1ZL2A

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine and phosphate ion at 1.85a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
253
structure length
253
Chain Sequence
MSKSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with inhibitor and phosphate ion at 1.85A resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 85
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zl2A00
4H1TA 5F77A 1TGVA 4QFBA 1Z36A 2Q7OE 4R2XA 3EUEA 3TL6A 2HSWA 4G8JA 1JDSA 2AI3A 1NC1A 3DDOA 1V48A 1Y1SA 5CXQA 2A0YA 4DA7A 1ODIA 3LGSA 4R2WA 1RT9A 2IQ5A 4WKBA 4DABA 4DA6A 3OCCA 4YO8A 3K8QA 1FXUA 1Q1GA 4TS3A 3MB8A 3DJFA 3IEXA 1RCTE 5CXSA 1PR6A 3UAWA 2QDKA 1PW7A 3BL6A 4OGKA 4TTJA 2QPLA 3FUCA 1RXCA 1PBNA 4F2PA 2ISCA 4OY3A 1VHWA 3U40A 4M3NA 4JWTA 1JP7A 2A0WA 2AC7A 1U1CA 1YQUA 4U2KA 4QATA 3O4VA 4JP5A 3T94A 4TXLA 2GUWA 1NC3A 3OZCA 3PHCA 4L0MA 1U1GA 1OVGA 4NS1A 1RXYA 1LV8A 4YJKA 3FB1A 4IP0A 5F7ZA 4QASA 1VMKA 1Z33A 2I8AA 1K9SA 4TXNA 3IOMA 4PR3A 1YQQA 3E9RA 4WKCA 3F8WA 1RSZA 1JE0A 2A8YA 1B8OA 1T8WA 5CCEA 1A9OA 1LVUA 1LX7A 3K8OE 2OECA 3FOWA 3KHSA 1Y1TA 1ECPA 1YR3A 5CYGA 1OTYA 3P0FA 1OTXA 2XRFA 3DF9A 3NM5A 4NSNA 1Z39A 1PR4A 1QE5A 3NM4A 4TTIA 4FFSA 2OC4A 4OJTA 4D8XA 4BN0A 3UAXA 4I2VA 1JDTA 1JE1A 4TYMA 4QARA 1K27A 4DA0A 4BMXA 1ODKA 3INYA 4F2WA 3MMSA 1A9QA 1CG6A 5CYFA 3DPSA 4F3KA 4TXHA 4ECEA 3UAYA 5B7QA 5I3CA 4D98A 1RFGE 3FNQA 4DANA 3GB9A 1A9PA 1TCUA 4TS9A 3UT6A 4YMLA 2H8GA 1OU4A 3OOEA 3LA8A 4MARA 4E1VA 4M7WA 4M1EA 4D8YA 1G2OA 1B8NA 1N3IA 3OPVA 5F7JA 3OF3A 5EUBA 5F7OA 4KN5A 1OV6A 3EMVA 2OXFA 3PNPA 1JYSA 1V4NA 1JDVA 5FAKA 2AI2A 1PR1A 4LNAA 1SQ6A 5EPUA 1SJ9A 1T8SA 3NBQA 4R31A 3D1VA 1RXUA 1JDUA 1PF7E 1Y1RA 1PR5A 4TTAA 3KVVA 2I4TA 1XE3A 4G41A 1A9SA 1Z5NA 1CB0A 1VHJA 4MCIA 4EARA 3BSFA 1ZL2A 5F78A 1T8YA 1Z5PA 4GKAA 5F73A 1Z37A 4WKOA 1T0UA 4QEZA 1A9RA 1PWYE 1V45E 1PKEA 1TGYA 1A9TA 3ODGA 5EFOA 4TXJA 3O6VA 3QPBA 3ENZA 5F76A 2HN9A 5KB3A 3P0EA 4TXMA 5JPCA 2QTGA 1Y1QA 1TCVA 5ETJA 1JDZA 4L5CA 1Z38A 4OGLA 3OOHA 1Y6RA 4F3CA 2A0XA 4L5YA 3E0QA 1U1DA 1RYZA 4NY1A 3E9ZA 3DP9A 1V41E 4GMHA 1ODLA 2ON6A 1ULBA 4LNHA 3EUFA 3GGSA 2AI1A 5B7NA 4GLFA 4D8VA 4PNPA 1Z34A 1T8RA 4DAEA 1Y6QA 1I80A 4DAOA 2HWUA 1RR6A 2RJ3A 4DARA 4D9HA 5F7XA 3OZDA 1RXSA 1A69A 5B7PA 2BSXA 4BMZA 1NW4A 1C3XA 4BMYA 1V2HE 2HRDA 2B94A 5DK6A 1YRYE 4LZWA 4F1WA 5CCDA 4OF4A 3ONVA 4EB8A 4WKNA 5C80A 3EEIA 4P54A 4X24A 4YNBA 1U1EA 4DA8A 1PK7A 4G89A 1PR2A 3KVRA 1ULAA 3KUKA 4MCHA 3LBAA 3FAZA 2P4SA 1SD2A 3PNSA 5IU6A 4GLJA 3KU4A 5K1ZA 1U1FA 3OZBA 3KVYA 4LKRA 3SCZA 2QSUA 4JOSA 2PGAA 4UC0A 4OEHA 1PR0A 4WKPA 4L6IA 4L5AA 3UAVA 4K6OA 5B7GA 2OC9A 3FWPA 3OZEA 3BGSA 4LDNA 1YBFA 1VFNA 3PHBE 4RJ2A 1OUMA 1PK9A 1Z5OA 1K3FA 1V3QE 3UAZA 1Z35A 1TD1A 1ZOSA 2QTTA 1JPVA 3C74A 3NM6B 1M73E 1ODJA 4QAQA 1WTAA 5IFKA 1SD1A 3BJEA
chains in the Genus database with same CATH superfamily
1I7DA 2QJFA 4FKZA 3G9ZA 1F9EA 3ITDA 2VBIA 1JF8A 1AKVA 2LCFA 3BE5A 1EJ6A 3CRW1 3Q2IA 3UWOA 4AF8A 4R1UA 3EUEA 1AH2A 2NOAA 3MWFA 2NMVA 1RKXA 4OHRA 4BEBA 1T2VA 1XMIA 3R6LA 4WX2B 3HSKA 3T12A 2F62A 1L8QA 1ZRNA 2GERA 3Q15C 2D7JA 3E23A 3H84A 4D3FA 2Q2NA 4MINA 5E4YA 1BXRA 2B8JA 4QPZA 3AVPA 2BFOA 5HGXA 1MC1A 4F5YA 2H7CA 2LV8A 4L95C 5C8VA 2J08A 2GKSA 4KACA 3TK1A 4AXXA 2B92A 3TS1A 4F6LA 3M3DA 3UMFA 3FY4A 3PQ6A 1E2IA 2ZQ5A 4URFA 1FTGA 1ST3A 1TX4B 1BGXT 1VJ5A 5J47A 1OWLA 1JXQA 4DABA 3CT6A 2DQZA 2OXIA 3RJTA 4AZ3A 2C82A 2ZYIA 3GRVA 2QQEA 4A0GA 3AXSA 5DN6D 1D07A 4TS3A 5BYBA 4YFVA 3JYQA 4N8SA 3V42A 4GNRA 1XTQA 1EYZA 2FP4B 2QTRA 2CXHA 3DXFA 3ONWA 4XKJA 3LPNA 4YP5A 1PYGA 3ZDEA 1T91A 1D03A 3PXUA 3MK31 3TEMA 1DCMA 4TMYA 3OIDA 4Q4JA 5AHOA 3NORA 1SG0A 3UG7A 2QDXA 3ENVA 1R0CA 1Z7GA 2P2LA 2B4AA 2YICA 1VSTA 1RJ9A 4UOZA 3AL2A 4OLBA 4HVCA 5DZSA 1U1IA 2PT5A 4KHPB 3I2KA 3PQ3A 5JXWA 3AH8A 5BOSB 5HK9A 3E7XA 1S2OA 2J4FA 3KELA 3AY0A 3M6AA 2K6GA 3GVIA 2J3LA 3PE3A 1MXFA 4ZEOA 2IYUA 4NDNE 4PN3A 2SICE 2Z98A 1EU1A 1BE6A 1FVFA 2QJWA 4OCZA 5JAUA 1UAGA 2HQBA 4UMFA 1Z4LA 1I6MA 3K0EA 3LL7A 5DOZA 5G0TA 2HMYB 3PDIA 3T94A 1T6YA 4HADA 4JBNA 2ZJ2A 1RRGA 2JIZD 3LT4A 3OQJA 4NENB 3RWOA 4H59A 2W6ID 3PR1A 3UHAA 2GUWA 1RKVA 2XBUA 1ETUA 1Z26A 2AB0A 2C84A 4BMNA 2UUPA 1XKTA 3FJYA 3KJEA 3DE4X 3CUVA 4AX4A 1U3DA 3PC2A 5I6DA 3IESA 3R20A 5ICMA 3HY6A 3EVGA 1HYHA 4WK6A 2FN9A 4R5HA 5DYGA 3UWSA 4O59O 4CMAA 1DHRA 2XBLA 4MRAA 1AJEA 1J42A 4KR0A 1KDZA 3TGWA 4ZT4A 4B7XA 2ZIGA 3N5CA 4F4HA 3JALA 4U2GA 5TMPA 3WNQA 2E18A 2H29A 1BVRA 2QR3A 2XUIA 2DFVA 1MRSA 3ANNA 1FXWA 4ZTBA 5JJLA 5F7ZA 1AS0A 1ZGAA 2VSOA 2ZRMA 1DX4A 1VMKA 5JCJD 4MVJG 1TJNA 3FOZA 2EJCA 1IHDA 2N0SA 1SIWA 2B1JA 2C29D 1QIIA 3DFMA 3F1LA 2I4NA 1SEVA 2FX3A 2X9NA 2EXXA 1WMBA 3NONA 3VJRA 1TT7A 2IIVA 2JCVA 2R65A 3A9SA 4TLLB 1KJWA 4CQMB 2XR1A 5IJ9A 3KTDA 5KSOA 2WICA 2VYND 4I5GA 4JUCA 3KT0A 4MS1B 3U7IA 1JE0A 3KPUA 1K6EA 1NJFA 3FTQA 2I87A 3TOXA 3UB4A 1NT2A 3S2UA 2X8JB 2NIPA 1YRHA 2BFFA 3P1JA 4WOJA 2LCQA 4UHKA 2WF9A 4GR4A 2OECA 3BFVA 2ZAOA 5AUPB 1GPYA 1YU9A 3LUHA 4F86A 1PFUA 2CFOA 2NUAA 4BVJA 1C0EA 2I4OA 3ZNNA 3RS2A 4BFUA 3RYCA 4LX8A 3QNMA 4HTFA 4FR2A 2VTBB 5HHTA 1SWWA 2UYOA 1KHTA 4Z4CA 3PGMA 3PUZA 1QO9A 4MW1A 2JAUA 4BNDA 4W7HA 2Y1CA 4RVOA 1XMJA 1PR4A 1RPJA 4IJWA 1PD0A 2QY9A 3HG7A 5CNIA 3UWKA 1O5TA 1QG0A 1TIPA 1RU3A 3HGQA 2RH9B 3FVWA 3P5SA 4OJTA 4DLRA 2MINB 4ZCTA 5JADA 4X20A 3WS7A 3INNA 2QNIA 4WVLA 3U62A 1RBQA 3QXCA 4LTMA 3STVA 4CIWA 2CCGA 3UAGA 1ORRA 1IJFA 2WIDA 3DWGA 2DWUA 4BFWA 4DYDA 4HFNA 1JH8A 4KUEA 4OJQA 5EJ7A 4Y7CA 4DV6B 1EESA 2AV6A 4LJLA 2CHUA 1JAXA 4EZEA 1BH6A 2H18A 1W52X 2BBOA 2G77B 3G1WA 3HABA 4W1RA 3TSAA 3UJ7A 4FCCA 4RETA 4R6XA 3KPJA 3Q3HA 1PJ3A 4DLWA 5I8WA 1CBUA 1LU9A 4QEDA 3M1YA 1Z0IA 2C9BA 1WL8A 3DZCA 5K3BA 2HSZA 3DC7A 4H7DA 4B32A 4NAVA 1A9QA 1IZ8A 2G4CA 5ITWA 3ILSA 3KJNA 1P9WA 4QPCA 3S3TA 4CKEB 3HR8A 4HNRA 4RUKA 3DMFA 4WSOA 1LDYA 1AHPA 1EP2B 5BN3A 4JB3A 4IPTA 4HEQA 3NWOA 3WGIA 1H2BA 1CY8A 1NNI1 1P4SA 1EXWA 2GN9A 4HQRA 1SXJD 2EZUA 4LYEA 2B35A 2I3GA 3I4CA 1Q95A 3H42B 1PN3A 1U5BB 3ZUPA 4L1KA 4HVTA 1YS2X 1CY4A 3HXTA 4Q37A 5JXJA 3OO0A 3EB9A 3CT4A 3FG9A 1N2IA 5AICA 1KGDA 1MV5A 1B43A 3AEYA 4R2JA 3GRAA 4RM3A 4I4LA 1VSQA 3K96A 4DN6A 1PP4A 2A0UA 1HGXA 2GRJA 3EVZA 3NIFB 3KQWA 4BN5A 3TMKA 4DV3B 5T8KA 4RZHA 1JQBA 4ZIRA 1V3UA 1DX6A 2WFLB 2VHWA 2PZ8A 5CURA 3ZUGA 2PUGA 1W85A 2JFBA 2O2CA 3C45A 3HB0A 5ALIA 1YJBA 1WQ3A 3S8YA 2RC5A 3EARA 4INAA 2X3UA 1O5OA 4JZYA 3UW3A 5JVDF 3AVOA 1BVUA 4LHVA 5F21A 2A1IA 5FJIA 2H1IA 5L9AA 1YMUA 3KKOA 1O96B 3QA9A 1MDFA 3ZH2A 3SK0A 3EIFA 5LMUB 4WFJA 3NCHA 1NQWA 4MUEA 2YZGA 1RRCA 2NPIA 4IXWA 1Y80A 2X4DA 1A0OA 3IP7A 2PTGA 4MH0R 2IHBA 3RTGA 2VIIA 3PQ2A 3QHAA 4FYJA 3MGBA 1UZLA 4I50B 4DIUA 1SUDA 4EKGA 1UMDB 2DTXA 2OXFA 1JYSA 4FMDB 5EZQA 3TI7A 3VPSA 3ZBPA 4QM6A 5KYWB 4H31A 2J33A 3GHYA 3LCJA 1UJ2A 4J2TA 4M0UA 5DXAA 5BWMA 4AZSA 2UU9B 2B36A 4Y67A 2CDBA 2NYVA 3WRYC 1PS8A 4K2HA 4AJNA 1EFDN 2O5RA 4DPLA 2UUCB 1Z6GA 2OENG 1JR6A 4CIYA 4BDSA 2X3FA 3E5MA 1YJXA 3TLGB 621PA 4E11A 1R12A 2GILA 3KKMA 3MCUA 2XMCA 3MGCA 3O2NA 1PFVA 2R48A 1T8SA 4MWGA 5EHGA 3RYFA 2YFQA 1N2CB 4N01A 5THQA 1ISPA 1TZCA 3D8TA 4UXHA 1EFPA 3C6QA 2C7PA 1L7RA 3JASB 5TE9A 5BV8A 1JDPA 1N6NA 1X7WB 2WSYB 1FDRA 1HLFA 3A6ZA 3BM5A 5F4ZA 5FADA 2QI9C 2X7XA 4CKXA 1MGPA 1G5HA 2GD1O 4YWHA 1T8TA 4MRPA 1SUEA 3AUTA 2HA4A 2VHJA 1P9RA 4HNAB 3HDQA 3SXJA 4KH0A 1HDOA 3NJ4A 1XDGA 1E9RA 1NBOA 3PHHA 1Y8AA 1HQYE 2O6LA 1YQDA 4LXYA 2CXUA 1UFVA 1C7RA 2YXLA 1NBIA 4R1NA 3H4TA 4CF5A 4EYSA 1ZC3A 1YE3A 2DHRA 5G40A 1OCEA 3HCDA 4MCIA 5CFRA 2IX3A 5ENVA 1Z7BA 1V1MB 1DI0A 2PSEA 2PZKA 1F2TA 1T5LA 1ZOOA 4C0XA 3AHHA 3R3VA 8LDHA 4Z53A 2B2XA 2WYUA 4Y0AA 2WYWA 2Q3BA 4O1IA 5E3JA 5BSMA 5T4HA 4C7MA 5GINE 3RUPA 4F93B 1IE3A 1I94B 4PTZA 4HAUA 5BNFA 1T0UA 4MYRA 4RAQA 2YY6A 4GOOD 5EXEA 5AXBA 5ESRA 5F1PA 2R7MA 3NIBA 4DRXB 3UJNA 4KQJA 1P73A 1TJ3A 3ODGA 1FDOA 1OPXA 1PVDA 2PMFA 3DBLB 4KXYA 3RWBA 4FJ2A 1AUPA 1MW9X 3SQWA 2J7KA 1OU0A 3ZHRA 4DQXA 4L9SA 4ZHQB 1LF5A 4MWBA 2ZR7A 3OCXA 4KDRA 2YMLA 4MVJI 5J5AA 3LBFA 5K0LA 4ASUD 3W0LB 4CDNA 4G8DA 4IYJA 3HGTA 3SC2A 1EGHA 1NZDA 3S99A 1BDJA 2A5YB 4TVOA 1KI3A 2ESRA 4IGKA 4TXMA 1K7YA 1MJHA 1RAEA 1YJQA 2CK3A 3I04M 3JRWA 4R40A 4DGSA 4Z1MD 3SKXA 2P6OA 3IEUA 3CGGA 3S2GA 1DTEA 5BVHB 2FZVA 5K0GA 1FUEA 2Y1XA 4DA9A 3LF2A 4G9GA 1BWQA 2PT9A 4FM9A 4FNOA 1B15A 4BWVA 5LIRA 5CUQA 3IPXA 2UZ1A 5A5FA 4JLMA 3WG9A 2B25A 4N48A 3H7AA 5CCXA 1XDZA 5EHIA 4BE4A 5CDTA 2BM0A 1EP1B 1JLSA 3P0RA 3PC7A 4R1QA 1VLJA 3KHUA 3Q8XB 3ANYB 3O8DA 4BLWA 2NZVG 3RSGA 5AK3A 5IVHA 3GL9A 4YR9A 2ZRLA 2ON6A 4YY3B 1DKRA 4O4LB 1HEIA 4NJMB 4YX9A 3T5PA 1U28C 2V1XA 4L4YA 3AHIA 3RIGA 1GGVA 5K0EA 3R7AA 3ZH9B 3DW1X 2VBFA 4QU9A 3CLTC 2LZ0A 4FC6A 4WCFC 1UXIA 2YH2A 3B1XA 2PK3A 3P0HA 4GI1A 5DYIA 3FUTA 3WK8A 2Q7XA 3PIRA 3X3HA 5IT5A 5A5EA 3LPCA 2VJMA 1TRKA 4I50A 2R6GA 2WJPA 2FUNB 1KBOA 1PJRA 1D6MA 1C7QA 3RVNA 2I3ZA 2W2QA 4K3UA 4CI9A 1MB4A 4JIGA 1JB9A 4EPWA 3LRTA 1QH1A 1P0QA 1NMYA 1QYVA 1UDCA 3RVRA 2I33A 3DT6A 4Q7EA 4CV1A 5GZ3A 3VKUA 3CCBA 2AFIA 2CN1A 3D3JA 4HD8A 1QR6A 4IWNA 4F0JA 2V7UA 3MWYW 1MO5A 1QG6A 3Q7EA 2BR4A 2IUUA 1J8FA 4Q19A 3D7KA 1THTA 5G0UA 3ZDXB 2L19A 5HF5A 1CDDA 1Z2PX 2VT6A 2JFFA 2ZFUA 1CDOA 3GFRA 5TQ0A 4B6GA 4B3SB 4ACAA 2DECA 3DXYA 2DLNA 3L02A 5IPFA 5L40A 4M0DA 1IRIA 1U7WA 3KJZA 3P5BA 2I4LA 2E2WA 1N5KA 1NIJA 2ABWA 2H7XA 1R3DA 3S5JA 5KUTA 4EGAA 2PX3A 5ALLA 5C1OA 2HYIC 1LF0A 1VG8A 2ZB8A 1VKZA 4BKUA 5TVKA 1BJTA 1TD9A 1ISRA 2GZ2A 4QTTB 1ZSVA 2XB4A 2NTVA 2ZITA 2FUEA 2C42A 1NBMD 2PJUA 2Q4RA 4RVDA 1EFHA 1V4VA 5F1YA 2OFXA 1H2AS 4RH1A 2NO1A 1O8BA 4DV7B 2NO4A 4AWBA 2Y76A 3ZTWA 5IU6A 2IWHA 2PUVA 3CRNA 4IHKA 1NU8A 1EBUA 1P0CA 3IOYA 3OZBA 1EK2A 2VDLB 4XSVA 1NXVA 3U3ZA 1XZDA 4EECA 5JHHB 1ACJA 1P2GA 1J8VA 1QO0A 2FXIA 5HS6A 4CQJA 4U7HA 3I92A 3UJDA 2FSSA 2PJZA 5ICCA 2IH5A 3GV0A 4QGGA 2BUCA 5AJHA 1Q0UA 3U9LA 2AJBA 5CT4A 3CG0A 1LDGA 2X3YA 3FR7A 4LW8A 4PLTA 4GW3A 4UNQA 3HI4A 2Z95A 3NC1C 4G9EA 4BLOA 1HR0B 2OGZA 1K88A 2DJIA 1MZVA 4TT3D 4BB0A 3R40A 1AMOA 5LQMA 3P9IA 1PQYA 4JVNA 3KR1A 1D4FA 3G68A 1BFUA 2A2ZA 1W59A 1VB5A 1PWHA 2E6KA 3IPCA 4FN4A 4OSEA 3W5JA 3KQLA 3L6RA 2JW5A 2Q27A 4GECA 4RL4A 1FB5A 1JHQA 1NVFA 1KS2A 4JLAA 4ID3A 2Q5IA 3DYVA 2VTBA 1M8KA 4LHZA 3CH7A 1O95A 1TD1A 2EX0A 1J2UA 3AR2A 3H5IA 3RRXA 3PQFA 2ES4A 4H1WA 3E81A 3CMMA 2Q49A 2V45A 3JQDA 3TD6A 1S02A 1ID1A 4BVBA 2OE2A 3VYWA 1SD1A 2F1KA 2D0IA 1WJGA 1FU8A 2VDNB 5TGTA 2FY8A 3N7UA 1L5KA 4R7TA 3ZQ4A 3EZ7A 2GZDA 5COAA 2CF5A 3G3EA 3IT2A 1M2WA 1LRJA 2NVWA 1EB8A 4J6EA 3IKMB 1R8YA 4B4OA 3LJKA 5I9IA 2WPDA 2R1VA 4R41A 4M0KA 4B2PA 1GUZA 3D81A 1U3FA 3JARA 4L02A 1LJUA 1SVUA 2IPAB 4NZMA 4J6FA 4OSOA 3DE0X 4RO0A 4TRNA 2XGSA 3DF7A 4KYTA 1Z6QA 4B2YA 3ZNPA 3CEPB 1X8XA 4N3AA 3D7MA 3NTOA 3RG2A 3LC7O 1B74A 3CZRA 4YXWD 1QVAA 2XE4A 4O2BF 4UEQA 3IOCA 4O4HA 2WHQA 3TYXA 4BGEA 1U28A 4YDHB 2XUQA 4XXHA 3K1JA 4IMJB 3H9UA 2A0YA 4KP7A 2HWKA 1A77A 4JJEA 4QUJA 2J8ZA 1S8OA 1K8XB 1Y8QB 2VYCA 1E62A 3Q12A 4NCJA 3C87A 3DAHA 5IAKA 4BUJA 2GO7A 3P9YA 4DRYA 2IQ5A 1E7YA 1B76A 2OZEA 3MPUA 4JR0A 5F5XA 1NFRA 1ZZEA 4E70A 4Z49A 3TFOA 3CE9A 1CT9A 3QVLA 1B3RA 3U17A 2FSHA 5JJBA 5CD1A 2YZKA 5JNVA 1ZHOA 4AKHA 5IT9A 1DSSG 5JH7B 1FQKA 4F5WA 2CV1A 1X7XA 1W0JD 4H1VA 2WIFA 1ST2A 3L7DA 3OY7A 3W6PA 2C96A 3JQAB 3NTLA 1HX7A 3FNGA 4EITA 2GEDA 2PSHA 4HPJB 1G63A 1LVHA 3F9CA 2L82A 2WJYA 1AKQA 4GUAA 4PQYA 3VR4H 2V96A 2Z0MA 4AP9A 4F5ZA 5LDHA 1CY1A 3NPAA 1G2QA 2IUSA 3D8HA 1TPYA 2QNRA 2PRKA 4Q3AA 4RANA 1I3MA 3QNWA 4GMDA 2J9GA 4IJUA 3C1TA 1FRNA 3RF7A 2HB6A 1ODCA 4IZIA 1HEYA 2ATEA 2VZ8A 4EO9A 5CIYA 2PDAA 5HXAA 1JQJC 3GJ8A 2OCIA 1OX4A 1S9DA 1E79A 3LUAA 3ZTYA 4FT2A 1LQUA 3O4VA 5FB3A 4I3FA 3DKRA 1FUIA 2K87A 4H7PA 4DMUB 2Z9CA 1KMHA 3OQHA 1Y9ZA 4CL8A 2QMOA 3Q1LA 4TS4A 1T1SA 2VT2A 4NG5A 4Q4CA 1G5FA 3RM3A 1BCRA 2W2XA 4GYKA 4UM9D 5CX4A 5GONF 3PHCA 4YP1A 3B6IA 4INJA 3V7NA 2NP6A 4MS4B 3GLFE 1BTOA 1NYQA 1J1IA 4K3VA 4IUYA 3ZJYA 1PZEA 2EW8A 2JL1A 3VR3A 5AW2A 1SAYA 4BMDA 4JJAA 5FCDA 1AO0A 4E14A 1AD2A 2ZJ6A 3ZZMA 2X23A 4FD3A 2HNAA 3NHFA 4QHSA 4XYBA 4H7KA 1UBJS 2BFCA 3ZWKA 2VDWA 2WJZB 3KB1A 4H7IA 3KKEA 2HY7A 1DINA 3W6UA 4QASA 4IHJB 4IJKA 4P53A 3TFWA 1GG5A 1Z33A 5DM0A 4MVXA 4NULA 4YMTA 1FFSA 2HF7A 4U9IS 1A04A 3E8XA 3VPFA 3VTAA 1H4QA 2FQXA 1Z2CA 1KU0A 1CVIA 1VIMA 2X41A 3K53A 4PR3A 2JIDA 1YBMA 3L05A 2HIMA 5CDUA 1R66A 3W3AH 1YQWA 2HIAA 1S0UA 2HJWA 4GI3A 3RFXA 1YKSA 3SI7A 2PKWA 2FW9A 5AXCA 3TDMA 4AN1A 2P75A 3TQSA 1B8OA 3KXDA 3ZV3A 3AF4A 1FLAA 1VMIA 2J1LA 2FSGA 1UOPA 3WBBA 4RTLA 3HWX1 2BFEA 2YJ6A 1OX4B 1UPXA 4Q4HB 3LDUA 3ZXXA 2AXEA 3AB7A 4RJKA 1QQAA 1DB3A 3TZQA 2JGDB 1H8HD 3SBEA 3LM8A 2BKAA 1M8GA 5D87A 4RD2A 1W73A 2QZ4A 4IS2A 2GN8A 1ND5A 1XU7A 4I46A 3VSDA 4Q24A 5HFJA 5CYGA 3IE0A 3O4RA 2V6IA 4IOKA 1ONOA 1U11A 1C9EA 2C1XA 1U2TA 4HZIA 4RENA 5LZ4A 3UV6A 3L0IB 1Z39A 1W19A 2P5TB 3L1IA 2VZ9A 1PG2A 2XPCA 4G36A 4UFOA 5C8YB 1FDSA 4JGIA 4LI0A 4KQEA 4QT4A 1QQ6A 5DULA 2H2DA 1PTJC 2MCFA 2EF0A 1TE2A 3FVQA 4FYHA 4KQXA 3QPDA 3OA2A 2GMWA 4WIAA 1CETA 3OFSA 1BMFD 4NCKA 4IFIA 1L1QA 3HRIA 3RSCA 3WLHA 5ICGA 1JHYA 3SWWA 1L5LA 3WNZA 1NOJA 3L8ZA 5BT9A 3MSXA 3H1EA 2C0CA 1OFUA 5E7IA 4YAKA 1H42A 2HIHA 3HZRA 1ADBA 1GFWA 3EGVA 4Y6LA 5HDQA 2QGZA 1HLGA 4K2AA 3KBBA 4RLSA 1U2ZA 3K1YA 3EIHA 3RVPA 3TM5A 2VBCA 4C4YA 4EFMA 3K71B 1FUUA 4EG5A 4F2WA 2JCXA 5CB4B 2JLQA 4G0MA 5EA2A 1Y4ZA 4P58A 3SC6A 1K3TA 5FUQA 2DT5A 2AYZA 3QTTA 2JFWA 4RAOA 4W9NC 1GD1O 1N9GB 4TTQA 4M9ZA 5F4BA 2BLLA 1VIVA 1GCAA 2GCOA 1E5TA 2ET6A 1Q1QA 2QJOA 3KT6A 3NT2A 1J8MF 3PQ4A 4FU0A 5DHAA 5JHGB 5L7WA 4ZOAA 5ALUA 1RXVA 1W5AA 1ZD9A 4GI2A 3HJUA 3JARB 4LCBA 3HKCB 3R5XA 3RV4A 3V2UA 2ZUBA 3AG6A 1TCUA 3U9TA 4XGQA 3TW4A 1AN0A 2JFZA 2Z8ZA 3HP1A 1D2HA 4IILA 2NQ2C 4JCOA 4CKYA 4TV9A 4QQFA 5CFOA 5JAZA 2UXCB 3LA8A 1QHFA 1XYGA 2PGLA 4CQLA 4OI0A 3CJRA 3SZOA 1IQPA 5K0SA 1OYWA 2C5SA 3CTMA 3I01M 1T43A 4AT1A 4BO9A 1M2OB 5DT2A 4G4SP 3W7AA 4KX3A 4MHTA 3PR2B 3Q9UA 4PZUA 4XDGA 4Y2HA 3PIIA 4TKZA 5FOVA 2XYHA 3B7GA 3K2IA 5BYAA 1TM4E 3RVSA 2O06A 2ATVA 5FX2A 3K3PA 3V1KA 4M6WB 4RHCA 4EMTA 4LGCA 5FUMA 2ZSHA 1D2RA 1HSOA 4IDPA 3BGVA 3NYIA 4IFEA 5IYZB 3BSWA 3OE7D 4O2AF 1M1XB 5FWXA 1WW2A 1UIRA 2YWCA 5G4LA 5HFNA 5M29A 3AI1A 3KKPA 2UZ1B 5K0JA 4OBXA 2WHYA 2DPYA 4MMYB 1T1RA 1JEYA 4BX9A 4O0LA 2ZJBA 1EJ0A 1Y9EA 3OF3A 3ED1A 3BMCB 4JZKA 4YGXB 1OLUA 4I66A 4BMPB 3DKPA 4YCNA 3OC0A 2R6R1 3HB4X 3ZEAA 1TTQB 1RHQA 3KR2A 2XNKA 3OQMA 1SCAA 3GJQA 3P96A 4WNCA 2OCPA 2C31A 2CNOA 4POOA 1EFKA 4QIHA 2VOEA 3UUFA 2ID4A 3HL4A 3UCEA 4EZBA 3KTFA 3ZE7A 1N6IA 1RLIA 1OBHA 2NUPB 3E3LA 3IQEA 4RYLA 5L4SA 3M6LA 1IHUA 2JB9A 2VAVA 1WXXA 1UWVA 3RC8A 4BC1A 1QC5B 2FUKA 3DLHA 1RABA 2J4DA 4PYLA 3GIWA 3X1ZA 2BM8A 4GOND 3CVJA 4B40A 4DGQA 5FEUA 4MLDA 2H1OA 1XMOB 4JLVA 4B7AA 3JQ7A 2IYOA 2HDOA 2JRCA 1KR2A 2ODNA 4PZZA 4GOXA 1WX1A 1HWYA 4PQGA 5CLHA 1CY2A 1PF7E 5F3RA 3T1HB 1CJMA 4NBSA 1KSHA 1AQYA 1PL8A 2J0UB 4B33A 4FFPA 1Y1RA 1WULS 3FZQA 3GEHA 1U31A 3AYZB 1HL7A 4YP0A 5BMOA 3AHDA 3TWOA 4WNAA 3PA8A 1E3IA 4CKZA 3GFQA 3ZVKA 5GOTA 3TIGA 4G41A 5ADUS 3MJVA 4FDAA 1QFJA 1F4VA 1TM2A 3CLKA 4HPWA 5JO0A 2Z56A 3WV4A 3S29A 3QPAA 1M1NA 1F06A 5E1MA 2BTEA 4FGZA 2QTFA 5DP1A 2E4WA 2AFHE 4IVQA 4N5DA 5EMNA 3IV7A 3OIUA 1RHKA 3VZRA 3WGMA 1FMCA 3CEMA 5BVHA 1KERA 1FC0A 1LC3A 2Q4EA 2AFIB 2M98A 2XOXA 1V45E 4L75A 5KYNA 1ZH6A 4WXHA 4PLPA 3G85A 3U49A 4INOA 4YAGA 2VZ0A 3U39A 4AICA 2DHCA 3IDSA 1E1CA 3QEAZ 4X71A 3P9QA 4ZQEA 3RT9A 3UMGA 1Y4UA 1KNXA 3OT1A 2B69A 3CRQA 3TO5A 3VR0A 1QZUA 4K9OA 2WR8A 1FFGA 2VJMB 3D9QX 3OIWA 2X0KA 3KOYA 3SSMA 3AEKB 1N5JA 2XJ4A 2KHZA 5REQA 3K4HA 2O54A 4ER3A 4GBED 1ISSA 1IK4A 4TTTS 1UBKS 4GSLA 5JPCA 3BFJA 1O5IA 1IU9A 4L4SA 4A1FA 1N92A 1Y8CA 1R18A 5FNVA 1C0LA 1DQSA 1VJ0A 1VM6A 3OE4A 4FOLA 3MTJA 4Q7MB 2L18A 5CB6A 1O96A 1V3VA 3KXPA 3MFQA 3SVTA 1VZ3A 4QTXA 2IOFA 1NUHA 1NKSA 4J4HA 2GQ0A 4EHLA 2BSQA 1PEAA 3HDJA 1XMQB 2CL7X 1I2AA 2MT9A 4KWCA 3PXXA 3GAZA 3LFUA 1NYLA 3ZGXA 1AZTA 2ICAA 4KDCA 1SIOA 1G21A 3LYUA 1W85B 4HO1X 2B4QA 3H0EA 4HAZA 2IV7A 3VNSA 3WIUA 1YIOA 3ETLA 4WLEA 4QNNA 3FSEA 4WCVA 4LNHA 2G08A 1W0JA 1XBTA 1A8UA 1SNYA 3Q85A 1ZGCA 3QG1A 1U4SA 4XARA 5FP0A 5A6SA 1V7CA 3RHZA 5CK5A 5B7NA 2R7AA 1O2DA 4BNXA 3VUFA 1FJHA 3BORA 5U9CA 2IW1A 4Q1EA 2FEMA 3U3MA 3VH3A 5JMOA 2XQFA 1M2JA 2R47A 1NVGA 1TFUA 5SY6A 1EE1A 5HZGA 4KSYA 4UMEA 2QN9A 2YINC 5HJ2A 4DE5A 2AMLA 1LLDA 3FBWA 2FQQA 1SQ0A 2WUVA 1RR6A 2XQKA 2ZJ4A 3GCGA 3PFHA 4PZYA 4YLGA 5DHQA 3ZBTA 1E8DA 3C7CB 3X44A 1MFPA 1N9ZA 2JI9A 2ZRGA 2WBLC 2B4KA 4Q66C 4MVYA 3ZJ4A 4DDHA 3OPYB 1VBNA 1N5OX 2ZRHA 4YQYA 4NKRA 2BGMA 3CM0A 4C4SA 4G0QA 1G8FA 3TQRA 5K0CA 4BMZA 3TVYA 4A6XA 1NW4A 5HOQA 3ZVMA 1R15A 3M9WA 2H7VA 4AYXA 4Y1FA 2HRDA 1L5HB 5HQJA 3U3JA 3DCIA 4M8LA 1SVSA 5IKEA 3PNOA 5ETJA 1KZ7B 4JQSA 4WZZA 1V1MA 1I0LA 1E4EB 5JSYA 1RLUA 3TMYA 4NWIA 4NFLA 3BAFA 3H2KA 1KC3A 2E6UX 3BMCA 3QU2A 2IP1A 2D62A 2C57A 1E2PA 5I7OA 1PV4A 2FZ4A 2I0FA 1S3GA 2ZJ7A 4D74A 2HDWA 4DCOA 1EH5A 3GT7A 4Q01A 3C6YA 2X0RA 2YX1A 4GLBA 1N2BA 1T4DA 4HNAA 4HYTA 3O90A 3S8EA 4N1AA 1V16B 3QIAA 4XD2A 3SMVA 3CTPA 1NG9A 1WCIB 2Q41A 3WADA 4J16C 1A71A 3K31A 2EV9A 4GDFA 1E7WA 1HDRA 1OFHA 4Y6OA 2P62A 4NJEB 2UUOA 3O7WA 3RS4A 3W05A 4M1ZA 3OZWA 3TLGA 1KO4A 1TZKA 3AUXA 3C3DA 1XRNA 4TV8B 3KC2A 2ODAA 2EJWA 3F6PA 4XA8A 3VH4A 4C22A 3PT9A 3L43A 2DXIA 3OIYA 2NUAB 2FX2A 1K8QA 1PQWA 3IJEB 3QE2A 4ILEA 1K86A 4NBNA 2XWPA 5JZMA 2Z4RA 2YQ5A 5CX1B 3VUEA 9MHTA 3FLMA 3VI3B 1JLRA 1LEHA 1C3LA 3B3AA 4O63O 1LUAA 5H59A 5HILA 4GE0A 5JIBA 1R50A 2F9LA 4IXNA 1L8LA 3K94A 3U31A 3ECSA 5ADWA 3LMKA 4PG4A 2W6PA 4OEHA 4OAOA 4RA9B 1V3TA 2R4QA 3D4LA 4B9EA 1Z4OA 2WV9A 2ZYAA 3D0RA 4N3NA 3BX1A 1DJLA 3H6KA 2UKDA 3LQYA 3S2ZA 4K05A 3ZTTA 1NP7A 1BWRA 3C5WP 1MRNA 1SKUA 1WS6A 2VPQA 1BFKA 2FAXA 5AK4A 1UDAA 5I7AA 1EE2A 1YVPA 4KHZA 2PIAA 3CPEA 4EG3A 4NH4A 3BGSA 4IXMA 3ECCA 2PT6A 4MR7B 1XHEA 4JLBA 3CLSD 4OFXA 5K4AA 1WPRA 2WFLA 1FP6A 4NV0A 1G5IA 4CM7A 5E4FA 3LWNA 1ZK3A 3WK4A 1T9AA 2ZJAA 1O9GA 1QE0A 1W48A 3TDNA 3O31A 1GNSA 4R8RA 5ELLA 3SQLA 3UB3A 3GLHE 4QAQA 1WTAA 2F1JA 4RKFA 3ZWYA 1CJCA 1OQAA 3I52A 3TPZA 1IRXA 3WK6A 4L85A 3EMKA 3IUMA 3O7MA 4RQTA 1BXZA 4EI2A 5BUSA 3CX3A 4A82A 4PNHA 4RE5A 5FD8A 2DWPA 2V6FA 1NTRA 3L1JA 3QQPA 1DUVG 2ZRKA 1TGVA 5F77A 4UAJA 5LQKA 1W75A 4YUVA 1TM5E 4J7CA 4C1BA 3CINA 2HMAA 6LDHA 4B3MB 2AXPA 2HH9A 2I34A 3KUXA 1VL0A 4Q4LA 3H87A 1XX6A 4MW6A 4TZTA 4DS3A 1XHLA 3THWB 2QLTA 1W30A 2DSNA 2ZUSA 3LDGA 5ICEA 3HN6A 4EDFA 4D4MA 1E6LA 1BRMA 2CD7A 3F5FA 3DDOA 3LF1A 3LRXA 4IRXA 3AR7A 4R9NA 4MGHA 1AM4D 5E8RA 2HTEA 4Q4HA 4PSVA 1FMFA 2WZDA 2EC5A 2GF0A 1OPRA 3UEOA 3TZCA 3B51X 3LGSA 5FPKA 3GVHA 4RGQA 2AW3A 3VMMA 5C2JB 4LFBB 3KYCB 3PNMA 2KPOA 4E5VA 3FKSD 5YASA 1WP9A 2G9ZA 5T5QA 2HCJB 2C5BA 5TS2A 4D4IA 2EGGA 3X2EA 3VC1A 4AJ2A 4UDNA 2ZANA 4MI9A 3RT1A 1BGVA 1MD9A 3A4VA 1PJAA 4HB4A 4K9MA 1P0PA 4B31A 2P79A 2B2CA 1K1EA 2PS3A 2PZBA 2ZIZA 4JEHA 1JWBB 4X20B 4QOJA 4BZZA 5JAHA 1ADYA 2GETA 1W34A 3P9RA 2XECA 2QDKA 3K6JA 4ZC1A 3OHPA 1HTBA 4GBGA 5E9AA 3WIEA 1SUSA 1PBNA 3LPDA 4YUYA 1Q0TA 3DHEA 3IPLA 4LMAA 1I1NA 3DFZA 3LE8A 1DU4A 1RIIA 4FONA 4IDEA 4W5NA 3GLFB 4JMPA 5K8IA 4WFKA 1JW9B 1JLKA 3IAAA 3QNUA 2YOHA 3VVCA 1KDPA 2QG6A 4I9GA 1A76A 5GONB 1PJCA 2QSZA 1VL2A 2AW5A 4PEVA 5HCNA 5C32A 3UMSA 5C18A 4US1R 4Z0PA 2ZR0A 2EP7A 3K9LA 1JXMA 5EPOA 3M6VA 1FJXA 2Y99A 1FIUA 3KP1A 3FTNA 3EC7A 4CFSA 1UBSB 1KMHB 1Y7IA 4XH9B 2Y68A 1D2MA 1J25A 2A33A 3BE4A 4MV6A 5EP2A 3UJHA 5BWLA 2YZ2A 1PL7A 2EZ4A 2N47A 3K92A 5G02A 2V6JA 3SZGA 5G2OA 5BR1A 5IJ9B 2YJ5A 2OMKA 5IF9A 3OWHA 5DNYB 2EKLA 5F2KA 5BN1A 4D7AA 3RNOA 4GZLA 3V4SA 3V6MA 3O8OA 4UBNA 5AVWA 2O1EA 3IHKA 4GICA 4IJ6A 2CLFB 1IC6A 2L2QA 4KIGA 1KQ3A 4KVAA 5EP1A 4E09A 3E1KA 5LP6A 1G6OA 2YXDA 3OTGA 1HNNA 3HDGA 3U7QA 4Z4IA 3W4KA 4UU8A 1FEZA 1T4BA 3WP1B 3JALB 4ENVA 1YWGO 3LW7A 1H22A 1JSZA 4PPGA 3KWJA 3PXEA 1QTNA 2C9ZA 1M2VB 2OR3A 4EX7A 3E05A 3GLHA 4GD3Q 4EPVA 4JUAA 2Q9BA 5DW3A 4IBOA 4U7WA 1E1DA 2CHEA 4RTOA 3R3ZA 4RVUA 4JEMA 3RREA 2AIRA 3L8DA 1DGQA 4JLDA 3PPYA 1ZJ4A 5FPSA 1CE8A 1TJPB 1SVMA 2EFHB 3N2KA 4ER5A 4X66B 5EIAA 2FGKA 3IMEA 4R05A 1KH1A 2XUOA 4E3WA 6REQB 4JP3A 1ISGA 1NUUA 3QMPA 4HUQB 4KXQA 2W2PA 5IRCD 2VH1A 4KN6A 1GFIA 2JZNA 2VUUA 4C4OA 4L28A 3HRHA 4BATA 1XTTA 1DEOA 5JSFA 1FLDA 3OESA 3WNBA 3QXJA 2YV4A 4BFYA 2R87A 3H5AA 2XMDA 4YT4A 4X91A 4WQMA 3G0HA 3KHSA 4NBRA 3H0KA 2XF2A 3IRVA 1ECPA 1M1ZA 4RORA 1C5KA 2RB5A 2DPGA 5ALXA 3ERCA 1AA6A 4J0QA 2PV0A 4KR6A 2IZ7A 4AQDA 5A3VA 3DZGA 1D6SA 1ZUHA 1PGNA 3AO0B 3WMRA 5ALNA 2OORA 3NM4A 3HFJA 5HKAA 1SRRA 3SKVA 5DTQA 1G41A 1THMA 1A5BB 1EXNA 4J0GA 2HYDA 5K0FA 4MI3A 3WKEA 1IM8A 1C7ZA 1OFTA 3O0DA 3HV2A 3LS2A 3NJ8A 1BOOA 1VJTA 2FDRA 2RJOA 2LGJA 1I3CA 1EB9A 3A1WA 3AV0B 3FI0A 3R9IA 4BYMA 1U7PA 2XGJA 3EWIA 2DUWA 3BB1A 3W9UA 1T25A 3CURA 2IHUA 4JDPA 5IASA 5D84A 3OTOB 3R3SA 2M1XA 1RPTA 3H6GA 3MS4A 2VKQA 4RF4A 2FMFA 3FH0A 3Q88A 1V8OA 4DREA 3WYFA 3BIFA 1H8ED 3DNFA 3O93A 1YBVA 3CNBA 4G9BA 1LDNA 2E85A 2Q29A 2V0CA 3NHWA 5AESA 1YB4A 4PTYA 3MCZA 1Y7TA 4LZLA 3AM4A 1PZNA 1FMJA 2DMRA 2WHRA 3L4BC 5AKGA 5C5EA 2X7HA 1XUOA 4HYQA 4CETA 3KQNA 2V5UA 2WSSA 3O95A 1SCQA 5HA5A 1G19A 4BMVA 3WJAA 3GYGA 3I2JA 3E61A 5CDFE 1WMFA 2CLIB 1RFGE 1KH3A 1FX1A 4YAJA 2BM9A 2PEZA 5LYJA 1LBQA 1G5QA 1DIRA 3E9NA 2QL5A 2D6FA 2ILVA 2JARA 2A94A 3QKWA 1YOBA 2RI1A 3IAEA 1CUDA 1U5CA 1M10A 3BBPA 4MHOA 1L8XA 4EJ0A 2IOHA 5AHXA 5DM70 4RQAA 3M6IA 2PCJA 4Q1VA 3PJRA 4MARA 5HX7A 1H69A 3M4JA 3S2IA 1KJNA 4ANFA 1J7JA 1CY6A 4A0RA 1P5FA 3ZZNA 3BGIA 4B3JA 3BILA 2J59A 2ZWAA 5EKXA 5TPWB 5EL0A 4OM8A 5IKMA 4GR9A 1H5UA 1K63A 3ZGVA 5DV9A 3VKVA 1JS1X 2KM1A 5DMHA 3ZG6A 3AU9A 1YGPA 2Q4OA 3TQHA 5G4KA 3G7UA 5ALGA 5C4IA 3WNDA 2MYUA 4EGFA 3SHOA 1P4RA 3AHGA 2PH3A 4M0LA 4N5HX 4PCVA 2WOOA 3SQNA 3N2ZB 4AMYA 2ADOA 4Y2RA 1AK1A 3ESRA 1JG1A 1Q17A 4FFRA 2P90A 3D4NA 3MIIA 2VPWA 1RDFA 1EGAA 5TVGA 4OHUA 2G8NA 2OORC 4RE6A 2Q0QA 3L4EA 4MV8A 3WIOA 4ZYXA 1MVOA 3T3NA 2Q2QA 3NEYA 4FBLA 2O0HA 1PJZA 1CR6A 4NFSA 2FEAA 2GGSA 2ZRBA 4A1OA 4KXNA 3AEUB 4POAA 2I1WA 2UAGA 1CS0B 3GFPA 5CLLA 3MERA 5DXFA 2YJNA 3LVFO 2AOVA 2G83A 1THZA 2GZAA 2N1BA 2ZWMA 1VL1A 2C4TA 4OL0A 1MABA 1FZQA 3BMNA 4MRMB 1NQOA 2PGNA 1XF9A 1TZ2A 1IK6A 2B0CA 2H5LA 4ZEWA 3D3WB 4E30A 2RSLA 3EFOB 4BBZA 1F5SA 4CN8A 1CY0A 4TL8A 3FI9A 1XQ9A 1WSAA 4RLFA 4LS3A 4PFJA 3AL0C 2ZIFA 4IV8A 4KPFC 3RUEA 4XPIB 4G2NA 4Y1RB 4BTVA 3I6ZA 3IL2A 2LVBA 3ZCVA 4D6XA 3AVQA 3RIEA 1ZW1A 4KOAA 1Z7YA 1QGYA 1UBLS 4DEVA 4CJXA 2G8LA 2YWDA 4P9NA 1PHPA 4JC4A 1K6JA 4JI4B 4AF6A 1WXHA 4UHBA 1PSDA 2VC2B 3ICCA 2XRZA 1IBSA 4L9RA 1K6MA 1YI0A 3MB5A 4MIYA 4O2BB 1RZRD 2JGAA 3UA3A 3UOGA 4H4DA 3E7PA 1V47A 3EXFA 2XT9A 4KQFA 4EABA 4JQOA 3QW4B 2V55B 1NL3A 3DBOB 3GLGE 1JHAA 1FNBA 2QXUA 2Q5QA 3U4QA 2JIMA 3CCCA 4HZGA 3F7TA 4I4TB 1TT5B 4C0WA 2PMWB 5ED4A 1RCFA 1XD2B 2FWBA 3EF1A 1PJSA 2CUKA 4UJ5A 2K7FA 4WKOA 1E5VA 3NQ41 1ZJ6A 4HYYA 1EVZA 1KEPA 4K9DA 4W9RA 4EATA 1Z5VA 2W22A 2HLPA 2CWWA 1T0IA 5L7YA 1QO7A 4OYHA 4ZO6A 5AI8A 4OHPA 4AJKA 1XL0A 2RD2A 4GKBA 1FK8A 3SDSA 2YR0A 3BE6A 2DFKB 4CCAA 3O1IC 4MJXA 1XZPA 2WKWA 5T4BA 4DJEC 5BT8A 1QIHA 4FEEA 2QVZX 3VR4A 5CVDA 4U7DA 4P82A 1PUJA 4BWGA 4F60A 3B38A 2BMVA 4MCAA 5P21A 4X1IA 1D1SA 3VO8A 2YV3A 1HT3A 1USIA 2DYKA 4CN9A 2X8AA 2JH8A 4C2BA 4HQFA 3L93A 4ITRC 2ATIA 2CMKA 1P6QA 2Y9PB 2H59A 2NU7A 4X6LA 3TQCA 5J23A 1JN0A 2FZGA 5J2UA 5IG2A 4ERXA 2KLBA 2WIBA 3NBXX 4R1MA 4Q3EA 4DSNA 5EMMA 1KSJA 5EJ4A 2FPIB 5HG0A 4Y2GA 1JJBA 4DQLA 4XWOA 4R3UC 3C3KA 2RHRA 4JVOA 1UC9A 2C2XA 1K3UB 1PDVA 5IM5A 4BY9E 1XCBA 4MIOA 4Q1FA 3U3XA 3DUFB 4AJ4A 2OZKA 3O03A 4LQDA 3ZCSA 4EJFA 3I61A 4HH0A 1CUUA 3E03A 3SQMA 3CKMA 3MA0A 1MXHA 4JVLA 3AVXA 2OHOA 1NN3A 4GP7A 1KYTA 1BVHA 1I5RA 4DQVA 1XMSA 1TC1A 1W4ZA 3EUFA 4M55A 4NOJA 1EVYA 1N4DA 1VSVA 3GRCA 3R6DA 5I9NA 2GPYA 821PA 3N70A 2AI1A 2PPVA 4OB8A 2OV6A 4C7VA 1DKMA 3TGPA 3MF4A 3UKDA 3VO9A 4V0LA 2B34A 4HXYA 3RASA 1F8GA 3WLLA 1L7NA 2IODA 4ER0A 1ILWA 2J5XA 3M6UA 4EY7A 4X7BA 1RWNA 3I01A 1Y6QA 5BSHA 2XIQA 5K8TA 1MPXA 5J2TA 1KOFA 1QDUA 4G81A 5ECWA 3WISA 2DHEA 2UZ0A 2MDTA 3RIMA 2XNCA 1XYYA 2GBCA 4ENRA 2RJ3A 2FA9A 1AQIA 4LXHA 5BYJA 3PSAA 3GR6A 3HB7A 3RQSA 4G1EB 1YNOA 4NCIA 3T8YA 3VKGA 2UYQA 3AFGA 3FFBA 3VR5H 4D3ZA 5K3FB 3ESQA 4A91A 3FYDA 4JOCA 1RQ7A 4ZGBA 3WOHA 3OOJA 4GPBA 2UZ3A 4TVBA 4ZC8A 2VQEB 3NTUA 4IL5A 2IIBA 2D4HA 3GP5A 5DLDA 5IH7A 3F73A 1W36D 2Y8EA 4UZEA 5HEKA 1RXEA 4ZN6A 1P7VA 2I78A 3RUDA 1XWFA 1HFWA 1UMDA 2I6SA 2NSLA 3ETCA 1GZ6A 3FDZB 3NV7A 3CR7A 3KVNA 1AZLA 4PAQA 4DRZA 1ZI6A 3AF3A 3U1BA 2XMQA 1P9LA 4LY9A 1MEEA 2OB1A 3MMPA 4B7CA 2G04A 3V4RA 3PNBA 4MQEB 3RTBA 4H6WA 3EF3A 1BGWA 4GXRA 1JIIA 1IY1A 4CM1A 4RCYA 5DGCA 4DA8A 3ICPA 3KTAB 3WWPA 3FTFA 3AR3A 2OGWA 1GZDA 1PNRA 4IIGA 2NU6A 2CNDA 5AW4A 2W2OA 3OEHA 1GCOA 3UICA 3KVRA 4HR7A 4Y2QA 2D7CA 3HU5A 1ZNXA 5FTMA 2HUNA 1R6VA 3R7SA 4QDOA 3TFQA 5KC9A 1KS9A 2Q1WA 4BTLA 5JLJA 3D6AA 4PLGA 3CY6A 3GLKA 2QPTA 3UJBA 5KYYA 3UGJA 4ND8B 2HGSA 1NUTA 4DVJA 3M49A 4MHSA 2PU5A 1JJAA 3IAHA 5K7SA 4D0RA 4RZXA 4JEIA 1GPAA 3S70A 2Z2KA 1Q16A 1GKUB 4V02A 4B3GA 3R0QA 4YWJA 1VQ1A 4I6GA 1NNUA 4QYIA 4CL2A 4MR8A 5DMXA 4CM3A 3QSGA 4YIHA 2PR2A 1DX9A 1QOPB 2JEYA 1EM8B 1MOZA 2OL4A 3B53X 3FPJA 3AIKA 1IY2A 3MJEA 4M0MA 2AYYA 4NFYA 3UAVA 3WRXA 3HY4A 1DL5A 2BZ0A 1P2VA 4XR9A 1Z3IX 5FLYA 3CW9A 1AK2A 1TU3A 4BLPA 4C2AA 2UXBB 1UOOA 4LE2A 1E99A 2QM0A 4MVJE 1D1PA 2CJYA 3I12A 2B21A 3JQGA 4MDFA 4UUBA 2X1LA 1LCIA 2QW8A 1UPAA 4LF7B 3I9KA 1VFNA 3WXMA 2QBYA 3WMGA 3WLIA 5EY5B 4PLCA 5HUHA 3HN7A 5LFAA 4FFLA 1D0VA 2PGDA 3IQZA 5U4QA 3ZV7A 5KNDH 2JVIA 2GNOA 1KH2A 4EHIA 5HTKA 5ARDA 1JPVA 1KYXA 1W96A 1DKNA 1VZ2A 2HCBA 2W2KA 3CWZA 1XZCA 2BRUA 1NSYA 2BEVB 3Q7SA 3EUAA 4MA5A 4BPRA 1YR9A 3UJAA 3WGGA 1ZH8A 3BJEA 3I0ZA 4D9BA 2XA1A 1HMYA 4W82A 5FBZA 3GZTB 4UBIA 2UYGA 5IYZF 3E5RA 4CRWB 1U6JA 2JJ1D 2WG2A 3A14A 3OCZA 3ICQB 4LYYA 3WC4A 4A8JC 1FSGA 2TSYB 5K3SA 4C20A 3Q4GA 4CEJB 2FVYA 1DFIA 1RLOA 1OIVA 2GBPA 5DJ5A 1I7LA 1VKHA 2IE0A 2QX7A 4OKIA 4RCVA 3AX6A 2ORIA 1UMBB 1HTTA 2W2KB 4LDRA 2WDZA 3FMFA 5F2OA 1Q7BA 1JKJA 2HBZA 1UP7A 4HDMB 2WY2D 1M6NA 3AR9A 4J0CA 2G82A 4UHFA 3W5VA 1NRWA 4JUBA 4EYKA 4CR7A 2XAUA 4EY6A 1F7UA 2G72A 2QGNA 5EKTA 1M2NA 1ZIYA 2JH3A 3DMYA 3FDXA 3A32A 4LG1A 3CJQA 4F72A 3ZXYA 2FCRA 1OKKD 1EZ4A 3I9FA 2XMPA 3OIGA 3RVMA 1C9NA 3IMKA 2V4ZA 4EVIA 4BL5A 2ZWIA 3Q3JB 2AN5A 4WKBA 2J5RA 3HKBB 2H4WA 1FL9A 3GRPA 4MUKA 3MBOA 1OI2A 2CLCX 5F3DA 3I73A 3U4CA 3S1AA 1RPZA 1Q1GA 5AVKA 5GAJA 2VPXA 4C89A 3R0VA 2RHOA 5F1KA 1H3FA 2BKLA 4S1NA 4ZI3A 5KSYA 3PUIA 3K8YA 3A1NA 1G9SA 2QXTA 4IFTA 4L5BA 4HDSB 4ZU3A 1FVOA 3H2IA 5DWDA 5GMOA 1SO8A 1YRLA 3QG5A 1PW7A 3JQAD 2QUBA 5FHRA 2HJVA 4DLTA 1U0SY 4RZSA 4YMHA 4GPIB 3G23A 3FSGA 3K4PA 1FDIA 5AVJA 3AM3A 3TXYA 3DMDA 1U6IA 5I5GA 4CMGA 3LL4A 3HYLA 2VQFB 1X80B 2ONKA 4CXMA 1T1IA 1MBZA 2WWHA 4BNTA 1RJEA 3ETHA 1Z9BA 4TQ9A 4YI3A 5G0SA 1T1GA 2FKNA 3DMPA 1H1DA 3DDNA 3TZLA 1BS2A 1Z2AA 2QMZA 5K8UA 3TX6A 3ICEA 3KQYA 1QF6A 4BJ1A 3T3PB 4E2XA 4KO2S 4RFSA 2R1TB 1R5OA 5ALPA 2ADFA 3R41A 4WTOA 3MRTA 4IIFA 2CFRA 1ZLYA 1CFZA 3QVXA 4NENA 4WAUA 5DIZA 3TNLA 5FBLB 5AOBA 2IRWA 1DC4A 4LF5B 5FWYA 1RXIA 2QRGA 2DFPA 2VYQA 4NP6A 3WYCA 1JDJA 4NCXA 5JYCA 4MQEA 3I6YA 2BMWA 1U1GA 2BEVA 4HDRB 3RC1A 1E2QA 1Y8ZA 3EYWA 3QP9A 2ZYRA 4XZ3A 2ECKA 4B75A 2GZMA 1K7EB 4DCVA 3FWYA 4M83A 1FU7A 1UWLA 1B1CA 1IPFA 1NW3A 3SVLA 4FFDA 4M0EA 5KYGA 1TADA 1NW5A 1QP8A 1W5SA 5IBPA 1FFXA 5D7BA 2FW8A 1NVBA 1R4NB 1ZOPA 4RHXA 3QF4A 5DHTA 3KETA 4QSMA 4H1UA 4WDRA 4B6OA 1QWOA 2DKFA 1KPHA 1IN4A 1DV1A 3FJ1A 1TUEA 2Q3HA 3PZRA 3T3EA 1MO6A 4F6CA 3VM6A 3D8SA 2Q6VA 3ILXA 5CIQA 3WGZA 1GVNB 2PGIA 2JLCA 2X5KO 3M5PA 4O1MA 4QBFA 4WOBA 3RB8A 1HT2E 1R0YA 1O6GA 1KTIA 3QSYA 3N74A 5BMVA 4JCCA 1GNTA 1L8OA 1V8DA 2ZB2A 3N05A 3H83A 1ZD5A 3HDVA 3QVKA 1EFRA 2GF9A 3THOA 1KAQA 3EJWA 4QXOA 3ACCA 1NAHA 3AP3A 1V9LA 2QU8A 4HWPA 5M7EA 3CX4A 1YZ3A 1FF9A 2XDYA 2YWXA 3R8XA 2UVPA 3IMGA 4JI3B 2D00A 3EC2A 3IJ5A 1AHIA 3TTYA 4RV9A 2QSYA 5JVDA 2VJPA 3F49S 1XCOA 1Z88A 3D43A 3IO5A 4ZANA 4ND8A 2PHZA 4ENSA 1O6ZA 3GZNA 4HH4A 4AC9A 3IHTA 1XTIA 1UIMA 4BEVA 4KH1A 2ZS8A 4RW0A 1C1HA 4ENTA 5C5CA 4RLHA 4EQ6B 3BXOA 4N6GA 1U2EA 2B8EA 1GTL1 2F43B 1AF7A 2UVQA 3I9LA 3OA0A 1L9XA 1Z17A 4BUCA 3C3JA 2ZWVA 3FBGA 3Q3VA 4M8KA 4TWAA 1BMDA 4JJ7A 1T34A 3TW8B 4TRRA 2JATA 2NG1A 4DR3B 5BN5A 2VA8A 1XTUA 4CU2A 2JC3A 3RT7A 4G0WA 1W0KA 1LZLA 3GARA 4I8XA 3FGOA 3CB4A 3PXGA 1XV5A 3LT5A 5TPZA 2BZSA 2E1RA 3V97A 5BRNA 1STOA 3WY9A 1OH8A 1SD5A 1VOTA 4WZBA 4XX1A 4MP8A 3LY7A 3K1TA 4YJ2A 4UQLA 1G7RA 1W4RA 4IOLA 3CLUC 1T5SA 2VQDA 1AGYA 1PQUA 4QVIA 3RRZA 3AHJA 4AIRA 5HVNA 1UJ4A 3HZOA 2PBZA 4IW3B 1C7FA 3Q10A 1S8NA 3OX4A 4Z4EA 1LS1A 3C6ZA 2PVSA 3L7YA 2GKGA 2W2VA 4G63A 1L9KA 3LPMA 4DANA 2BM1A 2CLDX 2C54A 2ZDHA 3F6EX 4N82A 4E3ZA 3AF1A 1VDMA 2JHPA 3QVJA 1T3GA 1GZUA 1VHLA 4MUMA 4BO7A 3THYB 3TKAA 5BSWA 4L50A 2BN4A 3GBPA 1KSFX 4YQEA 5DGXA 3KJGA 1AF4A 4K8OA 1WHTA 5KNBD 4MUNA 3L04A 5C34B 3GLIB 2Z2YA 1GU0A 1FTWA 2PKQP 3H1AA 3ZEIA 1U02A 4DUGA 3QZUA 4Y0VA 1M75A 5F9HA 3H8VA 3FA2A 4XB6B 4YRJA 2M6RA 4WZAA 5ERYA 2DR0A 4EY5A 5FR1A 5IKXA 3R0JA 2CUNA 3OCVA 4UQPA 3AF0A 4I0WB 3AFHA 2VP3A 1LK5A 2E5FA 3P71T 4KXXA 2QL7A 1XALA 1R0WA 3GFOA 3NO4A 1VCNA 1LPPA 3STUA 5IUNC 2HWXA 1N2GA 4M8NE 5FFMA 4E5DA 2WFZA 2G0AA 3ON5A 3ZQ6A 4AWAA 2P9BA 4Y30A 3M83A 4UVGA 4FQ8A 3ZX4A 3OZXA 3K5PA 5JRDS 3C7TA 3GRUA 2PRIA 1S5PA 5I4CA 3H8SA 1F8FA 1P4GA 3HDHA 1BEZA 2QN8A 1YZNA 5A2QA 1KY2A 2BI7A 3V9AA 3V8BA 1ZK1A 3JTMA 4X1IB 3H5VA 2BP7B 1RYEA 2BT4A 3II6X 1KR5A 2QRQA 3KWFA 4MYHA 5C51B 4QQKA 4OH7A 1ZU4A 1W44A 2LPMA 4JNCA 1RRFA 2WMOB 3PR3A 3CRRA 3R3HA 3NOXA 4ZYYA 4GAEA 3EY4A 1M2HA 3S2YA 5IVDA 2RC6A 4LNAA 3VTZA 3O8QA 2P9FA 1LWNA 2Q5LA 3AJ9A 5BQOA 4D57A 3MXOA 3DMRA 3KNZA 5BSFA 1Y5MA 1JG7A 2NTJA 3FM9A 4PPNA 3ZDZB 2QJRA 4P08A 1D4ZA 2X9GA 1Q91A 3D1VA 1XZAA 1QRSA 5BVGA 3AB8A 1G0NA 1XCPA 2WVAA 4I4TF 3SNKA 2IZZA 4K6MA 3S0JA 1PR5A 4DV0B 4RNDB 3CNLA 3PDJA 4YS6A 3O1JC 1NA5A 2G5TA 3IR5A 4S0ZA 3VH2A 4HN2A 4TKMA 1O8CA 2JFPA 2C5GA 1OWMA 4DZTA 5HKBA 5GV8A 3AJDA 3SC4A 5JJCA 1WU8A 3IILA 4B71A 2F8SA 1U99A 4GI7A 1TYAE 1Z3CA 1VHJA 3K0SA 1K92A 2OYCA 3R5HA 3H0CA 1XZBA 3C3EA 4WN9A 2XT6A 2GEUA 1A8PA 5AD1A 2O57A 2V97A 3QKSB 4M9SA 4YV2A 3OD5A 5K8CA 3Q2OA 5I7FA 3EGOA 1XZ8A 2LWIA 4BAUA 1KWKA 5FKJA 2XWBF 1O6FA 3VTFA 3K35A 2VHZA 4RADA 1ZZGA 1JMVA 5HKKA 1NI5A 2RAFA 1P4JA 4QXMA 2ZBVA 1GKYA 3URMA 1PR9A 1T5OA 4RQUA 3MWLA 5TT1A 4EY4A 3D3WA 3P27A 1IPHA 2UZ4A 4M1MA 4RV5A 2HHCA 2JIZA 1I2DA 3DO6A 1UC5B 4DMRA 1HSZA 4PLYA 1A9XA 1K97A 4AY4A 4TWRA 4BKQA 4QOFA 1M0WA 2ZM5A 1Q20A 2FE4A 1S2IA 2QYSA 3PVSA 4M7RA 4MIKA 5ESXA 3T5MA 2WKRA 3TX2A 1I6KA 1MKYA 3JQ8B 3K09A 3V1LA 4FDTA 5ADHA 1N32B 4LQ4A 1YACA 3CF0A 5C9ZA 2WUEA 1R00A 4YT5A 4QICA 2QR2A 2CSXA 3EAFA 4YRDA 3GVPA 2F4VB 5DX1A 3DKIA 4DQKA 1M1UA 1DTSA 1FFCA 3TXAA 1H9CA 2XNDA 1R7RA 3FZNA 1VYTA 2R86A 3QYPA 4MYDA 3FJOA 4K86A 5DIFA 5HMMA 1V5WA 1WXDA 5EIHA 5D5QA 1OA0A 5I7VA 4CEHB 5FPHA 4WXPA 1GIAA 3PNLA 4OAPA 2SKDA 3VA7A 5KKAA 1Q1AA 4FX5A 5FUBA 1SUCA 4YDQA 3LGXA 1MC4A 1G60A 5DHPA 2OY0A 3KYDA 1U8TA 5EMLA 3I62A 3GLRA 4WXEA 4GYYA 1ISFA 1YA6A 4FOOA 3VKFA 4UHEA 3GJYA 3MLEA 4UMVA 1YRQA 1GTZA 4I9FA 3SD7A 3PGLA 5IVIA 3HBNA 1E2NA 3W3AA 4QGFA 2FUG1 2P3QA 3GPIA 2YN2A 4OQEA 4Z5XA 4G5GA 4AG6A 3X1XA 5I4KA 1T1EA 3KV1A 4IDDA 4EHNA 4YRAA 3JQPA 1P7ZA 3OZGA 1CY7A 3I23A 5K2MA 4L7VA 5B57C 5FUVA 5JY6A 2GN4A 1E9FA 3NRBA 4NYJR 1G20B 3OQPA 3T54A 3B12A 3U48A 3OICA 4F9GA 2X8BA 1CP3A 3DL7A 4BMYA 1P45A 2ZYHA 3NHUA 4OXYA 5D5HA 4LZWA 1RNLA 3ZR4B 3EH2A 3B48A 4EGCB 5DTEA 5A7HA 1G6HA 4EB8A 4F4IA 3MT8A 3ZU6A 1HFEL 4G07A 5J4YA 4KIWA 3ZHUA 1JG3A 4QSHA 5HKOA 2P35A 5T7BA 3L1UA 4PCAA 3EY9A 2ZSKA 4GLOA 3PQ8A 4D44A 3F5SA 3KAPA 4A92A 1I4LD 3GN1A 1ULUA 2IP4A 3BG5A 3EXIB 2GEBA 3QH4A 1Y33E 1VXRA 3ONEA 2HKIA 4K6KA 4X24A 4JYMA 3TW8A 1UEXC 3BGOS 3OZ7A 4B82A 1OXSC 4RF5A 2AVNA 4PLVA 1RWVA 5DK4A 4EY3A 3DGEC 1JI3A 3T4PA 1Z28A 5E6UA 5KWEA 3C4JA 1O94A 3F6YA 1QMPA 4F46A 2C00A 4DV5B 1WBDA 2X40A 3FAZA 4PLWA 3W5UA 3WZLA 1S2GA 1V5EA 4IV5A 2IU6A 4IR7A 1OAOA 3E4CA 3UQYS 5JS7A 1POXA 1YDHA 4DIEA 4KR2A 5AHRA 1DP4A 2VL7A 3EDOA 3NHBA 1N7GA 4CFYA 1RJDA 3GLIA 5AVRA 1Q0RA 4LKRA 3BKXA 2X13A 1NWHA 2PZEA 3T61A 3TJMA 3A1UA 3R5FA 3SLRA 1MTZA 3TE6A 2QSUA 2ZU6A 3A3KA 4OSPA 5CH5A 4OXQA 2ZRFA 3JWGA 1TQ6A 1MORA 2R60A 4PV7A 3LKVA 3K72B 6CHYA 4HUQA 1T9DA 1ZOIA 2W4QA 4I5FA 4NNOA 3V7WA 1OJLA 1E3LA 3TF5A 4BVEA 2Y0CA 5DOVA 4OK5A 1PYDA 1PT8A 1X70A 3V34A 3R44A 2PT7A 1Z07A 4D0SA 5JNTA 1AE1A 2HF2A 4O02B 4U00A 5FDFA 4MJ3A 1TTPB 4UM9B 5WRFA 1UEIA 4K9SA 3DAGA 4Q7KA 1AUOA 1RM3A 5JXIA 1FBTA 2A9OA 3M81A 2WAOA 3JD2A 4EG4A 4QWWA 1O95D 1PL6A 1P2DA 1XA4A 2BGTA 2RGWA 3C5EA 4RDHA 2CHFA 4WZBB 3WV5A 4EKYA 5ITSA 3UK2A 1UPFA 1RE0A 2PFSA 4EF4A 4LXQA 4ZK6A 3DL0A 5MHTA 1JG4A 3AEQA 3V7UA 1V3QE 5ICFA 3ONNA 3OKCA 4FQ5A 1BDMA 4RH3A 4ZEMA 3P2MA 4D82A 3FE2A 2RGNA 2VF8A 2WTUA 3QI2A 1RYFA 4YJGA 5HGJA 3IQXA 2VWPA 2ISCA 4Y9SA 5L3VA 5MFPA 2NTNA 5IAGA 3PDWA 3ZCTA 5IC4A 4CEIB 2VATA 5EE5B 4AY6A 2CLSA 3A6HA 1NVWQ 1DEHA 2XXJA 3BWVA 3FPEA 4Q9HA 1GCGA 4I08A 3MWGA 3PXDA 3GLQA 1UKAA 3U4GA 2O5CA 3VGJA 4FEAA 4GMXA 3ETGA 1GPUA 1KJJA 3O83A 2AI3A 3HZHA 3AVVA 5BSKA 3AHCA 3N2GB 3T7KA 1AUVA 3T3DA 3QKRA 4HB3A 3FTEA 2TMKA 1D4OA 1HQKA 4R6WA 3RVJA 4D2IA 2AZTA 3P4UA 1XZKA 1C1YA 2IPXA 4JP1A 4CMJA 2GESA 3DMHA 5JWRA 1IBMB 4AB1A 3I1JA 3TUJC 1RLTA 1ZITA 4FDLA 3UUWA 2A3RA 2VRBA 4ZVVA 3UVEA 3ZD9A 4C0QC 4ZO7A 5EJ5A 4PFSA 1Y3FE 4D97A 3PQCA 4TVKA 2H63A 1GXSB 2QMQA 4EPTA 2F3TA 5LB4A 3DEKA 1I4OA 5LZ5A 3SS8A 4F97A 4JITA 5BMVB 3Q2KA 4CFZA 3IT0A 3CLSC 3HJBA 3W5CA 5BP7A 1FYFA 2YFYA 1HH4A 1RCTE 1IOWA 1UBNA 2OESA 3HKBA 4F84A 3R2JA 4CZ2A 4RK4A 4S1TA 2FP3A 4ZT6A 1EP3B 3KYIB 3BL6A 2YVQA 2YNMD 3EVTA 2AHOA 3G2QA 2F3SA 1J0XO 1GSHA 1KETA 1L7BA 2X7JA 3C3XA 4ZWNA 3OBBA 3A6DA 5JXHA 1V71A 1UDWA 1X39A 2ZBPA 3EFEA 3UG6A 3ZCPA 4RVNA 2P2GA 4G09A 3GT0A 4MUBA 5E9JA 1T15A 3EG5A 4B4DA 4CR8A 5KTSA 3UFBA 3SJAA 4ND6A 3A0RB 5JALA 3JTEA 4HN9A 1R64A 5HUJA 2HA2A 4LJKA 4LJ9A 1DIGA 3B1VA 3JW8A 3NANA 2C1ZA 1R10A 1XZEA 2GWRA 3HJCA 4HDRA 1JBKA 5DCYA 5E0OA 4LV6A 5EQDA 1J21A 2V7GA 4L8YA 1BW9A 5F2EA 2WNSA 4KI0A 4WXYB 1GPJA 5C4GB 3R3JA 3SMQA 4OQFA 3TI9A 3LHIA 3BL5A 2WNIA 4HFMA 5KJ1A 1JLMA 3DJYA 2FZ5A 2G40A 1L7PA 2H1HA 4M7PA 3W8DA 4J9UE 1CQIA 5AO9A 1JAHA 3J81k 3WDSA 2EEZA 3OM8A 3TLMA 2LIVA 1ONPA 1LWOA 1IN8A 4GX1A 4OKSA 4UW9A 1ISJA 5LA6B 1DS6A 1WXFA 3EHEA 1F2VA 3MRXA 5JVDB 1OAOC 4LJ5A 4OU4A 4QOIA 3RHFA 4ZI7F 4G0UA 2IEZA 3PYLA 3H75A 4DB4A 1X80A 1DQYA 3V5NA 1N5DA 4QOGA 4WGGA 1O97D 2A88A 2R7LA 3I6BA 1ABBA 3U61B 1OMOA 3UK6A 3VGPA 1XQ1A 3TRKA 3OPQA 4B48A 2FQ1A 3M82A 1N36B 3ZE8A 2Z30A 1KY4A 4IVNA 4TN1A 3DTNA 5HIMA 4BNGA 2EARA 2GDJA 4G65A 1NBHA 5JBQA 2X76A 4HRAA 5CVVA 4KE9A 3BPSA 1IY0A 2V6GA 4QTZA 4V2IA 3B1JA 2GPAA 2UZIR 1C7IA 3VU3A 5K3OA 4KK4A 3UCFA 1U0NA 2JA1A 4DHWA 3F8WA 2OEPA 4FYIA 5EMHA 2FN8A 2QRNA 3GNLA 3ML1A 2OVFA 4QYIB 1PJQA 2AJ8A 3HUDA 4QYXA 4Y7DA 2CLHB 2I7DA 5KOHA 3CZ9A 3W3AD 1BZYA 1Z6PA 2PU7A 4N18A 4Q1AA 4RJIA 5L51A 5CCEA 3ZS8A 1J56A 1JG2A 1ZCAA 2DG2A 3BIOA 2HSEA 5A62A 5CJ2A 3VQTA 2AKEA 5SV2A 3D02A 2BBSA 2PX4A 1G42A 2WVGA 3OM9A 4RIGA 3WB9A 4YBRA 4P0TA 4GX5A 1C7JA 1JRLA 1WE2A 1MB0A 2LD4A 1QIJA 1UFQA 1E3EA 3QWIA 4RVHA 2VCEA 4BAZA 2FSPA 3U6BA 3TG2A 4GWGA 3CW8X 4ARZA 4N3BA 2G6BA 2ZYUX 1UMBA 2IV3A 3TTSA 2VAXA 3DE5X 4NYIR 5JRJA 1DOHA 3DF9A 1S89A 3OKAA 4EKNB 3A06A 2FPUA 3ESYA 5H0IA 1F2UB 2GPBA 1WD7A 4M0FA 1JDNA 1XOIA 2HJ9A 2N3ZA 3QU5A 5AW3A 2OAP1 4TTIA 2PGXA 2CVPA 5FBHA 3WK5A 3W79A 1V16A 1ZD8A 1VGQA 3HXPA 3NHJA 1ZIXA 2E21A 4M54A 1XR3A 4QC2A 3K0AA 1NVEA 1QIKA 2PQ0A 3K7EA 1VIDA 4F56A 4NMLA 3G17A 3PUKA 4M1SA 4ZI2A 4GXTA 4S0XA 1J8YF 3PWKA 4H6PA 3GLGB 4IIJF 3AHFA 1WCXA 3P2YA 1KI6A 1NJ5A 4FGWA 2X0DA 2H16A 4ZDJA 4M22A 4NZYA 4OGWA 3OLZA 5D3ZA 4U0KA 1U2GC 1P17A 5D01A 2BR5A 4LMBA 3PX3A 4HMOA 2QAIA 3LHFA 1U0FA 2BGLA 4LVCA 1H65A 4D9FA 4P92A 1L5YA 1TIBA 4ZJPA 4DNFA 2YV5A 3RBXA 1Y3HA 1TA4A 5KQGA 1OF1A 2J5KA 4NK5A 3BQNB 2Z5FA 1J07A 1SC6A 1Y3BE 4LXIA 2W70A 2H57A 3WLNA 4ZCQA 3W9SA 5BNIA 5I3CA 3TH5A 3SZ3A 3ZGZA 1LNSA 2Q5OA 5JS6A 2NUTA 4FEYA 2P9HA 1AQNA 2C5EA 2REXB 1KZGB 3CPSA 5DM2A 3AFOA 4IDQA 5AUNB 2VQ6A 3OU7A 1VPLA 4XFDA 3R7BA 3H2SA 4D9KA 2HT6A 1GPDG 4OHFA 3X2FA 4L8VA 1RQRA 3LWBA 4KVFA 3I42A 2P6UA 4JVMA 2B3DA 4O4JA 5KKNB 3LRPA 4E1VA 2ZI6A 4M7WA 5GPBA 2CFSA 3OE7A 2ZP1A 3O84A 3CUEF 2FHSA 2IITA 4JVSB 4LDJA 1DXHA 4M1EA 4HGQA 4MJLA 3ULKA 5A02A 2PX8A 4CCYB 1KMCA 1XZHA 4LBZA 1YDGA 2CFIA 2FH5B 3CVVA 1JA0A 1U4NA 2CYCA 3BA1A 3GP3A 4FZRA 5HF9A 2J0UA 4EDHA 1QHIA 2J0EA 2ZBDA 4G1FA 4QUAA 1MO3A 2DPHA 2QMYA 4J03A 3H18A 1FSFA 4XIYA 2E4UA 4EB0A 1MHPA 4N3CA 4D3DA 4BBPA 1GRQA 1W88A 4MKHA 3DC2A 2IPMA 1KJYA 4GPD1 3HB1A 5F7JA 4QA9A 1JA9A 3CX7A 3HFGA 1YVUA 3U16A 5IBCA 4O4IF 1NNSA 2A1UB 3EW9A 2IXTA 4ZT5A 3RUFA 4AO6A 2QU7A 1LW7A 1XKXA 1C3OB 1ZK0A 3DONA 1RP7A 3EMVA 2W5UA 2ZSDA 4FE4A 2V1UA 2DRIA 5KIAA 5FAXA 2H1RA 4RWZA 1JQAA 5I9TA 2CYBA 1ZVVA 4QQNA 1QVVA 2J09A 3WJ1A 4AF7A 3T6KA 5A1JA 1WY5A 1N8TA 1XN4A 3INRA 1R3UA 2QEQA 2Z1NA 3HUEA 4G4SO 5HIKA 4MYTA 1NDUA 1QYCA 1JEYB 2BKUA 2V8BA 4TN5A 4Y2UA 3RUIA 1A2QA 3TIXB 4TKVA 5EHXA 1CYEA 1Q0SA 7GPBA 3DL2A 2AKYA 5K3DA 4ADSG 4XYLA 5B3LA 4P4GA 5BV2P 3KPVA 1WMEA 4PC7A 4M60A 4W7IA 4FFWA 3DH0A 4G26A 1V26A 2WWTA 1A3CA 2HDHA 3AWDA 3FCUB 2CXXA 3BCRA 2A5LA 4H0NA 1MGOA 4OXIA 5CYPA 4CPDA 2E5LB 4KQ1A 3BK1A 4S2UA 4X44A 3UA4A 4BQFA 5MGBA 1EXDA 4D41A 1SOWA 2COKA 2C3UA 1YT5A 3Q3EA 1OLXB 1Z8HA 1EBBA 1QWSA 5D3KA 3TRJA 1D8AA 4OYLA 2FPGB 2R1UA 4UBJA 2O2SA 3T7SA 4YXFA 4Y6PA 5L3SA 4R68A 1JVNA 2D0OB 4G4IA 4HGZA 1OBFO 1UBTS 2FMUA 3S55A 3AU8A 3SR0A 3JAMA 4YN3A 1CEQA 1R6XA 3DEHA 5AK6A 2W00A 2DF8A 5ITVA 1C1XB 3OPXA 1PJLA 4UHJA 4HJRA 1NRIA 1QB8A 2ORYA 4KG7A 2WIKA 4ESOA 5ILOA 1XPRA 3DUFA 4KAJA 3QLUC 4F3RA 1HEUA 1XEXA 3GJXC 2OO7A 2A9FA 4UNSA 2B82A 3IAXA 5I45A 2D2IA 1N5MA 3IA7A 4Y1RA 3TAUA 3THXA 4H08A 2EKDA 2FR8A 2ODQA 3QW2A 3FPFA 4Q03A 3BIWA 3ZK7A 3WHKA 3CXRA 1V7ZA 5KREA 2ZIEA 4FSHA 5EHNA 1Z6ZA 1JIQA 2ZI7A 4I55F 4RZUA 5CIWA 4ONEA 1SKBA 1LRLA 2FOIA 1XLVA 2Y1OA 1CERA 3EFOA 2NU7B 2RHCA 2H4YA 4MKRA 4L6AA 4JL8A 3NETA 1QVWA 4TSKA 5EFOA 5CB4A 3LZ6A 4CLOB 4TMTA 4IIHA 1O7JA 1SPBS 3EZNA 4Q0MA 3RO7A 4NR0A 1CUFA 4OLHA 3TR6A 1MABB 2H1SA 1B16A 1WUTA 3AT1A 4OJKA 3R7FA 1U2GA 4KLZA 5DASA 3LP8A 3V3TA 4LE0A 3VC7A 1NPDA 4DFDA 4YCMA 3K32A 1YDWA 2I3AA 3PD7A 1TEVA 3MHPA 1XCJA 1VCMA 2J46A 1B6SA 3RVBA 3T1NA 1FYXA 2WP0A 3T35A 3U7JA 2XNDD 3CZCA 2GXSA 2J3DA 3SGLA 1L2TA 2UYHA 2V5AA 1NN5A 1KE2A 1XQVA 4GXQA 2H4HA 2E0IA 3RTCA 3UMRA 1PD1A 2AMVA 1CUJA 3VAYA 1GUBA 2VJCA 4XWKA 3EPKA 2WT4A 3ZDAA 1YJ5A 1XTRA 3E0QA 3PPIA 4AROA 4DLNA 2JBHA 3SDBA 2HPHA 4PZLA 5BY2A 4N41A 3CW2A 5CA1A 1TT5A 4QDZA 1T0JB 3ZY3A 2J6BA 3CPJB 4GOLD 2QE6A 4GMHA 3TOSA 1VXOA 1GR1A 3QTLA 3RG8A 2EYUA 3OP1A 2HLHA 3ZD6A 5IMBA 3K9QO 4H60A 3RFUA 3HYSA 1PZXA 1WO8A 3VDXA 5T3YA 3BWDD 2QZPA 4B76A 4ZCIA 3AVTA 1CHDA 4UU0A 3A4NA 5AR1A 5DI9A 3O2SB 3STXA 2ID7A 4FZ5A 1NW9B 4S24A 4EA6A 3KQHA 4N9WA 2OBLA 1D6JA 1D0SA 1YL7A 1K66A 1IFXA 4FFBA 4LRWA 5FEMA 3G49A 1W5FA 2NV0A 1ITZA 3ETNA 3NU1A 5IAAA 3E1SA 1GTVA 1WP4A 3WRWA 3T41A 3E48A 3FFTA 4IGFA 2DULA 3U5ZB 1QIFA 1ZMRA 3LOPA 4BQIA 1GARA 4L8LA 3ZGLA 1C1DA 2GASA 2OMEA 2QTMA 1RXSA 3OZDA 2CZQA 2OAGA 1KXJA 2RGYA 2ZUDA 3W4JA 3I9V1 1RQLA 2O8CA 4YJ3A 4JAVC 4R9VA 3E5NA 1N9GA 5B7PA 1FVHA 2Q5FA 4KBYA 4X00A 3TNYA 2VJAA 4G84A 4E5MA 2R6JA 2WD8A 4PTLA 1YHYA 1Z2DA 2QE7A 3EXG1 5IX8A 4CTKA 2B94A 5FOWA 3E22A 3NP7A 1NMQA 3W5IA 3BMNB 1RQNA 4CM8A 5C7OO 4LRUA 2F3PA 5KYXA 5CCDA 5C5DA 3EAQA 5DNUA 4OL9A 3D3NA 5F2NA 2AEMA 1JR3D 4ZOCA 2I91A 1N2HA 3L8EA 3EPPA 3F5QA 5EQJB 4FINA 1YQ9A 4B3HA 4G0ZA 2CFCA 4IWXA 1SBIA 1GAJA 1TYBE 3IS3A 3KOUA 4YVFA 3REOA 4D4HA 2B37A 3CUUA 4YNBA 1KI7A 4X1YB 1GA1A 4B79A 3QKIA 2Z6QA 2FX5A 4PYIA 4EVSA 2RGEA 3QLTA 5SZIA 3SM3A 1KFCB 3FXAA 1CEXA 3KQUA 1BCSA 1PAUA 1ODTC 3AFMA 3K15A 4H3HB 5AQEA 2YXNA 2PQ6A 3PS9A 5ER6A 1FFAA 5G4KB 1EAYA 2ZEJA 2IS2A 2AFVA 2ZVPX 2C7BA 3KAQA 3PHGA 1G6Q1 2HHAA 3RKSA 3BWMA 4RS4A 3R4CA 4Y98A 8OHMA 4V1CA 2R6AA 3ND9A 2O2IA 1U1FA 4TZKA 2Q3CA 5BPHA 4C0AC 5JC8A 3R9KA 3LECA 1QDLB 4EYEA 1BDIA 3C1UA 1NUAA 3RSSA 5HZMA 5KEIA 3A26A 2JGIA 3LNTA 3WTCA 3PG5A 5FRDA 3D2AA 4RU1A 4DQUA 1RI1A 5IDQA 5JR3A 4P7KA 3ZYZA 1V5GA 1JQDA 5EN4A 3PCRB 4MYCA 2GM3A 3M2TA 3NGXA 2GM5A 4PFQA 4L6IA 3E35A 3ZLUA 3R0XA 4AS2A 1XQXA 1BJRE 13PKA 3FDIA 4B8ZA 3HCRA 2JHGA 3DWIA 2IK8A 3X2SA 2EL9A 3ZGOA 5C7IO 3BMQB 4R01A 1GNRA 1HQDA 1TM1E 1GV1A 2AUMA 4JWKA 4NU0A 5CAEA 4HWKA 4IHJA 1K4MA 4XI9A 3A4TA 2WT9A 3IVMA 3SZMA 3CEAA 4F5DA 2FOXA 4ZZ1A 1SQ5A 3R0ZA 2WE7A 1IHOA 3OOSA 5LZ8A 4JKIA 2I7XA 4Q3NA 1KP2A 1MJGM 4ZVNA 1EIWA 4FNAA 2O05A 4WZ6A 3WAKA 1RW4A 1TKCA 3EEQA 4JI6B 2CNNA 3V8EA 2YJTD 2LRHA 3N0TA 3OAAD 3QBTA 4O4HB 3HFSA 1LC0A 1OUMA 3NBKA 2EDCA 2OXEA 1Z5OA 2FWMX 2VHVA 2BHSA 3GGOA 4NYMQ 4R1SA 1Z35A 1KDVA 5GVSA 3ABZA 1U3CA 2AZXA 1NJ6A 2WILA 5DCUA 1NVAA 1WMDA 3V1UA 2OO3A 5FORA 3VR2D 5TIIA 3KLPX 5H5JA 3GNTA 5CRIA 2G1JA 3CV3A 1UT6A 1N2EA 4MR9A 4IEFB 3SLKA 5CGQB 2M2IA 2QLMA 4RTNA 1G8PA 4V3BA 2O7QA 2ZB3A 3G0OA 1WPQA 4C2TA 2NZWA 1Z75A 2CJXA 1MTOA 3HVIA 4X54A 3KKZA 5TEWA 1WSDA 2Z3VA 1KDTA 3G9QA 1XO1A 4R2XA 5JD3A 1U0GA 2UDPA 1HMPA 1GPKA <