1RFGE

Crystal structure of human purine nucleoside phosphorylase complexed with guanosine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
288
structure length
288
Chain Sequence
b'ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structure of human PNP complexed with ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rfgE00
4M1EA 4NS1A 1V45E 1ODKA 4WKBA 4WKNA 5IFKA 5F73A 2B94A 1Z34A 2QDKA 4RJ2A 1U1EA 2Q7OE 1K9SA 1N3IA 1TGYA 1V48A 1PR4A 1Z39A 1T8SA 1Z33A 5CXQA 4F2WA 4TYMA 4YMLA 3PNSA 3IEXA 1B8OA 1TD1A 1JDVA 5F7XA 3OOHA 4U2KA 2QPLA 1CB0A 1SJ9A 1PR2A 5IU6A 4OF4A 5CYFA 4D8VA 4WKOA 4WKCA 4DANA 4YO8A 1A9PA 4OGKA 5KB3A 4L5AA 4UC0A 2H8GA 4H1TA 1ULBA 5F7OA 3PHBE 1ZOSA 1Y1TA 4K6OA 5CCEA 1T0UA 4BMXA 1K27A 1Q1GA 1SD1A 4D8XA 1LV8A 1PR1A 3NBQA 1B8NA 2OC9A 3KUKA 2AI3A 3BJEA 3ONVA 4F3KA 5EUBA 1RSZA 2OC4A 4OEHA 3P0FA 1PR6A 2A8YA 1Y1QA 1T8WA 1T8YA 1U1CA 1ECPA 3K8OE 2HSWA 1V4NA 4QARA 2OECA 3UAXA 4QAQA 4OJTA 3UAYA 3KU4A 1YR3A 4TS3A 3OZBA 3O6VA 4X24A 4BMZA 3K8QA 4P54A 4BN0A 1RFGE 3ENZA 4TXJA 3INYA 4EARA 1RCTE 1YQUA 4KN5A 4GKAA 2A0YA 2P4SA 3E0QA 5C80A 1G2OA 4GMHA 3DP9A 3DPSA 1WTAA 1LX7A 1NC1A 4TS9A 1A9OA 3PNPA 2QTGA 4LNHA 4QFBA 4TXNA 3NM5A 5DK6A 1K3FA 1U1FA 4WKPA 3OF3A 1PBNA 4ECEA 4QATA 1A9QA 3FOWA 4NY1A 4DABA 1C3XA 1RXYA 3UT6A 1Z38A 3LBAA 4L6IA 4L0MA 2AC7A 3KHSA 3OZCA 1OU4A 1JDTA 1FXUA 1PKEA 4DA7A 4R2XA 1JDUA 1TGVA 3U40A 3EMVA 1RYZA 4I2VA 1OVGA 4DARA 3DF9A 3ODGA 1Z35A 3FWPA 3C74A 4YJKA 3BGSA 1V3QE 4DA8A 5F78A 5FAKA 1JPVA 5B7GA 1A9TA 1OV6A 3FB1A 4TXMA 4G41A 4E1VA 2PGAA 1PK9A 4L5CA 4TXLA 3NM4A 3EEIA 1YRYE 3EUEA 3PHCA 1SD2A 1XE3A 4EB8A 3FUCA 5JPCA 1Z36A 1A69A 1RXUA 1U1GA 1YBFA 3E9RA 3BL6A 1JE0A 4OGLA 4DA6A 1Z5PA 4BMYA 1NW4A 5F7ZA 3BSFA 5I3CA 4TTJA 3OZDA 1YQQA 2BSXA 1TCVA 4PR3A 1T8RA 4TTAA 3OZEA 4FFSA 3DDOA 4LNAA 3EUFA 3D1VA 1PR0A 2HN9A 1ODJA 3E9ZA 3QPBA 2AI2A 4F2PA 3LGSA 4OY3A 2OXFA 4QEZA 1RXSA 4YNBA 4NSNA 1ULAA 4DA0A 4R31A 2A0XA 3KVVA 1JYSA 1RR6A 1Z5OA 4R2WA 2GUWA 4JWTA 4MCIA 3TL6A 1VFNA 1A9SA 1JDSA 1ODIA 1ZL2A 3GB9A 4D8YA 1Y1RA 2QSUA 1QE5A 2I8AA 4JOSA 1PK7A 1PWYE 1VHWA 2HWUA 3OPVA 3KVRA 1VHJA 1A9RA 4G89A 4M7WA 4D98A 1Y6QA 1V2HE 2IQ5A 3KVYA 4LKRA 1OTXA 4LZWA 5B7PA 4IP0A 1PF7E 1Z5NA 1TCUA 4F1WA 4DAEA 3O4VA 1PW7A 4F3CA 1RT9A 2XRFA 1LVUA 4D9HA 4LDNA 5CYGA 3P0EA 3IOMA 1M73E 3LA8A 1RXCA 5EPUA 5CCDA 3UAZA 1ODLA 1SQ6A 3UAVA 1Z37A 4PNPA 1Y6RA 2AI1A 3GGSA 1JDZA 4DAOA 3MMSA 1VMKA 2QTTA 3SCZA 5B7NA 5EFOA 3F8WA 4JP5A 2ON6A 2ISCA 4TTIA 1V41E 1OUMA 3OCCA 1PR5A 4M3NA 4G8JA 5K1ZA 4GLJA 5CXSA 3T94A 2A0WA 4QASA 1I80A 5F77A 3OOEA 1NC3A 5ETJA 1U1DA 3FNQA 4GLFA 1CG6A 5B7QA 4MCHA 3DJFA 4TXHA 1Y1SA 2I4TA 2HRDA 2RJ3A 1OTYA 4MARA 4L5YA 5F76A 1JE1A 3MB8A 5F7JA 1JP7A 3UAWA 3NM6B 3FAZA
chains in the Genus database with same CATH superfamily
1FFXB 4G8CA 2XWSA 3IUJA 4J0FA 4NF2A 3UQZA 3EJWA 1JG3A 1SXJA 5K20A 3C1UA 1KC1A 2XOXA 3FDXA 4BVEA 3TLBA 3KOXA 4YMVA 5BSEA 1DAGA 2CK3D 1WCV1 1SU7A 2D00A 2ZBRA 3CKLA 3CUUA 3MYRA 5SY4A 2IPNA 4IIVA 1C14A 4CIDA 5ELMA 4G0NA 5LB2A 4DR7B 1YAJA 3LDHA 3U7IA 5K6TA 2FEAA 2QDKA 3QOWA 4DFDA 1P6QA 1HLGA 3NHYA 5CYPA 3UWKA 5JWRA 5A5FA 5CGZA 1K2WA 3M1IA 3L8HA 4P38A 3JS5A 1TECE 4ZK6A 4R1TA 1A0OA 4LJAA 1ZZEA 2NG1A 4JI7B 2ID4A 1Z6TA 5I7VA 2WMOB 3RSQA 1VI6A 3PBKA 2QW1A 3ENKA 1D6MA 3BIOA 3LM8A 5BT8A 1UZMA 3L7KA 1Y1LA 3WGMA 3UJ6A 5KNCD 1Q1EA 2PH1A 3H7IA 1ZH0A 2R8YA 4R9RA 1QCDA 1SA0A 3HBFA 3IOBA 3C0KA 4GVLA 4K7JA 4YCSA 2G67A 4UUQA 5DM4A 2EGGA 3JSXA 1XT6A 2VPPA 3CLUC 2JIMA 3HO8A 2QRMA 2YICA 4C0SA 4DBZA 4L8VA 2BFCB 2BY4A 1K3UB 2JCBA 4FIZA 3K0SA 1DPFA 3DV2A 2AEEA 2YVLA 3KAPA 5BT9A 1KEUA 1P7ZA 2I5PO 1DELA 2J3QA 4MVJP 2OP0A 3FGPA 1XZHA 4XQCA 4CPDA 4YGXB 5JMOA 2Y1KA 2XXAA 5EWJA 1A9PA 4P08A 3K9BA 5FWNA 1MZVA 4PQGA 2HDOA 4RKRA 3CISA 2ZI5A 5BV8A 5GINE 3PHBE 3LHKA 3VPAA 1PT7A 1HETA 4RPIA 3LC1O 4RKYA 1GRCA 4QOEA 3ZVMA 4ERXA 5DM60 3HZRA 3OQHA 4JX8A 4EVSA 1G17A 1LV8A 3LXXA 3E9QA 5CA1F 1MBZA 1EUDA 2Q0SA 1YHYA 4G5YA 1IHOA 1P17A 4I4NA 4CG1A 2P9CA 1DC6A 5C5EA 2AI3A 4RAQA 4EO4A 3JPYA 4Z7QB 3RTEA 3QX3A 1MRZA 2Z30A 3N58A 1TADA 4MS4A 4BY9E 3I9KA 5BR7A 1U2TA 2V0NA 3ABRB 2F1OA 4I55F 5JSKA 5EUBA 2W8ZA 3WLQA 3LECA 4JT4A 4OLJA 3P9CA 4RLHA 4EA7A 3WLRA 2QY6A 2AFIB 1XZDA 2PZMA 1U2DC 1NF2A 2DLDA 1AK2A 3K6KA 2YC2C 3H04A 3FNRA 4I50F 3RHSA 4BMPB 1EUQA 2CLKB 2W2KB 4LF6B 2WF7A 5F1KA 1UT6A 4FMCB 1DG1G 1EFKA 1R9JA 1WZCA 4MQUA 1LK5A 4N47A 3CVWA 4JXJA 3P19A 3VSEA 3GLGA 5C8DA 4FE4A 4WADA 1AMOA 4NG5A 1XN1A 2FDXA 1AUQA 3I92A 2EATA 4IKOA 4O8CA 4OKSA 1OLUA 3U4QB 1DFHA 4Y0VA 5E6UA 1FTYA 2VHVA 2XB4A 1XRQA 3KWJA 1KEWA 3I0MA 1GVHA 5F35A 4MV8A 1ZI6A 3GBPA 2Z9CA 4A6XA 1EP9A 5IH3A 3OUTA 1BXRA 5D8DA 5KC9A 4TMTA 5JCOC 2CNWD 2YYYA 3V4FA 4ZAXA 1HSOA 3UMJA 1QYWA 4GS5A 3HMKA 3SD7A 1VL2A 1U8AA 3H7AA 1LBSA 4E6EA 4IOKA 3GXOA 2BDUA 4OCZA 1E2JA 3MLBA 2GCOA 3NFRA 4QE3A 3IFSA 4BMCA 3FAKA 4FI3C 1VSVA 2EQAA 2OGSA 3N8IA 1U7HA 2HJVA 4IIYA 2VAMA 3F6YA 5H7XA 2XUAA 1EX6A 1NVDA 1T36B 3FOFC 1CIVA 1CY6A 1O96B 3KQQA 4RIIA 3I5YA 2ATIA 2J85A 1GL3A 2RBGA 4J7XA 4P35A 4DCCA 3GAAA 1MAAA 3IJPA 5DE3A 3L4KA 2J9XB 3TZBA 1C3LA 2X0EA 3E5HA 5LU8A 5ALZA 4MR8B 3Q15C 1RAGA 4DB4A 2PRJA 3HVHA 4OJQA 4IDCA 2GDZA 2RE8A 5C80A 4H4CA 1G8HA 2O5RA 5FADA 5FULA 3WKBA 2WJIA 2WYIA 2ZBPA 2IZ1A 2YCLA 1AS2A 1SNYA 2FLWA 2C3UA 2MDTA 2R4UA 5EQTA 1RDFA 4ZAYA 3BK1A 3BSYA 1FUIA 2BDTA 2DJ5A 3B6JA 3C8MA 2EZ8A 4HN2A 5CLIA 1S89A 1LI5A 2YWXA 4YVFA 1A27A 5AW2A 3ZJVA 3TPZA 4OIFA 4J2TA 4A92A 4LMRA 1SZCA 3DL0A 1T2CA 4ZCQA 4RVSA 1UDAA 1TT7A 2XMPA 3P1JA 3W1EA 3FSGD 1CULC 1D2MA 2QMOA 4R8MA 4TL6A 2AJLI 4W8HA 2FZVA 4IGFA 1VMDA 4RMGA 4JLMA 2KBEA 1RXYA 2OR3A 2VPTA 3S1AA 1ISJA 1D07A 2X8AA 4D97A 1G38A 2G06A 2R00C 5DI9A 1CDOA 3X1YA 5ISMA 1WB9A 2HGSA 3OCYA 1QHEA 5TPZD 3VZDA 1UDXA 3U44B 4QJ3A 4F3CA 3OSUA 4NU8X 1G4HA 2FP4A 1K66A 2ZG6A 1E2UA 2EX1A 2QT1A 3D8TA 2D3TA 1T2UA 1JS1X 4WXRA 3HJNA 4S04A 1NRWA 3U3DA 3VU1A 4MRNA 4PYQA 4R2XA 5F9HA 2GZSA 3P0JA 2OSVA 1NNI1 1AGPA 1QCZA 1PR9A 5CA0F 3OPYB 4BBZA 2GAAA 4QPPA 3UXYA 4QLOA 3WA6A 1B6TA 1CR2A 4I9FA 4G4SO 5AXBA 3OIGA 3GRFA 4D3YA 3Q7RA 1LLFA 4R83A 3WK5A 3PJFA 4F6CA 4C20A 1DBQA 2XUFA 3UTCA 2XOKD 4JP1A 1RYHA 2CVOA 3QMPA 4HGQA 4MUXA 3ZZTA 4F5DA 1T2NA 5EJ4A 3GUVA 4BLVA 1DCMA 4PNZA 3RS4A 1JHQA 1WUIS 1UFQA 3PI7A 4P4SA 2MSCB 2WHXA 3PEFA 4FDVA 3HXKA 4FONA 4ZDWA 4F9GA 5AW0A 3K92A 1JAHA 1GV0A 2QTFA 4BVAA 2NW6A 3P26A 3THXB 3K5PA 2OE2A 2OCYC 3TCNA 3W3ZB 2BT4A 2XOEA 4XIGS 3TW6A 3RYIB 3U7QA 3FNHA 4QG7A 1JEAA 1DTSA 5BN5A 5JR3A 1CUYA 1SBNE 4ZQGA 1JKMA 2VSQA 3TRJA 4BV8A 1YIAA 1G0NA 2GT1A 3NTUA 5GONB 3IPLA 2BYTA 1YCDA 1SG6A 2IYPA 2XUOA 1GTL1 1B0PA 4C22A 2AXNA 1LKZA 3GEPA 1MORA 1V8DA 4PG6A 4UDOA 1I0ZA 1E7WA 4LDRA 5DGXA 2C7QA 3O92A 1Z2OX 4WXEA 4JP2A 5CW2A 3LUCA 2VH5R 4BVFA 4ZVOA 4D0RA 2IHNA 1T26A 2WHPA 1F51E 3ICCA 3V33A 1L7XA 4JR2A 5JPCA 3UWSA 3CTMA 1P1CA 4HKTA 2Z0MA 4QD3A 2XNKA 1IM8A 5CHYA 4BLUA 4UPEA 2CSUA 5CTAA 2Z2JA 4B6PA 1X74A 3HGTA 4MW2A 2JANA 2ZJ8A 4RK6A 1JSCA 2AHRA 3LVRE 2I7TA 3DHWC 4JU8A 4NG4A 2HSGA 3RTGA 4CM8A 5BQFA 3OKFA 2XUQA 2BH9A 2RHLA 4WZ6A 4DWVA 5U4QA 4MV3A 4O2AB 2QLTA 1WVMA 2G80A 1JSZA 1MX9A 2FUCA 5EZYF 2XAAA 2ZI9A 3NJRA 3NTOA 4NULA 3TGLA 3GQVA 3Q11A 1LU9A 1QYXA 3QYFA 3URMA 2AXQA 1KQGA 4Y6SA 2O1XA 1T35A 4FCTA 5CIWA 2APJA 4J7UA 4D3FA 1NXTA 2DPMA 4G2NA 4YFYA 4TTVA 5LM3A 1H4QA 2JD2A 3AC0A 3FHOA 2QPAA 1AQNA 3CJTA 3B70A 3QKTA 5F5LA 1OCEA 4WOPA 2H59A 3AR6A 2VNIA 3RM3A 3FA2A 4WVLA 4ND8A 1Y7IA 3R7WA 5JT1A 5FOWA 5EE3A 4C4TA 1WIWA 3E9MA 1GSHA 1CY8A 1R0RE 1XQVA 2YWBA 2WIDA 3FOZA 3PS9A 1QG2A 1ZW1A 3EEBA 3O90A 13PKA 3T52A 1E62A 2NO1A 3GVXA 1T0JB 2ZQZA 4X44A 4ARVA 3R6WA 4W5QA 2NTNA 3URKA 4KGXA 4QWWA 1CUCA 1Y9ZA 2OXIA 4B7ZA 3NDRA 2X2PA 1M2HA 4OY3A 3ZYZA 4BFSA 1L5SA 3T3GA 3GR6A 3ZD8A 4A4DA 4JYZA 4ZYTA 5AQEA 4CU5A 3TEMA 2C5AA 3SZOA 4F0JA 1XQ1A 1AMNA 3NMUF 4LXXA 2A0XA 2V9ZA 4MX8A 1Z0FA 2K7ZA 3VR5A 1EJ0A 4KIGA 3T4PA 4FOTA 3ZOZA 2W2XA 3N07A 2ERYA 4XRGA 1ZRNA 1RBQA 5P8WA 4OMDA 4WK6A 4NCIA 3WGGA 2H4XA 1C2TA 5THQA 2GHQA 1XELA 1W47A 3HA7A 3HNPA 5T8KC 2OHOA 5C8XA 1EVQA 3G2PA 1BD4A 4HGYA 2G9ZA 4Q15A 2VHQA 3PX2A 1JZQA 4UASA 3WNQA 1G5RA 2F3SA 4YJDA 1N7IA 1MNQA 3LXUX 1YTLA 1XAJA 3U4AA 3AJ9A 1JHZA 3VR4D 1U8FO 3I28A 2REOA 3GRCA 3RROA 1KEPA 3O95A 4BTEA 4IXDA 4A0RA 4N5NA 2A1TS 4UVGA 3OM9A 1V6AA 4TUYB 1GGVA 1TIKA 4KK3A 3ABSB 3SVZA 5C5CA 1RWBA 1TQ8A 3AFNA 1NSTA 3H8JA 4RETA 4EYOA 2JIOA 4D0SA 2XZLA 3U0VA 1FDRA 3QY9A 2CNKA 3QUTA 3JRNA 3DZGA 4HADA 2X2EA 3DDHA 4G1BA 1LSJA 4OU4A 4TS4A 1N32B 4G89A 4K81B 3G0OA 4WK2B 1WKBA 3UYLA 4Z99A 2DE0X 3KD2A 5G3ZA 1VJRA 1YL7A 2ID7A 1Q1NA 3H2BA 1RE0A 1YMQA 2P8SA 3JWJA 1GQOA 2ODBA 2P2YA 3HLYA 2NIPA 3NEYA 3NT5A 1ZESA 4RHYA 3R7SA 3U31A 3VR2D 2O2DA 3ZX5A 2ZROA 5AI5A 4AJNA 4DVJA 3E84A 3DWEX 2JG3A 2VNKA 3U13A 4XOIA 1CUVA 3QNWA 3DV0A 3NDBB 3DO6A 3M9WA 3AP2A 3DFKA 3WDKA 1AM4D 1KBZA 4O0MA 1KTIA 3PC4A 4MRPA 4TMXA 3U6KA 5IYZF 4DV2B 3O8CA 3DBOB 3AR3A 5C0OE 4BV3A 2HBRA 4AZ0A 3CRMA 3SI7A 4IFEA 2QMQA 2ZYIA 5FNVF 3VPCA 2FSGA 4YUZA 2HZBA 2J4DA 3FJOA 1W44A 2JEOA 3FUXA 4EP1A 1ZM3A 5LQRA 3W5SA 5BYBA 1UBGA 2PUFA 2VPWA 4O3MA 5EKDA 1F6BA 1TNDA 2ZE5A 3WIDA 2C04A 3QVMA 2PBFA 3HN6A 2PSHA 4DCPA 4FJ2A 4N5IX 3HP7A 1Z4JA 4C43A 1KERA 3F3SA 1ZUIA 2AOUA 3IUBA 4X61A 1LLUA 4XRRA 3VQTA 3OE4A 2QT0A 3COWA 3ASYA 1E2NA 2QU7A 3G2OA 4UTNA 1RWVA 4LGMA 2TYSB 2FJPA 3F7NA 5L4LA 5LP6F 1XUOA 4ME6A 1A9XB 4HLDA 3TTYA 3BH7A 4GMFA 2XE8A 4RVDA 2JVIA 1SGWA 5CT4A 3VAYA 4PVDA 4UOEA 2WINI 2X0RA 2VJKA 2F62A 4BX3A 3RSFA 2IEBA 4PAGA 5AVTA 5LDGA 2E4UA 3UICA 1MB4A 1SUCA 2G5TA 4M76B 1G21A 1F7UA 4BVHA 4NECA 5BSKA 4WBSA 3N0WA 4YMGA 4A8JB 4NE7A 1P4RA 4HH3C 3AYXB 4XLTA 3AG6A 4LYFA 5JDCC 4MNTA 2WT8A 1HL3A 1KI6B 2HMAA 1UC8A 4I19A 4P9NA 5KOIA 2E3JA 2J4CA 3WSWA 1KOGA 4ENVA 3E6AA 5FBWB 4H9GA 1WV0A 3HB1A 3SS9X 2GERA 5DULA 4C4OA 5F9MA 4XIJA 3TLEA 3K70B 2B8JA 1O97D 2FG6C 4KXVA 4QRDA 4UEOA 1XV5A 2PO5A 3I2FA 1ZD4A 1OT5A 4ZHQF 3GP8A 4K6CA 1W2HA 3JQAB 1HDCA 4QPJC 1LB1B 4U2BA 1H5NA 3LWZA 4N0QA 5J5AA 4DPLA 1U81A 5L7YA 1D09A 1JF8A 3A8TA 3OHMA 3P27A 1C1DA 2IYEA 5C37A 3WO1A 3A0UA 1ZSVA 2ZYAA 5B36A 2B78A 3DC2A 1UAGA 3LW8A 5LLDA 2IODA 3VTAA 3OY7A 2Z9BA 4LS3A 3EF1A 1P5ZB 2BHTA 2YV3A 4UCWA 1LLCA 1TUIA 4PYJA 2WAXA 3BRQA 3ZCQA 2CJPA 2UDPA 2AWNA 3DHEA 1MX1A 2ZBVA 1RABA 1JDJA 1XTQA 1IN1A 2C83A 1ZJ4A 2B4TO 2DWOA 1OJ7A 2BBSA 2JVJA 2WTXA 1H4VB 3I73A 4KGZA 2EKQA 5FTJA 4E11A 1EUCB 1AQYA 1WPGA 3V4OA 3ZQJA 1YZVA 2OPBA 2P5SA 5EP3A 3PIDA 2QJOA 5GJVC 3NTQA 3BXHA 3BQMB 4BGEA 5A9RA 2GCEA 3CLRD 5BRJA 1FJGB 4M6WA 5M7EA 2HEIA 5DH9A 1ZGAA 2PYIA 1KORA 3B1KA 3KYDB 4ALJA 5IMBA 4LMAA 3PNKA 5K0TA 5IFKA 4RNCA 4ALLA 3PUVA 3QEJA 4ZOBA 2XMDA 2UYHA 3FVWA 2HC9A 1XCBA 1JDBC 2PVPA 4ZGGA 5KMGB 4X8LA 1U1EA 2BEWA 3FFXA 3FYUB 3BD6A 4OFBA 3WLJA 2YYZA 1V16B 1JKIA 2YJGA 3MZ0A 3OLYA 4JCCA 2G77B 4UMEA 4EB0A 2IS2A 3MBIA 3TW8A 1EK2A 4U3JB 1SIUA 2UUPA 4FR0A 4LTDA 3DFFA 3DDCA 4FSXA 1WMDA 3D2BA 4JQOA 5B3JA 4EF4A 5KYNA 1G5HA 2EIXA 1GZDA 3MTDA 1JBKA 4FBGA 3F8SA 4IGEA 1SBCA 3M82A 3PLRA 4YP7A 3S7TA 1KETA 2FDCA 4TYQA 3HR7A 5JQGA 1CJUC 1J7JA 3N8DA 4NMHA 5HQ3B 3O2JA 1JDVA 4HAIA 1JVNA 1SBTA 2NZVG 2ZRMA 4WLFA 5GZ1A 4AKTA 4URVR 3H3XA 4X62B 2QTVB 3HKDB 2OO7A 4HMOA 4X54A 1ECGA 2R96A 3OZAA 1MV5A 2W6IA 1SJ9A 1T4CA 4HEA6 4HMPA 4PGMA 4I46A 4UARA 3FPLA 4MB6A 4NDZA 2YY6A 2OEPA 1Z4QA 3OLCX 2IZ5A 5KHLB 1NFQA 2YOGA 4DQLA 3E61A 1ZN8A 3R24A 1B1CA 5BV2P 3I2YX 3Q8KA 2DXIA 1RRPA 1FJHA 3M7IA 3DE6X 3QW2A 3NC1C 4U5QA 5CFPA 3A2MA 4IIUA 5KQSA 2RGXA 3QOXA 3ZBPA 2P4HX 3PFFA 1ZCBA 4N3AA 3SZMA 1Z4MA 5LZ2A 4CL3A 1WXDA 3K30A 1U28A 2A5DA 3ON5A 4P2GA 2KPOA 4BAGA 1LNQA 1V26A 5ILOA 3PDCA 4I1IA 1DBWA 4JC4A 3IDSA 3OQMA 1GNVA 1RJGA 3IVRA 2JIRA 2AR0A 4RTLA 3QLTA 3BJEA 1ZJZA 2JFWA 3K6JA 2O2IA 2REBA 5JCZA 3IQXA 1AGRA 3LX6A 1FDWA 2WD7A 3ZI7A 8LDHA 3IBYA 1ONNA 4FFBB 1JU4A 5H70A 1EDDA 3FMFA 2JA1A 4CWAA 3ENWA 1L8XA 2CXHA 2M9MA 3K0AB 4HWKA 5KAPA 5JJKA 4G0PA 4ZVSA 4FQ5A 3ESRA 4W4TA 1WXWA 1T9HA 2X76A 3GD5A 2IYVA 1UMDA 4JLAA 1H94A 1RRGA 3FSJX 3TD2A 1QE0A 4CQLB 3IDOA 4LRWA 4F71A 2OECA 4B9EA 5JYEA 2YHUA 4A1FA 4E2ZA 1MABA 2WIKA 4O4HF 3KWFA 3OA0A 3OOSA 3TQOA 1HE2A 2G36A 2WW8A 3BRWD 1UBNA 3LCCA 3IUYA 3HCPA 1W5SA 1X9IA 2F3RA 3E8XA 4YRQA 1I2CA 2YXNA 3G1WA 4RE5A 1SIWA 2Z3ZA 3B6EA 2ZCVA 4Z1OA 4X6XA 1BGXT 4CDNA 1P39A 3LCJA 1PCXA 4JKOA 4K0RA 2VAVA 1O5OA 2DOKA 3ITNA 4R8LA 3Q7IA 3BC1A 2WWHA 3U4DA 5KUTA 1WBJB 2EG5A 3BF8A 1E7MA 4P3PA 4C7XA 4I55B 3O75A 5G0SA 4TXJA 2H4WA 3T9FA 3KB6A 2ZXFA 4Q4HB 4V03A 1IZ7A 4YI5A 7REQB 3DMTC 5JDIA 4D56A 1A8PA 1RRFA 3JYQA 3WK7A 1XTJA 3B5EA 4I50B 1WMAA 1Y37A 1P2FA 4GOOD 3U3RA 3EXG1 3N2YA 3UXMA 4KN9S 4MV5A 4DT1B 1CFJA 4L16A 5BRAA 1MIOA 1QIMA 1I3LA 2XDYA 2JFHA 3JAWB 2QMZA 4IJQA 2WMDA 1ZK4A 2OGTA 1G7CA 3A4YA 3PQ5A 1USVA 4G97A 2IVZA 1DV2A 1AT1A 4WSOA 5CUQA 2WAOA 5AOVA 3MN1A 2BWJA 3AETA 3K1TA 3P9ZA 1R8YA 3FGNA 4O1HA 4GMHA 5EJGA 3DP9A 2MJLA 2FPGA 4C7MA 3SDBA 3TUJC 2O23A 4NZYA 4P98A 4AT1A 4JV5B 4CDGA 4TTQA 4GYJA 1I7PA 1VIYA 1I1OA 5EE9A 1DQPA 2PZLA 4FK8A 4B5LA 2VDJA 2BGJA 3VHQA 4FYHA 2AEFA 1ENZA 1YZUA 2WFLA 4O33A 3WGUA 1JFSA 3RHTA 3M2TA 3FDFA 1UCFA 4JMPA 2G6BA 2YJ4A 4Q3NA 1DDOA 3ABOB 4C5AA 4WJLA 3DZBA 3TN7A 4IWYA 1A9QA 4WLNA 4AMBA 4C06A 4RQAA 5FTMA 3GGGA 5E9JA 5HFNA 3BTVA 2PR2A 1YB1A 1PEDA 5CLGA 4AC9A 3KV3O 2DFKB 2G0AA 3A9RA 3JZIA 3GLQA 4NFHA 1Y6ZA 4WXMA 4ZT3A 1U7OA 2QTMA 1XCOA 4DR3B 4J6EA 3QVTA 2AC7A 3KQWA 3UTDA 3FZNA 4OVKA 3TQSA 1TJ3A 4DRZA 2Y0EA 5L3RA 3LPDA 3OCXA 3QY0A 2PMEA 4BZPA 3WGQA 1A2KC 4LK2A 4B74A 4BP3A 2BEVB 2HKIA 3FPJA 3GELA 3EXHA 1TO2E 3RTDA 4D2IA 4LDJA 4ENQA 3AG5A 1Y0BA 5BUCA 2BCJQ 3IQEA 4J2OA 1PFYA 3M5PA 4XWAA 3I45A 1O89A 5E1DA 1EHCA 3SNHA 1N2XA 4EGCB 4ZZ2A 1A3CA 4OV6B 2LKDA 2Z08A 3ILYA 2AN1A 1IVNA 2FFRA 3ZHTA 2AOWA 2SCUB 4L08A 4YMHA 1TXGA 1VE6A 4IIDA 5B64A 1UP7A 5DOVA 2ZI6A 1N2EA 1TUBB 1PGJA 2E21A 3AERA 3ROXA 4TRMA 1MOZA 4JBNA 1E3DA 3ESBA 1MO5A 4W6QA 4XDYA 3TZQA 5BW8A 1QU2A 1V3QE 3OKAA 2PRKA 4ZCTA 1R0XA 4HH4A 2I7XA 1M6NA 3C41J 1TC2A 4IDQA 2IF0A 4Q9NA 1OWMA 3RC2A 4NMLA 2YQ5A 2F55A 4P2BA 1XKXA 5JIBA 1R50A 2NTVA 2XECA 1ZN7A 1MJHA 4C7KA 3KQUA 3B3JA 3ZEIA 5F4ZA 4GKVA 4CI0B 2BN4A 5DN6D 4BN5A 4Z6KA 5IKMA 1S6YA 2HA3A 3GP5A 2CLMB 5FUWA 4CE6A 1PK9A 5BYKA 5THKA 4YAUA 1FK8A 5ITZA 1O97C 5FI5A 5FL7A 1G3RA 1CUSA 3MGKA 5CA0B 4E30A 4KBFA 1FNSA 1LPSA 2ZSUA 1SCNE 3M6AA 4XPIA 5A4FS 4FSDA 2QX4A 4EJSB 1E7QA 4KYVA 4OTZA 5TSDA 1UBLS 2DPHA 1RQGA 4RCVA 5AO9A 3THWB 1MEEA 3LUPA 3EOAI 5FLKA 3WG9A 1BN7A 3H1TA 3MJEA 4KIWA 1CUJA 1ZVMA 2WIAA 3JQBC 1Y3FE 3RPEA 3V8PA 3IAUA 4I1OA 1JNYA 2PSSA 3S8YA 1VYHA 4V1CB 2RJNA 4XCXA 4OA8A 5I9MA 4U2DA 4V0NA 4J43A 3VC7A 4C3UA 4GL4A 3ZWYA 2O14A 4CMJA 1FMLA 1X7ZA 4FFVA 3L0BA 5C3UA 1BEEA 1R2QA 3PTZA 3Q2OA 1Z5PA 4PZUA 4WGGA 4Y2QA 5K0JA 1GGFA 3SQNA 2NU9A 4P5PA 3A2KA 3NVAA 3AK4A 4H0NA 5I3CA 3OTOB 1YA8A 2WJ3A 2V6MA 1T2DA 3DEYX 4EITA 1AC5A 5H9WA 3PDUA 2CBXA 4Q66C 3TRFA 4ESOA 1XZIA 1Q16A 1BYIA 2AKEA 5FTWA 3JARB 4NDNE 1DC4A 4PR3A 1HR0B 1YD7A 2VZEA 3CLRC 3SE0A 3TZLA 1ZP6A 5IJ0A 4H3VA 1JXQA 1QYRA 3U9TA 1LI7A 1W19A 2XQVA 3VHRA 3BORA 2I2DA 4CCYA 3NHWA 3M49A 4Y30A 1RADA 2JGMA 2POQX 1V5GA 1U2PA 2BGRA 3ICVA 1LPBB 3W5CA 1AHHA 3T34A 1TIPA 4TV9F 3BK7A 3R8FA 3FPHA 5G53C 4AWBA 2Y4NA 5DLQC 1WDTA 4XX0A 3GRUA 1DMSA 1CYDA 1GZ5A 4ZO6A 1Y98A 1EVEA 1E1YA 2C5BA 3W7AA 1XZ8A 5FEUA 4X8MA 1GAXA 5ALPA 3EIEA 2LUOA 3DVAA 3PD1A 4KO3S 3ZHZA 1CS0A 2AI2A 2YJZA 1IZ8A 4QQNA 2OXEA 4UNNA 4YECA 2LCQA 4M9CA 1SXHA 3ZWXA 1H4TA 4IHJF 1E2LA 4CXMA 3PTAA 2PMBA 2DX7A 4H3HB 3V2IA 3CRQA 3NXKA 2AMFA 1EM8B 4D9FA 5JBIA 1D1SA 3VU9B 3NDJA 1LRKA 2X4GA 1N3LA 5CLLA 4WMLA 5EZYB 3QXSA 3SF8B 1VP9A 4ND4A 1GZVA 3OLVA 4R31A 4NBRA 2W6JA 4D82A 1RR6A 4JFRA 5D3QA 1UM9A 3PXCX 4NFYA 4XVQA 3T35A 3TRHA 1O2DA 1EXVA 1J0XO 2Q1WA 2ONKA 3PGLA 5AW5A 3NAQA 3KQOA 5JXIA 3NRCA 1W48A 4LFCB 2V7EA 5CEJA 5AM1A 1K5PA 4B2YA 3NNDA 3L18A 1NW6A 3AHHA 2GBGA 1A9SA 5E9AA 3P9NA 3SXUA 3VDRA 4B33A 3ZIAD 4WD3A 1G42A 3PEUA 2EW2A 1YZTA 4LN1A 4NARA 4I36A 1MJFA 1K7YA 4MV0A 3JAMA 4I66A 2PLFA 2P0YA 3SXUB 3N70A 1LBEA 4L4ZA 3KZVA 1K8XB 3SX2A 3DWIA 4U6SA 2GBFA 4I3HA 1AKVA 2R2GA 3FVTA 3OZVA 4TLBA 3RK4A 1Z73A 1VI2A 3HWWA 5DTMA 1IB0A 3SSNA 5JHHB 4NX2A 3LNCA 3IX7A 2O2JA 2D7CA 3OBBA 2R6HA 2KLHA 1MA0A 1VXRA 3KD3A 1PK7A 1W96A 2JDIA 1NMQA 4CU2A 3RKSA 2ZAMA 3IHLA 4IJ5A 3UK0A 4EUKA 3AJDA 4LYHA 5BQXA 4GXQA 5TS2A 2DJIA 4EG4A 5E0OA 2EU8A 4I2NA 5JZBA 2PWYA 2HF8A 4G8BA 1ISIA 3V8NA 1X8LA 2Q4OA 1RZRA 5TEVA 1J90A 3BEDA 1CNMA 3KWLA 3VKUA 1JSRA 1KYYA 1XP8A 4EBBA 2EOAA 1CRQA 3M3HA 2L82A 3RG2A 4WXPA 3RU7A 1DIRA 1Z18A 4PG7A 5T57A 4C3ZA 1UODA 2HA7A 4MMZB 5JADA 1U63A 3JU3A 7ABPA 1Z5NA 4ZO4A 2I03A 4B44A 1M2VA 1HTTA 1P6UA 3MHTA 2DBQA 4AURA 3VNRA 3KYCB 4UTXA 1V3VA 2WF9A 1H1TA 4BCCA 4YLYA 1NVWQ 3ZLJA 1TOAA 3I39X 1BRMA 1P7YA 3VZPA 5EUMA 4MUMA 2W2LA 1AV6A 2VP0A 2L17A 2FMUA 2RI6A 4FS8A 5C5DA 1MNAA 1JW9B 1AA9A 1ULSA 2BMFA 3K0CA 3CUVA 3MOGA 4C4YA 2W42A 5F9FA 2A5YB 3ROEA 1VE1A 3C15C 2OZPA 3DOJA 1R5BA 4Z49A 3TQRA 3GJ4A 5ES4B 5K8LA 1X39A 2H0AA 3T15A 2M98A 5ESXA 2QL5A 3HG7A 4RGQA 4Z3OA 4UNQA 3EPHA 4F06A 5DEIA 3HRIA 3DNPA 2QAJA 4AP9A 5HFJA 5TR9A 3J7TA 1B6SA 5AM5A 2JGIA 4FDMA 1UIRA 2FOXA 2QL7A 1OXSC 3NP7A 1L1RA 4S0ZA 3FOCA 2PAAA 3THOA 3WB0A 1USKA 4RLFA 2E5FA 1S4QA 3DYBA 1XQ6A 2ZUBA 3H97A 2QVXX 4RZHA 4H0CA 4KZKA 5IYZB 2RC6A 3DTVB 4HS9A 4WZBA 1NUTA 3Q6MA 1LDMA 2XQGA 5JAHA 1T4DA 3UJ9A 2P69A 5FNVB 4EO7A 2QS9A 2V9PA 2WJ6A 4K9SA 4K87A 3WLEA 2I80A 3OTHA 1OA0A 3B82A 4B4KA 4F7WA 3BGVA 3MJHA 5JSHA 2QDXA 1XVAA 4UBNA 3KJGA 2P62A 3DYVA 1U2SA 5BN3A 4IMIB 3L7AA 2I2FA 2I55A 4N12A 3TPCA 4QASA 5SICE 3R8XA 4HQ0A 3GA0A 4DCGA 5I01A 5KOHA 2OYCA 1N6IA 2EFHB 2CL6X 3G89A 3LWBA 5DNYB 4Z2AA 3UAGA 1NYQA 3MOIA 1H0SA 4HO1X 1NI3A 2WKRA 4BKRA 5LP6B 1FY2A 1GNRA 1RKUA 3HKBB 3UKJA 4LHWA 5IN4A 2ICAA 3DBVO 3L8MA 1Z0DA 4J3FA 4K2AA 4X1YA 3WTCA 4B87A 3VR3A 1TAGA 2JKZA 4OUDB 4QYTA 4R9UC 1F2VA 1NPYA 1U3DA 3O4JA 4X5OA 3WJ1A 1GCGA 1EWYA 1JR4A 5IC6A 1O7JA 2WSYB 4FHZA 3O73A 5DBHX 2WSLA 1A98A 1WDKA 3CPHA 3ZDXB 3G0HA 3EH1A 3W5IA 3CNNA 4EG0A 3DB1A 3WKDA 3OU7A 4IV0A 3REQA 1ML3A 4N6NA 3RW9A 4BZWA 1RYYA 2QX8A 3PDIB 4HAYA 1KYWA 1FUEA 1XXLA 4M83A 5EQDA 3OTQA 2QN1A 3RD5A 1U4SA 4MULA 4RK5A 1PS8A 1DX9A 2IUSA 3DO5A 4Y9RA 3CU5A 3RRJA 1CERA 4MIEA 4D9BA 4EYQA 4RTJA 2ECOA 3DOCA 2II6A 4RV4A 3NM6B 1Y48E 4ZHQB 4PO3X 3FDJA 1QO9A 2X9LA 1XBTA 4TT3A 1R27A 3JQ8B 4NZMA 4WKBA 4WKNA 2CCGA 5I9NA 2JCYA 3PIIA 1CZNA 4MDHA 2G4CA 3K9FC 2BC9A 2VVTA 3OQJA 5G0TA 3FPSA 5BN4A 1ADGA 2Z57A 1JV2B 3A1SA 1T0HB 1OW3B 2RI0A 3IMGA 4OI4A 3P20A 1DEAA 3FVQA 2CB0A 3ZV4A 2R5WA 4TVKA 3IILA 5LOVF 4I1SA 1SVKA 4IG4A 1REQA 1ZJ5A 3EARA 5LZ5A 4KPFC 1WRBA 4AJ4A 4D8WA 8ATCA 3QE9Y 5F3WB 4GOXA 3RIGA 2O1EA 3BJMA 5ICGA 2QNRA 1PL6A 1YU6A 1R0YA 3E23A 3G85A 2ZJYA 3GT0A 3U17A 2JBAA 4UHHA 5L9AA 5LWQA 5C52B 3WL6A 1P72A 4HFJA 2JHFA 1SMKA 1X7WA 3AW8A 4O4IA 2A84A 3Q41A 3VKGA 2WF5A 4I6GA 4CV2A 3P4UA 1NXOA 2WA1A 2JJ1A 4EJ2A 1VLZA 5K45A 1VJCA 4GMXA 4UTOA 5CIYA 3KQMA 3E9DA 4YPFA 4OLBA 2Q5FA 4GYWA 1RNLA 5ADVA 1EESA 3GEMA 3FTNA 1TVKB 821PA 2C2ZA 1M0SA 1WF3A 1C3VA 2WUEA 3KTAB 4BEBA 3H2IA 1JJFA 5MN5A 5CG2A 3L3BA 3P2YA 1E59A 2CHUA 4QUGA 4EY6A 4WN9B 3OJOA 3S2IA 1HZJA 2X8BA 1CETA 4PHTA 2XT6A 4D0GA 1EEXB 3OI7A 4X1KA 3QHPA 1O95A 2H9AA 2Y71A 4O4JF 2J9YB 1GRRA 2ZB7A 1YKFA 3TINA 3UXEA 4GQAA 5H8WA 2CV0A 3QBEA 4JKYA 5AVUA 3FFTA 2HEGA 5AHOA 4CFSA 1E2GA 3HGMA 2V3CC 4L27A 4DTCA 3HUFA 2J6BA 5K4AA 4KDEA 1B8NA 2VF2A 3PC2A 2O8CB 5DHTA 3RIMA 4WECA 5IM4F 3K73O 3R7LA 1Z29A 2B8TA 2BFCA 1Y3CE 2F8MA 2QN9A 1VDZA 3M5DA 1VKOA 3ZKWB 4MV6A 4UBJA 1YVRA 1ST3A 2PH5A 4W7HA 4ZQBA 4FKMA 3HXTA 2JF0A 3AIMA 3HYNA 4QEDA 3X1MA 4XB2A 3TSYA 3M89A 1XK7A 5CK5A 3BWYA 4FVTA 4ND3A 4MW4A 4TWIA 4P0PB 2HSWA 4MR9B 2FW1A 2HF9A 1IOLA 1VPLA 4PZLA 4V0LA 2NYAA 1XEWY 2VDQB 3DFIA 1SHUX 1OE0A 1IN7A 1RZRD 1Y6GA 1B2RA 4Q48A 2ZI4A 5KNDA 4NYMR 3TL2A 4GWGA 4ZI5A 3A1WA 2C94A 3HKCB 4MWOA 1O9BA 2Y6UA 2VCHA 4Q4JA 1XU4A 1FDOA 1MEJA 4X7PA 1FXWF 3L1JA 3P4XA 1E89A 1SCDA 2C1XA 2HXGA 4X41A 5ALFA 4D9IA 4DL9A 4RUKA 4WLEA 5K0FA 1N6OA 2PXHA 2ATCA 3K5WA 4QBFA 1U7TA 5KBYA 3EZXA 3A3NA 4BNFA 3QBVA 4F9EA 4YT8A 3L7LA 4NI5A 3RSHA 3QHQA 2GD0A 3SYRA 5FWYA 4KQXA 1VP3A 2ISQA 3D81A 3PR2B 3ZXSA 1M0EA 4CIXA 3G7UA 5TXGA 4LPKA 3QKRB 2PUHA 1KAHA 4RZIA 4R1PA 1QH1B 8ADHA 4LF8B 1SC6A 4A15A 4P3XA 2VTBB 1ZN2A 5TEWA 1G5QA 1XNJA 4UUPA 2ZT8A 1HYEA 2G17A 5CDYA 3U4QA 1ES9A 3W2FA 1CCWA 2IU3A 3ZE8A 4DXAA 2AKAB 3H2SA 2O2GA 3L6BA 4O4HB 5G0WA 4C2AA 4Z4QA 1NASA 1JPNA 1H3EA 2QP3A 3JV7A 4ZO7A 2HSZA 2PU7A 1C7ZA 4Z4EA 3HDHA 4D4KA 2IH2A 3QKWA 3UUFA 1JALA 4PZEA 4URZR 1Z08A 3OX2A 4HPXB 2M6SA 4AD8A 1KH1A 1ZC4A 3WICA 3HJGA 1CTQA 1Y89A 4MS3B 2QTGA 4KWIA 2UXCB 1G8SA 3NANA 1T36A 4DMUB 2DQYA 1O96A 3BSWA 1ZA2A 1PT8A 2IS1A 1GTZA 1XQWA 1R5JA 3LUDA 4PFKA 3WE7A 4DDUA 2OA0A 4TVBA 2PRYA 3LX4A 2DFDA 2ZS8A 4AL4A 4D9GA 2ZWOA 1JEQA 1UZAA 3U49A 1R15A 4MR8A 3TTVA 2ZSKA 1I3CA 5L3VA 1MAUA 4HNRA 5BORA 3STXA 1E3WB 2FRVA 3OCVA 5DNWA 2VDPB 5FQNA 5FUXA 3KOWA 5I4CA 3AF1A 3KHSA 2AFIE 4DB2A 5EUQB 2DUJA 3STVA 4POAA 5K09A 4KN8A 4R9VA 2QI9F 5FR1A 1Q3HA 3O47A 3TIIA 3UY4A 4DXHA 3EUWA 4EKEA 3ZS8A 1L4EA 3SAJA 4DA7A 1Z0AA 4LCJA 1KJ9A 4ZYZA 5ECDA 1WL8A 2JFOA 4J94A 3TH5A 3WMXA 3M3PA 3G02A 4GRDA 1IY2A 5FXMA 4TKVA 4BQRA 1MDBA 4WA7A 1VB3A 5FPKA 1RU3A 5B1IA 2E9SA 3SK0A 1ADJA 1Q3TA 3QSGA 4FYIA 2XUPA 3UK1A 2E85A 4TN5A 4S0XA 3A0RB 1HY3A 2VWQA 3FSEA 1J8MF 3KCQA 3GFPA 2B5VA 4V3CA 5ESWA 2Q3EA 4EGQA 5AVRA 1OB5A 1UKCA 4M21A 3W3AH 5CX4A 4Q02A 1PFWA 2V3WA 4KU4A 3TNLA 3HV0A 3OZXA 2JAXA 4ICIA 2JGDB 1ZGGA 1EGMB 4RMNA 2FJUA 3ZY4A 1ODFA 2VRCD 4KDFA 3UKDA 3GZ4A 1JPVA 2H2IA 1A9TA 4BE4A 4RYLA 1D5CA 1SCQA 3PVCA 1M6WA 1ZD2P 4MR7B 2ZU6A 1N2CB 1SQ5A 2IYQA 4D74A 3C3MA 3H1BA 3KSDO 1QVVA 1A8SA 2B1GA 5SZJA 3OPYA 2X3YA 2HX1A 2BL4A 1KK2A 3IP8A 5ITWA 1E0KA 5KVCA 2XDQB 1SHTX 521PA 4EHFA 3W6OA 1NN3A 4GE3A 1GYPA 2HDWA 1SCBA 3GZNA 1CJBA 2VJLA 4WW0A 1K3TA 4R4JA 2BGKA 1MO6A 3D64A 3IAXA 4JI8B 3D8RA 3SR4A 3AM1A 1UBTS 5K3DA 6GPBA 5AIBA 1DAHA 1DOHA 3PWKA 3KHKA 5ITSA 5ALDA 2XMSA 4KWCA 2F1IA 4BC0A 1QMPA 3BL6A 4B4WA 3THXA 4P3NA 1MAWA 2PZKA 3AESB 1H8HA 3M4JA 4M89A 1IEQA 4OGLA 4HDKA 1W75A 4OGFA 2JLBA 2PMWB 1HFKA 3D7MA 3IP5A 2B8NA 4MLZA 3RYIA 2BFWA 6PFKA 3ET4A 1E96A 1GAWA 4YASA 2GNOA 4HDSA 3TSWA 1C3EA 3GDFA 1GV1A 2ZYWX 3P9PA 3VOBA 5DEOA 1NLMA 1FDTA 3UM9A 3BSFA 5GONA 4ALNA 5IJ9A 3RT7A 5INTA 2C77A 5MF6A 5IT9A 1P1JA 4W5NA 1HMPA 3HU3A 3MTJA 5CB0A 1HF3A 2OOSA 1QIIA 2D7JA 3BJIC 3V2HA 3EOZA 4RGYA 1T5DX 3SC4A 4ENWA 2W2TA 5CM2Z 1N77A 3PQ8A 4TTAA 3CCFA 2YMMA 3WGHA 1I4OA 2IYWA 4A0FA 4ATNA 1B23P 2J48A 1Q17A 4KUEA 1JEYA 3ER8A 2FXVA 4JBLA 3C4VA 5CPFA 3R3VA 3JCZA 4B34A 5BR4A 1F12A 4L6CA 2WICA 3MCAA 3PC8A 2FK8A 3LGAA 3HBJA 3I6MA 4ADSG 3N3AC 4YRNA 3ADPA 2J87A 5JYDA 2BM9A 2RGUA 4F46A 4Z9AA 2H1IA 1I01A 1L4UA 5LZ8A 3FRJA 5LQKA 4RS4A 4F4DA 1ULZA 2XQJA 5REQB 4B3SB 3E9ZA 3AOEC 1G8JA 1NN0A 2IRWA 3PF8A 2C5EA 4YGYA 3TLKA 5FWXB 3U6BA 3SZGA 3FOEC 3WP1B 4YWHA 1XO1A 1FYVA 2ZSIA 3V4SA 4EJMA 2DQKA 4Y2JA 2ZIXA 5IH7A 1UJ4A 2I6GA 2GB4A 2OV4A 2VI5A 2ZTLA 7ADHA 3Q85A 1KJ8A 3FPGA 4JJIA 1YCGA 1EBUA 5HKAA 2C4HA 3PQ3A 2BFNA 3I61A 5HBGA 5IXYA 1WTCA 4BGIA 5FBQB 3OUZA 2GF2A 4UAVA 1BS2A 1A5SB 2PQ2A 3LQFA 3OZRA 5E7IA 3KSRA 2F9MA 1GZSA 3W4IA 2ACVA 4Z7OB 4I9UA 4KV9A 1RYNA 1QNLA 5LQAA 1CP2A 1L3IA 1EVZA 2B82A 3ONEA 4L8GA 5I45A 4EAAA 4TV9B 2G7MC 2RKBA 4G5SA 4RVHA 3M4YA 2I33A 3GW8A 5IEJA 3LT0A 3GJYA 4N5DA 4UXHA 3U3KA 3UHOA 2OO5A 2I8CA 1V9SA 3QJGA 5ERGB 4XM2A 2I8AA 1W5BA 1TTHA 3CM0A 2A9QA 1TZBA 4H1WA 3ZWOA 3ICWA 1VLMA 4IHJB 4YAJA 5CB4A 4L22A 4MMYB 1GWNA 3ZZNA 3PDWA 2WWRA 3I01M 4PPFA 3VM6A 4JJGA 2XHZA 5JS1A 4H7IA 1JLMA 1WXHA 3EE6A 1D2HA 3D1LA 4M7WA 4HX9A 5DTEA 1U9IA 1WEKA 3PCXA 2VWPA 3NNNA 1H2EA 2Y1GA 5KO2A 3MJDA 4R1SA 2VTVA 3IYLW 1VHTA 2HLHA 4FI3F 4MXDA 4XUEA 4F04A 2CLFB 2BF4A 4PFSA 1KR2A 2AVNA 1M1YB 2CYBA 4RY2A 1ZXXA 4HV4A 4N9QA 1A4IA 5BN1A 1KY4A 2IEIA 4M55A 4EFKA 2C9ZA 1E9FA 3FTEA 3NGMA 3FETA 1QWOA 3WGKA 2CFRA 4BBAA 3I1FA 1VLLA 3LX8A 2CLDX 5LXTA 3JYHA 5CU7A 4F1WA 3KR0A 1TA9A 4QYXA 1M8GA 3D6HA 1P77A 2I2WA 2OUIA 1E7YA 4WY8A 2I22A 1MP0A 2HB6A 4XWTA 1BU8A 1IHXA 1WUHS 3F98A 2WIFA 4B17A 2FPXA 5AHKA 1U7XA 3IAFA 3EC7A 1EQ2A 1XMOB 2VNJA 1J0CA 3SKXA 3B9RA 1OFVA 1IU9A 1K97A 3NCHA 1GNSA 1S4MA 5I9TA 4AUNA 5KYWB 1KYZA 2RGGA 2H9YA 3TR0A 1M2OB 1MH9A 4WDQA 5EXSA 5CCDA 1V3UA 2AJDA 2IYUA 2PTHA 5K3BA 5DW0A 3IELA 3DGEC 4MUIA 4JY7A 3DZJA 4P4LA 5HPYB 4WI1A 2PZBA 1L9KA 4G1MB 1NMZA 1GPLA 4ON9A 1Z83A 4I9NA 5FBLB 3HU5A 3AZOA 5HS4A 3IKVA 4R98A 4WXYB 5LIPA 1TUEA 2V3VA 4AX8A 2ZYDA 3EVCA 1NL3A 1UC4B 2KWIA 3PFNA 2ZJFA 3C3DA 2ODPA 1PVDA 4X3PA 3N0TA 1UEIA 1XVIA 3KTFA 4JBHA 2Q8PA 2GYYA 1ZUNA 3ORQA 1M1NA 1M6YA 1ETHA 2IYXA 4Z0PA 1GEGA 1SR8A 3TRDA 4B47A 1TYAE 3CO5A 4DG8A 3EGWA 2FVXA 1NX9A 3CCCA 4MQEB 4DMLA 1IK4A 3DMPA 4ZAWA 3BT7A 3A26A 1PZEA 4MUAA 1EE1A 2R7MA 3ZCPA 5EHXA 2GN9A 4E14A 3AL0C 4J2HA 3HTXA 1G55A 3KOOA 2XEXA 1A4UA 1IJEA 1TZMA 4ZXPA 5LL6P 3HA3A 3TR6A 2QUKA 5HE9A 2ZETA 1U6JA 4PHFA 3GEDA 3DLHA 3OECA 3REGA 3HXPA 1CZOA 1DTWB 5HK8A 1LFAA 1OX4B 1NI5A 4QYWA 5ARDA 4DHEA 5JBNA 3EASA 3ISVA 1L7BA 1SZJG 4W5HA 5C32A 1SH7A 2MT9A 2VFAA 3JQ7B 1M67A 4XJSA 5CBPB 2E0IA 3JPWA 3O03A 5FOSA 3BFPA 1UP6A 3KOMA 3Q9SA 1K2VN 3PHJA 3V7YA 2OB2A 3REFA 1C81A 1WAMA 1CIJA 1FP2A 2I7CA 3MT7A 1J25A 1U4NA 1LBQA 2JGNA 4DNXA 2M32A 1J5XA 2QD1A 1SHJA 3JVIA 2ZJZA 4GLFA 4A8JA 1E1CA 3GD7A 4K9MA 1E60A 2PVSA 4C4SA 2OCDA 5BOSA 4ZVUA 3SHQA 1RD4A 5BSVA 3Q8XB 1ZD1A 5EWMB 5LMUB 4A0QA 4WERA 3AUJB 1B74A 3L5OA 3UBTA 3ZDBA 1O6FA 3A9SA 1G8YA 1EGHA 1VL6A 2QZSA 5J9FA 4BWGA 5MFZA 1H2WA 1XMJA 1T8TA 1UWKA 1MN6A 1U7WA 2OZEA 2WJ4A 3I5MA 1O58A 2K5UA 3LYUA 1QTNA 3N59A 4QUBA 4M1OA 3VU8A 3JQAA 4EUSA 5L95A 2BTOA 1J0DA 1H8HD 3AB3A 3FCUB 4Y9DA 2IU0A 4BP9A 4MVYA 4B8YA 3GFGA 1LA2A 1Y8QB 4I5EA 4N3NA 3QFHA 4KQWA 2JARA 4LXTA 5FR2A 3KZ1E 4JVOA 3WDSA 1G66A 4RDHA 3RE1A 1XHFA 2DH5A 3QE3A 3HYSA 1CFZA 4P58A 1W0CA 5MN6A 1ZUWA 4O5AA 1VKNA 4YCAA 3NWEA 3ZVRA 4I1PA 2B94A 3ZNPA 4H18A 2ACKA 4HGNA 5CJPA 2Q1SA 4LG1A 1JEOA 1K9SA 3AVWA 1HE1C 3LP6A 4EKNB 2HYIC 2EBWA 4CMIA 2V4MA 4IIJA 2R7KA 1TL7C 1V48A 4UU8A 3I4FA 4OXXA 4DA4A 4RA6B 1JA1A 3CGGA 1CJMA 2BCGY 3BN3A 2LIPA 3KJFA 1J1IA 1EX1A 3F9RA 3WIUA 4NXNB 1C80A 2OY0A 3CZQA 3A6KA 3K4PA 3UMCA 3WSTA 4EG1A 4YX9A 4ZIRB 2PUWA 1K06A 1R7RA 3RSCA 4AX4A 4CGYA 4RHFA 5DT9A 3RU3A 4DM7A 4E2XA 3UUEA 2GSWA 2J5BA 1NU8A 3EXFB 1QS0B 5HCIA 1K7FB 1MG5A 4KXFB 1L4YA 4Y6PA 4PV7A 2ZI3A 2QPTA 1SVNA 1FE8A 3D4BA 1MB2A 3NH6A 4FW8A 4NU5A 4UM9D 1XQXA 3M0EA 3HWX1 1W73A 1VSBA 4Y7DA 1ECJA 4BNNA 1GO2A 1DADA 3FYUA 3PNLA 5IHPA 3N2NA 1RYBA 1Z3IX 4W8GA 1H4SA 3AI7A 1V16A 1W5EA 5KB3A 3MMPA 3TE7A 5GP1A 5DI3B 4ZVQA 2DTXA 4NJMB 1ULBA 4U3JA 5BYAA 4OQXA 5AM4A 3ZYCA 4DMRA 3A10A 1P0PA 5LDDC 1BW9A 3BHNA 3HCFA 3H2HA 2C7PA 3Q72A 5GJCA 1W581 4EPRA 3KHTA 4YA6A 3IT3A 4PBRA 1Z2EA 5CVEA 4RTQA 4KQKA 4RKFA 4Z1MA 2I3BA 4X00A 1W8IA 4CTMA 4UDXX 4B3RB 2H31A 3C24A 5LD2B 1C9KA 2JATA 3NLLA 3HBNA 3ESYA 3ZKAA 3J7AC 1PYOA 2QNIA 4JD5A 1QQTA 3HKDA 4LVNA 4YJFB 4CM7A 4HD8A 2QF7A 4M8NE 2IBMA 2ACWA 4MKRA 2O4CA 5CIQA 1M5UA 3PB3A 3P7MA 4YJGB 4NKRA 1NRIA 2ZIWB 4MI6A 2ONJA 4P53A 3GEGA 2AK2A 2ZPAA 4ZYXA 2HREA 1O94C 5JD6A 4TSKA 3V34A 2VSNA 3E58A 2JIQA 4Y67A 2GEDA 2WOJA 5JVDF 5KQLA 1NVEA 4Z51A 4OL0A 3LFHA 1E1NA 2NZYA 2DU8A 1IVYA 3DOOA 2FCAA 2JGRA 2PRIA 2FUEA 2GBLC 4G67A 1UK6A 3PX7A 1KI4A 1QGAA 1E4VA 2B1IA 1T8PA 3CBQA 3DOHA 4LKOA 1FTWA 1C5KA 3NQ41 4OJTA 2VT6A 1UKVY 5H02A 2ZSDA 4IEEA 4O4JB 4RY0A 3S68A 1EHIA 4LOHA 1NYLA 2ZRNA 3L0ZA 2OXTA 3S4YA 2XTZA 3TVTA 5TMEA 4M1QA 1W1WA 2RHJA 3U4IA 1U3UA 4V0QA 3D2CA 1FFGA 3EWIA 4WZZA 2VF7A 1G20B 4EA8A 2Z83A 2GNPA 1DLJA 3ZJ5A 3H2ZA 3G9XA 1P4JA 1U0FA 4KRGA 4E15A 4HDRA 4WE3A 3L0OA 4G9EA 2HADA 1SXQA 3WLAA 1ZLXA 3LZCA 1T6BY 4LRUA 4X1OA 4B3IA 4KE6A 1JDNA 2C0CA 4RKQA 4I5FA 1FJXA 1T2FA 4KDRA 4E31A 1UDRA 3J81A 4O1IA 2Y1XA 2CUNA 2IITA 4E08A 3TD9A 3Q9UA 5LVAA 2WWTA 1W8DA 4US0R 3QE2A 1O0CA 5C4MA 4IILA 3CONA 1OFUX 3MC1A 5I6DA 4L4RA 3E35A 3LLUA 4PLZA 1HH4A 3UV6A 2OM2A 1BCRA 1DO8A 4DQDA 1JILA 2JJYA 3R7AA 3NZEA 1U6KA 4DE5A 2VUTA 4GOMD 4JBXA 1VC2A 4BO4A 4TOIA 1C3OA 4GPBA 4JJ8A 5TB5A 1AGYA 3MCUA 3P2JA 3TNDA 1HEUA 1PEAA 2BEJA 3JWGA 3E53A 2OO3A 5E1MA 4Q4CA 5IN5A 1OC4A 5I9BA 4WL0A 4YHHB 1A82A 2H2WA 5SYAA 1OWLA 1A7JA 1IDN1 3RQIA 1AU9A 4Y1FA 1KQNA 3ZWVA 3L0SA 2WAAA 2HSEA 3NU1A 2NO0A 4DLUA 4M0FA 4DPMA 3T1OA 5LQCA 1CZHA 5DK6A 3BXFA 1EXDA 3LP8A 4BP1A 2G25A 1BTOA 1SN7A 4L4YA 1RWQA 4BZZA 2J7KA 4E88A 3H5RA 4QT0A 4IWNA 2HM7A 4M8IA 1LSUA 2HHHB 4GP7A 4O5OA 5JTUA 2Z3VA 2R6JA 5IVPA 1NPTO 3G2QA 1BKSB 4CT5A 1J33A 2P4UA 1YV9A 3JQ9A 4PQFA 2W43A 3JXEA 2QMHA 1G6KA 1I3NA 4JVSB 5KTYA 1PG2A 1EXWA 1F0YA 3E1SA 3LBNA 1U9ZA 2AFHE 1EFRD 1BZYA 1NTRA 4Y8VA 3I09A 2QN3A 2XMGA 1K8QA 4BYGA 2CHQA 1TU3A 4V0OA 7YASA 3IHTA 3BXGA 1GDDA 3ER6A 1G16A 2C59A 1S8OA 1N33B 4XD7D 3DAYA 4YIKA 1XXHE 5KZMB 1BRTA 2P9YA 1S2GA 1CY4A 1FRVA 2AGVA 3N6RA 1Z5GA 3IUEA 4NVRA 1FL9A 3QXHA 4YV1A 1I4DD 1UXOA 4KW7A 1U0BB 3BXPA 4DRYA 3E7FA 2ZRQA 1NF9A 3JR7A 1QOQB 4EKYA 4TWAA 3O3OB 4HNHA 3ZUPA 4ZCRA 4EFMA 1ZHFA 1J2TA 3Q6NA 2V6GA 2E37A 221PA 2GAFA 4IIFA 3VH3A 4F2GA 3QEAZ 1Z35A 1CQPA 2HHCA 2IW1A 3AT1A 3FWPA 1DKUA 3ZU6A 1RLTA 2CC2A 3C74A 3LY8A 1AMUA 4YREA 4FFRA 3I76A 1ZVQA 2CXRA 3KJIA 4L9WA 4LVOA 5KJEA 3RC7A 4HEQA 1XZNA 1NW5A 2NADA 1HTWA 3UH0A 2EP8A 2IU6A 4L8WB 4DBLC 5FLXA 2J3IA 4CUKA 4LF4B 3QWIA 5D7BA 3BIWA 4B35A 4AYTA 4CKWB 4RACA 1ZH8A 3C14C 1YI0A 3K32A 4B4UA 2SBTA 3PLNA 3FB1A 4NEHB 2VRWA 4TXMA 1U8ZA 1J2RA 1P0CA 3QOFA 3VR6D 3ZW7A 1QYDA 5IC4A 3W2IA 1FVHA 1P80A 3LT4A 2QUAA 2EW1A 1M7HA 3EDOA 1RJEA 3PNBA 2DERA 2JRLA 2FFAA 2A86A 3EDQA 1VGQA 1L8LA 5FHQA 5IKOA 5T4HA 1J20A 2DTDA 4KIFA 1FU8A 4CW7A 2DETA 2PKCA 4ZU3A 2I99A 2QRHA 3EDMA 2DPGA 4FGZA 2Y6VA 2AH5A 5C9ZA 1X7DA 1TUBA 3A7DA 2EHJA 2XGSA 2E4AA 2P9BA 1L5NA 4MWSA 4MVJH 1FW8A 2A14A 1ZMTA 2PBRA 2YWRA 1Y8RB 1ODTC 2AR9A 3ASUA 3P2MA 1EWKA 4U8HA 3OFNA 2FZEA 3TB6A 3RC9A 4WRRA 1IEWA 5IZCA 2QRVA 3NBKA 1VG1A 4A0HA 4UTRA 2P91A 4JJZA 2OFOA 2YWJA 3KT6A 3SLKA 1WZIA 3QYJA 4D7AA 1IZYA 4WASA 5B3LA 4HWGA 3DOIA 3R9XA 3R5HA 2XRZA 1OHHA 2Q99A 1XWIA 4MHTA 4PCAA 4U7DA 1RBYA 3FX2A 2NVUA 1FSFA 2Q50A 2QV7A 3BE8A 2Q9AA 3SXJA 3SJUA 2GS9A 5BPHA 4KVFA 1SVIA 1N5RA 3BIJA 4RW0A 2IC5A 1W36D 1SUDA 5BVGB 2Q6TA 4XXHA 3B1JA 4FM9A 2MINA 2B4KA 5JH7A 1W4AA 3DW1X 1UBCA 5H80A 2WIJA 5L6MB 1SWVA 4PPQA 5FFMA 1OU0A 2P9HA 8GPBA 4R8VA 2EGHA 2PN1A 3K9GA 4K3VA 3KSAC 3O9VA 3IEIA 4KB5A 1YZQA 2UUBB 1B00A 3QLJA 1F4PA 4LVUA 1Q92A 2CLLB 4WA8A 2PX4A 5CDHA 1H6CA 2JJ2A 3ILXA 1CY7A 1XSEA 1SOUA 3RO7A 5BRNA 1X14A 3HHEA 3IALA 2R0QC 1RYEA 3C7AA 1XZPA 2F1RA 3HDGA 5DRYA 3KJXA 1I8TA 3D1JA 2DKFA 2BR3A 4GR9A 4PZYA 1YQDA 3FD8A 4XM1A 4AJHA 5EKSA 2W22A 2P35A 5HIMA 3GPCA 4QXPA 4QUIA 5KTMA 2NZUG 1T1EA 2WVGA 2OXFA 3NKLA 3PWSA 3PUIA 1RLMA 3AWIA 1NZFA 4KLCA 3IEVA 5C4IA 2WPDA 3D5QA 3OX3A 2B8WA 1EWTA 1O03A 1SFRA 2M1ZA 2YV5A 3I3OA 1UOQA 4INJA 4QPCA 3C3JA 4GG1A 4CN9A 2QAGC 1GUFA 4DA0A 3STWA 4F6RB 1RM0A 4BYMA 5HQJA 5CVTA 3MW8A 2CNBA 3IT2A 4OP2A 3THRA 4EX7A 4ITRC 1ZA1A 4TMVA 2R751 5AI8A 5AKKA 3T7CA 3RYFA 2X9GA 3WL3A 4IJMA 4CL0A 2C9YA 3FOBA 4G5FA 4JLBA 2DWPA 4PE5B 4A10A 4BV9A 4LJ6A 2ZEJA 3W8RA 4EQZA 4V1CI 2C3OA 2H1FA 1CQJB 2VF4X 3KFXA 1JDSA 4CMAA 1X9HA 2ACEA 4D8TA 2Y2UA 3DFUA 5H83A 1TZKA 2WWWA 4HDCA 3FYHA 1BNCA 2H16A 3DL7A 3KS9A 3MOSA 1KP3A 1B2LA 3BM5A 1YS1X 3JD3A 3Q2KA 3TAHA 3L7DA 3R41A 2JVKA 3UGJA 2OFXA 2GPSA 2VHXA 2N1BA 3NPAA 1EM8A 3MCWA 3MJ4A 3VU9A 4JJ7A 5M29A 1QZ3A 1CQIA 2IYLD 4DLKA 1VKHA 1FSGA 1PWYE 3L7YA 5HIIA 3ZU3A 1GN8A 3T4UA 5AUOB 2HXSA 5ALVA 3A9TA 4J7AA 2HNAA 1DIBA 2JFFA 1W9MA 2ZIUB 2OVFA 4I6EA 1SHLA 4RD6A 1VLJA 3UCFA 3WBKA 4BB9A 3QA9A 3OCUA 2ECPA 4TWJA 1AHNA 2ETVA 3VVLA 1QP4A 3C43A 5ALMA 1VL8A 5FO1A 1ZHOA 4ETIA 3S55A 3LF1A 4MROA 1P73A 4NV1A 2WSSA 3A9UA 3PUZA 4K8OA 3AHCA 4LXQA 1YOBA 2FSSA 2AX3A 3N87A 4G01B 4X95A 3IHWA 2BFFA 4JJ6A 2CJXA 2W2VA 4XJTA 5DSXA 2OK8A 1LPOA 2F90A 1WO8A 4LV6A 2V5UA 2PK3A 1WDLA 4IUYA 1DFGA 1TCUA 4INOA 4X7MA 4B73A 4DAEA 2XW6A 5DSZA 4RTRA 1KXZA 5HMLA 3D6FA 5E4FA 4CF5A 2W9XA 4LZZA 1RT9A 4O29A 2OV8A 2V9CA 3DH0A 5KQPA 4YALA 2XCOA 2TMYA 3EEYA 2G4LA 5CT9A 3SHWA 4QUDA 1RKXA 3LOQA 3EHDA 1ZONA 3N3BC 1LK0A 2GXSA 1GTVA 3SFVA 1ODSA 3CJRA 3QXXA 3ZS9A 1D7AA 1C7JA 3H9EO 2VZ9A 5EZ5A 3V55A 3LVFO 3T8YA 5IBRA 1SQ6A 2ZDQA 3AVPA 4ZOAA 1NBME 2HHLA 1B6RA 1BMDA 2GJ8A 2XUZA 1CNEA 4S1WA 3ZV3A 3IT1A 4G09A 1XZMA 5I51A 1N2SA 1QQ7A 1FBNA 3MRXA 3E2MA 4I3GA 4AN1A 5M5BA 3LPCA 3M9LA 2ZXUA 1Z63A 1C1XA 4EL0A 4PS0A 5MHTA 3KYCA 1HQKA 1VZ3A 3RU9A 4BO0A 1FBTA 1VMKA 4Z8YA 4EYSA 4GH5A 4MRAA 5CFMA 5CDFE 5CCXA 3SCZA 1QWSA 2OV3A 3ANYB 5DYNA 2C8VA 3P2IA 1LGYA 1QHGA 2F64A 4Q9JA 4OSPA 3RRXA 5H4HA 2O2XA 3IODA 4JT8A 3CEHA 2PBZA 3F8WA 4JP5A 3M1LA 3KAKA 4AYWA 1U90A 5D3KA 1D6SA 2CY0A 3DV9A 1XRLA 4X6UA 1AXRA 3IAS1 4KFSA 4S12A 4YRDA 4YJHA 3RRYA 1ORIA 3OP4A 3TKLA 1PR3A 3OZTA 2DULA 1P29A 3TM5A 9ATCA 5KDDA 1OPXA 3BB4A 4YP1A 5TPWB 4QG3A 1QHSA 1DINA 1VBKA 2G6TA 2BI4A 2FE1A 3HVRA 1DIHA 1XQ9A 3MHPA 3CRRA 4YHBA 4JB0A 3VR0A 4B5KA 1P3JA 3GRZA 2QN7A 3PGKA 4PX9A 4MQ4A 5JAOA 1EXMA 3KPWA 3ACBA 4IZIA 3W7VA 1WX1A 3DBHA 5DCLA 5IFLA 3PCRB 1KFCB 2NXJA 5E7JA 1EP1B 3HJAA 3THSA 4AIRA 4HOYA 1LUAA 5AK6A 1NRJB 2W8BB 2OLEA 1UF9A 2ZR8A 4OAOA 4ZZIA 4LC9A 1YFLA 2QL6A 3Q3HA 4GM4A 4IGIA 1KZGB 2CN1A 4MCHA 4EUEA 2WV7A 3ENVA 2ZIZA 4MKXA 3BAFA 1XTSA 2RJ3A 5FI1B 1DT3A 5HHTA 2MYNA 3QX9A 2CL7X 2NM0A 3C5VA 3BMCB 4GP6A 4XYMA 5KDLA 1Q12A 2XE7A 2AEJA 5DM2A 1ADCA 2GLTA 1ZHHA 3ZNNA 4NABA 5A4DA 5BNZA 2QUBA 1WP9A 5BQ3A 1OZHA 3RK1A 2CB9A 4U1RA 4B3CA 1FUKA 2YVUA 3T5BA 5B2FA 1KZ7B 4GE0A 4W1QA 4MUNA 3RGWS 4BGVA 5A7FA 5EIAA 5F2KA 5BUQA 1Y1TA 3FAZA 1OH8A 2CNDA 4F11A 1TZJA 2XPCA 4LFBB 1OHHD 5IVDA 1ODKA 2H07A 2M2IA 4IXMA 4L72A 3DZFA 1PZNA 2QR2A 1CR4A 3NHUA 5FOTA 3WK6A 3ZWQA 5B3KA 5IRCD 3AFIA 2QQFA 3R5KA 1RCFA 3GLFB 5J5VA 1X3LA 5IUJC 5D3MB 4YEDA 4IIGA 4LHVA 1Q3KA 1Z34A 1YFKA 1HYQA 3E27A 5JI2E 1FVFA 1V0JA 2OG2A 4KJXA 1E9SA 5EGSA 1Q0RA 1WW2A 3PC7A 3V4RA 4W9NA 3VTKA 3PKJA 3ETEA 5A6SB 4ESEA 3DKVA 2ZUFA 1E2QA 5IARA 3I04A 1OA1A 4DYVA 3FWKA 2A30A 3PDIA 5FO0A 3CVYA 1EDBA 4X84A 1T8SA 4HH1A 4EPWA 2IEZA 3PD7A 4QJ4A 1JFFA 1D0VA 1FTNA 2I6QA 1U0EA 2EFYA 3DKIA 3DZ8A 3KKMA 4PXSA 4F2WA 5HKLA 4TYMA 3CY6A 5KU1A 3TZ6A 3F0TA 3AXSA 1SUEA 3TTTA 4BLTA 3LD9A 4FP9A 5B58C 1L6RA 5JOQA 1MA3A 4UZEA 1PZFA 2CZQA 3EGXB 4CR7A 1YWGO 4CRWB 2CNLA 4QQKA 2CMFA 1PV2A 4KLZA 1L7AA 2V7UA 3T3OA 4AFNA 3ESQA 5HTOA 1LRLA 4OBEA 3E8MA 3MLAA 2Z56A 1MUUA 2Q4DA 2ARKA 3V97A 3ZXIA 1BH2A 3VNQA 4GD3Q 3C70A 2CYAA 4CMGA 2HPZA 1ZH2A 3V5NA 3SC2B 3WRXC 2O7QA 1IEVA 3W5JA 4EY5A 2D8AA 1HT2E 2HW8A 2ZRLA 4DLXA 5I9SA 1PJAA 3B12A 1BGWA 2ALJA 1UBHS 3EFOB 3L46A 2IK8A 2JGEA 4FLEA 4Q3BA 4Q0MA 3T3NA 4IIXA 1XMSA 3MBOA 1GZ3A 3S2YA 4X97A 2C1ZA 1M0TA 2XD4A 1D2CA 5AJVB 4KOAA 3SR3A 3OEEA 2DUNA 3WLOA 1QFZA 1O9HA 4K6MA 3UEOA 4AG6A 4D42A 9MHTA 2FWPA 3QP9A 3A25A 1XEAA 2H5EA 3DTNA 1AIPA 2PS1A 4YRLA 5EJ5A 1W36C 4AMUA 3TLGB 4DQUA 4BBJA 2XGJA 4NTZA 3GRAA 2PT5A 2VDNB 3A4MA 4B31A 3AJAA 4NZZA 2Q1TA 1EBFA 1TVKA 4WZAE 2H06A 1FFBA 3ABZA 3NTLA 3QG1A 3EXIA 1IHUA 1R16A 3C2QA 1XZBA 2J0UB 4FWIB 3WAJA 4KREA 1L4HA 4PU0A 1K75A 3VC2A 2R11A 5B6IA 5ALEA 1CY1A 1QGUB 4WN9A 3EH2A 4YV7A 4KG7A 5IC5A 1T9GR 2PV7A 3N6VA 3R3XA 4RJIA 5SZHB 4NMXB 5YASA 2YBEA 3TTWA 1MV8A 2A6PA 3JWHA 1Y3DE 6REQB 1H3NA 2V7XA 1KIFA 3UAXA 3L92A 5HKKA 1NUAA 1T5IA 1WJGA 5L7WA 5K99A 4UHDA 4QM6A 1R10A 3L01A 5D5PA 5GGXA 1QIJA 2MSKA 1PLKA 1RFLA 4CIAA 1ZU4A 2QTBA 1LRJA 4UCFA 3KU4A 2QXYA 2A3RA 1JJBA 2HLDA 2MSEB 3KDAA 1KR5A 2WI8A 4UM7A 1BQ4A 4LRSB 4TS3A 2J5KA 3QXCA 4MGZR 3ROKA 3UG7A 3T99A 2FN4A 1P18A 1NUQA 1CUIA 2W4MA 5LKRA 2DQZA 4I4IA 1YVPA 1FQKA 4IOMA 3ZXUB 3MAGA 2HLPA 1QIEA 1IUOA 3BCHA 5JVDB 4YY3B 3EVFA 1UK7A 4MW9A 5HRUA 1KI8A 4W5WA 5A06A 5CBKA 4L50A 3LE8A 1DXQA 2AWOA 4Z4GA 2CF6A 4MW7A 3QI7A 4H1UA 2H2HA 4ZYWA 3WVNA 2JBHA 1DL5A 4D26A 1KJNA 2GO7A 3D0OA 4G07A 3ULKA 3VA7A 3RB8A 4ZC1A 3CVXA 1Z8FA 5C8YA 4FINA 2UYCA 1AZSC 1SUAA 2ZIEA 2MSDB 4FTWA 2NT3A 4KXUA 3E5MA 4KQHA 1YDWA 3U1TA 3D6NB 1MJGA 2QPOA 2WRZA 1BX3A 1JXOA 3B1WA 3IH5A 3KB1A 2E4WA 4UTPA 5K6AA 3TTXA 2M1XA 4EKDA 3VSBA 2P6RA 4DC9A 5JV5A 1US8B 4OHUA 1R0SA 3ZZ0A 4DQKA 5AVXA 3E9YA 2AJ8A 2JCXA 3KRTA 3GEHA 3AF6A 1X1CA 1S8FA 4K5QA 5DBIA 2VTBA 3KYJB 3TPFA 3CWQA 5E1OA 2BBOA 4LYJA 4PRYA 5IBPA 1IHYA 5GZ6A 2HOQA 3A06A 3X43A 3BDVA 5HILA 1FU7A 2OM6A 4MCJA 4DCJA 2I7DA 3DFZA 4O4HA 3R5XA 3VYUB 2X15A 3WOVA 2WU3A 3L8DA 3U3XA 1PIWA 5IK2D 2WWGA 5KTKA 5AM0A 2C4NA 4WDRA 3GLSA 4L6IA 4YO7A 3N8HA 2ZJ5A 2QD2A 1RHKA 1YZHA 5FOXA 5H3LA 1S2IA 4TN1A 1II9A 3DSRA 5BWCA 2VYQA 4X1IB 1YA4A 5EIXA 5JSUA 1VJ5A 2Y1FA 1KC3A 4YCLA 1QJCA 2O8BB 2PGNA 1Q7RA 1GKUB 1ZGJA 3KZMA 4QDUA 4YRKA 4MS3A 4LTMA 2YCBA 2PKYX 2D6FA 1M6EX 1P1HA 1VRWA 4A9AA 1VPVA 2BFEA 2EYQA 2YMLA 4QYSA 4B09A 2HD4A 4G4JA 3LV8A 2GF0A 2GFQA 4HB0A 5ESDA 6Q21A 1G3IA 3K05A 4I2VA 4O08A 2FUG1 4CFZA 2VSXA 4Y2GA 4MI9A 1WKVA 4FE7A 1MVOA 1W76A 2G08A 4TWRA 4L9RA 5JW6A 1L4GA 5IWAB 2VH2A 1E6LA 2I2BA 4LXGA 5FBHA 3UC9A 5IAKA 3EEQA 1W30A 3H9CA 3HXOA 1B73A 4E1BA 2PUDA 3M4ZA 3S5JA 3AEQB 3ELDA 3AHDA 2FW7A 3F4BA 5DT2A 5I4IA 4F4CA 1WZNA 2DCUA 5SY6A 4TYWA 3OLZA 2X8WA 4PQRA 4B3GA 4ZMBA 4DR6B 1U0RA 4BNJA 5ER9A 2PJZA 1Q19A 3NHZA 2XIQA 1BE0A 1O8CA 1SXIA 2ZKLA 4KL8S 4RXTA 3LUJA 2R5FA 4OQQA 3SJCA 4B2LA 4QUAA 2O2ZA 2HR1A 2YJ6A 3ELBA 2HMTA 1ITZA 5HZHA 1HORA 3R3ZA 2DYKA 4AZ3A 5ADUS 3AI3A 2MSWA 4B6OA 2PSJA 1K4KA 2HCFA 2RSLA 4IDAA 3ZI0A 2QZPA 1UKEA 3K20A 5HDBB 5JLAA 3ZZ1A 2OBXA 4FD3A 3WGZA 1CV2A 1TCBA 5JXWA 3PHCA 2YTZA 3T5AA 3GCGA 1KK3A 1LDYA 1GKLA 2OGUA 1KHTA 2WE7A 5A62A 2COUA 4PYMA 3IR7A 5K8CA 2D5AA 1FP6A 1NPDA 5BMOA 4P92A 1PKXA 2W98A 4RPJA 3MAAC 1TIBA 5K01A 3QTBA 1ID8A 4DG9A 4CEIB 5E8JA 4TYNA 1MIHA 1X8KA 5IAGA 1KEEB 2V7PA 1JIIA 2C5FA 2EX4A 2UXBB 1ESDA 2PWZA 2C98A 3IRUA 4IH4A 3AHIA 4Q47A 4RDXA 2EFDB 4ODIA 5K4HA 4AP6A 1RIFA 1EB9A 3UCEA 3WLMA 1OWOA 2QHXA 1RWPA 5AYVA 2E5WA 3SIXA 2RD2A 2H1OA 5DTQA 2JB9A 4BKOA 2E49A 5A9SB 2REQA 4HDQB 2FZCA 4TGLA 1WOMA 1JJ7A 2B2CA 1X1SA 2VDWA 3DDOA 3O8OA 3P32A 4MTLA 3K09C 1F9EA 3ZU4A 1FMTA 3JWEA 1XAHA 1RZ3A 3QUBA 1X9GA 2Q2OA 1G8GA 3NHSA 3OEED 2VUSA 2GVDC 3OHPA 4UMDA 5HIKA 2CGEA 1A5ZA 4QELA 4XCVA 4ER7A 1K4YA 3M5CA 1WETA 2G5GX 1FP1D 2ZBQA 3EC2A 5CNMA 5FBZA 4ZGBA 4JA2A 5AVKA 4BNYA 2P3LA 4JJ4A 3A31A 3RWBA 3OETA 3DQPA 5EWLB 2AN3A 2EP7A 1XWWA 3I53A 3RT9A 5IAAA 2Z09A 3LGSA 3S2GA 1YFZA 3FTCA 1C30A 3K8ZA 4HQFA 1OBFO 3UK6A 3OU6A 1VPTA 3FE2A 1OAKA 3HZZA 5C46F 1RPAA 5CURA 2XCSB 1IK6A 1SOVA 2H18A 2WU0A 4FC7A 5KYUB 1XFDA 4ED9A 1EZ4A 5J2TA 1ULAA 5DPMA 3TSCA 2PZAA 1UBFA 1JYSA 2IIPA 1PT6A 1Z5OA 3C6ZA 4LV8B 4R2WA 2Q46A 4IV8A 3AGQA 4D9JA 1YZFA 4C87A 4PSAA 4A8HA 1KKUA 1E99A 1JJIA 1N2CE 4R0NA 3KVOA 1BWPA 3K6RA 3QPAA 1R4MB 5D5HA 2A7QA 4A0SA 3DNMA 4C21A 5H3HA 1I10A 1T4GA 4LQDA 1SA0B 4DLLA 4HFMA 1PYDA 3R8CA 2CEKA 1DAFA 2NT4A 4DJJA 4HAZA 2IVFA 4XYEA 3JY6A 4HHEA 4DSZA 3B53X 4RH0A 4F9TA 1Z68A 5AKYA 4WOBA 1VCHA 2XUJA 1E5TA 3L6CA 4UBLA 4YRFA 2Y0BA 2UZ4A 4KHPB 1YB6A 3DZHA 2CSXA 2XXAB 1PTJA 5H81A 1L1QA 4EF5A 3W5UA 1QRRA 1Y63A 2P68A 5BV7A 3WHLA 5KI6A 2FSPA 3WWOA 3PA8A 5FFFA 2QTWB 3C3KA 4IHKA 4BFVA 4D4GA 3KWMA 4BFWA 5K9ZA 1A5AB 3BDAA 2VHCA 1MEOA 1ZCFA 4UJ3A 1C0PA 2Z8XA 3RU2A 3FUWA 1QFSA 3ZGYA 2Q5IA 3UV7A 3VAZA 4XLLA 4GU5A 4PNEA 4A36A 2NNWB 1EUDB 5EHNA 3KYBA 1M9NA 3MJCA 3UGQA 5BP7A 5IKPA 1CDEA 2ODTX 5E3IA 4IS3A 3GPLA 2VAPA 3GMDA 3KTDA 1J56A 4PQEA 4MS4B 4F93B 2YHIA 2ZULA 3HMQA 4LBZA 5BR8B 1J8YF 3UCXA 4XUCA 3GLIE 3ZJTA 3JD1A 4DEXA 2NP7A 4MRMA 1NONA 1GQRA 1BE1A 3KKZA 4IHJA 2C2WA 2XRFA 3REOA 4DMKA 3USCS 5ARBA 4WXHA 4D4JA 4TL9A 4CHGA 2HWKA 3SJAA 2AYXA 1JHAA 2PKQP 4UEJA 4U0JA 4EHHA 4CEJB 1RAIA 4J3NA 1JA9A 5K0NA 2XCLA 1P4SA 1RXCA 1EDEA 2WVJA 4MGHA 1ODLA 3G5UA 1NXXA 4N3GA 1M1YA 3DQQA 3DDWA 3UAVA 4NBSA 1OLUB 2ODNA 1HQDA 2FOLA 1IE3A 2DM6A 4HSEA 5E6UB 1QPBA 1V71A 3G2JA 2BE9A 1H8ED 2GTPA 4MHOA 4MMXB 5DDIP 1JEEA 1DBSA 3B78A 2QRNA 2VAXA 3ILVA 2XYHA 1BXRB 1ANKA 2WYUA 4MKHA 1M2WA 2HJ9A 1ZGHA 1BHQ1 2H0QA 1WSBA 3E03A 3IV6A 5G1OA 2O0HA 1TD9A 4C04A 1RXIA 4IMPA 4JROA 3LDGA 3LJKA 3H65A 4K26A 4D3SA 4PCUA 3S29A 2BZ1A 2GCOB 2ZITA 3WWEA 4UD6A 5AJUA 4FFPA 4Z4IA 2I1WA 2J9RA 3W3AA 4P7KA 2IEGA 4RHXA 2W00A 3ZDDA 3AF2A 5K1ZA 3OZSA 3SNKA 4NR0A 4Z8XA 3SSMA 3RUCA 1DAKA 4TM7A 3OOWA 3CGWA 4IHAA 4LY6A 2AOTB 1E5XA 3DUFA 3R3JA 2HO4A 2JD1A 4KQ9A 2AT1A 3F6EX 1SKUA 3GGDA 3RJZA 4MWGA 3RUEA 3VJMA 3WLFA 3GAMA 1OIWA 1JH9A 2JHCA 3T94A 4DLNA 1XCPA 3KEOA 3QE0A 4WK0B 4NHEA 2UVQA 1GPBA 2EGUA 4XZ3A 3A3PA 4P5EA 4JI1B 4AG5A 2C7GA 4AF8A 4MQBA 1ABBA 3G2KA 4LF5B 1P61B 1IRIA 3F6BX 2SKCA 4HXGA 2GO1A 2UUAB 5BXQC 1IUKA 1H2AS 2PE5A 3OOEA 3TDKA 5CB6A 2WG0A 4UNPA 1TFUA 4OSOA 2PLNA 1PRYA 4IRXA 4RMJA 3HPRA 4MQEA 1UINA 4P86A 1D4OA 1IDOA 1M33A 2WJPA 1EVYA 3EVTA 3FWNA 3KYIB 3DJFA 1KEVA 4LWOA 4KR6A 1Y1SA 4UVEA 2AV6A 1PWZA 1LJUA 4Y2YA 5DBEX 1OKKD 1Z56C 4GMGA 2ADFA 3O0TA 5DLYA 3UHPA 1I6WA 3G23A 3RADC 4LJKA 3AEZA 1IEXA