 4KRGA 5LLTA 2D0IA 3JS5A 1UP4A 1EX9A 3DBLA 5HHTA 1SBIA 4AAYA 1ODKA 2W2LA 2M6SA 5FBQB 5C7YA 1S89A 1T2UA 1C0EA 1Y8QA 2YWDA 2ZBGA 3HJRA 3L7YA 1QNLA 2FZWA 4D26A 2LP4Y 4RS4A 4KXNA 3R44A 4Q4AA 1NXWA 1ZXLA 3SZOA 3VJLA 3GV0A 4RULA 1SN7A 2Q5HA 5JS1A 2ASVA 4C22A 1X7YB 2O7NA 4KAFA 1FUIA 2YXPX 4WKGA 4B0OA 2VP2A 5HQJA 3OZDA 3AVOA 4KDRA 4D3DA 3MTGA 1CRQA 3ETJA 4V3CA 3UK0A 1PEKE 3KLPX 3L06A 4OHFA 2YWJA 4RVNA 5CXQA 1E9AA 2P4HX 4DB4A 1G4AE 1H2HA 2G6TA 4TYQA 1KP9A 2A9RA 3DMYA 3M6FA 3P2JA 2OEPA 1QH0A 5JALA 2G71A 3NM5A 3S5UA 1XCGB 1D0IA 2JLCA 5EIFA 3HCOA 1XQVA 1OA0A 3ZBQA 1DMRA 4QYXA 2HA6A 1R15A 2QW1A 4HB0A 1WKVA 2BEWA 1K89A 3QFFA 3WBBA 2OESA 5LP6C 1QP0A 1ECCA 2JAXA 5EI5A 1WVIA 1HE5A 3TZQA 1Q5PA 1NXSA 1FX1A 5D1HA 3VNVA 1CP3A 4R2LA 3GMTA 4XAQA 2IV7A 2OZLA 3LK6A 3BDAA 2MMGA 2OHJA 1PE0A 4NBKA 4ZHSA 3R23A 3PQ5A 1QRUA 3QBVA 3K0FB 2WM9B 4DYVA 1N2CE 3TUZC 3LHKA 1XNRB 1DAPA 3OZXA 3WY9A 1S3SA 1OJ7A 5EG5A 2FA9A 4ERNA 1NN5A 2CN1A 2W9XA 3IEPA 4QBKA 5DLQC 4ZN6A 1IHYA 3R3YA 3E9CA 1GPBA 1SQ6A 2WFMA 3SYKA 3WLFA 3U6KA 1CLEA 1BEZA 3F7OA 4XX0B 1XJQA 1QX4A 3DWEX 4O4IB 3UT5B 3FJ1A 1E2MA 3VX3A 1P9WA 2ZZNA 1P3DA 5K8VA 4EYSA 1XMJA 2CVOA 2O4UX 3CNHA 4J2HA 4A2PA 1OFTA 2NXJA 4MVWA 2ZJ3A 2XTMA 3NBAA 1LBQA 3VI4B 5HCNA 8ABPA 1F12A 1Z25A 2DLDA 5A0VA 4HX5A 5ESWA 3ZUGA 2Y1GA 4KAXA 4FW8A 2F4NA 3RS2A 1E2JA 4GEKA 1LBHA 2IQ5A 1Z2EA 3A36A 1ZVQA 1XF1A 3C0KA 3EGWA 3LD9A 5FTWA 4EG8A 4HGNA 3DULA 5FWYB 4D79A 1RHUA 2FP3A 2GB4A 1PW7A 4EJ0A 4JXKA 2AX3A 3BREA 3PXXA 4RVCA 3JQAD 4IO1A 4IOLA 5KTRA 3SYRA 5FOWA 3U26A 4MKFA 3IUMA 2XIJA 2OO3A 4KQIA 1N8TA 4MUXA 4N54A 1YK1A 3FG9A 2C29D 4KI7A 4MVJP 2ZRHA 1ZMBA 3G1TA 4GEGA 3FSRA 4N1AA 4RY9A 3RJZA 2WWYA 1RWKA 5DN9A 5HX7A 1K7YA 2FMUA 2ZB7A 1XYYA 4ARZB 3KKKA 4N0EA 1PYDA 5JI3E 1L8AA 2AI1A 3SEFA 4BO9A 1YFZA 4V0ME 3K9NA 3L49A 1N2EA 2BBWA 3DOCA 3CR8A 4J16C 2P4SA 2JRLA 1J56A 4MK4A 2J7PD 1CDOA 2FR8A 3GJTA 5CX1B 1HPLA 5FRDA 3OZSA 3RARA 2Z2YA 2H1SA 3E18A 2O3TA 5HF5A 1TT7A 1XI2A 2GDZA 1OKKA 4J1NA 5KNBH 1KZ4A 1TM2A 3NOQA 1JHUA 4R9UC 1BROA 4LZOA 5TDHA 3JQGA 2AQKA 1KL7A 4IHJA 3Q5GA 3NTRA 4QBGB 4I4CA 5CXXA 4LY9A 4FXOA 2VZEA 4WNAB 5IM4A 5HZGA 1HMPA 1XJWA 4AP9A 4BWGA 3HQ4O 5YASA 3QVVA 2C8KA 1AKUA 2MWMA 3LPCA 1XROA 1EFVA 2IP1A 2P8SA 2M2IA 5JWHA 1EFUA 5A4MS 4J7CA 1PZXA 1E2BA 3LY9A 1J7JA 1MCZA 3UJ7A 3AL0C 3W9YA 3K8QA 2VNIA 2QP3A 4LOAA 1JDVA 5HRCA 3L01A 3QNMA 2HA3A 4R98A 4H59A 5BPFA 4OK5A 1UZUA 3MA0A 3ZPXA 1GQ2A 1AKTA 1HSZA 3R0IA 2EVWX 4GLOA 2Q8NA 3AR4A 4MIEA 4UM5A 2P4QA 3O95A 1T5SA 4XQCA 2GF0A 1P73A 3V00A 4LECA 4Z6KA 1PD0A 2UYYA 3PCRB 1ULAA 1GRCA 2Q5EA 4INAA 5IN5A 3T9CA 2ZRNA 4OQDA 5E4FA 3GLFB 3DE4X 3JAWA 4GC9A 4NCBA 4OYLA 2IK8A 3JQ9A 4QHSA 1JKFA 2FW8A 2ZYWX 3OCWA 4PCAA 6Q21A 1TF5A 3GW8A 1H8ED 1MV8A 4Q1AA 3RFUA 4B31A 2BJHA 4TYYA 1IQUA 1PGJA 5AQEA 3K32A 4QREA 1JQLB 1P4JA 4DCCA 1BXGB 2IHZA 4ML3A 5ITSA 5EYPA 1N5DA 4MVJG 5LOVF 1XTIA 3NEJA 4YAOA 3S4YA 1E6KA 4F96A 1AA6A 2F67A 3Q6IA 3SKVA 5BSEA 2FRXA 3GJQA 3UEOA 1XTSA 3K71B 4MYCA 4RJLA 5DHAA 1M2JA 3ANNA 4R54A 4GUDA 4NH4A 4AECA 1OX4B 4OGWA 1X0VA 3SR4A 4AUMA 3U1VA 1ODIA 3DBHB 5K0GA 2NX2A 2XA2A 2ZYAA 4WDRA 1IN4A 2H51A 3QU2A 4DIEA 1S2IA 3S6JA 3WQHA 4JCOA 3J81A 4OXIA 1FYDA 3VR5D 2YV4A 4QNNA 5IBCA 3CVYA 1FXUA 1NQOA 3ELDA 1K6MA 1Y6ZA 3Q6MA 1Z8NA 2VEDA 1FTSA 3HNOA 4Y9TA 4CV3A 3ZD8A 2XVMA 1VYHA 3BTSA 3VPAA 5KYYA 4LV6A 1T9GR 4D4JA 1P77A 2BE7A 2HJSA 2E5WA 4IEFB 2RD2A 4Q9KA 4PPFA 2O8CA 1NT4A 3HDGA 2P91A 5KJ6A 1P1CA 1SB9A 3HO1A 4RU1A 4NYMR 3BAZA 1OTHA 2ODBA 4R9NA 4HZUB 1Z07A 3ROQA 5JCOA 2JAWA 3MTEA 1GV0A 1T9AA 2Y66A 3BFVA 4WESB 1UMDB 2QVLA 4KSYA 2RGBA 5GGYA 3B7PA 1CR4A 3M4NA 3NM6B 5GMOA 1E1CA 3CNLA 3CUYA 3OWXA 5CIYA 5EMMA 1H0SA 4G8JA 4ZGGA 4XE5A 3RIYA 4YRPA 4ALMA 4F0JA 1F7VA 2EEPA 2GJAA 3T1OA 4AQDA 3OIFA 2FW7A 2YIDA 1TKCA 3T5TA 2C2BA 4FYYA 3V7UA 1F0YA 1PGOA 2JHGA 4Q16A 3S68A 1AUXA 2ACEA 1S7CA 2WT9A 3F74A 4FNMA 3TM5A 4BE4A 4DT1B 2VZ9A 1ZOIA 3LQ2A 2M1ZA 2A33A 2GZHA 1MXHA 2NU9A 1ISIA 3HZRA 4CHTA 1JLMA 2H63A 2IH4A 1ZP6A 1T5HX 1QRAA 3RSSA 3OFKA 3EIWA 1RADA 2H6EA 4ROSA 4CXMA 2O2HA 4MINA 5D1NA 3JALA 3QU7A 4AF8A 1X1DA 5DSTA 2ZAYA 4HGRA 3HU5A 4D0LB 3WWEA 2L18A 1GU0A 2NUBA 2JIMA 2PY6A 4ZC1A 3VNQA 1USVA 1MB3A 1SVOA 4TPKA 2PD6A 2DWUA 2VK2A 3DZFA 3HSYA 3KKZA 3L0IB 1AB5A 3T9BA 1O0CA 2Z56A 4FYVA 3IVCA 4X7PA 4CKCB 1P33A 4KN6A 4YP9A 5K09A 1G6HA 3KKNA 2DFPA 2AW3A 2KHZA 2YQ4A 4GRDA 2QRUA 2W6JD 2DP4E 1E1RD 1FB5A 2PV0A 4MMZB 4K0KB 1I94B 3OPVA 3SX4A 3L7LA 3V6LA 1GPLA 1R6AA 2HOQA 1RJGA 3ROGA 2JI4A 1XTKA 4PN7A 3PHHA 3PNVA 5IC6A 2FGJA 5JMPA 2IEBA 3JWEA 3RF7A 5REQB 4BNMA 4G3XA 2X4LA 1P5ZB 4FILA 3WBKA 2J3DA 2ZZMA 2OXEA 2QX7A 3F4KA 4OQZA 4LBYA 4GZ5A 1NAHA 3UICA 1GZUA 2ZYVX 2SBTA 4KQHA 1G7TA 1BVHA 4BATA 1NQUA 5U9CA 5F9FA 1SQFA 1TYCA 4YEDA 1RMTA 5A4DA 2KWIA 4FCVA 4QPJC 5B3JC 1V4NA 1VKZA 2UVDA 3OPMA 2R8ZA 2XB6A 4BVBA 4B7AA 3Q2IA 4XD7D 1Y3DE 3KFLA 4L6AA 1MF7A 1E3JA 4QNMA 3K2IA 4IMIB 5BQXA 1QS0B 5A2QA 1RDFA 2RG7A 3PA8A 4YJFB 4YCSA 3KU4A 3ROZA 3IPXA 5KQGA 3DHEA 5T57A 2BDTA 4M0DA 1P19A 5HGXA 1ZZEA 5E9JA 1XNHA 2DM6A 3GGCA 3JR3A 1ODTC 2I7CA 1S2NA 5JJIA 4LBVA 3C3PA 3LRXA 2CHUA 3PNOA 1FP6A 4H0NA 2KSQA 1IWBB 2P4UA 1MPTA 1W88B 3UWOA 2BGUA 5JRZA 4R3WA 2B5VA 3DQPA 3OCXA 4J7AA 3PJDA 5AK4A 1VSTA 1VPWA 1U6IA 3NEAA 1ODJA 4MH0R 4RY8A 1X1TA 2BHSA 3OIVA 3O8LA 4EMUA 3HY3A 2ZR7A 3PQ7A 4X60A 4X7BA 3QKUA 3QYFA 2EW1A 1MIOB 3VR5H 3HRIA 2UZAA 3K9HA 4LHSA 4WEOA 2EBFX 2HPAA 4TQGA 1JNYA 5FXMA 4BNLA 3CG0A 3LF2A 3MMSA 1EZZA 3S7TA 2FPPA 1QUFA 2ZTVA 3WKAA 1S8OA 1U5BA 2OCDA 4ZDWA 1P9LA 1JEYA 2PQMA 1ZMOA 3FZGA 4M7PA 2IZ1A 3ZQKA 1ZN9A 4PYLA 2FE4A 2HRRA 2YJNA 3M4ZA 3R6DA 4MCHA 2UAGA 3EVNA 3ZDEA 5HZKA 4ZCIA 3B9BA 3QJGA 4HYTA 4CNQA 3OQIB 2ZXFA 5JEDA 1N57A 1WZIA 2C98A 2GEDA 1KZHA 4NPAA 4MRNA 5TVKA 1G7CA 1CLUA 4YT2A 4X62B 4C7VA 3RYCA 3GPDG 3C7AA 3LECA 3JRWA 3PUJA 3O93A 3QPWA 3THYB 4IWNA 5K1ZA 2HJGA 2R5NA 2H59A 2V55B 5CFPA 1H3FA 2K87A 4LSMA 4YAJA 1RYEA 4Z2AA 4UD2A 2YFQA 2WSIA 2YWHA 4U4AA 4LCBA 1RQLA 4RMHA 2YFKA 1FDRA 1HDGO 3GR6A 3GX1A 1DEHA 1QRDA 3MGKA 4FFDA 4I1VA 5DHPA 2R6R1 3H4VA 4HDMB 4E32A 4DDWA 1JDUA 2JGKA 4RM3A 4AZTA 4BO7A 4UTXA 3RTAA 1JLSA 2Z2JA 3E5RA 3O9VA 4YRRA 4R41A 4XR4A 5DP2A 4ZV4A 1Q7GA 4OX9B 4F6RA 4I5FA 1SUEA 3TLGA 2VJCA 3HFGA 2OLEA 3HB4X 2LCQA 5KMGB 2QN7A 1EKXA 3H5NA 3OT5A 5I9SA 4EO7A 4I50A 3OIWA 3R3HA 1QH1B 4MW5A 4YJGB 2XOEA 3F4LA 3TSOA 4BZZA 2ATIA 2QBYB 1TUBB 2JASA 2J0VA 5KYNA 1E94E 1F9AA 1U2PA 2XXBA 2FPGA 4RXUA 4Z1OA 2HT1A 1BFUA 1QTIA 5BWNA 1WU8A 4NL4H 1KYYA 2VUUA 1XMQB 3ZZMA 5HZMA 1VGVA 4LKOA 4NKRA 3RSFA 1Z2AA 1YZNA 5JSFA 4RDCA 5LPNA 2CLIB 1XWFA 4XOIA 5DULA 5DFAA 2AN9A 2O8FB 4RKYA 4CMEA 1W5BA 2H18A 2GPSA 3II6X 1CR6A 5AI4A 5GPBA 1UPCA 1YQDA 3NETA 3P5SA 2IYSA 1TKRA 2EJTA 1KRHA 4JP8A 5MHTA 3NGXA 4EMTA 3B2QA 4LXTA 4FHFA 3IRUA 3Q3VA 4I5GA 4F5EA 1G1AA 4ETIA 1PN3A 1SXJD 1Z7BA 3RHTA 4BMVA 4HNAB 3VSAA 5CDGA 1GNQA 4EFNA 5JJCA 3PUIA 4YS6A 5IKPA 4AXXA 4CG2A 1E0KA 2YYYA 1ECLA 3SBOA 3ROPA 1YQ9A 2QW8A 5ALDA 2IH5A 5GM2A 1ATZA 4MV4A 4GP9A 5CVCA 2QMEA 3R7DA 2FSFA 4D0NA 4D74A 3FF1A 1I1HA 3G13A 3QYJA 3IE0A 1YRAA 3AEUB 2E4WA 4J9UE 4E7PA 5CH3A 1F6DA 3AHFA 3CURA 4EX6A 4XVHA 2CVPA 1W25A 4HAOA 1CY6A 2VKTA 4KPUB 4OATA 3FNFA 5T8KC 2L82A 1XKQA 1ISRA 4XSGA 3IC5A 3ETGA 1FRZA 3EEQA 4F9EA 2BHRA 2DBRA 2VWPA 5E8RA 4DNOA 3TQSA 5CA1A 1NHGA 4NCAA 1R3DA 1QTQA 1GYRA 1MJGA 4PBRA 1HZZC 2YNMA 1RYYA 1XQ1A 2YW2A 3KVVA 2B0JA 4MVYA 4CTMA 5I01A 1K4MA 4O8CA 3HACA 1XRNA 3O5AA 1E9BA 5HOEA 2A4KA 2WIJA 1WNTA 1Z7GA 3EN0A 3FAZA 5HS6A 3TI9A 1RAHA 1EK1A 2XIQA 5G0SA 1VP3A 5AI6A 1O95C 3REQA 1HT1E 1REQA 3TX2A 3WLLA 3KE8A 2R47A 3HR7A 4H6WA 2WC1A 4KQ2A 1UK9A 2Q3FA 1II0A 2H11A 4G1BA 4JWTA 2AVNA 1OTYA 1U02A 2WZBA 4MIYA 5BN1A 5IEJA 1L3CA 1OR8A 1PK8A 2IF0A 2GVZC 4HJRA 4U7PB 2EQBA 1SBYA 4XWGA 3V32A 3LCRA 2N46A 4B6RA 1WRBA 2Y1WA 4RJKA 4UASA 1OT5A 4F7WA 2KBFA 1X7DA 3V3KA 1N2CA 4W6ZA 2EDAA 4BPRA 1R6XA 1ZVKA 2C3MA 3QVWA 2NUPA 1IQPA 2COEA 3MMNA 1YAHA 1HORA 4JNKA 1H5QA 1PWZA 2I62A 3AHHA 4MEJA 3WG9A 4A0RA 1KIMA 1ZQ9A 3F6SA 2Q9UA 1QIHA 3ZDRA 7MHTA 1E8NA 1EDBA 4D9KA 4NBWA 2DGDA 5I47A 1B93A 1CUEA 2VSNA 4HLDA 3BQ9A 4CFSA 421PA 5CDFE 4RETA 3Q7TA 1T91A 4Q4HA 5GONB 3RIEA 4NOKA 1X70A 4U02A 4B74A 4OHBA 2RB5A 3BWCA 2OAP1 1TAUA 1C9MA 4AZVA 3EA4A 3IE2A 1XMXA 2GI4A 4V3BA 1JPVA 3ESRA 1RD4A 2CLDX 5KOHB 4OHUA 2AKEA 1YE8A 4GMFA 1F3LA 1E5TA 1QHFA 5ALMA 2XJ4A 4QRHA 5EFOA 2TSYB 2Q2OA 3N8KA 1E2PA 2N1MA 4MI1A 4YCJA 5AVVA 2HPHA 3KDPA 2XVAA 5EIOA 2B8JA 2WHRA 4GSYA 3N2ZB 3OM1A 3AB8A 3SZLA 5HKAA 3IHLA 4L8YA 1TJNA 3PQ2A 3QUQA 1PJSA 2R1UA 4QXPA 4NG4A 3P4YA 3ZTWA 1VG1A 4EG4A 4RPLA 1N0IA 3VV2A 3DDHA 5K51A 3V1TC 4RK0A 1ZJ4A 1PT5A 1ZH0A 4QARA 1LY1A 1XV5A 1FS6A 2WYIA 3GJSA 1VPVA 2BTQB 2J3EA 4I1YA 4KVAA 3I0ZA 3T34A 2GHQA 1YR7A 4V0MA 2YJ4A 4KNWA 1V11A 2FP4A 5E1MA 3JPWA 2JAHA 3JVDA 3R7FA 2W93A 1E2KA 2AXQA 3AVPA 1JBKA 3IPCA 3QWBA 3ZU6A 1QDLB 2HF8A 2Q1TA 4E2FA 2Q28A 5IRCD 5M3BA 3ZVMA 2F1JA 3TSYA 1VSUA 1VMIA 1WHTB 3LP8A 4RK6A 1CVLA 2B6NA 3GHYA 4CF4A 1GN8A 1EP1B 3X1YA 4OI4A 1P2GA 2PZFA 4MB0A 1TQ4A 4J07A 5ICFA 3WMXA 2QIPA 2ZB3A 4IRUB 4IXMA 1E60A 3FLBA 1H2BA 2Z1MA 3CRMA 3FIUA 3Q7QA 3T4PA 2NV2B 3ZK7A 2G28A 5SY6A 2RC6A 3BCHA 3TG8A 4PLHA 1W96A 4I55A 4LK3A 1M1XB 4OQNA 1JAZA 4UUBA 5F52A 3W5IA 3WGNA 1ZNWA 2E4VA 4DMRA 3HRHA 1NBEA 4KO4S 2OM2A 3KKOA 2EIHA 3WWPA 4DIMA 5ES3A 4C2UA 1CJVC 3T12A 3FD8A 3UAXA 3CUWA 4FFLA 1GCIA 4CBVA 1L7OA 3D3QA 3MJCA 4HAXA 3CA8A 4MWBA 1K88A 1U2EA 2OUIA 4E31A 2QMUA 1JDJA 5GY7A 1FVOA 1K9SA 1RLMA 3BB3A 3H2ZA 3EWAA 1V9LA 3FCUB 4IO0A 3FPKA 3RRNA 3TNLA 3ECAA 3SC2B 1LRLA 3MTDA 4AJPA 2YDXA 1ORTA 2L19A 5L53A 3ZV5A 2EKZA 4ZCRA 4H08A 4QYMA 2RGAA 1L5RA 3H8WA 4G01B 2PA3A 3ZWCA 2DWQA 1VE3A 2GWRA 5G41A 1NSTA 3SXJA 2AB0A 2CK3D 2REQB 1NTRA 2O05A 1D6NA 2VN8A 5F76A 1SUIA 1WSBA 1Z6ZA 4XJVA 3HHPA 1C7IA 4GE0A 1OBOA 4M53A 1EBBA 1JU4A 3JYNA 2LXNA 3ZXUB 2J07A 3A1VA 3KAQA 4J91A 2Q8QA 3ZW9A 1KI1A 1AZWA 2A2ZA 4RA6B 1Y8QB 1K92A 4GI3A 4PC6A 1R0CA 3BB1A 3EXAA 3OZFA 3IO3A 3LOQA 5LNK6 2I78A 3DTYA 4J1QA 4D45A 4I99A 1TTPB 1XZJA 3OM9A 2LKCA 4BLSA 2H17A 1BXKA 4CKBA 1G60A 3LL4A 4DV3B 2BI7A 4NE2A 3PUXA 4NTZA 4A23A 4BNDB 1I5OA 2A1UA 4QX6A 2HIAA 2O1WA 3ZE7A 5KTOA 3E5MA 3CB4A 3FMVA 4MO9A 4IR7A 3TCKA 4YRMA 3QSGA 3ROTA 3O2SB 1RKXA 1SY7A 5H1YA 1TYAE 1GKKA 1NW6A 3JQRA 3KVYA 1C1DB 2CYAA 3L1HA 4ZIRA 1FDWA 3PXCX 1NVBA 4NJMA 4B35A 2IXAA 2XZOA 1XJCA 2J0QA 3LW8A 4TL8A 1MC8A 3TXAA 2B4QA 2ORYA 1PZMA 1ISMA 3KUXA 2WJAA 3OAAD 1ZD2P 1OXTA 4DTCA 2BEWB 2YHAA 2FW0A 2P3LA 4FI3C 4I9NA 3AF5A 1FYXA 1RACA 4L1KA 3LBIA 4X63A 5G4KB 4D6XA 4HUQB 3N0WA 4GKAA 4JR0A 1EJ6A 3EX7C 1FMTA 1QHHA 4LTMA 2C88A 1GQQA 4R2KA 4R1NA 4XFDA 1X39A 2JFYA 1VCOA 2V4UA 1H0KA 4MHOA 1T43A 1K7CA 2E9SA 5ALQA 5U1PA 4BRUA 5HJ5A 3VKHA 1ODFA 1K3FA 2BMDA 1E77A 2HLDA 4DRXA 2Q4EA 2QTTA 1NI3A 4BNGA 4MQFB 5BV8A 1D2CA 2NUAA 4IH4A 2GAIA 4OA8A 1NQTA 4EPXA 1XIVA 2P27A 3ULKA 4EUNA 3SR3A 1EX1A 1DO2A 4W8HA 2AS0A 4Z49A 4JUFA 1KE1A 3DLHA 4NBSA 3GGSA 1G3IA 4R9SA 4UBLA 1JG7A 2VJPA 1PBNA 3B1ZA 1QU3A 3DWFA 2IU0A 1FPQA 1SBHA 3OZBA 1MP0A 3VZDA 5LMCA 1ZIXA 1L4UA 1A7UA 4X7MA 4EJFA 1E4YA 5HFNA 1ZK4A 2XCSB 2ZUTA 1SXIA 2QSUA 4G0NA 4JOQA 3TW6A 1XMIA 4FFWA 4S35A 5KDDA 4KFUA 3KEMA 4DM7A 1AKWA 4XOUA 3THXA 1L5SA 3WRXA 1U0FA 2CWWA 1Y9DA 2P6OA 4BNJA 2DHDA 3H5LA 3RSQA 2FDCA 4BKQA 1A8IA 4G86A 2V7PA 2OXCA 1S9DA 4JC5A 1T13A 3O8NA 1GNVA 3M82A 3MN1A 3ZDZB 5ENDA 3QITA 4LYGA 4LWPA 4ZU1X 3P32A 3CGGA 3E22B 1ECPA 1P4SA 4EY5A 3BWVA 1IG3A 1XCLA 2HPZA 2MR6A 1IBLB 1EUQA 4BHTA 1Z2CA 2G9RA 4MW4A 4NK4A 1UBRS 2JLUA 4S24A 4ZVPA 1YJ5A 1YQQA 3NAMA 2VJBA 1GSHA 2WMOB 3SBDA 1XHEA 1CULC 4B85A 3E23A 4RZ2A 1ABFA 1UM9B 2A5DA 4NULA 2I2BA 5DK6A 2WSSA 3N70A 4YJ2B 4CMAA 1OB2A 1YZUA 4JJIA 3DFFA 1F5SA 2CDBA 4XLTA 4NRDA 1Q3TA 5HUQA 2CNWA 4BKMA 3B3QA 2IZ5A 3GJ8A 1AKYA 2HR1A 3BSSA 5J2UF 4IQGA 4M1SA 1FYFA 1Q1AA 1Q50A 3D0OA 1KDZA 4CPDA 4EEKA 5HKOA 1GQYA 1KYQA 1HNXB 1E5LA 2MYUA 3FWHA 1AUVA 1LPSA 1YA4A 3FTNA 3RSHA 3LG2A 2H9YA 4G84A 1O9HA 2A14A 4ZT7A 2AR9A 2WWHA 5A02A 3IJRA 2ZAOA 3CJTA 1F2TA 1ORIA 3JX9A 3KUCA 3OT4A 1G8JA 4Q9IA 1YK0A 3DE7X 5ALHA 3O8OA 2AMFA 4ZICA 5A5VA 2J0SA 1WZ2A 3B6MA 2WVGA 1KK3A 4W1RA 1OU4A 1DQPA 5FPTA 3SJ7A 1XRSB 5U4QA 3STVA 3WXMA 5EIXA 4NDZA 4GMXA 3TEMA 2F59A 2ZSDA 3A2NA 4JKOA 3U37A 4EG6A 4EJ6A 1VE9A 4O0MA 4IFTA 1Y9EA 1DRVA 3HDYA 5LCXA 2XMCA 2OHVA 5EP1A 1UFRA 1NVDA 5EZSA 1KOGA 2I99A 3I28A 4F85A 4IXNA 9LDTA 2VYQA 1SPXA 3I9NA 3AWDA 3V8BA 3WICA 5HJEA 4BFTA 2QE7D 3PZRA 5I9LA 3EUEA 4FNGA 4U5QA 2XMGA 2AWNA 3MELA 3QU4A 1MNAA 3DFIA 3MRTA 3LGAA 2RGYA 3QKWA 4TLAA 3THOA 1DV1A 1N0VC 3G2NA 3IP1A 5E3HA 2A1TR 1X1QA 1FNBA 2AFRA 4KLZA 4RY0A 2HB6A 1M66A 4R2JA 4URHA 2NNLD 3NHKA 1U0OC 4QDOA 3HWRA 2YWCA 5HRUA 2Z9CA 3M89A 1S7GA 4EB6A 4YPOA 5ICGA 3B6ZA 5GIPE 4E1BA 4ND7A 4U7FA 2VLIA 5B3AA 3PDCA 3L7BA 3LUPA 2HU5A 5EYPB 3ZU2A 2Z6QA 3H2KA 3CVWA 4NV3A 3HUEA 4HNRA 1FA9A 5KPJA 4WACA 2X3FA 1L8OA 4BEWA 1NJFA 3W6NA 1NW4A 3GO4A 4MDYA 1C4XA 4C6TB 1RXYA 3HXTA 1E61A 2IELA 4KW7A 4RZUA 5JD3A 3CLRD 5TMBA 4C4PA 3IEVA 4IDHA 1P2UA 5F3RA 1ONNA 1R0SA 3K20A 1JJVA 3OD1A 5FKJA 2FPIA 4FEYA 4OU5A 3CTMA 4BECA 4Y2XA 2OP1A 5BUSA 5G0WA 1Q0RA 1E89A 1SQGA 3QVGA 4PINA 3S2YA 1ZAKA 1FTYA 2P3OA 3A4YA 4FP9A 3WAGA 2GPYA 1I2ZA 4AROA 3VSDA 3FDZA 2WAMA 4XIJA 1GQOA 4ZD6A 1GKYA 1QM5A 1L0BA 4INJA 4QRIA 3HUUA 1RWVA 4DJAA 2HGSA 2QUZA 2UUOA 4F1JA 4NYMQ 5L40A 4MHTA 4WNIA 4AM8A 2IUEA 3HH8A 5J58A 3O1LA 5DDIP 1RXVA 3BD6A 1QG6A 2PUJA 5I9IA 1HDOA 1V3VA 4CKXA 2B5OA 4LQDA 2DHRA 1VHQA 5HBGA 4JX8A 4LCJA 1YDWA 1X8KA 2OLJA 2JFFA 5FR1A 1EINA 3MJEA 3CCCA 5EERA 5ES4B 2B36A 1KAEA 1SK8A 5SZHB 1ZM2A 4FFBB 4E1VA 1XL1A 2GSWA 4FZVA 3TIVA 4CL2A 1IEVA 2G7ZA 2MDTA 3WSWA 2DQ4A 4CMIA 4Y1GA 4GP7A 1E4EB 3M7IA 3OOSA 3VNRA 2X58A 1NI4A 1JTEA 4I1SA 3O4GA 4QDTA 3R6WA 1YZTA 4J1TA 4F11A 5JCJD 1S2MA 1KDTA 2K7ZA 4IFIA 5IT5A 3GRUA 1IOLA 2H4FA 2I03A 4LF6B 4N03A 2QMYA 4FJ1A 4JFAA 1LQ2A 4MWDA 3FCCA 4XM1A 2FPMA 1P7PA 5DNWA 1KOLA 2VYNA 2NU9B 5FBVB 5AW2A 5L7TA 3EXG2 1HNWB 2PUAA 4C7OA 2JIRA 3E58A 3GEDA 1BJRE 2A88A 1NP6A 4J1SA 2QAJA 3NANA 3KAPA 1GL6A 3G5AA 4KAAA 4EJSB 4NFSA 3H11A 3WZ2A 2HUPA 2J3QA 1EBUA 4QUGA 1M8PA 2W7TA 2WDZA 2WUDA 1D4FA 3WLAA 5FA8A 4TTTS 1OH6A 2AG5A 1EEXB 3KQYA 4C0LA 1EVYA 2WSMA 3GA7A 3IMGA 3N7AA 1NL3A 3PZBA 4H7EA 4H7IA 3PQDA 3AKEA 4LDAA 1SULA 4P5PA 1JA0A 4H0FA 3DC7A 4EYKA 1CJUC 4OLAA 1NJ8A 3MRVA 5IABA 3PHJA 4EBFA 4IQ0A 3U7EB 3K9BA 4OLFA 4D81A 1V71A 4PPYA 2E7ZA 2A8YA 2W43A 4TKUA 1F51E 3C85A 3Q3CA 2X76A 4LXXA 2WLSA 2M6KA 2YQZA 5BT9A 5JSHA 3IESA 2OV4A 4K28A 1A3CA 1QFYA 1X7GA 4HB4A 1UFKA 3GEMA 1NVEA 4KLCA 4RNCA 2QV0A 4TV9F 4ASUA 4IY1A 4XPIB 3BFPA 1S8NA 1XTQA 3BK1A 3S29A 3QI7A 4D43A 1I7NA 1YIOA 2UZ4A 2XYQA 3P20A 2OD9A 2OKGA 4ZK2A 5KX5F 2Z5VA 1I36A 4G0VA 3DE0X 3RI3A 2QYTA 1F4VA 4QD3A 2IIBA 1QVZA 3K96A 1Z5ZA 2A0YA 1U3VA 3C6YA 3D8RA 3COWA 3H9BA 3R2JA 3DZBA 4MCAA 3RJTA 3UK6A 1I8TA 2FOIA 1TCAA 3ZDYB 3LVFO 4YUYA 2ETVA 2R96A 3RS0A 4IKOA 3DMNA 4JKIA 4DHEA 4PSCA 3S40A 3D59A 4N6NA 2PRSA 3REOA 3WZLA 4RTKA 1A5BB 1IOZA 1GEEA 1QR2A 2CHVA 2O3QA 2VJQA 1PT6A 4BJHB 4KR6A 1E2DA 1I4WA 3P7MA 2BH9A 4FHDA 1KVTA 1XRQA 4LY6A 1KAHA 4JS0A 4WFJA 4YQFA 1HK7A 2EFJA 1FEZA 1GTZA 3PC4A 2PD4A 4YJDA 3WGHA 1E3MA 3G49A 4QDJA 3QVOA 4XUGB 5JH7A 2ZIGA 2R2AA 1QB8A 4QO8A 4RPCA 1MEOA 1UH5A 1VJ0A 4YFYA 1BG6A 1GGHA 2I4OA 1SVUA 2OILA 3AUUA 4XB2A 4MQ6A 3HKEB 4OBXA 1HV8A 4PNPA 1PLLA 3NHAA 1EVJA 3G85A 3M6WA 4II2A 2IYTA 1HLGA 3VYWA 3C45A 4RX1A 5CDFA 1X7WA 4RTOA 4UHCA 2ODPA 1MW8X 3UCFA 2VSXA 4B3BA 1B23P 1VI6A 4EX7A 4GKVA 1E1KA 1WW2A 3TD2A 4JI0B 4AWAA 8AT1A 2C95A 2G63A 2R8YA 1NTOA 2B4KA 2W0SA 4O4HF 2VUTA 2IKSA 2RJOA 3WHKA 3JWIA 1N3YA 1WZNA 5BORA 1JEYB 3AR3A 1YHZA 2PSEA 4AKHA 2C2WA 2QJWA 1VRCA 5AJWA 2H2HA 2B2NA 1RWMA 2O7QA 3DZKA 1JG4A 1K3TA 1GZSA 1PL8A 2PEYA 1WE2A 4HF7A 2FZVA 2CXRA 3W90A 1V1MB 2BCGY 3QPVA 1AKRA 5I3CA 1Q0LA 2NZVG 1JDTA 1JSCA 3GVIA 2X6RA 4JLOA 4X5OA 4N6OA 5I7AA 2JLBA 3RYCB 1N5LA 3DA8A 3JQEA 4KR9A 3K9GA 1PK9A 4JOBA 4PG5A 5JV5A 1JEOA 3MILA 3P71T 5CK5A 3U0BA 3ESDA 3BFKA 4S05A 2P79A 1W73A 2DPMA 2WP8J 1C9NA 1WXIA 1D2MA 3AKCA 2RCYA 3IFSA 3MWGA 5K3FB 4BO2A 5IJ0A 2JFZA 3I53A 2BMFA 2AUNA 3FYUC 3RC8A 2GBPA 3DTTA 4WAUA 2AXEA 4WA8A 1BFDA 2KW5A 1Q83A 5FL3A 1H2AS 5LWQA 1A82A 1W4RA 1JL3A 2DVMA 3H1FA 221PA 1X19A 4IQ4A 3HV0A 3AEXA 1INLA 2CV0A 3UJ8A 1RQPA 2FUG6 3DQZA 1ZIYA 3KOOA 3MWLA 4IINA 3W6ZA 2K7FA 1Z56C 1KO1A 1TVEA 1X7ZB 1ZXXA 3D4BA 4I50B 1KBQA 4DDHA 1U94A 2OZKA 1V5IA 1RFGE 1N8SA 1Q0TA 4ZVTA 2ERYA 5C35A 5FHRA 4HQKA 2WK1A 3ESXA 3MYYA 4NQZA 3T06B 4E13A 5LU8A 1QGED 2IHKA 5KQRA 4P7GA 3LE8A 1U7UA 4YDHB 3UKOA 3MWFA 3UWSA 4PRYA 2HSDA 5IFLA 2YXDA 4L51A 2OB2A 1TYZA 3O90A 3ETCA 3T4EA 2WLTA 2XUFA 3TAUA 4EFKA 4EG3A 2J32A 3C48A 1K8XB 4BCDA 3CR7A 3KLMX 3ZKWA 2OUKA 4NF2A 3N87A 4B4UA 3GJ5A 1A8UA 1RZUA 4EHLA 1R5BA 3T95A 1ZJWA 2BMAA 1BCSA 2G1KA 1Y9JA 3EF3A 2QVGA 3EULA 2CYCA 2ASEA 2XUPA 1NVMB 2XTAA 3QNWA 1E1QA 1M34E 4ARUA 3QOFA 3BGDA 5LUAA 2R1TB 1E2LA 2VBFA 1B0UA 3LT2A 3VKUA 1LRKA 1GL7A 5F7ZA 4AJ2A 3CMMA 4IFBA 2DY1A 4X91A 3F6PA 4ALNA 3ICQB 4GM1A 2DCMA 1VYTA 3E8SA 3A14A 3B3AA 3NC0C 1NXOA 2GBLC 3QWIA 2X86A 3SSNA 2XD4A 5BR4A 3ZVNA 1BMDA 4KC0A 4DSZA 4M7WA 2NZJA 3QY0A 4U39A 2BEUA 1Z2PX 2Y1LA 2BM9A 3MEQA 1R12A 4ABTA 1YBFA 3ZH9B 1XNGA 1GYQA 2CCJA 2R1VA 4LMAA 4WHMA 1P8JA 3ZHCA 5IMSA 4DS3A 4EW1A 1TAGA 3COZA 4BJ6A 1RYDA 4RYDA 3L84A 3VR3D 1G5HA 4JELA 4KO1S 1OIXA 2OO5A 3ZGYA 1NYRA 4N4AA 3MOSA 1OYWA 2JL1A 1B74A 1OC4A 5J1TB 1QRTA 3EIXA 3KJNA 3AUFA 5K6AA 1DX9A 2Y6UA 4B3FX 5BW4A 3ZI4A 5BVGA 2XEDA 4E5UA 2D59A 4HFRA 3G5UA 5JADA 1WUHS 3UHFA 4PG8A 3RTBA 2R79A 4E21A 1TLLA 2PRIA 2ZW9A 3LKZA 4NJEB 4PQGA 5B58C 1YMUA 3HJGA 5ECYA 5BR8B 1YSCA 4JY7A 4M7OA 1ZI8A 3CUKA 5AVKA 4CM3A 2DF8A 2QR5A 4A73A 2GDJA 1FXWF 2HF9A 3JQ6A 3D7KA 3ISVA 5F51A 2BUBA 1T6XA 2XD9A 4GO1A 4B1FA 4WMLA 3UB4A 4EUSA 3REQB 1G20B 2C07A 2ODTX 5EZ6B 3PLAE 2C8JA 2QRJA 1CE8A 2GK3A 2ILTA 2ZUVA 2JS7A 5ECGC 1RRKA 5EJ9A 5IAGA 3KEQA 3QKRA 4PFQA 3UWKA 2C7GA 2IDMA 4BC1A 4O08A 1O08A 3T15A 3VU0A 3U16A 1C4KA 1UC9A 1T5LA 1VL6A 5C5CA 5LL6P 5JRJA 2ZAMA 1WB9A 2C97A 4W5QA 1HG0A 1VKRA 1VMAA 1U63A 1Y6QA 1TQ8A 5CVJA 3KL4A 1RWOA 2XXAA 5IK2A 4KR7A 2QRNA 4LVOA 4ZOEA 5DMHA 4A1OA 3K70B 4LJAA 3N39C 3M6LA 2KX7A 4A4DA 3HU2A 1JKXA 2G80A 3KHUA 4GGOA 5EZ5A 1S2OA 3B6EA 2WBLC 4QDKA 3Q3GE 3WYGA 3U5ZB 2JD0A 4I4LA 1FY2A 1NVGA 4ZOAA 4O2BB 4IJQA 3RRBA 1U1CA 3C3WA 3OZIA 4WECA 2D74A 4DV0B 2HLHA 2EXXA 3ICEA 1G42A 1Y3IA 2RJ3A 3AP2A 3HR4A 3O2JA 4GGMX 4E12A 4E5NA 1H9AA 3RTEA 3V2IA 2GKOA 5FNVF 2FJPA 3BRSA 3SC6A 5GADl 3GH3A 2FFAA 2IXEA 3HM2A 3KETA 3VPCA 1YS1X 1TLFA 5I9BA 5ALZA 1X92A 1YAJA 2FWIA 2PRZA 4RA9A 3UMVA 2B25A 2UUAB 3OCYA 4D4KA 2V7VA 4J0FA 3L7KA 1BA3A 2IW1A 3SU8A 1IAVA 2OKCA 2X1VA 3HP7A 1PSZA 3A70A 3NBXX 2I1LA 4UC0A 2AN4A 3RLIA 6AT1A 3FZNA 5FNZA 1JGTA 5G3ZA 5JLJA 3A1UA 4YP7A 4O29A 1Z75A 1QVWA 4MPDA 2XYHA 2NXNA 4AZSA 2Z30A 3PTLA 5DWVA 4LXYA 5AKYA 3H1PA 1KYIA 4X8MA 5EE9A 1ZC4A 4L3OA 3S0JA 5KTNA 4AW9A 2WSLA 1L7BA 3AM3A 3T7CA 2WF9A 3R5TA 5MN4A 3KQNA 4LN1A 4RLSA 1XDUA 3DH0A 1AHNA 5C8ZA 1V11B 3PT9A 1W4LA 2OZPA 1AK9A 4H6PA 3GRZA 1ODLA 4JOSA 4RCYA 2N75A 3Q7PA 3UK1A 3E84A 3FUCA 1RBQA 2GK6A 2RHHA 4OO3A 4DG9A 1U28A 3ND5A 4B4DA 3I1IA 4JLPA 3U4CA 3KTFA 2AJCA 5M5BA 4CEIB 4G9EA 2RHMA 4YROA 4TRMA 3LQ4A 5IKOA 2NACA 3HP1A 4ABYA 3HK2A 3EIFA 3FNHA 2BKLA 2PMFA 2Z08A 3LYLA 1KEUA 5F4ZA 1H2WA 3W78A 3FPBA 2QEQA 4M1WA 4TTIA 1Z62A 1UBMS 4BQQA 2VT2A 2GHTA 1C8LA 2HA7A 3OZUA 4JVNA 821PA 1OBFO 3VO8A 4M9XA 1YACA 2QVYX 3ZH2A 4QASA 3ZU5A 3OO1A 2YOHA 4Q3LA 3G5LA 1SUCA 1RPTA 1JG2A 2GT1A 1FLDA 2W2MA 4HP8A 3U7QA 1TO6A 3CF2A 1CRPA 3DL7A 1MX5A 2HBZA 4GI7A 2XB8A 1WOYA 2VBIA 5GAJA 4E5DA 4A91A 4N5DA 3NHMA 4K8OA 1VJGA 4IUYA 2Y8EA 3ZE6A 1IM2A 2J9GA 3UMRA 4P35A 4JSRA 2XCTB 1Z7YA 3GLGE 3H6HA 1O6FA 3I2GA 1YRHA 2AMJA 1DAIA 4CVNA 3K0AA 2Q27A 4UVGA 4ZI7A 4HDNA 1I6KA 5K0FA 1QE3A 2I67A 4NMHA 1TJ5A 4YLGA 5DX1A 2H1LA 4MULA 4H27A 1PR4A 1GN9A 3GLHB 2DEUA 1FTWA 1NBOA 3IHKA 2ZJ7A 1CUBA 2O4CA 1BW9A 2I6QA 4QUAA 4ALIA 1KQFA 4RIGA 3TM4A 5JY1A 1MGPA 1LK5A 1R4NA 4I08A 4EB8A 4R6XA 4U2GA 1GHTA 1NE7A 1ODCA 4MW9A 4OJMX 5FEUA 1KGDA 1FDTA 4R0NA 3TZLA 2GH1A 1JJBA 2ZYTX 4CR8A 4F4DA 4JDUA 2YHUA 3IELA 1JECA 4YHBA 4QJ4A 4YUWA 1XWIA 3PR3A 4QYIB 4HSEA 4NI5A 4JDPA 3PUHA 4NESA 3IQZA 4U2DA 4M83A 2UYOA 3KXDA 1VYVA 3GHHA 3IAXA 4YH1A 5E4JA 1SIOA 5LSAA 5TSDA 5LA6B 4LGYA 3NXSA 2JI7A 3HL0A 1GAXA 3EQ8A 5HILA 3AFIA 1JQAA 5A7HA 3IV6A 5H8WA 1SXJE 2A1UB 1J5PA 2OFXA 2QW0X 2RBGA 2VHTA 3AHCA 3M6IA 3OKFA 4M9SA 3UHAA 3W2HA 2W2QA 2WMNB 1NQ5A 1TC1A 3WQBA 2ICAA 1M2VB 2MSKA 3G8DA 1MJNA 3PS9A 3GBPA 3OLVA 2XCQA