1RFGE

Crystal structure of human purine nucleoside phosphorylase complexed with guanosine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human PNP complexed with ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 83
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rfgE00
4LNHA 1K9SA 3OOEA 3MMSA 4WKPA 3LA8A 4OF4A 5CCEA 4YJKA 2HRDA 2AI2A 1SD1A 3IEXA 4L6IA 1V4NA 1C3XA 4D8XA 2A8YA 1JP7A 4WKCA 1OV6A 3U40A 4DAEA 4GLJA 2Q7OE 5CYFA 4OJTA 5F78A 4MARA 4P54A 5CCDA 1A9QA 4YNBA 1JPVA 2I8AA 3DF9A 1T8RA 1U1GA 2A0XA 1CG6A 1I80A 1OVGA 1YQQA 1NW4A 1JDUA 5EPUA 4TXHA 3SCZA 5I3CA 4OGLA 4G8JA 4UC0A 2HN9A 1A9PA 4DA0A 3FB1A 4LNAA 4L5AA 1CB0A 3BJEA 4ECEA 1PR2A 1ULAA 1PR4A 1V48A 1PR5A 4TTIA 1RSZA 4F3KA 2RJ3A 4EARA 2H8GA 3TL6A 3PNSA 4TXNA 2HSWA 4TXJA 5IFKA 4GLFA 1Z5OA 2P4SA 3ONVA 4M1EA 1TD1A 5FAKA 1A9OA 5K1ZA 1PR0A 1ODIA 1VHWA 1JE0A 3E9ZA 3OCCA 1VMKA 1JDZA 4U2KA 2AC7A 1Y6QA 4NS1A 4G89A 1A9RA 1JYSA 5B7NA 1Z39A 1VHJA 5F7ZA 3NM4A 3O6VA 1Z34A 2A0YA 1OU4A 4F3CA 4TXLA 5CXSA 3BGSA 3F8WA 1JDSA 4TXMA 2BSXA 4F1WA 3OOHA 5F77A 3LGSA 4KN5A 1PK7A 3KUKA 1JDVA 1JE1A 1Z5NA 1RFGE 4OGKA 3BL6A 1NC1A 3E9RA 5F7XA 4MCHA 1ZL2A 3QPBA 4LZWA 4LKRA 4EB8A 4L0MA 3O4VA 1PK9A 1V3QE 3UAXA 4H1TA 3OF3A 3IOMA 4MCIA 4GKAA 4BMXA 5ETJA 3UAYA 3FOWA 2OC9A 1U1FA 4QARA 3MB8A 1PR6A 3C74A 3OZCA 4DA7A 4TS9A 3KU4A 1RCTE 2HWUA 3E0QA 1ODLA 1YRYE 5DK6A 3NM6B 1A69A 4I2VA 3PHBE 3EUEA 4G41A 2I4TA 1OUMA 1QE5A 4R2WA 1YQUA 4OY3A 4F2PA 1B8OA 5B7GA 1XE3A 1ODKA 3KVVA 1OTYA 1PR1A 1ECPA 3DJFA 3K8OE 5CXQA 4IP0A 4QAQA 1JDTA 4D98A 2OECA 3DDOA 1VFNA 4DA6A 1K3FA 2PGAA 1G2OA 3GB9A 1RR6A 2QSUA 4BMZA 1Y1TA 3OZDA 1Q1GA 1V41E 3P0FA 4PNPA 3UT6A 4DARA 1Z38A 3UAVA 3NM5A 2OC4A 5KB3A 4QEZA 1U1EA 1TCVA 4WKNA 1LVUA 4TTAA 1RXYA 4DABA 1SD2A 2XRFA 4D8YA 1OTXA 1T8WA 3KHSA 3EMVA 4R31A 4L5CA 4NY1A 1Z36A 3GGSA 4DAOA 1ODJA 5F76A 5B7PA 1ULBA 1ZOSA 4WKBA 1RT9A 4TS3A 2GUWA 4DA8A 1V45E 5JPCA 1NC3A 1U1CA 3OPVA 1T8SA 4QFBA 4K6OA 4M7WA 4TYMA 4BN0A 3UAWA 4QASA 4YO8A 2ON6A 1PW7A 5F73A 3K8QA 3LBAA 1PBNA 3OZBA 1TGYA 1LV8A 4QATA 1Y1QA 2OXFA 1PKEA 1A9TA 3KVRA 4JP5A 1TCUA 1RXUA 3FWPA 1SJ9A 1SQ6A 1K27A 2QDKA 2B94A 3PNPA 4YMLA 1TGVA 3ODGA 2QTTA 4M3NA 1U1DA 1Z33A 1PWYE 3ENZA 3PHCA 1T0UA 2ISCA 1FXUA 5IU6A 5F7OA 3DP9A 2QTGA 3BSFA 1Z5PA 4TTJA 3NBQA 1M73E 4LDNA 5C80A 1Y6RA 1YBFA 2IQ5A 2QPLA 2AI3A 4RJ2A 1Z35A 3DPSA 4PR3A 5CYGA 1RXCA 4JOSA 3INYA 4X24A 3KVYA 4FFSA 1RYZA 3UAZA 5F7JA 4DANA 4D8VA 5EUBA 3T94A 2A0WA 1YR3A 1B8NA 3FNQA 3FUCA 4OEHA 2AI1A 1Z37A 1V2HE 1N3IA 4D9HA 4GMHA 3D1VA 3EEIA 1Y1RA 3P0EA 4NSNA 1T8YA 5B7QA 1WTAA 1PF7E 4WKOA 1RXSA 4F2WA 4L5YA 5EFOA 3FAZA 3OZEA 4R2XA 1A9SA 1Y1SA 3EUFA 4BMYA 1LX7A 4JWTA 4E1VA
chains in the Genus database with same CATH superfamily
4MVJA 1VI5A 4FI3F 1NTOA 1A7KA 1P6QA 1Q16A 2YFHA 3MGKA 4GI5A 1OYWA 2RIRA 3EFOA 4O3FA 4YRQA 3LQKA 5DM1A 3RBAA 2ZT5A 1Q3KA 1RPAA 4KUHA 3PTLA 3B5EA 4XWGA 3UMBA 4E1BA 5MFZA 4WESB 1NFRA 2C9MA 3I58A 3GXBA 3H99A 4C29A 4AKEA 4FKMA 2NU7B 5J2TB 2WD7B 1DS6A 2GZ1A 4KJXA 1SD1A 2Z1DA 1PZEA 1FXWF 1P6UA 2JA1A 4WOBA 4CKYA 1J70A 1OILA 4B3MB 4NV0A 2YV4A 3CVWA 4Q7LA 2AJBA 3KR1A 4YCJA 4YDQA 2GZDA 3NOXA 1AO3A 4LK3A 5DLEA 2HLDA 1Q50A 3EMBA 5K3AA 4ZHSA 1TADA 1L7BA 4PVDA 4X1IA 5A06A 5HVNA 2OAP1 4JR0A 4LYHA 1J2EA 4X7BA 1EX9A 3NHWA 1P33A 1E9RA 2RAFA 4JHLA 1G0NA 1SVWA 4KPUB 1N2CB 3AUXA 4HAOA 4ZVMA 1RHQA 2XADA 4Z7QB 1TZMA 2RG7A 3MFQA 4NWIA 3N6VA 3NC1C 1E5DA 1GKKA 3GRUA 5FPSA 2R8YA 2CGEA 1IB0A 4RKEA 4UUPA 1NBWB 2XUFA 4BYGA 1D6JA 2YVAA 1YHYA 4M6WB 1LCIA 3L49A 4HGZA 4JROA 2LNDA 1WV0A 5HBRA 4EX6A 3B82A 2VWPA 3JQAD 2XCQA 4OAOA 4QLAA 2WHPA 4GZ6A 3I37X 3K72B 1H4SA 3DC7A 4BVLA 3OMWA 5JSZB 3PIDA 3MPOA 1DCMA 5HR5A 1II0A 4RMHA 1U6JA 3NHYA 3RU3A 1XMXA 1GA4A 3FPLA 3ZS8A 1NWHA 1KAMA 4CR6A 1L5FA 3QWBA 3RI3A 2E1PA 3PQ6A 4W8OA 2VPZA 3GPDG 3ZDYB 3HBMA 1FLDA 4JR1A 2WJZB 4FDLA 1YZLA 1MX3A 5A4FS 4UHCA 2HAEA 1J39A 1ESZA 1MX1A 2PH1A 1Q7EA 2E2WA 2Q9BA 1G98A 3KIPA 1CSEE 1P9LA 2GCOB 2I1WA 4GBMA 4HXFB 4R6XA 4S24A 1ULAA 3VYUB 3VZDA 2QUKA 4QGGA 1RWBA 4C4TA 3LCVB 5K0GA 1PR4A 2ACKA 3LVFO 1LVGA 2X8BA 3IUBA 3VC3A 3K35A 2Z4RA 1FF9A 3EXG2 5AKHA 1N2XA 1U7HA 2N1MA 4DGQA 1A1VA 3E70C 3AEKA 3VR4D 4YYZA 4BS9A 2BTQB 3AF1A 2NYUA 1LNQA 5EIXA 1TVKA 3HO8A 3MUNA 4GPTA 2O5CA 1U7OA 2WVHA 4TXJA 3H4TA 5I45A 5LQSA 1Q44A 2AFIB 4R8MA 5KQLA 4RZIA 4Q37A 4G07A 4DNXA 2G70A 3B2NA 1KO7A 3HBJA 4F8YA 4PQYA 3ONVA 2X7HA 2B8EA 1RQ2A 2QY9A 3LFUA 3D64A 2ISSD 5EE0A 5EIAA 1V5GA 5EUQB 4NZPA 1E3SA 3TJZA 4H1WA 4RPJA 3KJNA 3U31A 3B3FA 4QTZA 1EFUA 1RHUA 5KJ6A 3OJEA 1U28A 2G09A 2GNPA 3LO8A 1B8PA 3DE0X 3TQSA 1SOUA 3MHTA 1TMYA 3ZOKA 4NULA 3V4ZA 3O90A 4ZHQA 2GN4A 2EG9A 1ORDA 2ZXEA 2RCNA 3NM4A 1G5QA 3O6VA 1RKXA 1MABB 2OFPA 3IDQA 3LSYA 3Q7RA 3V2HA 1XAIA 2WJJA 4Z0PA 1RAAA 3RODA 2NSJA 3REOA 3L82B 2OQIA 4ND3A 1XTIA 3SG0A 2H3HA 4C87A 3FPEA 2HFJA 3JQ6A 5C81A 4DR5B 4G5RA 4I1IA 5D3MB 2H9AA 4D4JA 3H9GA 3UJDA 1MNAA 2ZREA 3WWPA 1DKUA 5FOTA 3VMFA 2GOYA 4CGZA 3QXCA 2QN1A 1H05A 4QRIA 1LRKA 2DVMA 3UWSA 4CNBA 2GEDA 1TC1A 2E4ZA 6YASA 3IE2A 3PHHA 3PFBA 1DB3A 3UB4A 1GPBA 2Z2YA 4FXPA 4K6FA 3U3RA 3WTBA 2FR8C 2G5PA 5JAZA 1GNVA 2JGNA 3JQDA 1XVUA 2XE4A 4TUYB 2ESRA 1DGQA 4S1PA 1XZPA 4TV9F 2CFOA 1YULA 2FETA 3HR7A 3VPSA 4ESHA 3CBQA 3ELBA 2UDPA 1UK7A 4P4SB 4XTRA 1M1XB 1G6KA 3NTUA 1JSXA 2CXTA 2FEMA 2ZRKA 4FLEA 1Y48E 3QHQA 1D7OA 5LPNA 3BEOA 4RO0A 2FX3A 1LEHA 1B2RA 1FP6A 3CWQA 1O96A 3OF3A 1SOMA 4MQEA 1MAVA 3CLKA 1I8TA 2YN2A 3BERA 3GVCA 4O4LA 2W6OA 2CB9A 3HRHA 4TKLA 5ETJA 1KJ8A 3TB4A 5IKOA 1SN7A 3GLGE 4OI0A 3PNKA 4LOLA 1OH8A 4BLWA 4ZJPA 3K5HA 1KFCB 1Y6JA 4L4UA 1PR6A 3TRJA 3VGPA 3WJAA 4YV0A 2YIMA 5CBPB 1AV7A 3COVA 2IK8A 3MELA 2P90A 4DA7A 2V5UA 3LBNA 4JAVC 2YWHA 4HXEB 3CYFA 4IEFB 3PD1A 4HJXA 5E4FA 2DUNA 3YASA 2SKEA 4FOTA 4GPIB 4AX8A 2E4UA 4AFNA 2JLYA 2QPTA 4WOKA 3CR8A 1F2UA 2V65A 3BIWA 2V6JA 5J2TA 1ETUA 1JZQA 1UC8A 3I6IA 1ODTC 1P61B 1Z83A 3K9BA 3QLJA 4ER3A 3ZDFA 2EKDA 4F60A 3GBSA 4KFRA 3PR3A 4MI3A 3VU9A 3T3EA 4D97A 4ZVKA 1R5JA 4TT3D 3VUFA 4BKQA 3EVFA 4OY3A 2VQSA 1XT6A 5IP5A 4ZI5A 3VSDA 3UPTA 3L46A 3H11A 1HA3A 1ZAKA 2EJBA 2ZRFA 1ZISA 2CVFA 1I3OA 4JP2A 2VK8A 4HDKA 2I4RA 3P9RA 4JCOA 4LHYA 4CMEC 2VPXA 1GG8A 5KDDA 2GD6A 2YYYA 2GF9A 3L0OA 3WL4A 4YAIA 3L18A 1XL1A 1ZLXA 4MIYA 5AYVA 1K8QA 4YALA 2ODEA 3CUTA 3KHTA 5BMVF 1QYDA 1NIPA 3PDWA 4B47A 3W1VA 1FMLA 4QFCA 1KIAA 1HT1E 3QYPA 4AJ9A 1M0EA 4IJQA 3KQYA 1BH6A 1ML4A 3S2EA 3C3JA 1IBCA 1RE1A 5AVXA 1K6XA 4ZQCB 5GOZA 4A10A 1MW9X 3CVOA 3UGKA 3ETLA 1X80B 2A2ZA 1V6SA 5AKZA 1KAEA 3O94A 4DA6A 2SNIE 4BWGA 3PFHA 4IIXA 4CM1A 2NZYA 1ZUNB 2IYPA 3HPQA 4EGFA 2V55B 5K4AA 1G8GA 2I4NA 2P2CA 4GOJA 4RXMA 1MVNA 3VR5H 1W76A 2NOAA 5REQA 4FB4A 1GARA 1NJ1A 3PYXA 3RC2A 4OUKX 3NU1A 3U62A 2H48A 5CHYA 2ZRQA 1L7MA 3WBJA 1ZHOA 1Z7YA 1V16B 3O8QB 3S8MA 1TT7A 2I7DA 2VG8A 1MTZA 2ZU6A 5CFRA 4BZXA 1PNTA 1X7YA 2XZDA 5AUQA 4BV9A 2P65A 3THSA 3DDNA 4FN5A 4I1UA 4DARA 4P7FA 2LW7A 4D6XA 1KO4A 2Q27A 5CA0A 2CSXA 2F90A 2X5XA 4F3YA 2KX7A 4PZ0A 4G1EB 2HBZA 4TQUS 3T0GA 2DBZA 2EP7A 2OBMA 3CX8A 2ONJA 1T91A 3MJRA 3WXBA 4G9BA 1M76A 4RIHA 1A1SA 2D13A 3LQ1A 3LY7A 2QQGA 4KI0A 2MR5A 2P9EA 3OP4A 4KH1A 3UV7A 3ZH2A 1ORHA 1VGVA 4D79A 2PPLA 3H9JA 4AULA 3WMGA 4D0RA 2FJUA 2ASEA 3V2GA 2I4IA 4S05A 4OYLA 1EUYA 3WKAA 3U80A 3H84A 3K1AA 3UT0A 1RMQA 3ROZA 2D8AA 2F7SA 5LP6C 1FCJA 5KNCD 2NXEA 2ACEA 2B78A 3ND6A 2I03A 4L5CA 4MXDA 4N6GA 1GNQA 2FZ4A 3BPSA 3VI3B 3UMGA 1G60A 2ZJ1A 3HA3A 1TE2A 3LK7A 5HK9A 1LWNA 2W43A 4CT0A 4L9SA 1HLFA 1ODJA 3UEOA 3SYKA 1F7UA 1HT0A 2MYTA 5LOVF 1WD5A 1J7KA 3DZDA 5EWJB 3IT1A 3OT1B 2B98A 1E6UA 3KJGA 3KNZA 4ESOA 4OL0A 3U16A 2C3UA 4HGRA 3DFUA 4TS3A 4KR3A 3T0IA 1U63A 1CP2A 2HSDA 1B74A 1LS1A 4JDPA 5TQ0A 1U8AA 2G63A 3ZN2A 2ZM6B 4GOOD 2FQWA 4NU0A 3SNHA 1R4NB 5CDSA 2M6KA 1BXZA 1SKYE 1FSZA 5LKAA 3AHDA 4B6OA 5AKKA 1ZIDA 1P3JA 1Q0PA 2W6QA 5TT1A 1IATA 5DCYA 2AQIA 2Z5VA 1NVEA 4IH9A 4MEJA 4TYMA 2VAWA 4YP5A 3I45A 4YO8A 3BMOB 4XYMA 3EC7A 2R9VA 3K1ZA 1E5QA 3UW1A 2ZXUA 3I5XA 4R9RA 1P17A 5FBZA 5FTWA 1ISRA 4UM9B 5EHQA 2C2YA 5JJCA 2VR1A 2MIIA 1EB8A 4KV7A 3BK7A 3MRTA 1UH5A 1X86B 2AT1A 3KTAA 4R68A 5E1DA 4DA9A 3IBYA 3QVSA 1J0DA 2QMHA 4FR5A 4L73A 4E12A 1ADJA 4ZPJA 5FTMA 4DTCA 1CQZA 3L0CA 4P5EA 1TMOA 3KZMA 3N0VA 1KS2A 2VA9A 1QKKA 2PRYA 3EFEA 4QATA 4CKBB 3M34A 1WUYA 1KYWA 1QHEA 3LK6A 4YRNA 1FUKA 2AE2A 2ZTMA 3CNLA 4PHCA 2O8FA 4HLCA 2GFIA 3CUYA 4Z3OA 2BWJA 4MWEA 1AUPA 2CLHB 5KTNA 2Y1OA 1ISSA 1K5DA 4FMCB 2VHTA 4JB2A 1SK9A 4QX6A 1S89A 5J2TF 2R7MA 4ESEA 4CQMA 3GUYA 3F5DA 3ZQJA 2VS1A 1O54A 2DQYA 2F2TA 2NTYC 3EPRA 3P2EA 4FX2A 4MKHA 3ETGA 2LP4Y 4UEKA 3U0BA 5IZCC 5JBIA 3AM4A 4OM7A 4XUEA 5JS7A 2ZWAA 5J63A 4UCWA 4KQ9A 3IP3A 2HU8A 4YQEA 1NT2A 4LRYA 3LFTA 3KR2A 4DIFA 4LF7B 3L4EA 2XGOA 1HZZC 4QSHA 3OLWA 1GUDA 1NXOA 3R9IA 3BRWD 4YAUA 3P9KA 3IODA 1ECCA 2NP7A 4NYMR 1RYDA 1KAHA 3DTYA 1JPJA 3ZLUA 5IJ9B 3B60A 3PPWA 4OA5A 5DTMA 1N9GB 4KXNA 3WMFA 4J91A 5CH3A 3B3GA 4BWFB 2QN7A 1G0OA 4H27A 1J8DA 5E1OA 4C3OB 5AW0A 5C53B 3BSFA 3C4JA 4TYPA 4HDNA 4DSOA 2YUTA 1CUSA 2W4MA 2GBPA 4IWNA 5BNFA 3U49A 3KQKA 1XTJA 3MOIA 1E2IA 3U17A 5DK4A 2PSSA 2C5LA 1T26A 2J8ZA 3CUKA 2WKWA 1DC7A 3VHXA 2FSIA 1TVKB 3A31A 4RJLA 4W5JA 1IOZA 3NETA 2PMFA 3B6EA 4G0PA 4V2UA 4GDMA 5KJEA 3X2FA 2PKYX 5CGZA 2QTZA 3GAMA 3AVPA 1XX6A 2XKAA 3N28A 3GJRA 1DTEA 3QBEA 4ZOAA 5ADUS 3H9EO 3OE7A 5JJIA 3V4SA 1XLVA 4PQGA 5T67A 3B6KA 1Z7EA 5JJKA 5K3EA 1I1HA 4BEVA 4HVCA 1MJ5A 4QXPA 4FHDA 3PEUA 4A6XA 5FOQA 1RQNA 4DJFC 1QHYA 3K92A 3MG9A 3OHSX 3RUHA 3ZPXA 1P7YA 1C7QA 2IDMA 4HNSA 4U7WA 2W2NA 1N2HA 4XB1A 3K1JA 3X1WA 4DANA 5KYUB 2O54A 2A9RA 2ZAYA 5JD4A 4KR0A 1FLAA 1YR3A 3FNQA 5FOUA 2PBZA 3F90A 5CFNA 4AF7A 1CNMA 1CJVC 4OEHA 4P0TA 1LA2A 1R15A 5C4GB 1ADCA 3L5OA 4IJKA 3UJCA 2GBIA 2IU4A 3PE3A 4XW2A 4GMHA 1DDGA 1KK0A 2C4UA 1ETHA 3ID6C 1CDOA 2PJDA 3OVMA 2Q3LA 3N8DA 5C46F 2DE0X 1Z9BA 3N0RA 4ENQA 5DO9A 4K81B 3OPYI 2JH8A 1W7AA 3P71T 1E6MA 4LRQA 2R2AA 4XIFA 4H6XA 2D1FA 2ZYVX 4NBTA 3TRKA 5JU6A 2H85A 2PGIA 2F8TA 1X8KA 1D4AA 2H16A 2GPNA 4O4HF 1FPMA 3ETCA 5FBLB 1LRLA 2FU5C 2COKA 1A4RA 2L19A 3QKUA 3DOJA 4CMEA 5BNWA 4XDZA 2OT3B 3CZRA 4QGAA 1ZUIA 4M83A 4INJA 2JKZA 1UADA 4CF3A 1JT9A 2GBFA 4DC1A 3UGJA 1PYGA 1CW2B 1CY7A 1M9NA 2VDPB 2FEOA 4B4UA 1WG8A 1NDHA 2Y1CA 5B58T 3KBOA 1KERA 4KR2A 2J3KA 2O48X 3CZ5A 5D5QA 3DZHA 2WNSA 1HYHA 3B6JA 4BX0A 4DPMA 1DRWA 3EWNA 4AG6A 5KVVA 2F4VB 3P27A 4PLYA 4PN3A 3VC2A 4A1FA 1U7XA 3FYUB 2H7YA 2VJLA 3OF5A 2ZR9A 3PNVA 5EP2A 4GLLA 1VM6A 3IQWA 4Q9AA 4ZO6A 1J23A 3UUFA 2VDWA 1C7IA 1GTVA 1OWPA 2GK7A 3CVJA 4KQ2A 3T4XA 4IWYA 1GQ2A 2QTWB 2NGRA 1G7TA 1KMIY 4LNHA 1T4MA 4UAJA 2ZJ2A 1BS2A 4YMHA 2EV9A 4N40A 3K70B 2Q6OA 1U02A 4YJKA 3GWZA 2YV5A 3ZWPA 3THYB 2DH6A 1YI8A 3RIGA 2ZVJA 3DYBA 3KLBA 3W79A 4PG5A 1YBAA 4B4OA 1TEHA 4AS3A 3WQSB 2Q1TA 1EBUA 1X8XA 3RCBA 4B7AA 3V32A 1LSUA 5BORA 3IEUA 5AH0A 2A8YA 5LZ8A 3MT9A 2PUEA 1JP7A 1XL0A 3HACA 3L4KA 4P0QB 3HXOA 1IG3A 4G09A 5ALUA 1PEDA 3TKAA 1OYVA 2GEUA 3R4VA 1VCIA 3JQAB 1L9KA 3R0JA 3MD9A 2DZDA 4ZOLA 3E8XA 4IFIA 1E5VA 3L4SO 5DIZA 2QNIA 4EITA 2Q7OE 1LQTA 4G0WA 1NMQA 3UB2A 4I9NA 2VUIB 3VVBA 1QF6A 2CUKA 4W5QA 3AVTA 2I3AA 3CW8X 2AE1A 1ZIYA 3F98A 4GL4A 1FYVA 1KEZA 3IAHA 3QPCA 1PJLA 1FW6A 2ZQYA 1OSNA 1TDJA 1DL5A 2WF9A 4WZAB 5DYWA 5FD8A 5AK4A 2VHQA 3KB1A 3HNPA 3FW1A 2Y2UA 3VSAA 2AR0A 5JXHA 2J3LA 1FP4B 4YWHA 2VHJA 3N3AC 2P7HA 5JIBA 2GVDC 2BMDA 4Z51A 1HZZA 2IYQA 5DBOA 3OQHA 4GD3Q 4Q3EA 3OFKA 4EYSA 4NPAA 3AVUA 4DLAA 1E2PA 2IYFA 2DOKA 2IEBA 4BKUA 2WQ7A 3RFUA 1NVGA 4B85A 2VN8A 3HYRA 2VDJA 3CLSC 1CZNA 1VGQA 1F1BA 3EVCA 4JVNA 1T6NA 4OI1A 4AECA 2V1XA 1Y4UA 2G40A 3TFWA 2FN7A 3WKEA 4P3PA 3SKYA 4A23A 4DSZA 3FRJA 3RAEC 2OHJA 3EIQA 3DMDA 2R5NA 2VT3A 1CIVA 2AOTA 2BW0A 2SICE 4IIJB 1XKXA 1GPH1 1SVLA 4BRWA 3OEYA 4E15A 1LSJA 1G6HA 3QOYA 1HEUA 5JASA 2PE5A 1I5RA 2ZRPA 2BMAA 2CD7A 1XCJA 3KR9A 2G8LA 2ZRBA 1CC1S 1E61A 2VKTA 3LUPA 4RD2A 1FFBA 1W59A 4TS4A 1Y9JA 2QLLA 3N7UA 5A4IS 2J9XB 1JFLA 1PR5A 1ZN9A 2RGBA 3FROA 3EW9A 1XPJA 2C2KA 3FSGA 2M6LA 4C2AA 1Z63A 2PNJA 3OQBA 2VRNA 3E1GA 1RJWA 3RVNA 2DFLA 1U8YA 1UQTA 4MWDA 1Q2UA 3TLMA 3Q6NA 4JENA 4M1SA 4Q3LA 3S99A 3A6LA 2ERXA 2XVYA 3QE3A 3D6AA 4LWPA 2QL5A 1L4HA 3E03A 4YHBA 2QIOA 4U3JB 5HW0A 1Q21A 3G88A 5LUBA 4N4AA 3PIRA 1H0KA 3E7PA 3I32A 4RKYA 2QMEA 4L95C 5FBRB 3VU0A 2QUHA 1YTUA 2EX0A 2H5EA 2CFRA 2JJMA 1H6DA 2W2OA 2ZB2A 3C48A 4IHJB 2XZOA 1TTTA 2Q9UA 2GR9A 1PX2A 3GJ6A 3LQRA 1G8AA 1JVBA 1G20E 4DUZB 2ST1A 4WZZA 3EGOA 4WLFA 1TU4A 2DQSA 3FKSD 3GROA 4FPXA 1G3IA 4K9MA 3HJFA 4YGXB 2VQEB 1E7YA 3QEMA 5KTMA 3FCYA 4JBHA 4BTLA 4Y9SA 5EXTA 1ZXXA 5JSHA 1WU7A 1PL8A 1ZMTA 3L0YA 2GARA 1VXRA 2ID9A 3HCFA 1EE1A 3LGSA 2YDYA 3IH5A 4HWTA 4RV9A 1QTIA 1POWA 2C82A 5FI5A 1S2MA 4JQZA 3USCS 2QSZA 1ISPA 1GTMA 2QUAA 3QK7A 4BQIA 4OJKA 1H2HA 3AEQA 3L8HA 3KC2A 4DDVA 4OX9B 1TEVA 1HE3A 4UVGA 1BA2A 3O4RA 3OMXA 4ZYYA 1VHLA 1VLHA 2VUUA 3DZCA 3I04M 4NPCA 4AQYB 3RRBA 3AHIA 3D6HA 3KAPA 4EB8A 4OHZA 2F8LA 3JPYA 2OCLA 3LRTA 4KQIA 4W5HA 3L6UA 1V3QE 3TBKA 1RM5A 1UXJA 1P81A 2AH5A 5T57A 1UJBA 2QRLA 2EL9A 3F1LA 4U6QA 3LW7A 5JMWA 1U7WA 3TVTA 4BPRA 4G5SA 4MCAA 1NGSA 2E6UX 3JRXA 2PVSA 1S9HA 1IJEA 2I0FA 2GXUA 2OR3A 3PP8A 2F3RA 621PA 5DISB 3ZD6A 4G1BA 4RK0A 4ENRA 1YJAA 1X7HA 3KSRA 5DYYA 3W1WA 1HGXA 3DR5A 1YZYA 4GWKA 4S12A 4WEQA 1DTWA 4YJ2B 2COEA 3KP1A 1FOEB 1YOVA 2N47A 2XOEA 4RCVA 5AR1A 3V80A 1W85B 1ODLA 1VP3A 1K3UB 4H9GA 2WIJA 1CUXA 2JK0A 3G5UA 2EBHX 4IEEA 4ZOLF 5FL3A 1YB7A 3NUZA 3PL5A 4M9XA 2QR2A 2LE0A 2Z3WA 3IAS6 2EX4A 2IUTA 3JQFA 1ZM3A 4KRGA 2IHBA 3HCAA 3B51X 5DF1A 1QP4A 3JR7A 3QW2A 4HBZA 2B36A 5ITZA 4DYDA 2I4TA 1YK0A 5K45A 2O1EA 3IVAA 4N5NA 6ADHA 1SPXA 3OX1A 3MRSA 3CRMA 1RQXA 4HQFA 5ALMA 1S96A 1BOOA 4XQGA 4BIIA 5IKPA 5DM60 2RI0A 2EG5A 1O89A 3KOUA 2YS7A 3HI6A 2D5IA 4YRGA 3LTNC 4Q1FA 3VDMA 3VV2A 2JW5A 2AUMA 4Q5IA 4PGGA 3L4BA 2VP3A 1JR3E 2ONKA 2IHVA 3D4IA 3MM4A 3O4JA 4B6GA 2CV2A 1CJMA 3OJLA 4I9GA 1FY2A 2AWNA 2C5BA 5FQNA 4ZVRA 3T5TA 5IAGA 1W44A 2DHEA 2CDNA 4Q18A 3HVJA 5T41A 3D6TB 4F4FA 4KAAA 3W9BA 1TB4A 2FZLA 1AF7A 2R3SA 4ZKEA 4KLCA 5INTA 2WNIA 1UBNA 3DVRX 3TE6A 1LRJA 1FBNA 2PSDA 4RHUA 5L3ZA 2K6GA 1KO8A 1X7XA 4GVXA 2FW6A 2IVFA 4QVIA 1P0IA 1XF9A 1D04A 1GUAA 4HH4A 3UNXA 3Q41A 1E2GA 2O2DA 3HBFA 4HJRA 3I1YA 4PV7A 4DV5B 1S7CA 4FCVA 3GCXA 3LDAA 4XFKA 5A5EA 3PF8A 4RK6A 1D8TA 3H4MA 3HN6A 4QEDA 1ZYUA 5BQPA 1U9IA 2O7VA 3D6MA 4PX5A 4DEVA 1L1RA 3QLVC 3BD9A 3T0FA 4L78A 5A62A 1QZUA 5BVHA 3TD2A 4CVNA 2CD9A 4DN6A 3L8YA 1GO2A 1VHQA 2D2IA 2ZVDA 4M88A 4KYTA 3SKVA 3H2HA 5E6UA 3RC3A 2HX1A 4LWZA 4QLOA 5AK5A 4IIDA 5C8YB 1NPYA 3WGZA 2GZRA 3T34A 3RK1A 3HS3A 1KAQA 2F48A 4FBMA 4R3WA 4RK7A 3O9MA 4RWZA 4DV7B 1BN7A 3EHEA 3JVUA 5JBQA 1JW9B 1PZXA 2FR8A 1TECE 1G8MA 2ZUWA 4FCTA 2M6RA 2AJLI 3EMKA 3PCTA 4RJIA 5DBHX 4CKBA 1EGAA 3WK8A 3DDUA 1DO2A 1QKJA 4J43A 4OSPA 5ESRA 1VFPA 1P18A 2R7NA 5FADA 1ISIA 1S8AA 2COUA 1I2BA 3B1FA 4RCYA 2ISQA 4B76A 3KEMA 4G65A 4BFLA 2G4LA 2Q8QA 1K3TA 3DKKA 3FUUA 4XJVA 1XK7A 3ANMA 3PRKE 5EE5B 5EQDA 3PQEA 1OWOA 1KY3A 4Q3DA 4TUYF 4D46A 1F9AA 2WINI 3LUAA 4O5AA 4J16A 1WB9A 2OGUA 4O4JB 3R0QA 1G21A 1ULBA 4ARVA 1T5SA 3EJWA 1E9SA 2JZNA 4D1YA 1BE6A 2QU8A 2GUWA 3NONA 5J5CA 3A36A 2FW7A 1N2OA 2W83A 3CF0A 1HE1C 4JWKA 1BX1A 1P5ZB 3AG5A 2JCYA 2YRWA 3KUUA 3LDHA 3MK31 4NK5A 2HL6A 1LUAA 2BZ1A 2XH8A 3AYZB 3GLFB 1RZRA 3I62A 1RKQA 4U0JA 1LDNA 1ZXBA 5IJ0B 3HG7A 1FSSA 2H17A 2EFCB 4QA9A 5SY4A 2V54A 2QJWA 5J58A 4Z4FA 3ABSB 4DM4A 4XGKA 2BONA 2A5FA 3SXJA 1M2JA 5JV5A 4QEKA 4PTYA 1EDOA 5CDHA 1YRWA 1FDTA 2GZ3A 4L75A 3UFXB 3EXHA 2OFWA 1QOPB 5GPBA 3LBAA 1SA0B 3O1HB 4CKZA 1E2MA 1KK1A 3TI9A 1PNVA 2ZRMA 1XHFA 2C2WA 3KKKA 2MYUA 3B20A 4GP7A 4HL6A 4JFRA 1LWOA 1QF7A 1UBEA 3AR3A 3CW9A 1G3RA 1DDOA 2BKLA 5EG5A 3W5VA 1PUXA 1XG5A 2QA5A 5JROA 3AT1A 1HDEA 2O8EB 4YMVA 1DQSA 2AX3A 4QG7A 1RWKA 4HNGA 1AQYA 3ESZA 2H4FA 4L51A 1MV5A 4FZRA 3JXEA 4D3YA 1C4WA 3DC2A 1OY1A 3SZGA 5DX8A 5H3CA 2IW3A 3V1MA 5I7OA 1T8PA 5LQMA 4ARZB 5AVTA 4XR9A 4E2WA 5JTTA 1G19A 2CHGA 2BV3A 3PE4A 3QGMA 5IS2A 5KJCA 2HCTA 1I6WA 3L7IA 2ZUEA 5THKA 3CCFA 5IDQA 4PZ9A 1OLSA 2V8OA 1TYZA 2VT6A 2ENUA 4UM8B 1CFJA 4C6TB 1YI1A 2EFGA 3GHHA 3JYPA 1JXQA 4FZVA 5HA5A 5HFNA 3VYVA 4UHDA 4P3XA 2FK7A 4AMZA 4YGYA 3WB1A 1QONA 1WXFA 4TWRA 3UG7A 4BC1A 5K0NA 2ZTUA 1KC3A 3AVQA 3DFIA 3ENZA 4H7HA 3ZV3A 1QIMA 3OSZA 2VUHB 2EW8A 4YQZA 4OYYA 5CPFA 2JEOA 4XSVA 2FPLA 2AB0A 3ZWXA 1SCUA 4JL5A 2PJZA 4EB0A 1TNDA 4RUKA 2VZLA 3CE6A 3IUJA 4O29A 5ESDA 3REGA 1C8KA 1UDWA 2OO5C 4R1OA 5F9HA 3R7NA 5AHWA 4QSMA 3HCCA 2X2FA 1UBKS 1OYOA 3K5PA 1CNEA 1M1YE 4O4IA 4R1LA 3KYDB 4BV8A 4MB0A 2HT1A 1FYXA 3TZCA 1PQUA 3STYA 3LTEA 3ZTWA 3X2SA 2AR7A 1YMQA 4U3JA 2OHIA 4QVKA 1EVYA 3VYRB 1JDBC 3R7SA 4MI1A 4MS1A 2XI4A 4NTZA 1DSSG 5HCIA 2JLUA 4KVAA 5JANA 2VNHA 2E55A 3LI2A 4N5HX 1I0LA 4TKVB 5L7YA 1W6UA 1Z6GA 2PX4A 2ROQA 3D31A 5HDBB 1W35A 2JJ1D 3TECE 2XWSA 4JOSA 1DV1A 1L6RA 2ZATA 1SHZA 3BULA 3WFJA 4ZT4A 4I9HA 1OHHD 1EDDA 1OX4A 1MO6A 1PO7A 1R6BX 4IHJA 1H85A 1UIRA 4MQ6A 4XDYA 4LBZA 5ARDA 4EWLA 3BTOA 3OC0A 3OJ0A 1F5SA 5CR9A 5J1TB 4F06A 5CFQA 1AHPA 1V8BA 2FHPA 3K0KA 4HDOB 4KN6A 1PS0A 1IONA 2ECPA 3FUCA 3G0BA 3O5AA 2DHDA 2X0JA 4RETA 4XQEA 1CT9A 5DCLA 1BH2A 3NIFB 1WCV1 1L7QA 2OGWA 1WUJS 4DMUB 3MTJA 4INAA 3RRJA 5C2JB 3K09A 2AXQA 4IKEA 5A3QA 2I2DA 2P2LA 3V8BA 2JIZA 5C9ZA 1JIVA 1CY6A 3C3WA 4K9OA 1P5RA 4L07A 3V4LA 2WF8A 3WSVA 3ZHYA 2JGDA 1UXIA 2YY6A 4YUVA 5EMMA 2I62A 4OOEA 4F46A 5K8JB 4WNYA 4XWYA 5C5DA 5KQPA 3NXKA 2P4EA 1Q3TA 2YXBA 3PXEA 1XD2B 1XTZA 3AIKA 3WWZA 4XI9A 5A4DA 3KQNA 1SRQA 3O1LA 1PW5A 1L5HA 1X8LA 1UAYA 1EZ4A 4C2TA 1N6RA 5T8KA 1USKA 1WNFA 2XY4A 4WKOA 3I1IA 5D00A 4TZ0A 4G8BA 3GR6A 4FFVA 3VZBA 3CUVA 1N5MA 1P9RA 1VYHA 2PUWA 2WOJA 5KQMA 1USVA 5C7LO 3NYIA 3R6GA 3ADDA 4DEXA 3PDIB 2R5FA 4XVHA 2HPZA 1UDBA 2CLDX 1WF6A 3P2IA 4AICA 4AJOA 2GFHA 3QTBA 4QLBA 2PGOA 1RI2A 1X1EA 1P9NA 2AIRA 3M33A 4I6GA 2FSGA 2KS6A 3G1WA 3CNHA 3NNDA 2IXFA 2P9HA 3GARA 3DTVD 1FB5A 1SVSA 4LTMA 4Q05A 4DM3A 4L8GA 3MD0A 4IDEA 4XSHA 2PKRA 1E60A 3M5CA 3WJ2A 3WA7A 3H2IA 4DV2B 1JH9A 3A4MA 3JVIA 4Q7KA 5GV7A 3REQA 4AVYA 2GT1A 3JTEA 2YVKA 2XODA 4YT4A 3UBTA 5KSZA 2EOAA 4B48A 4WCFC 3RSQA 2XRMA 3DV0B 4Z9FA 3T54A 3OOSA 1KQGA 3FYHA 3NOOA 1YRBA 1JLLA 1KHHA 1VPDA 4U2EA 4MROA 3ZXXA 1XALA 2E48A 4DQ0A 2CJFA 5IJXA 2RHJA 3S0JA 1SBYA 3USES 4MW5A 1HDOA 4RD4A 1D9ZA 1Y82A 1ZHFA 3GFSA 4M0KA 1GV1A 3IOCA 3AEZA 1G5PA 4QDXA 3T61A 1QH1B 4CV3A 4ZDWA 1R27A 4JEIA 4EPWA 2PS1A 2DAPA 2Z8ZA 3EVGA 3K9FC 1NXVA 2FGKA 1K5PA 1ACLA 3MQ4A 4Q9NA 4HF7A 3SOZA 1JHQA 3I61A 3P9YA 2XNCA 4WNAA 5FWNA 1TCCA 1EEXB 2V7VA 1Z4MA 1NWCA 1Z07A 3GNSA 3S2UA 3BHJA 5ALEA 1VRCA 1RM4A 3FMIA 3N6RA 1IEWA 2XWPA 3E9EA 1PV4A 1F1JA 1SC4A 4X8LA 2O8BB 4OVKA 1ZW6A 3K0HA 5BV0A 1IY9A 2OZLB 4LHSA 2EFJA 1Q7RA 1UL1X 2JLAA 2VHZA 4WCDA 2WYHA 1DRUA 3EXIA 3MOSA 3ZS9A 4G2NA 1QGED 2ZJOA 3QBVA 3TPFA 1M8KA 2YN4A 3VVCA 1U7TA 5DBFA 1XQXA 3FVVA 4AS2A 1AS3A 4UDOA 3ZY5A 3RABA 5IHPA 1OKKD 2XAAA 3ZEAA 3CV3A 4QRHA 3S7TA 3TQTA 3QXJA 2I6GA 3SJAA 3DNMA 2JLQA 2BFOA 3P9XA 3E0XA 1AKMA 3AKEA 2I3ZA 3DNPA 3NBKA 1WZCA 3M2TA 5FOVA 4K9RA 4DIKA 5TPWA 2W11A 4P4TA 3EDCA 2HRRA 3C15C 4NZYA 3W05A 4EAAA 4IAOA 4BVHA 4EGAA 3KEFA 3G9ZA 4FDMA 4AWBA 3ZCSA 3FPBA 4D81A 2A33A 2CF5A 1U4SA 2H31A 1CLUA 2XB6A 1EINA 2G36A 3K4PA 3MT7A 4GX1A 4F92B 2RGRA 1Q1QA 3LUDA 4G4SP 1L3IA 3F5FA 3PVSA 1GPKA 1JKMA 4KFSA 5FPTA 5H68A 3BCHA 3EFBA 1NATA 1EK2A 1Z0KA 3GQBA 3QIAA 4B46A 4N5LA 1X1AA 1JEQA 5ARBA 5EXPA 5KCMA 1C3VA 2YFYA 1B16A 3G3EA 5L40A 3PDUA 3E7DA 3QNMA 3EA5A 3WIOA 3EA4A 3GCWA 3IVCA 2XB2A 4FMPA 4BGVA 2EJWA 2Y1EA 3TL6A 5LP1A 1FW8A 3I2HA 3NHBA 1XZFA 3AIIA 1DKMA 4UCXA 1AGRA 4O2AB 1PK8A 3W78A 1I51A 4BLRA 5AW1A 1NF9A 1L6IA 3V2IA 4TSFA 2XZTA 2H51A 4J94A 5EIOA 4TMXA 3ZBPA 1Z5OA 2G5TA 4EBBA 2C78A 1QGDA 1SKUA 1E6EA 1WXEA 2CFIA 4RKRA 4TZTA 4Y6QA 2EW2A 3QU7A 3O38A 4C05A 4FJ0A 1VMKA 1JDZA 3HUDA 4UFPA 2G08A 5AW5A 1E2JA 4N3AA 3U7FB 1MOZA 1IFXA 4E3WA 4RTNA 2PRKA 2QMQA 2XEDA 2D1YA 4BQRA 1Z39A 4GGPA 5IVHA 3V8PA 3VTFA 2C54A 4RSGA 2QPAA 4MEBA 3VO2A 3VZCA 4YEDA 4MS4A 3NGXA 1K7EB 3RTEA 4KZPA 3IAEA 2OUIA 5CFZA 3OFND 3EPLA 4LHXA 3Q5GA 1YCDA 2YJ3A 2C07A 3UT5A 4ZWNA 1E0KA 5KMGB 4WN9B 3HKCA 3I9FA 5FKJA 1ECBA 2ORIA 1TKBA 4PLFA 2PR7A 2WV9A 2B7BA 4S2UA 2PUCA 3E23A 4QBKA 4ARAA 1JI0A 1SVNA 4Z2AA 3GLGB 1IN1A 4ARBA 3GPBA 4LECA 5D2CA 2HHJA 1QFZA 3N7AA 1XLTA 1PBTA 3PFNA 1Z5NA 2FE1A 4NBLA 5FLKA 1RFGE 1JHMA 2NXJA 1XXHA 1AT1A 3LDUA 2VYFA 1QB7A 3E15A 1DG9A 5CT6A 1J1IA 1GV0A 4Z53A 1TQ2A 1VIMA 1VMDA 4TMVA 1AUQA 1E3TA 1ESEA 4J7UA 5CRIA 2OV1A 4YPFA 3VA7A 3AUTA 1WZIA 3TBHA 1FFDA 2ODWA 2Y1KA 1BMQA 4LKRA 4RZHA 7ADHA 2IEAA 1YS7A 4DLLA 5F3RA 3WLEA 4B4VA 4XWWA 1GKIA 2FE4A 2R11A 4B3JA 2EJVA 4QDOA 3IOMA 5EEHA 4EG4A 1EWQA 2J6BA 3AOGA 4GKJB 1GAWA 2IS2A 3UTCA 1TPZA 4GI3A 1U1FA 2AEFA 1I14A 1E4YA 2WF5A 1JWAB 3R0IA 3A9SA 1FZTA 1T9DA 4DWWA 1TVCA 5WRFA 2MR6A 4FHFA 2NLOA 4OSOA 1WCIB 1L7XA 1FNDA 4KW7A 1PFGA 1JR3D 2VH1A 1SQSA 2K7FA 1WHSB 4BB9A 1RCTE 2Q3DA 5JZMA 1BDIA 2Y77A 3H9BA 5EGNA 2O8CB 1DFGA 2O3RA 4XUCA 4L0QA 2Q5CA 1FP2A 2OAQ1 2RKWA 3JQBA 4JYMA 1NJ5A 1Y5NA 4UFNA 1JJIA 3TLEA 4AY4A 5A4KA 1I7PA 4UDYX 1TOAA 4ZDKA 2D7DA 4DCUA 4UZSA 4IOKA 3JWEA 1W5BA 4JYBA 4ICIA 1COWA 5DBEX 2F17A 4HGNA 2V8BA 3C43A 4R2WA 2QTFA 2H7VA 1QRTA 2OCBA 4N01A 3ZGYA 1H8HD 1JXMA 5DM0A 1QFJA 4K6KA 3HXKA 4PFQA 4KNVA 4FGWA 3VSBA 2CEAA 1AK1A 2ZRIA 4RY8A 2H4JA 3LC1O 4Y2QA 5FL7A 3ZD9A 2YIJA 2YL2A 5COQA 3SEFA 5B64A 1PT8A 3KVVA 4X7PA 4EPYA 2NZUG 1EX6A 4WY8A 3T7RA 2O5VA 1ZGZA 1P2SA 1BXKA 4MIOA 3GELA 3LQQA 1ECPA 3M6UA 1AG9A 4CZ2A 1XMPA 1Y4AE 3L8MA 4H0NA 2AG8A 5FH9A 2HJVA 4INZA 3ZHCA 3T7TA 1IL0A 2F1RA 4OUDA 1XDZA 1NQAO 3STUA 2G83A 4UULA 3HXLA 3OICA 4MUEA 1JMYA 1XGKA 5H0IA 3DDOA 1BDMA 1Z0AA 1I0ZA 2I91A 4BRUA 4LOKA 2QVYX 4LZZA 2EX1A 4NE7A 4P9NA 2WE8A 2A59A 2Z04A 3KJXA 4IDHA 5AFSA 4G0OA 1G5RA 2FDRA 2G04A 2PH5A 2YMPA 3GRCA 3GWGA 3H5TA 3BXPA 4WZAE 2Z5GA 1N33B 4ILKA 2ZR0A 3FVQA 4YR9A 3JQGA 4RTRA 3B5IA 1VL6A 3NPAA 1X0VA 1VDMA 3MPUA 4Y2RA 4FWTA 5JOQA 3BYZA 4CG2A 1Y1TA 5AVYA 1K8RA 3BXHA 4LJAA 1AKQA 4LYFA 4OAPA 5B1DA 5HGXA 1ZJYA 1N3YA 3ZH9B 4RHFA 4I1OA 4RVCA 4QPJC 4BLVA 4V0SA 1PJRA 3KAKA 3BTSA 1KZYC 2L69A 3DPIA 3G5AA 3S55A 3JZFA 1QE3A 2DHRA 5BQ3A 2Z5FA 3UK2A 3ZJTA 1LB1B 2EZUA 5J2UA 1QANA 1T10A 1G9XA 3QQ5A 5LN1A 2EJCA 1BOFA 1U31A 4AUMA 4DRZA 3I6QA 1APBA 1IEXA 3VVLA 3JWIA 1I30A 2AFVA 3WDMA 1KIFA 2GKOA 1E3WB 3GRRA 3OBIA 2YDXA 3QELB 1XJCA 4HAUA 4RY0A 2WSYB 4ZJUA 3ZLJA 1N5JA 4C4AA 1ZK3A 3KQTA 2CL7X 5AVOA 4Y1GA 2GVNA 3CO5A 3U4IA 4Y2UA 4E07A 4R31A 2HHCA 4TSKA 3VHQA 2L42A 2D0DA 1E9BA 3QZUA 4EVSA 1YXMA 1K7YA 1Z36A 3VAZA 1IU9A 3QKSB 3WLLA 1OTHA 2WSSD 1N7HA 4OX9Y 3IKTA 1EWVA 5TRTA 2NU8A 1YVDA 1N1DA 1SZDA 4NMXB 3G2MA 1ZOSA 4Q7MB 2JAXA 3L6DA 1WDTA 1TVEA 4WT7A 1ZCBA 2G9VA 5BW6B 1TAQA 5JPCA 1PWEA 4NYMQ 4N18A 1U1CA 4JR2A 1I1NA 2X4GA 2FOLA 1KEPA 1NVVQ 3SK0A 3SS7X 2AKEA 3NVKI 1GAQA 3THRA 3Q5DA 4ENWA 4US0R 1WXDA 2YNMA 3G5MA 3ONFA 1QAOA 4LFCB 3V3TA 2FN9A 2REQA 5KNBH 3PGLA 4GMGA 4QASA 1IAQA 1TU0A 2AZDA 3P0IA 3ERCA 4YMIA 1BSVA 3BIJA 1BNCA 4JU8A 5KWEA 4TRJA 2CJPA 3KSDO 4Q4JB 3JRNA 1W47A 2XQKA 1ZH0A 2OBXA 3OCUA 3X2EA 1R0WA 3A06A 1W2HA 2BR5A 2HJGA 4FHGA 3B6MA 4IQFA 4QWWA 4R41A 3UFBA 5F73A 4ZYZA 3CKYA 2WWVD 3ZCTA 4U7TB 1NQUA 1L5KA 4MV9A 4J29A 5LIPA 2C8JA 5DVZA 3OZBA 3F67A 2GLUA 4TGLA 2CNBA 2YHUA 3MJEA 4X44A 4CLOA 2O3SA 1JF8A 1WDMA 3CUSA 1GPYA 3UXMA 2NVWA 2NG1A 2Y4NA 3DJYA 2IYEA 2WOOA 4A03A 3KQUA 2CHEA 1EA5A 1F14A 1X6VA 1JG4A 3HVKA 2RJNA 1JHYA 1FK8A 3P97A 5JPIA 3W2TA 4AZTA 1KVTA 4BCCA 5CDYA 3NXSA 3ZKWA 3N8IA 1I5EA 1OFUA 5DULA 5ALWA 3CZ4A 2CXNA 1QR2A 2ZQZA 1D4OA 3NNNA 3O47A 4F9TA 1Y3FE 3IMGA 1EFTA 1S7GA 4MS3B 4EJ2A 2JCBA 2QDKA 3KTDA 1VTKA 1FVXA 1BQ4A 2PZJA 3P2JA 3VPXA 3W8FA 5JW6A 2H2AA 3DFFA 4MUFA 8GPBA 2O6HA 2D7CA 3Q10A 2ZJ8A 3O75A 1Z73A 3LUHA 5FOXA 4AX4A 2P6NA 3MWFA 3Q40A 2IIBA 4F9FA 1ZM4A 3GN1A 3RFFA 5CDUA 1GRCA 1PNRA 1VLQA 1TJ5A 1HL7A 3QNWA 4JHXA 3UK7A 2JHFA 3AX6A 3E3OA 3JU3A 4A5SA 5C4MA 3QVTA 4NXNB 1P0PA 1X8JA 2C9ZA 4HXYA 5ICEA 5IU6A 4HNHA 5J4HA 3IAM1 2B37A 2CFSA 3S1SA 1QIFA 4B3RB 1NMSA 2IP1A 2BDTA 3QOFA 5DV9A 1SXGA 3VR5A 3BFKA 4YJGB 4B74A 3AILA 1A72A 3NHRA 4M49A 1NRIA 2PWPA 3C2QA 5E4JA 5TMDA 1HEYA 1OI3A 2ZAGA 4O2RA 3E3MA 1A88A 3L9WA 4MUBA 3BGOS 1JBEA 1M2NA 4OQPA 1OAKA 3RS8A 1JJ7A 2P9ZA 5JAMA 1H6BA 4C03A 1B6RA 2W0MA 2YXNA 3A04A 1JDJA 2XUKA 3OEED 4CI9A 5K99A 1DBPA 2QPLA 2VK1A 4K1XA 1I6MA 3RT9A 1H2XA 1WRBA 1ZK1A 3LMKA 3P20A 4ZCQA 2UZ1B 1JFTA 4J9UE 1II9A 2P11A 2PBRA 1CWUA 2XA9A 1NF2A 3I4CA 4IMRA 1ZX1A 2LR0A 2R8PA 1B0PA 2VNSA 4MV6A 5EHGA 4DVGA 5CT8A 1T1SA 1IOVA 3T1VA 4ZIRB 3UJBA 1KORA 3C7KA 3TI7A 2M2IA 3FBWA 1P9WA 3OA0A 2XYQA 3GJ0A 4RW0A 2BKAA 5EUCA 5GONA 2HTFA 1FS4A 2NUAA 2X19A 3I3OA 4D8VA 1N6LA 2PMDA 2C03A 3MJCA 4Q15A 2Y1LA 3AHGA 3U0VA 4CL3A 4ALNA 5KTPA 2BH9A 3AM1A 3BC1A 3L5KA 4MRRA 2Q6KA 3W34A 4F21A 1XD8A 5AESA 2QJRA 1ESDA 4DMKA 3IBTA 1V2HE 1GP2A 4FYVA 1M6NA 3AL2A 2OOSA 4OQMA 4XB6B 5AVJA 4NHOA 4BWVA 5BWLA 5FO0A 4DILA 4U63A 2WJIA 2W71A 4HTFB 5AOVA 1P7ZA 3TK1A 4EPTA 1YFZA 3S8YA 3NDJA 4HEA1 4CHTA 4YQFA 1I2DA 3WFIA 1W36D 4PAMA 1YJXA 1WVIA 3C3BA 5A7GA 3T9BA 5C0OE 4AZ3B 5BNIA 4HLQB 4YUXA 3K9GA 2OBYA 4E3ZA 2QD2A 2WWFA 5B7QA 4WKGA 5JHHB 1ZCFA 5D8DA 3HL0A 3N2ZB 4GWGA 2BI8A 1JHRA 5ULLA 5DP1A 1R6XA 5EVJA 3LDGA 2QLNA 2G1UA 3IAM6 1I7NA 4WXRA 1DG1G 1PFYA 2C98A 2W6PA 2YXLA 5TS2A 2YWDA 3AM3A 3DOCA 2ZIEA 2X40A 3HMKA 1LLFA 3FDZA 4UHFA 2PMEA 1VXOA 2HADA 5KSYA 3IILA 5A0TA 4QTYA 4XVRA 4FZ3A 2V9CA 1TO2E 5IUJC 1H6AA 2OFXA 3LUCA 1GPUA 4EMSA 2O7RA 2YQ5A 3LXXA 5KHLB 1U65A 2ECFA 3P9QA 1N8SA 3SQDA 3ICCA 4KPEC 2FQYA 3CBGA 1N2JA 2ZBRA 4NEQA 1WQ1R 5CFPA 1JG6A 3TTVA 3K9LA 3O2QB 3KUXA 2Z3ZA 3KFXA 1KA9H 3MS4A 5BOSA 1VL5A 1JALA 2FPOA 2Q3HA 1H5UA 1ORVA 4MUXA 3FYUC 3LOPA 2MMGA 4CQNA 8MHTA 5H7XA 2RH5A 2WAYA 2J32A 1ZH2A 3E5HA 3OQ1A 4LNUA 4OIMA 3VR2A 3LDFA 4DY6A 1GM5A 2FPIA 3A70A 4DNOA 5C3MA 2GNAA 2PGLA 4Q3NA 2R8EA 2BFDA 1DP4A 3HA5A 2X13A 4IGEA 4EHIA 4LXIA 2BF7A 3DONA 3EPHA 1ONOA 1F8XA 3WB9A 1ZINA 1EXMA 3R3HA 3GJ4A 5DH9A 4JXJA 3IIJA 1CQJB 5LQCA 2DETA 4TLBA 4XD7A 4L8VA 1MPXA 1NW3A 3D4BA 4U0KA 1OB5A 5FR2A 1Q0TA 5CTJA 3IO3A 1GVNB 5KTKA 1ISFA 2XCUA 2IGBA 1SG6A 1JFVA 4CRWB 5JAUA 4YRKA 1HC7A 2PZAA 1WSDA 1S9DA 1HI9A 2FSPA 2HLPA 3BJMA 1SC9A 2V7GA 2NYRA 3IKJA 4DSNA 4A6PA 4BKRA 3C16C 3TRIA 1DPGA 2PVCA 1T0HB 3FHTA 3NHAA 1HRDA 4MQEB 4UAGA 1W6RA 4J7AA 4WZBB 4CLOB 5I7EA 1KHTA 2W2VA 4LCBA 5ICGA 4BJ6A 2OXIA 1ZVJA 5H4GA 1LD3A 3PGMA 4RZ2A 3SFZA 3UZUA 2PT6A 1RIFA 1ZKMA 1QRRA 1OZGA 4LC9A 1ZWKA 4M54A 4ZZ3A 1N25A 2LBPA 3THWA 2OHOA 3O93A 4NK4A 1P2TA 2JVIA 3V00A 2V3CC 1P4JA 2R6DA 4OKSA 2VSXA 1FFHA 1JAXA 1PIWA 1T35A 4A8JB 2GLXA 4XTCS 1MA0A 1GN9A 1C29B 4G8JA 4Q3KA 3SZUA 2X1VA 2HN9A 1A9PA 2QE7A 1RKVA 3OE5A 2GETA 4MYCA 2NSDA 4D3FA 1GSAA 1H1LB 1F3OA 2H00A 3JVDA 3JWHA 2A0UA 4RV5A 3IX7A 3FSEA 1Q77A 2Q7XA 5IAKA 3CH5A 1R4ZA 4TWZA 1QCYA 3HI4A 5CYPA 1XAJA 3AWDA 3R9XA 2ET6A 1GT91 2HHLA 1R1DA 3QBJA 2AV6A 4BBPA 1QH8A 4COOA 2WZCA 5LMNB 1V48A 3A58B 3I28A 3A3PA 4RYLA 2O4CA 4G56A 3VTAA 2YJTD 3PL1A 1H65A 3GT7A 4UHHA 1XFDA 3S1LA 1NBME 1QS0A 2QZ4A 4TTIA 1JQ3A 2ZFUA 4KSCA 3UGTA 1KARA 3EQ2A 4Y2TA 4GH5A 3H6HA 3C8UA 3NAMA 1YE3A 4P53A 3GT3A 3A7EA 2DPGA 4HEHA 3C3DA 3MCUA 2QTMA 2G06A 4WWHA 3WLIA 1JYEA 1QTRA 3C5HA 1C7ZA 1EG2A 5AQEA 3WE7A 2N1BA 1Z0SA 1A9OA 3JQ9C 4FBLA 4PU0A 4QECA 5F5XA 3TW0A 3KLOA 3K31A 2IEZA 2WMNB 2FW8A 3WIVA 3EXHB 3JS5A 3ZNQA 1EM8A 1NMZA 1HE4A 2GZMA 2I7XA 3H3JA 3OMLA 4TS1A 1PS9A 4GYJA 4NMWA 2IDKA 5HJ7A 4FN4A 4RULA 4BNUA 4KQJA 3B48A 3ORQA 3WBFA 1T2DA 2SECE 1NAIA 3ZE7A 3ZW8A 4ZRMA 4FMDF 3PD0A 5L7TA 3JQQA 5FI0B 1X13A 1QQBA 2H06A 3RVMA 4F3CA 2UUAB 1ECJA 5K8LA 3K6JA 4QRDA 4P6VF 1R50A 5IMSA 5LP6F 4DCSA 4DG9A 2PQ6A 4E51A 5HIIA 3WA6A 4FS3A 4PHFA 4KOEC 1S2OA 1CS4C 1K6MA 1M34A 3THOA 4Q12A 4RJJA 5A9SA 4D99A 5LQJA 2CW5A 2VNIA 4YRLA 3U61B 1E20A 3OFVA 1YVRA 5IPFA 4DIDA 2JRCA 2HMTA 3K96A 5ESWA 4JBGA 4FZJA 3OFSA 3ZD7A 3KD2A 1ZI6A 2GH1A 1EUCA 3C39A 2CXPA 1HMPA 3K8ZA 2BTOA 3K9NA 1YB6A 1MZVA 1XU7A 3WK6A 5FWXB 1Q0LA 2P68A 2ZJYA 1C41A 1UDCA 2RHRA 2PBFA 2X3YA 3BL6A 4LOAA 4N0QA 5AHKA 1NC1A 4LJ4A 4MUJA 5DT2A 3W5DA 2BDEA 3QNUA 5HYVA 4UVHA 4QE3A 4U7JA 1DXHA 1BCRB 1NLUA 3E6AA 1ZU5A 4MV0A 3MBIA 4DJEC 1HE8B 3QPBA 3FYSA 1KSJA 4E4YA 5JS8A 1G5IA 1REQB 3KJEA 1UK8A 4XOIA 3TRFA 3WLHA 1F2DA 4CLXA 1NBMD 1XMSA 3EY4A 3SAJA 3PUJA 5CLQA 2OCXA 4QJIA 4OUDB 2GYYA 3P5SA 1O9GA 4RPHA 4GKAA 3V34A 3WSTA 4ZYXA 2W2MA 3K53A 1CJUC 2XT0A 3AK4A 1PFWA 2OV3A 3R41A 1QHIA 4PLGA 4NXMB 3FZYA 4N47A 5I8ZA 2H2HA 3MMZA 2OHXA 2G25A 4UUBA 5KTRA 1PFKA 1CD5A 4R8KA 4KNYA 1PGPA 1Q2XA 4CR7A 4WFIA 3VAYA 4JBYA 4DIOA 4JYCA 3VJMA 2B1QA 3PNLA 1KQ3A 1XXLA 1R9JA 4O4LB 2YMLA 3KU4A 1RYYA 3L77A 1QCDA 1NA5A 2J5QA 3BFVA 1MA3A 1WF3A 3KPYA 4O5OA 5IG2A 5MFPA 5ENZA 4HRXA 3RC1A 1WR8A 4I2VA 3WDKA 1HBJA 1XK6A 1RMTA 2B0JA 3VJKA 3ZUGA 4KXVA 3ROTA 1VYVA 3WHKA 5H02A 4ZI7A 2PL9A 1AGNA 4MUKA 2WJYA 4IY1A 4RPLA 3TRDA 4IG9A 5HHTA 1M5RA 2WSMA 1EE2A 2R2GA 3JASA 4EPRA 1X7DA 1YMUA 3BRQA 5IARA 3LC7O 4KQKA 2AVNA 2JJ1A 2NTNA 1X7XB 1CZHA 4RLHA 4EPXA 5HQ3A 4RTSA 4JELA 4E46A 2QBYA 3WRVA 5KYYA 1NDUA 3H2KA 4HCJA 2OB2A 3R6WA 1XJ5A 5TMPA 3HKBB 4QFDA 3QJYA 4YAFA 3VAAA 5TGDA 5D1HA 2XCTB 3PJGA 3H2SA 2WUVA 2ICAA 3ELUA 1XE3A 2JFBA 1ODKA 4KWEA 4L5BA 1X1QA 2SCUA 2CE7A 4UBNA 2CL6X 4FQ7A 2E6KA 4LOJA 1JLMA 2H0QA 3TMYA 2O19A 1Z4OA 1H8HA 2QQEA 3N0TA 4GZMA 2C4VA 2Y1DA 1ZIOA 1SURA 1PJQA 1PLJA 4FFBA 4U2DA 3TTUA 3D4OA 3GVXA 4FEEA 1ZGBA 5K6AA 4UMVA 4AP6A 4G37A 3ZV5A 3RAJA 5IUKC 4G4SO 3GLUA 2XSZA 2OQ2A 1QXSA 1E4EA 2W0SA 3PC6A 3L0PA 2CMDA 2LCIA 3G5TA 4HDSA 2QJFA 3SSMA 4OLBA 4YT5A 2WPDD 5KOHB 3FOFC 1V39A 3ACCA 2C5HA 1MB3A 1QG2A 2I55A 3PT5A 4BLQA 2NW6A 3EZFA 3G0IA 3HDQA 2VXCA 3NFYA 3TINA 4BLTA 3IIMA 4XEUA 1WXWA 3V97A 2VTVA 2GA8A 3FYDA 3K1AB 2CVHA 2OORA 2REOA 4YIHA 5KYNA 3RSOA 4L3OA 4AK9A 1RCFA 4E11A 3RAFC 3BIOA 2KI5A 2ZXFA 3NIWA 1Z6AA 4JC5A 1QHXA 1C7RA 4ZV4A 1NNLA 1OLUA 1ECGA 1L7OA 3LD9A 4OQYA 2JPDA 4WUVA 2H6EA 1DQYA 1F2TB 2Z5LA 4R8SA 3KJIA 1IK4A 4X3PA 5H16A 1LLDA 2W8BA 3N74A 4HZUA 1N5OX 4GU5A 2DPHA 1J97A 5K51A 2X42A 5FTJA 4ZYLA 4UKDA 3O8CA 3DXZA 3AEKB 4GKKB 1V5IA 2J4FA 4BIMA 4IIBA 4RFLA 4LN1A 1SCIA 4UU7A 7AT1A 3V55A 1NUQA 1RAFA 2G0AA 3VO8A 3VTKA 4IW3B 1JB1A 3FDZB 5BYBA 1B0AA 2VJKA 5GMOA 4KO8A 3KB6A 3ZQ6A 1DJMA 1T4GA 2JH3A 1SBIA 2HA6A 2IYSA 3IOEA 3HZOA 4CMBA 2Y66A 3OWHA 3FRHA 3RFVA 2P41A 3O82A 3HCBA 2BJHA 4RLFA 6ABPA 4HMPA 1C4XA 1E3EA 1OX6A 1WX1A 2MSEB 3OPMA 4QFMA 5DT9A 5JD5A 2XD4A 2IQIA 1OFHA 2L2QA 1JNXX 3A32A 1BGXT 4WXYB 1ONPA 1YRHA 4Y6PA 2CZQA 3Q8WA 221PA 3R5TA 4OXNA 3K6RA 3HUEA 1D2CA 3SJUA 1I3NA 2XA2A 1FXWA 1F38A 3QOWA 5JCJA 3AHEA 1RRPA 3ET4A 3NBFA 4LJSA 2CV1A 3DNFA 3BSWA 4YJ3B 2AYXA 4H16A 1I01A 2AOXA 2XV1A 3PLRA 3NHUA 5IKEA 3HE3A 3LZCA 1QTQA 1FTNA 1JTEA 4EDHA 4QJBA 5IM4F 3M7IA 2C9DA 4UEQA 4EOGA 4BLOA 3S1AB 4QU8A 5DNEA 3GLHA 1TA9A 2C1EA 4LQLA 4EUKA 1DFHA 3C1AA 1P4HA 4JL6A 4U9HS 2GAAA 2GAOA 3AY3A 1WQ4A 4FOOA 2BJVA 2QRUA 5AW3A 3M70A 1I7SB 1R8YA 4N49A 5CJ2A 1BC5A 5JO9A 3NBXX 3RB8A 4REMA 2XGMA 2FWMX 1JDPA 2ZPUA 3AI7A 5HE9A 5ES4B 1GPJA 1KBOA 2QMUA 1I7LA 1G42A 1PDOA 1EMDA 1TAHA 2AK2A 3PQ7A 2EL7A 4GFDA 3FMVA 3DQPA 3R8FA 5HK8A 3QEAZ 2PD4A 3HRKA 3M6VA 1O4VA 4AMUA 3E53A 4BXOA 3K16A 1M5UA 2WU4A 1Y8QB 3DVAB 3P52A 4UZEA 2PIDA 4OXQA 4EG5A 4I4CA 2RHLA 3HCWA 3KUDA 1LV8A 3F2VA 1F8UA 1YVUA 2AZMA 2C8VA 2JH9A 1HLDA 2DP4E 4PSAA 3KQQA 3CRW1 3IPLA 4JLVA 1V2GA 4WGFA 4Z4CA 2B20A 1GT6A 5EIWA 4MWZA 4FILA 4XD2A 1M2EA 1UKBA 1H5QA 2HH9A 2XQGA 4UW9A 5DYIA 5EKXA 3K70C 3PDHA 4FUQA 1FLNA 1UBUS 5FTNA 4ND1A 2B4QA 3Q0IA 3C1TA 1YJBA 3FR8A 3INRA 1GITA 3I6BA 1BIFA 2XT6A 3CPSA 1M1ZA 4RF3A 2XGJA 3SQMA 4WASA 1I32A 1JEDA 2PZEA 1JJVA 4TMZA 4WECA 3ODGA 1J9GA 4KVZA 4NEGA 3RSGA 4MWCA 2Z1NA 4EW6A 3AL0C 4HAZA 3DUFA 3MT0A 2HSJA 1MQ8B 2N0SA 2CXXA 3AU9A 3DD1A 2D3WA 2O0JA 1WSWA 3FSRA 1A3CA 3KPUA 3PWTA 4WCFA 4X6UA 1XTTA 1KXJA 4G0NA 4O59O 3KLPX 4IFTA 1XJWA 4D0GA 3OQNA 3F3SA 3QFTA 1ADYA 1M1YB 5F9MA 3QITA 4YP6A 4PC1A 3SDBA 2CBZA 1BDHA 2XECA 2UXBB 1QH1A 2B34A 4C21A 3RFTA 2B4YA 2HGSA 1Z62A 3A11A 4YI3A 4DNQA 5DLQC 3N2NA 1WMBA 3L7LA 4KFUA 3WLPA 2YOGA 1SO8A 2AXNA 5EP1A 1FUEA 3SYNA 1GKYA 4FFMA 2ZVQX 1Y6RA 4EG0A 1T0PA 2WUGA 2O2XA 3VBCA 1A4XA 1EBBA 1ECFA 5ALSA 4KACA 3ADBA 2ZROA 3LL7A 4FW8A 4AU1A 1ZSNA 4QBIA 4ND8A 3NKFA 1GUYA 3VX4A 3H83A 1GL9B 1SKYB 3ITDA 3N0XA 5CG2A 2QN9A 1Z28A 3AF3A 2YVUA 1IC6A 2J3DA 4K9NA 1I6LA 3HV0A 4GUDA 4I3FA 1SG9A 4B4WA 1IBSA 4BJ5A 4K6MA 1PZFA 5G4LA 3J81k 1T9CA 3F6RA 4D43A 1PU2A 5E4YA 1XRRA 1PS8A 3N75A 3R6TA 1O7JA 5K3CA 4YCBA 2GZ2A 3Q1KA 4EKEA 1V7PC 1J8FA 4N39A 2R68A 3RBVA 3IT0A 3AR7A 3JZIA 4JA0A 1M6EX 1PYOA 2XQFA 3PI6A 2XT9A 4CN8A 3DLHA 3BH6A 2VHVA 3NVDA 2EYUA 1DEXA 4GEKA 4ME6A 4AF6A 3WR5A 1XXHB 4ITRC 2BSAA 4PF1A 3U9TA 3V48A 5BNZA 2Q3BA 3X1KA 3UN1A 1K7CA 3A1WA 4RD1A 3QUSA 3TGLA 2Q6TA 5E7MA 4NBKA 1E79D 1KI8A 2GTHA 4INOA 3BMXA 3RTCA 4PCUA 1IYZA 5CAEA 2AW3A 2A5DA 2I4LA 1SXJE 1OV4A 2VFAA 3P0EA 5FI1B 4D0NA 4DXDA 4F8JA 4YXWD 1HFWA 3NHLA 3NPMA 2OXCA 4M38A 3E18A 1MENA 1U0EA 2VSNA 3DYIA 4B3GA 2KB0A 2VYCA 4PO9A 4UDNA 2WU0A 4C0JA 2LIPA 2NIPA 2QI9C 2VTDA 4B1FA 1LDEA 1JDNA 3TZQA 1H0HA 1IRIA 4YRJA 4JVMA 4J3JA 4B0PA 4HI0E 4LY3A 4DCMA 1OWNA 1QVVA 3GEHA 1M67A 4GC9A 3D6VA 3FAZA 1DZIA 5EIHA 1O8BA 1YS2X 3H17A 4ID3A 4O2BA 1OB2A 1TJ4A 4WZBE 2Q1WA 3W7AA 2XTAA 2AUNA 5CA0F 2P8JA 1XQYA 3B7PA 4K7JA 3V7FA 1RW4A 3P1JA 3O31A 4IHAA 4KPFC 1E92A 3AJDA 3L7KA 5BWMA 5FFMA 1OAOA 1H0RA 4BZZA 2Y2VA 4LF9B 2DFPA 2PLNA 1GZVA 3U56A 3GT0A 1HNNA 2R6FA 2BOVA 5EXEA 3P9NA 3FPAA 4BLUA 4E2XA 1Q95A 2G6BA 4FEAA 4FONA 4CU5A 3A6EA 4PYRA 4EUSA 3LPDA 4MDYA 5LVAA 1P1IA 1P74A 1NBAA 4GGMX 2F3QA 2VCEA 5FYDA 4ZI7B 1UMDB 3E9QA 3JQBC 1OHHA 3EISA 3NYWA 1UBTS 4HWPA 4ALJA 4BEJA 5LOVB 2XB8A 4Q1EA 2X15A 1T9KA 1YZGA 2VJAA 1JILA 1KZHA 1QH0A 4Q3CA 4L85A 5HEKA 5HKKD 4ADSG 1IPHA 3OWOA 3DZKA 1SHKA 3C8HA 3WRYC 1L8OA 1OASA 4ML3A 4DCGA 1CUIA 2OXRA 5LQUA 2YZNA 1PZGA 3ZWKA 3L8EA 1ZOIA 5JALA 2IV7A 4CWAA 3BDIA 1JIKA 3JX9A 1BQEA 1RQLA 1QYWA 1SUBA 2VRBA 1RAGA 3K15A 3MINB 3OH8A 1FTQA 5HTKA 4CLRA 2PHZA 5LYJF 3T41A 1UOQA 1CYDA 4UBMA 2CUNA 2JKVA 1IIRA 3NEJA 4R40A 4R5MA 3QKRA 4RVGA 1R74A 1EUZA 3AR9A 4PICA 3I2IA 3VKUA 1HWYA 2BZ0A 1X1BA 1ISHA 4HEQA 1JJAA 2VWQA 4MUNA 4QQNA 1A9QA 4RX1A 4DIEA 5LLDA 1HFKA 2CMHA 4MMXB 2I2AA 3U7QB 1E1QD 2B4RO 2HYIC 4NZZA 3HDTA 3VH3A 4ZYUA 5JAIA 1U4NA 1QFMA 3L06A 3HCNA 2JI7A 1O5TA 1VE5A 2OO7A 1VA4A 1G21E 2YMQA 4L8LA 3DEKA 1UPCA 2Z2KA 2IZ7A 1GNRA 1NVUQ 1TUIA 2DMRA 2VP9A 3TQHA 5E1BA 3BB3A 1RI3A 2II6A 1YRLA 2OOKA 3P4YA 3V46A 3ZIUA 2D6FA 2EFYA 1UT8A 1S2GA 1XZCA 3AVXA 3BG5A 4JUCA 5KAMA 3U3OA 3ZGLA 5C5CA 1KZ7B 5HIAA 1P31A 1EI9A 3CIOA 1GOTA 4JDUA 5BR7A 3LX8A 5GZ3A 2VCHA 2P0AA 3KUCA 4J0DA 4B3TB 4HLDA 4P93A 1B00A 2XMQA 4NH0A 1M33A 5DJ5A 3WQHA 4C43A 3C3AA 4BO2A 9MHTA 4HDCA 1VA5A 4NHEA 3ZWWA 1S3SA 2KW5A 5KYWB 3W3ZB 1X92A 4X7RA 2QUBA 1WMFA 4O08A 5EI5A 4MMYB 4QGFA 5TQ2B 3RUIA 3UJ8A 2W2XA 3E22A 4EJFA 1OROA 2GYUA 3TNYA 3GLFE 5ITVA 1E79A 2F4NA 4G2TA 3TVDA 1IY0A 3T5DA 5A03A 1G16A 2O0LA 4P4GA 1CE8A 4JSYA 2IUFA 4JY7A 2R8BA 5E7QA 3G17A 5FUYA 2WJ3A 2VDRB 4Q1CA 5EJ9A 1C0KA 2OLEA 3ND7A 3GQVA 2WT8A 1VMAA 3STVA 1XVVA 2DWCA 2X14A 4JL8A 1N5IA 4QYMA 5FA6A 1VBFA 4Q1BA 3B6ZA 4RVNA 1K8YB 2R4QA 3WL7A 4EARA 2RAUA 2A86A 4Q01A 4IQ8A 3PQ8A 2IGTA 2XD9A 5LQNA 1CHNA 4BX2A 1U8ZA 2TMKA 3QY9A 3RRYA 2G76A 1ST2A 2JZOA 4UHBA 2MDTA 4GLFA 1KPIA 1EYZA 1R37A 4BDTA 2VPWA 4N1AA 2IV2X 3MBKA 4O8CA 4PS0A 4F72A 3SXUB 2QLMA 3OURA 1PR0A 3DAYA 3M5DA 3E9ZA 3W9UA 3WGLA 3PA6A 2AC7A 1MOPA 2QG4A 3BMNB 3GC6A 4LVUA 3ST7A 2AOTB 3QYJA 4EVRA 3JQAA 3EG9B 3EDRA 2WZQA 5IDVA 1JYSA 3PZRA 4MKXA 5YASA 3NNSA 5AKGA 3K0CC 1M3SA 3TCNA 1AB6A 4J75A 3LKVA 1K0UA 4KODA 3CNEA 2W37A 3BB1A 3RF6A 1HF3A 1LI7A 1MX9A 4BNIA 4W6ZA 4A15A 4ARUA 1U3VA 3L7MA 3IE0A 1JI3A 2YZ7A 3L7YA 3NWBA 1T2EA 2DHCA 4P86A 4X1IB 1XRJA 3L40A 3TQOA 4LVNA 1QNLA 2A67A 4QL3A 4B3IA 4C3ZA 2FW9A 4FWBA 4B4KA 3H5IA 2YZKA 4I5DA 3GL9A 3OEEA 4CLEA 2XSZD 2VXBA 5EZQA 1RCUA 1KVSA 4RPGA 1V4VA 4YREA 4KEAA 3QFCA 3E84A 2B8NA 2G88A 1MC1A 4OHOA 4NYJR 2NO1A 1KSGA 4J03A 3ZGOA 3HXTA 4C0KA 1V9LA 2AMVA 1CR4A 1T6XA 5EJ4A 5CLJA 5JYCA 2C97A 4S04A 5C1BA 3BCRA 3G79A 2X5KO 5EY5B 2GZHA 3L41A 3OLCX 4R54A 1NBHA 3TTSA 3GLGA 4XFJA 4C4OA 4ZJZA 2DJ5A 2JVJA 1EK6A 4TV8A 1IY8A 1KNXA 4L0MA 3SNKA 3LGXA 5ADWA 4UTOA 5H80A 2HMVA 3FSJX 4J0FA 1G8JA 1NU6A 2CNWD 2PFGA 1GTG1 5FBQB 5AXCA 1M2KA 2YV2A 5JATA 1K2WA 1VPTA 4FIDA 4P34A 2PGXA 4X85A 4QQRA 1Q0HA 4V3CA 2Z4SA 2AYZA 1PJZA 4FCCA 4G01B 3RRNA 1Z0IA 2Y6VA 3DVLA 3LKZA 4QBFA 2JGKA 1RI5A 4EEKA 1DBIA 2WJPA 4TZ6A 4PPNA 2YOFA 3FTNA 5KQRA 2IJGX 3C6MA 2HWUA 2X8JA 3EQZA 3F8SA 4D8WA 1AGPA 3OZAA 1S2NA 1U2ZA 2GO7A 3HY6A 4XJTA 4M8LA 3RGGA 1G7RA 4DOMA 3C24A 1QBGA 1NVDA 4L15A 1I24A 1V8PA 1D7AA 3QWIA 1NRJB 4LJ6A 3L43A 4JJEA 1U80A 2CNDA 3CLUD 1NTRA 5B2ZA 3WYBA 4R0MA 5K6AC 4Z9XA 2DWUA 3T9AA 4DLXA 1QG0A 3GLHB 3BTUA 1CR2A 1UK9A 2XJ9A 3EHDA 3RIEA 1QE5A 1DC3A 3KT3A 1N2ZA 3BMQA 3HY3A 6Q21A 2DBRA 4G0UA 1P1RA 2NUPB 2QTNA 3ZLTA 5ILGA 3IVMA 3I0MA 4JJFA 1HDCA 4LI0A 4PRYA 1A95A 4R0NA 1JQ5A 3D3EA 4NBSA 5CB8A 4RK1A 2IRWA 1RKBA 1T43A 1N5DA 1JJFA 1JZSA 2FKNA 3R6LA 1QFSA 1UMBA 4C0XA 2ZKIA 2C61A 1E63A 2XDYA 5AKLA 4BQPA 5LL6P 2J3IA 3BWDD 3M6XA 2HSGA 4MV1A 1MQAA 4GI7A 4ZT7A 4DUGD 2ZWIA 4DC9A 5KCZA 1OIXA 4JLKA 3I23A 3ROGA 4RKWA 3RUPA 2BZSA 2V0GA 3GAFA 1AB5A 1PZMA 3DLPX 2HMYB 3KDAA 4LYYA 1M0WA 4FZ5A 3A3NA 1Z0FA 1WU8A 4CTNA 5AW2A 2IYLD 3Q87B 2HC9A 3GXOA 3N2LA 4Q1VA 2ZBVA 3BA1A 3CUUA 3LW8A 4QUHA 1WLSA 1NLMA 1LFAA 4JBNA 1CHDA 4HLUC 1DWPA 2WQZA 4Z6KA 5L8VA 2YRFA 2B7LA 1PUJA 4WJZA 5CH5A 4ZN6A 1QHHB 3LPAA 1ESMA 4M1QA 3OOWA 4ZAZA 2DTXA 2HPVA 2ZYWX 3KSBC 5IASA 1SUFA 1JR2A 1Y0BA 3GY0A 3GZNA 3E7FA 1HQDA 3GW8A 4LDRA 1YSCA 2IYTA 4WN3A 1MJNA 2QTHA 4LMBA 1O9BA 4RMGA 1ILEA 2RBGA 5K0LA 2HRCA 3T7CA 5L4LA 3U81A 3B52X 1GTRA 1P73A 2O7SA 2JGAA 2D4AA 4BTEA 1QGYA 2HLNA 4I4NA 3NUQA 4WFKA 2PK3A 2Q4BA 4D9GA 2Z6AA 2CXSA 1LDBA 3U3KA 1T4DA 4LGVA 2A5GA 1CXZA 1Z38A 2PEZA 1SCDA 4J2OA 1TYBE 3FVWA 4QXQA 4XLTA 3WLSA 4YRMA 1PJSA 2O8CA 1YZQA 1DQNA 2D2XA 3G0GA 4UBJA 4BZQA 4B09A 3AERA 3HFSA 4WOCA 3IUMA 4UBOA 1JHPA 3RQIA 1UPBA 4N0MA 1R0LA 2YKGA 4DABA 1D2GA 5A2GA 3QX7A 1M6VB 2HA2A 3HEBA 3N8GA 4PHHA 3IPYA 4D8YA 1SBNE 1ZP6A 3FH0A 3KWMA 2ADFA 2NT4A 5EMHA 2BH2A 4EZIA 3GH1A 3JYLA 1C3LA 4HN2A 1C9EA 3TFQA 1GFWA 1Z17A 4CUKA 3BK1A 1GZ4A 3QEJA 3IYLW 4KI7A 1NSYA 1AQNA 1S2IA 1JR4A 1ZN2A 3BCUA 1EQUA 3DUWA 4QVGA 3RVKA 2RE8A 3R74A 1PSZA 4OQFA 2F3PA 6REQB 2NP6A 2D0PB 3GFVA 5JNSA 3HEAA 1TKCA 1AX9A 2FEPA 2NM0A 2W6JA 3HDYA 3HDJA 3PXBA 4X97A 1CKEA 4GMFA 4DCPA 1MP0A 1Z2NX 2QS9A 4UXIA 1JU3A 2VO1A 2X6TA 3AHHA 5BUSA 4R01A 2BM0A 3DE3X 4WOPA 1I13A 1JKJA 2OBNA 3N39C 1T8SA 1L5MA 2WC1A 4B2YA 3PUVA 1ZS9A 3BDVA 1DE0A 3UXEA 1Y4DE 2CNWA 2ZSAA 1L8XA 4TL7A 3C5EA 1ZCAA 2CJYA 5HMMA 3VV3A 3ZWVA 4DPKA 2GHTA 3F4KA 4HR7A 2O1SA 4RU1A 2XWJI 3Q12A 5DLYA 4ZANA 4L57A 3IO5A 4HNTA 2BFBB 4LZAA 1AA6A 1NIJA 3M89A 1WEHA 1GRVA 3WRYA 3MSCA 3DE1X 3QV2A 2CCGA 1XC7A 4UAUA 1RXVA 1IWBB 1LBQA 1W8IA 5H5JA 3ABZA 1U8TA 1GU0A 3I0ZA 4PXYA 2PX8A 2V97A 2WA2A 1MJFA 3BWVA 1XZMA 4QPZA 2P78A 1LV7A 1UFQA 3CB4A 3WSWA 1T9GR 4X63A 1SKQA 5U1PA 3H5RA 2D2EA 3MWDB 3CHYA 1IB6A 1GUBA 3G9XA 5JQGF 2JBAA 2AKYA 2L18A 4P08A 2X9LA 4JC0A 3CE9A 5GZ6A 1OBVA 2AR9A 3OJOA 4MVJE 3IGFA 1RLJA 1XMVA 4J4BA 4QWMA 3SE7A 2WTMA 1I1QB 1AZLA 3IQZA 4JQYA 3SZOA 3G2LA 2W8ZA 3DEZA 4FXOA 1GQSA 3ILYA 3GI1A 3IS3A 1CZOA 3ER6A 2OZKA 4XM1A 2Z2ZA 1IN8A 2IPXA 4UE3S 1C30B 3S3TA 2WAMA 2GA9A 4E94A 1KQFA 4YACA 4B0OA 1YZ3A 2OE2A 3DR3A 4N8DA 1J22A 4Z8YA 1KVQA 1RE0A 1Z0ZA 2BFCA 3EZXA 4JP8A 4P7BA 3WK7A 4LE2A 1ORWA 3K8YA 4EHNA 1RLOA 2V5VA 5JSYA 2AL7A 5JWRA 2GBCA 2EXXA 1REQA 1SUSA 2JFGA 3GLTA 4KHPB 4OIFA 5ELXA 2R86A 3O8RA 1LJLA 4HO1X 2IS1A 1D2AA 2H1RA 4B82A 4YMSA 1G8PA 1T0UA 1C3OA 4OREX 4XJSA 3HJGA 1H69A 1A04A 3Q72A 2HIMA 4K2HA 4LJ8A 2WHYA 3PUZA 4E14A 4TTSA 1NUAA 1OZAA 1PYDA 3NWJA 4KWTA 5JYDA 5J1SB 3EIXA 2JD2A 4C5BA 1YBVA 1Z26A 3QF4B 2NUPA 3HUTA 1WL8A 4WPGA 1SUDA 3RS3A 1R8JA 4TRMA 1DKOA 1N6NA 1Y8CA 3IAFA 1NYRA 4LDNA 3VHLB 4D7AA 3GRKA 1ZGCA 1V9CA 1JMVA 2JGDB 4RCZA 2J0UA 4A1OA 1XDGA 2AI3A 2BHRA 2GPAA 2ZB4A 3BJIC 4CQMD 3AONB 5BYKA 2NO4A 3GAZA 3W0LB 1KJZA 3NV7A 4ALKA 2XNJA 5BNTA 2WSSA 3D9QX 3ZWNA 3IFSA 3THXA 1KH3A 1QH8B 1RBYA 1VE1A 3L6EA 3RHZA 3ZE8A 5D86A 4EJSB 4F6RA 3EQ8A 3HRIA 5AP9A 5TNXA 1P5HA 5FPYA 4B3BA 4DMRA 1V16A 2GASA 2TMYA 2X2PA 3MYYA 3O8QA 3S70A 4HFNA 1YVEI 1E1QA 1NASA 1UBLS 2Y6UA 5EUBA 2NYVA 1WZNA 3BRCA 4I1RA 3BHIA 1N7IA 3CM0A 4PGFA 1NM5A 1PZNA 4PZUA 4M53A 2C0QA 4R2JA 3W5HA 4DA4A 3GGOA 4I4TA 4NDZA 1UMBB 4K8RB 1V95A 2IA5A 3W8NA 5CA1F 3C8ZA 1XCGB 3FJYA 2DPLA 2ZR7A 4DJAA 3GJXC 3TOVA 2X8WA 1W88B 2C9CA 3DOUA 1DRKA 5FBWB 3V7UA 4RH1A 5CIQA 1QGZA 5M04A 3TSWA 1I36A 2QIPA 3FIJA 3NORA 5IVKA 4JBLA 3OQIA 2DUWA 2Q2QA 3RYIB 5KTSA 4Q9LA 1L8QA 2R79A 3UAOA 3I5AA 4FUTA 1TLTA 2IYOA 3Q11A