3DDOA

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with by phosphate ion at 1.5a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
240
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQKQTSHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title X-RAY Structure of the Uridine Phosphorylase from Salmonella Typhimurium in Complex with by Phosphate Ion at 1.5A Resolution
rcsb
source organism Salmonella typhimurium
total genus 85
structure length 240
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ddoA00
1OVGA 4QASA 4WKCA 4LDNA 2QPLA 1JPVA 3BJEA 3EUFA 4G41A 3EUEA 4EARA 3FUCA 1V3QE 3DJFA 3IEXA 3OZBA 4G89A 4TTIA 4KN5A 1K27A 2QDKA 1RXYA 3D1VA 1YBFA 4NS1A 1Z37A 1YRYE 3LGSA 1I80A 2QSUA 4TXHA 4TXJA 4M7WA 1Y6RA 3OOEA 1N3IA 5IFKA 1T8RA 3PNPA 4LZWA 1T8YA 1QE5A 1YQUA 3PHCA 3BGSA 1SD1A 3LBAA 5CCDA 1A9PA 1VFNA 4WKPA 1Z35A 4F3CA 1B8OA 5CXSA 4DA0A 4TXLA 1NC3A 5F76A 2QTTA 4U2KA 4M3NA 3NBQA 1PR4A 3FNQA 1RXSA 1U1FA 1YQQA 1U1DA 5IU6A 1RFGE 3OZEA 3DPSA 1RR6A 2GUWA 3K8QA 1PR6A 2AI2A 1ODIA 1T0UA 1OTYA 4NSNA 2AC7A 1V4NA 1T8WA 1JE0A 1NC1A 4LNAA 1PR0A 5JPCA 4BMYA 4ECEA 3OOHA 2I4TA 4L5CA 4D98A 2OC4A 5CYGA 1Y1RA 3FB1A 3OCCA 1ODKA 5CXQA 3UT6A 1WTAA 1Y1QA 1JDVA 4FFSA 1A9SA 3DDOA 1V48A 1TGYA 2RJ3A 2HWUA 1OU4A 1V45E 2OECA 3UAYA 3QPBA 4BN0A 1A9TA 1V41E 4DANA 3OPVA 1JDTA 4R2WA 1ZOSA 4TYMA 1YR3A 4GKAA 1JYSA 3IOMA 4OGLA 1V2HE 3UAWA 1Z5OA 2A8YA 4WKOA 2I8AA 2IQ5A 5F7OA 2Q7OE 3UAZA 2ON6A 5KB3A 4OEHA 4H1TA 5EUBA 5CYFA 3EMVA 3GB9A 3U40A 1LVUA 4L0MA 5EFOA 3MMSA 4JWTA 4OF4A 1PR5A 3PHBE 5K1ZA 1A9RA 1OUMA 4DAOA 1C3XA 4PR3A 2A0XA 5FAKA 1RCTE 1Z38A 1U1GA 4R2XA 3ODGA 4X24A 3PNSA 3F8WA 4G8JA 4YJKA 4TXNA 3DP9A 1OTXA 1Q1GA 1Z36A 4I2VA 1LV8A 3SCZA 3INYA 4D8XA 5DK6A 4RJ2A 4L5AA 5F7ZA 3OZDA 1JE1A 3O6VA 1G2OA 1TCVA 2P4SA 5F7JA 1SD2A 3E9ZA 3DF9A 4OGKA 1PR1A 1TD1A 5B7GA 3OZCA 1TCUA 2XRFA 3KU4A 1T8SA 3TL6A 4D8VA 1K3FA 1K9SA 4TXMA 5C80A 4YNBA 1JDSA 1U1CA 4YMLA 1Y6QA 3NM4A 1RSZA 4L5YA 3KVVA 4GLJA 4P54A 4PNPA 1ZL2A 1PW7A 3ENZA 1JDUA 4QARA 1CB0A 4TTAA 3BSFA 1A9OA 3KUKA 4L6IA 1PR2A 1PWYE 1XE3A 2OXFA 3MB8A 1FXUA 1PKEA 1PK7A 3FOWA 4E1VA 5I3CA 2HRDA 4GMHA 2QTGA 3FAZA 4NY1A 1A9QA 1Y1SA 4DAEA 2HSWA 5F78A 3UAVA 1ULAA 4DA8A 1Y1TA 1SJ9A 2B94A 4OJTA 1A69A 1CG6A 1NW4A 2BSXA 5ETJA 2AI1A 1VHJA 1Z33A 4JOSA 2ISCA 5F73A 3OF3A 3P0EA 1Z39A 4K6OA 1M73E 4MARA 1RXUA 4BMXA 1U1EA 1PF7E 3KVRA 1VMKA 4QATA 3NM5A 3KVYA 4EB8A 5F77A 3T94A 3ONVA 3O4VA 1PK9A 3E9RA 3C74A 4D8YA 2PGAA 1JDZA 1Z34A 4QFBA 5B7NA 3KHSA 4DARA 3LA8A 4BMZA 4F1WA 4MCHA 4DA6A 1JP7A 4F3KA 5F7XA 1SQ6A 4QEZA 4TS9A 1Z5PA 3FWPA 1ULBA 4F2WA 5B7PA 2A0YA 1ODJA 1PBNA 2AI3A 3GGSA 3P0FA 3UAXA 2HN9A 4YO8A 1RT9A 3E0QA 3K8OE 5CCEA 3BL6A 4OY3A 1B8NA 1TGVA 4F2PA 4D9HA 1Z5NA 4R31A 1ODLA 1ECPA 4WKNA 4GLFA 3NM6B 2H8GA 2OC9A 4LNHA 4TS3A 3EEIA 4MCIA 4QAQA 1LX7A 4M1EA 1RXCA 2A0WA 1RYZA 4UC0A 4WKBA 1VHWA 1OV6A 4IP0A 4JP5A 5EPUA 4DA7A 4TTJA 4LKRA 4DABA 5B7QA
chains in the Genus database with same CATH superfamily
1OVGA 2YVLA 2XXAB 1LNZA 5G0TA 3UV6A 1HKHA 2OHVA 3AHJA 1XDZA 4M8SA 4X45A 5K9ZA 3OQPA 3OKFA 4BFYA 2XGOA 2GEDA 4GX5A 3M6LA 3VKUA 3BXOA 1BEUB 1LSJA 4NE9A 2IY8A 4R8LA 2AE2A 4RNDB 4ZAVA 1UMKA 1TEVA 1ISGA 1LI5A 3ESYA 1HSOA 1TCCA 2K7ZA 4ENSA 2ZPAA 1WCIB 3G9TA 4BO8A 3I12A 5HFAA 5EYPB 2FSSA 2DWOA 2WFLA 1GZSA 2JJ1A 4AXXA 3PXEA 2AC2A 3F71A 4V0RA 5IASA 5KQGA 3QVGA 1SA0A 4N5IX 5J2UB 4ZAYA 2OO5A 1G9XA 2REXB 1MQ8B 2XAUA 4LY0A 3HUDA 4JC5A 1PJAA 3KU1A 4BYMA 1I80A 1T3SA 3ITEA 5HKKA 1QOZA 3P9PA 1P7WA 2JBHA 4QDKA 1CUYA 2PKYX 2QL9A 2QSYA 3IBCA 3CX6A 4IH4A 4UQPA 3RS5A 3UV3A 3ZR4B 2DETA 2G7ZA 2DT5A 2O2IA 5A5EA 5A4JA 3U3OA 5IMBA 1OQAA 4AMYA 4BPRA 3CZQA 5B1EA 1O3YA 2A9PA 5BVGB 2PCLA 3NJ8A 3THYA 1JTVA 3ON5A 1YQUA 3RRNA 3MHTA 1PFQA 3MBOA 4C0XA 5D51S 2AXEA 3E5HA 5ARBA 1K7CA 3PEWA 4BJ6A 4Y6PA 5G0UA 4C87A 3ZD7A 4DMGA 3KJQA 2RGRA 1OLUB 3U7FB 3ZBTA 1GZHB 5FIUA 2TSYB 5C18A 3O4JA 4D1YA 2D1QA 3Q5DA 4I1RA 4B80A 1W5SA 5K3SA 1TKRA 4MW5A 2R60A 4YTEA 2XQKA 1XELA 2JLQA 4MS1A 3PQ5A 1IBLB 4NESA 1TKCA 1NQTA 1NWCA 3FVTA 3V1LA 2I29A 1ZUNB 3KKLA 3STUA 2VT6A 2NAPA 4PLCA 4B6SA 4PGMA 3PNBA 3JZDA 3PD1A 4U2KA 4YT4A 2YJNA 4DDHA 7YASA 4BFVA 1DO0A 3FHLA 5FPTA 2LKDA 4MVJG 1AG9A 2VH2A 1PR4A 1UL1X 2ODNA 3G5UA 5AKGA 5FA8A 2O0LA 1XDWA 3WISA 4HGOA 4F3NA 3JAKA 1AXGA 1UKBA 4Z51A 4Y2TA 3B36A 3F47A 1H65A 2GBFA 4BASA 2A84A 4BGVA 1YKSA 2ANBA 4YRGA 5JXJA 3DPSA 1M1YB 3LOUA 4N39A 1TLFA 3ZNNA 1RJ9B 1UMCB 2G4CA 1MN6A 3V33A 3GLQA 3D8TA 2F2TA 1E1NA 3E5NA 1JLKA 1NMEA 4A26A 4DG8A 2A1TR 4PVCA 1VOTA 5CVJA 3SBEA 3GDGA 3H1AA 3IVMA 3HXKA 1ZJ6A 3LXMA 2O7RA 1JE0A 4QOIA 4UNRA 5C1OA 5SY9A 3UOAB 4YJHB 4V0QA 2E85A 3M3HA 4O2AF 3BMOB 3DOFA 2GK4A 3WLKX 2EW2A 5EIWA 4PFSA 3IHLA 5I7HA 1XXLA 2E4YA 2HGZA 2XCUA 3FFTA 1DTSA 1I2AA 3GN2A 2DQ4A 1AD2A 1N6OA 1TMGE 3UUGA 1DKMA 4B3DA 2NPOA 2RH4A 3F4KA 2OBNA 3LP5A 4YCJA 4MSUA 5DSTA 5KKCA 3ZDCA 2QQFA 4G9EA 3G2JA 1EFLA 4KN8A 1BCRA 4L5CA 5AOVA 5E6UA 3Q8KA 1FX1A 4AZSA 2O8BA 5FD8A 1WKVA 4WJZA 3RK4A 2I91A 4A0FA 3CEAA 3JR3A 1BMQA 4G37A 4HDNA 3L8CA 4FXOA 5FNZA 1LBSA 1ZUD1 4UBLA 3U3XA 5I7EA 2VJCA 1GTSA 4P3PA 1X9HA 2FETA 2ASEA 3EHEA 5BRJA 2R86A 3OFND 4LCJA 3ZZNA 4I46A 1X13A 4XWTA 1KJJA 5BO5A 3FDZA 2WTMA 4CF5A 4DM3A 3F73A 2HW8A 1ZGZA 1EB9A 4RMGA 1L4LA 2VPPA 3LPAA 4JHXA 3DD5A 3TQHA 3WLOA 1QB7A 2VBFA 5CFNA 5DN6D 2G4LA 4DA9A 3TR0A 4JCOA 2I65A 4YJ2A 1B6GA 4L8YA 5A9SA 3F7TA 1UFRA 4YQEA 1B0ZA 3OZFA 2IDKA 1R5OA 2JFFA 4OJMX 5B2FA 1V96A 5CFRA 1JA1A 1OU4A 1L9XA 1N2SA 1NDHA 3NBAA 3WY9A 1UK7A 2PS0A 3WMXA 1AA6A 1T9CA 3EXIA 1VB5A 2OCKA 4KMRA 4BV2A 1V9SA 2WU0A 2V7XA 4MI1A 4CM6A 3GLGA 1NOJA 1XEXA 5SZKB 5IC5A 3BSYA 2HD4A 3KWMA 1KNQA 1PLJA 4QYIB 4RTLA 1UJBA 3ZUPA 5AI0A 4K40A 3PP8A 2XLCA 1XUOA 1VPWA 1VPLA 4CI9A 2JIMA 2GD0A 3T3GA 1UCFA 3V5NA 5D86A 5L9AA 3EVFA 1NT4A 1PQWA 1Y3AA 1ZK4A 2J5QA 4WOCA 4Y9TA 2F3UA 1NQVA 4RLSA 2AJCA 2NU6B 2MSNA 2QE7D 3AVQA 3UXMA 3N8GA 2C2BA 1OBVA 4ZOLB 1E9FA 1PHRA 3QLUC 5EMNA 3SQOA 2YVKA 1GV1A 4JGIA 4EKEA 4CMGA 3EQ6A 1KVUA 1JIXA 5IZ4A 1IMOA 4A92A 3WL7A 2JG3A 4EK9A 1JAYA 1VB3A 3IAS6 4QDTA 4LISA 4N0EA 3WLMA 3QX9A 3HA3A 4CM9A 4DSOA 4XLLA 821PA 2EW1A 1SUIA 2Q3EA 2YFKA 3IBYA 3W5UA 2XZTA 2YCLA 3PC6A 1P5HA 3N74A 2ODBA 4RELA 2C8VA 4QBTA 3BHNA 1JBQA 2PG3A 3Q12A 4MV7A 4Q9KA 1L9KA 4ZCPA 6LDHA 2W58A 4W8HA 1RYEA 3GAFA 2KLBA 2BRUC 2YCBA 3FWKA 4G36A 1AUXA 3QXCA 4YLGA 2FN3A 3WADA 1L4BA 2ZVQX 4CMKA 5C3UA 2GCGA 5BNZA 1P61B 4RJIA 1KQOA 3DC2A 1S7GA 3L7CA 2OD2A 1ZSVA 3LRXA 4LZJA 3KB1A 2WUEA 3ESQA 1GADO 1WZUA 3NTOA 4TLEA 5H7XA 1I4EB 1UQRA 2JAQA 3EARA 4REMA 1N5MA 1VJTA 2FDRA 2HF8A 4HQRA 5LFAA 3L43A 1U3WA 2NT3A 4CIYA 1GT6A 1Y4AE 2D0DA 4OREX 4BZPA 1Z38A 5CB4A 3TWOA 3SWWA 1ZXLA 1U1GA 2FMUA 3ORHA 3ODGA 1FSGA 4KMMA 5A2GA 4BJ3A 2D4HA 1PUIA 4IQGA 1ZJ4A 1TO2E 4RZ3A 5ICFA 5BYBA 3N8NA 4MQUA 2P62A 3H1TA 4TXNA 2AUTA 1JG4A 3ETLA 3HVJA 2P9JA 2ZIXA 3S8EA 1QLWA 2QWXA 5EMKA 1Q1GA 4JJEA 1Z36A 2EERA 2GN0A 3IXMA 2NTVA 1DKOA 3JD2A 3RS9A 2IF2A 4M9XA 5IN4A 1SUCA 3LQKA 2YVQA 2UYCA 2ZT7A 3KB8A 4UTVA 4FOPA 1T1GA 1L5KA 1L5YA 4FTWA 4GAEA 4H4CA 3GFQA 4K7JA 2Z3WA 4WADA 4J1TC 4DC1A 1XCOA 2X0KA 1HNZB 5FTNA 4JI6B 1HL3A 3HJGA 1E3SA 3EFOB 2ZSIA 4O4HA 5FQNA 1MPXA 2EGHA 3U7RA 1XLUA 3A4VA 2CHFA 2NUBA 4AZ3A 2AC4A 4Y2YA 1US8B 2ZGVA 3C97A 2J9YB 3OKPA 4NARA 1WVGA 4EHFA 4ZCRA 3B9PA 3C4VA 2V58A 4MS4A 1U81A 5DNUA 3X44A 4IDEA 5DI3A 2SKEA 3CXUA 3DBVO 3OJ0A 5AW0A 2B8NA 3ZNPA 5EEGA 1Y7PA 2YJTD 4P81A 1Z0AA 5AP9A 5J5CA 2WUFA 3RYHB 3SSOA 5LOVF 5DM70 1Y9EA 1QIIA 2ZWVA 4OJYA 5LSAA 1N9GB 3UGQA 1JDSA 1MRZA 3DKKA 5IKPA 2X40A 2H2HA 3QVSA 4P9NA 4RZXA 4DRXB 1VLZA 2PKWA 1NMSA 3CTPA 3GDWA 5GONA 2ZAYA 3D6NB 3W2HA 1L5LA 4I99A 4YDRA 1WIWA 1W4AA 2V03A 1QTQA 4CFYA 2JGFA 5F2NA 3HCDA 3TKLA 1GRNA 1LB1B 1P4RA 4GI3A 4ZHSA 4HNUA 1Z0JA 2HREA 3DXXA 4K6HA 4ACAA 5INTA 4KKVA 1KP9A 5L7WA 1EGVB 4MR7B 4UUMA 1U3GA 1IBMB 2ZJ1A 3OSZA 5EJGA 2Z9CA 1R66A 5TF4A 4EG7A 4YCDA 3IPRA 2JJ1D 4GWKA 3DLCA 3OHPA 3E15A 3KQNA 4EGQA 1ATIA 1E2MA 1U5BA 2FWJA 2PMBA 1AY0A 3BZWA 1P3JA 2PWAA 4AROA 3GA5A 3E8XA 5KINB 4B34A 2VH5R 3CYFA 1C3OB 3BA6A 2K2QB 3IVAA 4ND5A 5FPQA 2Q49A 1XA4A 3IAXA 2CD7A 4E07A 1ZJWA 4N0MA 2VJKA 1BRMA 1UXIA 3HCAA 3I1IA 3NAGA 1L5VA 4FGZA 3UHFA 3X1DA 3KOUA 3LTNC 1QHEA 5J3JA 4QT4A 1E1LA 4UBOA 1AT1A 1U2DA 3A3KA 3FHCB 3F0TA 2B4YA 4NDZA 3ETCA 1GR1A 3ODPA 3IT2A 1W36C 5FB3A 3LY5A 3BIJA 1R6DA 4D0RA 5EP3A 3I6IA 4GLBA 5JD6A 1A97A 4OV6B 4LJ4A 4FCWA 1ZK3A 2QR2A 1EG7A 3L5KA 2IU0A 1EP1B 5IAJA 3SXUA 3QIVA 1I14A 1TZ2A 4BMNA 1T10A 3ZWBA 1HDCA 1Y3CE 2XQIA 1VHDA 3C3DA 3RUFA 1GKYA 2O48X 1JSRA 5LPNA 4MDHA 3OA0A 4LYFA 5HBRA 3WLJA 3I23A 1FFSA 5IABA 1O0SA 1RPTA 2ZITA 1MZPA 1XDGA 5T5QA 2PGNA 3WDLA 1U3DA 2HSZA 2ZJ0A 4JC0A 1EAYA 1DC4A 1VIAA 4YAWA 3ZY6A 3B7GA 1WMBA 3UMVA 2EQ5A 2W0SA 4RO0A 1Y7IA 1UKYA 4G0WA 1PWEA 1XMSA 3NGLA 4OA5A 3SI7A 1SKUA 3ASVA 3N28A 3U39A 1CW2B 2QM3A 4TVBA 3REGA 3OZ7A 2BTQA 2VR1A 4QFDA 5G0WA 1WHSA 1AUOA 3PDWA 4KR6A 3IAS1 2H7VA 4UFOA 2Z2JA 2NSYA 3UAOA 3PX7A 2XMCA 3NC1C 3C4JA 3U1VA 3VR4A 2NU9A 3JQFC 3SZGA 1HO3A 4POAA 4BNXA 4E2XA 5CB6A 4N4AA 4CCWA 2HHLA 2PLRA 3F7NA 3V34A 1ZUIA 1CU1A 2I3DA 1E1YA 1I4WA 2GKSA 2IZOA 4B3GA 1UC4B 3OE4A 2X4GA 3UMMA 1N7GA 4IH1A 5FHQA 5CYOA 1TZKA 3OQ6A 4ND6A 5TSDA 5A4IS 2P30A 3HH8A 4JK3A 1CRWG 5FPKA 1PYOA 4Y7DA 3DAYA 5JMWA 4J1TA 4KWEA 3TD9A 2JGDB 3CH6A 4FZ5A 2I22A 2FOXA 2GN9A 3G7SA 4QGAA 1OW3B 1SB9A 3BWVA 2L0XA 5F5LA 3J7TA 2HQ1A 3RIYA 4AO6A 2X2PA 5BSWA 3M4JA 3U56A 1NHWA 4MP3A 5EWMA 1EFUA 2JAXA 2KX7A 1CLUA 4PGHA 2YHSA 4D0GA 3HG7A 3COPA 3I37X 4US2R 1XTBA 4RKRA 1NVUQ 1JLLA 1SU6A 4L9AA 4YGXB 1PHPA 1IAQA 1Z5VA 2HHAA 1QIMA 1L8AA 2ZREA 4TN5A 1YKGA 4BO7A 1UBRS 4DADA 3GXBA 4TKVA 2OCDA 2J87A 2BH9A 2OBXA 1SOUA 5TX7A 4ZGBA 1V6AA 1BWPA 2SKDA 2CK3A 2H1FA 1QAQA 2IDZA 3HJCA 1F2UB 4MRSA 5I7SA 3NM6B 3RK1A 4FLEA 5ULLA 4F97A 2F1OA 2FWPA 5EXTA 4HX5A 4BP1A 4RBNA 1OU0A 3ZWXA 2O5VA 2WIDA 2YUIA 4DJJA 4CPDA 1EVKA 4YRQA 4QREA 1PEYA 2PJUA 3OZTA 2QPAA 3BIOA 4AJPA 4QTUB 4S1VA 2UXDB 4WZAA 4UVHA 1U80A 4YP5A 3H6HA 2GZ3A 2EDAA 5JS6A 1NNLA 4XQ9A 3VHXB 1SC9A 3SKVA 5BMVA 2IXBA 1JHMA 2FTKE 1K8YB 1RYZA 2SKCA 3BBLA 4ZQEA 5J23A 4GDMA 1ECBA 5TQ0A 3P9IA 1H3EA 3EC2A 4WKBA 4ADSG 4LN1A 2QAGC 1SBTA 1GNLA 4TTPA 1A82A 3HLYA 1W2GA 4IS3A 1P2FA 4LOAA 1ZOPA 1NPYA 1QCDA 4QU8A 3KD2A 4QASA 5DGXA 3SSAA 5JFTA 3RSCA 4H1UA 4M0MA 5EGNA 4QPPA 3VSDA 4YI3A 1CK4A 3PFKA 2ENUA 3FIUA 3SR3A 3H2YA 4JS0A 3UVEA 4DNFA 2IDMA 4DWVA 3TI9A 4C2UA 1ZMOA 3ZYZA 4XD2A 1PWXA 4EABA 1DRJA 2VXYA 2FG5A 2ZLBA 4ND2A 4OM7A 3WK5A 2PD6A 3BD8A 3AEYA 4RPGA 3AOGA 1CQWA 1LV7A 1KEEA 4D4LA 5ICCA 4ISCA 1QCYA 1Q3KA 1M74A 2A9FA 2YC4C 3QI2A 4IFTA 4KFUA 4OQQA 3EEQA 3OUZA 4LHYA 5JYBA 2E21A 1C7RA 2O19A 1AC5A 1GGJA 1VQ1A 2IHJA 2VHCA 5TQ2A 2JLCA 3NIFB 5CCXA 5IX8A 4TKLA 3MCWA 3MA0A 3PGVA 4RACA 4R2HA 4XKJA 4ZAXA 4OKIA 1GZUA 2VWHA 4TSRA 3LGSA 3RFTA 3T5GA 2HDOA 4HO1X 4ZU6X 1J0XO 2VL7A 3EXFB 4ZVTA 3RBAA 3TSOA 4AN4A 5B4UA 5FI0B 2C7RA 1RXIA 4B74A 1GCAA 2XKJE 4GP6A 5BQOA 4B7XA 4F04A 2CMDA 3P2YA 1BHQ1 5LR6A 3REQB 4RH3A 3UJ6A 2BP7B 4FSDA 2CW5A 2ESRA 1JHZA 3D02A 1YSCA 4C6TA 2P6NA 1V7PC 3KPVA 2F3TA 2D5IA 3D4NA 3RVMA 1BMDA 1GNTA 3EG9B 5CX1B 4LCBA 1EXWA 1LF0A 2I7TA 4LJYA 3CF4G 1N8KA 4U7WA 2XNSA 1EGQA 4TL6A 3FZGA 1RJFA 1DC7A 1SD1A 1V7QA 2DPLA 3EA0A 4N0PA 2XDWA 4QOJA 2B99A 2FN4A 1E8DA 3EDOA 5EZYF 3F6EX 5GWXA 1P2GA 2FRDC 1OASA 3CUSA 3ZDXB 1QK4A 1MPTA 1NUSA 4HOYA 1SVKA 3GRZA 1BJRE 2PGDA 3K5WA 2PMDA 4M1SA 5LZ8A 2GBPA 5B53A 1HEUA 2WJIA 1JHUA 1J9EA 1NI4A 3ICWA 3JAWB 4HTFA 1KTIA 2XEDA 1J5PA 5EZQA 1R0WA 4U9UA 1R8YA 2ZT8A 5FL7A 5M29A 1V16B 2WD9A 1VG1A 3HXLA 3IT1A 4CN8A 5B1YA 3R4VA 5TJHA 3RIMA 3HYSA 3JQFA 3H5IA 1P75A 3I72A 4GP7A 4TXLA 2XZPA 5G40A 4JNKA 5J4YA 4DV3B 3RAEC 3M1LA 1PJQA 4DCSA 1ULUA 3MQ4A 5GIPE 2Z2ZA 4BQFA 2F7SA 4R83A 1N33B 3M4XA 2Z4SA 2D1SA 3A9TA 3NEJA 2XOKA 1QPBA 1IPFA 3DVSX 4OMCA 4Q1FA 3DOUA 3D0QA 4UAGA 3UGTA 3USCS 1G8GA 2WZBA 4FKMA 3A4YA 4GPZA 4XRRA 3P7MA 5I7VA 2GX6A 4O2AB 2WWYA 1PAUA 2YV5A 3IKVA 4KQ2A 2PZMA 2BMAA 2O06A 2RHCA 1PZEA 1E79A 1YR6A 3QX8A 4LXXA 4EFMA 3NOVA 4YP7A 1OYYA 2HJWA 3V00A 5A0VA 3DO8A 1HL7A 3H2KA 4IKEA 3FLMA 2NXCA 3LLVA 3WYCA 1O57A 4ISBA 3HVUA 4QIHA 3R7DA 4DQ0A 1UBGA 1QHNA 4Y2GA 3TTUA 1EBFA 3ZWMA 3PNKA 2O2XA 3ZC3A 3HO8A 4JJAA 1OFVA 4TLCA 2VP3A 1FPMA 4IQ8A 4TV9B 1G2IA 4E70A 5JPCA 1ZLXA 3TBFA 1LD3A 4MITA 2TMKA 3WNVA 3CE9A 3ZDBA 1C4KA 5JRZA 2GXUA 1ICIA 2W11A 4NZPA 5TY0A 1ISJA 1ECJA 2QX4A 4B82A 2YS6A 3KTOA 4W5WA 2JKZA 5CLQA 4D98A 4ZQIA 3C1OA 4CMJA 1OH6A 1TZCA 5EJMA 2UKDA 4QO8A 4C0LA 1RVDA 1J0BA 2PRYA 2DGDA 2ZOSA 4I8XA 5B30A 1WPGA 1IM5A 3CX4A 1I94B 1WCWA 4DIMA 3I9NA 4G9GA 5CXQA 3UK1A 4L3VA 4G9BA 3KELA 3RIGA 1D2RA 3AEQA 4XJXA 3UWSA 3NRJA 3W1VA 3EGCA 4A6DA 1QU3A 4M1ZA 2C7GA 3LFTA 2BFDB 2MJLA 2I99A 1TXGA 4U39A 5SY4A 1GRCA 2D7JA 3WBJA 3UYKA 3K05A 4NYJQ 3Q0TA 4TZKA 2INGX 5LUBA 2J5KA 1XFDA 1K8ZB 2VHUA 3OJXA 2H4HA 1SBCA 3P8ZA 4GOKA 4I55A 5JUWA 1A9XB 4MPTA 4FFDA 3W79A 1KO7A 3ZGLA 4FNAA 3UJ3X 3BHJA 3Q9LA 5A3RA 4M7PA 3BJIC 2HGSA 4Q48A 1H6AA 2V6IA 1QPZA 3IC5A 3JVIA 1I01A 2QI9F 1W75A 3BZUA 2C20A 2Q41A 2O6LA 3C8UA 2ZG6A 1P74A 1SUPA 3HQ4O 3HYRA 3VHRA 1JR3E 1FRZA 5ALPA 3L0ZA 2RFLA 3TW0A 2PUDA 4YJFB 2CVOA 2HK6A 4QT0A 1J1IA 2VHEA 1RAFA 1GPJA 5E7JA 4B3CA 4CL0A 4YCLA 5KVSA 2HA2A 3BILA 2W98A 3PDIA 4P4SA 4X91A 3WQSB 4DXDA 3A6KA 1HWYA 1R0CA 1A4RA 4QQRA 5D84A 3LPNA 1EFAA 1F4LA 1T2CA 3K0AA 4TLMB 1YVEI 1YR3A 4RE5A 5KWVA 5MDHA 5BUSA 5C1IA 1H1DA 1WV1A 1IQUA 1DAIA 2JL1A 4LV6A 2C5BA 4RVFA 4H7JA 1SG6A 3BX1A 4E7OA 1YJXA 2AFIA 4FNGA 3E4DA 1SVLA 3EGXA 3GPCA 4MR8B 2R7LA 2XT0A 4MW1A 4QTYA 3SLGA 1RYYA 4UXJA 4ZCSA 1E4EB 1V3VA 1CETA 1SZJG 3LX8A 3ASYA 1GPLA 5G02A 1YHZA 3S1AA 4E5YA 4YR7A 3L7IA 2REQA 1Q0HA 4A91A 2AVDA 1IAVA 4N5HX 1WUHS 3EBLA 3PFIA 5JI3E 4LTNA 1JVNA 1O4VA 1GPNA 3QUTA 2VG8A 3T06B 5D3MA 3C6ZA 3NP9A 2XOXA 4KMSA 1VPVA 3DMYA 2ZQ5A 1N1DA 3GPIA 1WWKA 1YQEA 3OFJA 4OQMA 1UM8A 1ZZEA 2VYFA 3O2QB 4FUTA 1D8AA 4R5HA 4ZCIA 1UEJA 4UAJA 3D43A 4UM7A 2AL7A 3UXEA 2FRDA 4IINA 3ITKA 1F2TA 1N7IA 2WHYA 3CNLA 4JH0A 5GPBA 4BU1A 3G5MA 3TCKA 4D8WA 3SF8B 1RXEA 2BGTA 4FFOA 4GNKA 3RVRA 4HWSA 1QFZA 4OTZA 3RNLA 3FFBA 3L84A 2Q3CA 3V8EA 1E1DA 4H1HA 3NANA 4Q66C 4ZO4A 2VJMA 3HE3A 4GW3A 4OHWA 4XPIB 3BEOA 3WL5A 2E0IA 3WL4A 3ZE9A 4BXOB 1C1XB 2VKQA 3ESBA 4JZKA 5I7RA 2WKRA 3CB4A 5ALVA 4DLAA 5ITZA 2FF5A 1E1KA 4AS2A 1Z4LA 2WK1A 4A3SA 4X6LA 3ZDFA 4LV5B 4S05A 5ED4A 3AF1A 1M1NA 1QQ6A 2YMPA 2OZKA 5CVVA 2EF1A 3PNSA 4NZOA 3E61A 2ZAMA 1NI5A 3MGGA 621PA 2HJRA 3KL2A 2I55A 3W4KA 2ZYRA 4TQ9A 4C6SA 3UEOA 4DV7B 1V7CA 1GVHA 2V96A 2ZWMA 1SQSA 2AX4A 1YUNA 2ZBEA 3E2IA 1QMGA 3PC4A 1EVZA 4Y6SA 2IHZA 1O8BA 3EFEA 2XQGA 2Y66A 3MIZA 4NU8X 4P38A 3TZQA 3UMSA 4P36A 3ZU4A 2IZ5A 3NALA 1HK7A 1QR6A 2GASA 3CKLA 2X9GA 4JX9A 1FQJA 5FUYA 5LBUA 2QOEA 5FHRA 4HADA 2H29A 1UJMA 2WF6A 2CHEA 1OD6A 2NYAA 9MHTA 1E4VA 1QYDA 1G19A 3EVCA 3WIUA 5LOVB 1S0UA 2HPAA 5DMXA 5JXIA 1RM0A 4LE1A 2I76A 4TMZA 3AB8A 1TVCA 1L5HA 1U2TA 5KHOC 4JEIA 1C9MA 3BWCA 3H1GA 2JGNA 4OGKA 3P2OA 1SUSA 2PL1A 3EN0A 4POOA 5B7GA 2IOYA 3FPKA 1SQ5A 3OX1A 4WXPA 2IZZA 3URKA 3IP7A 4F0JA 2ZTMA 3FKSD 1O96B 2OB1A 3GPLA 1TTTA 1IJKA 1XRRA 1D5WA 2B3TA 3O2SB 1QNFA 2MYNA 2IW3A 2ZRAA 4A0HA 4IDGA 2KJQA 5C80A 1U1CA 4KYIB 1QO0A 6GPBA 1FP7A 2VOJA 3F3SA 1EI9A 3NEPX 4P54A 1NJ6A 4H16A 1T4BA 1IZ0A 4UCXA 4L02A 4RLQA 1J97A 2WU3A 1XMQB 4GBGA 4H17A 1T3LA 2AFIE 1FUUA 3NKFA 3KUKA 4ZC1A 4DZTA 1ENZA 2I54A 3OT4A 3KTFA 1GGKA 3NIGB 4OLJA 2AJDA 3L93A 4DLVA 3TXYA 1Y0BA 3KYCB 3L1HA 4NDNE 1EU1A 2PBZA 1SCQA 2QLTA 3BAZA 1KOFA 4UUPA 4E46A 1ES9A 1MJFA 1Q1ZA 3MMNA 2IHKA 4EF4A 3EIWA 2KB0A 5JAUA 4QM7A 4IL5A 2YXDA 5HE9A 4JUAA 2ZAOA 4A23A 1N0IA 1RC0A 5C7LO 1XMPA 3I0NA 2QMHA 1UBOS 1DXOA 3ANNA 2C8LA 1NV9A 1U98A 5KPDA 2D0OB 1CRZA 1T13A 4M8IA 5BOSB 5JARA 2WA2A 4NCAA 2XDQB 1J56A 2IYLD 4PYIA 1S3SA 4J16C 5JWHA 1IXKA 1SD5A 4YQZA 1OV4A 2CLCX 3UUFA 3FAZA 4I5EA 1X80B 1DXHA 1EUDB 2BKXA 4L4XA 3QKRA 2YVUA 3VH1A 3D8HA 3QXJA 5CBPB 1RPNA 1T43A 4WESA 5JCJA 5T6MA 2IEBA 3RVBA 2H9YA 1FUEA 1WMSA 4ZK6A 5JRJA 3TRJA 1ULHA 4B81A 4MKZA 4AG6A 1D4FA 5FBZA 3DGFC 1XO1A 3L4JA 1SJ9A 4PG6A 2B94A 1D0VA 3PKJA 1XQVA 3C3KA 3RWBA 4CCSA 1AZLA 4IGEA 5K3EA 3QENA 1UK8A 3KAKA 4RHCA 3AF6A 4ZIRA 3E2MA 1NYQA 1Z33A 2B1GA 2PT9A 4F6RA 5BQPA 4PAOA 2X5NA 1V8DA 3K4PA 4JB8A 3OLZA 1HE1C 2YRWA 1R6UA 3GQBA 3HB5X 4G4SP 1MIOB 4WL0A 5T64A 3SZUA 5C2JB 4MYSA 1JR3D 3P5SA 4TMYA 4UNPA 2RDMA 3D7KA 1U8CB 2IYUA 5EE9A 5CT4A 4NYJR 4XYMA 5JCPA 4PYRA 2YXLA 3CRMA 5JWRA 2WEKA 1CBUA 2O2JA 3R3HA 3TB4A 2YZKA 3AY7A 2O1WA 2ZZNA 1HYQA 2EATA 2RBKA 4CMBA 3W8FA 4BNMA 4DJEC 2ONYA 5FL7D 3ROPA 3ZCQA 5EZ5A 3RDPA 5FOQA 4J9UE 2IF0A 2V7QD 2UZIR 3D6VA 4GQAA 1MB9A 1WJGA 4RDHA 1YQDA 4EB8A 1LPOA 4B6JA 5ICMA 1WKCA 1R4NA 5JATA 3UW1A 1MRSA 3AUJB 4HYYA 4I1YA 2NACA 3P2EA 4OFZA 4M53A 4X1IA 4BO6A 4BVFA 2QTVA 4ZYUA 4BNWA 1GZ7A 2J07A 2PGAA 2P2CA 4UCFA 2Q3LA 3L7MA 5CNJA 5TS2A 4BFCA 4ZVRA 1XXHE 3D3QA 3D3NA 4LOKA 3FOBA 3GJ3A 3DZFA 5LXTF 3U7JA 3RC2A 1H9BA 1YRWA 4GRDA 3EVGA 2FDCA 1KH1A 4O5AA 3W2EA 4G1EB 1GDHA 1OT5A 4RESA 4L8GA 1EIWA 2XADA 2B7CA 1AK2A 4KXQA 3FPBA 4L4RA 5IPFA 2GF2A 2J45A 2HCJB 1S7CA 2AF3C 2P67A 2YFQA 4NVRA 5HQ3A 5KDDA 4TS9A 2WNSA 2C9MA 2XNJA 4AS1A 2H2AA 1AGYA 1C9YA 1L2TA 3M1IA 3OLXA 3U62A 4DHWA 2YY6A 3OIWA 1Q17A 2ALJA 3IAM6 4ZFNA 1JPUA 4C7OB 2Q2QA 2VBIA 2WWWA 3PVCA 4Q7EA 3HI4A 4EI2A 1NIJA 3TN7A 3ZV3A 2J33A 3EWSA 3VO1A 5K6TA 2JA1A 2XE8A 3ZLJA 1XRPA 2A0YA 2FUG1 3T5BA 4DIDA 2WP0A 4TTRA 3VOAA 1JEYB 4OU4A 2BY4A 1F8GA 3HNOA 2F59A 5DT9A 3VBEA 1HKUA 3ZJ4A 4F5DA 2YOGA 2XTMA 1EUCA 1QZZA 3NLLA 5JSYA 3AETA 3X43A 3L6OO 3LOPA 4GMKA 4E51A 3O3MB 4N3NA 3LW8A 2WB2A 4DC9A 4BDSA 1MABA 2SBTA 1AVTA 2V0GA 5AXDA 2VK1A 5AVUA 1F4VA 4CU5A 2H1IA 3VPHA 4ETNA 1VMIA 4G24A 4JR0A 4B2IA 5HKBA 1Q0TA 4LWZA 1DG9A 3GFVA 5DGHA 2O52A 3CX7A 4CFSA 3EQ9A 1R4MA 1XU4A 2PUGA 1FJGB 4CCYA 4JI3B 1A27A 1FFAA 3PFFA 3QF4A 4UJ3A 4FS8A 4KRGA 4K87A 2GZAA 4RVSA 2W2TA 3RTGA 4R7GA 1P19A 3LBIA 1QIJA 4O1MA 2HRCA 1PV1A 1F8YA 2FPOA 3E3MA 5JCOC 1VRCA 4RDIA 3BTSA 2O3RA 4EUSA 2PLAA 2O2EA 5FYDA 5K0BA 5F52A 1Q1AA 1VHLA 5F1PA 1F6WA 2J3LA 1U3VA 3KJHA 3RM3A 3U0BA 1AURA 2HUPA 4M1EA 2A5YB 3JQ8A 3TIXB 5AQEA 1W5TA 2FEOA 2PS9A 3EIEA 2ZDGA 2NSDA 3SLKA 2HNKA 1FMFA 2I7CA 4UE2A 4C43A 1U0GA 1T9GS 4LF7B 1KZ1A 5JDCC 3FDXA 4RK1A 1GZVA 3WRVA 1D0SA 1EXDA 2G04A 2KLHA 2E2WA 3UT5A 3MOSA 3GGCA 3ZK8A 1SUDA 1M2HA 4RGBA 4INPA 2ODWA 2PTHA 3L7NA 3OU2A 4JMLA 1MAWA 1UP4A 3DE0X 4IRXA 3WHPA 3AUAA 2J7PD 3QJ5A 4LKRA 2WKSA 1N5IA 4J16A 3TXXA 6AT1A 5IXSA 3HP1A 4HGPA 1FDSA 4KJZA 2PXXA 5GIOE 5DCUA 3M9XA 4I1UA 5JAIA 1A2QA 3CRW1 1H42A 1P9NA 2EF0A 2F9FA 5C31A 2Z9DA 4Y2XA 3DLBA 3F7MA 4Q19A 1HT0A 1U8TA 4RX1A 2C5AA 3V7WA 1Q11A 1BGXT 3FLBA 4TL9A 2ZUTA 3NZEA 4MRVA 5HK9A 4JODA 3NXSA 2WOOA 4L7QA 4R69A 3UKOA 1IDOA 3GZNA 4RAOA 3T7TA 2IXEA 1JVSA 2ZUDA 1XYVA 3L46A 2HMTA 3ABQB 5HWSA 3B1FA 1CDDA 1E1RA 1EDDA 4RH1A 2VHJA 3O4IA 1P1JA 1ZVKA 2HSEA 3I2IA 5BWNA 2WFZA 4Q1AA 1E66A 2C83A 5MFZA 1M0EA 2RGWA 4CEJA 2FKNA 4BFSA 4Q7JB 2I66A 3JQBA 1QU2A 2AF4C 3EIQA 3HO1A 2HA6A 4Y67A 4JUCA 1OI2A 3QPWA 4E5VA 3JARB 3BXFA 2H1CA 3C5EA 3VUEA 1YRLA 4DTCA 5H83A 2FMFA 1PE0A 2QY9A 1V5IA 3BRWA 1K8QA 2BUAA 4IZ6A 5EZYB 2WF5A 4ZGGA 5HXAA 3D2BA 2GJ8A 1GRVA 2A5DA 2ZSBA 4LDPA 1B2RA 4MKHA 2MINB 2MOKA 1E3LA 3QEBZ 4AC9A 1T2UA 3SZ3A 1OZHA 2VDMB 2OHHA 3BDAA 1EXMA 3K09A 2Z0MA 3ZBUA 3SQNA 4OIMA 1A9PA 3E9MA 5IYZF 3ZHVA 1I3KA 2FPPA 3KOXA 3GWGA 4WY2A 3E18A 3CUKA 3HKDB 4B9EA 1TVEA 2IHYA 3L0SA 1NBMA 5CYPA 2B9VA 4MS3B 1GPMA 3E3LA 4LBZA 3RHZA 3K70B 4MYHA 1XCGB 1XZPA 3IQWA 2GD1O 1F4PA 2VCYA 3TAXA 1HE8B 3ACCA 2PXAA 1RQNA 1P91A 2R7AA 4I1IA 3U3DA 2IYOA 3I2JA 4OUKX 2J9GA 3QOXA 5IBPA 3VVBA 5B12A 4IJQA 4LSZA 2FVXA 4NFLA 3WOVA 3JD3A 2QTFA 2ZYTX 2JH8A 4P3KA 4RMIA 5M7EA 1YJ5A 1ZN8A 3W8EA 2VPTA 3VOBA 5LD2C 1GRQA 4DR4B 2FW7A 2H2IA 1PNTA 4ND7A 4JT8A 2FWMX 2I6SA 3H5RA 2B5OA 3KG2A 3ZHQA 3HN6A 1AV7A 4S35A 2Z4RA 1C4XA 1X1RA 2HF2A 2VI5A 4I1OA 4JB3A 4L2IB 4LDRA 3DV0A 1ODIA 2P6UA 1SBQA 2GETA 4OUDB 4B17A 3FNIA 4N3CA 3ROQA 3MPOA 2XJ9A 2YBDA 1AJEA 3H19A 2VVTA 4B5KA 4Z9FA 1OVMA 4OHFA 4OXYA 1JMYA 5B1SA 5BSRA 3ZBPA 1T8WA 1IEXA 1GTRA 4MUXA 1PG0A 1PRYA 3CO0S 1W49A 3R2JA 1YE5A 4R3UC 5BSVA 1FLDA 2W2XA 2PQ2A 2VDOB 1G5HA 3RFFA 5EWJB 4LRTB 4A0QA 4BWVA 1X2EA 3P2MA 1Z5UA 2MSDB 3EYWA 2LBPA 3BN3A 5FBHA 3RABA 4YHBA 4WINA 5LMZA 4A0SA 3QV1A 3ONDA 4Q3LA 2KHZA 1SQ0A 5LP6C 2APJA 6YASA 3VKHA 3ZI0A 5K03A 1O87A 1SIWA 2X7XA 3IAM1 4LVOA 4OL0A 5JCOA 4RTQA 2PT5A 4YRFA 1NVAA 1E0DA 1E77A 3Q7PA 3CNQS 2YYYA 4MW7A 2GN1A 3CGGA 2IEYA 3OCCA 3RC9A 4XIGS 2B2NA 1LPPA 1C14A 1ODKA 3RHTA 3CX8A 4PONA 3EQ7A 4OGFA 3QYPA 1R16A 4WDQA 2O05A 2W2KB 5JDCA 1L5QA 1HSZA 5HTKA 1PZXA 4NZYA 1GUZA 3OI7A 1REQB 2HRZA 1UKAA 2C31A 1TCBA 2O3QA 4II2A 4R9SA 3DE7X 2HBQA 5GZ1A 1P1CA 2JIZA 1C2YA 3K5IA 3KEFA 4D99A 2XKAA 5JCJD 4BQNA 5JJKA 5EQDA 2O8FB 3CPJB 4H6VA 4YS6A 1ZAKA 3UHPA 2FFAA 5K6RA 4KPUA 4FK8A 3GUUA 3Q7SA 5CDTA 4UFNA 3QOFA 2OZEA 2CEKA 5HDQA 3VV2A 4EW2A 1DO2A 3RI3A 3FROA 2EFDB 2J5XA 1ISHA 1BN6A 2VHZA 3K20A 3JQEA 4ETIA 3I61A 3BJMA 4PPYA 3OC0A 1A9TA 3TLGA 2ZRIA 2Q1XA 2HU8A 3TI7A 3LUBA 3V4LA 3A9RA 4Q4JB 5HKAA 1AMNA 4ARCA 3R7BA 2ZBFA 5JSUA 1X39A 1XR3A 2JATA 3PNQA 3CBQA 1K6IA 3JU3A 4R2WA 3SZOA 5KNBD 3AVYA 4BLVA 3IV7A 1NA5A 1NFFA 4URZR 4CQJA 4KB5A 1NW7A 4B76A 3A1UA 5DB4A 1VJRA 3ITNA 4TWRA 2H11A 2EQBA 2VUSA 3BJRA 4TWAA 2JFGA 4KQ1A 4DOMA 3IEMA 3MCZA 4ZRDA 1QK3A 3MWKA 1C1DB 2EZ8A 2CXXA 1R2QA 2L82A 4HYQA 4RLHA 5FTKA 1CIJA 1V11A 2OPHA 2C42A 4EJMA 2Y1OA 5BR4A 1VG9B 4IR7A 4HMQA 4PFKA 4CEHA 2GA8A 2VH1A 1DOHA 4DW8A 5JZOA 4X97A 2LV8A 4BAGA 4OHVA 4FDLA 2NLOA 4UU1A 2FHPA 3ETHA 4JN6B 2FR8C 2X1MA 4OK3A 3ZWPA 3B6EA 3A2KA 2QAIA 3WMWA 3B52X 1FYDA 3DP7A 3GLFA 1SVUA 3GFPA 2AFVA 5DFAA 2BTEA 1ZI8A 4AF6A 4ZREA 3P9NA 1CJBA 5BV2P 1YBVA 2H4FA 3HWSA 4M36A 1LVUA 2HIHA 5DNWA 2EJWA 2YKGA 3KQPA 1QDEA 1V6CA 3BFXA 2G9UA 5KJEA 2O2YA 4BE7B 2YW9A 3ZCTA 4B84A 1TA9A 2EWMA 3ELWA 5D5HA 3VSBA 3TLYA 5LDGA 2H65A 1UKCA 3D7RA 3L1JA 1Z17A 3IOYA 3CX3A 4JJGA 4OH7A 5LCXA 4WPGA 5T57A 3UC5A 5CAEA 2PE5A 1II8A 2E1PA 1DQSA 3FSRA 4C5CA 3OFKA 2QORA 3K72B 1DRUA 1ECLA 3O0DA 2QHXA 1OZGA 1AKEA 3OZGA 4LY3A 1ZIDA 4Q1VA 4X90A 3T61A 3CJQA 3ORRA 5KHAA 4OJKA 2XUZA 2PGIA 5AUNB 1I2CA 3JRXA 3ZK7A 5JPDA 3FOZA 4PR0A 1IK6A 3E7WA 1NP7A 2PEZA 2XKBA 3CZPA 4KXFB 1F48A 1V1RA 3CRZA 3L1IA 2F8TA 1KFJB 3EIFA 4FHEA 4WERA 3RSLA 1WKBA 5FWXB 3D5QA 4L50A 2V3VA 1G7CA 3EJWA 1T8PA 3TQRA 4BFXA 2IIPA 2QL6A 3HK2A 2O6HA 3FF4A 1NRXA 3BS4A 3UA4A 3GH3A 4URXR 2PH7A 2EBHX 4NNOA 4R40A 1M3SA 1RQRA 1RZVA 2A78A 2HMUA 3E35A 3L7DA 4ZT4A 4AS3A 3PXXA 5DULA 5MGNA 1VG8A 3INYA 2JLVA 1HYHA 4GOMD 2ZIGA 2NZVG 5JFGA 1SZCA 3JD0A 3L8YA 1PFKA 4P4UA 3RJTA 4E21A 1OBHA 1QH8A 4L5AA 5DE3A 1ZJ5A 3PRKE 4KWCA 5IAOA 3HU1A 5B6PA 4EY8A 2UZ0A 1JE1A 1I7SB 3BMQB 5A4KA 4QELA 3P19A 3Q5GA 5IW8A 5ENZA 1I9GA 1V47A 1G7SA 1OLSB 2WIBA 3KYBA 4OYYA 3B3FA 1KQPA 1OTHA 3DQPA 5IULC 5CVTA 1U9CA 3FI9A 1M2WA 1T2FA 2GPYA 3FWYA 5FEMA 1KOLA 2HWXA 2RH9B 4NENA 2C96A 4N18A 1I6WA 1VRVA 2QROA 2GJ4A 5LP6A 3FDFA 5G3ZA 4HBZA 3Q8XB 4Y1RB 1XD2A 4DCPA 4ZYYA 1E9VA 4UVDA 3MN1A 3WSWA 1RI3A 1TQDA 1XMXA 4HPWA 4REQA 1Q77A 4ZT7A 3WZ2A 2WJ4A 1VECA 2XF2A 4IVRA 4YNBA 5DGTA 1GNSA 1DFHA 2R68A 1W0KD 2R79A 2QD4A 3DXYA 2H5IA 1V95A 2Q8NA 2Z2IA 1KH2A 4KFSA 1ZGBA 3DUFB 1G21B 2OVFA 3H4VA 4NLLA 1M2VB 1TAHA 1YZQA 4IKOA 1P2VA 2RC5A 3FGOA 1K4KA 4ZXFA 3LBFA 2GSDA 1OXXK 1RLIA 4TPKA 2PIDA 4LRYA 4A2WA 3HYLA 1XXHB 2E18A 2WWHA 1CE8A 1ZR2A 2FFBA 3V1MA 3D8UA 1WEHA 3IJRA 3FSJX 5ALHA 2OXFA 5BV0A 3EXHB 4MVJF 2OBYA 1MNAA 2J46A 2RHOA 3B1ZA 2H4YA 3JS5A 2V7TA 3OQJA 4G0MA 5M34A 3MINA 1AUQA 1DLJA 4NBVA 1JKXA 5CFMA 2I9PA 3ZDDA 2PRSA 2X2EA 1E1QD 4RWZA 4LOHA 2AW5A 2Q8QA 1P5JA 2OQRA 3E3NA 3UMCA 1PW5A 1KH3A 5COBA 1N6IA 1Z8HA 4J1SA 4QWWA 1FFEA 5LWHA 4AN1A 5BNWA 5T6BA 1MQ9A 2RC6A 1RCFA 3OT1B 3ESZA 1FDTA 3UK7A 1SCAA 5F78A 1UBLS 3GF4A 1VKHA 1I6LA 3LUPA 3WYAA 4EEKA 4YRAA 5JC8A 1NP3A 2HU2A 4N7BA 3TVYA 1RKQA 1E1CA 2BCJQ 3CVJA 5G1OA 4AVYA 3V4SA 1A69A 4WY5A 4ITUA 1I5OA 4E09A 2CGEA 3AWIA 1KWKA 4EGFA 4OP3A 4LFAB 3QU2A 2JDID 5FWNA 1SVMA 3BF8A 3ZCSA 1JDPA 4CVNA 5AVSA 2FEWB 1WXHA 3ZY4A 5CDGA 1U9JA 1NMXA 4AMBA 2Q1TA 3UATA 2FR8A 2JLRA 1VLQA 2OZLA 1QP4A 2OP1A 2JKVA 3DDCA 3IP5A 4I4TA 3ZOZA 1FVOA 2AOWA 3LYHA 3H1BA 3D1JA 3PDUA 4GSLA 5A0FA 3UTCA 3GARA 2OXIA 4R2JA 4HKTA 4J6EA 1N75A 4P4NA 1XZQA 4JKOA 3I5AA 3CIOA 1H3NA 4QBHA 2PTGA 4LYYA 4BPBA 5CGQB 1HE5A 3ZDZB 3IVRA 5JAHA 3AVTA 3OCVA 2ONKA 2C88A 5A4FS 5LXTB 2BGIA 1QGUB 3P20A 3HB1A 1E89A 2BC9A 2WI8A 2CLLB 4MVJE 4NJEB 4KV7A 3FN4A 1AKRA 1WR8A 2DUJA 4G5RA 1P45A 1QQ5A 2WWTA 1TEXA 5DX0A 1Z34A 4YAKA 1S4QA 1W2HA 2OG2A 1SHUX 1DJLA 1Z7BA 3UMRA 3V32A 1C0LA 1X1AA 4KGVA 4BFLA 4BC0A 1GNQA 3MW8A 5AT1A 4IF6A 4PLVA 3UWOA 3S4YA 5SZJA 1E2KA 1IN4A 3VYVA 4PN7A 1XDUA 3AH8A 3W1WA 4DBZA 3Q8LA 1T5BA 2W2LA 3B20A 3WDMA 2F8MA 3IUNA 4L95C 3BRQA 2AGVA 4OXQA 5AM4A 5DZSA 1RWPA 1YOBA 1X70A 3ANMA 1I1QB 3H16A 1K5DA 3N7UA 1JKIA 4XWKA 2RKBA 3WAGA 4RXUA 2ZULA 4J7UA 1SHZA 1IM2A 1D03A 1ZA1A 3TSWA 4UARA 3DZHA 2NSHA 3KEQA 4TMTA 3S29A 3T99A 1WDWB 4RCZA 2HNAA 4FVTA 2XUKA 4OLFA 4MR9B 1W46A 2ZVPX 3OZRA 1PT7A 2OO3A 4ZV7A 3R7WB 4X7MA 1BHO1 1S6YA 5F1KA 4ALKA 4CM4B 4AKTA 3SE0A 1P5FA 2BT4A 1VBNA 1U99A 1PBNA 1P44A 2FFQA 4JP8A 1Y6GA 1L0BA 1OZFA 1R88A 4HYEA 1G7RA 4FOLA 3ZVNA 1Z73A 4MUHA 2WSLA 4Y98A 4QZVA 3JPWA 5FFFA 4CEIA 4KZPA 5C8VA 2ZWOA 4K9NA 3FB4A 4HNAA 4F9TA 2J6CA 2XT9A 3ADCA 3A06A 3C1UA 5DLEA 2WE8A 3ZQ4A 1QC5A 4YUZA 2XF8A 4ESOA 4W1SA 4ENVA 4LX8A 1CUDA 2BSQA 2GMWA 1H5QA 2WUVA 2YNMC 2ZTSA 5I6DA 1EQ2A 2E37A 1Z5NA 2GWHA 3BMXA 3D0KA 4UTZA 1YI0A 3GFOA 4A4DA 4F2DA 3PUWA 4MPPA 2AOTB 1KVTA 3THWA 1OI3A 1U7WA 2FWNA 3V7FA 4F9EA 3ETEA 4QSHA 2OC9A 1W35A 3IX7A 1H85A 1M66A 2I80A 4UVEA 3PGA1 2XODA 3AI2A 4LSWA 2OBMA 2UZAA 4HEJA 4OXNA 2XWPA 1JG2A 2QD1A 4OYRA 2F4VB 5JG7A 4BBZA 2IHTA 4Z8YA 2Y1LA 5EE1A 5AVRA 3DV2A 4HYTA 5EOVA 1U7OA 2ZRGA 3ZE8A 2CC2A 1XVIA 1GQQA 2W8BA 3DHVA 2NPFA 5EJ7A 4WKGA 2ZE8A 1URPA 1FNCA 4UC0A 2GRUA 1THMA 1M8FA 1IQRA 1CIVA 1IC6A 2LIPA 3IQEA 3LDGA 4BNIA 5FLKA 1M76A 4I6JA 4D92A 1L8LA 1H8HA 3HY3A 4JV5B 3LECA 3JWHA 1JJBA 1VSBA 2POCA 4MV6A 5KQSA 1H5NA 4BB5A 3WJ7A 1ATZA 1QIGA 5BVHB 2ORVA 2BHSA 3OLYA 2AHRA 1JPVA 1M6YA 1D4AA 2EFHB 1FDIA 1U8UA 2GN4A 3SSNA 1E6KA 3ZLBA 3FZQA 4J8PA 2R1TA 2J0VA 3C45A 3ENKA 5CFPA 1SUFA 1EFVB 3VDQA 4MEBA 5LMCA 5C9ZA 4TQAA 3BJEA 4G41A 5EHQA 3RTDA 4Q3DA 7ABPA 4PTZA 3RLIA 4FKBA 4KSCA 4YRPA 3VVCA 4AJ4A 3E22B 5EXXA 4MVJP 1KEPA 4INJA 5KU7A 2KWIA 3K73O 4F3TA 2FUKA 1CR1A 3H5LA 2GHQA 2J6BA 1N4AA 1ZIXA 2QZZA 2EWVA 3NG1A 3DTNA 3TGPA 1XZLA 1U0HC 1UBFA 3ORQA 4LJKA 2BJWA 2WB4A 3Q3VA 2H2GA 4BVHA 5KYKA 4GM4A 2X5OA 3FRIA 3NKLA 3HWX1 5A5DA 1GTVA 3NEAA 4X3OA 1W5AA 2VC2B 4KIFA 1XK7A 5JYDA 3R3WA 3BK1A 4W1RA 1HDXA 5U4XA 5CDYA 4NATA 1O8CA 1JEQB 4CGYA 3K16A 4E2FA 1OAOC 3F2VA 4JIMA 1NVTA 2DSNA 4F1KA 4EPXA 2QENA 5IYZB 1QHGA 3O31A 4FS3A 5LZ2A 4ZHQF 5LQKA 1FFXA 1N2XA 1NOKA 2IU3A 4FP9A 4JYCA 1YD7A 4K26A 3I2GA 4BFUA 5CURA 1UOOA 1VMAA 5T4HA 1OX4B 2E4AA 2Y99A 3QPCA 1GYQA 4EY5A 2P7HA 3GFSA 2JHPA 1ADCA 4HX9A 2IOFA 1Z7GA 2VRBA 1HDOA 4M99A 1HE4A 4G8DA 1QIEA 5IDYA 5LQMA 4FDAA 1IOVA 3DJYA 4LXGA 5ESXA 1WSBA 5EA2A 3FYCA 2IT1A 4OQ4A 5DX1A 2JLBA 3UT0A 4QDXA 5FA6A 1Z35A 4RORA 3NBFA 4YV1A 1NMQA 5AFSA 2CHGA 1KEVA 2C2OA 3FZNA 4LVCA 4BY9E 2PXHA 5C1DA 2OOKA 3QA9A 2DT8A 5EXEA 4MHOA 4EEZA 7REQA 3QLVA 1S2GA 3HV0A 3ZE0B 2CT8A 4HNRA 4RS3A 4E4RA 5C5EA 1L4MA 3ZVMA 3EIHA 1IXYA 2FPMA 1VIYA 1B3RA 2P2YA 3AJ8A 3MCAA 4PX2A 4MVJD 1Z47A 1Z8DA 5FPSA 4D42A 5DEOA 5NLLA 2JAUA 3BSWA 3I3OA 5HF9A 3M2TA 5LQSA 1TUBA 3K94A 2ZATA 5ARDA 3PUYA 1DAOA 4AYTA 3T0IA 1KMMA 2C5GA 4YGYA 4BATA 5IK2D 3BXHA 3K4QA 1S2NA 4HHEA 5C0OE 2YJ5A 5LB4A 1N1GA 1T9ZA 1TIBA 2Z2XA 3K9NA 1T8UA 1HI9A 1U9IC 4FFLA 1G5FA 4Q4AA 3AC0A 4S2EA 3K1YA 1Q0LA 1VTKA 4D0LB 5JQGA 5IM4F 2ZROA 1Z16A 3MWGA 4C9BA 5HM8A 1Y9JA 1Q7RA 2QRPA 4J0HA 4HWRA 4Q00A 5GP1A 2Y0BA 3VZDA 1Z4MA 4IDBA 1KFCB 2D6FA 4K1XA 1XBTA 4IZOA 4FHGA 2QN2A 2R44A 5IUNC 1F12A 3CPHA 3VR3D 2CFTA 1FDOA 1PR0A 5FV7A 3BPSA 1VLLA 1K6XA 5F4ZA 4PINA 5IFLA 1LK5A 3AU8A 4LMPA 4Z9XA 1Y8RA 3RYTC 4DIKA 2OLEA 3BIXA 3FPEA 2B0JA 3CT4A 1ADJA 1Y1LA 1JQEA 2BHTA 1QZUA 1GFSA 1B93A 1RMYA 1CY4A 1VGRA 1XL0A 4FD2A 2G6BA 4WN3A 2PV7A 2VYVA 4TKUA 1MX5A 1XHFA 1RD4A 1WSAA 1PL6A 2R6ZA 2WDPA 3FB1A 3MMZA 3OM9A 4MKGA 4AT1A 5ALRA 1X42A 3ICOA 4H18A 4HAUA 3RVOA 2Z09A 4KYTA 1HR0B 3DUWA 2WFAA 4HDRA 2Q1UA 2QUJA 1PJTA 3IEUA 4BFWA 3QFFA 3R5FA 2E4ZA 1I33A 1TC2A 3IIEA 2YWRA 2ATCA 3NT4A 3LKDA 2NGRA 3P0HA 2VWGA 3HR4A 3ZLTA 1G5RA 3C3PA 1M2OB 4BGIA 2RHHA 5G4KB 2PPLA 4DKJA 1V48A 3CVXA 4KLNA 1A9YA 1G3UA 2BR4A 1DWUA 4W1QA 5TT1A 3WE7A 2X8JB 2IYEA 2RHMA 3FETA 3AVUA 1XZHA 4BHTA 3BERA 3JCZA 4TN1A 5LQUA 5JZBA 1J2UA 2AG1A 4PQEA 1YFLA 1V39A 4C7KA 1EFPA 3U19A 3KKOA 3L41A 3RSQA 1HTWA 4YAIA 3G8DA 3KO8A 3W7AA 2ATVA 3CEJA 3DWEX 1SXQA 2AS0A 1SKQA 1G3RA 2Z2KA 4XR4A 3PQ3A 4MA5A 1A5AB 1MG5A 4A8HA 3QF7A 2BDTA 3ZHYA 2G5TA 1SC4A 3SFZA 5E1MA 4NP6A 3LT1A 1IBSA 1ZNZA 2GPTA 1IPEA 2ECFA 5HFJA 2POQX 1L7BA 3HXPA 1EK6A 1G3IA 1FXWA 1KBQA 1G9SA 4AMGA 2PAAA 3GAMA 3UICA 4CV2A 2ZE7A 4ES6A 1N6NA 1ZWKA 1O6FA 2DSTA 2AQ8A 4X9XA 5SY6A 4B7UA 2GZDA 2YZ2A 1RAEA 3AIIA 3G6WA 4AI6A 1QIHA 3IPAA 3M6VA 1USWA 2QVBA 5CYFA 5JALA 5P8WA 4BUZA 1WULS 2LP4Y 4UAUA 3BWBA 1RJWA 3LBHA 3NTQA 3CW2A 2X7HA 2P5TB 2QV0A 4GO1A 1DBSA 5A1JA 1S2MA 3AFGA 4TZ0A 1HDEA 3FTQA 3STTA 1YH3A 4A73A 2R47A 2I3GA 1TTQB 3LUAA 5EIBC 2XBLA 3LIIA 4Q9NA 5AW5A 1X14A 3K31A 4DN6A 1GCIA 2HA7A 4WY8A 5THKA 3GMTA 3UB2A 1PZMA 4DQUA 4B85A 3MMSA 2BCEA 1CQJB 3Q98A 7GPBA 1N2GA 4NQZA 1DQPA 3NBKA 3PHBE 4UNNA 5FBVB 3ZTWA 4D45A 1DCFA 1H3FA 2PO5A 1N5RA 3INNA 3JATA 4PZ0A 3A05A 1I7PA 2AFHA 1D2CA 4NJMA 4YUYA 2WHXA 1WSWA 2JFQA 4BECA 2GRAA 3F6PA 1KE2A 2P5UA 1MT3A 3R0XA 2G36A 1AF4A 2XZDA 3U7QB 2ZU6A 2J8ZA 1TL7C 3KZMA 4KNVA 3L4KA 4E1BA 4EAQA 5F2KA 1DARA 1E20A 1KAOA 2VA8A 4IJ5A 4CUKA 1TJ5A 3R8FA 3TAUA 3WGOA 4FJ1A 2YYZA 3ABOB 4M98A 2DG2A 3QE0A 4UEWA 1YZKA 2JHAA 2VEDA 4TWIA 4ZC8A 1XEWX 1ZM9A 2FZCA 5ICSA 5FNVF 1XKLA 3RNOA 1G20E 4OB6A 2UZ1A 1O77A 1U9IA 3LXUX 3HN2A 1VRWA 4KQ9A 3TLXA 3C8ZA 3UB3A 2CVPA 1ADFA 5GVSA 3CVOA 1EKXA 3LM8A 3RU2A 4K9SA 3CXRA 4IW3B 4WX2B 5F7ZA 2BKVA 1J07A 1IDN1 4JVLA 5DV9A 2A67A 2NVUB 1W1IA 4X60A 2GHTA 3N75A 2PZAA 2X4LA 1YFJA 1XALA 1DBPA 4CKCB 2I8CA 2IEDA 2C2XA 3I64A 3T3PB 4FGJA 3AUKA 3WLEA 5DBFA 5BSFA 4DSAA 1TCVA 2QYOA 1ABEA 3RGGA 3DBLA 5AIAA 5J58A 3E27A 4B32A 2XSZD 5DT2A 2AOUB 4H4DA 3ZH9B 4KLRA 2JJ2A 5D87A 3ET5A 1OPXA 3Q7EA 5FORA 3VYRB 4QLOA 4B6EA 2VPIA 2IS6A 2H0QA 4WMLA 4INOA 3RVDA 3E4CA 4KXVA 2VQ6A 3BWDD 2GXQA 3PXGA 1QTNA 2YH2A 2QP4A 1IVSA 1Y6QA 4U9HS 4A7PA 1NZFA 2ENWA 5KIAA 3HS3A 3OSUA 2P0YA 4RC9A 4XX0B 1WLYA 4WZZA 3MXOA 4GOND 3L0IB 2EKDA 3GD7A 1YVRA 4A15A 5C3MA 1E3EA 3NRCA 3B12A 4NBSA 5TF0A 4DYHA 3IOCA 5HRCA 1O95C 4I08A 4I3FA 1LKZA 4IYRA 5ITWA 3CEHA 1KSHA 3GOHA 4Q1BA 4XFJA 5BSTA 4HQLA 4JGGA 2W90A 4K0RA 3WJ2A 4B7ZA 4Q24A 1ZD4A 3L4SO 2VPWA 2ZUSA 3JQGB 5CT8A 1LC3A 1RWVA 4JB2A 2WD7A 4C20A 5K2OA 2EIHA 4HFJA 3O8QA 1DI0A 4BNYA 1UR5A 4D97A 4EJSC 2PUTA 3V1UA 3JYOA 2FMKA 3HGQA 4MGYR 3TXAA 5H4GA 3DHWC 4JLSA 3Q1KA 2QR5A 4ZO7A 3I1JA 1ISPA 1VLHA 5JEEA 4YWHA 4RSGA 4U8GA 3UG6A 5AVQA 5JY1A 3NQ41 4FFPA 4PCUA 4TMFA 3ZU6A 721PA 1N0WA 5HCUA 1LBEA 4ZMRA 5EJAA 1HLGA 3JVDA 3S44A 4CLRA 3D6MA 3A2LA 1W19A 3WLLA 3QUAA 1Z83A 3GRAA 5T4BA 5D00A 2J3DA 4GYWA 4X65B 4QQFA 3K6SA 4YROA 5FAXA 3KR1A 2JZOA 3IUPA 1L4KA 3HZRA 4BTLA 3KT6A 1RLMA 1RXVA 3FCCA 2HF9A 1O1YA 3C85A 1Y1TA 3NCHA 1CF9A 1D1TA 5IS2A 2EP8A 1Q7BA 2AFHE 2HB6A 2GVDC 5FYQA 1JQLB 4FBMA 3OM8A 2A3NA 1NQXA 3WDSA 2GPBA 3ZCXA 4JOSA 4AP9A 1CEXA 2OYSA 4ZPXA 2W70A 5LZ5A 4L72A 4OQLA 1X1EA 4L08A 1Z39A 3FRJA 3PQFA 2PA3A 1P0QA 4O08A 4PYLA 2DKFA 2XT6A 1KQNA 1ZXBA 4JROA 4DR6B 1MGPA 2FSGA 4E11A 4WN9B 4DLLA 3JZFA 4DWWA 2P3OA 5FOVA 3OESA 2IIBA 1JIUA 1X7WA 2J3KA 1T2NA 4C06A 1QZTA 1NLFA 3HVHA 1CJMA 1IE3A 3NI2A 4M0PA 3KVYA 4IIVA 1HG1A 2Z04A 3QRWA 5F77A 2WYVA 3QHQA 1QHSA 2OKGA 4D26A 1RRVA 4HAVA 5JXGA 3O4VA 3KC2A 1EE2A 2RI1A 3VDNB 2NU7A 1WY7A 1P81A 4P3YA 3G59A 1KMHA 1VSVA 3GO4A 3OM0A 3A6FA 3CLKA 4QGFA 3NW9A 3IDAA 2ECOA 2WAMA 3G89A 1JDZA 3MMXA 4HGYA 1NULA 3GCXA 4EB6B 5MN5A 3OTOB 3R44A 2YY5A 4N65A 4OA8A 1M6NA 3G1UA 3THYB 2WAXA 3OQHA 5L40A 1UUFA 2WIKA 1QMPA 2NO9A 4J03A 4NX2A 1Z2NX 4PCVA 3HSYA 3D31A 4MULA 3FTFA 2PUWA 5LDDC 2JGJA 1IIBA 1Z6YA 1UPXA 4PHCA 4TMWA 1F7UA 4E6EA 1E7MA 1HUQA 2V4ZA 4M0DA 2QLLA 3K9HA 4D3ZA 1SIBE 2GZ2A 2NQ8A 3H1EA 3LX6A 2OYCA 2W6ID 2VBCA 1QRTA 3VU1A 1IH8A 1GA6A 5HHTA 5AW1A 5ECWA 1FP6A 3L04A 2C78A 5T3UA 2VXOA 3DZCA 3RFXA 3QW2A 5ELXA 1KI6A 1IHPA 3EXG1 1KZYC 3FUWA 3R0VA 1UJCA 3PDHA 1WHTA 4L4ZA 3EGDB 3GAZA 4HAYA 3S2EA 2OMEA 5T4FA 3L0BA 2DBQA 1GAQA 1MC4A 5FBQB 4ZI5A 2PUCA 1ESDA 1WX1A 3R9XB 1DVRA 3GFGA 3IAEA 4QUHA 2LDBA 2FU5C 2EBUA 3SYTA 4KMOA 2WNHA 1QNLA 3QYFA 3AXTA 3Q3CA 1CZNA 4IJWA 1U6JA 5CUQA 1TZBA 2FH5B 2H4XA 4DEXA 4Q7QA 3PYLA 4BJ1A 2BONA 1HYGA 5KWSA 4YJ3F 1A95A 1B6RA 1DZIA 4UHKA 1PTKA 1N8SA 1LVGA 2Q2NA 4MJ3A 2JBAB 3GOQA 3GYGA 4GM0A 5AHWA 3VU3A 1XAIA 5DOZA 3UKDA 3KZKA 5CM8B 3ZHZA 1D2MA 1QHHA 2JLWA 1PL0A 1Q16A 3I83A 5TPWB 1T91A 4KAFA 2QN6A 5EINA 1IOWA 5HZGA 3KJFA 2OZVA 1Y81A 2H8GA 4XB1A 3WK6A 4YCCA 3O8RA 3W7VA 3H2JA 2X0IA 3BIFA 3ND6A 4II3A 2JW5A 4YYZA 4B44A 2A5FA 3SHQA 3P2IA 4JKIA 3VSEA 4BLPA 4FZRA 1XIVA 1O95A 3EVZA 2V59A 4IX9A 3PJDA 4QAQA 2AJLI 5JSHA 1JXAA 1YU9A 4UVGA 5A5FA 1NKVA 3SHWA 1Y7TA 3PHHA 4RMHA 4Q9HA 4JD5A 1WOYA 2DZDA 4PRZA 5FWYB 2D5CA 1IZ8A 1LCIA 1NBWB 3BXGA 5ALKA 4HQFA 4BNHA 3VHLB 4BMOB 5EQTA 1DUSA 4ZI7B 1I2ZA 3W7BA 3I92A 1W85B 4LHWA 2DFLA 3SJCA 2ICAA 4CDRA 1HDGO 2AKAB 1FTQA 2XCOA 4EJSA 3ABSB 1LA2A 2X4DA 2C0CA 2G83A 1IBRA 2Q21A 4AXBA 4L5BA 4BAZA 5DYTA 3CH5A 2O50A 2E49A 4E94A 4TL8A 1U0NA 2PSFA 3DFZA 4G56A 3ZQUA 3GNQA 4CN9A 1J42A 1FYVA 2JRCA 2QP9X 3I5UA 4QE3A 1SXJC 2DFVA 1NN3A 3C6BA 1JXOA 3BH7A 4WLUA 2E89A 4KH1A 3R3SA 3HPRA 2JIQA 3K2QA 4KN6A 3ESXA 4D3SA 1RXWA 1XV5A 4J4HA 1DIAA 2OCIA 4X7RA 4O2BA 5KTYA 2VRNA 5EE5B 4JLWA 1XVAA 5JANA 1WZIA 2GBCA 4URFA 2HDWA 3KHTA 5JAPA 3OU7A 3GRCA 5GGYA 4JY7A 4X5OA 1CY8A 2ZT5A 3LA6A 1ZCAA 3TSZA 3WWPA 4IGIA 4MCAA 1NVKA 3N2ZB 4UUAA 3ST7A 1XEXB 3OTWA 3LHIA 3DMGA 2QYSA 3N6VA 3OY7A 4EHKA 1NX9A 1XNGA 3EEFA 4QOHA 4QKQA 2YASA 2J4FA 2ZI4A 3R3YA 4L8VA 4ZI2A 2H4WA 3H3FA 1TA4A 1YRYE 4P7GA 1FS6A 3I0ZA 3L0CA 4ZHQB 4BB9A 4CMHA 3QUSA 3LI2A 1MFZA 4QGGA 2O23A 1KO8A 4NNPA 4TXHA 4ASUD 1ZNYA 1BKDR 3HCEA 4LXUA 3EQ8A 4AFNA 2QW1A 1E2EA 2VAWA 2NQTA 3T7SA 4F06A 1QYWA 3UCEA 3MWDA 1SFRA 3C6YA 4Z3OA 5EIFA 5JHHB 1J0DA 3UV7A 2IRWA 4ETMA 2EG9A 1Z82A 4DLZA 3B82A 1HORA 3GHHA 4D3XA 5E1OA 2D2FA 2PD4A 2FKAA 1RACA 3KBOA 1N0VC 5G3YA 4LJAA 4UHBA 5GADl 2QR3A 2EC5A 3EIUA 1MV8A 2QX9A 3VPDA 3HVKA 2YZ7A 1C81A 3B53X 1BRTA 4E6PA 2GERA 1GARA 1TLLA 4AZ0B 5D5PA 4ZZ0A 2V1XA 7MDHA 4NCXA 2LNDA 1VFNA 5J1TB 4K6CA 1UZMA 5JZSA 2PVCA 4JQYA 4FX2A 3JZMA 4IIBA 4P84A 3V3TA 3TRHA 4C0HA 2VDWA 4PANA 2FJUA 3TLMA 3DF7A 4PX5A 3JZIA 3TYXA 4CGZA 2B36A 3TLZA 1NVVQ 2P68A 3MTBA 3AL0C 3TO5A 4MTLA 2HWWA 2ZRCA 2C92A 1VJGA 2ZSDA 1ZEMA 4RPKA 5AM2A 1IN1A 5DM0A 4Q1CA 4RF5A 1CUJA 4G0VA 5J59A 5KYWB 2Y0DA 4L15A 2WJWA 2B37A 2I4LA 3K8ZA 4CKWA 5FWYA 1B2LA 2EJUA 5D6OA 4UXHA 2B8JA 1UT5A 2RCNA 3AERB 3NHKA 1NXPA 3NEYA 2JVKA 3SHFA 1QH1B 3WBKA 3MRVA 3PUIA 4RKYA 3WNZA 2CYAA 4J1NA 1N5LA 4Z7JA 2JJ2D 3B1YA 3OMLA 3V8VA 3VJRA 2QIOA 5G4LA 1KK0A 1YZNA 4Z1MA 4BNVA 3ZW9A 2XRYA 1FVHA 4U2BA 2AWOA 3TTVA 3DFMA 1Q0ZA 3WGJA 3JSXA 5CK5A 4EKGA 3Q0EA 1B4DA 4ZV4A 2ZTHA 3GJZA 2FP3A 5AJXA 1SVIA 4KE6A 3F1KA 3WWDA 1IG0A 1NVBA 2GF0A 3ROMA 1KSJA 2DWPA 1VJCA 4KDRA 2Y1XA 4MO2A 1TAUA 1U9ZA 1SURA 3RUEA 3G88A 4M9QA 3RTCA 1ZICA 1JHOA 2M6KA 3QMMA 1S5PA 5IARA 4BO9A 1T6XA 3DM5A 1FVXA 3G0DA 2HX1A 5KC8A 1P6QA 3DOIA 5JYCA 4X1YA 5FFNA 4K6GA 4DT1A 4DV6B 2JGEA 2DJIA 4ARZB 1CFJA 1MA3A 3I4CA 4P98A 4EUKA 4GI1A 4GMXA 4YY3B 1IXRC 4KPGA 5DHQA 4ZD6A 4YV7A 4RPHA 4PIMA 3T1YB 2ZIUB 4LF4B 3SZLA 3H4TA 1FC0A 2GBGA 1Y1RA 3P52A 3VU9A 4TYYA 3PYMA 1OFUX 4P2BA 4Q3NA 3K15A 4KWIA 4U6NA 3SR0A 4WACA 3U44B 1NE7A 5BSGA 2FW8A 3NUGA 3H8SA 3HKBB 1UOEA 4EYGA 2WA1A 4FINA 1B8UA 3HP4A 1CQZA 3COSA 1ZFNA 3WTCA 3LQQA 3GWZA 2ZKLA 1T1EA 3H84A 3HYTA 5KTRA 1NU6A 1SBYA 4FZJA 2R4QA 2Q07A 4RANA 4HDQB 2JB9A 3K6KA 1SXPA 1PFVA 2AFRA 2QGFA 4MXDA 4U0JA 3TQCA 4UE3S 1U90A 4CG2A 2WQ6A 4H6XA 1SXJA 1P0PA 2G80A 3D54D 3OP4A 4MV5A 3VAYA 4CM7A 5K3DA 3WI7A 5J2TA 4D6YA 2GI4A 1E5XA 4LK2A 4ZVKA 4RTNA 4Z4FA 2QLFA 3KVOA 1Q83A 2FUEA 1TW2A 3JR7A 3ML1A 3UBMA 4EM6A 4MIOA 2DR2A 3NHAA 1XTRA 4BNJA 4EZBA 3BM5A 1E2IA 4LJ7A 7MHTA 1MO6A 2OECA 4PQGA 2AN1A 3ESRA 4HC4A 4AN0A 4F56A 1UBNA 1E5DA 1TM2A 2QAJA 1UMBA 2Q9CA 4LAFA 3GP5A 1SUAA 2COKA 2O8EB 5C4GB 1WXDA 3EAGA 3N3AC 5TNXA 3I04A 1AMUA 4RTKA 1G20B 2LVBA 1HFKA 2BEWA 4U2EA 2V7UA 2LCIA 3VC2A 4JYZA 4LX0A 4BB6A 2D1YA 3O83A 3T7RA 4MV1A 1L7XA 5AUPB 2ZWAA 2DF8A 2P0AA 1Q74A 3VR6D 3RRYA 2JASA 4MROA 1AM4D 5TC4A 5IRCD 2NXEA 4LHSA 2G82A 2X15A 1YACA 2OA0A 1FMJA 1XZFA 2A8YA 5FDFA 4DLTA 3IXQA 9ATCA 4FZ3A 3CVWA 2VZ9A 1FSSA 4URUR 3X3HA 4CMEA 3V8NA 3U31A 1TIPA 3PLAE 4YMTA 1V6SA 1NATA 4HG2A 1ZU4A 4DG5A 2VK8A 2HQBA 2PYDA 3UUEA 2Z08A 3O8BA 4L8LA 4DWOA 3WLTA 2YVAA 1CC1S 3GLTA 3PIDA 1RRCA 5IVHA 2V9PA 2OLJA 3Q41A 1D2HA 4P35A 2ZSKA 3ZEAA 4JOQA 3G9XA 4C4PA 4H31A 4XJSA 8ADHA 3CPSA 3WJAA 2EBWA 3SXUB 3TM5A 1HDRA 2ZKIA 1L5WA 4KO4S 3FAKA 3UJHA 3KOZA 1KEWA 1PV4A 4XGQA 5EE3A 3I53A 1ESNA 1JFFB 4QJ5A 4DDMA 4O1IA 2RIPA 4COKA 3MWEB 3W5JA 3ZJUA 3L01A 4PR3A 2GJSA 2DWQA 3CG0A 4PW0A 1Q14A 4C88A 1JB9A 3U37A 5CITA 4PZEA 4V2IA 3QVTA 4PTLA 5FNVB 5HGXA 1BOFA 2CUNA 2AD1A 2DBVO 2ZT6A 1PP4A 2OD7A 2QMEA 2W83A 2YN0A 2VJQA 5L7YA 4X24A 3N86A 3OTQA 1MB0A 3S2GA 4CV3A 2NTJA 3JQAD 2WT8A 3COWA 2W6QA 1ZN2A 2OTCA 3H2GA 5B55A 2OXCA 4YQYA 3U1TA 4B71A 4B3IA 3WVNA 1OBCA 1OTXA 4O4JA 2CNLA 3K2BA 3NWJA 1SAYA 3G23A 2K7FA 2V4MA 2IGTA 2M6RA 3Q3IA 3T5MA 3PVZA 4H7DA 1WMAA 2JNWA 5CA1B 3ZE2B 1LS1A 2QN8A 2H3HA 5BT9A 2FPIA 1GQFA 1SIOA 4M0UA 3ANXA 3IPCA 4BCBA 1CJVC 1ZWLA 2D0PB 4KODA 5ALQA 5HEKA 1Y8AA 2ZYWX 3H4MA 1P72A 2X1VA 3SM3A 3ZWCA 3SYKA 3RPEA 3TTSA 5DNAA 5JI2E 1XAJA 2C4KA 4FT2A 1YR2A 3KYDA 2DH6A 1YJCA 2EEPA 1LRLA 2GPSA 2VHTA 1SRQA 4MIEA 3TPCA 1UFVA 2VJOA 4IUDS 2BBWA 4P3OA 5AJYA 2QY6A 1M2FA 3UUWA 2MSEB 2XB9A 1KI4A 4G4SO 3VU8A 2RGNA 2GOYA 2ZJ2A 2FXIA 1ILWA 1NY5A 3GK3A 1K3FA 3A26A 3AK4A 3HVIA 2H1RA 3PF8A 4LQ4A 4ZRMA 3GZTB 1KGDA 4YCBA 3IDFA 3Q10A 4O3FA 1IUOA 3UMFA 2YZMA 3W3AD 5I9TA 1TMOA 3KVVA 3KZVA 1ORVA 4G5SA 4I9HA 3H86A 1G3MA 2HK8A 1PW7A 2ZR0A 2XTAA 4UD6A 3RJMA 5EJ2A 1G5IA 2Y2UA 3RU3A 4O4JF 4TTAA 3I8OA 3UK0A 4L9WA 4EG8A 5KREA 1DDIA 3QYJA 3ZKAA 2PLWA 1FS4A 3F9CA 3GXOA 4Y0NA 1JBEA 4CJXA 1VL0A 3C3CA 1NWHA 1U4SA 1M6WA 1S2DA 4WCFA 5F9FA 4DVGA 1NHGA 1W8IA 4EI7A 3ZG6A 4QXPA 5SYAA 1E8NA 4N41A 1CUGA 1N1MA 2VSNA 2DFKB 2B4KA 5DP1A 4WZBE 4Y6GB 4XJTA 4HVLA 4XDHA 4BRSA 1U3TA 2WQ7A 1DJPA 2XGSA 2B8EA 3QKSA 1P1RA 1Q1EA 3OD5A 1UJ2A 4RD4A 3U2QA 3GEPA 4A5SA 4R5MA 3BQNB 5TQ0B 1QF9A 4N3AA 3OE7A 1HPLA 4N5NA 2WVHA 3KCNA 3C3MA 2ZUWA 5K4AA 4YAEA 4E5MA 4NMXB 1IXZA 3KTAA 2YINC 3QSGA 4AJ9A 2NO6A 2RAUA 3P5BA 4BTEA 4PLFA 4YT8A 1CUVA 2C1XA 3DV9A 1XDBA 3MRSA 5K7SA 5FT9A 3AY3A 5EHXA 2XYVA 4A27A 1V3UA 1A9ZA 5BXQC 1U0RA 2R6DA 3AKCA 2WSMA 4FGKA 2M1ZA 5TMDA 3URMA 3CY6A 3FPCA 3FCYA 4HD8A 4WFKA 3OWOA 3WLQA 1LBTA 3C98A 3HCWA 1ZIYA 3I1FA 1JU3A 2BMDA 3MELA 1YMVA 4N0DA 5E9AA 4KACA 3RAGA 2HIAA 1JN0A 4HI0E 2C9OA 3E7FA 4H7PA 1YXMA 1AZTA 1S8AA 3MOIA 4BMXA 2D1RA 5HM6A 5L3VA 1UJNA 3NONA 5K8IA 1NFQA 2Z6VA 2NTEA 1OWPA 4JI5B 2VAXA 2C5FA 1OA0A 3NWBA 2XWQA 3TLJA 1IEQA 3EGWA 3O7MA 5ILGA 1WZ2A 1U5CA 3LT2A 4DIBA 1ZM2A 1E8MA 1LTHR 3O03A 3SMVA 2YMLA 5A3QA 1D4OA 5HIMA 3R3JA 4I9NA 3VR5D 3BCRA 4B4OA 3E1SA 3CNNA 1DX9A 4FFVA 3C74A 1KAMA 1M0WA 1XVLA 2J1LA 2VP9A 4CT0A 3OPYA 1A96A 1NF8A 4EX6A 2O54A 2FX5A 1L5FA 3ROEA 3NTLA 2FCAA 2ONJA 2QN7A 3DBHB 1Y5IA 1NRJB 3HUUA 4IWNA 1SXIA 4PLGA 4QFBA 5EKSA 2JH3A 5BN1A 4QUDA 3AUFA 1JILA 2VTDA 4ZEOA 1VBFA 4F38A 2W5UA 5HMMA 2CJPA 4IEIA 2JCSA 5G53C 3BE8A 3LA8A 4IICA 3TSCA 3AJAA 3IR7A 4QG7A 1KF0A 1NSTA 3SFVA 4ZRNA 2HJSA 3FMIA 3UF0A 4D4HA 3GLUA 2I2CA 4MQ5A 1J5EB 4Y6OA 5FTJA 1F38A 3AJRA 5F7XA 1YDFA 3SE7A 1IHXA 4KH0A 1E3WA 2ZJ7A 5IT9A 1ZZGA 4IIGA 2BFAA 5KOIA 4IGAA 4RSRA 4BE9A 2N46A 4YBZA 4PSAA 4LQCA 3WK9A 3KQYA 3NRBA 1LPNA 2IA5A 1GZDA 3DWGA 2QW0X 4E0BA 3CEPB 4TRJA 4KWHA 2FX3A 4YJ3B 3RVQA 2HEGA 1Y6ZA 2WJJA 1KDRA 3QFCA 3NR2A 4FMPA 3G0IA 3ROKA 1YULA 1K2VN 2VSFA 2EFJA 2Q3JA 2WMNB 1KY5A 1ZINA 1PDOA 2HN9A 1E64A 1GHTA 1W88A 3ISVA 4MQFB 5AKKA 4GVLA 1K0UA 2FQXA 4QSMA 2DHEA 4EBFA 2AXPA 4MDEA 1H0KA 4N40A 4IUBS 1DT3A 3KD3A 3MTIA 6Q21A 5AW4A 4FBLA 1QQ7A 1R6VA 3LE8A 2F3RA 3AHFA 3DVQX 4JBLA 1YB4A 4YUXA 2OFFA 2R1UA 4GLLA 1AMOA 4R51A 1K2WA 2AK2A 3VRHA 4CRWB 2IUUA 3UENA 3V4ZA 3W4JA 5A0TA 3U49A 2COUA 5AM3A 3VJMA 1NLMA 2DB3A 2G77B 2VSQA 4YONB 3R1IA 4PE5B 3CR3C 3DYBA 3ETDA 2BE7A 3H13A 2UZ3A 1XZIA 3KK0A 2HAEA 3B60A 1ISMA 2QRUA 2QRNA 3D5EA 2CF6A 3HDGA 3SXPA 1WL8A 4DLSA 4DUYB 5ADWA 4NPCA 4RPLA 4XD7D 5JT1A 3MT8A 2FQQA 3JQAB 2GCEA 3C8HA 4CMIB 1DG1G 2AQIA 1R0XA 4RQUA 1JDJA 3CPEA 2QL7A 5E3JA 5AWFC 4GKKB 2V7BA 3KBBA 4OHRA 3ZHBA 1LBHA 4IHJB 2JLZA 1XAHA 2I2DA 3AL3A 4OXIA 2GAIA 4QXRA 1WPQA 2PS1A