1ZL2A

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine and phosphate ion at 1.85a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
253
structure length
253
Chain Sequence
MSKSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
publication title Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with inhibitor and phosphate ion at 1.85A resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 85
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zl2A00
4BMZA 1TCUA 3ODGA 2HN9A 4U2KA 4TYMA 1Y1SA 4R2WA 4BMYA 1G2OA 1ODLA 1A69A 1Z39A 2AI3A 3NM5A 4GKAA 1ECPA 3F8WA 3OPVA 1VFNA 4M7WA 3EEIA 1A9PA 3UAXA 5IFKA 1JDSA 3DJFA 1Z36A 4TS3A 5CCEA 5IU6A 2P4SA 5I3CA 4OEHA 4TXMA 1U1DA 4G41A 4TTIA 1PR2A 1A9RA 1NC1A 3OCCA 1OUMA 1T8RA 5FAKA 4EB8A 4DA7A 1RXCA 1NW4A 4QATA 1Z5OA 1TGYA 1Y1RA 1YRYE 1Y1QA 2OXFA 3EUEA 2A0XA 1LVUA 3KU4A 3FOWA 3PHBE 4OGKA 1Z35A 4DAEA 1SD2A 2AC7A 1RR6A 1RXYA 3U40A 1ZL2A 1PK7A 3QPBA 3DF9A 1U1EA 1K3FA 4K6OA 1OTXA 1RYZA 4L5CA 4TXNA 4DAOA 3FAZA 1PKEA 3MB8A 4M3NA 3BL6A 4BN0A 2QSUA 4LDNA 1ZOSA 4YMLA 1V45E 1RXUA 4QAQA 2OC4A 1JDZA 5F77A 3FUCA 4D98A 1PR1A 4QEZA 2QPLA 1T0UA 3KHSA 2Q7OE 2AI2A 4NSNA 1V3QE 4H1TA 3IOMA 4JOSA 1YQUA 4JP5A 4G89A 1B8OA 1SD1A 1A9OA 4EARA 3E9RA 5EFOA 5F76A 3IEXA 1B8NA 2H8GA 3SCZA 4QASA 5JPCA 1TGVA 5B7PA 1RT9A 1VHWA 2OECA 1LX7A 3DDOA 4DA6A 3GGSA 1T8WA 4OGLA 4LKRA 3ENZA 1ODJA 1CG6A 5F7OA 1YQQA 4F1WA 1V48A 1RFGE 4TXHA 2A0WA 4DANA 4TXLA 1LV8A 4QARA 1WTAA 3E0QA 1JE1A 4BMXA 3UT6A 2QDKA 5B7QA 2IQ5A 2PGAA 2B94A 4F2PA 4L5YA 3ONVA 1C3XA 1A9TA 4IP0A 5F7JA 1Z33A 4D8YA 4M1EA 2A0YA 3BGSA 1NC3A 1OV6A 3BJEA 4E1VA 1PR0A 1VHJA 2QTGA 5B7GA 1Z37A 3PNSA 1PR4A 1JE0A 1Y6QA 4YNBA 1RXSA 1SQ6A 2HSWA 3EUFA 3OF3A 4L6IA 2HWUA 1T8SA 5EPUA 3K8QA 4DARA 1ODIA 3DP9A 3FB1A 1VMKA 2AI1A 1K9SA 4NY1A 4R2XA 4LNHA 3O4VA 1A9SA 4WKPA 4OJTA 3PHCA 1JPVA 2ISCA 1T8YA 1U1FA 4JWTA 1JDTA 3D1VA 4L0MA 3PNPA 2HRDA 4F3CA 3KUKA 4WKOA 4TS9A 3E9ZA 3NM6B 4OY3A 4TXJA 1RSZA 1YBFA 1V41E 3TL6A 4F3KA 1PF7E 4L5AA 3OZCA 3T94A 5F78A 1U1GA 1OVGA 2BSXA 2RJ3A 3BSFA 4G8JA 4OF4A 3OZDA 3C74A 2OC9A 5K1ZA 3OOEA 4I2VA 3EMVA 1I80A 5CYGA 1Y6RA 3NM4A 4D9HA 1K27A 3P0FA 4GLJA 4X24A 4YO8A 4MARA 4KN5A 1V4NA 5B7NA 1JDUA 4P54A 5DK6A 1V2HE 5C80A 1PW7A 1Q1GA 4GLFA 5CXQA 4D8XA 3NBQA 1Z38A 1OTYA 3INYA 4UC0A 4F2WA 4TTAA 3UAYA 1ODKA 5CXSA 3KVYA 4DA8A 1PR5A 5ETJA 2XRFA 1QE5A 4LNAA 4MCHA 2ON6A 1JP7A 1SJ9A 2GUWA 5F7ZA 1XE3A 2I4TA 4DABA 4WKBA 3UAZA 1JDVA 3KVRA 5CYFA 4ECEA 1U1CA 5F73A 2I8AA 3FWPA 2QTTA 4D8VA 4TTJA 2A8YA 3MMSA 4LZWA 4QFBA 1PK9A 3DPSA 3OZBA 1PR6A 3O6VA 3LGSA 3OOHA 1TD1A 4PR3A 3P0EA 4YJKA 1TCVA 3GB9A 4FFSA 4PNPA 3LA8A 1JYSA 1ULAA 1Z5NA 3OZEA 1PBNA 1A9QA 1Y1TA 3K8OE 1N3IA 4WKCA 3FNQA 1Z34A 4MCIA 3KVVA 1M73E 1ULBA 5EUBA 4WKNA 1PWYE 5F7XA 3LBAA 3UAWA 1Z5PA 5CCDA 1OU4A 1CB0A 3UAVA 1FXUA 1RCTE 4R31A 4RJ2A 4GMHA 4NS1A 1YR3A 4DA0A 5KB3A
chains in the Genus database with same CATH superfamily
2QZJA 3S5JA 6NULA 1I24A 1OYYA 5F2KA 1X9IA 4B3RB 4G5OA 1UP4A 4UJ3A 4FOOA 2Q3BA 1NLZA 4PINA 1KQ3A 1W0KA 4X8HA 1QHNA 1M2OA 2E48A 2OT3B 4LXHA 1SOUA 5JCXA 4FZJA 2OZLA 1JW9B 4HH3C 3IOCA 5DNEA 2NXEA 4O4HA 3D2BA 2ISQA 1F5SA 3JYPA 1DJOA 4IXNA 3OPVA 2Q29A 1K68A 3DLCA 3QLJA 2V5VA 1MGPA 3ZQJA 1YQGA 4L5JA 3UAXA 3WYCA 4IFBA 1UJMA 1RRVA 1LXCA 4EQZA 1WW3A 5JANA 4FN4A 4XX1A 5DISB 1C9MA 2FZVA 3WXBA 3EIHA 4DLZA 2PIAA 4LC0A 3G79A 4YIKA 2H1VA 4KGZA 3OIUA 1YR7A 4PZAA 3WBKA 1ZHOA 1MT0A 1NPTO 3CXUA 4TRMA 4ZARA 4UTXA 3WJ1A 4DTCA 2ZG6A 2NX2A 4D9CA 4BX3A 2JD2A 3MJEA 2AZDA 4K5QA 4XW2A 1T34A 2CHEA 4TYWA 3D0KA 3H16A 4JLSA 4YVFA 3U3RA 5K8IA 2AKYA 2ZTHA 1RLMA 4JOBA 2DOKA 2Z8YA 1ZAKA 5E38A 4DVGA 3U4QB 2WQZA 1F0NA 4HDSB 2VNIA 2RHCA 3JCZA 4QTTB 2X7HA 2DLCX 3QKSA 4CEIA 3FWKA 3M4XA 5JSQA 1QLHA 4GMXA 1Q6ZA 4M1ZA 4KZKA 1USUA 2OXFA 2WFLB 5FWYB 3SNHA 1QYDA 1QDUA 1I3OA 3V8EA 3RVOA 2CC2A 5CEFA 1LTHR 4IG4A 1VRVA 4NOMA 3MYYA 1N2SA 2AOTB 1JHPA 2WIGA 1I2AA 5KQLA 2JK1A 5HP4A 1DL5A 1M10A 3SJZA 5H83A 1UKAA 4H7KA 3KBOA 4U6QA 1G5PA 2H4FA 1FTSA 2IVFA 1I7PA 4B6RA 1H9AA 3VU9B 4HGPA 2W98A 1FJGB 5DTQA 1IM5A 5EE0A 1RQLA 4U2BA 4WT7A 3S29A 2I7DA 1RR6A 2V74B 1RKQA 2CNDA 2D3TA 2A1TR 2W2PA 3FNFA 3FTDA 2YYAA 3NIDB 4G1VA 1T3TA 3VR2A 4ASUA 2C4UA 1L3BA 2BE9A 1N2XA 2DBRA 1BYIA 2VTEA 3KD3A 3L7NA 3JX9A 4DMKA 1Y6JA 2AB0A 2VYQA 4JENA 1OYOA 5I7FA 1Z5UA 5KWVA 1FVHA 3WL7A 1C4XA 2YZKA 4FFBB 4R0NA 2FFRA 2C58A 4ZGBA 3IHLA 3NTVA 3ZHUA 4JLBA 2JD1A 3GEIA 1WCYA 2YZ2A 4X7MA 3T7CA 2AGVA 4XR4A 1H5QA 5E9WA 4H4EA 1SHLA 1H8HA 4K6OA 4NMXB 3P2MA 5TRTA 4D0NA 3BRQA 3ESRA 3HZRA 3A9RA 3R5TA 4L4UA 5HGJA 1KEVA 1W47A 3IEIA 4HZUA 2QPOA 3Q7PA 1YZNA 4INPA 2C9ZA 5JPDA 3M33A 2FK7A 1M8PA 2W22A 2FSHA 1R6TA 2R44A 3CZ5A 3LIIA 4B9AA 3OM1A 3ROTA 1OWOA 1QK4A 2GNOA 3RNOA 1OGIA 3FHOA 2HF7A 4KNVA 7YASA 3U37A 5E9JA 1E4EA 5KVSA 4HNHA 3Q6NA 2KBEA 1FZQA 2XRMA 3JVIA 2UYQA 4B4KA 4DCNA 3E4DA 1V95A 4BZPA 3C3KA 4A6XA 2IF2A 3UVEA 2JI6A 1D6MA 3ZR4B 1OWMA 2QW0X 4L8FA 4B3BA 4BQFA 5J2UA 2A9FA 4RKWA 4TWZA 4KHPB 2DSNA 4BZZA 4IZOA 4D92A 4KFRA 2ACWA 2OLEA 3COPA 4NZPA 4R9RA 4X90A 4BDSA 1WCIB 1JHMA 3Q8XB 3DE3X 4XAQA 3ESAA 1DTWA 4DMMA 3GLTA 3K0HA 5KEIA 2RGRA 4BV2A 4OMCA 4XWYA 5HDQA 3AVXA 4LFBB 1EWVA 4Q18A 2IOHA 2MSDB 2BMWA 1VRWA 2H1FA 5CXUA 3ZCVA 1OWNA 2YJNA 1C3LA 1AC5A 3GLRA 4FC7A 2WJAA 2JCGA 4UATA 1XVAA 2PCLA 1JZQA 4OXKA 5D1NA 5ES3A 2N75A 3U17A 2H1SA 5FQOA 3ZY4A 3K0FB 1OILA 3AW9A 1DS6A 1FBNA 3CWQA 3R3WA 3NBAA 5J2TF 3NV9A 3ZQ4A 1UBEA 2J7KA 4IGIA 4G0OA 3EDCA 1ID8A 1OWPA 4J90A 5IFLA 2R6JA 3H0EA 2D1TA 4QTXA 1V11B 1ZD8A 1KO4A 3FSEA 4M2LA 2DGDA 3C6MA 1VCIA 3KS9A 5ALVA 2OECA 1L4KA 1N2GA 3H3FA 3DQPA 1LX7A 3H5TA 3IELA 4U9IS 4XPZA 1JHQA 2QN1A 5C4GB 1ZD3A 3V4RA 4LW8A 1RADA 3SXUB 3LOUA 1YIDA 3DT9A 3IB6A 1MW9X 1DEXA 2HXGA 2NNLD 5F51A 4JCOA 2FPSA 5KSYA 2WB2A 4JBHA 2A0FA 3DZ8A 3N86A 4KO8A 3VR4A 4RHCA 1OZGA 4DCJA 5ALFA 2FKNA 3JQBC 4A1OA 1OXXK 5JASA 3VA7A 3DAOA 2NU6A 4AJ9A 3FPSA 5F7OA 3DMFA 1U7OA 4Q7KA 1FUYB 3VKFA 2F67A 2JLZA 2VDMB 1BU5A 1SUWA 4KLAA 1EYZA 1Q74A 3HDGA 5FJJA 5KNBH 2P41A 2Z2YA 4IIJB 3HRHA 3HG7A 2OV1A 1HZJA 1PSDA 3OMWA 1R9MA 2MIIA 5EWJB 3AR9A 2FW0A 5AKHA 3AFMA 1V8OA 3HDTA 1BSVA 4WJLA 1EM8A 1L5YA 3N58A 4Z4HA 3EVEA 2GJ9A 3ZV5A 2PG3A 2V96A 1H2YA 1XTBA 2IW1A 4AF7A 4BGDA 3EXFA 4PZYA 2OFWA 2FN8A 3ORRA 2VWPA 3B51X 2NUAA 1L1QA 4NI5A 2I4IA 1GG9A 3IKMB 4LMRA 3FZYA 3HUFA 2B94A 2GK6A 4DCCA 5JH7F 3H6HA 1NBEA 1T5OA 3HCAA 5JYBA 2QUKA 5L4LA 1T0JB 4ZYVA 5BP7A 4ERXA 2QG9A 1NXWA 3AOEA 3KUXA 4GE0A 3GLFA 2H5JA 1ZVMA 1XD2B 2GLTA 2NU9B 4J1NA 1MG0A 1RBQA 3BJEA 5K3OA 1T10A 3Q8WA 3RVKA 3PEEA 4NBVA 1KH1A 4B71A 2JVJA 1V9CA 4S1NA 1XZAA 1UK7A 1Z8DA 2HA5A 3ACDA 2I2BA 3KEMA 3ISTA 5E1MA 2Y68A 4HG2A 4KLNA 5IARA 4BB9A 4P3NA 4AJHA 4B83A 2X0JA 5I9NA 4ZOCA 1ZD1A 1REQB 1UEXC 2XZTA 3PUHA 5CLLA 5T6MA 1O95D 4CF5A 2I6FA 2ZYIA 4L8YA 5BSFA 3HWWA 1IVSA 3K0CC 4AVYA 1IB0A 2HL6A 1I7NA 3QFTA 3MMPA 1E2PA 1GGFA 1DG9A 3FUUA 5AMXA 3ZXUB 3OF3A 3ZHVA 1W36C 3IVAA 2Q4DA 2Q50A 2YIVX 1J8QA 3RU3A 4DQVA 2XNKA 3AHEA 1V5EA 2VC2B 3BB4A 4MRPA 2XV1A 4P81A 4ZOBA 2XUKA 1AXEA 2MHCA 1CQJB 2PEZA 4NYIR 5BYAA 1FRNA 4ACAA 5CFZA 5JMOA 3K8QA 5EMNA 3MVEA 3BM5A 2PVCA 3FPFA 3QPWA 3V4OA 1QGZA 2PSJA 2JZCA 4EW6A 1YTUA 2RC6A 3QMWA 4GBJA 4XYMA 3PXGA 4GM4A 1JKXA 4LZLA 5BRAA 3GYBA 4KGXA 5KNDA 5CFLA 3S2EA 1FRVA 4UPDA 4LJYA 1MC4A 5HTKA 4NR0A 3O4VA 1P4SA 5LA6A 3KOWA 2R86A 4IX1A 3S6JA 3ZQUA 4EF6A 1EVYA 2J46A 2LIVA 3UJ8A 3LRPA 3OSUA 1GDDA 5AESA 3CM0A 4PYNA 5BN4B 2NWQA 2XYGA 4R98A 4Z9XA 3D4PA 2DKOA 4PICA 2VN8A 1AA6A 3V4PB 3V2UA 2YS6A 1ZOLA 5GADl 3H5LA 2V3WA 2XUDA 3O73A 4KXXA 4P2BA 4M0LA 1YR1A 3H3XA 4NOKA 2NG1A 4RMNA 2GAAA 3GC6A 1NU8A 4QGSA 3TG8A 2QKYA 4X71A 1EQAA 2RSLA 2AG6A 4H31A 3KJFA 2IIQA 2F1JA 4IV8A 3VPGA 1U63A 1IOWA 3EF3A 3IP8A 1QRRA 2IT1A 5KJ1A 2GEKA 1BE6A 4PYRA 1SUSA 2P2LA 2YZGA 3I37X 3JR3A 3TW8B 5TPWA 1IVNA 3AVYA 1BD3A 1GCAA 1ID1A 1IHYA 1DLJA 3H0CA 4R1OA 4J3JA 1YBFA 3X1ZA 1UFOA 4MOWA 1O96B 4KREA 3OT1A 5DGIA 2O5RA 2OXTA 3HN7A 3ZBTA 2AZMA 4L5AA 3MLBA 2Q5LA 5JCZA 2XOXA 3EX7C 2VAXA 4WX2B 4JVSB 1BDJA 2AHRA 5FBWB 1E5TA 1K4YA 3CNOA 3I1JA 3LHIA 4D9FA 1WCWA 5KDDA 4YQYA 1OVGA 3GGPA 4MPTA 3B3QA 2H4YA 2HNKA 3L8HA 4XTRA 2BSXA 3LWBA 5IDQA 1JHYA 1R6VA 1TM2A 1XTUA 2QSYA 4Q7LA 1THMA 4Q93A 3DTNA 2A5GA 4MPDA 4R8RA 1IZZA 2AJCA 1HNZB 4YCDA 4BEJA 1WDLA 1T29A 4HSEA 3NP7A 3OZDA 2G36A 1GPAA 4DJJA 2HIHA 1SBZA 2GPJA 4A8JA 5EY5B 1JDBB 1TZBA 3EZNA 2FUCA 5IF9A 1MO6A 5KVAA 4I2VA 2C5HA 1V1RA 3DOFA 1U9IA 1K8RA 1BOFA 1TUIA 2BGKA 4XWAA 2XQFA 1DSSG 2HJVA 3PPYA 3AJ9A 4JT2A 4XKJA 1Z4QA 4Y8VA 5BMOA 3MLEA 2IE0A 2ZWMA 3SS7X 1SOMA 2DY0A 2HCRA 4V0NA 2NAPA 5BMVB 5KWSA 5DBEX 4B32A 1NP3A 1JH8A 3RANA 4RJKA 2O05A 2Z9CA 1D7OA 2K87A 3KKMA 1DRKA 3EVDA 3H18A 1LB1B 2HA2A 3N2NA 2VTKA 5KKCA 4CUJA 4MUXA 3QI7A 2JVKA 4LXQA 2PA3A 4AS1A 4FOSA 4GLFA 1K2VN 2R5NA 4V2UA 3U7RA 1UCFA 2ZR7A 3HACA 3MELA 5D85A 5FNZA 4B3JA 4QELA 3VU3A 4KNYA 5A3SA 3E1KA 2WKPA 5LQNA 1MD9A 3HUEA 2V6FA 4JI1B 2WYHA 1IY1A 3WMXA 1W36B 4P80A 2QN9A 3CTPA 4YI3A 5C8YB 3UH0A 1WZUA 3G2IA 3U3JA 3WLPA 4E4TA 1CUSA 3PP8A 3WQQA 2PX5A 3QW4B 2ZSJA 3O0DA 2D5IA 2WW8A 4EZIA 4WHMA 4DNPA 4CTOA 4JGIA 4BO9A 1LI4A 1RABA 3N5CA 1M6WA 5AVWA 4L95C 2GR9A 4QOJA 3VKWA 1EFCA 3SIRA 1P61B 4K81B 4E5DA 3G0HA 5SZKB 3GUVA 4N3CA 5AKJA 4EZBA 3SSNA 1O6BA 1XD8A 5AFSA 2HWWA 3QXGA 3WOVA 4B46A 1BCSB 3D0RA 3RV4A 3WLMA 2GFIA 2GBFA 3HXKA 1AD2A 3HKEB 2VKQA 3T3MB 4E6PA 4A3SA 1AB5A 2VPIA 4GPD1 4ESOA 2VXOA 2C2WA 1ZUNA 1NDUA 3FCSB 3AI1A 5DOVA 2F3QA 3LWZA 4JKIA 4BS9A 5HR5A 1HBJA 2NUPA 2VEDA 3GPBA 5DNUA 5DGHA 5JS6A 2PAAA 1VJ0A 4RIEA 2VHJA 1YGYA 2Y0CA 4H27A 4Z9BA 3VR4H 3SQMA 2A9JA 2FEXA 4C01A 4M9RA 3G5TA 3EG9A 2JI7A 4LGCA 4PC7A 3H9GA 4PGFA 4ARSA 1J2YA 5F73A 5FTWA 1XRMA 3UCFA 4D80A 5FL7A 3NHPA 1H9CA 2ONYA 2Y1LA 3KT0A 4PZCA 3STWA 1FP2A 4UNSA 3UWSA 4BNGA 4Q6WA 4LZWA 2WSLA 3AG6A 3CH7A 4U4AA 4QRHA 2J0EA 3O7WA 4HQ6A 4B3TB 1MIOA 2ZS7A 5L4NA 3U16A 1NLYA 1RYHA 3KOYA 1LY1A 3ZW8A 3A1WA 2YJ3A 4R01A 4BKRA 3OIGA 1WRBA 5KVCA 2ZCJA 1T1EA 5L4SA 3VPSA 4JXZA 1W46A 2AOUB 2QRVA 2CNWA 5EWMA 2JD0A 4EUFA 4UHCA 4CU2A 4RIIA 2FQYA 4HATA 1I51A 5HM6A 3ZJUA 3AWIA 5EP2A 3NDRA 1GNVA 3AERA 1UK9A 3O38A 1XVLA 2AKAB 3FG9A 2HRRA 4WLNA 3W8NA 3HWRA 3DB2A 2ZAGA 4UD6A 3D8NA 3ZV3A 4AZ0B 4D02A 4EHIA 4XRGA 4ES6A 1NN3A 1QE0A 5CJ2A 4EKDA 4JCCA 1FP1D 3G2HA 2VCEA 1QFSA 4UU8A 2NV6A 1QHFA 2RHHA 3B1KA 3NWEA 2HK7A 4RLFA 3W2TA 3CY6A 2Q4TA 1RAHA 1MVOA 1MX1A 1F8UA 1NBAA 1UC8A 5IAGA 5TPZD 5UKDA 5JV5A 1EJ2A 4KRXA 1KWGA 2EZUA 3GPCA 1GTJ1 3DDSA 2FJ0A 1QYWA 1TZ2A 3NHBA 4TL8A 1DIRA 1G4UR 4YS6A 4N5DA 3V4FA 5FDFA 5K0TA 4HFJA 3SLKA 4WA7A 1Q44A 1F6BA 3PWTA 3TOSA 2IUSA 3DOJA 4U6NA 3UG7A 4OKIA 2BCGY 2NADA 1G6HA 3GHYA 2ZJYA 3L4JA 5DJ5A 2YHIB 1GL7A 2X2OA 2ZSKA 2PBLA 1X9HA 2K7ZA 4HQKA 1IULA 3IHKA 3VR6H 3UMYA 4TV8A 4UM9B 2V7BA 3MT9A 4US1R 3C16C 1IC6A 2KW5A 3P9IA 3ED5A 2X58A 1WIWA 3P32A 1BD4A 2C29D 2JJ2A 4LRUA 5LP6C 1ESEA 3P9NA 1LC3A 1PLLA 1CY8A 4NBKA 3ILSA 4OQPA 3BMXA 2OM2A 5FYQA 2WJGA 1KDVA 3FZEA 1L5WA 2AOVA 2WIDA 4EW3A 4NTZA 1W36D 4G5SA 4G85A 8AT1A 5KNDH 1DELA 3D8HA 1GGNA 3EEIA 3HVJA 4P32A 4D0LB 1YA6A 2ZRQA 4GIBA 2P6PA 3SDSA 2IZ1A 1NYLA 2ZBUA 3B1XA 3RRFA 4IUBS 4RZSA 2PZJA 5B57C 1B0PA 1EM6A 3T9AA 3I8OA 2X86A 3M1LA 3R6DA 2FOXA 3NGMA 1Z0IA 2FFBA 2G07A 2VJNA 3KCNA 3THRA 5T67A 3LM8A 2WD9A 3RBVA 3UB4A 2I55A 5FWAA 4ESEA 2NIPA 1OCEA 1Q0LA 2P69A 3W5BA 1XEXA 2FX2A 3RSZA 1U2RA 3ZOZA 1VI2A 2C20A 2W2QA 3RRYA 2PGXA 1QJ4A 5CBKA 3DV9A 2WAAA 2J9RA 3IA7A 3UICA 1FC0A 3CVUA 1UXGA 2GEBA 3O74A 4W63A 2UZ1A 3GP8A 3JWHA 1NY6A 3MWKA 4F7WA 2ETVA 1X86B 2GRAA 3NIWA 3O8OB 4MR8B 5IMSA 3MFYA 1RZUA 4K9SA 4EF4A 1NF9A 5FI3A 2I3ZA 1TO2E 3D64A 3G8AA 3TNLA 3FNIA 1A5ZA 2GXQA 3IMEA 3ETCA 1T0PA 2OK7A 3JD0A 3VR3A 4A16A 1CJSA 5J43A 1E6LA 3FOWA 3DZHA 3OJLA 4U3JA 10MHA 3K9CA 1JIJA 2OSVA 5J4KA 2HH9A 1CJMA 3NZEA 4MQFB 1O97C 4OGKA 2BGRA 2XQKA 4WZAB 3AL3A 4ZEXA 3QE2A 4ESVA 4XIJA 2RJNA 3LVBA 1RYNA 5K20A 2J0QA 1LBQA 4QGFA 5ILQA 2W2OA 1NG9A 5EIBD 1U8FO 3E35A 1TF5A 1DIAA 3FR8A 4JJEA 2FZEA 2WWWA 3UMCA 3EXG1 3VVCA 3QHAA 4D5EA 3PJRA 1PK7A 1TD9A 2LTAA 3A37A 5T64A 3WO1A 4DW8A 1OLXB 4URHA 3OLZA 4ZRNA 4KUHA 2F8TA 4DMRA 1QIMA 3GH3A 2AUTA 3NHFA 4F84A 5K6AA 2RGDA 3JYOA 5IVKA 4PC3A 3KPYA 1O87A 3VZCA 3B3FA 1T36B 3HNPA 3JQCA 4JLNA 4WERA 1N6HA 4AP6A 1I01A 2C9OA 2IXDA 2ZGVA 3ZX5A 4EECA 3H6KA 3A3YA 3DHEA 1YHNA 1K5GA 3E9QA 4M0CA 4C4SA 3QEBZ 2J07A 5A3JA 3Q10A 1LU9A 2I2FA 3ETLA 4CLOA 5KOJB 3BMOA 4QM6A 2RGBA 5JI3E 1J24A 4DY6A 3EGCA 4KV7A 2QLNA 5DV9A 4DUGD 3WADA 4BZWA 1SCJA 2EKZA 3O47A 1U3UA 2XR1A 5C1DA 3ANSA 4CYMA 3KEGA 3AM4A 1FUUA 1V6CA 1L3IA 2H5EA 3DHVA 3OCJA 3W8FA 2Q46A 3TRDA 4EYSA 1Z8FA 2Y0DA 4LY6A 5U1PA 2AEMA 1MX3A 3Q6MA 4KSYA 1FTQA 4JX8A 3A1VA 4NH0A 1Z73A 2B2XA 1WZEA 2TMGA 5I9BA 5C34B 3BL8A 4URVR 3HA7A 2A88A 4ZYTA 3G6WA 4HN2A 4BE9A 1FJ2A 4OSEA 5BNZA 4OYRA 5LP6B 1ABBA 3QH4A 1TJPB 1RJEA 4GG1A 5LD2B 3WYBA 4BUZA 1M8JA 2R7NA 4MLCA 1XX6A 4FOPA 3ROFA 1P7PA 1YL5A 5BUCA 2ZUDA 4B7UA 3TRHA 2HI0A 2NO0A 2PRIA 1J0XO 3GFPA 3SP1A 1XG5A 5JJKA 2JFXA 2BKXA 3EGWA 3DMYA 1LZLA 3EQ7A 1R0YA 1WF3A 4JP5A 4EKYA 1YFJA 4HEJA 1UM9B 1QRDA 2EFHB 3PUVA 5EFOA 4NCXA 1CY1A 1P6QA 5DTIA 4EYOA 1D0VA 3FOZA 2B7LA 5KMGB 1LQTA 1A9XA 3F1KA 5JAIA 5LQUA 3F6BX 2WOJA 4QASA 4FP9A 1YJ8A 5K0EA 3NJ4A 1UWCA 4TVBA 1VJRA 2VTVA 4PRKA 1IWBB 3QLEA 5ALLA 3UB2A 2PRSA 4EPVA 3KB8A 4G9BA 1C9YA 1P4AA 2PMFA 1R4NB 2PS3A 2RGCA 2XYVA 3UG6A 1H2EA 3IKTA 2XJ9A 4H1WA 4JI4B 3C5VA 2W2KB 5AJTA 1DXQA 1U3DA 3DE1X 3FHLA 2R0QC 3GX1A 4YRPA 1LCIA 3ZHTA 3CONA 2JFNA 2QDXA 4IY1A 2MR5A 3IGFA 4DA6A 3ZIAD 3GCXA 3GQBB 1NW9B 2DHCA 4BJHB 3E7FA 1JLRA 5HKKA 1O8CA 3E9EA 3LHKA 3R41A 5H8WA 2PUEA 1E8MA 4ZVVA 4AJLA 1GSHA 3VYWA 1WOYA 4ZZIA 2HA6A 2JCBA 1CQWA 3AT1A 1FFWA 3R6WA 4JITA 3KOUA 1WHSA 4YRQA 5IHPA 4N3AA 1WCV1 3PZBA 2CB0A 2EW2A 4QDTA 1I13A 1KS2A 3K73O 2FPXA 3F7OA 3T3EA 3UJPA 1LPBB 3IOYA 4QPPA 3HB5X 1TM5E 3DPUA 1MAAA 1ZSVA 4TXLA 2FB9A 4ZO9A 1PJ4A 3T54A 2WU3A 2I0FA 3U39A 2X14A 2IYNA 1YFKA 4FT2A 3SF8B 4ZMSA 3JWJA 2P27A 1UDCA 1WMSA 3RUCA 2OPHA 3W6ZA 3RRXA 4YR9A 4UEKA 1MC5A 4OXNA 4KQFA 2FZCA 2KE5A 3L8ZA 4NP6A 5B7QA 5DCYA 4CG1A 4AJJA 1Z45A 1COWA 2H31A 5DYIA 4AO8A 1DEOA 1U2ZA 3PICA 1PFWA 5L7WA 4NABA 4UTZA 1T8UA 5FX2A 1KKMA 1IBRA 3WNBA 2PZLA 5IX8A 2O2HA 3QYAA 4AU1A 4G4SP 2BFFA 4DG9A 5I9TA 1GFZA 2PUFA 4KW7A 4YJFA 2VHTA 1L7XA 4BGVA 4BB6A 3WL6A 4H18A 4DCSA 2CXSA 2QTGA 4QDUA 3LUHA 1UFQA 2CMKA 4YJ2F 1JSXA 2PL9A 4LZNA 3L5OA 2PKQP 1WABA 3NTQA 1H3NA 2X8WA 4N8EA 4AG5A 1LPNA 4GX1A 3D31A 3IQGX 3V1LA 1HT3A 2QHXA 4WAUA 3EUWA 3AEZA 3V1NA 1QSGA 1SQ6A 1MB3A 4JT4A 2PPVA 2X8AA 4J3NA 3KLPX 2O5CA 4R71A 1M1NB 1WUTA 5K0LA 3JD2A 1A97A 2HFKA 4B5LA 1J8MF 2NZ2A 2QA5A 3SKVA 3VO1A 2ALJA 1Y9ZA 4GOXA 3HC7A 3PGKA 2O2DA 3MWLA 2JLQA 2YQZA 3E48A 1NUAA 4UUMA 4X94A 4AJ1A 2HB6A 3VHXB 1NM5C 3F74A 2P5TB 3ETEA 4NC9A 1P9OA 5L7TA 3C4QA 4Q4DA 4QJ5A 2VK8A 4PZ0A 5EYPA 1IUKA 5P8WA 1P3Y1 3L1KA 4Y6GB 2Q1XA 3WDKA 3ZGVA 1SVUA 4XSHA 5K5EA 4E2ZA 2IPOA 3DVAA 5BQPA 3Q9NA 5ITZA 4GDFA 3CEHA 2W4QA 3BHJA 4ZKDA 2CF5A 3KO8A 1T3HA 1GPDG 4NEGA 1RRFA 1S6YA 5DHSA 4EKNB 1FRZA 1SUIA 3HCBA 1KEKA 3FGOA 3OEHA 2OM6A 5JY1A 1CW2B 3PHCA 2ZU0C 2ISCA 5C2JB 1K7SN 1PGNA 3M2PA 4NFHA 4CCAA 2CXOA 4CFYA 2GFHA 2FZLA 1JIXA 3TCNA 4OQLA 3UCEA 1D9ZA 4YV2A 2Q3FA 1BW9A 2R6AA 2Y1CA 3USES 2MTBA 4GC9A 4J7AA 3U7QA 4GPBA 3UHPA 1X0VA 2G0TA 3PEUA 3PDIA 4FFNA 3WWZA 1T6ZA 3PA8A 4AMBA 4ZV4A 4J1QA 4G24A 1SIUA 3BAFA 3M5CA 3DKKA 1YBHA 2EDCA 5A06A 5CDFE 3RKRA 3NXKA 4ER3A 3B36A 1XL0A 3FZQA 4LA4A 4OM7A 2IS1A 3OQMA 4WBXC 2VDWA 1FPMA 5DU2A 1CUAA 3NBXX 5BXQC 3S4YA 4G0XA 3DUFA 4S0ZA 4KBFA 4FZRA 3WSWA 3PJFA 1B93A 1KAEA 3EDMA 5K4GA 2HSDA 2WOOA 3HHPA 1FE8A 2G5CA 2QRKA 3ZGOA 5JO0A 2HNAA 3GIDA 3OE7A 4Y1EA 3QEAZ 1M66A 2FPRA 1ZDMA 1E1DA 2QE6A 1MP0A 1X92A 2J87A 2QE7D 3A1UA 3KV3O 1J21A 2HPVA 3U31A 3V1MA 3LDGA 3E58A 3HKBB 1IXSB 4W8OA 4YALA 1TTTA 2H92A 5CJPA 1HK7A 3O8NA 2W9XA 1EK2A 3UWPA 1O97D 1PN3A 4LG1A 4AYWA 4GMFA 2ZRGA 3MINA 4FBGA 2P9EA 3KYCA 1KY4A 4TLDA 3RT1A 3WGNA 4EOGA 1V8FA 3FCXA 4NICA 4B5KA 1AQLA 1OROA 2Y1GA 721PA 4I9UA 4V3CA 5LMZA 5E3JA 2G6BA 2PKCA 3IPRA 4FB4A 4HGRA 1Y6RA 2NO1A 1U9CA 4WECA 1YZ3A 3TOXA 4Q3OA 1LZKA 3VR6D 1QH1B 1XAGA 3VVBA 5IWCA 1ECLA 1RKVA 3U1BA 4PFJA 3EGEA 4Z8YA 3COSA 2BZ0A 3KXLA 4ZQCB 4RVNA 3T4UA 1RLJA 3TCXB 4DE5A 3CF6R 5BV7A 5KBYA 1RPZA 2F43B 1Q3HA 4C2AA 4LEIA 3MIIA 3R20A 5DW0A 5KNCA 4GL2A 2W4MA 3NT2A 4RADA 3JRNA 1YMQA 2CLFB 5SYAA 3RRZA 1EAYA 2PMBA 4MW0A 2RH5A 3WJ7A 3QF4B 4FYYA 4Y6LA 3X1MA 1HEUA 1Y3CE 5TLSA 3RLFA 3FPEA 4PGAA 4HH4A 4TROA 1KI6B 3V9AA 3FWYA 1W4CA 4MS1B 1VPVA 1S0UA 3MS2A 4X93A 5A3QA 4FKBA 4ZHQA 2KPOA 4G63A 4IJ5A 4BNXA 2JIOA 4ACBA 4KL8S 5C4IA 5CVTA 3E1SA 4FYJA 1QCZA 4CFSA 5KOHB 5LFAA 3G9TA 1WB5A 3PRJA 5K3FA 3RSCA 1OH7A 1ND6A 5LOVB 4UU0A 1N2CB 2H85A 1Y3AA 3NBMA 4FCWA 1X87A 4GL4A 1QH8A 3ZUPA 3PUWA 5G3ZA 3NVKI 3BIWA 6ADHA 3I2KA 1II9A 4YROA 1XROA 4DA8A 3I2IA 2D5BA 5GONA 1KORA 3ICVA 1CCWA 4A26A 1IZ8A 2WD7A 5M3BA 3GCWA 3CKYA 2ZUSA 1RWBA 1NE2A 5EVCA 3R7FA 3ZVNA 4Y6SA 2QTNA 3BIJA 4FUQA 1HZZA 3WDMA 5L6LB 3GMDA 5DX0A 1HFWA 4OUDB 3KQNA 3GLHA 3GJSA 5CDHA 3U9TA 1U2TA 4EX6A 3IVXA 3I2GA 4PPYA 4Q3CA 4HMQA 4HT3B 5F9MA 4CDMA 1RTKA 2Q1WA 3CUVA 3MAJA 4DABA 4KWHA 3S1AA 1PJLA 3D7NA 3CRMA 4FSXA 4HTFB 3T7AA 1S2GA 1UT5A 5HQ3A 4N39A 3UAZA 3AK4A 4PO8A 2GSWA 1F60A 1H2AS 1KXZA 2MSWA 4RQBA 4YJ3B 3QYJA 3M9LA 2I29A 3RC8A 1BH6A 1JVSA 1PL0A 1DC4A 4IMRA 2CHVA 3GG2A 3G0OA 1L5RA 3K3PA 2A14A 2JJYA 4G5RA 1NXTA 4ZALA 1RW4A 1ZNZA 3G5LA 5E9AA 1NLMA 4C7OA 3FGNA 1XTKA 4R6XA 4BB5A 4EPRA 4KXNA 2H4ZA 1X7GA 1TQ8A 2ZT7A 3TINA 1H8EA 2VATA 1EB8A 5CTJA 4E09A 5D3ZA 4JI7B 3GA7A 3NUZA 4PWZA 4G5GA 1XDDA 2WFMA 2O9JA 4IOLA 1LQUA 2YMQA 2OO7A 1JJBA 3A9UA 3HPQA 4V0LA 3BWVA 5AUNB 1L8LA 2EQBA 1F38A 1H1LB 2VP2A 5EXXA 3IUJA 3KAJA 4PNPA 3ZKWB 3K2IA 3FMIA 3R1IA 1G8FA 2GCGA 2JFHA 3OF2A 3JYLA 1FYVA 3Q15C 2NN3C 4L4ZA 2WHXA 3A2MA 4UCXA 3T1TA 1H5NA 2R8YA 4PQRA 1TF2A 3ESCA 3FSJX 2P9QA 3IUQA 4PCVA 4FYHA 4RA9B 1XNQB 2IPAB 1ZI6A 1S4QA 1TVCA 4FS8A 1VL1A 1L8XA 1ZJ5A 2HNBA 5D1HA 1IPHA 1Q7CA 5ENZA 5LXTB 2Q2NA 2WZQA 3I6ZA 4OREX 5IT0A 3DOOA 5L3QB 1GU7A 5DSTA 4I4LA 5TC4A 1U0NA 2ZXFA 2WZBA 1ZCFA 4B3IA 5CHYA 4J0GA 3QU5A 3JQ9C 2ECFA 1UF9A 3IESA 2XUOA 2DF8A 4DHWA 4IDEA 1GVNB 3UPUA 2WWHA 4U7WA 4S05A 3KAPA 1AS2A 3PXDA 1Q0TA 2GJ8A 4EY4A 1K66A 3E2PA 2XNJA 3L8GA 1DFGA 2ECQA 4R7ZA 1LJLA 1P8AA 1JNYA 1LF5A 4U8HA 4LVCA 4ZO8A 2AZTA 1YXMA 2C2HA 2DSTA 2JHFA 3K6RA 2A5FA 3LIPA 1A8QA 3GFOA 3SHFA 3TIVA 1UIMA 2YWRA 4Q1EA 1PS0A 1MTZA 1GEEA 2VZ0A 1RMQA 2A1IA 2WILA 2XH8A 3SC6A 2D59A 3IL2A 4PRZA 4Y2RA 3UYLA 4R2WA 4HDCA 1E69A 2QVYX 5BY2A 3PQ3A 4YRMA 4J0HA 1G0NA 3HA3A 4PIMA 3S68A 1LUAA 1OXBB 2EX0A 4LAFA 3IAM6 4Y18A 4ETMA 1P3DA 4Y2HA 2Q3HA 3LMKA 4L76A 4RCYA 1JBQA 4B81A 1JILA 4PWYA 4DLTA 3PTAA 1H2BA 1R8XA 4XCXA 2OWEA 1O9HA 1IY2A 3PHLA 3QMPA 4HNSA 5AJHA 1NE7A 2OVFA 3BE4A 3DSRA 3EPJA 5HRCA 1G98A 3GP5A 1JSCA 2OKCA 3PQ7A 3VBEA 3M9WA 4KPEC 3EIQA 2HTEA 1KTVA 2JBWA 4NAUA 4I3FA 1SULA 3C85A 3WOHA 4IJVA 2C0CA 4INZA 1GTZA 2HY7A 4WZAE 4YPFA 4JBLA 3W77A 3L8YA 4UAVA 4U9HS 1UAYA 1AKYA 4N47A 2PZ8A 5EPOA 3L0BA 4WZBB 2GMWA 5JG7A 1WS6A 4WEOA 3IERA 1T9CA 1GLGA 2EAUA 2QAJA 4Z54A 5JZOA 1V43A 3E23A 4TTQA 1L7DA 2VG8A 2ZQZA 1DCTA 1OUMA 1SVIA 3P45A 1W76A 4EB6A 2GM4A 4EB8A 4QGHA 5HZMA 1P1RA 3PIIA 4OV6B 3A1NA 3BSWA 3HB7A 4UFNA 1EP9A 4WZ6A 5LLTA 1AXGA 4GS5A 3OC6A 5DM4A 5HZGA 1V8BA 4QTZA 1J0AA 4LHEA 2QP3A 4MKRA 4OH7A 2HYIC 2A0XA 4MV6A 3PLRA 4YCBA 2YJ6A 2AJDA 2WK1A 3OFJA 1V4BA 1H0SA 1IJEA 5IC5A 3IQDB 5JBIA 4IHJA 1QF9A 4K9NA 1SRRA 3B13B 1H6BA 2NV0A 3LDUA 1DI0A 3RAJA 5C5IA 3N76A 2HJ9A 4Q9JA 4ZIRA 2WQ7A 1D2AA 4Z9YA 4RPHA 2E85A 4HO1X 3RC7A 1LVGA 2B78A 4JXKA 4NEQA 3BMCB 1M6HA 2YZMA 3GAFA 3IFSA 1X7XB 4FTWA 1SN7A 5ARCA 3VH2A 1AMOA 4XWWA 1KEEA 2I22A 5EE1A 4YYZA 2O1XA 4QBHA 4XPIA 1I2ZA 2IE8A 1PLJA 1YU9A 7GPBA 1D2MA 3QSYA 4EJ2A 1RMYA 4M99A 4XOUA 4R7TA 3WGIA 4YLYA 2WKSA 1ADYA 3NW9A 1C3OA 2CHFA 3HO6A 3K32A 4DKJA 2WKRA 2CE7A 1JJFA 2EC5A 4E13A 2Z2XA 3Q6IA 1QK5A 5JXJA 2DFDA 2EX4A 2POQX 2AV6A 1XP5A 3JU3A 3OEWA 1P1KA 4CDNA 2UDPA 2NGRA 1Q57A 1ZUHA 2PT5A 2I3AA 2ZU6A 4PLFA 1LWNA 3B38A 2QRHA 1S89A 5BN5B 3WQRA 2PRJA 1JAIA 4HLCA 1CKEA 1Y5NA 5CB8A 2Z6UA 2XA1A 3MWFA 3S3TA 2ZJBA 1ZA2A 3LL7A 3MOIA 2ZSFA 1ZO8A 5CDSA 5K8TA 3WG9A 4M8SA 1ORHA 4AYTA 1NVWQ 2QN7A 1V45E 2GPSA 4BLPA 1JFLA 3IMCA 3M5DA 5FXMA 1JDZA 1SZCA 4F97A 2HSZA 5ICMA 1J22A 3QFFA 2C2XA 4HLQB 2PV7A 1FFEA 1AHHA 1N0UA 4H1UA 3GZTB 4IUYA 1F12A 4HXEB 4PG7A 2PR2A 2C9DA 3AF6A 3E15A 3O4JA 5EOVA 4FNGA 2CZCA 1TLFA 4KRFA 5K05A 2GAFA 1K6MA 1J0DA 3QFRA 1SWVA 1HGXA 3DDHA 4RSHA 2D74A 1R0CA 2ORYA 2X6RA 3EDRA 1M75A 1XPRA 1WP9A 3BTOA 4D46A 5CJJA 1GZVA 5I7OA 3Q5GA 4UUPA 4NYJR 3IAHA 4CE6A 3Q3EA 1OXMA 4NXMB 3OLWA 4KG7A 4G89A 4MVJD 2D3WA 1CYEA 4JYBA 5JDIA 2EFGA 2YXEA 1XWWA 1NJSA 2BELA 1CULC 1E2GA 4P3KA 1AN0A 4IVNA 3W78A 3OQJA 1G63A 4DCGA 1EVJA 3T6KA 4DLPA 2PKEA 2XSZA 4RESA 4Z0PA 3EOZA 3C8MA 3VC1A 1OC4A 3NOQA 4Q1VA 2ID8A 3VPAA 3GLIB 2ZWOA 3C43A 5THKA 4A73A 4K86A 4AZSA 4HGYA 4AT1A 3THYB 1VIAA 4V0QA 3ICQB 3R44A 1RYFA 1RIIA 2FUG1 2AJLI 2PXHA 4OU5A 3KETA 4UU7A 4TMYA 4C5AA 2XUJA 1B26A 2WF5A 5C5EA 3T5TA 3BULA 1JMKC 3NAGA 4CMAA 4JJ8A 1MC1A 4MH0R 1R1DA 3BREA 4Z1MD 3ZNNA 4KAAA 3OQBA 2W0MA 3H9JA 2RBGA 4E2WA 4CEJA 3PU6A 4DQ0A 5IDYA 1KA9H 4BLQA 1E96A 1A5AB 4WACA 5EQFA 1UADA 2WJZB 1OOEA 1Y8RA 4N3BA 5AKLA 4KBYA 1KXJA 2C97A 2GEVA 1F8YA 5ALEA 2D1YA 3DDNA 3CLVA 3FDJA 3ZOKA 1DKOA 1DQNA 4PSKA 3D5TA 3WRXC 4D5GA 1JLSA 2E4WA 4EQ6B 4YMVA 4BQEA 3ILHA 4KYUA 3HXTA 1NVEA 3R7WB 1VKZA 3PJDA 2O3RA 1L9XA 2J5QA 2ZTLA 4FYVA 4FB5A 3R9XB 2XLBA 3K2QA 4CCSA 1N75A 1Q7TA 1JQLB 2ZWIA 4N54A 4AUMA 2ZJ4A 3V6MA 3VU8A 2PA0A 3LKBA 4NEHB 3HUTA 1DDOA 1MCZA 1RWQA 2OCGA 2XVMA 3QVUA 4YRSA 2DR0A 3A9VA 1IQRA 3F3MA 3MHTA 2PGAA 3T38A 5JJLA 4EITA 1ZMXA 2ID7A 5E6UA 4KR2A 1I0IA 4IP0A 1MOZA 1U8UA 5EIHA 3V1TC 2JIDA 3DL7A 4LGVA 1QHYA 4RPCA 4YT5A 2L82A 1PGPA 3OE1A 3CZCA 1GNTA 1WB4A 3AXSA 1QXSA 4DV2B 3ESDA 4E1VA 1GL6A 1E5LA 4BFSA 3D9QX 3T3GA 3WLEA 2I9PA 5K8CA 2ZB8A 5KDOA 3GT4A 2DE0X 2WHPB 4XYLA 3OQIA 1XRRA 5D8DA 5FNVB 2HSGA 2I1QA 5HQJA 2F8MA 5CAEB 1B7GO 4HDMA 4M60A 1YK0A 4E7OA 4K0RA 2V7XA 3GCGA 1M7BA 3ECAA 2CLEB 3C3MA 2ZDQA 3INTA 1M2VA 2POCA 4RPGA 1YMUA 1ADCA 5G4LA 2XQIA 3S2ZA 1RRPA 1ML4A 1QUEA 4Q1DA 3WAKA 4WBNA 5ADWA 5K8VA 4H6XA 1OFTA 5LN1A 4RWZA 4Y6RA 3TDMA 3MMNA 4AZVA 4ND2A 4ZOLB 1M5TA 3CSUA 4UQPA 3TLXA 5BRJA 4F5YA 4K3UA 5IN4A 5E2BA 1NAIA 4DREA 4B84A 4N76A 2J5RA 3HSSA 4ZANA 4ZCMA 1CIVA 4BNWA 4PYMA 2W58A 3RLIA 3A4TA 4L9RA 3TVYA 3UJCA 5IPFA 3TR0A 1P31A 1R50A 1KI8A 2N3ZA 4ZAGA 4KQJA 1NW5A 3FNHA 4GE3A 4PQYA 1VCMA 4LNHA 2I65A 3RKSA 2HYDA 3AKDA 1CV2A 1TC2A 1SQ5A 4JI5B 3Q87B 3QX9A 1PO7A 3R76A 4L7VA 3EN0A 1NVVR 1ONSA 1G4HA 3PKIA 5AK6A 2QRQA 3HSYA 5C51B 3I64A 1UBHS 4I9NA 3CKMA 1P1BA 1NQAO 2FEWB 2VKTA 2WTBA 3FCUB 3NYWA 4YJHA 5COQA 4DMCA 5A7FA 4LK3A 4BNDA 2HMYB 2J0SA 4XVUA 1JDTA 1Z06A 5FKJA 3D1VA 1Q1AA 3O93A 2APJA 3OFVA 3PPXA 4HEQA 1UFVA 3EA0A 1LBEA 5HJ7A 1IAVA 3MA0A 2X9QA 4PGHA 3TQCA 5FA6A 3GOQA 1UMDA 2YCBA 1V5FA 1MH1A 2WAMA 2D7JA 2YW9A 2O8FA 1B0AA 4GW3A 5JLAA 2PNJA 2Z4RA 2ZBVA 3F97A 4PRLA 3L6OO 1YCDA 3IVGA 4I8DA 4HVLA 5ALYA 2NSJA 3MC1A 2E6KA 1UJBA 1YE5A 2ZBDA 4I0WB 1U6JA 2C78A 4ZCLA 4EY3A 1YBAA 2UKDA 4BVKA 1E2IA 3CRQA 4GUAA 2CL0X 2ZVDA 1Z4IA 4V1CI 3BXPA 2G25A 4BBZA 4B4DA 3OTWA 3LY5A 3ZJTA 3K05A 3ZWAA 4ID9A 4AK9A 2GPYA 1RRKA 1DKNA 1H6AA 2PZKA 3IT0A 4MK4A 1VPWA 1BFUA 1U2GA 5KPJA 4ZEVA 1RWXA 2OWDA 4QRDA 4FGSA 4AJPA 3PXAA 3R0XA 5FBLB 1NBMD 1U80A 3JV7A 4B3MB 5F9FA 3HBFA 1NPDA 4OJMX 3WMWA 2CVFA 4YGYA 4A0QA 4L9SA 1I80A 4LMAA 3LXUX 4V0KA 3NM4A 4HUQB 4ZQIA 2EKPA 4J7CA 1U3TA 1N2CE 3G0IA 4R2KA 2VAWA 4MA0A 3UJHA 2CUTA 1SCKA 1WXGA 1TUBA 1L7VC 2OXEA 1OHHA 1I4DD 2AR0A 5KZMB 4OK3A 2UVDA 2B82A 4YXFA 2Q2WA 1V4NA 3ABZA 1NQUA 2ZRKA 3JQAA 5I9SA 2ZCVA 4CQJA 3R5FA 2XOKA 5H3HA 2G9ZA 5TQ0B 2OENG 4LN1A 1FYFA 5A4IS 1G5IA 5DN9A 4R2MA 3P0HA 2WWYA 1XVTA 2CLKB 4AYXA 1IK4A 4TMXA 4Q9HA 1G42A 2QD3A 1ZMOA 2XCUA 2ZULA 4RKRA 3PUYA 2ZUEA 2QQ0A 2BF7A 1OTYA 1FQJA 1RHQA 4H0NA 3IDOA 2GKGA 3N53A 4BX8A 1NXSA 4OH1A 4W5RA 4AJ4A 1MAUA 2N46A 4WIAA 3RUDA 4AP9A 3K6SB 1ZR4A 3WLSA 2I1WA 2ZVJA 1GCUA 3EFOA 1CQXA 4TUYA 4QLOA 2CWWA 3ROPA 2AC2A 1TLLA 1EGHA 2BISA 1RJWA 3EVCA 3DO8A 4MVYA 4NDZA 3QVVA 4K87A 5LYJF 4ZCQA 1QIFA 3HYRA 4FNMA 4LS3A 3DR3A 1B14A 2ZXEA 5HJ5A 2OZEA 3ROGA 2HUPA 5ICGA 1C1DB 5CD9A 5DHUA 1K2WA 3AONB 2IYFA 5CT6A 3IBSA 5CNKA 3WE7A 1K9VF 3AFNA 1GUZA 4DSTA 4ZOAA 3DLPX 3K4PA 4NMHA 3HCDA 4E33A 4ZZ0A 3IBTA 4A8PA 4IM7A 1PG5A 2XZLA 3I73A 3HMKA 2G1AA 2RKBA 2P5UA 5AOAA 2FMUA 2GXSA 2AYXA 2EBHX 3OUZA 1J39A 4M1KA 5ESDA 3TTUA 4PZEA 3SDZA 1M2OB 2WB4A 1GL3A 1PWXA 5JI2E 3X2EA 4DLWA 4IGAA 4M8KA 2OZLB 2ZI6A 3QJYA 1Z3CA 4F7DA 1L4LA 3FOFC 4O4HB 4G01B 3AESA 1N8KA 1B4DA 4P3YA 1HE4A 4B4WA 5I01A 4L28A 2IHJA 3MM4A 4JJFA 4Q01A 1OBOA 9LDTA 5CHEA 2Y2UA 4WBSA 4KAJA 5AXCA 5H70A 4KFCA 1EB9A 3F90A 2DHEA 4J1SA 2M6RA 3L5KA 4ZVMA 2DLNA 2FR8A 4DJFC 3F4KA 3KWJA 1TO1E 4D8VA 4QOHA 1DUVG 3SEZA 5DF1A 4BGIA 4RE6A 2EP5A 1G18A 2SHKA 1NUSA 2QB5A 3B6ZA 1FEZA 3KQQA 3TKAA 3G9XA 4BFXA 3DZIA 4HAVA 4JVNA 4C4PA 3AVWA 1S9DA 3I6YA 2Z98A 3TJMA 4RTLA 1LPOA 3PTLA 1ZH2A 2FETA 5LJLA 1ACMA 4JBWA 5JWOA 4HPWA 3U1VA 3AFOA 3KC2A 4JODA 2Y1EA 3HFGA 1TCAA 3RFVA 3TR5A 3WMFA 2WTUA 1E7WA 1LF0A 1J0EA 1SC1A 3A1EA 3P0EA 4ZJUA 1MVLA 3GT7A 4BCDA 4YQEA 2FOIA 2IL1A 3F6RA 3NHKA 4XYEA 4NYMR 4N5LA 1IM2A 3C5EA 5E6RA 5EZYA 1E89A 1GN8A 1OGJA 4LIPD 4WFIA 4D6XA 1NYTA 1DAHA 1MO4A 4N49A 2PO7A 4B8YA 3QKSB 4CEIB 1Q19A 3L8FA 3QX3A 2O2ZA 3L82B 4J9UE 4G97A 1HDYA 1NW3A 1Z34A 5D01A 4F45A 2UUOA 3HGQA 1YBVA 1VIYA 5EUBA 1TKCA 4IDOA 3S2IA 3R7SA 3AFIA 3OM8A 4FN5A 2JFFA 3PGJA 1YL6A 1OAAA 2TS1A 4MVJE 4EPYA 5AW8A 3O5AA 3THXA 1VB3A 3EIWA 1T3LA 3EAGA 3ZPXA 5AVYA 5LKAA 4JL5A 3I2YX 3RC9A 3T7JA 4KGVA 4UHKA 1CT9A 1V0JA 2YYYA 4NONA 4OMDA 1F06A 3CH4B 3WDLA 2VT2A 1V3UA 3MJRA 5KNBD 2BM8A 3ZS9A 1L4MA 1ONBA 1ISGA 2PLWA 2EQAA 4D3ZA 4TQUS 2V1UA 1TVKA 1ZD2P 2QTMA 3CW9A 1EX7A 3HXPA 2OBFA 4BMZA 1IN4A 1TCUA 3ZVMA 3QU4A 3DPIA 3ZN2A 2VF7A 3HB4X 2HA0A 5JNWA 4WZBE 1DEKA 4U2KA 4CWAA 2Y1WA 3KEOA 5A5FA 5KWIA 3FVRA 3MXOA 5LZ5A 1JEDA 1HQCA 1M7HA 4HZUB 1Q83A 3AFHA 3AOEC 3WKAA 2IYPA 5EIWA 3BXXA 2J4FA 3U7EB 3CT4A 1G2IA 1NRWA 2IOYA 1B6TA 1HQDA 4L9WA 1R8SA 4O08A 4RF5A 3NEJA 2OO3A 1VFNA 1OW3B 3BRWD 3OD5A 4M7WA 4JKYA 4XEUA 4F9GA 5AVRA 1KS9A 1E63A 3OLXA 3RPEA 1XF9A 5KSZA 1E4EB 4Q0MA 2R8ZA 3DJFA 1OIXA 4MKFA 2IYTA 4BNFA 3ZW7A 3N2EA 3CF2A 4FBLA 2ZBFA 5DHPA 3SYTA 4TV9A 2PTHA 1U3FA 5J2UB 2PD4A 5K03A 1DMSA 4MQUA 3LBNA 4QYMA 3Q7EA 3PI6A 1DUIA 1LI7A 4DLYA 1U1DA 2XMRA 3HRIA 3HWSA 1D0SA 3QJ5A 5IANA 1E7YA 1C7FA 1RXVA 3ZJVA 5AUPB 1DTWB 4C03A 1PR2A 2X4DA 2X4IA 4CODB 5K8UA 1BRTA 4CV1A 4I5EA 5HM8A 3VI3B 1J5PA 3SYRA 5JY6A 3M82A 4BRWA 5JD5A 4WADA 1ZCBA 1RXCA 1XMSA 2O8BA 1W0KD 4KFUA 4HZIA 4OGWA 4Z6KA 1N1DA 3TJRA 5I7UA 5C1PA 5DVZA 2JNWA 1D2HA 4L4XA 4S1PA 4WINA 3OAAA 4M9UA 5FPHA 1F2VA 2AKEA 1MJFA 4Q4HA 5JMTA 1J4AA 1NJ1A 3DLIA 2JCVA 4YRLA 4Q02A 3WFIA 2EARA 4KN9S 1I9CA 3GWGA 2IP1A 2J6BA 2ZT5A 3IUYA 4NULA 4BKQA 2D0OB 3Q3IA 4R83A 3ZHRA 5KIAA 1IXRC 4RZHA 2OCDA 3FGPA 1WE2A 3H8WA 5LBTA 4AUKA 1QR2A 2JBAA 3U3MA 3CRW1 3S27A 4B6QA 3D54D 4CR6A 5FPQA 3ZGYA 1QH0A 2FAXA 2PYIA 4FI3F 4QUDA 4EFKA 1USKA 2ZJ1A 1VLZA 3W90A 4CCYB 4D56A 1RHKA 2CNLA 2X77A 3GFQA 1Z2AA 3PTZA 4DV1B 1Z4JA 3UHJA 2MMCA 4B82A 3RTEA 1RRCA 1E5DA 1EVZA 3QM1A 4E32A 2BHSA 3EIUA 2P2CA 1OXVA 1BDHA 2GZ2A 2NU6B 1U7WA 2WYVA 4G5XA 1WPXA 3HBJA 4TKLA 3COYA 2H1WA 2ZIFA 3IMGA 2PE5A 1Y6GA 3BTUA 3BDAA 4IO1A 4UHFA 2WG0A 3EMKA 3ESYA 3FF4A 3RUHA 2WYWA 3FVQA 3R40A 1C8KA 1DJMA 2O7VA 1JV2B 3FAZA 2P6RA 5I9IA 1PUJA 4UOZA 3RHZA 4E1AA 3OQ6A 1C7ZA 1FXSA 1O94A 4NX2A 4KQEA 4RM2A 4R8SA 4BMSA 2EFYA 2OUKA 3QHQA 4TKVA 1N6OA 4TSFA 4BN0A 4ZJZA 3H11A 3KRTA 1EM8B 3DL4A 3OE5A 2WMOB 3E27A 2CVHA 2PFGA 2W42A 4Z4EA 1CIPA 3EXFB 1H4TA 1MB2A 3OO1A 3LP5A 2NUAB 3N0RA 3RROA 2YFQA 2DJ5A 3R0JA 4A8JC 4ASUD 2QTWB 3G0DA 3T1NA 2NVOA 3GLIE 1IQUA 2GN6A 4KIGA 4URZR 1BXKA 2IHZA 3K5IA 1U9IC 4KQ2A 1SCUA 1TM4E 1H5UA 2L17A 1TEVA 1XXLA 1RHJA 5DM0A 2VJQA 5ALZA 5KQRA 4Y7DA 1JU9A 2R8RA 3E3AA 5F4ZA 3VH4A 3B6IA 3GLFB 2FPPA 3O26A 1WAMA 1H8HD 1FOEB 1LTQA 1UAGA 5BW8A 5ICSA 3PNBA 1VC2A 2GPAA 2YYZA 2F8SA 4ARCA 4GWKA 4WL0A 3ETNA 1S7CA 4M9CA 5E7QA 3UQYS 4ZYUA 3EXHA 4L9AA 1DE0A 3W5HA 4GH5A 5JD4A 2Q2VA 1HE5A 3FWZA 3B7PA 5K0ZA 4Q3BA 4ZQEA 3UHFA 1LDEA 4C3OB 1DKMA 1TADA 3HFJA 1VPDA 1YF3A 1EFPA 5GP1A 3WL8A 1NMSA 1PP4A 1TT7A 2WPDA 3ZWOA 4D42A 3GEDA 2HQOA 3KKPA 1EFHA 1MQ8B 4OP3A 3V2IA 4W8HA 5B1SA 1IUOA 1V8PA 2KYRA 4RK7A 4KQCA 4BNIA 4EHKA 1KP9A 4RVFA 3KSDO 4RH3A 4WGFA 1NBME 4XLTA 5KTSA 5IKXA 3SE0A 4BAUA 4OOEA 1UZLA 3N75A 4FFRA 3U4GA 1KKUA 2QM7A 3JATA 4K3VA 3P0JA 3HL0A 2UYGA 5KKAA 2Y93A 4R9NA 2P11A 2COUA 3TR6A 5ED0A 2FP4A 3V8PA 1UBGA 4TN5A 3ZK8A 2WLSA 1DIBA 1KY5A 2B0JA 2OGZA 3BRCA 4RZUA 5LA6B 4G1UC 4YDSA 1Z28A 3NC1C 1YB7A 2BHNA 3R7NA 2EG9A 2VUHB 4V03A 2QRUA 3L9XA 3REGA 5M29A 4OHXA 2NVBA 5SZIA 3UWDA 2ZSIA 1IHPA 2DFNA 1KVRA 3FRHA 4NMMA 3W5JA 1WV1A 3MOGA 1Y4DE 5C31A 1KI1A 2X22A 2XB9A 4B3HA 1NUHA 3NB0A 4BU0A 4CIVA 1U11A 4DC9A 3HV2A 4Z3KA 3HVKA 4MIKA 5F9HA 4GRDA 1ZJWA 3FFWA 5CVJA 3N8KA 3VPDA 2HU2A 1CNMA 1JDJA 1QIEA 1U0HC 3DWFA 2EGHA 2VLIA 1XRQA 3KOXA 1HL7A 1QZ3A 1G8SA 9MHTA 1ZJZA 1EZ4A 2J9FA 3GAMA 2VWHA 3NC4A 3EB9A 5ANRB 5TPWB 4DR2B 1NVBA 1OH6A 1HI9A 1NVGA 1MQ9A 1UEIA 2VNJA 3F6CA 3LCUA 3ONVA 3OT1B 5TT0A 3KIPA 1C3XA 1A9TA 1Q95A 3C0KA 4KKVA 4ODIA 4WQMA 5ERGB 4MYSA 3SYNA 3VR4D 1SQFA 1BGXT 2MT9A 4EVIA 1U2DC 4GGMX 3I32A 3OTHA 3HEBA 2DULA 3KR1A 1D9XA 4EHAA 2VPQA 4OTZA 3KJQA 2REOA 2YVAA 4FMCF 2L19A 2YYSA 4ZT3A 3D3QA 4D6YA 4R5HA 5B7GA 5I7RA 5FBKA 3V00A 3UPTA 1PR4A 1V16A 4IDDA 3MSXA 4TLMB 4C0HA 3TO5A 4GPIB 4QDJA 3L0YA 4GZ5A 4YNBA 4YJ2A 2XMSA 4I9FA 4YR7A 3W9SA 2VHWA 3DXFA 4A8JB 1FF9A 1IHOA 4WLOA 3VOAA 2I6GA 3NS7A 4B1FA 1CRQA 1WB6A 1V1RB 2IGBA 1VPLA 1XTTA 2R65A 3HV0A 3N39C 4NFLA 4QDXA 4IDPA 1J09A 3MBOA 4X1KA 4X84A 4XLLA 2IH4A 4KPFC 4MJ3A 5DT2A 1BWPA 4QG7A 1FL9A 1GNSA 1QZZA 2IBMA 3B3JA 2OGUA 4PE5B 3K15A 3PBKA 4TPKA 1JX6A 4QUHA 4YJGA 5BSVA 3VKGA 4WPGA 3OURA 1UBTS 1YI0A 4WD3A 3PGA1 2WLTA 4DDVA 1NR1A 3JQRA 2DUWA 1S2MA 2W83A 5IT9A 1QQ7A 1F14A 2BBTA 1V35A 2BZSA 4HYEA 3AR6A 1AF4A 4BU1A 3HMQA 3RBXA 2VT3A 3ZTTA 3P9RA 4O25A 4A2WA 4RGVA 4DA9A 3HDQA 2Z8XA 4L0CA 3V7NA 2FVYA 4OJTA 4IMJB 1Q14A 3ZDRA 2GASA 3A1SA 1PYDA 3JQQA 2PH1A 4GPTA 2XADA 3VPBA 4IL5A 2P9JA 3EWNA 3QELA 2QTHA 4G4SO 2WDZA 1WXWA 4GI1A 1G20A 4YDHB 3DWEX 1W75A 2X40A 4OB7A 4L72A 4D79A 3WK6A 1J49A 2VRCA 1QGUA 3NNDA 1P9LA 4B0PA 1DWOA 1PZGA 1J2UA 3BSYA 4GKVA 5J40A 5A5DA 5IT4A 4PX3A 2DT5A 1AUXA 2QGZA 3DBHB 1PUIA 3CX3A 4MJXA 2D1FA 2PKQO 3CLRC 2ZJ5A 2IIBA 4MKGA 3P4UA 1W48A 1U3CA 4NV3A 4RIGA 4XVHA 5SYNA 1KOLA 5LQCA 3KYBA 4X6XA 2G08A 5L3SA 3TLBA 3AZQA 3AGPA 2IEZA 4I6EA 4BOYA 1HDCA 4YAFA 4ZOQI 2NOAA 3AY0A 5KNDD 2A57A 3ZWYA 3PUIA 3BCSA 1KO8A 5EJ8A 1FNDA 1J2JA 1L7OA 2FLKA 2J09A 1OU0A 2Q0SA 2QT0A 3DD5A 2F1KA 3K0EA 4RW0A 3R8XA 3N3AC 3TNJA 5I3ZA 4MPPA 3EY9A 3FFBA 4I99A 1U7HA 3EPKA 3RI3A 1ZUNB 2BKLA 2IUYA 1Q0UA 4FQ5A 4S3MA 1LQ2A 4YQZA 1LPSA 2QAGA 4Q82A 2NUPB 3NWJA 5KDLA 1GGKA 2IXEA 1KO7A 1WXFA 3UK0A 2OCAA 2RDMA 4G67A 5B1DA 4WZZA 1ZWKA 3WGYA 3IALA 2JBHA 1U2QA 3ET5A 4HNRA 3VR1A 3DE0X 5LLSA 1GZDA 2CZGA 2FZGA 2OZPA 3EG9B 1RJ9A 4JP3A 1KNXA 4KXMA 4LXGA 4LY0A 2PX0A 4BASA 3PDCA 4LYFA 4O63O 5K0JA 1TEXA 4HLUC 4R1LA 2OC9A 4W1QA 5K1ZA 4WK6A 5B36A 1SUEA 3RJMA 4PSDA 4R2IA 1A71A 4E70A 3EMVA 1AKEA 3ZYCA 2XMDA 3W1EA 3GR6A 2QNBA 1K8YB 2OD9A 1YCHA 2OXIA 1MIOB 2BUCA 3KVOA 4FLMA 5EXSA 5FTMA 1LTKA 2D8AA 2BAGA 3H9EO 1PTJA 5JRDS 5LQRA 1H6CA 4TS1A 1W5SA 4KE7A 5ELXA 4IOMA 4OSPA 5FV7A 1CBUA 1E0JA 4ITRC 3A4NA 2ZRAA 3IOBA 521PA 2P9BA 2QRVB 3QWBA 1EH5A 4P54A 2Z6QA 1WXQA 3TZHA 4C6TA 2PFKA 2PX6A 5EWMB 4PW0A 1LNZA 4FIDA 1IY8A 4KQ1A 3PIDA 4IZIA 1O58A 3DC7A 3K4HA 4IDHA 3EWIA 1Z4MA 1TYCA 4NFYA 3AERB 5KJEA 4CMGA 1KTIA 2QQ5A 1E1LA 1MO5A 2X7JA 5GOTA 3L01A 5K6AC 1XAIA 2FGKA 3QOWA 1YKFA 2Q21A 2ZAMA 2KI5A 2C2BA 2VJOA 3ENVA 3DVLA 3RBAA 2MDTA 3KYJB 2Z5FA 1KJNA 2MSKA 4RD2A 4BLWA 5TMPA 3UAYA 3IIJA 1QVWA 2HBZA 2H06A 4X1IA 4R7GA 5FBHA 2BI8A 5FUMA 4C3UA 3CNHA 3ETDA 4QT0A 3DTTA 2VP4A 3OX3A 3IP3A 3ER6A 2CFCA 2ZKLA 3GPDG 4Q9NA 1QQ5A 2J08A 1ISHA 1XK7A 1QFYA 1K92A 5C32A 3I5XA 4XH9B 1M0TA 1YASA 1JG3A 2OUIA 1EK0A 3D81A 3NHYA 3OJFA 4EA6A 3O8RA 4ZTZB 4UZFA 5CA1A 2X1HA 1OC2A 1Z2NX 1WSWA 2R6R1 5CT8A 1N8SA 1XDSA 4PVCA 3A6DA 1ATIA 4V0MA 4DIEA 1WZNA 4MWDA 3W5IA 1KJQA 1N6PA 4G1BA 2FSSA 2XHZA 2V59A 2VPYA 3OH8A 3PFHA 3QG5A 4TV8B 5EZ6B 3L4BA 3W05A 4F4FA 4FFLA 1YZKA 5LUAA 3MGKA 3V8NA 5DYYA 1C80A 4GQAA 4S12A 1OT5A 2C31A 4CQMA 3W6UA 4WKBA 5I7SA 4PZ9A 1UQUA 3IC5A 3STYA 4DLUA 1D1SA 1UKEA 4LI3X 4UUBA 4A82A 3CW2A 2Y1OA 4CTMA 5CYFA 2W6IA 1E6EA 3DFFA 4D9JA 4AQDA 1XFDA 5J1SB 3M6UA 1LBSA 3PWSA 3ZE2B 1YDWA 2HU8A 2IZ7A 4YT4A 2GM3A 2FMTA 2Z1DA 2FI1A 3SGLA 1OZFA 3WLAA 1WVIA 4RTSA 5EI5A 5C8VA 4V0OA 2DWPA 2OBLA 4KVFA 4G36A 3W7BA 3R3UA 4N12A 3EAFA 3HB0A 1H05A 1XEXB 3D2AA 1ZRHA 3L77A 2MSNA 4N0MA 3RASA 1OQAA 1VDMA 1XZFA 2P62A 1HKUA 3B6KA 4ZWNA 1NVTA 3RIEA 1GEGA 1S3SA 3IEPA 1EFLA 4QM7A 4LCBA 2B21A 2RGYA 4M0UA 3FPGA 4PYLA 4Q4CA 2UZ1B 3N70A 3N8HA 2R8OA 4JMPA 4JJ4A 4NF2A 1QTQA 1VYUA 4HDNA 3RWOA 2Z95A 2XWPA 1FMJA 3FYDA 3W8RA 2ET6A 4IJMA 2YDYA 3VJKA 1WVMA 3OOJA 4D26A 1CZHA 1D2GA 1FVFA 1Z4NA 2FE1A 2YV3A 3KKLA 4U3JB 3PVZA 2DQSA 3QY0A 4RK0A 5NULA 4TYNA 1PYOA 2IPNA 2GRJA 3PC8A 4C4XA 3HU5A 1VE3A 4HYYA 4P58A 5FL7D 2OYSA 4XJSA 1GTVA 2D2IA 1OXTA 1KU6A 1ZH0A 1R0ZA 1YBMA 5ESXA 2LWIA 3H1EA 3RS9A 1VLMA 2H2WA 1A7AA 3H97A 2I1LA 2R96A 3EOAI 1Q84A 3G85A 3HXLA 4QQNA 1YFZA 4HSGA 1GU1A 4R31A 4BFUA 4NZMA 1C3VA 2PS1A 2P7IA 1QDLB 3G2NA 5B1EA 3DXXA 5J4VA 2CXNA 5EHXA 4CEHA 1WDKA 4PCAA 1ZIYA 5A05A 3FYTA 1YR8A 2CNWD 1PFVA 3O4FA 3HCWA 4QHYA 3WQBA 4AZTA 3ZCUA 4LYHA 4BQOA 3LPNA 2AF3C 3PFIA 1UMCA 4QGGA 2I3DA 5FLYA 3PT5A 4M1QA 1T9HA 5T8KA 5KO2A 1Y1SA 3MWGA 1CJVC 1JHZA 1I5EA 2HHCA 2Y92A 3E9CA 3QEKA 4WNCA 3EGIA 4UXIA 5H0IA 4D4JA 4Y7CA 3WTCA 3HDYA 5CBPA 3ITEA 4CLXA 3NHAA 4U7HA 4MV7A 3E8MA 1N2OA 2PY6A 5HF9A 3PGVA 4GEGA 4HAWA 2PS0A 4ND8A 1QQ6A 3BE6A 4MKIA 1IQ0A 1XF1A 2BFMA 1L4UA 2RGWA 2YIJA 4OLHA 2V58A 4CLOB 3BMOB 5HE8A 2XF8A 1P7WA 1EDZA 3CB4A 3DAFA 2V4UA 3HP1A 2QTFA 3NX4A 4QDOA 4F4JA 1CB7A 5IFKA 2X9GA 3PRYA 4MTCA 2H1RA 4ENVA 3OTOB 4GOLD 2ESRA 2H00A 5FBRB 1J0BA 3LFUA 1AGYA 3V4LA 2QK4A 4YPOA 5I7WA 2AL7A 5I3CA 1IUNA 1SU8A 1XYVA 5CR9A 3G7NA 4HVCA 1YB6A 4RYDA 5BQ3A 2PTGA 2BRUA 4G41A 5HJEA 2VQ3A 4EHLA 2AE1A 2PT7A 5ITSA 1SIBE 2AX3A 3UENA 1N32B 1PFKA 1VHQA 1A98A 3G5AA 4BBJA 3BX1A 3RF7A 1WWKA 2J3MA 2WHRA 3X1XA 2J48A 5EJEA 1T8RA 4QJ4A 2Z2KA 3F3KA 2VDRB 3AEXA 3PEWA 3E9MA 4DHEA 2AEFA 4LOJA 4O4LA 2WA1A 4Z99A 2I91A 3QK7A 1WCXA 1DAMA 2D4HA 3C7DB 2RB5A 1JU4A 1E2EA 3O94A 1YRYE 2WM2A 2ZIVB 4NV1A 1ISFA 1DJQA 2EATA 2Q28A 3NG1A 3F9IA 4N18A 1EU1A 1I4LD 3HP7A 1JXOA 3SHTA 3TXXA 1A9XB 1UBKS 3CLRD 4QXOA 3T0GA 1EAMA 4FKZA 1BQ4A 3GRYA 1ZJ6A 3BD6A 3W5AA 3TQOA 1WQ4A 1QYIA 2JJQA 3HYSA 4I2NA 4GZLA 3JWGA 8GPBA 5K3CA 4DXHA 1VE6A 2WWRA 4GZMA 1I0LA 5FOUA 5CNJA 3GUCA 4J1TA 1DNPA 1X1RA 1QO0D 3A6LA 4XFKA 2M6LA 4KDEA 1SK8A 5H4HA 3ZTWA 4M86A 2MMGA 2BPOA 4OXQA 3PSAA 3UV3A 3SC2A 3RC3A 2MYTA 1E9CA 2R6DA 4XQ0A 3AW8A 2IYXA 4PG8A 2B20A 1DOZA 2IP4A 2JFVA 5A5GA 3W8DA 1DO8A 2JGMA 2R79A 2LPMA 1P4GA 2YRWA 4ZAXA 3SIPA 4CKBA 4DVJA 1WEHA 4F4UA 5JXIA 3UC5A 4MW1A 5ARBA 1G7CA 3CH6A 4ETNA 4FMBB 1T3SA 1WHSB 5BR1A 3GLFE 1ZGHA 2DT8A 4L5CA 1TA4A 1HWYA 1ENYA 1T5TA 1ZM3A 4HB2A 3BWDD 3ROZA 5K2MA 1DC6A 4JQSA 5KVVA 1TJNA 3VR3D 3FYHA 1E5QA 2J33A 1KZ7B 2R7KA 3LO5A 5IMBA 1USIA 2D0IA 3BGOS 5GIOE 3MW8A 1S2DA 2ARKA 2XE4A 5JWHA 4R2HA 3OWHA 4LGMA 3GDOA 2CJXA 2OMKA 5FT9A 5BOSA 2QWXA 2W43A 2C8VA 3AEQA 3TLCA 4N9QA 1ENOA 4KMSA 1Y8QA 1GR1A 2WIKA 3U0BA 1E2MA 5FFNA 3T7DA 1XRPA 3SBXA 5LYYA 1NUUA 1C5KA 4RD1A 5K3BA 1B3BA 3WGOA 2FWIA 5ENDA 2G28A 3C1AA 2QOEA 4TMTA 1W52X 2QPLA 1Y98A 1AUPA 2BFFB 1LWOA 5AK4A 2XUZA 3FCAA 4IHAA 4JL6A 1WL8A 4YJFB 1FIUA 5KCMA 1TYBE 2I8CA 1DGQA 1M0SA 3MTEA 5DCLA 2QV0A 1PJRA 2H3HA 2IODA 4W6QA 1A2BA 2EQ5A 3KKKA 2O2GA 3FW1A 3SVLA 1VTKA 3BJRA 4MWZA 3Q3VA 4DBZA 2FW9A 1G5RA 3QENA 3CRVA 1MXHA 2GD2A 2I2XB 1X8LA 2ZQ5A 1L4HA 3A1TA 2QNIA 4MW4A 3AEUA 1G5FA 2FWJA 3CNEA 3RCBA 2TYSB 4JSRA 4D2IA 1XZHA 2CYAA 3C6BA 3Q40A 2B9VA 3L4KA 1XYGA 3E7PA 3NKFA 4HHEA 3CVYA 5ABPA 2R6CA 5H9VA 5JADA 1K7FB 1UXKA 3PQDA 2C0PA 1VXOA 3BK1A 1UM8A 1R18A 2QR3A 5EYPB 3SM3A 4AD8A 4EPWA 3ASZA 1DRWA 4NE2A 1RE0A 5DHQA 3U60B 2JJ1A 1A7KA 4YUWA 1CUDA 3DVAB 1Q0QA 1NURA 1PFGA 2J3EA 2YY5A 5ITZB 2UUCB 1QGED 1N0WA 3QZUA 5CW2A 2V9CA 1Z18A 4ENWA 1ODJA 1NFFA 2FRVA 3O03A 1HZZC 4ERNA 1U9JA 1VLHA 1FXWA 1KNQA 1JJ7A 2VDNB 1KFBB 4Y0VA 2G1JA 5FUBA 3NT5A 1CY0A 1JAZA 4L7QA 4UDNA 4EG4A 1C3EA 4RDXA 2FWPA 4ZVPA 3GT0A 4G25A 4DDKA 2H3EA 1J33A 1D6SA 1UBLS 4QWWA 5TR9A 1YVUA 4TQ9A 2B1JA 5AVSA 3Q8LA 3RVQA 3MNFA 1KGDA 2NZ8A 2X76A 1BW9B 2G9UA 1BJKA 3ABSB 3ZZ0A 3EMBA 5D5HA 3U7QB 1ABFA 1G16A 3DVRX 3LQ2A 3E0QA 1HDEA 4A27A 1VIVA 1YQ9A 4BPBA 4OI0A 1QRUA 1Q0SA 3UMJA 4D3XA 4CRWB 1MJ5A 5FL3A 2VDWB 4M1YA 1YL7A 1BVRA 2VHEA 4Y2QA 4ZCPA 5H3CA 1Z4OA 3DUFB 1IN1A 4PLCA 4RLHA 3CTMA 5JSYA 5CA0F 1VZ3A 5B1HA 3C3XA 1NQ5A 2QRMA 3HI6A 3JS5A 1N8TA 2A0YA 1WW2A 3NJ8A 4FEAA 4HRAA 4TWIA 4JXXA 3VNVA 1R0XA 2HV8A 4YFYA 1DIGA 1B0UA 1NOIA 2CFIA 4K9RA 1LLDA 4FX2A 5D3KA 4P7JA 1INLA 4L22A 5DCUA 2X0IA 1D8TA 1ODFA 1GDHA 1H65A 2PX3A 1WUHS 2XVXA 3IH5A 1JHOA 2VDJA 3G5MA 4UOEA 3JQBA 3TNFA 1JE0A 3MINB 4XFDA 1DBPA 3AEYA 3KYCB 3OTGA 4MR9A 1Y6QA 4ZI7A 3RHSA 1JIVA 2R8PA 1NLFA 3TZCA 2O8CB 4BNNA 3AUUA 4NNPA 1PHRA 2F55A 3N59A 3PNMA 5DBIA 1X7HA 3RTDA 4NCIA 4RHUA 1DKRA 1UKBA 2DAPA 2VK4A 4UFPA 3FFXA 4TT3A 1NJ5A 1ZITA 4J0IA 4OBBA 2FU5C 2BGGA 1EUDA 1COWD 1KJJA 5H16A 1JIIA 3WJAA 5BWMA 1QRSA 2WF9A 1YUNA 2JKYA 2HCFA 4GEKA 4J0EA 4C4OA 4Y98A 4ZAVA 1ODIA 2XITA 3DP9A 3NHMA 1N3YA 1VGRA 3B12A 3H1BA 3L04A 4O4IA 4RXUA 3ZY6A 4H7FA 1KYWA 4GGOA 1Z6AA 2Q5JA 3ZZ1A 5IZCA 4ZVRA 3S8YA 2D7CA 1OBFO 3QUCA 4RE5A 4BFTA 2R1UA 5A1JA 1THGA 2R85A 3W2HA 1W19A 1YB2A 2C4HA 4PY2A 4MX8A 2FOLA 3E9NA 2GBLA 1NUPA 1ADFA 3BH6A 4ZHQB 2BMVA 2EKQA 5JZVA 4Z9AA 3ZLBA 3EVAA 3B60A 4GUDA 2PGIA 3FSRA 3ONNA 4F3NA 4W82A 4TT8A 3KB2A 5DRYA 4AMUA 5DWVA 1QS0A 5K3FB 2FHSA 1SKUA 3VGPA 3WKCA 1KPHA 1LSUA 5F64A 4PYJA 4R3WA 1QH8B 6YASA 1E3QA 2DBYA 1X7ZA 1QHEA 1XJ0A 2EJTA 2X9LA 1KGSA 4II7A 5GONB 1DC7A 3TUZC 2WD7B 1Q5PA 3TRJA 3AIMA 3K0CA 3GV0A 1L5SA 3ICCA 3KUCA 4X62B 1VLLA 4JYZA 1CVRA 4FHEA 4IIJF 1H2ZA 3EJWA 1F2DA 1ST2A 5F5LA 5PGMA 1EP3B 1X14A 3GLHB 4YRTA 4C6RA 4XQEA 4F3KA 3WWDA 3ETHA 4MQMA 2HHLA 1G9TA 1ZM9A 4LDPA 1Y89A 4FMDB 1G8PA 3GCZA 4WMLA 2QJOA 1EUCA 3N8NA 3S1AB 5KYKA 4S0XA 3H5AA 2F64A 2GTIA 1OXUA 4ZCSA 3UK7A 4RTNA 2IVZA 1Z4PX 4YXWD 3HU3A 3OEHD 1SRQA 1ZVJA 1XC7A 2JLAA 1UXIA 2H0QA 3C3BA 2JL1A 3EH1A 4RNDB 4BQIA 2GEJA 4KACA 5HJ2A 1N0HA 3WGZA 2ZRFA 4X9XA 2BGTA 3LFTA 4G8JA 1FU7A 2PRYA 4C7OB 1B2RA 1H22A 1YUBA 2NYVA 3DTVA 2ZJ2A 5A9RA 3E1GA 4W99A 1W8DA 2VSFA 2WAOA 3L07A 4N7RA 2F6RA 4EYGA 1UOOA 1VKOA 2ZRLA 3LGAA 5BV8A 3EEQA 3C70A 3WA7A 3OE4A 3UK1A 2O07A 2FPKA 1FDUA 3NTRA 3T41A 4LZZA 2QQGA 3X1WA 3UOWA 4QOIA 3GAZA 4MGZR 3GZJA 3FDIA 2I80A 5EJ4A 2YFKA 1T0BA 2CHGA 2PSHA 4AJ2A 4AKSA 5C1OA 1TZKA 1XJCA 4FX5A 5AM0A 2BJWA 1NJ8A 2HJRA 3DLTA 3E3NA 4ZN6A 2VNAA 3FNRA 4GWLA 4HXYA 4PS1A 2PPLA 1M6EX 2Z04A 5ERYA 3WQSB 3OE7D 1RQ7A 1T9BA 3I5AA 4MWSA 2AMVA 4CHGA 2WU0A 4JEHA 4N0DA 3N6XA 5H3LA 1NTRA 1UBJS 5U4XA 4R1NA 1GGMA 1V3VA 4XRRA 1ZJJA 2EJVA 4A6PA 5FD8A 1XMOB 2ATXA 2TMKA 4CKCA 1I3MA 2H9YA 2H2AA 3GARA 1Z6XA 2EJCA 4ZYYA 3LQFA 2QL7A 4HV4A 3NH9A 5HMMA 4IG9A 3FYUA 4FHCA 4LXTA 4RO0A 1LPPA 5T4FA 4OU4A 2ORIA 5BN1A 5DZSA 3TRKA 3B6JA 3K5WA 1E58A 4CQLA 3F2VA 4KR7A 4ER6A 5DKFA 5MGNA 4BWYA 1CR6A 2Z1MA 3N2LA 4RVDA 5T5QA 3EVNA 1IIBA 2D06A 3KTFA 3GA0A 1QE5A 2HT6A 1ZS9A 1QFMA 1T13A 3JQEA 4LQLA 1DBIA 4Y2VA 2ZKIA 2PH3A 2BONA 3T12A 1EP1B 4TYQA 3D43A 1K98A 2QRPA 5FWNA 1OWLA 2O2EA 4OM8A 1F0KA 1H2FA 3OX4A 4O0MA 4YMHA 2JHGA 5KX5A 3PUXA 3BG5A 4OBXA 4BUCA 1WTCA 2OLKA 4KXLA 3T35A 1JWBB 3AC0A 1DCFA 1T6BY 3A14A 1B73A 3MGCA 1HDZA 3C4VA 2QMEA 1NSTA 4D3YA 5KYNA 1GTSA 3B1YA 1JLMA 4DCUA 4MQLA 4X7BA 4RF3A 1R16A 3D5QA 4C14A 3VYUB 4EI2A 4OKNA 3O8DA 2Y4OA 2FWAA 1VG0B 1VI5A 1N1GA 3RDPA 4BJ6A 2E1RA 4KXYA 1Z6QA 2Y99A 1Z07A 1GPYA 4ER5A 3QXCA 5H81A 5GGXA 1NV9A 4NCHA 4QVKA 2D1RA 3IO5A 3MMSA 4F71A 1MIHA 1OX6A 1A50B 2BI4A 4UASA 4B3GA 4IDGA 1SUFA 1NQVA 2PWPA 4FXOA 4OJKA 2BEWA 5ALJA 2LRHA 1V7ZA 4C06A 2OSBA 4F3RA 4BBPA 1L6IA 5FO0A 3E82A 3AYXB 6Q21A 4JYCA 4LOKA 5DH9A 2WSIA 3C7AA 3LTEA 4JBYA 3USZA 4NCKA 5E3HA 4GQIA 4EVSA 1YAJA 5KYUA 3DO6A 1GSAA 1OLSA 4LF6B 1Z5NA 2XWJI 4X8OA 5JE8A 5JNVA 2ZYWX 4QWMA 4KK4A 3OTQA 4RLSA 4BNYA 1XZPA 4OI1A 3AKEA 3PJEA 1AUQA 5BMVF 1K4MA 2OBYA 1Y4UA 3WC4A 1BFDA 1PWYE 2OCIA 3HN2A 1YRHA 1NHGA 1XMQB 4KHZA 2I33A 2YWEA 2JATA 3OPYA 1SELA 4HQOA 4IHJB 3OOSA 1JG1A 3LNTA 1XRNA 3BICA 5BNIA 1Z0FA 4M1SA 4ZIRB 1N5RA 3C2QA 1RYMA 4GR9A 4MUNA 4WA8A 3VPHA 3HJUA 4CMIA 1H8ED 3TDNA 1KDPA 4J2TA 3FTFA 5BWOA 4BO8A 1MZPA 2FN9A 2D1SA 4MUBA 4GMHA 4XJXA 1WOMA 4C30A 1VBKA 3TLZA 1P2TA 1YU6A 4XPIB