1P1BA

Guanidinoacetate methyltransferase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
193
structure length
193
Chain Sequence
RWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monoclinic guanidinoacetate methyltransferase and gadolinium ion-binding characteristics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Guanidinoacetate N-methyltransferase
total genus 58
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2003-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1p1bA00
1RJEA 1P39A 1T43A 3A25A 3GWZA 4RVGA 3UJ9A 3EVEA 2IDKA 3CJRA 2PXAA 2FRXA 3NW9A 5IH3A 1JTFA 2CL5A 3KHKA 3LSTA 4QVGA 5LQUA 4GC5A 2G1PA 3KKZA 1WZNA 3P71T 1NW7A 4LWOA 5KYGA 2DULA 1XCLA 2VP3A 4GOOD 3FUTA 4FT2A 4PYMA 5HFJA 3CCFA 2QE6A 4GOLD 1KYZA 1EQAA 3O7WA 3GRZA 3P9CA 3Q87B 3FPJA 3IHTA 2H11A 1SVUA 3G8AA 2ZZNA 1U2ZA 4RTKA 3FYDA 2C7QA 5DM0A 4QVKA 4HSGA 3KQTA 5K0NA 1WS6A 2PKWA 2H1RA 4LWPA 4RTRA 4PYIA 4IV8A 5CCXA 3G5LA 2H00A 2HR1A 1R18A 3HNRA 4MQ4A 5EIFA 2R3SA 1VP9A 3P2EA 5EC8A 2PBFA 3KR1A 5FQNA 3HM2A 3LCVB 3AY0A 4HTFB 2AN4A 2YXLA 3OU2A 4YUYA 3ER9A 1EG2A 4QTUB 4C04A 4PWYA 3T7SA 5CIYA 3S68A 3BWBA 1YUBA 3F4KA 2EJTA 2IFTA 5CVUA 4EKGA 5HIKA 4H0NA 2XYQA 3PB3A 1VP3A 3OU6A 1M6YA 2ZBQA 4QQNA 4RVFA 3LDFA 1I1NA 3C3PA 5B1SA 5HILA 4RSRA 4RTNA 4YUWA 5T64A 3UA4A 5BP7A 2PX5A 2ZZKA 4R8SA 4V0QA 1M6EX 3LL7A 5CVJA 5DM1A 1EAMA 2OBFA 3ANXA 2IIPA 2NXJA 3FRHA 2HTEA 2P3OA 3B3JA 2OO3A 3QOXA 3GDHA 4L7VA 5EEGA 3REOA 3TR6A 5GIPE 2BH2A 2I9KA 1ZHFA 3DULA 2OXTA 5LQKA 3Q7EA 3K6RA 3UBTA 1ZG3A 2Q41A 2XYVA 2BR5A 2P40A 3FTFA 4OBXA 5M5BA 3CKKA 3LCUA 4KVZA 4GOMD 3FYCA 2PX2A 3MQ2A 2P41A 3PX2A 3TKYA 1L3BA 3FTEA 2PSSA 3PT9A 2PJDA 3KR9A 1D2CA 3KR2A 4ISCA 3GGDA 1SUIA 3AXTA 1X19A 1HNNA 3PFGA 2AOTA 3VC1A 4YV1A 1QZZA 2PWPA 1SUSA 3UA3A 1Y8CA 1EJ6A 2JJQA 2ZULA 2ZBPA 2BM8A 1NT2A 3LDUA 5HOQA 4GQBA 1O54A 2UYQA 3ERCA 2ZWVA 4C4AA 5K0JA 3FPGA 2OB2A 5ICGA 3M6WA 3MGGA 4B17A 1XDSA 3U81A 2B78A 3HA5A 3E05A 5DT2A 3P9KA 4LECA 1ZGAA 2XVMA 3I53A 3FTDA 3OE4A 1TPYA 3QV2A 1IY9A 5C9ZA 4RTJA 2IBSA 4DA4A 3CJQA 3A26A 4P7FA 1QAQA 3JWHA 4FZVA 5HIJA 5HIMA 5FUBA 3G8BA 5KQRA 3MERA 4OX9Y 1QAOA 3KQYA 4RVDA 1YZHA 3UJBA 5E1MA 2EFJA 3LKZA 1O9GA 1R74A 4P7GA 3DR5A 3UFBA 2FK8A 3SSMA 3NVMB 1RI2A 4GUAA 3A7DA 2YXDA 4HH4A 1XTPA 3G2PA 5F2NA 3SXJA 2QYOA 5EGSA 3G7UA 2ZCJA 3LDGA 3GRUA 4EK9A 1NV9A 1NE2A 1QAMA 2ERCA 1VBFA 1EJ0A 3EVZA 5E2BA 3TMAA 3P97A 1JQEA 4JXJA 3LCCA 5LQRA 4KDCA 4DMGA 3E8SA 1G6Q1 2R6ZA 2UYOA 3FUXA 4KDRA 5DLYA 2OYRA 4RYLA 4CKBA 3HCBA 4X41A 2HV9A 1NBHA 1YZ3A 4FP9A 1L9KA 3CJTA 5CVVA 2EJUA 3CBGA 1X1AA 3MB5A 3HCDA 5BW4A 1DCTA 4OQDA 3SM3A 3TOSA 5FWAA 4POOA 3P9NA 2AOUB 2P1DA 1KPHA 4NECA 2IH4A 2FCAA 1VIDA 3EGEA 4HGZA 3ELYA 5DWQA 2V74B 2N47A 1KHHA 3C6KA 3NWBA 1SKMA 3SMQA 3PS9A 3GRVA 4MWZA 2ONYA 3CC8A 1AQJA 3LPMA 4BLWA 1KXZA 3P8ZA 3OPNA 3RW9A 4C07A 5K0GA 4MHTA 4M36A 4PYQA 4RTOA 3O4FA 3EGIA 4C06A 3ME5A 5E2AA 2OKCA 1KP9A 1L3IA 3ELUA 4FT4A 5F2KA 5FCDA 5K8VA 5EKXA 4RV9A 1UIRA 3TKAA 2O57A 1YFLA 2AOTB 1O9HA 1VE3A 2QRVB 2YVLA 5LQJA 5CCBA 1YF3A 3A7EA 2C7PA 4Y2HA 4PNEA 3MHTA 3G2OA 5KQSA 5JUWA 4R6WA 4EKIA 3SX0A 3IYLW 5K0LA 5CD1A 2XBMA 1Z3CA 2VDUE 3R24A 5E9QA 2P7HA 3EEYA 1P1BA 3ELWA 3PFHA 3MAGA 4FR0A 3VYWA 4CTJA 2UZ4A 2GB4A 3G2QA 3HVHA 2G8NA 4WXHA 4A6EA 2IH2A 4PINA 2P8JA 3TRKA 2AOWA 2AOVA 2LD4A 4PCLA 1G60A 1FP1D 2QM3A 3OE5A 4X63A 2ZIGA 3M6XA 5LQAA 2O06A 4RTMA 4DKJA 2G70A 2HMYB 2JG3A 4GOND 3MTIA 3BT7A 3BKWA 4PIMA 2PVCA 5LQCA 3HP7A 2NNWB 5EMJA 4A6DA 2OPBA 4OA8A 4X61A 2XVAA 2YXEA 1AV6A 4YV2A 1SQFA 3KU1A 3DP7A 4CXMA 4RVHA 1MHTA 5K03A 5EZSA 3D2LA 4PYLA 5K0BA 5EIWA 5IKMA 3HTXA 3KPWA 4ER6A 1IM8A 3BGIA 3C6MA 1G38A 3R6TA 3FPEA 3BWMA 3G5TA 4PONA 1JTEA 3T7RA 3TM5A 2GPYA 3E23A 1H1DA 3JWIA 2BM9A 1KR5A 3ELDA 2NXEA 3HCCA 4ATNA 4R6XA 5EPEA 5ICFA 2YTZA 3OU7A 2Z6UA 2PXXA 1N7JA 2QRVA 3FZGA 3LECA 4OQEA 4QPNA 4CKEA 5E1DA 4X1OA 1L1EA 5T6BA 5EKUA 3DXYA 3KR0A 3EMBA 3O31A 10MHA 4Z2YA 3OZRA 2UYHA 1XJ5A 4BP1A 1RI1A 4YMGA 5KVAA 2Z6AA 4QTTB 3TQSA 2YR0A 5DRYA 1ZKDA 4E30A 2ZFUA 4F85A 4P7KA 5DM2A 4ZTBA 3KQQA 1N2XA 4KWCA 3GRYA 5GM1A 2Y1WA 2AOXA 2O05A 3KQSA 5HIIA 4CKCA 2IBTA 5FA8A 1B42A 3BWYA 4PGGA 1L3CA 5DXJA 3ER8A 9MHTA 3KPYA 3KQVA 2AOUA 3LX6A 5EHGA 1JQ3A 2PY6A 4AUKA 2PX8A 1P1CA 3NDJA 1R8YA 4O29A 4YMHA 3A27A 1NBIA 2FK7A 1BC5A 4YUXA 3I9FA 1SQGA 2FYTA 1XCJA 1OR8A 3MTEA 2AZTA 4PYKA 3UJAA 4GBED 3KQWA 5G02A 1ORHA 4RTLA 1AF7A 5C0OE 3X0DA 2GAFA 2PX4A 2ADMA 2AN3A 5EZQA 3V97A 2ZBRA 3R3HA 5E9JA 3SGLA 4MIKA 3SVZA 3M33A 4CWAA 1X1BA 2ESRA 2B25A 3HEMA 4E32A 2ORED 2NP7A 2EX4A 1KPIA 4OBWA 4QDJA 4E33A 3M6UA 3OFKA 4AZSA 1M0EA 3I64A 4XUCA 2NP6A 5JR3A 3PTAA 3M70A 5E9WA 1UWVA 4V0RA 4WVLA 1XDUA 2WA1A 5EMLA 3NTVA 4HRAA 2C7RA 3FPFA 2NYUA 3HA3A 4IWNA 4RX1A 4F84A 2OZVA 3HCEA 1JSXA 2JHPA 1TW3A 3R0QA 4QQKA 3EVBA 3LBYA 3NWEA 3LKDA 3MCTA 1R8XA 5K01A 1KPGA 4LG1A 1NW6A 2JHAA 4DM3A 2ZW9A 5FA5A 3EVDA 3EVCA 4DZRA 4M38A 2FHPA 1VLMA 2OB1A 2ZTHA 2VS1A 3EVGA 4KIFA 2KW5A 3GJYA 4GC9A 3EVFA 1VPTA 3M4XA 2E5WA 2F8LA 2I6GA 5FWDA 2P7IA 3BUSA 1Q0TA 2PWYA 2IDJA 5E8RA 2GS9A 5C1IA 3K0BA 3SR4A 4AZTA 4PYNA 3H2BA 3BZBA 4AZWA 1G8AA 2CWWA 5GM2A 1MJFA 1EIZA 3UWPA 1P91A 4AX8A 5DRTA 4C08A 4XUEA 1NW5A 4EVIA 1JSZA 5LSAA 1R00A 1X1CA 3E7PA 1JG2A 2PT9A 5FQOA 3LGAA 2HWKA 3GNLA 3HCFA 3UZUA 2I7CA 5DXAA 5FULA 2I62A 3KPUA 1VL5A 4GEKA 1R6AA 4FGZA 3THRA 5D1HA 5HEKA 3SSNA 1I4WA 1NW8A 1DUSA 3NDIA 2NXCA 3M6VA 1NKVA 3DH0A 4MTLA 3NVKI 2PGXA 1F3LA 2AR0A 2B3TA 4RTQA 4DF3A 5KS2A 3UJ8A 2ZSUA 5T67A 1RI5A 1VQ1A 4R8RA 2GLUA 5CVDA 2B2CA 3OFJA 3FTCA 4Y30A 5CVEA 3T0IA 4KRGA 4F86A 2C7OA 3LBFA 5K0EA 3I5UA 5DX8A 4FSXA 2B9EA 5EVJA 1N7IA 3JWJA 5BXYA 1QYRA 1G55A 1WG8A 5EG5A 1BHJA 3A4TA 3B5IA 3OZTA 2PLWA 2Z6QA 4G56A 1NV8A 3DMHA 2VZ9A 4RTSA 3B3GA 1IXKA 1DL5A 3BGVA 3EGVA 3KQMA 3OZSA 5ERGB 3DLCA 2V7EA 3FPHA 3G89A 3JWGA 4PIPA 3TLJA 3UJCA 1D2GA 5DM4A 1PRYA 5DPMA 3MCZA 3RODA 4BLVA 4ER3A 4UOEA 4FSDA 3AWIA 3DXZA 3CGGA 2ONZA 4HGYA 5F2OA 1I9GA 2IP2A 3FUWA 5GOZA 3GIWA 5DTRA 1JG3A 4E2YA 2AN5A 3HVIA 5EQJB 1V39A 2GH1A 2WK1A 5DTQA 4DCGA 5BW5A 5ICCA 1ORIA 1TW2A 3GU3A 2JH8A 1WXXA 4YV0A 1ZQ9A 3B89A 2ZLBA 2BZGA 1JQDA 3HA7A 3PVCA 4PYJA 5E1BA 5K0CA 3DOUA 4BP3A 3T7TA 1RI3A 5DSTA 2WA2A 1FBNA 4FS8A 4C05A 3WSTA 1XXLA 2YQZA 5P8WA 5LR6A 1BOOA 2K4MA 3GCZA 3NJRA 4HG2A 4U7TB 3TPZA 1RJFA 5E1OA 3P2KA 2VDVE 2XYRA 3EMDA 1NW3A 1JR4A 3P2IA 4PYOA 2ZVJA 4DCMA 2PT6A 4QDKA 5K05A 1FP2A 1RI4A 4XCXA 3BGDA 1BKYA 4ER7A 8MHTA 2IPXA 3B7PA 5GP1A 5DTMA 2BR4A 2CKDA 3HVJA 4E2XA 4DQ0A 3FUUA 4E70A 4HC4A 1YFJA 2UYCA 3UJ6A 5DX1A 4KIGA 4K6MA 2YUIA 5EMMA 5EMKA 1FJXA 2G71A 3BKXA 4GF5A 3PLAE 5GIOE 1RJGA 4E2WA 4R05A 1YB2A 2G72A 2O0LA 1Q0SA 5FHRA 3HCAA 4YUZA 5MHTA 5E8JA 5FADA 3C0KA 4M37A 3KPVA 4PCAA 5FTWA 3UJ7A 2CMGA 1FPQA 3ORHA 5H02A 4RTPA 3BXOA 1SG9A 2AVNA 3FUVA 3L8DA 5FHQA 5K0FA 3VC2A 3EEOA 2ZZMA 1AQIA 3GRRA 3HVKA 3GXOA 1X1DA 5GINE 4BLUA 5CM2Z 2P3QA 4EQZA 3CVOA 3GO4A 5K09A 5CUQA 4IV0A 3OCJA 4ER0A 1WY7A 3C3YA 1WXWA 1ZGJA 2EG5A 3KQOA 4BY9E 2YX1A 2IH5A 4RWZA 2A14A 2HNKA 1JG1A 3DXXA 1HMYA 2AS0A 2OY0A 4E31A 4AZVA 3KQPA 2PV0A 3G2MA 5GWXA 3SSOA 1KIAA 2BR3A 2IGTA 3AXSA 5DX0A 3TM4A 4ER5A 1XVAA 1QANA 3IV6A 4OA5A 2VDWA 3B3FA 3FRIA 3BWCA 3ID6C 5HZMA 1PJZA 2DPMA 2O07A 5D1NA 4CTKA 1KYWA 3V8VA 1G8SA 1JG4A 2JHCA 3IEIA 3LHDA 3DUWA 2ZIEA 1F38A 1UFKA 1D2HA 5LQNA 5DSXA 5EOVA 3PX3A 2QY6A 3EVAA 1INLA 4IKPA 2P35A 2ZIFA 4X60A 2P3LA 3NMUF 2CMHA 4XUDA 2FPOA 2NXNA 3QOWA 3UJDA 2Y1XA 4KW7A 4HTFA 1XDZA 3KPJA 3I58A 5U4XA 3G88A 1RJDA 3AJDA 4PGHA 4QPPA 7MHTA 2GA9A 3DMFA 3P9IA 3TFWA 2ZWAA 5EEHA 3DMGA 3THSA 4P58A 3DLIA 4M7RA 4P7JA 2AVDA 5ICEA 4YUVA 3RIEA 4EMSA 2PXCA 3DTNA 3VSEA 4C03A 3EPPA 4U7PB 5EHIA 2JH9A 4E2ZA 3R9XB
chains in the Genus database with same CATH superfamily
4HN2A 4HQFA 3VPHA 2O20A 5HFAA 3A25A 5B6PA 3VR6A 1G41A 3LC7O 4KAJA 1H2WA 3ZCVA 2VHWA 4HUQA 4Q5IA 4BO1A 4R83A 3ZC3A 1JWBB 3OBIA 1L7VC 2HJGA 1XL1A 1JJAA 4A8JA 2HA3A 3NBZC 3ZHRA 3MFQA 3FCSB 2B1QA 4XFDA 2HX1A 2Y71A 3TJRA 2GCGA 3UAZA 3PGJA 4FFSA 4LYFA 4MUFA 3U40A 1ZK4A 1FUIA 1RHRA 3IEUA 1U28A 5BSGA 1EXWA 1MBZA 3OZEA 4WOJA 2XWSA 2JJ2A 2ZAYA 2O3TA 3C6ZA 4Y2XA 3KXPA 4LVOA 3TW8B 1C9KA 1T15A 4M22A 1NMEA 2IW3A 3BK2A 1LKZA 8LDHA 1MDFA 1RMTA 2AC7A 4K9KA 4C7VA 2I91A 4YRIA 3T7EA 2QRKA 4MHSA 4Y1RB 5P21A 3SBDA 1Z63A 2W71A 3RTAA 3U9TA 2X1HA 1WPQA 4Q3NA 4CEHB 1XJWA 2E89A 2PQ2A 2Z4RA 3KO8A 3MT9A 4M1MA 4EY8A 4L51A 1XDDA 3V8NA 3GFOA 1FYWA 3K09C 4P3XA 5NULA 3ZWPA 4Z7JA 2PEYA 1ZK1A 3KX2A 1ODTC 4I08A 4HZUA 2E5FA 2H17A 1VCNA 3DWEX 2D0PB 3GCWA 5FUYA 3ZV7A 1XZFA 1COWA 3UGTA 1RKXA 3BJZA 3DBVO 1KOLA 2DYKA 3ND6A 4TT3D 4TZ6A 1IZ9A 2VK2A 5HIKA 2XYQA 2NO0A 4GVLA 4L74A 4RVFA 3QI2A 5CFNA 2G88A 5A5FA 1EFKA 4O1HA 1JAXA 4MKIA 1SIOA 4RSRA 4ZT2A 4QLAA 5BSFA 5BP7A 3VH4A 5E7MA 2GEFA 3MWFA 8AT1A 1M6EX 2PRZA 4M60A 4PRZA 2JGEA 5BQXA 2D2XA 2ZKIA 4HFRA 4J1TC 2QT0A 2ZWIA 4YRLA 1GKIA 4Q03A 1NXSA 2RGCA 4JLBA 3EF0A 4MCAA 4JJEA 4JBHA 2ETXA 4U2FA 3KXDA 5KX5B 2I4NA 3QG1A 4PLPA 4EHFA 1X7HA 1YDEA 4X44A 5K99A 5GZ3A 4ALNA 3E53A 3AR6A 1LEHA 3GEDA 2XCIA 1N4AA 1C7EA 2D0IA 5A4KA 3LA6A 4DUGD 1VDMA 1L5QA 3GGDA 1CY6A 1Y63A 2OZPA 4U3JA 1XRMA 2NXWA 2PYIA 4IFTA 4LKOA 2ONCA 3ABRB 1Z2PX 1HX7A 4I19A 3C4VA 4YV1A 3O4JA 2A5YB 1X3LA 4FBLA 5F3WB 1R9JA 3PF9A 2QX9A 3MYYA 1LLQA 5C53B 1GADO 1TYBE 1RADA 1P4AA 4E51A 4K0KB 3VA7A 4GNKA 3IUEA 1DV2A 1J5XA 2OQIA 1VHWA 4D8UA 4DLNA 1XCBA 1NBMA 4INPA 1ZGAA 4EVRA 4XGNA 1U28C 5LXTA 1TPYA 3K0HA 4B3MB 4FI3F 5HJ2A 4JBYA 1PJBA 5IEJA 2WICA 5FNVF 2IF0A 1KSGA 4RSGA 4GP9A 3RHSA 1HE4A 3S1AB 3WRXA 1WOMA 3MERA 3KQYA 5LU8A 1U4OA 3L4KA 1VG9B 3PNKA 4ZV9A 2OLJA 3QMPA 3LBIA 1NT4A 2EEPA 1KDVA 3SSMA 3NVMB 2CSUA 4K26A 2PJUA 3W04A 1XTPA 5TLSA 2PMFA 4CTMA 3C74A 5FD8A 4JMPA 4BNUA 3T61A 2AXPA 1J2JA 2GYVA 4WD3A 3AEYA 2XA9A 4BJ1A 1P2UA 5BV8A 1NDUA 4FHDA 4Q0MA 3QE0A 3Q0TA 1JP7A 3U7JA 5BW6B 4F6CA 3LUCA 4TS3A 4MDEA 1TEHA 1VSQA 1XEWX 2AEEA 3E8SA 2OYRA 5BSWA 4ZO7A 4C7OB 3FHTA 5BR7A 1NBHA 1NZDA 3UEOA 2Q8PA 5LNK6 3L18A 2NTYC 1R0LA 3HY4A 4I46A 5C80A 2OD9A 5I9NA 4YP5A 2R6CA 1IXRC 2J3QA 4IW3B 1BMTA 1F8GA 2IH4A 4RE6A 1R10A 1F5SA 5BV2P 4DNQA 3ELYA 1HDXA 3DV0B 1NVTA 2V74B 3JVVA 1TUBB 1BAPA 2VT6A 3C6KA 1UM9B 2G17A 4MA4A 3SMQA 1IUPA 5HS6A 4LX8A 3KTAB 4OJQA 1NBOA 1YZFA 2PR7A 3C7CB 2YWGA 4Y9DA 3VDXA 1YGPA 3HMKA 1LSUA 3N2GA 2E1RA 4CQJA 5A2QA 3SC2B 2WUFA 3O2SB 3QRWA 3GQVA 1W48A 4KDFA 4BAUA 3O4FA 4RD6A 3AU8A 2RIRA 3ME5A 5E2AA 3FDXA 3N2EA 4I99A 1SXIA 3L0ZA 5ANRB 3TKAA 1UR5A 2BUAA 3LYHA 3O3OB 1LPPA 1AOXA 2J32A 2YVLA 3N2KB 3OUZA 1EUCB 4XTRA 1E9FA 3HJFA 4BYMA 1ENPA 1CHDA 2YC2C 4PG7A 2XAAA 3WQSB 3ANSA 4YRGA 1GNTA 5EWJB 3AWDA 1YUNA 3MS7A 4DNOA 4LJRA 2F1IA 2VLBA 3EMKA 4UU8A 3R24A 4RO0A 4ZD6A 5I9TA 3PFHA 2WWVD 2XCRB 5IBQA 1ZRHA 3AV3A 1ZC4A 4JQCA 4K40A 3JQAB 4WXHA 2B34A 1MX3A 4HGRA 4KDEA 4RENA 1DWUA 3G23A 4P4UA 5GONA 3WICA 2EX0A 5CGQB 4ENQA 1HDIA 1OXMA 2WIJA 4MW6A 2O06A 3Q6IA 5J4YA 4LQDA 3PQEA 4M8IA 5TX7A 4AY4A 3EXEB 4QSMA 2P4HX 3I8SA 3AGQA 2QN1A 4GE0A 4P4NA 2IPOA 4KEAA 5CFRA 2YUTA 2WF8A 3DYVA 3WGOA 4HCJA 2A67A 2OCYC 4RPLA 2YJ4A 5CTAA 2JBWA 2DTDA 3JQAA 1G20E 1E2UA 1L5FA 1QFXA 3EW7A 4BV8A 4W9MC 3C5VA 2VPTA 4QEKA 4BNDA 1YCFA 2VI5A 3AEUB 4Q4AA 1U7TA 3NUGA 3TM5A 3E23A 3PKIA 4HWGA 1ABEA 2Y67A 5TDHA 2WD8A 4I50B 3LLUA 5BSVA 4WIAA 1DFHA 4RK1A 4A4DA 1J20A 2C5HA 1LJLA 4Y1FA 1LD3A 2PNJA 2I4MA 1SBTA 4QPNA 4YWJA 3NCTA 1C3JA 2XGSA 3BFXA 3N0RA 3UATA 5HKOA 2LBPA 4R98A 2H18A 1B14A 2IUFA 2PBZA 1SM4A 4DQKA 3SQLA 3TZKA 2ZUDA 5B6IA 4NK4A 1S3FA 2Y0PA 2JJ1D 1VG1A 2DUNA 4LHZA 2ENWA 4YMGA 1EUDA 1P2BA 3LPLA 2TMDA 4M1TA 5A7GA 4LRWA 3T1QA 1L5YA 1QH0A 1BEZA 3KBOA 5DM2A 4DYDA 4DDVA 1QO9A 2BMFA 1N5IA 4KGZA 4NV0A 5ALUA 4CG0A 1O87A 2AR7A 2O8BA 4Y2VA 3WLAA 1T26A 1N34B 4Z9FA 3OOHA 4F72A 3KQVA 2XA1A 4MGHA 4H4DA 2PX8A 3ROFA 1U8FO 3CTMA 5BSMA 1OI2A 3ACDA 2DQYA 2VL7A 3A27A 3O1LA 3OBBA 4N40A 2X77A 1BKSB 2AMFA 3VM6A 2FYTA 2NVUA 1IAVA 1OR8A 2HA7A 4N5NA 2OQVA 1PJAA 2A9QA 1I2MA 1CYDA 4HDRB 4MRSA 4RF5A 1J0CA 2PX4A 1BKDR 3ETCA 4BV2A 2I3ZA 4FX2A 2ZBRA 4FFWA 2EKQA 4LSWA 4N0DA 1X0VA 2VQ6A 3WNZA 3LWNA 1SZDA 4CWAA 3PEEA 3GBPA 2AC2A 1A9QA 3TI7A 2AT1A 3RFVA 4HEHA 3WQRA 4DOMA 1I33A 1OSNA 1V9LA 3AHIA 1DEOA 4M88A 2IXDA 4A0RA 1TZCA 4GI1A 5FNZA 5HBRA 4E94A 2C8LA 2ZREA 4F04A 4OMUA 4R2JA 2NU7A 2XLCA 3FZYA 4ZQBA 2BF7A 1PSDA 1W52X 3DFZA 2P9FA 4MR8B 3ADDA 3BE5A 2H4YA 2X3YA 4BLQA 2CHQA 5F1PA 5JEDA 2Z30A 2OYCA 3NIFB 4CEIA 2WF7A 2DY1A 2JHAA 3I9JA 4EYSA 3OJCA 2V4ZA 1S4MA 3HUUA 3DD5A 4O25A 3CIFA 2OENG 1DTWB 5K9ZA 2JKVA 1JKFA 3AI7A 1J33A 3E1GA 4TPKA 2JLZA 3WKCA 1QONA 1VHLA 3I8OA 1G5QA 2ADOA 2PYDA 3CYFA 4RVUA 5JFGA 3DOCA 2RHCA 3MD9A 4JMLA 4Q9AA 5FWDA 4ZQHA 3FDIA 1N32B 4QARA 1QJCA 1Y80A 3B7WA 2YMPA 4YLYA 3LA8A 1LTKA 1YZKA 4G1UC 4WCFB 3GFVA 2YMMA 3GLGE 4HB0A 3RKUA 1IUOA 3TB4A 4ENWA 5F9HA 1NW5A 3GUHA 5EJMA 4W8OA 1K5DA 4NCIA 3VKWA 2XCSB 4HH1A 1JG2A 3UZUA 3GNLA 5DNUA 4KWTA 2I6TA 3KPUA 1CIJA 3ASUA 2ZK7A 4A0QA 2X23A 3HV2A 4L4SA 1P1JA 2IT1A 1U90A 3MGCA 1TA9A 5E6UA 2EW1A 3DCIA 1Y0BA 2A92A 2RC6A 3HRHA 4QUDA 4YGXB 3SHTA 4JH0A 4HZGA 5KHAA 1HH4A 1CB7A 2OUIA 1IXSB 2QVYX 2AR0A 3N2LA 1KFKB 1FP6A 4E5UA 1LWNA 4N5HX 1DQRA 3B82A 4YYZA 1PFWA 1ZVMA 3A9SA 1P81A 3IAXA 3KP1A 3KWFA 2WHQA 4JLJA 4B0PA 3RYFB 1NI4A 5KNCH 1T3GA 1Z7YA 3WYAA 3FPCA 4YCMA 4BE7B 1O94C 1G9TA 2RFLA 4ANFA 1KQOA 3RSHA 4FMCF 4GFDA 1RKBA 4DYVA 3MS4A 3CUTA 4QQRA 5ER9A 3RS7A 1N2BA 1O6ZA 1Z4KA 3SNHA 2PHZA 3OKAA 4PLHA 4Q02A 3HH8A 4L75A 1V39A 5JALA 2Y99A 3GQBA 5AVXA 1G66A 1G18A 4KVAA 1LBHA 5WRFA 5GPBA 3S5UA 2JH8A 2J67A 3OQHA 4HEA6 3BEOA 3ICWA 3VZPA 1L5HA 4JLOA 2BEWA 5E1BA 2EFEB 4L9RA 4TXLA 5EHQA 4D8VA 1MU0A 1NF2A 1W6RA 1WMEA 2HMSA 2C88A 4OLJA 2P9GA 3DEFA 3AQ4A 3KKEA 4K6HA 4OAQA 4QDTA 3HK2A 1NM5A 2ZUSA 4HWKA 2DOKA 5K6TA 3TG2A 5HR5A 2R6R1 4R7ZA 1RRGA 2QPTA 4OIFA 1P1KA 3RUAA 3RUIA 4ZYYA 1OFHA 1GVHA 3L01A 1J8YF 4HXFB 1U9IA 1O0CA 4N3CA 3BGDA 3E22B 4OIMA 2OBXA 3ZE9A 5G3ZA 3SMVA 1I6KA 3CLUD 4G07A 2BR4A 2Q0XA 5BNZA 4RHEA 5A2GA 5CMLA 1GAEO 5TS2A 5AK6A 1PZXA 4PANA 2E55A 3NT5A 4I4TA 1GPMA 2UYCA 4KE8A 4Y2PA 4E15A 2VR1A 1V8BA 5EMMA 4TRJA 16PKA 1NZJA 2HJRA 4H6WA 1USIA 2C98A 3UCXA 3PLAE 2PGDA 1ZXBA 2N75A 3NHAA 2RBKA 2FQYA 2GPSA 4DMCA 4UREA 2V6FA 1GAWA 1FMLA 3C0KA 4OB6A 4EFNA 5JQWA 2PIAA 2D3TA 2YVKA 1QYVA 3QKRB 1Y9DA 5B7QA 3L8DA 4DQXA 2Z2ZA 1DE0A 4UVDA 2ZSAA 4LTNA 4CNBA 4F9TA 3MLAA 2NQTA 4B9AA 2A88A 2CUKA 1KO4A 1NF9A 1XZ8A 3IO3A 5FOUA 1Q57A 3DC7A 1KGSA 1VTKA 1Z6PA 4EQZA 1BWSA 1N57A 4GI7A 3VZQA 4PW0A 3LY5A 4MA0A 4O0MA 5FJJA 3C8ZA 3GH3A 4EHAA 3V3KA 5KNDH 4MJXA 1IOVA 1Z06A 3BYZA 3ON5A 1HQYE 3A6FA 1Q7GA 3GELA 2F3UA 4M21A 4QASA 3QXXA 5AK4A 2BFWA 2PX3A 3P96A 3HCPA 5GWXA 1VJTA 4LV6A 1J00A 1KEPA 4REOA 3GY0A 4IJWA 1E61A 3E7WA 4KSBA 2Z08A 3IV6A 3PDIB 4MINA 3B3FA 3ANYB 5IMBA 1EVIA 1JJ7A 2MYUA 2YICA 4U7HA 4ARSA 4RM2A 4L50A 5JSZA 1OXVA 4JEHA 4UEJA 1XVUA 3AUJB 1INLA 4AJ2A 5AWFC 1U94A 1ATZA 4H16A 4O5OA 2AMVA 4XUDA 1M6WA 1AKMA 2FPOA 3S0JA 3VNRA 3DTVD 3FLAA 4EGFA 4BNGA 1KWKA 2IYQA 2P6NA 2YWHA 3K6JA 2IEZA 4OD0A 2QAGB 2QX7A 4FGSA 2CGEA 4XWYA 1LK7A 3NVDA 3LNTA 3CO5A 4B3RB 4LI0A 3DMFA 2B0JA 1Z47A 3O1JC 3CRMA 3QWBA 4URYR 1ACJA 3GNTA 5FL7D 3RARA 3DVQX 2CDRA 4ZZ0A 3AJ9A 1GGHA 1NFQA 1TB4A 3QEMB 5ICEA 2FNAA 1UBNA 2GTIA 1JPUA 4M0KA 1C7QA 4TUYF 4DYHA 1GSHA 1ZY2A 5EHGA 4CMJA 3RAEC 1V5IA 2EBWA 3EFEA 1T0PA 1YULA 2ZM5A 2TMKA 1ZVVA 1N6HA 3GWZA 2IYYA 1FA9A 1TD9A 3GG2A 4EOGA 1PV4A 4HDOB 4S1WA 3L7IA 1JX6A 3PC4A 3GD5A 4LQLA 4MI6A 4H0CA 4DCCA 4EG4A 4ZVVA 3EPJA 3MWYW 4DMFA 5KHLB 4GC5A 1T0JB 1FFBA 1AB6A 5FPSA 1YRQA 2VA8A 1D1QA 1EWVA 1MC8A 1Q92A 1QCCA 4Z7OB 3AHHA 4JYZA 3S29A 3ICQB 3EIFA 5TVKA 1IG0A 2G4VA 4D3YA 3KOOA 1MAHA 3BMCB 2PL5A 2VN8A 4EO9A 1GNRA 4D9IA 4DG8A 1Z0KA 3AY6A 4OVKA 4RTKA 3B5EA 3GDGA 3L6BA 3F47A 1LC0A 1WB6A 1HTTA 3TXXA 4RK6A 4TWRA 4LDAA 5DGTA 1ADGA 4OUKX 4BZXA 2HQ1A 1Z7GA 2X0IA 4F7WA 1I1HA 3ENZA 2OWDA 3SYRA 5JWOA 5AM3A 5DBIA 2X58A 2XJ9A 3JQ7A 4PBRA 4EI9A 5G4KA 3T4PA 4XJVA 3ZTTA 1QB7A 1QLWA 3HFJA 2JH3A 4HTFB 1O0SA 3UUFA 4AJLA 2HRZA 1G2QA 1KDYA 4PSDA 1U1DA 1XUOA 2EF1A 1EG2A 2L18A 5M04A 3B9BA 4WXYB 5CIYA 3QVLA 5HE9A 2DKFA 4FHGA 3USZA 5T6MA 4DNFA 1N6LA 2A8YA 2EJTA 1J8DA 4WFJA 3SIPA 5EIXA 1A8IA 4HUJA 3OZUA 3WXBA 1KOJA 2MJLA 1FX0B 2O3RA 2R2AA 3D7MA 1BDIA 4BQEA 4J3NA 1GY8A 2PMEA 4FBMA 4MV0A 4MLDA 4V0QA 1MORA 2PL3A 4WUVA 3D4IA 3V32A 2BH2A 1E92A 2P5YA 1QIEA 2GFHA 3EDQA 3NDRA 1KS9A 4G86A 2VQ3A 3ESZA 3IQFA 5DHSA 5CLQA 4X1IB 3VU9A 1KBZA 3LXXA 2M2IA 3UBTA 4OGGA 4L0QA 1KVQA 4UZEA 1E1NA 2HN9A 2AL7A 3FYCA 3LWDA 4F11A 4Y3UA 2RHHA 3L84A 1DHRA 2ZRJA 4O4HF 2E48A 3E9DA 1H6BA 4K2HA 2BGUA 4IEFB 5HRCA 2HB6A 2VPPA 4LAFA 5EE3A 2QU7A 1KL7A 1Y6QA 1CUJA 3OPVA 4KMRA 2X0EA 3R8CA 4DWVA 3BTSA 4CFZA 3ZV4A 2YJ6A 1GA6A 3MYRA 1U0FA 4EHLA 1UDWA 4OAPA 2ZULA 4ITRC 1VE9A 2WPDA 2ACVA 2RGNC 2XTJA 4FQ5A 1LSOA 2NVOA 3G9QA 3H5WA 4MUKA 5FBLB 5B1YA 4ZICA 3CXRA 1L4GA 5K3BA 2QY9A 1FFEA 1Y6RA 5I4KA 1U0JA 4DIMA 3FLEA 2YFHA 3IMFA 3MGGA 1Y8RA 1XDSA 2B78A 1QFMA 2ALJA 3P9KA 1TK3A 1W44A 3GOQA 2W37A 4W5JA 5L6MB 1XMOB 5E7IA 3F90A 1M8PA 5J2UB 5J5AA 3LPAA 4RY8A 3NC1C 3VOBA 1QVRA 1M2KA 5DBEX 3DEKA 3GB9A 4D46A 4ZK6A 5EJ8A 2DKNA 3ZZNA 2Q49A 5L7YA 4W5QA 2GKSA 3L4BA 2CV2A 1R5OA 2VZEA 3IODA 3C1AA 2KLBA 1U7UA 3KWLA 5F3RA 4DR3B 1I3CA 1FFSA 2EFJA 2GD6A 1R66A 1KH1A 1V11B 3DR5A 3RJTA 5KTRA 4KAFA 4KKVA 5LA6B 1RI2A 3ZTWA 1H5UA 2X8JB 3COJA 4ZANA 2Y1DA 1GGEA 1V0JA 4E5YA 2ZSIA 3HKCA 1E6KA 4LSGA 1EX1A 1USKA 2EBHX 1MXHA 2C1ZA 3OO1A 3SXPA 3TB6A 4JLPA 5F5NA 4F5EA 3IRVA 1SPBS 4ALKA 3KOWA 3E9MA 4X93A 3TTVA 5CB4F 5EUQB 5DLYA 3FKJA 5I7AA 3CX4A 4RLFA 3RSCA 2O8DA 1G21B 2FPLA 4KR2A 2FF5A 3I05A 5IFKA 3DGEC 5BW4A 4EW6A 5FYDA 3DBIA 1E1MA 4M7PA 3SM3A 3UWOA 5LZ4A 2FUEA 2HRCA 4FMDF 4JP5A 3S8YA 4DCVA 4WADA 1TUEA 2R6HA 5DJ5A 1DWPA 1VLJA 3KVRA 2SCUB 4K87A 4QYWA 1ZD2P 2F64A 2CF5A 2OOSA 1PS9A 1SCBA 2F8MA 3CKMA 4QTXA 3VOSA 4ZVSA 3AYZB 2IX3A 5LQMA 4QHYA 2VBFA 3DMRA 3LW8A 3MJTA 2X0FA 3RW9A 1PFVA 5ICMA 1UC8A 4V38A 5J4LA 4M9UA 3IH5A 1W5AA 1BU8A 2RHWA 4UUOA 3CNLA 2C04A 3H2ZA 1N2CB 4DLVA 3ASZA 2QS9A 2YRXA 4LA4A 3PWSA 2NWQA 2ORIA 3U7RA 5JVDA 3VMMA 2M32A 2VXCA 1QZUA 2ZXFA 2PUGA 4OLHA 3DZDA 1J2UA 3LX5A 1MC5A 3ORFA 4KBYA 4MS3A 1EFRA 2DTEA 3V6MA 2ZYVX 2I99A 1PYDA 3LF1A 4BMPB 3HCOA 4JI7B 4RDXA 2VDUE 2X0JA 4A91A 2FZVA 4JROA 4V2IA 3RTDA 3EJWA 2C4VA 3TSZA 4KUGA 2PA3A 2PH5A 3Q2KA 4EIWA 1U99A 3IIMA 2CLHB 2HQBA 2W6JA 1G20B 3TRKA 2G1AA 4K0RA 3RM3A 3JSXA 4NEHB 2C83A 2DTXA 5LDGA 1EFPB 1NOJA 3N8GA 2BMJA 2GBIA 4GOND 1OX4B 3BT7A 4PIMA 1QHXA 2ODWA 5COAA 5LQCA 1FQWA 2CE7A 2WYVA 4F4JA 3BGOS 2XXAB 3Q0IA 1RPTA 4M1WA 3RVMA 2E6KA 4C2UA 5IKMA 1VPWA 2UKDA 1KY5A 2AZ4A 1D8AA 2ZJ0A 3BCRA 4DT1A 3R6TA 2VP0A 3DL2A 1ZNYA 3CSDA 5DN6A 1KORA 1GFSA 3GX1A 4PONA 5D2CA 5K1ZA 3R7NA 1V3QE 2ZJBA 1XQWA 4IQGA 4NZOA 4NQZA 3PIRA 4MI3A 5L3RA 2PMKA 3L7CA 2AG1A 3GCXA 3K0EA 3T34A 3M6MD 1GCAA 3IJEB 9LDTA 4YMTA 3HGQA 3RNOA 3MC1A 4TXHA 4LMAA 1GDTA 1ZISA 4Q00A 5B1HA 3KIPA 5J4VA 1EBFA 2Y8EA 1ADBA 4OLFA 4ENVA 4BX3A 4YIKA 1GU7A 3D6MA 2WWFA 3B53X 4PLFA 1RI1A 4U2DA 4XA8A 4XPIB 4PRYA 4BVJA 2ZFUA 4J0CA 2B2NA 2VSXA 2IHVA 4G0PA 4OGFA 2ODNA 3E84A 4K6OA 3QUBA 3KQSA 4EVQA 1QO7A 3FAKA 2Y0BA 3AR2A 3Q9UA 5FA8A 3TOXA 1T2CA 4JWTA 2GK7A 4G4SO 4IQ0A 3LUDA 3KB8A 1QQ5A 2J3LA 5FWXA 1KZ9A 4C3VA 3UHAA 1ZINA 1A7AA 3JD1A 3HB4X 4Q21A 1PS8A 1NX9A 4XLTA 1DWOA 4EFLA 3FSEA 1XVTA 2X8JA 1QIIA 3NI2A 1A4RA 4MRPA 1I0IA 1IN5A 2OCPA 4L4XA 1MO2A 3UAOA 2O5CA 1ZI9A 1D0VA 1KO5A 2VYNA 5DNVA 3RRBA 3SVZA 4OHFA 2OXRA 1CS0B 3Q7QA 3HYNA 4I7EA 4YRFA 4QBHA 4ZK2A 5KTTA 1PL8A 2NP7A 4OBWA 4WY2A 1MN6A 1SH7A 3E61A 1MKYA 1P7WA 3VYUB 1U0BB 3AH8A 3C6YA 2AZXA 1YFKA 4YCCA 4Y2SA 4L16A 1ISFA 4HRAA 3OFND 1TIPA 2FPMA 4DREA 2R00A 2Q0HA 4CM8B 4N76A 3DDSA 3J81k 2WYWA 2O5EA 3CBQA 3JARA 1AQYA 2X0RA 1Y8AA 3HUDA 1R8XA 5AJZA 3KWMA 1QRTA 4Z4FA 2JD1A 4EUHA 1G3UA 2ZR7A 4HEQA 1II0A 2BLLA 5I4BA 3GLUA 4O4JB 2IF2A 2LCIA 1CQIB 1VE1A 2BLNA 4HDKB 2DEUA 3VPDA 2ZRCA 5CD9A 2FMTA 1NRWA 5KJEA 3CH5A 2CC2A 2YMQA 2V1XA 2E5WA 4PQFA 5JBQA 1A50B 3CF4A 3LCRA 2IGBA 5FTNA 2V9ZA 2VRWA 4KN9S 2GXAA 1YGYA 4PFQA 4N4AA 5FUXA 5CVTA 1KAMA 1NRIA 1U7OA 2XGGA 3NAMA 1XF1A 2C7GA 4W9NC 5K8CA 2V03A 4ARUA 1E89A 3RRNA 4KQHA 4RGBA 4PHHA 2CK3D 1RYHA 2GETA 3HADA 3T3GA 2XT0A 3SDSA 4DIKA 4IIXA 1H2ZA 2ZROA 1KYIA 5DXAA 4V0SA 3UCFA 4CHGA 1EA7A 3BMNA 3M49A 4EB0A 4F3YA 2WHPA 4MYRA 1ONOA 4V0KA 4E11A 2AFRA 5FPYA 4PC1A 3A1FA 3VPAA 4C4OA 4JV5B 3EWSA 1CDEA 1Z5OA 4WE3A 4REQA 1CUIA 4GM4A 3Q1KA 2C59A 1RVDA 4PWZA 4UULA 3S1LA 1T1GA 5CVDA 1CKEA 1TMGE 2AKAB 2E21A 2IHZA 2PV7A 3FTCA 2O8VA 5G1NA 1U3GA 3QI7A 3U4HA 1RKQA 5D7BA 1QOZA 3ENVA 1SGWA 2QNRA 2I8AA 2QROA 3ICOA 4N8DA 1G55A 4C0XA 1NMYA 5DK4A 3NZEA 5EG5A 2ID9A 4MRMA 3RS8A 4R2LA 1USVA 3F3SA 3OTQA 4TZ0A 3JATA 3BWXA 2ABWA 4MUYA 3RWMB 3T52A 3REGA 2P1RA 3SF0A 1SXJD 1LH0A 3G6KA 1D2GA 5DM4A 1XOIA 5AJUA 3QU9A 1RWXA 1Q3TA 1WUTA 1ST3A 2RGYA 3AWIA 2K7FA 2DCUA 1GJRA 4DIEA 1Z6ZA 1WU7A 5GOZA 4GL2A 2XJ4A 1ZMXA 2C2YA 2XTZA 2VH1A 3LXRA 1Z74A 1O94A 4XEHA 2VTKA 4M0CA 5ICCA 2EIXA 1WVMA 5KNDD 2P11A 3OE7D 5JHGB 1XZLA 2M6KA 4CR7A 3DLBA 1CJMA 2VH2A 4UBNA 2RHRA 1JQDA 2KM1A 4GWGA 1CFJA 4TOIA 3ZV5A 4ASUD 4XD7D 4PYJA 3DOUA 5KEIA 4LK2A 1S2IA 3CW8X 1N2ZA 4TRNA 1QU2A 1AKNA 2WA2A 1HE1C 1SZCA 2XDAA 4C05A 2BUCA 3ZCQA 2C9MA 2VYVD 3GCZA 1YAHA 3TPZA 3WJ1A 1YQTA 2ZVJA 1YUMA 4QDKA 2IOFK 3ZEIA 4NP6A 4MQFB 1UK6A 3EXAA 4Q4JB 1BKYA 1C1DB 2M9MA 3H5RA 1NIPA 3W7VA 4GOJA 3FF4A 4YT5A 2VF5X 1AGNA 3SFTA 3UWMA 2Q6KA 1AVTA 4IDHA 4IIHA 5JNLA 1LDMA 3UHFA 5CFLA 1ZPDA 5GY7A 1NP7A 2ZVPX 2OPHA 3UJ6A 3Q15C 1U2TA 2QAGA 4UU7A 4W5HA 3CUUA 4R0MA 1Y82A 1K75A 4O4IA 4UBJA 4CUZA 4AMYA 5IJZA 3BBLA 4EB6A 2CLMB 2WINI 2QW8A 3FMPB 1EWRA 3D6VA 2VEOA 2WD7A 1LGYA 1OJ7A 1WKVA 2BGIA 2FLWA 4XJSA 5IF3A 1VJGA 2OCXA 3C1UA 3PEUA 1EZ4A 2AVNA 3BXOA 3PGVA 1Q0ZA 3WRYA 4J8PA 3R40A 5LDHA 4IYJA 2FMFA 5JNSA 2RGBA 3WLSA 4U6QA 3QBVA 1QVZA 4YAFA 3TX2A 4BLUA 3F4BA 3NJ4A 2JLQA 3EH2A 3QEJA 2FSSA 1M2HA 4H0FA 4NS4A 2AWOA 2UYYA 1S4QA 1K4KA 4IQFA 3S55A 5G53C 4ENSA 1S8NA 2R6FA 2H2DA 2KPOA 1WUJS 4PEVA 5KWEA 3OEEA 2BFDA 1IZYA 1CS4C 1V3TA 2AS0A 3LBHA 1NATA 2AZDA 3L6OO 3MRSA 3QVWA 3N28A 4HNAB 2FG7C 4PSVA 5ITZA 3P0HA 1ZOIA 2DLCX 1ZR2A 4YRNA 2QR2A 3H1TA 3TM4A 3OP1A 1XVAA 4RMJA 3JYPA 3CGWA 4BVGA 2ZIUB 4CIDA 1KKUA 3QX9A 3R5JA 2BTOA 2JHCA 1L0BA 3IEIA 4KMOA 2JFXA 3WL6A 4F3KA 3I2YX 1V35A 4FBGA 1BH6A 2BKXA 1TTPB 2H57A 2QY6A 5C3UA 5JYCA 3WHPA 1Q84A 1WSDA 2FI1A 3GC6A 2Y1FA 2WV7A 5TARA 4V1CB 3WP0A 3D6TB 2HMAA 3DONA 1EXDA 2EL9A 1ZL0A 3GVCA 4YDQA 3DJYA 3DR3A 4BVEA 1VM6A 3S99A 3E03A 4FFNA 4IBOA 4TTIA 2AD5A 2WD9A 3BIJA 2CNNA 4OMDA 3M83A 5CNIA 3JYOA 5JSZB 1YBHA 1L5GB 1O8BA 1H4QA 3DWIA 3F1LA 3HXMA 1UXOA 1JLMA 1Y1KE 2QIPA 4NH0A 4OL9A 1ESEA 3KS9A 4DV1B 1UQTA 3WYDA 2XYPA 3DG9A 1V8PA 4A6XA 4CKYA 2CJFA 3MWGA 3IMKA 2LDBA 5EYPA 3UHPA 3O3MB 4H7PA 2CV1A 4UBOA 1QYIA 2QKYA 3PYLA 2VPZA 4NU6A 1K9VF 2Z09A 2G4CA 2OHFA 2FWIA 2GA8A 4LWOA 3DJFA 1Q91A 2DULA 3IP1A 2R84A 1Z62A 2G5TA 4G85A 1GPNA 3CCFA 5AP9A 1RRVA 5EPUA 3O7WA 3RS9A 1P73A 3M2TA 5BQPA 4QVIA 3ADCA 3VAZA 1ZEJA 3JRNA 2WJYA 1SVUA 4N49A 1IATA 4FNAA 1ZEMA 1XYGA 3FVRA 3GAAA 3NUQA 3ZS8A 3AKEA 3GAZA 1Z6YA 5SZJA 1I7QB 4IDOA 3V34A 5G40A 2H51A 4RUKA 2IHTA 2WZCA 1VL1A 1GP2A 3QH4A 2H00A 4UATA 2PGLA 3W06A 4CR6A 5T8KA 4YRPA 1SAYA 4YC7A 3U1TA 2OD7A 1XWFA 3KAQA 1MG5A 3IILA 4HATA 4GLJA 2PKQO 4I9FA 4PLCA 5ALVA 1AH2A 4N1AA 4KR3A 1TTQB 1AA9A 3S68A 5CFMA 5GVRA 2QN8A 1KEKA 2VG8A 2D2VA 3KALA 4EKGA 1XMQB 5DYNA 4JLAA 3VX3A 4ZVRA 5SYMA 1TEZA 4C88A 1X1TA 4P3YA 2RKBA 4FD2A 2I7XA 5LP6F 1TVKA 1X8JA 4OK3A 3VVMA 2V6MA 4TMVA 5H81A 5CVJA 2AH5A 3T0GA 4KPEC 2XV1A 4EEXA 2CNWA 4GE3A 4J16C 2IUSA 2OO3A 2CV0A 3OT1A 2QLTA 3QHPA 5KZMB 4P5EA 4BDTA 5T5QA 3H97A 1Q1NA 1TKAA 2VNIA 1GGJA 2IKSA 5BSKA 3NNDA 3JQ9A 3WLQA 1V1JA 1O08A 2N9UA 2QSZA 2QJWA 4FZ3A 3FVWA 5IAEA 5B4TA 3TKYA 3IVRA 4AG3A 1XPUA 5L53A 3M5CA 5L3VA 3EBPA 1QLHA 1QLJA 3BZWA 1BGWA 3AGPA 3HLTA 1FNDA 3TRIA 1N6PA 2NZYA 3HWSA 1K5PA 4J90A 1SUFA 1FJGB 1U04A 1J49A 3EN0A 3UA3A 3YASA 4MYTA 2Q7DA 3I2FA 2IKQA 3LUJA 1W5FA 5EJ6A 1T2FA 2NMVA 3Q7IA 4OPMA 1VMKA 4FFPA 1ZU4A 4OQXA 3QBDA 3S2GA 3KYCB 3SOPA 4RF2A 3SKXA 1Z6XA 2Z9CA 4P8RA 1SIBE 1MX9A 1D1TA 3DZFA 1MT3A 1P29A 3HZRA 4RKWA 3FHCB 5LFAA 3ITNA 3OKPA 2CMDA 2RK6A 1PBNA 1YCGA 4GYWA 5TIIA 1A2BA 2LXNA 1M0TA 2GEKA 2ODTX 5GZ6A 4WCFC 4YEDA 3B70A 1GG8A 3TQRA 3LO8A 4P4SB 4YLEA 3MG9A 5JBIA 1B73A 3HJRA 4E3ZA 2BE9A 2FV8A 3QTTA 4GI3A 1NVMB 1MB9A 5EFZA 1L8XA 2CNOA 4GLOA 4BS9A 4UVEA 1E62A 4YO7A 3A7DA 4TXJA 3GGSA 4BKMA 3QEBZ 1X94A 4LMRA 4LVCA 4MVJI 3B60A 4OK6A 4PX2A 4YR9A 4EUKA 1RAGA 3R3JA 1KJZA 3DEHA 4XDYA 2ZCJA 4MPDA 1IRXA 3EVZA 1QAMA 5JS6A 2CLKB 1NYQA 5AOAA 1MV8A 4WLUA 3TMAA 3R5KA 3ZU2A 3L79A 1QP8A 1D4AA 1UT6A 4F6RA 3HJHA 2JD2A 1N9ZA 2VUIB 1ANKA 2WWHA 3GFPA 4V3BA 5KNDA 1SCNE 3X2FA 4YUAA 5KYKA 1V8FA 3PU6A 2AZMA 2ZYGA 3OC6A 3FHJA 1U0RA 4CKCB 4BWGA 4WW0A 3ZY4A 1ZH8A 4N47A 1V45E 1PIWA 1AS0A 3AEXA 1K63A 2BFCA 1TM2A 1YQWA 1RM0A 1JG7A 1J8QA 2W58A 5J4KA 2FW7A 3M1IA 3PK0A 3T8YA 4AG5A 3AHDA 1ZJJA 3J7AC 3LT0A 1ND5A 4D02A 4KJZA 1X3SA 4EJ6A 1QCZA 1Z4JA 2DQKA 4B6GA 1IDN1 2W2LA 4IFEA 5AHOA 3WRXC 1E60A 3HPQA 4IIFA 1XTQA 5FFNA 4EGCB 2FZKA 2JJYA 4FDTA 2O9JA 2PWZA 4QXOA 4E5DA 4BFLA 1XMPA 5A5GA 2ZUEA 3T1OA 1F8UA 2M6LA 3G9ZA 5EMHA 2G36A 1T2VA 2AMYA 2FX2A 4PG6A 4CM6A 1RC1A 1NQVA 2EGGA 1FE8A 3A1DA 3M2PA 2XQJA 1UIRA 2PSEA 4A5OA 4AC9A 5CCBA 1WB4A 3PE3A 3IBSA 3FWKA 3HXKA 4FFLA 2VJQA 1R5BA 1U98A 4FR5A 4Q7EA 2P9JA 3MHTA 1ISSA 1X38A 1YQ9A 3KVNA 3WB2A 3OF5A 3RSQA 2GCPA 4ZXPA 2WKWA 5ICSA 5JAHA 4UD6A 3B6KA 5CD1A 3NKVA 3G5UA 2JIBA 4KLCA 4XR9A 3O83A 2ZPUA 3JALB 1EG7A 2UZ4A 3COSA 2VP2A 3ESBA 3BB4A 1FYXA 1NN1A 4QBGB 4WOKA 3H2GA 4PQRA 4K9DA 4E5SA 5A1TA 1ESNA 4EMUA 4WNAB 5LUBA 4B6EA 4WJZA 2HMYB 1KQ3A 2PG3A 4NYJR 2HEIA 2PVCA 2HIAA 3OH8A 4I5FA 2VNHA 1TYDE 3HP7A 2IBSA 1N2OA 3O8BA 2VJAA 3WMFA 2Z04A 5HPYB 1RQGA 3LP6A 5LLDA 4L5YA 2IS2A 3Q3EA 2PFSA 3AP3A 1EFPA 1RPJA 1G19A 4ID9A 1SIUA 3HB9A 4P93A 3W6NA 2XQVA 1ODLA 3OQIB 4TLLB 2RD2A 1X8XA 2OFOA 3C3MA 2DX7A 5EP3A 5EQDA 3W5BA 2PKCA 3F1KA 4NONA 1PKXA 4RHYA 3V1YA 4U2GA 3S44A 3QLJA 2JLVA 2QTZA 3L77A 3A6KA 3QM1A 1CQPA 4HYYA 2B0CA 3RC1A 1BJKA 1T9GS 1JFFB 2LIVA 3A6JA 3P2JA 4UNQA 5HA5A 1DX9A 3D3QA 3D1JA 4GD3Q 5KTOA 1U6IA 2HO4A 4D9FA 5HRUA 4DV5B 3MFYA 4P5DA 1IQPA 3WG9A 3F71A 1XXHA 5LZ2A 2DR0A 1V7ZA 4G4IA 3GLGB 5KJCA 4EEZA 1PJQA 5IVKA 4OHUA 2R4UA 1G6HA 4YIHA 1RCUA 2Q2VA 2DPHA 3H5TA 1X7GA 5JMPA 5TMBA 1NVWQ 2IEBA 4FGJA 4QTTB 2XWJI 2W0MA 3TW8A 5ES4B 4E30A 2DECA 3L06A 5TPZA 1QX3A 1DC3A 2HCRA 3ZGZA 5HIIA 1HDGO 1UEJA 5HTOA 3W05A 1PUJA 1S2NA 3FA2A 4MWGA 1WZ2A 1JKJA 4B3CA 5HKKD 3E3OA 4X7BA 3UB4A 1U2PA 3STUA 1TM7E 4PO8A 3IGFA 4NZMA 1ES9A 1R8YA 1Q7EA 1U7WA 3I9NA 3O92A 3PPXA 4IIDA 3SY8A 4YMHA 2PZAA 3ZQKA 3I9FA 2KI5A 3NWOA 4EY7A 4Z99A 4OAOA 1V1RA 1WCYA 1Y4SA 4V0MA 1T8YA 4GBED 5G02A 5AXAA 3Q12A 1TMKA 3D02A 1AF7A 2SCUA 2WIBA 4MV1A 4LNAA 4Q3BA 4R1OA 3W6ZA 1L5SA 4LF5B 2QTVB 3QPCA 2ADMA 2O3SA 3LVFO 3RRXA 3WMWA 3EGWA 1KTVA 1EFCA 1OU4A 4IS3A 1UH5A 5AVYA 2HBYA 4NH4A 3ZQJA 1TUGA 4QU0A 4AZ0A 1J97A 1GT6A 3HGTA 2C0QA 3AFHA 4HV4A 3UMCA 3WFJA 1R6UA 4NS1A 4WZBE 3UT5B 4XUCA 4TV8F 3IKMB 1ZNWA 3PGMA 2TSYB 4DPKA 2J4DA 3KZCA 4O2BF 4L8LA 4YAJA 5ITWA 5DOZA 3LDHA 4FE3A 5BVHB 4ZJYA 2QPLA 1Q3KA 3R4CA 4RXTA 2V0NA 3PQ7A 2VTDA 2H65A 4F84A 2YRWA 4RX1A 1CPYA 4NBNA 4IVPA 1XJQA 5J2UA 4X92A 2FFAA 4ALIA 2QP4A 1N3YA 2HC9A 3MBIA 4H31A 4LGMA 4TKMA 1O95C 3MXTA 4QDXA 4DCSA 2P30A 2HF8A 2GPBA 2P6PA 3LL4A 1KNXA 3ASVA 1GDDA 4HZUB 3GEMA 1KMHA 3AVUA 3EQ2A 4B46A 2ZTHA 4B4KA 3AUAA 4UM5A 3VU9B 4NU0A 1NJ1A 3K32A 1KO8A 4PNHA 2ZYAA 3AI3A 3KVVA 2Z1DA 3ZEAA 5E3JA 1MXFA 3O91A 4F4UA 2CSXA 3CF6R 4HQ6A 2EJBA 3VU8A 2PWYA 4QYXA 2QLBA 1Q0HA 2E49A 1Q0TA 5AW9A 2IW1A 3KFLA 1Y8QB 3UWPA 2P9ZA 4DCNA 1EIZA 3I9LA 4INAA 1YMVA 5JLAA 3ZY2A 2GJAA 4AUMA 4OL0A 3K05A 3EY4A 2ZUCA 1S8FA 1XKXA 3MCAA 4C22A 3MJHA 2XXBA 3V4PB 3A1VA 3KXIA 3PNYA 3FVVA 4M55A 1I2CA 2R9VA 4S04A 3OT4A 4ZRNA 2QJTA 2R5FA 4LDPA 3F5DA 4M9RA 1FDIA 3BA6A 4N65A 5TB5A 3VTAA 2C97A 5LYYA 1RMYA 4WEOA 1USGA 3INYA 1CJCA 4Y1GA 1RLOA 4LBYA 3ER6A 4MO9A 5SYAA 4AJHA 2GCOB 3G9XA 2QN3A 3GBSA 4XWTA 5GVSA 4LS3A 4C4ZA 2CLSA 4EFMA 2P5SA 4INOA 2WM8A 2X9GA 1W36D 1XLVA 3UJ8A 3EBLA 1XD2B 1J0BA 2ZRBA 2VUSA 3N8NA 4WEQA 3OETA 3M1YA 3PQFA 2VHCA 4LPSA 4ILKA 5IM4F 4TSFD 4RIHA 4BUCA 1X70A 1RAIA 1UPTA 2D2IA 2TS1A 4QPZA 5IKXA 4R01A 2FZEA 4KMSA 4MZDA 4RTSA 2HSZA 3A2LA 3BAZA 3H0KA 3NH9A 1IXKA 3BGVA 1KDTA 3A58B 1I14A 1W0KD 3G89A 3B85A 3TLJA 3UJCA 3Q8KA 1H4VB 1PRYA 1UEIA 3VAAA 3WBJA 4W5TA 2XMQA 4UQPA 4EJSA 1F14A 1ADFA 4R2MA 3D64A 4MCJA 3ZHYA 5FI1B 3N1UA 4H7KA 2AN5A 4XVQA 2Q45A 3VI4B 4EAQA 1TKCA 3WZ2A 2P79A 2Q4OA 4ZVPA 3GU3A 1GNQA 5KI6A 1RM4A 2WQ6A 2J0VA 2ZT8A 1BHQ1 3ANTA 4O5AA 1KP2A 1Z29A 5KYUB 2JGMA 4UFOA 5K20A 1NN5A 4PHCA 4BIMA 3AETB 1GYQA 2EWMA 2NV2B 2GF2A 2G7MC 3BK1A 3ODGA 2PUVA 4HUQB 5P8WA 2VT7A 4RH0A 4D6PA 3WGMA 3RTCA 3HJNA 1T9GR 3P1JA 2F67A 4YT2A 3KDSE 1BDBA 2BGKA 2FN9A 5HCNA 2FPSA 2WSYB 3KKPA 4LNUA 3H6KA 4MIEA 2D1TA 2AX3A 3GHYA 3UMMA 4KC0A 3JPWA 4EF4A 5DYGA 1XU9A 3I01A 1PJ2A 4CIXA 5KSWB 5J43A 5MGBA 2WQ7A 1IOZA 3QBTA 3U60B 3OMLA 2OO5C 3RGGA 1CRQA 1R5JA 1QNLA 2ZI7A 2DPXA 5DX1A 5K3EA 4R1PA 3M7IA 5ERYA 3T3OA 4ZQEA 1JS1X 4PLYA 1PT7A 1H4TA 2A35A 3OZDA 1RJGA 3TQIA 1RYNA 1VLHA 4F06A 1EQUA 4U7DA 2ZOSA 4HWSA 4QRIA 4MQBA 2Y1LA 3AETA 2O0LA 3I45A 4BNDB 6NULA 2UUBB 2A84A 1CUVA 4JUAA 1UCFA 2QAGC 4UVHA 1QKIA 3G0GA 5ESWA 4Q9NA 3EEOA 2A5DA 5IWAB 3IBFA 3HVKA 1Q7CA 3RAJA 2A0XA 2H08A 1K3TA 3L8EA 4ZHQB 3IP7A 1E9CA 2QN7A 1IVSA 2JGDA 2LRHA 2PS3A 1E3MA 1SR8A 1GTMA 3KTFA 1CULC 3P9PA 3O8QB 2G06A 1ZGJA 2RH8A 1GTG1 1GUAA 3WL8A 1GLVA 1ZOOA 3NFYA 4U63A 1GCOA 3O8DA 4G8DA 3UMGA 3VTKA 2VXBA 1VLQA 4IDPA 1GYRA 3G2MA 1E1LA 3W6PA 4TVBA 2HADA 2IGTA 3KNZA 3EAFA 3NTLA 2AV6A 1VMEA 3EUAA 2FP4B 3VR4D 2PNFA 1CZNA 1MJGM 3WX0A 5FAKA 3A04A 2FDCA 1ESCA 5E4JA 1CUBA 3WWPA 4L3OA 1L4KA 2FFQA 1PYGA 3KB1A 4IDGA 2CFIA 1EXVA 4OHBA 4XB1A 5JXIA 1WABA 3H17A 2W70A 3HHPA 1NLYA 2ZIFA 3NMUF 2I87A 2PS1A 1VOTA 2DCMA 2QPAA 1H1TA 2HU8A 4IHKA 4NBSA 1CQXA 4Y7CA 3PFBA 1ODFA 2VOJA 3WC4A 5LP1A 4CF3A 4CMCA 5CH3A 5U4XA 2G63A 3G88A 4TWAA 3C97A 4QPPA 1O03A 1NLZA 5CYOA 5J5VA 3T7KA 4KSYA 2QVBA 3I2IA 3C8UA 4Q1CA 3ZTYA 3RADC 3DEAA 5A4DA 1CK4A 3AOGA 1FTQA 1Z33A 1STOA 1FP7A 2PXCA 4RXUA 2IC5A 4QOEA 4BASA 5E0OA 3MAAC 1YE3A 3PWKA 2B69A 1QG6A 2CZCA 3TL6A 3IELA 1DNPA 4BFXA 1PJ8A 1UUFA 4EATA 4JOSA 1QKJA 3AERA 4PY2A 4QDUA 3A3NA 1AV7A 3N39C 2N46A 3VPCA 1DC6A 2FRXA 3LSTA 1CY4A 2D1RA 2DFNA 3F6RA 3FROA 4F9GA 2PUDA 1DUVG 4AUEA 2C5AA 1ZUWA 1A2OA 1BE8A 1Y3HA 2PM8A 1C9JA 1G7RA 2HU7A 2Q21A 4CF7A 3RCBA 3UGJA 4R31A 3AR7A 1C9DB 1FZQA 1WDLA 2ERYA 2ZR0A 3GGGA 4PO1A 1POXA 4AVYA 4L15A 1OT3A 1WF6A 1WCXA 2KB0A 3RK0A 4MGZR 2J6IA 2IBMA 3WK4A 3ZCUA 5I7SA 3FYDA 2XUGA 3NT2A 4NJEB 4P92A 4J3JA 3QVKA 4W8HA 4KPUB 5A4AA 1U7PA 3I92A 2YHIA 4GYJA 4WK4B 3DV0A 3ODPA 3SIXA 1PR9A 2GSWA 1SD1A 1TMOA 3PC7A 2O0KA 5CFPA 3IT1A 4PTLA 1OLSB 2PQ6A 1HE2A 2YN0A 4S0ZA 1K27A 3AX6A 3OHSX 4OQ4A 1EHIA 2GPAA 5I9SA 1VPEA 2C1EA 3W2FA 4PG8A 4BX0A 3GLFA 2HJVA 2VLIA 1Z6AA 4S1TA 4A23A 5DNCA 1MO3A 2V7TA 4QTUB 1P0FA 5KYWB 2X2FA 2ZI4A 3LW7A 4XRRA 1QQTA 1O96B 3WFIA 5FIUA 4DRXA 1GNPA 4DEVA 4ZHQF 5I9LA 2ZJ5A 4OXKA 4EJSC 5D6NA 4UC0A 3V1TC 1PGOA 1I1NA 3O2NA 5AHKA 3UMYA 4UKDA 5AM4A 1LCIA 1T5BA 3TIVA 1BIFA 4EMBA 4YUWA 3TNFA 3K6SA 2C31A 1H5NA 3U0VA 1MR3F 3H2IA 3IJ5A 5J59A 4PHGA 2A94A 2NXJA 4EHDA 1NVFA 2FSFA 1Y7TA 2EHJA 2JGJA 1QC5B 1NUQA 3GUUA 2XOEA 3QA3E 4CG2A 3N7AA 4L8VA 5G0UA 1CUWA 4IDEA 4U5XA 1BE6A 3G2LA 1B8NA 3SQNA 2QR5A 5H3HA 3D6JA 1H6DA 1E5XA 2VBIA 4IIBA 1WCIA 1M7HA 3WY9A 4AB1A 3EXIB 2F1JA 1N5KA 4FYIA 4IHJA 4UM7A 3EIHA 4R4JA 4RHTA 2W6PA 5DTIA 2DWPA 1ZC3A 2B5OA 2IVFA 3AYXB 3F96A 3Q4GA 4ZPXA 3J7TA 4HAZA 4RHXA 3DNFA 4NZZA 4YP7A 4MR8A 4PZAA 1SUIA 5KU7A 1HY3A 1E3WB 4Z9XA 3URKA 4BKOA 3I3OA 3QPBA 1GXSB 5FTJA 4EO4A 4X1KA 1Z8HA 1Y8CA 4AJ1A 5DNDA 2JAOA 2BM8A 1ZN8A 2BM0A 1KRWA 4Q3OA 4HAXA 3STYA 1TZKA 1W88A 3AUTA 3FPGA 2I3AA 3ITKA 2ZVQX 4B6JA 4F3RA 1L4LA 3NPAA 4DV6B 5AM1A 5EJ2A 4Y18A 2Y1EA 4RY9A 3LC2O 3M6LA 2WILA 5JNVA 3C4JA 2FUKA 4U6NA 3LUAA 3IMCA 4EJ0A 3AEQB 2BELA 4HAUA 2HXSA 1BDJA 2XNSA 4RVDA 5DCYA 3UKJA 3AJAA 4DPMA 2QE7D 4C0HA 5CB0A 1RWOA 2IXBA 4YB8A 1BZYA 2UV8A 2IJGX 4ZIRA 2W4MA 4CLOA 1PN3A 3NBMA 3NIWA 1J24A 1E1RA 1LRJA 1Z7WA 2WMOB 3GRUA 1SHJA 2SBTA 3CN9A 5YASA 1U63A 1U7XA 4O4LA 2YHSA 3UXYA 1OOEA 3O75A 1DHTA 1JQEA 2I3BA 1Y5IA 2AG6A 3LU1A 4FR2A 4Q3CA 3VJRA 3A1NA 1J42A 2ZJ2A 4EVSA 1HDOA 1QIKA 2GBLA 5A0VA 5CVVA 4QYSA 4LE0A 3TD6A 5KTSA 1S1CA 2FB9A 1KHTA 1RJ9B 3OWHA 1MJNA 2Q3BA 3ZE2B 4AKGA 1OGJA 4POOA 1IYZA 1UBOS 2H1VA 3C45A 2J09A 2L17A 2MOKA 1XKTA 5TT1A 3LUPA 4DSUA 1M2OA 3M6AA 3L02A 3RC7A 3A9UA 1KHHA 1W0CA 3QVGA 5C7OO 3IVAA 2HZ7A 3I6ZA 5LZ8A 3TVDA 3H6HA 5JD5A 1JI3A 1JAZA 1H3FA 1TK9A 1YKGA 2W83A 2ZWPA 3D6NB 3SJ7A 3SIRA 4BLWA 5IT5A 3OPNA 4P6VF 1GYPA 3GMIA 5HQ3A 1R1DA 3NC4A 2VKTA 1QWSA 1LQ2A 3ZDZB 3HM9A 4ZTUB 2BFOA 1RXWA 1EP1B 1KZ4A 3HZZA 1WJGA 2Q50A 3PXXA 3JAMA 1JJBA 1T10A 5EKXA 4KN6A 4TYPA 3VH3A 2O57A 1IVNA 3JQ8B 2RCNA 2PH3A 3D5EA 2D6FA 1YHNA 1CVIA 1BVRA 4PLZA 4HF7A 4DV4B 1XZDA 5KYWA 4LZJA 1E2QA 1E8DA 1HT2E 4WBNB 3B52X 4RIIA 1T5DX 1YTUA 1KMIY 5KQSA 5F1KA 3D7SA 3ENKA 3K8YA 1H8HA 1JTVA 1PI3A 3HKEA 1JL3A 2PZFA 3E0XA 3EXHA 3ND8A 5IAGA 1P1BA 4IX9A 5A6VA 2I2DA 1NFFA 2WT8A 3FCYA 3L0PA 3ESQA 5EHNA 3T15A 4DLYA 4Q7QA 4MDFA 3BZUA 2H5LA 2WF9A 1OKKA 1Z17A 1Y5RA 3GMDA 5EWLB 3SLRA 4EZIA 1RWMA 4LGCA 1AX9A 1PG0A 3NEYA 4BMNA 4BECA 1WTAA 9GPBA 1SUDA 2CXOA 2JFOA 3PI6A 3CH4B 1GGFA 2R2GA 4OYYA 1JBKA 1LVUA 5GTDA 5EMJA 4PGMA 1AKQA 7YASA 1SRRA 3Q6MA 2FPPA 4IIJA 3CVXA 5B3AA 1ODCA 1UP7A 3BD9A 1PWZA 3B1JA 3HTXA 2HA0A 1MAAA 1E5DA 3KPWA 2VSNA 1PK8A 2EIHA 2BDEA 4AM8A 2QTWB 4Z3DA 1SHTX 4M7WA 3GN1A 4WECA 4IGEA 5FO1A 4ZCTA 3MBOA 1XRPA 3BXGA 3EFOB 1G6KA 1B7GO 4BNYA 2UXBB 2RGUA 3JWIA 3OLZA 2QXUA 3DSRA 3UENA 2HRRA 4M4SA 2OP0A 3IOYA 4O33A 2EBUA 4YUYA 2IP4A 2IQIA 5JZBA 2XCLA 5L7TA 2X0NA 3RANA 1UBGA 4R81A 3W8NA 1SUBA 1RRFA 1J25A 1C3VA 2IL1A 1OIXA 5EKUA 4TLMB 2DFVA 3DXYA 1AA6A 3E58A 5AI9A 3SS8A 5FAXA 4ZYVA 2YZ2A 2X6RA 5EIBC 1SZJG 1CNMA 3PE6A 4Q7MB 3FF1A 2BOVA 1NVUQ 4U8GA 2CVFA 5G4KB 4JDPA 2COUA 3N0VA 1TKBA 2F59A 1ZMRA 3NGLA 4W99A 4KWCA 3VTFA 5C37A 4MCHA 3R3WA 4JCCA 3ECAA 3CR3C 1T0HB 2Q62A 4GXQA 2AOXA 3AZQA 3QYFA 1P75A 3NDBB 3MMNA 4HH3C 4G0OA 1YQQA 1DI0A 2E37A 1KO1A 2J9ZB 2LCFA 3GLVA 2EWWA 4RA6B 4HLUA 2C9OA 2FPIA 1Z56C 1K3UB 4CI0B 4RMIA 1BC5A 3PV0A 4B8YA 2FEXA 1GL6A 4QOFA 3P27A 3SYMA 1XCJA 3G82C 1PLJA 3GJ8A 5EXEA 5AW0A 5LD2C 2LW7A 1NMXA 1P80A 3IAM6 3L92A 4EG3A 2YY5A 2XUJA 4TMFA 2Q9BA 1HQCA 1JZQA 1Z6TA 1AY0A 1E7QA 3EX7C 1DAIA 4TUYA 4PAQA 3TZ6A 3CH6A 4JR0A 4LFAB 1Q7TA 2AIRA 2B25A 2V45A 4B6PA 5GMOA 4RLHA 2A33A 3TPCA 2GBLC 4DBVO 1NXOA 2G5GX 1EWKA 4J1TA 5BUCA 4G1BA 3BMCA 4RJJA 5CW2A 3ELBA 4MDYA 3H2JA 3RNLA 2C84A 1PSZA 2L69A 5KU1A 4K3VA 1U1EA 4L2IB 4UEQA 3HL4A 2WF6A 1ENZA 1ZP6A 2BGTA 5JWRA 3GRAA 1J90A 2OQ2A 1YD7A 3PD7A 5E6RA 1EP9A 5ULLA 5KTMA 3R0QA 4RIEA 5JZ9A 4ZAFA 4IINA 2ZE8A 4KU4A 2IZ5A 4TLBA 4A1OA 4KH1A 1JIQA 3R0IA 2ZITA 1KPGA 2Z43A 1Q1EA 5CAEB 2GZRA 3FR7A 1Q2XA 1TU0A 5KCMA 3A4NA 1C1YA 2HCJB 1U1GA 2GQ0A 4HT3B 2QLFA 5A3JA 3F6CA 1HURA 2B4KA 3N2ZB 3TYXA 4DPLA 3H5LA 5HQ3B 3DAGA 4G9EA 4I36A 2JI4A 1A5TA 3GT4A 2IYEA 5A9RA 3U56A 1NMSA 2JEZA 1DG1G 3GJ0A 5BUSA 1H94A 1JJVA 4H3KB 5IH7A 5ALXA 1SCDA 2JIPA 2VYCA 2H9IA 2B4TO 1GAJA 2GXQA 3U16A 1THGA 3WB1A 1QE5A 5F33A 1EX6A 4TWZA 4JGIA 4O8ZA 2JLBA 4LHVA 1E9RA 3U09A 2W2XA 3IHLA 4UHFA 3ABQB 4B2PA 3MWKA 1EPUA 5IJ9A 3B1ZA 2CMFA 3AVOA 5K6AC 1E5LA 2DZDA 4NBUA 4OJKA 4MUIA 1DUSA 3DL0A 4JC8A 3UV3A 1OH6A 1OYYA 1HSOA 3PPWA 1B6GA 4D6YA 5IZ4A 3QEKA 5GV8A 2AFHA 3GIDA 3IR5A 2G1JA 5I7WA 1Q0PA 3NVKI 4FINA 3LWZA 4V0NA 3D59A 1XLUA 2JBAB 3U44B 3L4EA 3VU0A 3QLVA 2OGZA 4QG7A 5DBGA 2HGSA 2ZYRA 2C95A 3ENWA 2C7OA 2VAVA 3MOGA 2OORA 2H4ZA 4N0MA 2B9EA 3O2QB 4EHBA 5JAPA 2R1UA 1CZRA 1NNI1 4IH1A 5LYJF 5DHTA 2JBHA 4CGZA 3OZTA 4YGYA 1PKEA 4HBGA 5AJTA 4QEZA 4BCCA 1YRAA 4OO3A 1Y8QA 3GLHE 1T2EA 4UOEA 2FUG1 3MCZA 3TMKA 4FSDA 3R7SA 2JI9A 2Z1MA 2ONZA 3GARA 2WDPA 1I9GA 1W5SA 4AY3A 1UKZA 1MB3A 1RTKA 2FSIA 1J1IA 2ZRIA 3CW2A 1QG0A 2OILA 3C5CA 1R5NA 3EGCA 3U4IA 1YDFA 3V5NA 4D9MA 5BW5A 2DUWA 4CGYA 1GZ7A 1M3SA 1UK8A 3TNJA 4A16A 3EA0A 4EX7A 2NYAA 1JPNA 3B89A 3WL4A 3U19A 1A4XA 1JLLB 1WBBA 4KRXA 4DJJA 1HT3A 4BNTA 3UK6A 5AK5A 4AZ3A 5JSYA 2XR1A 3HKCB 3CLRC 1MA3A 3DVSX 4BEVA 2KHZA 4XB2A 1NNEA 2JZOA 5CT5A 4YRQA 3O21A 5BORA 5HWSA 5KPDA 3P2KA 5DNEA 1BG6A 4L3WA 1KQNA 4NCHA 5IUKC 1NSFA 1IFXA 1OIWA 3ACBA 2H85A 2VCYA 1R12A 3EWIA 4FGUA 3CF2A 2CVQA 4G5XA 2J5QA 4ZMRA 3HSYA 4HJXA 4M1KA 5DTMA 5H70A 4UJ5A 5EIEA 1KDRA 4C2BA 2UVDA 4LHSA 3V7NA 4P54A 4YRZA 1QO0A 3Q8XB 3OX1A 5DGHA 5BNWA 4EUSA 2CFSA 1XEXA 1CYEA 1PR5A 2Q07A 3CVUA 3WIDA 1W4CA 2JA1A 1D7OA 1C50A 5EP2A 2JPDA 3AF0A 4KQCA 2H5EA 2D8MA 1OT5A 2PGOA 1IZ0A 3BXHA 3CH7A 4IICA 3OQNA 2Q4EA 2R4TA 3BSFA 4CF5A 1G3QA 1F2TA 3N2YA 3U13A 4K1XA 5FADA 4Q1FA 2HA6A 4EMTA 4LEIA 4PX5A 2BEVB 5K0FA 1TU3A 4KG7A 3HI6A 2XUQA 5KBYA 1O6CA 1FEZA 3GLFE 3OIUA 3TL2A 3MRTA 1OV4A 1PVOA 1G5TA 1EK2A 2C58A 4ER0A 3OPYB 3QWAA 2FZ5A 1JDUA 2Q28A 5JJLA 2YYAA 3VFDA 2WMDA 3TZQA 5U1PA 5FKJA 5C4MA 3PX7A 2C8VA 3OM8A 4Z9YA 1GDHA 5F98A 3V1KA 4JX8A 2QZJA 1E6LA 2Z9BA 2J7KA 4XWOA 4KO2S 3KJHA 3ZGYA 2CXTA 3CUKA 3H9UA 2PK3A 2V3VA 4R8KA 2IHNA 2UDPA 4MGKR 4RD2A 1NWCA 3HKBA 2BR3A 4QATA 3I0MA 3FOBA 3WOHA 5KX5F 4UVGA 4W9NA 3W2GA 2ACEA 4HNVA 1FLVA 4F7DA 3NWPA 4J29A 3LQRA 1NX6A 3QXCA 4JJIA 3V8VA 3REQB 2WFZA 1X80B 3DUWA 2ZI3A 4TQUS 5LQNA 2Q3EA 4JXZA 1LPBB 3EVAA 1MNAA 3KOYA 3U49A 5B64A 4JYCA 2FPGB 2AG0A 1V6SA 1YQGA 2YN4A 5HXAA 4OSEA 4KW7A 5JS2A 4ZI7B 2OGSA 1KOFA 5F51A 1GPWB 1I51A 4IG4A 5HK9A 5KAPA 1OFTA 4LMBA 3C7AA 3A6EA 3A32A 4CUJA 3OZBA 2O0HA 4Q3KA 1F3OA 1E1CA 1T8WA 1SHLA 2MTBA 2WNSA 4N01A 3VO8A 5KINB 2ZWAA 4IXDA 3EK2A 1VMDA 3DKKA 4KQ2A 1EVZA 1OHHA 4OP1A 2ZUBA 5FB3A 3VI3B 2REQB 4HOYA 3DTNA 1NVDA 5L4NA 5BOSA 3VAYA 1EWYA 3EGDA 1OCEA 1TF5A 1F17A 4FD3A 2GK4A 5F77A 1QV9A 2ZB7A 4EKDA 3BGSA 5HJ7A 3H5AA 1M75A 1MABA 4PFJA 2BHNA 2C92A 5FNVB 3CVYA 4OLBA 4CEIB 5K4AA 4ACBA 4QFMA 3HDTA 4HBZA 4RS3A 4BEWA 4Z49A 4JHLA 1LC3A 2HWYA 5AUPB 1NVVQ 4EL5A 2R8OA 3FSRA 4GPEA 3OD1A 1NW7A 2RH5A 3G68A 4JLDA 4KLAA 4ESVA 4GOOD 3BIOA 1XPRA 1PD1A 1JDVA 2DQSA 3A9RA 2FCRA 1FSGA 2QE6A 4I4CA 5CLHA 3GAMA 3JARB 4M1QA 6PFKA 1TIBA 4BJ6A 4IHAA 4QKQA 4DS3A 2IIBA 3IHTA 2VAXA 3OMWA 5FJIA 4FK8A 3PR3A 1XB2A 4HLQB 4OB7A 5D3QA 2A5FA 4M9SA 4WA7A 3I9V1 4N3NA 3EZ2A 4RAQA 3WGNA 2Z5VA 4NE7A 2PSJA 3ZUPA 1SKYB 4F1WA 2GSDA 4LWPA 1N2SA 5J2TF 1GN8A 2JGAA 3QZUA 3RIHA 3ZNNA 3T3IA 3AEUA 2GD0A 2I2BA 3MLEA 1ZR4A 1S3SA 3DTVB 2ZJ6A 3NT4A 2VHVA 5JSUA 3TS1A 3KQHA 2RAFA 2GNPA 4TMYA 3CLTD 5EN4A 3U7HB 4E31A 5ADHA 4MEBA 3VH1A 2AEJA 5BQFA 3IDZA 3IKTA 5IDQA 4J4HA 1FFAA 3VVCA 1YIAA 4B6SA 1YUBA 1Q3HA 1QBGA 2IFTA 3I2JA 2DUJA 4TSKA 1QH8A 1OX5A 5IHXA 3R7WB 2C0CA 1FDWA 3VX4A 1HSZA 1M9NA 2BBOA 2C07A 3DGFC 4LXTA 4WLOA 4UHEA 1TGVA 1PR1A 2YL2A 4MPTA 2Z57A 4O1IA 5T4HA 4D9GA 1PS0A 2WOJA 1YS2X 4I4LA 5GJWC 5GJCA 3ANXA 4CMHA 3R77A 4EW2A 4JEUA 3W3AD 1PR6A 2GM9A 4AI6A 1YS6A 1OC2A 1Z0DA 1EZZA 3CUYA 3SLKA 2X5NA 1VPDA 2Y1GA 4JGGA 1ZHFA 2GEJA 2PGJA 3K6RA 4XX0B 4ZYUA 2Y27A 1UBFA 5H4GA 1SC3A 4R69A 3ZE7A 4J49A 3OJFA 1E63A 2XY4A 1F2UB 1TJNA 1B6TA 2HDWA 3VV2A 1ZM2A 3N53A 2FMIA 1GKKA 1LW7A 3LD9A 4OOEA 3CFYA 1R64A 3Q85A 4Q66C 1P0IA 3C7TA 1A9XB 1KQGA 3GEGA 4RIFA 3UT5A 3CV3A 3OESA 2AOTA 2OV4A 3V1MA 1NJGA 1PEAA 4Y1EA 3G9UA 2W6ID 4MI9A 1DDIA 2ZBPA 4L8WB 4XLZA 4J43A 2IPNA 1MZVA 1RQPA 2D5CA 4B83A 4WBNF 5KTYA 1J0EA 1ULZA 3CQ9A 5IG2A 2P62A 2QMQA 2B36A 4PNPA 2QW1A 1ZGCA 2A0YA 4Q9DA 2EFGA 3M6WA 1E2FA 3PNMA 4MVJM 5B7PA 1L4MA 4RF3A 3GDOA 5AI6A 3HA5A 4M0DA 2BKEA 2VK4A 2WE8A 5ENZA 4D44A 3T3PB 1OZAA 3QV2A 3PR1A 4MZXA 1POWA 4X90A 4CG1A 1N77A 4TKZA 2C3MA 1IY9A 3G17A 3OEED 5JMOA 4YMWA 5F3DA 3EIXA 2NZVG 3A26A 3NHSA 4UTVA 4OX9Y 3DE4X 1V95A 2VHYA 1XCGB 2W6NA 3DDHA 3HCNA 2FZLA 4LJ8A 4FN4A 4WK6A 5E1MA 1A7UA 1TUBA 2FK8A 1NNUA 3D8UA 2CD7A 1BSVA 3DDNA 1CF2O 3G1WA 5JW6A 4P81A 5K45A 4D0GA 2YFKA 4F4FA 2BTEA 4QLOA 2X3FA 2R7AA 1SUEA 3SC2A 1R4NA 2HPAA 5CCEA 5E2BA 1Z18A 1GTZA 2ZJ1A 1SXJE 1UEXC 4RD3A 5L95A 4CLOB 4ZIRB 2BKUA 3SOZA 1W30A 2B8JA 3DWFA 1GU0A 3PYXA 5DV9A 1TLFA 1T1RA 3V1NA 4TYWA 3WK6A 4CIYA 4YAOA 3JASA 3CJTA 4M6WA 2ASEA 3KUXA 3K3PA 3W9UA 4OQDA 1DCTA 1XVVA 2J9GA 4LZAA 4KXMA 2BGWA 4NDZA 1X2BA 3CZPA 3I37X 1ZIDA 2AC4A 5I48A 5IWCA 2XGJA 1PX2A 5AHRA 3HR7A 4QXRA 2O7NA 1L7MA 5CFOA 2NV0A 2F2TA 3FY4A 4MLPA 2VDQB 3F3KA 3QKSB 2BTQA 5H16A 5A4MS 2W4QA 3GMSA 3PI7A 4MRVA 4ZWNA 3LPMA 2YY7A 5K0TA 1Z37A 2G4LA 4ZI3A 2BI7A 1F2VA 5LBIA 3KEMA 4PYQA 2I34A 1T34A 1IY0A 3RKSA 2X5JO 1NRJB 4WN9A 1S2LA 1N9GA 4DLWA 1KP9A 1K0FA 1WX1A 2BD0A 4I4IA 5IXYA 3BICA 3ZJVA 7REQB 1MUUA 4IH4A 1V6AA 1KE1A 4LJ6A 3RFCA 5IK2D 4LOKA 5JPCA 2AYXA 2Q3CA 4ZQFA 2CFRA 2ZCVA 4G3XA 4KJXA 3Q3HA 2OMKA 4U8HA 1JDPA 1H9CA 3QITA 1Z82A 3ZGVA 1QYXA 2ZM6B 3ES9A 4R6WA 4J7XA 1A8UA 1G98A 1KO7A 2JIDA 4GNRA 4WGGA 4DMMA 5JNTA 3IAHA 3PLNA 4WWHA 1WCIB 3KSDO 3L8ZA 3F2IA