1RFGE

Crystal structure of human purine nucleoside phosphorylase complexed with guanosine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
288
structure length
288
Chain Sequence
b'ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structure of human PNP complexed with ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rfgE00
1A69A 1CG6A 3LBAA 2I8AA 1JDUA 3INYA 1K3FA 4EARA 4BMXA 1YQQA 4DAOA 1T8YA 3OCCA 1Z38A 1ODJA 4GLFA 3ODGA 4OGLA 1JPVA 1YRYE 3BGSA 4K6OA 1V41E 1XE3A 3DJFA 2IQ5A 1U1GA 3OOEA 4L0MA 1Y6RA 2Q7OE 3UAVA 4YJKA 1TGYA 4DABA 1RYZA 1SQ6A 4WKOA 4QATA 1ZOSA 5F73A 4PR3A 4WKCA 3OZEA 4F3KA 4YMLA 1FXUA 4QAQA 4PNPA 4NY1A 4TXLA 1N3IA 1PBNA 1G2OA 1PW7A 3GGSA 1LVUA 4UC0A 3DP9A 1A9SA 4TTJA 1ODLA 4GLJA 3DPSA 4RJ2A 4OEHA 1YQUA 1YR3A 1JYSA 1T8RA 1Y1QA 1JDTA 3DDOA 3FNQA 1V4NA 5ETJA 4G89A 1ODKA 1ODIA 2AI3A 4BMYA 2RJ3A 4DANA 1A9OA 3GB9A 1U1CA 1NW4A 2B94A 4WKNA 4BN0A 1PR6A 4YNBA 1LX7A 3UAYA 1OTYA 4QEZA 5CXQA 1RXUA 3P0FA 1OVGA 4WKPA 5KB3A 3ENZA 4LDNA 1ULBA 4D8YA 1JE1A 1Z36A 4DA0A 5F78A 3NBQA 1TCUA 1T8WA 1RCTE 3E9ZA 3EMVA 4D98A 3LA8A 4X24A 1A9QA 1ULAA 2OC9A 2HSWA 4MCIA 1I80A 1VFNA 1ZL2A 3PNPA 1B8NA 3ONVA 2ON6A 3IOMA 4D8XA 3NM6B 1JDVA 4DA8A 4R2WA 2AC7A 4L6IA 3OZBA 4TS3A 3K8QA 2P4SA 1JDSA 1Z35A 1PR0A 3DF9A 5C80A 2XRFA 1U1FA 4DARA 4OF4A 1PR2A 2A0YA 3C74A 4L5YA 4H1TA 3KU4A 1A9PA 3PHCA 3K8OE 1M73E 1V45E 3FB1A 4L5CA 1PK7A 1Y6QA 4LZWA 1PF7E 4QARA 4BMZA 4TXJA 1Z37A 1RR6A 3UT6A 1V2HE 5CYFA 1PR5A 1RT9A 1VMKA 2QSUA 2HN9A 1RXSA 1Z39A 2AI2A 4IP0A 4NS1A 1K27A 4QFBA 4FFSA 5B7QA 5CCDA 3BSFA 1QE5A 3T94A 3P0EA 2H8GA 3EEIA 4DA7A 4WKBA 4M3NA 1T0UA 1RXYA 3FWPA 3BL6A 2OXFA 4G8JA 1ECPA 1LV8A 4G41A 2A0WA 3OF3A 4U2KA 1Y1TA 5FAKA 4GMHA 4TTIA 1OUMA 3KVYA 2OC4A 3UAZA 3D1VA 4MARA 1PKEA 4LKRA 3FOWA 4YO8A 1RSZA 3OZCA 4KN5A 4TS9A 5F7ZA 1K9SA 3NM5A 5K1ZA 1Z5PA 5B7NA 1TCVA 1Z34A 3KUKA 1Z5NA 1CB0A 4JWTA 3FAZA 1TGVA 5CXSA 1Z5OA 1NC1A 5EPUA 3O4VA 1YBFA 4TTAA 5F77A 1A9RA 1SD2A 4R31A 4F1WA 1U1DA 1PR1A 3BJEA 5IFKA 3LGSA 1SD1A 1SJ9A 4E1VA 1NC3A 3U40A 3F8WA 3OOHA 4TXHA 1WTAA 1B8OA 4DA6A 1Z33A 4OGKA 4TXNA 3O6VA 5IU6A 4D8VA 2QDKA 4TXMA 1PR4A 1V48A 3QPBA 4JP5A 3KVVA 2A8YA 3UAXA 4ECEA 1PK9A 3SCZA 2I4TA 2PGAA 2AI1A 1OU4A 4P54A 1JDZA 5I3CA 3EUFA 4LNHA 1U1EA 4M1EA 4NSNA 3MB8A 4I2VA 4MCHA 1C3XA 4EB8A 4F2PA 2QTTA 3MMSA 2BSXA 3TL6A 2QTGA 5B7GA 3PHBE 1TD1A 1PWYE 5CYGA 1Q1GA 3IEXA 3OPVA 5F7OA 1Y1RA 4L5AA 3FUCA 4OJTA 5EUBA 3OZDA 2QPLA 4D9HA 1JP7A 5F7JA 1VHJA 2HRDA 3KHSA 4M7WA 1A9TA 2HWUA 4GKAA 2ISCA 5F7XA 1VHWA 5JPCA 3EUEA 1RFGE 3KVRA 4DAEA 3E0QA 3E9RA 1JE0A 2OECA 1OV6A 3NM4A 5CCEA 4JOSA 5DK6A 5F76A 1T8SA 4OY3A 3UAWA 1V3QE 5B7PA 1RXCA 4LNAA 4F2WA 4TYMA 2GUWA 3PNSA 4F3CA 1OTXA 1Y1SA 4R2XA 2A0XA 4QASA 5EFOA
chains in the Genus database with same CATH superfamily
4AY5A 2GZAA 1P1KA 3AV3A 1NUQA 4GSLA 4HPJB 4KXXA 3WSWA 5BUQA 1HOXA 2WJIA 3ZU4A 5L6MB 3AJ9A 1RI2A 3IIKA 2RHRA 4RJLA 4DDTA 1F51E 4Y1FA 4FVTA 4WBSA 5IUKC 4LZOA 4S1VA 3ZY2A 2QGNA 2WPNA 4G4SO 4JBXA 4NS4A 1NP6A 4HQ0A 1DBIA 4Z1MA 1AQJA 3J80A 1M34B 2GVZC 2F3RA 5TPWB 3LBFA 4ZOCA 3SKYA 4BB9A 1GA6A 4TMWA 2IEBA 5AVKA 3IV9A 2QK4A 1RAEA 4LFCB 2EWMA 3ILYA 2NVBA 2HDNB 4DEVA 3K70D 2VBCA 2Y0DA 1RYEA 3GWGA 4YV7A 4IJWA 1YIOA 1FQKA 1KYIA 2VKQA 3GCXA 4P32A 2QT1A 1KETA 2L19A 1KOFA 2V6FA 2AOXA 2YUIA 3KT6A 1FY2A 1KXZA 3NKVA 1XZFA 2DWUA 2J59A 1A9ZA 3EASA 2G80A 3JWEA 1UCFA 1XX6A 1QH1B 1SHJA 1COZA 1W1UA 3B13B 4JEIA 3F4LA 5HW0A 5JW6A 2VT3A 2GQ0A 1I2CA 3THSA 3VV2A 1IY8A 1VA5A 3EOAI 2GKSA 4QECA 3K0CC 4DIFA 1NJGA 2OFPA 2PA0A 4WN3A 3TDKA 3IE0A 3T3HA 3RYCA 1AK1A 1XHFA 1L4UA 2PGJA 2CLEB 4GPBA 2A67A 1JG6A 3D7LA 1E32A 4TV9A 5I9BA 3H2BA 2J0EA 3OZTA 3VI3B 1FYEA 1G6KA 1ULHA 3FAKA 2C2BA 4FR2A 1YD7A 2M6SA 4HQKA 2H07A 2F48A 1VJCA 2Q4RA 4QHTA 3T15A 3UMFA 3ETCA 1S02A 3GD5A 2BZGA 1BWSA 3SJUA 1QYWA 1YNSA 1ZK4A 5FADA 1N0IA 5B57C 2VRWA 1T6NA 1JLMA 1OXUA 3UXYA 1QFJA 1XRSB 3UGTA 4KPUB 4C20A 4YHHB 3JAWB 3UANA 5HXAA 3D8SA 4OK6A 4DA9A 5J1SB 3FPBA 4FI3C 1EWTA 3V32A 1AKMA 1NVVQ 4E5YA 2R8PA 3VR1A 4L15A 4EYGA 4M0KA 2Q1YA 2GX6A 3O8NA 5EZQA 1BVYF 2WJAA 5FI1B 4B81A 4D3ZA 4EPWA 4JIMA 4KNWA 3H1EA 3GPBA 2A0KA 4BO2A 3RS0A 4X9XA 1EFRD 4B43A 4OEHA 4PAOA 4YP5A 1PQWA 2P6NA 3EIWA 2GJAA 1T8RA 1NFQA 1JDTA 2FFHA 2NUPB 2JGAA 2WG1A 5DN6D 4B6JA 1Q1EA 1BEEA 3EGVA 4GWLA 5K2OA 3GLGB 1FW6A 1V8BA 2WF9A 1LI4A 2IE0A 2JGDB 4OU4A 2XMGA 3VPCA 4YCNA 1P2SA 4WPGA 4DR2B 4R7GA 2IW1A 3PKIA 4QJ5A 4ENUA 3CLRD 1A76A 2GK7A 3O3CA 2ZRAA 1LXCA 1N5JA 4IXTA 3DEKA 4PN3A 2YHAA 4F72A 3P9IA 3RFVA 1CE8A 1GSOA 1PK8A 1VPVA 1XEWX 3HDGA 4YNBA 3SS9X 1ZVQA 3LBIA 1FNCA 4L8FA 3U7FB 1MG0A 3RC1A 2JIOA 3IVCA 1OTYA 3JQGB 1QLJA 3PXXA 5B1HA 5KAMA 3VYUB 3BB3A 4GKJB 2QRGA 2ZFUA 2D1TA 1USUA 3MZ0A 4X8MA 3ZCXA 2IV2X 4HDRA 3H9CA 2OV1A 3ZCUA 3DZCA 2Z8ZA 1OOEA 3ENZA 4KP7A 5CPBA 2PZJA 3GCDA 3LWNA 1C4XA 1OZ0A 3LX4A 2IEZA 1CT9A 3BH6A 1RCFA 1E7MA 2Q6KA 1TIBA 2ZR0A 4O4HA 5JWHA 3AM1A 1JJAA 1FTQA 2WJZB 4FSXA 3SS8A 1F06A 5T8KC 1G3RA 2N9UA 1SVWA 1SIBE 3K0EA 1JE1A 3GUCA 3PJEA 4MCJA 3DJYA 4QBHA 3JY6A 4YK7A 3MWEA 1TC1A 1DT3A 2CFSA 4LPKA 3UT0A 1H1LA 2R2GA 2FZKA 4X62B 2G8LA 1YMVA 2RGBA 1WPQA 2ZJ8A 4U2GA 2XZDA 1DIRA 2RGYA 4R1OA 1ISIA 4N7MA 1YB6A 5ALWA 1S8AA 2F1RA 4BO0A 1GVHA 4G25A 4Z9YA 2ZSDA 3QBVA 1RC0A 4FGJA 3TKLA 1SCAA 3CMCO 1KDVA 1L5MA 3R7SA 4JQOA 2CKDA 3UQYS 3SPXA 2FG7C 1M2WA 4LF4B 1SXGA 2CXSA 2ZRHA 4CM7A 4F9FA 2FXIA 2CHGA 4QPDA 4KQXA 4QODA 4BGIA 4BPBA 2N3ZA 1W59A 1RPTA 1Z2EA 2J9XB 4EVSA 3OFKA 1P45A 3FCYA 1J2EA 3VA7A 1R5BA 3AY0A 3NM6B 2DH6A 1V0JA 3L8CA 3A28A 3K2IA 1X8JA 2BFFB 3JRXA 5B58C 1SG9A 3T9BA 3FROA 3KYDB 1CIJA 1DI0A 1J0EA 3NTRA 5HNKA 2A1UB 1Z8DA 4B2YA 3P4UA 2DLCX 3FCAA 1B6GA 4CIXA 2FFRA 2HUPA 2VKTA 3QOWA 2NSHA 1JTEA 2JH9A 3BSWA 4O4LA 4OLFA 4QNMA 2VDJA 4RE6A 1VYTA 2D0DA 521PA 1RWVA 3R5XA 2QI9C 1HM5A 4RKWA 4C5AA 4O3MA 3IAUA 1QMGA 3FYHA 4YUAA 4XVHA 4PAQA 3D6NB 5IKPA 5K8IA 4EGAA 5FA5A 2YIDA 4DUYB 4OL0A 2J67A 3Q4GA 5ITZB 5DBOA 4AZWA 1M6WA 2O8DB 2NOAA 5KYUB 1F4VA 1NVAA 3V4FA 4WNIA 2RIPA 1U8TA 4QTYA 4GWGA 4FHGA 2ZI9A 3IURA 4RTKA 1CS0B 2C07A 1VSBA 5DK4A 3G2OA 1DJPA 1T4BA 4TTSA 3COVA 4YLEA 5EWJB 1CY7A 1GZ4A 1RPNA 3T7JA 5HIKA 3G02A 2O5VA 3PHCA 1BE1A 4E5KA 5AR1A 3OWHA 2QR3A 1X1RA 3KWFA 2VYNA 3N0VA 2RGCA 1TPZA 3ED5A 4BO5A 4IIJA 4S05A 2Q3FA 2PUVA 2VDWA 4HG2A 4JIGA 5JMPA 3UT5A 1F9AA 1JZSA 1DEHA 1RTTA 3MTDA 1KZ9A 3MGCA 3C6YA 3B3QA 2Z8YA 2WTEA 3CA8A 3D5TA 1O9HA 4IR7A 2X0DA 4EZIA 1QK3A 3U0VA 4OL9A 1W5BA 4ZYUA 4LJ5A 3A11A 5KVQA 1DRUA 1MZPA 4BNDB 1K06A 4W6QA 2PK3A 2XJ4A 2XPCA 5EAIA 3P2KA 1M6VB 2HOQA 3KZKA 4B83A 3LPNA 3T5TA 4DV5B 1Y7PA 3QJ5A 5TNXA 3G1UA 5CYFA 4TRJA 1I7DA 1Y3FE 4KWIA 3KSMA 4CM8B 1ZD4A 4WLVA 1UOEA 1EUYA 3W7BA 4ZT4A 2QSUA 3ETHA 3NBKA 4CEHB 2PS9A 2B83A 3Q9SA 3RU3A 1QIIA 4XWWA 2HU5A 1G21B 1Y63A 1BSVA 1YDGA 1H0KA 2G40A 4BL5A 2G5CA 4WK4B 5KZMB 4X94A 3K9QO 4EO4A 4WFQA 4BMSA 1U94A 2UUCB 4PSAA 2V6GA 1YE3A 3HL4A 2JANA 2VXYA 3GVXA 1CUJA 1F4LA 3T9FA 2XMDA 4MA0A 3WGHA 1UPXA 3UC9A 4C4TA 4EYEA 1HH4A 4ZQBA 2QN9A 1W1IA 4FCTA 3UEOA 3ESRA 4X1YB 1HEYA 3DE2X 4I66A 3P26A 1YACA 3JQFA 2BBOA 4FOPA 4L4UA 4D8WA 1X7XB 4D4GA 4UZFA 1MJGM 5UKDA 1W5SA 4YRAA 1RXYA 5BWNA 2QYSA 2FYTA 4GO1A 1UWKA 5DM2A 4E1BA 1J00A 1XTKA 2VT2A 1LVGA 2YFKA 4LDAA 4NAHA 5JC8A 5FTJA 4ODIA 5A4MS 1HZZA 4KGZA 4GFDA 5AVSA 4OHRA 1YSCA 4IW3B 5EE0A 2O8FB 3IQHX 4M6WB 2C95A 4J1QA 3HBFA 3LP5A 3TRJA 3KQQA 3E61A 3TIFA 3QYPA 3MQ2A 5AK3A 2IH2A 4GZ5A 1A7KA 3BGVA 1K0UA 1XRNA 1ZIOA 4I3HA 1UPAA 1BXRB 4BV8A 5JOQA 4CLXA 2JHPA 2PXXA 4LMBA 2OM2A 4B3FX 5FAKA 2Z6QA 4RIGA 4KTTE 3TAUA 3SVLA 1GKKA 5LQNA 3B7WA 1PHPA 3KZ1E 3VR6A 4AY6A 1XZ8A 2WWFA 2Y6VA 3PC7A 5BSMA 2E5FA 3ZY4A 5EHXA 4MARA 1RHRA 5L53A 2UV8A 4FB4A 2JJQA 1Z0KA 3F7TA 2HNKA 4XM2A 1PJAA 2DERA 4OJKA 2H4FA 2X58A 2ZJAA 3E9YA 4C0SA 3ZWBA 1VE7A 3C8HA 4LQLA 1JKFA 4UJ5A 1KVTA 5CLQA 4A6DA 4DG8A 3TR6A 4V0ME 1E1CA 1V25A 2CF6A 5C8DA 5FUYA 4MH0R 4JWTA 4KW7A 3PC6A 4OB8A 2ZXUA 1QH8B 1M34A 1QVZA 2G1JA 2Q62A 4LEIA 1NVWQ 2O0KA 1II0A 1GEEA 4I4TB 4AN0A 4JJFA 2IYAA 4RANA 5CHEA 2QLFA 5F23A 3NKFA 3CUEF 4O2BA 1YBFA 2E85A 3OA2A 2POQX 5JCOC 3GFFA 3ROEA 3FFXA 1ICEA 5TQ2A 4ZRNA 2PUJA 5FYQA 1QH1A 2I4OA 3ABQB 1L5NA 4I1VA 4CG0A 1USVA 4L9AA 3COPA 2XE6A 4IO0A 3P0JA 4G5FA 2HF2A 2AEMA 3MRXA 3CGWA 1ZIXA 4L72A 1Q7BA 4JQCA 1H2HA 1LTHR 2HNAA 4YMWA 3VKFA 2ZSFA 3T1HB 1DQYA 4I6JA 5F2OA 5CH5A 3F5MA 2FPWA 5ENDA 3PI6A 1V8ZA 4PHGA 1DAHA 4ARSA 1ID8A 4CVNA 3FFWA 4LC1A 4L2IA 3L07A 2LD4A 3AI3A 1KZHA 4LDJA 4OHFA 1SVOA 1NVTA 1RE1A 2Q3EA 3EGEA 4TMZA 2ZUTA 2XKKA 1IBKB 4Y6RA 5EYPB 2OZPA 4R8LA 1T5TA 2WWIA 1QKIA 3PCRB 1A72A 3USES 4JC8A 3S7TA 5KREA 4D9GA 2J4DA 3WOVA 3EQ8A 3JAWA 4J90A 3ZGZA 4HRXA 3BUSA 3O6VA 2A4KA 1M7GA 3TQQA 1VB5A 2COUA 3ANTA 4XW2A 1EAMA 1DC7A 4Q7MB 3SE0A 5C35A 5KOHB 1QIMA 2EFJA 4YAWA 5F3RA 1MTZA 1LK7A 1QTRA 3DBRB 3HCNA 4QTUB 1MOPA 1R5NA 1TZCA 4GD3Q 4RFLA 2W0SA 3GCZA 1Z2AA 2SNIE 1PK9A 4G09A 2YASA 3FFAA 1G42A 2LKCA 1DKOA 4OXIA 2H1SA 1FMTA 1N7JA 2WT9A 3A6HA 1NIJA 5K3SA 4W5QA 1C3OB 1HYQA 2NQ2C 4KVZA 4I1OA 3QVJA 2BGIA 2CVOA 2NUPA 3Q6MA 4LNHA 3HUDA 1E5VA 3A10A 1IVSA 1L5VA 3I6BA 4HZIA 3GLGA 2QX6A 4HXFB 2OMEA 2WICA 3Q7IA 4LY6A 1XNQB 4K9MA 2ZEJA 2G1KA 4FDAA 3L0DA 4JXJA 3DGEC 4W1SA 1GOTA 3QLVC 3DWEX 5TPZA 2AQ8A 5CLJA 4QD3A 2ID7A 1HPLA 4C7JA 2G07A 5COAA 1F7VA 3BJMA 1HR0B 3TWOA 1JQJC 1OC4A 3F6PA 4GMDA 1H2BA 3TCXB 4S1NA 1BDIA 3FSGD 3JQGA 1IZ7A 4LHYA 1HFJA 3GDOA 4BV2A 3OPMA 4N6NA 5HF6A 1JR3E 1RHUA 1OKKD 2YWDA 3GCWA 4J0EA 2FG6C 3LQ2A 1DXOA 1YT5A 2Z0MA 4JYZA 2R6HA 1KR2A 2E4AA 3D8NA 4OQZA 2DH5A 4XWGA 3SR0A 2CF5A 5ES4B 2QTVB 2PH5A 4OH7A 1TUIA 3LH5A 2E55A 3JVEA 1JILA 3AILA 2GFIA 1AO3A 4W82A 3VR3D 5IRCD 3VH1A 2V3VA 1XLTA 1NFFA 4B6PA 4OQYA 3SN6A 4E30A 4PG7A 4QLBA 3IE2A 4IDPA 4MUJA 5HMLA 5IK2A 1G1MA 3U60B 1SUPA 3BN3A 2IPXA 5A62A 3ZGOA 3A25A 3AETB 2Y1CA 3EUEA 1N1EA 4WESA 1RI3A 1POXA 3VM6A 1PR9A 2VSNA 1R27A 2AKYA 4ZPJA 4UUAA 4RY0A 4TMYA 5BR8B 2BR4A 3C3BA 4LHXA 4XX0B 2JFFA 4EB0A 5MF6A 1UXKA 3IDFA 4M7RA 2V7GA 2P2CA 3ABZA 3BQNB 2KBEA 3LRPA 1QH0A 3V80A 4RS3A 4TVBA 4D6PA 1FJGB 1GL9B 4JX9A 4Y2SA 3OVMA 5K3OA 2HPAA 5KVCA 1KTIA 1CEEA 4ZMSA 4X3PA 2AZ4A 4L8WB 4JD5A 1EWRA 2CZQA 4CCSA 2ZSHA 5KHAA 2UVPB 3I62A 2AUNA 1PJQA 4HVCA 5P21A 4P9NA 2QAGC 1SXHA 5EY5B 1DWQA 3C4VA 3ANSA 3EG9B 4CMBA 4TYNA 3AFHA 1E6LA 3GJ3A 4IIBA 5C18A 1EUQA 1PFQA 2R62A 3REOA 1N2ZA 1P5FA 3ILHA 2VHEA 3KYDA 2RJNA 2OXEA 1ZMBA 1M66A 4FFRA 2A1UA 4KHPB 3QPAA 4DA4A 2F62A 1H1TA 2XGMA 3AY6A 1E0KA 5DFAA 2XE7A 3FYUA 4A0HA 4KAFA 1BWPA 1VKJA 1FJ2A 4K81B 4OOFA 3W8NA 4BTEA 4DMFA 1YUMA 3WWEA 3FPHA 4Z99A 4GBMA 1PS9A 1R18A 2G6TA 5I9MA 1BN7A 2QM3A 2XD9A 1JJVA 3UCXA 1CX9B 4R6WA 3KO8A 1EPUA 1VL5A 2AX3A 1O95C 3F4BA 3GX1A 3NUZA 3O92A 3ZY5A 3K70B 2J0VA 3F74A 2QKYA 1P7PA 2RGNA 2J5KA 3INYA 5ITZA 4RJTA 3MNFA 1AHIA 2A58A 1ZJZA 1U9IC 4BMXA 3AU9A 4GG1A 4JGGA 2YJZA 3H86A 4TSKA 4BJ6A 4DAOA 2C9OA 2MSLA 4GP6A 1CS0A 2ETXA 2LE0A 5IM4A 3FGPA 1UDWA 4HNVA 1IQPA 2PZEA 2CVPA 1FX0B 5K3FB 3MLAA 4B4OA 4U63A 4EJ2A 3THXB 2KYRA 4EJ6A 1J8YF 2RHHA 1M33A 3KZNA 1PWEA 3IGFA 1LWNA 2TSYB 1WJGA 2VSOA 4KUGA 2NW6A 2ZJ2A 4HNHA 1YR2A 5HIAA 2GAIA 4C0WA 4ZEMA 5AHOA 3DJFA 3PUJA 3IMEA 1VCMA 3NBZC 1DKRA 1IG3A 2VAPA 4G1EB 1WEHA 2E4VA 2YOGA 4MV7A 2XT6A 3RIEA 3UMJA 1HOTA 3CNQS 4BNDA 5A6VA 4DQUA 3Q0EA 2GLUA 3OE4A 4JH0A 4YJKA 5HCUA 3LE8A 2D7DA 1M6VA 3K6SB 1VE6A 4U9UA 3WLSA 3MXTA 4RV5A 5JAUA 4CUKA 4B6RA 2H1IA 4HGNA 1CU1A 4CM8A 2V55B 3RJZA 2WZQA 3ETDA 3FNGA 3UMGA 4CEHA 3HC7A 1WETA 4J3FA 3HZOA 2RGGA 4H7FA 1G21A 1UK7A 1DIGA 5LD2B 3MAAC 1OWLA 4HNAA 4PFSA 3N6RA 1NOIA 2VK2A 5LA6F 3WGNA 3P8ZA 5HIMA 5BQ3A 2HK8A 1YQDA 4FYJA 4YMLA 2HGSA 2R11A 3HWX1 2IJGX 3O4HA 3HL0A 3SYKA 1SOAA 4PIMA 1NKSA 3VPDA 3Q7RA 2WM8A 3HCAA 4C21A 2G71A 4LBYA 3LT1A 3C1UA 5BQXA 3TDMA 2AQIA 1UJCA 2PZLA 5JY1A 1X7XA 1I9CA 3FPAA 3KB1A 2YIVX 3OKCA 3H11B 1H9BA 4O1MA 4GM0A 3A06A 1FNDA 4OG2A 4HNTA 2VP9A 2YQZA 3CU5A 3P1JA 2Q6LA 3J7TA 3PWTA 5JS8A 1RRPA 2J4CA 5KNCD 1WAMA 4NYIR 2WB2A 3CTMA 1S6YA 4C2UA 1M72A 1MVOA 4GOOD 2HIHA 4KL8S 4NDZA 1ORHA 4PCVA 5K3EA 2O8FA 4JT4A 3V6LA 1GG9A 3WGVA 2WBLC 4BQNA 4H7HA 4HH4A 3CRVA 4CL2A 1TDJA 4HNGA 5FOQA 4ER3A 2GN0A 4X3OA 4N0MA 1ODIA 3E9NA 1R6BX 4D96A 4KE9A 1K1EA 1A9OA 1GRNA 2H0AA 2CXRA 3ZDRA 3GB9A 2HA7A 3UUGA 3DDZX 5JSUA 3KQLA 5HTKA 5ALYA 4BNYA 2FB9A 3BULA 2IZOA 3NBYC 2WG2A 4EB3A 3ENKA 5BSFA 4TUYF 1A4UA 1HT0A 3GXBA 2C4KA 2HMUA 3KX2A 4ALMA 4ZDJA 2X0EA 4HO1X 3ZD6A 4W8OA 3GJRA 3B51X 4UDNA 4AJHA 4LMAA 4BVBA 5AKZA 5CGQB 3WYCA 3FVRA 3NBUA 4LECA 2ASEA 4RKEA 2AE1A 1M2EA 3DPIA 5GGYA 5DNVA 3R7WB 3AWDA 3ICOA 1QH8A 4KQJA 5JG7A 3TJRA 2DWPA 4LV5B 2ZYAA 4FT4A 1DOZA 1NRJB 4PYRA 4V2UA 4LYHA 3GFBA 4YDHB 2JAUA 3TQCA 5CFQA 1BS2A 2BLNA 2W43A 1K5DA 1O9BA 4L4SA 5E3JA 3SYLA 1I30A 3AKCA 4A6PA 2V97A 1L7VC 2XWSA 1TCUA 3K71B 3AI2A 3NWEA 2PM8A 1DJNA 1RWXA 3SS7X 4IG9A 3H2YA 4ACBA 3GT3A 3LG2A 3ZVRA 5BYAA 5K6AA 2ZIUB 2VWHA 4XM1A 2FSUA 2QD2A 5A4JA 1VOTA 3AO0B 3FG9A 2I1WA 4KQCA 4X24A 2B4YA 4FQ7A 3C3EA 3W5DA 3C8DA 3ZE2B 1JQEA 2ZIZA 1JJ7A 4MCIA 5E0OA 3KV3O 4NU0A 4QPCA 2X15A 4F8JA 4ZYLA 1OXTA 3LQQA 3EZ7A 3QFCA 1LC0A 3U4CA 4RCYA 5LQDA 2WWGA 3IEPA 2WILA 5IDQA 5AI4A 3W2EA 1VG0B 2Z4RA 4DLZA 2WWRA 1FJXA 1ECBA 5DPMA 3HN2A 1VSTA 3RKUA 4TL9A 2V6IA 2A7QA 4IJUA 1WMAA 4FZVA 3PD1A 4N3NA 3RRMA 1DSSG 2NZ8A 2C03A 4DG5A 3U3MA 4PHTA 2DY1A 3AIOA 5B58T 4LOHA 5EYPA 5AKHA 3HU5A 4M9ZA 1U8FO 4Q4CA 2Q2OA 1UXOA 5HZGA 1EUCB 5ESXA 2B3DA 4WLEA 5EXEA 2Q1WA 3EC7A 3ILSA 3NYQA 3LDHA 2WE8A 1FLAA 4I46A 2E49A 3W8RA 1BX1A 1QCYA 4L0DA 3CSUA 1MOQA 5B30A 3KQNA 4C3UA 5KOHA 1JG4A 3DBRA 3AM5A 2V1XA 2WTAA 1UWVA 3INRA 1NXWA 1XWIA 2J1LA 2VI5A 1WIWA 1FU8A 2FK7A 5T3UA 2HHJA 4JL6A 2GFQA 3MK31 2K2QB 3KB8A 2J30A 4Q05A 4ND2A 2MSCB 3E5MA 5EVJA 3QMVA 2NV0A 2YQ4A 4H6PA 2VUIB 4L4YA 1V5FA 1E7SA 3B3AA 3C74A 3TKYA 4LJ4A 3MMPA 3UWDA 3WGTA 2OQRA 3H75A 2YFQA 2VTEA 1X1DA 1K0FA 3L8HA 4JZKA 4M2LA 1AURA 5AVWA 3E7XA 2XGJA 4PSKA 5GTDA 3FUVA 1O0BA 3JQCA 5IDYA 3MERA 1UKEA 1HF3A 4W9MC 1SU4A 1ZHOA 5LYYA 4F4HA 3NRJA 5E38A 1YS2X 2YVUA 1PK7A 4G86A 5EIBC 1VJTA 2RHOA 2WU0A 2ZPUA 5FO0A 1FDIA 1EH5A 1QHXA 3KUDA 5JO0A 1SG0A 4LZWA 3L0CA 4IIVA 4H6WA 4Q19A 4J0HA 5FCDA 1W2HA 4UFPA 2IHNA 3E1KA 3IC5A 4NABA 1BWRA 1WULS 4KLZA 1LF5A 3CUWA 1JEDA 2QX9A 4QARA 4FYVA 2PUAA 1E2BA 1RR6A 2RARA 3MEQA 1SWWA 1PS8A 1XAJA 1UBNA 5GM2A 4B47A 2YW9A 2QTVA 2ZE5A 5G3YA 3ICEA 4B17A 4HTAA 1ZJ4A 1F2VA 2OZKA 3FYSA 2XYQA 3FPJA 1ZNYA 1KZ4A 3OE7A 4FZ5A 4YJFA 4MUBA 2EV9A 1PGNA 1BRMA 3MRVA 1CEYA 5FV7A 2GGSA 1XA0A 1H5UA 2ATCA 5FBHA 1EZ1A 2JCGA 3I30X 5AJHA 3IPXA 3TZLA 4MQBA 4Q02A 1GFWA 4KREA 1YONA 3LBNA 3AETA 4MHSA 3SBXA 1ENZA 4A6EA 1TM5E 3EZ6A 4PC6A 4LF8B 4X44A 1T9CA 3WLOA 4W5OA 2DPYA 1KMMA 1M8FA 2NO6A 4HEHA 4M0MA 3ABSB 4XX0A 1OBFO 3V4OA 4B6SA 1GYRA 3JQAD 3P0EA 4XVUA 1AK9A 3EAQA 2VHCA 4Y9UA 5CG1A 4GPTA 1TJ5A 2RHMA 2Y68A 3PUVA 4K28A 4NBVA 4R98A 4Y2VA 5IXYA 2VCYA 1DOHA 4ERNA 2EQAA 3I2IA 1FVHA 1L9XA 1X80B 5DM4A 1VYHA 3GA7A 4RZUA 3SR4A 3I6MA 5B1IA 3TOVA 1Z4OA 3ZWVA 4B76A 4CZ2A 2UVPA 2RAUA 3A4VA 1KJNA 1QFMA 3ASUA 3AUKA 1NYLA 1IONA 1W73A 3PKZA 3KYBA 2P5SA 3GZTB 4RTRA 3EG9A 4EGFA 2IDJA 3B53X 1XVUA 2N42A 3SIWA 4JZYA 5KJCA 4ND8A 4HS9A 2OHGA 1BA3A 4AG5A 1K68A 4BV3A 4DPLA 5J4HA 5JNVA 5L3SB 2EX0A 4KQKA 2J3KA 4NF2A 1ABEA 1NOKA 2EJTA 4EHHA 3PYXA 5AJWA 1O97C 1YO6A 2YDXA 3MN1A 5LN1A 2FSHA 2RH5A 3B20A 3A04A 2PXCA 1JMKC 2F17A 1KBQA 4FDLA 3CCBA 1C7RA 4MLZA 4B32A 4NFYA 4DLNA 4CKXA 1DTSA 4PFQA 5HKBA 2PSHA 4YUXA 4MQ4A 1SCQA 2OSBA 2Q07A 2Q7XA 3B6KA 2PQ2A 3HKCB 1IBRA 4HAVA 2Z95A 4D9FA 4GMKA 2VTVA 2C59A 3OZCA 1F9EA 1Z0SA 4URZR 3CLSD 5AI6A 1SVMA 4JVMA 4Q1DA 1ADYA 1O7JA 2H1LA 3MWLA 3CNNA 3OOWA 4AWBA 2OVBA 2FMXA 4Q4HB 4BFWA 4MMXB 2GJSA 2CJXA 4FFVA 2GYVA 4YS6A 4LFAB 3VJMA 3FNBA 1Z15A 3E8SA 4Q39A 3VPFA 1IXYA 2KSQA 3QE0A 4HH1A 1E1QD 2QTMA 3DE4X 4DYHA 3TGPA 4R1LA 4Y6GB 5K3FA 1TZBA 2Z30A 3KKMA 2JHAA 1G7SA 4ZAWA 5IT4A 4UMFA 1HL7A 1PLLA 2G4VA 2AD5A 2WYOA 3FIJA 3MYYA 3O4VA 4IRMA 5FQOA 5K05A 2Q8QA 4L6CA 4RVGA 4RVUA 2O2EA 4OGWA 3CWZA 3ZK8A 3V4SA 3M33A 4TTAA 5HKLA 3UY4A 4LQDA 4WLUA 1RD4A 2AB0A 2COKA 5KC9A 1D2CA 1TEVA 4RD3A 4G01B 4C7XA 5ALXA 1KIMA 1M5UA 5BSRA 3OZSA 1J1IA 1PNRA 5AVXA 3AR9A 3GJZA 4XGKA 4V3BA 1GZ5A 3EZFA 3JD2A 1NXVA 1KQNA 1LF0A 4G1FA 4JT9A 3C7CB 5AK6A 2JGEA 3RVNA 2XYHA 4KQ1A 2IP4A 2WJVA 4P36A 1MMFB 3SNHA 4DNFA 2BEJA 2CYAA 1H3FA 5T6BA 4RMNA 2W42A 1EWVA 2XGOA 3LHKA 4BKOA 5CCBA 4JBHA 2YYZA 4M1SA 4PLFA 3ROMA 2X8JA 2ZWPA 3K5HA 4L22A 4RD6A 3QEAZ 1I0LA 5ICEA 4I1PA 5SZJA 2DT5A 2OSVA 2R6R1 2NU7B 2V7UA 3F8WA 4IO1A 2ZUEA 3VO1A 4N3AA 3D3QA 1G0OA 4UCXA 3V4PB 5KWSA 3HO8A 4LWZA 1EFRA 3DVAA 4UJ3A 3WBKA 2BAGA 1YMQA 2WHRA 5J2TF 4MYTA 4U2DA 2FPUA 5DN6A 4YLYA 3PPWA 4JMPA 4EATA 1MH9A 3RSZA 2C5AA 5COBA 1IH8A 3L0YA 3DMHA 1GGVA 3NTOA 3KZVA 3OQHA 3Q98A 1KVRA 1XTJA 5BNFA 2IOHA 3DBVO 1GNTA 5AI8A 4CM1A 2ZIWB 3R2JA 4PV7A 2F6RA 1FUEA 3H11A 1D8AA 3OT5A 4IOJA 4HYQA 3MGGA 4GGPA 5FF9A 3SCZA 2OBBA 3UV6A 5J2UF 5L45A 1F8UA 3T7CA 4NCHA 1K08A 2ZAYA 4OM7A 2M6LA 1GQQA 1FFGA 3U4IA 4DE5A 1T3ZA 2X8AA 3DLIA 5HQTA 1DQSA 1G8JA 1T5OA 6GPBA 4I2VA 3HACA 1D8TA 1W5FA 2E4WA 3GDFA 3DD5A 2B9VA 4IOMA 5D3MB 5KHOC 1UM9B 4EMTA 4X95A 1FTWA 2DKOA 3B7PA 3ORSA 1IULA 1QKKA 1VGVA 4O6VA 3CTPA 2QRJA 3N8DA 5LSAA 2HJVA 4GSYA 2JLBA 2OLJA 5A9RA 3STWA 4C07A 1G59A 2XDQA 4DIDA 4NOJA 4FZ3A 2B7LA 2HSGA 2P6RA 4XWTA 5DF1A 2BGJA 3AR4A 5JD4A 1HYHA 2AJDA 3L7YA 1SU7A 4U39A 2W48A 3FETA 2IU4A 3H1GA 5BOVA 1LLCA 3EIXA 5LOVA 1E3IA 1QR2A 3RO7A 1JZTA 4HD8A 1W87A 2C0QA 4OJMX 3PA6A 3ZJUA 1XK7A 4K6KA 3D31A 2H1RA 3VR4D 3VUFA 5DVZA 3KJHA 3PXBA 1QGZA 1NG9A 3UCFA 2JIZA 2YV1A 4R1UA 2OYSA 2X40A 4GKBA 3VPAA 3C3CA 1PFKA 3R7WA 5EJFA 1M9NA 1MTOA 5D5HA 1QHFA 1YB5A 3OWXA 5KSZA 3BWCA 1ZN7A 3U2QA 1MN6A 3QHQA 4HMPA 4OGFA 3NT4A 4EP1A 5HUHA 4D3FA 1M8KA 1L4EA 2UVDA 4ZREA 3LX5A 1O6ZA 3DAOA 4Z8XA 1V5GA 2FUNB 4LZNA 1J6UA 1N92A 2ZR9A 3WLJA 1PP4A 3B6IA 1CR2A 1CRLA 4HJRA 4OHZA 4F6RB 3OUUA 1D6JA 1IC6A 4NJMB 2VSFA 5KX5B 2XXJA 4L73A 5EP4A 3UHAA 4G1CA 2VF7A 4CLDA 5LP6A 4N5IX 4BX8A 2FWJA 1O95D 2VPYA 3D81A 4KG7A 4R01A 1VM6A 4RPIA 1U9YA 2IUTA 3PXUA 3UF0A 1YFZA 4ZT7A 4BFZA 1QVRA 1ST3A 3INNA 4C4OA 2CD9A 5JANA 3UAWA 5HILA 1JV2B 3MTGA 1V3QE 2OWEA 1KPGA 4PRZA 2AFIE 2CLMB 3GN2A 5JWOA 3WLIA 2VN8A 1EE1A 4F46A 5BXQC 2KQUA 1PWZA 2ZBEA 2X9NA 2X0IA 1YH3A 1X1CA 3TVTA 1TE2A 1XN4A 2YICA 3GAZA 2DM6A 4IHAA 3K4HA 3AZPA 5EG5A 2DEUA 1BO6A 3ER6A 3HV0A 3KSZO 3K9LA 4G0ZA 4L3OA 5T4BA 2ZRFA 4YGYA 3ILXA 3URKA 4YJ3B 4C05A 4ZK2A 2H11A 1NWCA 1NF3A 1OTXA 2X77A 3NHLA 4RCVA 2ZUBA 5HG0A 1PT7A 4YO7A 4CFZA 3PJFA 4AWAA 4HDOB 3HXOA 1T91A 1I2DA 4KLRA 1TYCA 3HNOA 5EHZA 5E8JA 3JSAA 4QEKA 5ESRA 4BMVA 3ZW7A 1FNMA 2XB9A 4PWZA 3ZCSA 1VP3A 5AJTA 3V1TC 1H3NA 3G6WA 4REMA 4Y6SA 3RIXA 1EBUA 3JZDA 1NXQA 1R2QA 4Q15A 4DIBA 4LZPA 3COWA 4JU8A 1N75A 3THRA 1TK3A 2N46A 4F86A 3U44A 2NYUA 3M82A 1FFAA 2Q0QA 2VJDA 3UXMA 2HW8A 1TU4A 1QGUA 1K6JA 3HCBA 2E48A 5K9ZA 3ZCQA 1W48A 3KT3A 5BUZA 2ZE6A 1PLJA 1BROA 3G0DA 3GGPA 1CP3A 3VBCA 1YXMA 4N0QA 1Z6YA 1I7SB 2VPWA 1TO1E 3GH1A 2JH3A 2OR3A 3ZY6A 4AX8A 5ADHA 1LLQA 3WC4A 4WBNF 1UK9A 2HMYB 1I7PA 3CZ9A 4MQ5A 4E5MA 5KJ6A 2HNBA 4H6VA 2BI4A 1JPVA 3SJ7A 1CV2A 2AFHB 3VZCA 4DCOA 1E2JA 1Y42X 2QNBA 4EHLA 4UM9B 1DTWB 1RJGA 4CMJA 1GRQA 5EVCA 4QOHA 5T4FA 1EHCA 4BQSA 1Z3CA 1NG1A 1Z3IX 2P1DA 5U4QA 1TKCA 5KAPA 3HGTA 3STUA 3THYB 4MO9A 5HGJA 4Z5XA 2HYDA 1XNRB 1DQPA 4MYRA 2X1HA 4ARVA 3CVUA 1UQRA 2PX2A 3FLMA 4EVRA 1ZEMA 2D62A 4JT2A 1DVRA 5TJHA 3OFSA 2R85A 4RL4A 4P98A 1YGPA 4F7DA 3NG1A 1GPBA 1VPTA 1N32B 2BMFA 1F20A 4QATA 4YDRA 4M8NE 2EWVA 3LTEA 1SHUX 3VKHA 1TMOA 1DXHA 4DMGA 1Z28A 4LBVA 4EABA 2VRCD 4B75A 4C0QC 2J31A 2D1SA 3WL3A 1ISGA 3OG9A 2R7NA 1MAUA 4K6HA 2JFZA 2W2KB 4IIUA 3M6VA 1YVPA 3FUTA 4PW0A 1UBOS 3TAXA 1CFZA 3MJ4A 4AKHA 4EF4A 1HNXB 2O3RA 3MBKA 3OKFA 3NOOA 2P27A 3WMFA 5L4SA 4KRGA 1PFWA 1X80A 3Q7TA 1XVTA 5D6OA 3RHFA 4ZI7B 4LDPA 1XV5A 2PN1A 3D6TB 4QYSA 3UPUA 2HQBA 4F92B 2DR2A 2F4NA 5G4LA 2CJPA 4B0PA 1YL7A 4W8GA 1UKVY 3HY4A 3FNQA 3SX2A 2I33A 5MHTA 2JFOA 2VLBA 3WSVA 1Y3CE 1TX4B 3M3PA 4ZODA 3P97A 5L3SA 1GKUB 1V26A 3FW1A 1P6UA 4RQTA 1RM4A 4J94A 3ZXYA 4LGYA 5KKAA 2HRZA 4WKGA 3KNZA 2LRHA 5EQTA 2QJRA 2R1UA 1NASA 2FW0A 1VRWA 2AHOA 5FTNA 3LUDA 3N8NA 4IIHA 4Y2YA 4X64B 9LDTA 3RCBA 2IH4A 2FEMA 4B80A 2YWGA 3GVHA 1Q16A 4ZJPA 3EVEA 3VPXA 1P1JA 5A3JA 1YZGA 3HKCA 1XA4A 1A95A 3G8CA 3H4IA 3PC4A 5FI0B 3DOCA 1XPOA 2FPLA 3LPLA 4FWBA 3GT7A 3K0AB 5AK0A 2ZI7A 1URPA 3VSCA 1KJQA 3A9WA 4Q4HA 1QORA 1X8XA 1UQUA 3HKDB 2D1QA 5KYXB 4L4ZA 4MVJM 2CNWD 3R5HA 1O8BA 4X71A 1I2MA 1Z82A 4REQB 4NMWA 4DN6A 1E7YA 3QKUA 2C84A 1DBVO 3KWMA 3MAJA 5E4YA 4LV8B 4A92A 3P9ZA 3C97A 1TLFA 3OTWA 1GZHB 5THKA 4CIDA 4P2GA 4CM3A 1YL6A 4U2BA 4X91A 2OT3B 3D2BA 2O59A 2CLDX 3MUEA 5KQGA 3FH0A 5CU7A 3HB1A 4QHYA 4WDQA 1ZUWA 2ZWMA 2GCOB 2AVNA 3AM4A 2C2MA 3C3KA 4B1FA 1XRRA 2IYSA 2NZWA 1G3UA 1JGTA 4B3IA 1VJ5A 1JG3A 3IUSA 3SZUA 3QSGA 1Y7LA 2JBAB 2QG4A 5D7BA 5ILQA 3EULA 4DTCA 1T0HB 1GSAA 3MILA 1R6AA 2WTXA 4H60A 3QI7A 2EYQA 4I4LA 1VFNA 1L4BA 5JBIA 3R3JA 2X1LA 2VUTA 1YC2A 2EJBA 1EQAA 3D02A 3P2OA 4YB8A 3WYGA 4NZ9A 4D8XA 4I5DA 3G2IA 3SVZA 1G7TA 4B6OA 5BNIA 1IPHA 1DRWA 1YOBA 2XA2A 2W5UA 2YMLA 3IP7A 1QP8A 3GROA 4FPXA 3Q88A 4LJ7A 2NU7A 3GWZA 1AOXA 3GAFA 4HQFA 1AJEA 5BQ5A 1B16A 2A78A 2PZ8A 3DLAA 2P9HA 3KV1A 4HAZA 4MUMA 5IBCA 3QI2A 1SCKA 1OQAA 1I14A 2W6QA 3A4NA 1AKWA 3KR2A 5ERGB 3UGKA 5J47A 1XCMA 1W4ZA 1DWPA 3FSRA 2J3MA 3MT8A 3O91A 1PT6A 4R9NA 4AY3A 5AESA 3COZA 2VQ3A 4IKOA 3WIOA 2H29A 1EFDN 1RLJA 2IDKA 3F3SA 4FJ1A 4OM8A 3D4LA 3P9PA 5EIBD 3KZXA 1XVAA 2P4SA 1B76A 221PA 3O38A 3A05A 4G84A 4TTTS 3QVMA 3ZXIA 2GXQA 4DM3A 4ZO7A 2BKVA 3LPDA 2G4CA 1Q3TA 3I64A 4DCGA 4UEKA 3GLIA 1WW2A 1IE3A 1WSBA 3GRAA 3FPSA 4IXWA 1V4VA 1HXHA 3H19A 2EZTA 2J0QA 3LECA 3UBTA 3ND5A 2CE7A 4ML3A 2FR1A 1NI3A 2WU8A 3AK4A 4XXHA 3EYAA 3TL2A 1LRJA 3BDVA 3FSGA 4Q9JA 2IKSA 3M0EA 1FA9A 1SVKA 1KF0A 1X9IA 3E1SA 3HFRA 4XB6B 3VC3A 4ZOBA 2LBPA 4H1TA 4H35A 5D3MA 3Q7EA 1UM9A 3WRYC 1OKKA 1VIMA 4LOKA 1A9PA 2XTNA 1O58A 3VPSA 2ZANA 1H2WA 2BTQB 2PLRA 4V1CI 1BCSB 4OB6A 5K01A 3MCAA 4OHMA 3VPGA 3RHSA 1GPWB 3VR2D 3P5SA 5L95A 3DFZA 4L5CA 3GLHA 5EGNA 1CNEA 3QHPA 3VR3A 1J23A 2LV8A 3T7KA 4BLQA 1K89A 3GG9A 4P0PB 4EG5A 1T3SA 2PRZA 1V7QA 1P74A 2D06A 3DMTC 1NA5A 1PVDA 2RI6A 1SHZA 4NHOA 1PF7E 1E5LA 3QH4A 2JLSA 2AH5A 2WHEA 3B89A 1Q0SA 3DE7X 2MYPA 3E27A 1DNPA 1UXJA 3G2NA 3VDRA 1C14A 4MI9A 3UT6A 4NMLA 1QZ3A 3HUTA 2TS1A 3CVOA 4EVIA 2BELA 1PR5A 2FDXA 2YNMD 3U26A 3EY4A 5H70A 4E88A 5JI3E 3JQAB 2I2WA 1W8IA 4Q6WA 4A36A 4EJSB 4F5ZA 3DOOA 1LPAB 2HN9A 4PQEA 3D1LA 4K6MA 1KEPA 3ZPXA 4IP0A 5HKAA 3FRHA 1JEOA 2GPAA 2L17A 4RGBA 1E1YA 1Z7BA 4WGGA 3HUFA 3HZZA 1NLZA 1ZUNB 3MSCA 1O97D 4ZAZA 2CXHA 4TV8F 4ZTZB 1HGXA 3LQ4A 3TSCA 2DWQA 3NIFB 5ALSA 3GU3A 1B8VA 1J25A 3F98A 3QYFA 4JVSB 4NJMA 4F6RA 1JJIA 3HWRA 1IBCA 3A1TA 5JCZA 2WOOA 3NFRA 1I3MA 2AG0A 1G4AE 2HUNA 3LRTA 1FFHA 4TMFA 5EJGA 3VVBA 5F4ZA 5BWOA 5EJEA 2XLBA 5BOSA 4BE9A 2IHVA 3ASVA 3KEMA 5GJCA 5B4TA 5JJBA 5JT1A 3ANLA 4O33A 3TXXA 2FLKA 3O93A 1RAHA 2BZ1A 2POCA 1Y1PA 3PL5A 4G5YA 2PUEA 4NZYA 3ZQ6A 5DXJA 1OI7A 1Q84A 3K31A 4Q1FA 4I6EA 3F97A 2I7VA 3VTAA 3KVNA 4KKVA 2XF8A 1SBIA 1TLTA 2YV2A 2VHXA 3HI4A 4HB0A 5DX0A 1ZKMA 3N74A 2FWNA 1EJ0A 4YJ3A 3WLQA 5JH7F 4UREA 1V3VA 3O75A 3RC8A 1MJGA 3CIOA 1LSUA 3A6DA 3W5CA 3O47A 1TMGE 1UOPA 8ADHA 2WUGA 3ZX5A 1MAHA 4EMSA 4C3ZA 3F3KA 3QIVA 4EMUA 1DUVG 4RHCA 1CEQA 3MWYW 2D3WA 3GC6A 3NR2A 4TWBA 4C7MA 3EG5A 4J1TA 3RLFA 4U02A 1IJBA 4D4LA 5I9LA 1E98A 1MU0A 2EZ4A 4MEAA 1D2MA 4D45A 1G55A 4HMOA 5TX7A 1EFTA 4BN5A 3U3DA 5H5JA 4B3BA 4OHOA 4IY1A 1PCXA 1EK0A 4RPJA 2G9VA 3DOJA 4L0QA 3EPRA 4MOWA 2EATA 2I3BA 3FGOA 1Z88A 1ZP6A 4MR7B 1Q7GA 3O26A 2RE8A 2Z5GA 1WD7A 2RHJA 3E58A 1SK8A 4LHZA 4M88A 1B3BA 3TD6A 1OH6A 1F2TB 4LWOA 4PHCA 3D3KA 1DTWA 4QVGA 1RYDA 1YJ5A 3VMFA 5CD9A 4Y2PA 3IT0A 1P0PA 1SD2A 3CF0A 4L8LA 1KZYC 2LP4Y 4QX6A 4F1WA 2R7AA 1T36A 2ZTMA 1EP1B 4CV2A 5TB5A 3OC0A 3THYA 3ZE1B 2UYYA 3M9LA 4BVAA 5FI5A 1EJBA 2BGTA 4PZEA 2W6JD 4ZYXA 1SD1A 3LCUA 1EYZA 2OA0A 1TM2A 4GZMA 2G6BA 4PTZA 1PW5A 4RHXA 3L5KA 4UHJA 5GONB 4ZKEA 3VI4B 3HYNA 3WIUA 3GEDA 1ZR2A 2PTGA 2ZDHA 2AMYA 3IIMA 3BE8A 4UCWA 3OCVA 4CL3A 5DIFA 3OUZA 3TI9A 4IJ6A 1DG9A 3EQ6A 4YMSA 3FM9A 4EG6A 3OOHA 4IJKA 2PDAA 1JFTA 2PJDA 2I65A 3UMRA 3H6HA 3SZ3A 3K8ZA 3KK0A 1CJTC 4EG1A 5BSHA 5IU6A 3W7AA 2QLBA 2W2KA 4J7AA 1JEEA 5ALDA 3GLFE 3X1KA 2FMIA 2L2QA 1V48A 2QY9A 4P4UA 4NCKA 1GNRA 1MH1A 4H9GA 5D5QA 4CDRA 1KEUA 1KZ6A 3GJYA 2F67A 2OVFA 2DR3A 4XSHA 4ZI7A 2I4TA 2PGAA 4JI4B 2J8ZA 1HTTA 2BZSA 1J21A 2B20A 3CX8A 4MW0A 3TZQA 4PX2A 3X1DA 3L6OO 2UZIR 3R7DA 3GCGA 3UJCA 3QTLA 1BNCA 4NE2A 1UC4B 4YBRA 4F2PA 4NCAA 1YR1A 3NKLA 4KNVA 4KR0A 4JYMA 1PTKA 1RC8A 2REOA 1TL7C 2QQ0A 4Q3LA 3RVMA 1M75A 3IO5A 3WIBA 2CDCA 2P5TB 2WWVD 1TZJA 1AUOA 3WL8A 1MDFA 1PG0A 4ZANA 4ZMRA 5BVHB 1EX9A 4F91B 2J33A 1I7QB 2INGX 3DTVB 3AX6A 4TZTA 3T5DA 5CCXA 421PA 2O1SA 3JRNA 1JECA 2IF0A 3LC1O 1XXHE 1IATA 1ZKDA 3BEOA 2PTHA 4HQNA 4NBRA 1DDIA 1KVSA 1S9DA 2QY6A 3NRBA 5IDVA 1CZUA 1DADA 1WUYA 2PL1A 3K0AA 3QVGB 3IQZA 3ZWDA 5AICA 3TE6A 4YRKA 1THMA 2Z3VA 3OE5A 3DFFA 1CDEA 1NX6A 3RI3A 3ENNA 4IV5A 3L7NA 2I9PA 4NG4A 3URMA 3HKDA 4WSOA 1X0VA 3L6DA 3PK0A 5ALHA 5KYXA 4G8BA 4X84A 5AHWA 5IABA 1QE3A 3NOQA 3CC8A 3S1SA 4REQA 1HQKA 3IVRA 4L8GA 3C15C 3V8BA 2X9QA 3FRJA 4RHUA 2YZ2A 3ZV7A 4MW1A 1RZRD 1M2VB 2M98A 1E77A 2QD1A 1XB2A 1RYNA 3KHSA 4I14A 4KACA 4O2AF 5HJ2A 3U80A 4Q3CA 4Z86A 2GTIA 2X5XA 4DLPA 4QULA 1OXBB 2B8WA 2VPQA 2X1MA 3CRMA 2FUKA 5ALJA 4IIEA 5DW3A 4I8IA 1QU2A 1RFGE 2KX7A 1NPYA 1N5LA 3AV0B 3ENVA 4DIMA 2GCOA 1VLLA 3JWGA 3MCWA 2DPHA 2PZAA 2H5JA 5CT5A 5K0LA 2GZRA 1KAOA 4JOSA 5AT1A 2JBAA 3V1MA 2AWNA 1PHRA 1K8ZB 3U9LA 1XF1A 2OP0A 2ODAA 2Q2QA 1XR3A 1Z16A 1TZKA 2FSFA 4NU8X 1E6KA 1E9AA 1UMDB 2R0QC 2JA1A 4KI7A 5LB4A 2P69A 4N7RA 1NW5A 3PTZA 1U3UA 1R4ZA 3UK2A 1T1SA 2VZ8A 4UBJA 5E7QA 4OK3A 2ST1A 3EDQA 3CUSA 3R3SA 2G7ZA 5CMLA 3FKSD 4X6XA 3QENA 4EL0A 3ESQA 3SHWA 4U9HS 1NP3A 4JI6B 3V1UA 4DYVA 4WXPA 2GI4A 3PXEA 1E2GA 1Y5NA 4FYWA 5DMXA 3EDRA 4YV2A 2V5UA 1L5OA 1HEUA 1TZ2A 1W52X 3EOBI 5TGZA 1YFKA 1PQYA 3I5UA 3M4XA 2A0XA 1JHZA 1WDLA 2CFCA 2ZTUA 3GBSA 4X41A 2B30A 1Z5UA 1U5BB 1YB1A 3QWHA 1RJWA 4RYDA 6AT1A 1JDUA 1MIOB 3IR5A 5CP8A 2ZVQX 2BJVA 3G23A 4KO8A 1IB6A 1YS1X 2FV8A 3I5MA 4O2LA 3QTTA 2CDAA 2WIKA 3T3GA 3BFVA 4MQEB 1Y3DE 3WL6A 4LWPA 1WZUA 4B4DA 2FF5A 3R7BA 1NBME 2AMLA 1C4WA 2X3UA 1KYXA 3MWDB 4Z51A 1UMKA 3RJMA 1DV2A 1I1HA 3F5QA 1OYOA 3GJ0A 5ALFA 3UIEA 4LF7B 1I2ZA 2BGKA 5JWRA 1RPJA 1AF7A 2BTQA 1ZRMA 2BV3A 1GY8A 2IY8A 1YQEA 4JS0A 2O2XA 1OH5A 3QUAA 1AQUA 1FX1A 1HQCA 1HFKA 3V46A 5MGBA 2FMUA 1YB7A 2RBKA 1ELOA 5LIRA 5HVNA 5A4FS 1QYDA 1ZN2A 1DX9A 3TFQA 3N59A 4Y3UA 2IEIA 4C04A 1MENA 4UXIA 4YJ2B 1O4VA 4RESA 1U1GA 1K8QA 2VF5X 2C31A 1TYEB 2D2VA 4FFBA 2F3PA 3E3OA 3SI7A 2VC2B 3FKQA 4XB1A 5CH3A 3WLPA 1B0AA 5FPYA 2H00A 1GKYA 1HKHA 4B8YA 3LKDA 3AF1A 1C8LA 4WXMA 3W1WA 4IS3A 1FXSA 1Y9EA 3JALB 4JP3A 3JQAA 5I8PA 1EFAA 1P73A 4HQOA 4P82A 2B7BA 2OFOA 3DVLA 5H02A 4CF3A 2V7QA 5EP1A 4CTMA 2Q45A 1JBKA 5DCWA 2L82A 4ZDIA 2RCNA 3QV1A 2P9YA 3WP1B 4PR3A 1ZUNA 4KSYA 3AERA 4JJ4A 1E1LA 4YRRA 2ZWIA 2O7RA 2XZLA 1NN0A 3RTAA 2XT9A 3LIPA 3RYIB 3N6VA 2ROQA 3ON5A 4WLOA 3KT8A 5HS6A 3ZV3A 1P61B 5EEGA 4JJ7A 1P4SA 2J6BA 3DNMA 1AS0A 5D84A 5AW8A 1ZAYA 3KSDO 2A3RA 5CB4F 5B37A 3SXUA 2PYIA 4M1OA 4RK7A 2IYRA 1A2OA 1T34A 4IRXA 3X2SA 1OZHA 4GLJA 3CVYA 4TX1A 1T24A 2CEKA 4OAQA 3TQHA 1T10A 3ESBA 3D1JA 1UBTS 3WI7A 2CLSA 5CFMA 3AUSA 1EVLA 5I7UA 4RVSA 4FMBB 16PKA 4BVEA 1EVZA 1ZFNA 2SICE 3HA3A 4MGYR 1U0LA 4UXHA 4TYWA 4J76A 2OAP1 4RA9B 2C3MA 4G1VA 3JQ6A 3LUKA 1N2BA 2O2IA 4YUWA 4CCAA 3AWIA 1X7ZB 3NMUF 3HMQA 5LXTF 1J4AA 3O84A 3PQEA 1Q7CA 5KJ1A 1T4MA 2AYYA 1QTQA 4CLHA 2REBA 2HHAA 2PL5A 4OUKX 2C3UA 2CVQA 1E1QA 4ER7A 2AFHE 4RHFA 4YP0A 5L40A 4I8XA 4H0NA 4GI1A 1CJVC 4IINA 2H2AA 3KLNA 3WZMA 5ALTA 3GG2A 5DM70 3TOZA 4CJXA 1L8XA 5FNVB 1DJLA 5EHIA 5IVKA 2DY0A 4OYLA 4ZCSA 4CMEA 4P3KA 4KFCA 2N1BA 2V4MA 3O8LA 4R05A 4RD1A 3AR6A 3RSOA 3UOGA 1N2CB 3S40A 1RQ7A 3AEQB 3M1AA 2ZJ1A 4PPYA 4C6HA 4E70A 2H18A 2WG0A 1ZG3A 4MVJI 1V9SA 1JNXX 1RWPA 2GPNA 4JB3A 1UDCA 5JYCA 1QU3A 5A0TA 1GZDA 1HLGA 2QG9A 2RHGB 3V33A 4MR7A 4EF6A 1E3DA 5DSTA 4FM9A 3LDGA 3PSAA 4PYKA 2WKRA 5BWBA 3ROTA 5AMXA 1OXVA 1ZGJA 4E5PA 2ZS8A 1F2TA 1QIHA 3CRNA 3DHNA 3UUEA 1RMTA 1RACA 5EJMA 4B85A 3DBLB 4R3WA 4HN9A 1C7IA 3C3MA 5JU6A 2P9GA 1QF9A 4YMIA 5JVDB 1K7YA 2CYCA 4Z53A 1XEAA 4HF7A 2HRBA 1JHXA 2VSQA 2UU9B 4CQMB 2MMGA 2NADA 1KY2A 1GFZA 3ZX4A 5F21A 2J3IA 2ALJA 1IJEA 4EUNA 1VHDA 3LYAA 2WUWE 2YWBA 3RRBA 1Q7TA 3PUHA 2L69A 5GONA 4KH1A 1XMVA 2X22A 2X4GA 3ONVA 3EGWA 4XD7D 1YBHA 1CZKA 4FTWA 3T7AA 1CIPA 1AGYA 1EQ2A 4L75A 4PHFA 3W7VA 2B99A 2YC4C 3TQSA 1Q1QA 4LJRA 2OCGA 4QDTA 1LPPA 1L4FA 3OLWA 1O5OA 1AVTA 2GBLC 2W71A 4GDMA 4UHKA 3VU0A 4DV0B 1E3LA 4WXEA 1J0BA 3L6CA 1QPGA 3DOIA 1G8PA 2CMGA 4X45A 4G0PA 3EQZA 5NLLA 3SSNA 4G5OA 1XMSA 5EZ6B 4C87A 1MC5A 3K8QA 3QUSA 4QWWA 4D57A 3R3WA 3WGJA 4L8VA 1YR8A 3ZV6A 1Z8HA 5HCNA 3W9BA 4TT8A 621PA 4FOSA 1J7JA 4QRIA 5JZMA 3S28A 4YUYA 5DYIA 4QYMA 3TZKA 3DCYA 3G68A 2ONCA 2VZLA 3ROZA 3UMMA 4RHYA 4ID9A 6NULA 3BZBA 3ZLJA 2N75A 3UATA 4RULA 3DDSA 1HDRA 2H7XA 1Z0DA 1GLVA 1RI4A 2EEZA 4QWMA 3UO8B 5DSXA 2IUUA 1KI3A 4F6CA 2LR0A 4GH5A 3OPXA 3QG5A 4I3FA 4FGLA 2HMAA 2UYOA 2GYUA 2R2AA 3IJEB 4EHBA 3WK7A 1GNPA 1EDBA 2ZZKA 1M2GA 3NORA 1Y9DA 3IMKA 2A9OA 3LXRA 3WWPA 1AMNA 3VR4A 1YJCA 2ZBUA 4N6OA 1K98A 5BQPA 1M73E 1NQTA 1A4XA 1TKAA 1XXLA 1CBUA 3MQ4A 2CMFA 2HK6A 5BVHA 1C81A 1UM8A 4IGIA 1GPJA 1K88A 1UZAA 2J5RA 3DTVA 3L6RA 5AVJA 1TTTA 3Q8MA 4J3NA 4V0QA 3F3MA 3ND8A 2D2EA 4AU1A 1JTVA 1Y4SA 2XUDA 3NVMB 4MJLA 3UJNA 3OFND 3QVGA 3U1TA 1JQDA 1GV0A 4BQPA 1ADGA 1RP7A 3CR8A 3JD4A 2P2YA 3QVUA 2ZXFA 3GFPA 4HBGA 4LI3X 4N0DA 4RY8A 5LZ5A 3R9IA 5BPHA 5KTKA 4IF4A 4JX8A 1AC5A 4ES6A 1VBNA 3PC8C 4IIGA 1FFBA 4QXMA 3BH7A 1A88A 5GPBA 4DV3B 2C7BA 3G9QA 4UVIA 2XCUA 3ENWA 4IX9A 3KJEA 3GFGA 1VMKA 2I4LA 5GVSA 2XZOA 1K9VF 4OHVA 4EYOA 1QRTA 3LVQE 1Q0ZA 1FDTA 4MP3A 5EJAA 4TYQA 1B74A 1JI0A 3F2IA 3GBVA 4JITA 4U6QA 1UPTA 1U9IA 4A4DA 4DZRA 3VISA 5EXSA 1RQRA 3LJKA 1VSQA 3U7IA 4PLCA 1Q11A 3K9NA 1KDPA 4I3GA 5FUMA 4NZNA 2NU9B 1ZW6A 1OAOA 3IAXA 5HPYB 1CQWA 4E22A 2VL7A 1NNLA 3HWSA 1IM8A 2HZBA 1C4OA 1N7HA 1J49A 1V95A 1NT2A 1ORTA 3DP7A 3JARB 4M3NA 4A0RA 4II2A 1WCXA 4U7PB 1F2DA 1IK6A 3P2JA 2CHQA 1UMDA 2ECOA 4TN1A 1JX6A 3A9TA 1IN5A 3EVDA 4J2OA 2D13A 1TVKB 1WKVA 1KO1A 4C22A 5CNKA 4BVHA 2JFVA 3PYLA 3KE9A 4OP2A 3R5JA 4IUYA 2A84A 4D2IA 4FNGA 3Q7PA 3ZJ5A 3PU6A 1ECPA 1NU6A 4TVOA 4C30A 4JKOA 2ADOA 2J9RA 1PJLA 3OT1B 4HWOA 3TQOA 1Y34E 2XB4A 3TX6A 4LF6B 1G7CA 4N5DA 3OJWA 2IF2A 2JI7A 3AG5A 3Q11A 1T2VA 4QFDA 4NYIQ 4CV0A 2W6ZA 2E37A 2QZJA 3U9SA 1R88A 3EJ6A 2QGFA 1F2UB 3FCXA 5EIHA 1IZYA 3KVYA 4MIKA 4GI7A 1N3BA 1E1NA 1W0JD 1PL6A 1U5BA 4LKRA 4OYHA 4F2DA 1OLUB 3L04A 4YO8A 4A8TA 4BS9A 4GP9A 1PV1A 1L6IA 5F7ZA 2IDMA 4FWTA 4YC7A 3MINB 4K6CA 5KO2A 1OLSA 3JCZA 5GZ1A 5K8VA 3ANMA 1L3IA 3K2EA 4MQEA 5JASA 3CXUA 3CUVA 1AA6A 1D4ZA 2GPJA 2ZIXB 4P6VF 4XLZA 1ZITA 1ZNZA 3A3OA 4EFKA 3KAKA 5KTSA 1SUSA 4DCPA 3FAZA 1E2EA 4MW6A 4ND1A 3MWDA 4XR4A 5FYDA 4UTPA 2F2TA 4ZEWA 1ZJJA 4KQWA 5CXSA 3SZRA 5ICGA 4JI1B 4J0DA 1E9RA 4WA8A 1CY6A 1L5FA 2HEIA 3P9RA 2QOEA 1WB6A 5K0GA 2JD2A 5EQDA 2WQ6A 1JSZA 2PMBA 4KIJA 4TV9F 5E95A 4K1XA 4LE2A 3E5RA 1GGNA 2HFJA 4M36A 4PBSA 2NNWB 4RPKA 3V2HA 3ISJA 2F4VB 3H2JA 4LYYA 3HBNA 2SCUA 2AMJA 4ME6A 1FUYB 4RF4A 3VPHA 4E4YA 1X9HA 4CM5A 2H5IA 3CVWA 4YJ2A 1EDZA 5BMVB 2RH4A 4Z0HO 1AM4D 5DDIP 2AWOA 1T3TA 1QF7A 1KEKA 4QFCA 1G6OA 1X19A 5IFKA 1DC3A 3WKAA 4Q7EA 4XEHA 3BXGA 3I05A 2JCBA 4RHTA 3RC7A 2AX4A 2HLDD 1WRBA 4RZSA 1P4RA 1IIRA 2XWQA 3JALA 4TKUA 3E03A 2Q27A 4CLOB 2WAOA 4BNIA 1KE2A 4A23A 2D00A 5JJCA 3AH8A 1E9EA 1VIAA 4MNTA 2CE2X 3ZOZA 4ASUD 4EUKA 5BN1A 1KGDA 2CZGA 2CLIB 4LVCA 2XRYA 1NLUA 3AUTA 1EA7A 1QIEA 2F9MA 2I1VB 3AONB 1XVVA 3DMYA 3IUEA 4ZGBA 4HWKA 1L8LA 3D4IA 4ENRA 1A71A 2EEPA 2OBLA 5B6PA 3N5CA 1N5IA 3RYIA 3N3BC 2I6TA 4TL8A 1QGED 4JJ8A 5EJ2A 4ZVOA 3BMQB 3KFLA 2X3YA 1UAGA 2B0CA 3D8BA 3W4KA 8LDHA 4IDBA 1EGQA 1W4BA 1PR4A 3AEZA 4M0EA 2KJQA 3QPBA 4XFJA 4RW0A 3OZUA 2DJ5A 1XZJA 1CUDA 4KE6A 4N9QA 2ZSAA 5IH7A 1VMAA 1BYUA 2Q2VA 2HX1A 3T3IA 1JYEA 3GEGA 4YDSA 3ZIUA 2VK8A 3K73O 2ZBPA 3EUFA 3FDIA 4E03A 1X87A 4M1EA 2AYZA 3NDPA 4KEAA 3L7DA 5JSFA 1O1YA 3V8RA 4BU0A 2GRUA 3QNMA 3D0RA 4RA9A 1EWQA 2H0QA 2WFMA 2ACEA 2ZB4A 3HCRA 5IC6A 2QG6A 1X7ZA 4JY7A 3HUEA 1TJ3A 2Z4TA 2QYOA 2QMUA 4QOIA 2BMAA 4PHHA 4W9NA 3RW9A 1NMZA 2CNWA 2C8LA 4X1OA 4PGFA 3L8DA 4KOEC 4GF5A 4O4HF 4Z2AA 1TCAA 4JP8A 2E4ZA 4INPA 5AOAA 2ZTLA 2J3QA 2X6RA 2ZIVB 5EHGA 4D9JA 1PWYE 3PR2B 1J0DA 4OHBA 3V00A 1L8AA 3IEXA 2R84A 1KMNA 4RL6A 4QTTB 3PNQA 3TLXA 2QR2A 2XRMA 3KQVA 5EXXA 3LOUA 1KSGA 2BFAA 4YROA 5FNVA 2QNRA 1Q17A 2QLTA 1K4KA 3EW7A 1RLMA 1ZA2A 4FEYA 4WACA 2QAIA 4GBGA 3RAJA 2C78A 2SKCA 4PIVA 3BWEA 5BSKA 1N2CA 3ELBA 4DLYA 3PUZA 2IUFA 3PFHA 5EUBA 1E1RD 3AEQA 4E2WA 5BSGA 4YCDA 5DULA 1N6PA 2RGXA 3RVLA 4OBBA 3LC0A 3OZFA 3NEJA 2H4XA 2WHPB 3KSUA 1MD9A 2JVKA 3LF2A 3F9RA 1X6VA 4GE3A 3OOJA 4KQMA 1OU0A 2IYPA 3FOBA 4M7WA 3AL3A 1X7GA 2XQVA 3IP3A 1REQB 3WWOA 4G0UA 2P77A 2ZROA 3TVYA 2XEDA 3ZJVA 3KSRA 3SEZA 3DBLA 1S8OA 3E2PA 1RXEA 5JVDA 1GCGA 1LTKA 4RDCA 3RYHB 2Q3HA 4F4DA 2BF7A 1UUFA 4RGYA 3PFIA 2X1VA 4BFLA 1OV6A 4BFTA 3ZDEA 1X8KA 1EJ6A 3NM4A 4R1PA 1I5OA 3IQWA 3IUPA 3QVXA 3FDJA 3OEHD 3I9JA 1P9LA 2HL6A 1E96A 2QPOA 4BGUA 2WIFA 2ZUDA 2WF7A 4O4LF 3IV6A 3DB1A 4G36A 1LY1A 1U02A 3IP8A 1VIVA 3VOTA 2XQFA 2P8SA 3T8YA 1YCGA 4IYRA 2XMRA 1PI3A 4RAOA 2MR5A 4HUTA 4N01A 4BGEA 1HT3A 5EKUA 1Z6QA 4B5LA 4BO7A 1TW3A 2PUTA 1WY7A 2GUWA 2RKBA 1Z0FA 5CYPA 2CMDA 2JHGA 2QGZA 2PMEA 1XCGB 1QG4A 3OJOA 4I36A 4J2TA 4F3CA 4XE5A 1B3RA 3V34A 4EJMA 3NXKA 4BRWA 3O3NB 1FSGA 2VCHA 4I4CA 4X63A 1Q7RA 4CDNA 4Z4CA 2QTZA 1WMEA 4BECA 3RGWS 1DLIA 5FX2A 3H18A 5K2MA 3RVDA 3N2IA 1DWUA 4MAMA 3AFOA 2P9JA 1YQWA 4GOMD 3M9WA 4LQCA 1KWKA 1Y4UA 4QXPA 3GUHA 4TVSA 2EF1A 3N2KB 1S0UA 2G08A 5B2FA 2DRIA 4MV4A 3WS7A 3NYIA 4IIJF 4Q82A 2HJ9A 4R41A 3OHSX 4ARUA 5BV0A 3ZGLA 1DFHA 1K3FA 4HEJA 1ZVMA 1L4MA 2ASVA 2JJ8A 4CR6A 3OAAD 4IDOA 3PVSA 4UU8A 1QRUA 4RBNA 3TLYA 2ECQA 1IBLB 3W5HA 1X86B 3CX3A 4QXOA 3BCRA 3B78A 4UM5A 1JR6A 2CC2A 2JD1A 1J20A 1ECJA 1SBHA 3NIDB 3NYWA 4C29A 3ZNNA 3UA3A 2X5OA 1NNUA 2AN5A 2G8NA 4AJ2A 1RXIA 1WMDA 2B4TO 4OKSA 4HKTA 5CDTA 3N1UA 2G7MC 4HADA 4XD2A 5AOCA 1ORVA 2JGFA 2TMYA 1RM3A 4KVFA 3TTUA 5GINE 4RTSA 1NAIA 2YNMA 4UBOA 1WSWA 1PJ4A 4MGEA 3LCJA 1O8CA 4XCVA 1GPH1 5FFNA 3RE1A 1ZGAA 3OE1A 3L77A 1J8FA 1XAIA 3R6DA 3RRYA 1HTWA 2DP4E 1KI8A 2Z83A 4LS3A 1E0AA 4LAFA 1KYYA 5CBKA 1I4EB 3D4NA 3LY9A 2QQEA 4FC7A 3VR5H 2Q7OE 1Y6RA 3O7MA 1FP7A 2C98A 3DM5A 1RJ9B 1YIDA 2H1WA 2WC1A 3B8HA 4RQBA 4BQOA 4Z1OA 3F49S 2PX0A 3SVTA 1Z2DA 2J07A 3L4EA 2Z9CA 3GPIA 2JG3A 3LW8A 1ND6A 1Z06A 2ZSEA 2FR0A 4TS1A 2Y1EA 3ND9A 5TQVA 5CFLA 2YV3A 3CN9A 4E2ZA 3LOQA 1V39A 2OZVA 1NJ6A 3M3HA 4U6NA 2QP3A 3WAGA 3MHTA 3RQSA 3ZWAA 4WKCA 3EVFA 5GV7A 4TKVB 3RJTA 2Y1WA 1GQ2A 5C7LO 5E7MA 4PNPA 1PYOA 2NU9A 1LBIA 1CUCA 2RKOA 3FPLA 4EJ0A 2MOKA 2YZ7A 1U6JA 1FYXA 2ZYVX 4W4TA 1PW7A 2P2LA 3Q1LA 3PNVA 2X0RA 2SKDA 4NOKA 4P53A 3E48A 2FRDA 3JARA 4INJA 1EUDB 2P2DA 3HSSA 2F9LA 3NJ4A 1J2RA 3DCNA 1FB5A 2O2DA 4GU5A 4TTJA 3SLRA 4U0KA 4EHFA 1YRWA 4Z4FA 4RJ2A 4YV0A 4IYJA 3BXPA 4H0CA 1TVKA 1VJ0A 2G63A 2PIAA 3ANXA 1CUBA 2QTHA 3D8UA 4I5EA 4UUBA 1HORA 2AXQA 4RK0A 1PQUA 3O2JA 4YASA 4DJTA 2WQ7A 3WJ2A 1VLZA 3RUPA 1F14A 1L5RA 1Q74A 2NSLA 2GEUA 2X2FA 2YOHA 2JB9A 3P71T 2FMFA 3AHIA 1YDMA 1V4NA 4A8PA 2VSXA 2YVLA 3OT1A 4GX0A 4MUNA 1JMVA 1XEXB 3R23A 5GZ3A 2WY2D 2CSUA 4WXRA 4DCNA 1U99A 3BRCA 1DFGA 1DHTA 5KSOA 3K94A 4W7IA 3MAGA 1JFLA 1N6OA 2G1AA 2QEQA 5ELLA 2O7VA 5BSTA 2WDZA 5CNIA 1ZUIA 1F2UA 4FHCA 1FLDA 3DOEA 4UBNA 1GU0A 1P62B 1TUGA 3E5HA 1OHHD 1VI6A 2HMTA 3LVBA 1OLUA 1T1GA 2FUG1 3I5YA 3W2HA 1BYIA 1Z0UA 3FHOA 3F71A 2O0LA 3MINA 3E7PA 3AFMA 3Q3HA 1ABBA 2C7PA 1PT8A 2YFYA 3M6FA 2BSQA 2NGRA 4LDNA 3D54D 3Q3IA 7MDHA 3EBLA 2WJYA 3N76A 4FT2A 2P68A 3G6KA 3Q8WA 7ABPA 3M4YA 1DLJA 4BO8A 1VPEA 4XB2A 3BHIA 3CLUD 1QQ6A 4BQQA 4CDMA 3SBDA 4P0QB 1C7ZA 2FRXA 3M5WA 4GC9A 2CLHB 4FN4A 1MT3A 4BNUA 4DF3A 2W6JA 2BGLA 3IEUA 3ZCPA 5IN4A 1KAGA 1CYEA 3G89A 3HDYA 3EQ2A 4PQGA 1NSFA 3GQBB 1V96A 1N6NA 1WW3A 3UAOA 3UXHA 4BQFA 4DMHA 4KX5A 3Q7SA 4NU6A 4HRYA 5DRTA 4NJEB 4YAGA 3NDRA 2OGTA 2ZUSA 1N2GA 4MVJA 2I3DA 4G1MB 4HUJA 5BMVA 1QZTA 4MAFA 3WHLA 4OB7A 3NHWA 2UKDA 2YX1A 3SC2B 3IVMA 2EBUA 1QWOA 3BTOA 2CKMA 3PX3A 4L28A 1SOUA 1UBMS 1XQ6A 3NP9A 4JUIA 3WLFA 4DNOA 3AEXA 2OHOA 3UTCA 1WWKA 2ID4A 3ZDYB 1X9GA 4ENTA 4YP9A 3GMDA 3N58A 1QV9A 1T35A 3QBJA 4EX6A 2TRSB 1B7GO 1Q0RA 1U3WA 4MW5A 4Y2JA 4D7AA 3BIOA 4BNHA 4CLOA 4BCDA 3AP2A 2C2HA 3M4NA 4Q1VA 2PUWA 1UJ4A 1KORA 3W4IA 3CX4A 4KOAA 5LLDA 2ERCA 2OORA 2GKOA 3VU1A 3DZKA 1Q2UA 2W2NA 3UYKA 4RZIA 2OE2A 1GYQA 5LQMA 1PZXA 4K6GA 2AZDA 3OZBA 3I2HA 4JV5B 4CV3A 3BMQA 3CB4A 2G0TA 4ZEOA 2VDVE 5SY4A 2Y0PA 3P9CA 3N2ZB 1VECA 4WCVA 3GO4A 4YRCA 3RARA 1UL1X 1L4LA 1KDTA 4B34A 3ESZA 3GVIA 1DOAA 3RBAA 3ITNA 1KHHA 3ZQUA 1NE7A 2L0XA 5AKKA 3P5BA 2WPDD 3RJ9A 4QU0A 1GSHA 1OY1A 1BA2A 3EISA 1PKXA 4JHLA 4RF2A 2DSTA 2W90A 1NVVR 2I5PO 4YXFA 4QXAA 3A9VA 1N2CE 1X7WB 1UC8A 2P4HX 1KEWA 3MGAA 4Y9DA 3I2FA 1G3MA 5C3UA 3LT5A 3ZWNA 3TJMA 1Q14A 4KPFC 4K46A 2PWZA 5TRTA 3LAWA 5FHQA 2DTXA 3KTAB 3PE4A 4TQ9A 4BJ3A 1J22A 3G5LA 1OD6A 3M6MD 1TQ2A 3KBOA 5HRUA 1JIUA 3EHEA 3KD3A 3RAFC 4OGGA 1NNI1 2X8WA 3K9WA 5DGCA 5HR5A 3DTYA 1RZRA 4UUOA 3IE1A 1NQOA 3AVYA 1UKCA 3NTLA 4IXMA 3IUQA 3TW8B 1JVNA 1N3LA 3ZVMA 1TTPB 4M4SA 4DY4A 5ER6A 1XN1A 3PPXA 3FDZB 4JUBA 2XH8A 2FDCA 1C8KA 5F9FA 2VYCA 4NZMA 3AI1A 1R0BA 4ND6A 4MV3A 2F1JA 2IBMA 4CG3A 4JXZA 4HX5A 2WHPA 4BKPA 1SBTA 1JT2A 4FEAA 1RXSA 4AXBA 1CHDA 2DCMA 4BB5A 2E89A 1R6XA 1B4DA 2XMQA 5T67A 3PQ5A 1REQA 4BMPB 3I39X 4DBLC 2JGMA 2P9QA 1U7XA 2Q49A 2CHFA 5FORA 1KYTA 1OGYA 3M1YA 3CJTA 4JJIA 5IBQA 5H3LA 1UBLS 2Y2UA 2P3OA 1TF2A 4N1AA 3RYHA 2BEKA 5JAMA 3C3DA 1AU9A 4YXWD 3DVRX 1GAWA 2A7XA 2JAWA 2WM3A 4C3OB 3MTEA 2ZVDA 3F6SA 1X3SA 3IESA 5LUBA 3FKSA 4D74A 4KXNA 1L7OA 1TT7A 4RJIA 1OGIA 1D2RA 1TYAE 4PCLA 3GH3A 2FUG6 4KRYA 4EHJA 5LVAA 5DLEA 4MA5A 4XWOA 5I7HA 4HXYA 2ZQZA 4QELA 3NX4A 1ZK1A 2Z2XA 3ECSA 1ZHHA 4WASA 1Q92A 1I4OA 5C7OO 2CBGA 2HU8A 1C1HA 1FMLA 5K0JA 1W2WB 3OZXA 1IQ0A 4RVNA 5IAGA 9LDBA 4DBLE 5JARA 1JLRA 2JJ1A 1M1YE 4ESHA 3OIYA 2C4HA 4UU1A 1U81A 4H16A 3ZU3A 1FTYA 5C1BA 3GRPA 2WZCA 1GFIA 4OFXA 4CKWB 1AXGA 2EKLA 2WU1A 121PA 4K8OA 3GYGA 5IM4F 4KQGA 2HZ7A 1BD3A 1MKYA 2C42A 2FZWA 2OC4A 3PA8A 1KY4A 3T1QA 6ADHA 1T5SA 1NAHA 1WABA 4F04A 4AROA 5EI5A 1ZIDA 4ISBA 3VNAA 4ZIRB 4NBLA 4OAOA 1WDTA 4TS9A 1WPRA 4EZBA 2QMZA 4P2BA 3AG6A 1XALA 1D9XA 2AUTA 3NM5A 2OD2A 3VJKA 5KC8A 4PSCA 1Z73A 1H65A 2F8SA 1Z34A 3DEIA 1GGKA 3CT6A 4QXRA 1T4GA 1Z5NA 2ZYUX 2PAFA 3I28A 4FU0A 3RAGA 1CY1A 3TMYA 2CV2A 3NCHA 3IQFA 2XMSA 1KPIA 4KWCA 1VSUA 1LZLA 5B55A 1T8UA 2V98A 3QPVA 4ETMA 5M34A 2ZLBA 1N6IA 1M2FA 1I33A 1BCRA 1LKZA 2Z3WA 4QUGA 5CEEA 4B31A 4EF5A 1SCJA 1B26A 1F8XA 1DL5A 1GTZA 1T3HA 4EAAA 1E3WB 1UEJA 2VVTA 1IWBB 4O2RA 5DASA 2OCDA 4HDSB 1KY5A 1T5BA 2Z8XA 2ZR7A 3ONNA 4ZZ1A 2NNLD 2Y27A 3SQWA 3KD2A 3EIEA 1XQVA 2E5WA 4ZOLA 1AK2A 2UZ4A 3TTSA 1RJ9A 2GEFA 3BJEA 5A5GA 5K99A 4KR3A 3MQFA 2HA5A 5KKNB 3DC2A 1YBVA 1QTIA 3DL4A 2Y3IA 3PR1A 5FPQA 1A98A 1N2OA 4RACA 5IH3A 1DXYA 1Y3IA 1W1WA 4Q3KA 1RRFA 3DAFA 3Q9LA 4RM2A 1XTBA 5FXMA 1HRKA 2GYWA 5EGSA 3KOZA 4TMTA 3IXQA 4ID3A 3VKUA 4B6QA 2OD7A 3OO0A 4E1AA 2QD3A 2QVGA 2PGXA 2PYZA 4Q3AA 1W6RA 5T6MA 2KB0A 2PGNA 4AMYA 4M86A 5EE3A 3KIPA 5DHSA 4ESOA 3WLKX 1X39A 3ZH9B 4B3TB 2WYHA 3ORQA 3CS3A 4AYXA 2H4YA 3NJRA 3MB5A 1R3DA 1NDUA 2WU3A 5AI0A 5H3HA 3T9CA 3QKWA 4AQDA 4E5NA 1L7DA 3EVGA 1EUDA 1Q1BA 3BE6A 3EH2A 5HIIA 1YZTA 1NBHA 4ECEA 3WK6A 1RWQA 5KYGA 1GZ6A 2VNHA 4FIZA 1U3FA 3OOYA 1RLOA 4WZAB 4MA4A 2FSVC 3LSYA 4U5QA 1L7MA 4HLUC 3AXSA 2WABA 1M5TA 4JKIA 3A3KA 1NY6A 1VCHA 4NVRA 4M1ZA 3I6QA 2BFOA 1E7RA 3BGIA 1OFUX 3FLBA 2OK7A 3FYTA 4R71A 2DZDA 1BOFA 1XEXA 2E0IA 2HCFA 2QP4A 3JWHA 4NH4A 5J58A 5JRJA 2YCBA 5KINB 5F98A 1NYQA 2D0PB 3WICA 1DKPA 4QUKA 5DWVA 1HDYA 3M6UA 4KVGA 1NXOA 2GO7A 1GUBA 1R00A 3GZNB 3DULA 1P6QA 1NBEA 4W5JA 5HE9A 3L43A 1Y8ZA 2ABWA 5G1PA 4E6EA 2NWQA 5IBPA 4CMIA 2FW1A 4QAJA 5C8ZA 1CTQA 1NJ1A 1RABA 4XQ9A 5FHRA 4RX1A 2WKPA 2W2OA 4CCWA 1BHO1 1GCOA 5K0NA 1T1IA 1WO8A 4X85A 5JO9A 5NULA 3R0QA 4PYQA 4MMYB 5CVDA 1NTOA 5JYDA 4YI3A 3ROKA 1T4CB 1SWVA 1MNAA 4TL7A 2XQKA 2RI0A 5ARCA 4L5IA 3FBWA 4G0MA 3C16C 2ZZMA 3M3DA 5TMBA 2VUHB 2XLCA 4H3HB 1XG5A 3G7SA 2BM9A 3R8XA 1E6EA 4D9HA 4DC1A 3SY8A 2P41A 3IQIX 3WBFA 3H2ZA 1RKBA 1P2FA 1Z7YA 2DF8A 3O83A 3OO1A 3ZJ4A 3NHJA 4V38A 2F7SA 2R25B 1TPYA 2GPBA 3HCCA 4WFIA 1JDNA 4Q3OA 1AN0A 1U28A 1M10A 1KOLA 5F7XA 3GQBA 2Q50A 4XD7A 4YBZA 5GGXA 4F21A 2ONYA 2EDCA 2ETVA 4NJEA 2D54A 4PYIA 1HEIA 4K9OA 1ZM7A 1JE0A 2BW0A 2PD4A 4L16A 5HDBB 2OECA 1G64A 3SC2A 3RU7A 1SMKA 1CRPA 1ANKA 5KHLB