3DDOA

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with by phosphate ion at 1.5a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
240
Chain Sequence
b'SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQKQTSHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
publication title X-RAY Structure of the Uridine Phosphorylase from Salmonella Typhimurium in Complex with by Phosphate Ion at 1.5A Resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 85
structure length 240
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ddoA00
4D9HA 4LNAA 4L5YA 1PK7A 1RXCA 1T8SA 2HN9A 4DA8A 4WKBA 1RYZA 4L5CA 3KVYA 4TXJA 1K9SA 1PWYE 4M7WA 2A0XA 5C80A 1OU4A 2HRDA 1JYSA 5CYFA 1OTYA 4NS1A 1Y1QA 2RJ3A 4JWTA 1K3FA 3EMVA 3KUKA 4BMXA 4D98A 1ODKA 1U1GA 4TXHA 3C74A 4QEZA 1Z38A 3FAZA 2I8AA 1OVGA 1JDZA 4E1VA 2AC7A 4EARA 1LVUA 1U1FA 3F8WA 4PNPA 4WKOA 4TYMA 5B7PA 1Z5PA 5IU6A 1SJ9A 2QDKA 4QFBA 1JDTA 4D8YA 1VFNA 1PK9A 4D8VA 3IOMA 4OY3A 1Y6RA 4LZWA 1NW4A 5F7JA 2A8YA 5B7QA 1PR2A 3E9ZA 4QATA 5ETJA 3P0EA 2GUWA 4TTIA 4YMLA 4BMYA 1ZL2A 2H8GA 2A0YA 3GGSA 3KHSA 1JP7A 2QSUA 1Z39A 4KN5A 1ZOSA 4L5AA 4TXMA 1RCTE 4DARA 4RJ2A 4GLJA 4OEHA 1Z33A 3ENZA 4YO8A 1CG6A 1PW7A 4G41A 4LKRA 1T8YA 5B7NA 3FNQA 1PR0A 1PR1A 1JDSA 2AI2A 3EEIA 3LGSA 3KU4A 4TTJA 1TGVA 4F3CA 4R31A 4WKPA 4YNBA 1YQUA 2OECA 1SD2A 4IP0A 1JDUA 2AI3A 4M1EA 3BGSA 4F2PA 1U1CA 3UAYA 2HSWA 3OZBA 4NY1A 1JPVA 1ULAA 1YBFA 5JPCA 2I4TA 1U1EA 4LDNA 4JP5A 4JOSA 4F2WA 1OUMA 1V45E 4TXLA 5K1ZA 4WKNA 4PR3A 3T94A 4DA7A 1T8WA 5FAKA 1ECPA 2QTTA 1C3XA 1NC1A 3SCZA 3TL6A 4DAEA 1Y1TA 3BJEA 1FXUA 1PF7E 5F7ZA 5IFKA 5CCDA 1TCUA 4GMHA 2PGAA 3FWPA 1A9RA 3E0QA 1ULBA 1YR3A 2QPLA 1JE0A 1Z37A 3OPVA 3DJFA 4OJTA 3E9RA 5CXQA 5CXSA 4GLFA 3LBAA 1OTXA 1ODIA 4OGKA 1PR4A 3INYA 5F78A 4K6OA 3MB8A 3QPBA 5B7GA 1Z34A 1A9TA 4G89A 3GB9A 4U2KA 4YJKA 2OC4A 5EUBA 4DABA 2ISCA 1M73E 1VHJA 1A9OA 1A69A 5EPUA 2IQ5A 1JDVA 1QE5A 4G8JA 4L6IA 5F73A 5CCEA 3OCCA 2BSXA 1RT9A 1RFGE 1NC3A 1V48A 2A0WA 4QAQA 3KVRA 2ON6A 1RR6A 1RXUA 3UAXA 2AI1A 2QTGA 3OZEA 3NBQA 3PHCA 3OOHA 2P4SA 1TCVA 1U1DA 1ODLA 3P0FA 3FOWA 4WKCA 4EB8A 3KVVA 4LNHA 4I2VA 4M3NA 4QARA 1RSZA 1PR5A 5DK6A 4QASA 2B94A 3PHBE 1RXYA 3FB1A 4DA6A 1Z5OA 5I3CA 1CB0A 1YQQA 1Z36A 2Q7OE 4ECEA 1OV6A 1I80A 4R2XA 4NSNA 1B8OA 3NM5A 3UAVA 3EUEA 3NM4A 4UC0A 3BL6A 3NM6B 1LV8A 1T0UA 1TD1A 1Z5NA 1A9QA 4P54A 1RXSA 4FFSA 3D1VA 3O6VA 3OZDA 3ONVA 4TS3A 1T8RA 3PNPA 4H1TA 3LA8A 4BN0A 1K27A 5F7OA 2OC9A 1PBNA 3BSFA 1N3IA 5F77A 1WTAA 3K8OE 3OOEA 3DPSA 1VMKA 1ODJA 1B8NA 4TS9A 4TXNA 1Z35A 4BMZA 3UAZA 4OGLA 3DP9A 2XRFA 3ODGA 1Y1RA 2HWUA 3U40A 4DA0A 1A9PA 4GKAA 1TGYA 1PKEA 3EUFA 3IEXA 1V41E 3FUCA 4L0MA 4DANA 4TTAA 5EFOA 5KB3A 1SD1A 1A9SA 3OF3A 3PNSA 1PR6A 1Q1GA 4F1WA 3MMSA 1XE3A 4DAOA 1V4NA 4D8XA 4MCHA 4X24A 1VHWA 2OXFA 3UAWA 3K8QA 4OF4A 4F3KA 1V2HE 3O4VA 1JE1A 5CYGA 3DDOA 3OZCA 5F7XA 3UT6A 5F76A 4R2WA 1SQ6A 4MCIA 4MARA 1LX7A 1Y6QA 3DF9A 1Y1SA 1YRYE 1G2OA 1V3QE
chains in the Genus database with same CATH superfamily
1YVEI 1MIHA 3N8DA 4ZO6A 1UMBB 1RBQA 1QCDA 1ZUD1 3L02A 3I2HA 1WG8A 1NMZA 1WOMA 2P77A 4YDSA 1MTOA 1AKQA 5IMSA 5AW9A 4P3NA 5LJLA 4H4EA 3PQ2A 3OMWA 4CCYA 1IEQA 1KI2A 3U26A 4MWZA 3OLYA 1N2BA 5LKRA 3J80A 1EBFA 2O6HA 1E1QA 2QSYA 4D4LA 4UDOA 2AD5A 4U6NA 1J24A 3I0NA 4BQIA 5HM6A 3F46A 4FLMA 4RO0A 1N0VC 4B6EA 1VI2A 2QY6A 2VDQB 1GZSA 1QB7A 1J5XA 4L5CA 2IGBA 3K0CA 2QV0A 3J81k 1ID8A 1SUFA 5ALHA 2FZLA 4DIUA 4TZTA 2A0XA 4EHBA 3BWYA 5FORA 3EMBA 5CDFE 5K0CA 2R8PA 4QPDA 2ODWA 2ODQA 1CCWA 1G7SA 5PGMA 5LYJF 2ZSIA 3JALA 4ALNA 2A1IA 4G23A 1VM6A 4AO6A 1RHRA 2VT3A 1KEUA 4MQ5A 1CIJA 4MWSA 3RHZA 3QLVA 5IULC 3ER6A 4OYHA 5JAOA 2C84A 1MRZA 3PXDA 1T4MA 4I14A 5C1OA 5AVUA 5KJCA 2GKOA 3CCBA 1VL8A 1KJ9A 1TA0A 2Q3LA 2VWPA 4DBLC 3AF6A 3L5KA 5CYOA 1GGHA 1XTIA 1U0GA 3OZTA 3ZWOA 1UKEA 5EE9A 3X2FA 2Q2VA 4CF4A 4ED9A 4UJ5A 1QIIA 4YV1A 4E1VA 4A5SA 5CDFA 3GFOA 2RH5A 1XP8A 4X6LA 4U5QA 3V8NA 1PDOA 3A8TA 3HEBA 3ORRA 4NOLA 4PC1A 5D85A 2WY2D 3T5AA 1ZSNA 1BXRB 2Y1XA 4B75A 1K6XA 5IM4A 1FSSA 4WKOA 1PQ4A 3A7DA 3AONB 4GOKA 1M34A 5IKXA 2J9FB 3IMGA 1L1QA 1E1YA 1MIOA 1F2TA 3H87A 4K3VA 7MDHA 3LC7O 3VU1A 4A1OA 4F8EA 3RVOA 1V16A 1JR4A 4A6PA 4C4AA 2VUSA 5C0OE 1AKYA 1B15A 3DW3X 4NYMR 5BQXA 3SM9A 4QFBA 4BNJA 3LQYA 4MS1A 1JR3E 2O0KA 3GGJA 4IKPA 1FUUA 1FRFS 1A4XA 1SOMA 1V9CA 1ZMTA 2X86A 3U7QA 5HWSA 5AJZA 1SXJD 4DV0B 4ND5A 3DUWA 4MJLA 4QO8A 5IAEA 3TQQA 3KQWA 3DV9A 4X1YB 1TQ2A 3A70A 2B9EA 4C6RA 2JGMA 4K9QA 4RCVA 2YYZA 3HCBA 3FYCA 4KNYA 4A2PA 3GF4A 1CX9B 1YL7A 4MEJA 4K9PA 5M34A 4B2IA 1MENA 6AT1A 1PLLA 2NSDA 2DWOA 1DXQA 1Z0FA 1IEWA 2FK7A 2OZPA 3I32A 4ZU3A 5LDGA 2FA9A 3RVBA 3UH0A 1O89A 5B7QA 2AW3A 2E3JA 1JR3A 4M49A 2OPBA 5EZ5A 2HK7A 2O2ZA 4J0CA 4PFSA 3T9DA 4ZJYA 5DZSA 3TD2A 1N1GA 2PCJA 4B3SB 5TMPA 4DJAA 3PLAE 4F04A 2Z5LA 2Q3FA 3HYCA 2H06A 4HQLA 3VR1A 5ICCA 1NDUA 1OJ7A 4UJ3A 2O1EA 4C29A 4E2YA 2ZIXB 1VLZA 2H8GA 1OGYA 1YS6A 2A0YA 2QORA 3DO6A 3Q2OA 5LB2A 4D0GA 4E5YA 2FUG6 2MMGA 4U6SA 4ZFNA 5U9CA 1Z39A 3WGZA 3WLEA 1FP1D 2XTZA 3NNDA 2I6FA 3BL5A 1KMIY 4UBIA 3P9ZA 1J5PA 4QXAA 2ZJZA 2VBFA 3WIEA 4QSHA 4A6XA 1CKEA 4AJJA 3PDWA 1TUEA 1H5UA 1UBRS 2HU8A 2XD9A 4HX2A 4ZQBA 2PNJA 2MIIA 1E3DA 1T25A 4C89A 4D79A 1NXWA 2V7QA 4GKBA 5KYKA 1YS2X 1XVIA 5JTTA 4EAQA 2FPXA 2C5FA 2DSTA 3DOJA 1MMFB 1QR6A 2O3TA 3EGXB 1XR3A 3PF8A 1I1NA 5AKXA 4ZKDA 1EVZA 4ESHA 2I7XA 1M2OA 4H7PA 4I4TF 2W4MA 3NHBA 3FNQA 1XDBA 2FZVA 4LGYA 4HAXA 4ZKEA 3PVCA 5EUQB 4CEHA 3ZPXA 1KQNA 5K3FB 4J94A 2XH8A 1BGXT 2D2FA 4HVLA 4M88A 2OB2A 3VH2A 1GYQA 1KORA 4PYRA 1ESNA 1AT1A 4N48A 2G67A 1Z4KA 1J7KA 4NBNA 3VH3A 2YRXA 1OT5A 4NHEA 3I4CA 4MCAA 1SRQA 4LWOA 4OGGA 4F1KA 2Z6UA 2C9ZA 2Q8PA 1ZR4A 2Q5EA 4R3WA 3ZBQA 3SFZA 2HCBA 1GSHA 1IB6A 2G8NA 1PFQA 5EIHA 2QMOA 2DFKB 5LUAA 3WGTA 5BWMA 3R7FA 1L4FA 4Q05A 2OPHA 1OU0A 5DWDA 2CVHA 2V9CA 1D6JA 4HTAA 4J1NA 3U80A 1UM9B 1U3VA 2O05A 2LV8A 4JB0A 1PT6A 1IQRA 4TWIA 5B6JA 1XNRB 4X44A 2WZCA 1L7BA 2NT3A 3X1JA 1SELA 1CV2A 2VP0A 2PZFA 3RKUA 1IXYA 1Q7RA 2PZMA 5L6LB 4A15A 2D6FA 5J47A 1E3QA 5TY0A 4F38A 1GHTA 4IOJA 3TS1A 2G5PA 3GJYA 2OGTA 1IHPA 1NBIA 2I4TA 3GEBA 4BIMA 2OB1A 1AKUA 2ZIVB 5T57A 2I3DA 2V8BA 1ZNYA 2XZDA 1IJBA 1JAXA 4XVHA 4R71A 1F7VA 1E3SA 4MWBA 1VJTA 4LMAA 2P2LA 4KTTE 1IN7A 4B4WA 1WSAA 2CDCA 2FSVC 1RIIA 5DCUA 1DFHA 4AI6A 2J3KA 1NVGA 2B4TO 3ASVA 4Y6PA 1GAXA 1CRPA 4JJ6A 5AMXA 2NMVA 1EUDB 1YS4A 3CKMA 4HB2A 3H13A 3I05A 1ZONA 3G8AA 2JJ2D 3LOQA 3PKJA 4QPCA 4WK6A 4ZU6X 4UAUA 3SQNA 3SZGA 3WB9A 3HI4A 4A7PA 4LYDA 3M6LA 1CUBA 1KF0A 4NFHA 4C4SA 3DTNA 3COWA 2P2GA 1C0PA 1G4UR 2IYYA 2AZTA 2OP0A 2YRFA 4HJXA 4DRYA 5JT1A 4XOIA 1C0KA 4PBSA 3ODPA 3NRCA 1CDZA 4FGJA 3CZ9A 2CLHB 4IDHA 4UCQA 5BUCA 2VCHA 1PGOA 4C0HA 3HUDA 3JWGA 1BE1A 1O9GA 4OFZA 2ZQ5A 4R81A 4QGSA 6NULA 1ULBA 4GVXA 1P31A 2PZLA 1CQPA 2ZYTX 4LC9A 2G04A 3E7WA 1XZJA 3HO8A 3LQKA 5F9HA 1DLJA 4P22A 3T3HA 5K5EA 2WV9A 4J7AA 3UGTA 3A1WA 4G24A 3O47A 5KSOA 2BI8A 1QV7A 1PS8A 4FYKA 4TL9A 4L8YA 4LX0A 4LNUA 3DFUA 1Y8RB 3TIIA 2H2IA 1FQWA 3CG4A 5TPZD 5FI0B 4F4HA 4GMDA 1N1MA 2VWGA 2CN1A 5AK5A 1DXOA 5B1HA 4Y2UA 3EK2A 5J4VA 1H1TA 2H2HA 3K96A 4M9ZA 3DOIA 3H5AA 2BVNA 1Y5IA 5K8IA 1YIOA 1JPJA 2TRSB 3JQFC 3WJ2A 2FEXA 1O8CA 3K5IA 4TVSA 3PFFA 1NURA 3EAGA 3Q6MA 4B17A 2RGRA 4DNFA 4TKVA 4MUFA 3IDAA 1FFWA 2DTXA 4NI5A 4RIEA 5JHGB 4B31A 4KUGA 5H7XA 2DXIA 5DRTA 1R18A 2OOSA 2J9YB 2PSJA 4GX2A 3LBFA 3OE7D 5CHYA 4WBNF 3GZJA 2UAGA 3QX3A 3TFOA 3O4GA 2PRYA 2WHYA 1ECJA 1LF0A 1CBUA 2EJCA 4MHSA 3B2NA 4QBFA 3V3KA 3FA2A 3OO0A 5GVRA 4B3JA 2QM7A 3UMYA 3MS4A 1ZD8A 3PBKA 1K5GA 3AIIA 4ZOCA 4A03A 5T67A 4BKRA 3OCZA 3GFTA 3PEUA 4KPUA 5F1OA 2G76A 2A59A 3ANLA 3V4VB 1O3YA 4BV8A 4MICA 2Q3CA 2WINI 4BNDB 2JFBA 3L06A 4ABTA 2DY0A 4M22A 4NXMB 3SHWA 2X77A 3BMCB 3HL0A 4DDVA 4RVCA 4KN8A 4YJ3F 2PX0A 1ZKMA 3BDAA 2O8EB 4R1QA 4WLVA 1PJ2A 1RAEA 3WKBA 3B36A 5A0FA 1J6UA 1G291 3GGOA 4HH0A 4DIMA 1RM4A 121PA 1KVTA 2Q0SA 4LJAA 4ZDWA 4W7IA 2B99A 3GYBA 2OV4A 3U3ZA 3WWYA 1CZOA 2WJAA 1J09A 4XR9A 2FSHA 3FHCB 3JD3A 4OQYA 4IS3A 2A9JA 1SBYA 4QARA 2ZTLA 3KLMX 1YAHA 2DFDA 4R1UA 1XTZA 1DAOA 2YVUA 2XNKA 3PFWO 5E6SB 1AQ6A 3TLJA 3TZBA 5DK6A 5EHXA 4M9UA 2XB2A 1SIBE 3AHGA 1HG1A 1WSBA 2GAJA 2GAFA 2QN8A 3I5YA 3ZW7A 3V9AA 4J16C 2NQ2C 2O06A 3DE5X 3ANMA 1C8VB 2I6GA 2OHIA 4KDEA 1E9FA 1Y4DE 3CLRD 3OMLA 4C0KA 2WICA 3EXG2 3B13B 5JY6A 2GK6A 4ZAGA 1UMDB 2I6XA 5JNWA 3OZAA 2JCSA 1I80A 3I92A 1YDMA 3S4YA 3HP7A 3HWRA 5TGTA 4EB6A 2O8FA 1C4XA 2R4QA 3CSDA 4F0JA 4EVRA 2W2LD 1KI8A 4GWKA 4RL4A 1RAAA 1XQXA 4Z2YA 1UDRA 2N75A 3HP1A 5K8LA 1MZVA 1RRCA 1G18A 3ZU3A 5IJXA 1XN1A 4OQNA 2QN9A 4JXKA 4GBGA 4LXYA 1LDGA 2XNHA 1A9QA 4HGRA 1PLKA 5B3AA 3ZIUA 4XGKA 1OLOA 4OQLA 4YPFA 4F60A 1BCSB 2JZOA 1NI5A 3JW8A 1G7TA 4FHFA 4GBMA 3K0EA 1G3IA 2VOJA 1P39A 3PCRB 4M0LA 1R66A 2V6BA 4BAGA 5LNK6 2ZVPX 4P6VF 1H1DA 4LDZA 3II6X 2WJJA 4Q7LA 4AQYB 1JH8A 3AB7A 4QBKA 3DAPA 3Q6IA 1DRWA 1P0QA 3FDZB 3R4CA 1E64A 3OG9A 3ZXSA 3ZCQA 1AO3A 3C5WP 2H1CA 3EC2A 4XIGS 4H0NA 4LA4A 2ZUTA 2JGDA 3WLNA 4W99A 1VG9B 4I1YA 4FN5A 4AWBA 4RWZA 1H2ZA 1UWVA 2PX4A 3UTDA 5HMMA 4YREA 3ZLTA 1VMKA 2IYQA 1JNYA 2BIFA 4P34A 7MHTA 4YIKA 1STOA 1X1SA 4HAOA 5BSGA 5EEHA 1R0KA 3IPXA 5TV2A 4L4SA 1QH1A 2W6JD 1Y3DE 3LRXA 4FYYA 4BMZA 2IS4A 1DG3A 4UMEA 3M81A 4CIXA 3H18A 3PNMA 4IDQA 5FPQA 4BGDA 1N1EA 4ARZB 3IDFA 2DFLA 4OQXA 2ACWA 1DRJA 1MOPA 2WJHA 4JP3A 3MTIA 2HSGA 1X9IA 2O7VA 3IA7A 3BJRA 2PO5A 4LSMA 2Q3MA 3UTCA 1C9MA 1GL9B 2QZSA 2OCIA 3DTVA 3ID6C 1IY0A 1NPYA 2JBAA 4X8MA 5EAIA 3ZGZA 3ZHBA 1PJ3A 3LDGA 1IOLA 2HJWA 5IAGA 3ZQ4A 4R16A 5C7IO 3W1WA 2DJ5A 2XDAA 4DC1A 2HPZA 1D0IA 2IX3A 1KPIA 1T9BA 2QQFA 2R84A 3VGJA 5HVNA 4TTAA 1AUPA 4XB1A 4QTXA 3ZE0B 2UXCB 2VZEA 3T7EA 5IF9A 5D1HA 1EBUA 1INLA 1IEVA 1MC4A 2EFCB 4JLSA 4L2IA 4XWAA 3UQZA 2X14A 3OJWA 4QHSA 4K8OA 1JEQA 3CRMA 5BNZA 2FQQA 4KIJA 1QK5A 3FXAA 4IIEA 3GJ3A 4UMDA 1U3FA 1JA0A 4OREX 5JATA 1YUMA 2A35A 4E4RA 1ACLA 2P8SA 2WWGA 3OP1A 5K05A 3U7EB 2J0UA 3B38A 3V1MA 2PLNA 5D3ZA 4BQRA 4ZRNA 2PKEA 3PENA 1JFFA 2BEKA 3WYGA 4DLUA 1FFDA 2QR2A 2VSQA 5ALXA 4Q3CA 1J9EA 1KHHA 3VJRA 4P1ZA 4O2AB 2C5EA 4PWYA 5TE9A 4HZUB 2P35A 3FW1A 1K9VF 2HU7A 2OZLB 1JIUA 1EWKA 3D6NB 3R3WA 4UBLA 4IGIA 2AQ8A 2W6CX 1YH3A 4F3RA 3L77A 4XD2A 1N0UA 4FJ0A 1RP7A 4O2BB 1AU9A 5F7XA 3O8QA 4C01A 1Z5WA 1W5TA 2HMSA 1V1RA 2XT0A 3EZXA 3L6BA 3VOSA 5F76A 1IBRA 1YCFA 3OOJA 3WGOA 1B2LA 1PG5A 1PQWA 1Y7TA 2VJAA 1HDOA 4QFCA 3NC1C 5LLSA 3E9MA 3O1LA 5KWVA 1UFOA 2ZRIA 2FYTA 2DY1A 2PU5A 3DT8A 3KSMA 3FUWA 1XELA 4DMMA 4YRBA 5JMPA 3OU6A 1Q0QA 4DJTA 4ITRC 3UA3A 5B2EA 4CM4B 4KPEC 3HNPA 3TLEA 1HDCA 3IVCA 3IUYA 3PEEA 1AE1A 4K5QA 2W22A 1ZO8A 1X1TA 2VTBA 2JHCA 2D3TA 4LYJA 4OHKA 5BQFA 1F8GA 5FI1B 1T6ZA 1F8XA 1XL0A 4QUDA 3FHTA 2HK9A 4BJHB 1F8UA 1WCWA 1OA0A 2G80A 5LMNB 1UQUA 1QYCA 5AKHA 4QU9A 3UMSA 4L8VA 4YRRA 3HXQA 1TW2A 1QG6A 2XF8A 3EH2A 2VYND 1FFYA 1SVIA 1DAMA 3ACCA 3EC1A 1WSDA 3FUUA 2IUYA 2B1QA 1N3BA 2LVBA 3S99A 4ZEWA 4MJ7A 4MKRA 2LGJA 2HKIA 5KNBD 2XOEA 1C9KA 4P4UA 1Z25A 1P1RA 3DE1X 3GT0A 5AD1A 1HEIA 2E4YA 3SF8A 3VDXA 2OLJA 1MEJA 4HAZA 5HKLA 1P6UA 2QVXX 1JQLB 1TIBA 2YN4A 3LL4A 1T9GS 1YI1A 2H31A 1XZNA 3C6ZA 4Q48A 4TMXA 1CETA 3DZGA 5IC6A 1VA4A 5AW4A 4HXFB 3CVYA 1KRXA 1ONBA 2OXEA 4UM8B 1PZXA 3OM1A 5JDIC 2N9UA 4YP1A 4Y2YA 1RHUA 1KRHA 1I3KA 1X1AA 1ITZA 3PC8A 4IL5A 5AKEA 3DZFA 3I6YA 5HILA 5F98A 5GM1A 5CLLA 1CZLA 3HDJA 1DAPA 1UPUA 1Z15A 2W8ZA 3ISJA 1T4CB 2E37A 4EJ2A 3DVAA 1A2OA 4N0DA 4D9NA 1JDZA 4KC0A 5EHIA 3U7RA 1T10A 2L18A 4QOEA 3ZGNA 5BY2A 2NU6A 1C1XB 3GQVA 2ZS8A 1JNXX 3V7UA 4EMBA 1KQPA 3M6VA 3RBVA 3CG0A 1PJQA 1FUIA 4TYMA 2NZUG 4ZVQA 1Z5PA 1VRWA 1A27A 1U0RA 3OCXA 4QG7A 1ZVMA 2WZBA 5BORA 3FMFA 4WFIA 3B6ZA 5JJ5A 5JWOA 3OPMA 1DCTA 2VRCA 4KWHA 2JD2A 1CUFA 3JATB 5FDFA 2GVNA 3ACBA 1TZJA 1GU7A 3GFQA 4IHJB 4JXJA 4AXBA 4PZEA 4L50A 5KTYA 2JFUA 4BFSA 4D8YA 1I14A 5CVDA 1WEHA 4BUJA 2ODTX 3GEHA 3NVKI 3RBZA 4ZOLA 1GFSA 4DJDC 3BHJA 1HNXB 2QBYA 4F2GA 1CUXA 2D54A 4IXTA 2ATIA 2H1IA 1KH1A 4F5EA 3EYWA 4RPGA 3DZIA 1GG8A 4TRNA 4F9TA 1GVNB 2JVJA 3ADKA 2IBMA 1IUNA 1VZ2A 2VWQA 1NW4A 1GXSB 4L73A 1WQ3A 4OVKA 4WADA 5EVJA 1PG0A 3OD5A 2HNKA 3UBMA 3B3QA 3VR6A 2BFEB 3GN2A 4OB8A 4BVKA 2OFXA 3AEQB 3PQEA 2B21A 4FU0A 3WGGA 4CKYA 1Y81A 1RACA 4HQFA 2VHEA 4YRPA 5A7HA 2PUDA 2V0GA 1E99A 5G3YA 3OZVA 5TIIA 5ICEA 1W29A 2WD7A 3LHKA 3AEKA 4TSFA 4EW6A 3I09A 1J0AA 1TO6A 3AYXB 2IYNA 4G26A 1YZUA 3ZZMA 4IEFB 4IDDA 1PBTA 4TTIA 5HQ3B 1SXPA 4NZNA 5SYNA 1E3WB 1X14A 3BWEA 4ETWA 1ZUHA 4R0MA 2X0DA 3MAGA 3IE0A 1ZN9A 3I58A 3IR5A 2G0NA 1QHEA 1JWAB 3NYIA 4FMDB 4TMVA 1L2TA 2JI7A 5DM4A 3RYHB 3ZHCA 4ZMBA 2IS1A 1IY2A 4A0RA 5IJ9A 5CH3A 3NT4A 1HMYA 3BMXA 3O94A 1REQB 5EERA 1JEJA 4EFLA 4D80A 1XJ5A 1OBCA 5KPJA 1JBKA 1IE3A 4BFCA 3NH9A 4KYTA 4G85A 4AUEA 2C00A 3MTDA 3CVOA 5IT9A 1KDYA 5HJ2A 4B71A 1QQ5A 1QDEA 1QTNA 3TW6A 4TVKA 5GGYA 5JQGF 1U9YA 1JQEA 4ZCRA 3VVBA 1WSWA 4A5OA 4C0QC 3KOZA 4DB4A 1CG6A 4NCBA 3H2JA 4U2FA 5JALA 2DLCX 4WK4B 3M83A 2QPOA 2EKPA 1UXIA 4LE0A 1EVJA 3IMKA 4F7DA 1D6SA 2IYWA 4XM1A 3WV4A 2JZNA 3ZCUA 1HKUA 4YQEA 1C3LA 3JYLA 1KMHA 1PUXA 1SCJA 3P2OA 3L0SA 5IVKA 2FPSA 6REQA 1UODA 1MU0A 2DCUA 3IMFA 1T3LA 3TRJA 4HLNA 5FBWB 3MBIA 4EX6A 3SNHA 1AK2A 4R8MA 4YQFA 2YWFA 3EEIA 1EFPA 4Q9HA 1TCAA 2OCDA 5ECGC 3R74A 2EC5A 4D9JA 5I6DA 2DPYA 1NUAA 2CBXA 2HF7A 4C87A 1QIKA 4MLZA 3OCJA 1B16A 4MVJD 4AL4A 5U4QA 4GKJB 4J03A 4ESVA 1CU1A 1CQXA 2D7JA 2I4RA 3ILVA 4GBJA 4ZQHA 5AOCA 1XZLA 3RVJA 1M8JA 1R8XA 4IXDA 2BFMA 4G0YA 3G5MA 4KQWA 3FUTA 3KOWA 1Z4OA 3MUEA 1OBOA 4NMXB 2X6RA 4YI3A 2FWNA 4KPFC 3L07A 1WF6A 4AZWA 4C0LA 1OH5A 5DE3A 2ZIUB 1Y5LA 3L79A 4UNSA 5IN4A 3JASB 1XBTA 3N07A 1AD2A 1KVUA 4EJSC 5ES4B 4CR6A 1WV1A 1JTEA 1YAJA 4RX1A 2P0AA 4EG1A 3W6NA 1N2EA 3UW3A 3WDMA 3QLEA 2HADA 2WF6A 1A2BA 4E33A 3CZ5A 5F5LA 5KYUB 4DLPA 5LQJA 2JIQA 1AQJA 1U6IA 2WHQA 1JPVA 4TLEA 1M83A 1WJGA 1ZL0A 4QU5A 1RJGA 4RHXA 3PYLA 3ZK9A 1AGXA 1K0FA 1TEHA 1ULAA 4Z3OA 1JLMA 1G9TA 2XBLA 3OOWA 2Q5HA 4E1AA 1XA3A 2XMPA 4TS1A 2ZVDA 1JXQA 4BEWA 2G07A 1T6XA 3AILA 3P32A 3JZAA 4OUDA 4K05A 3U3RA 4C6TA 2HOQA 5DP1A 1IZ8A 3GNTA 4UPVA 4MEAA 4EEXA 1CUEA 4GPTA 3PPXA 4Q3AA 4RNDB 2O5VA 1V26A 2DLDA 3VDMA 2CEAA 1QFZA 1TKBA 2A7XA 2FN8A 3FPEA 4IDGA 5L4LA 3DDNA 2FQXA 2Y77A 2NAFA 4HWPA 2DM6A 3VVCA 1M6HA 3CNLA 2OCXA 5EMJA 2FMIA 5AVRA 2DKOA 2ISQA 4LZLA 5FR2A 3AXTA 5D2CA 3ET4A 3CR7A 1W2WB 3C1AA 1D2RA 4K88A 3PXCX 5DGTA 3WLIA 2DFTA 3S7TA 1GQ2A 1KETA 1Q5PA 2XVZA 4O4LF 3DGEC 3DXFA 2FB9A 4X7PA 2QX8A 4B85A 5KNBH 4L9RA 4G0OA 5AP9A 1EEXB 2GSDA 1WMAA 2C31A 3ADPA 2MDTA 3JQCA 1J7JA 1ZUWA 2UVPA 1U2RA 1BS2A 3E0QA 2J3QA 3EAQA 3HR4A 3JCZA 1FZQA 1E6UA 2BHTA 4W6QA 2E5WA 2B25A 1J70A 5DN6A 4ZI7F 1NN5A 1GPH1 5EKTA 1AM4D 3F6CA 3GH1A 3DJFA 4CMIA 3RFCA 5K0EA 5FO1A 4DIKA 5BOSA 1U7XA 1EQ2A 1RKVA 2ILVA 2ZBUA 4JEHA 5I4IA 5IDQA 2FSIA 4NYIR 1XWFA 1LBSA 3W7BA 2CNBA 4CCWA 2QOEA 4Y6RA 1ETUA 1PL0A 1T1RA 2XYGA 4POAA 1ZLXA 2PPVA 5AJVB 4D7AA 4K7JA 4FHEA 3QBVA 2EFEB 1MRSA 4QUIA 5FF9A 4DSZA 3H17A 1Z2DA 2A5YB 1VI6A 4X20B 3CW2A 2Q4BA 1EVLA 1TD9A 3D7KA 1ETHA 4X62B 4PU0A 1JHXA 1DCKA 5EZ6B 3RSQA 4E5KA 5B7GA 2OVFA 5CPFA 2ZIWB 5F1KA 3SYMA 1U04A 2FW8A 5IAJA 3V80A 1ZH4A 2CFOA 3R20A 5A5EA 5H82A 5C9ZA 2NP7A 4LXTA 1G8FA 4GG1A 1PJAA 4WZAA 2CVOA 3HJRA 3WL6A 4F1JA 3F97A 4AN1A 2W8BA 2LD4A 1QHNA 1RU3A 2N0SA 2ODEA 3BXGA 1SVUA 4JJIA 1P4JA 1P2DA 4PO1A 2Q9BA 4AYXA 2PTHA 3U17A 3WLQA 3U61B 4XLZA 1QKJA 3ZDCA 1DWQA 2C59A 1LVGA 1SKMA 2GBPA 4GXRA 1V11B 4O4IA 1RJDA 2QTAA 5E2BA 4ZCPA 4G36A 4YWHA 3F67A 3R7WA 2O5RA 4R7GA 3SN6A 3ZY4A 3ZHVA 5I4BA 3AIMA 1WCXA 4FFNA 4QZVA 5CURA 3HLYA 4BBPA 4KO2S 3P0RA 3I4LA 4R5HA 2UKDA 1NVWQ 4QBHA 3TEFA 2C04A 3K6RA 2R85A 4RD2A 4MPJA 4HCJA 1E1DA 4ADSG 3NAQA 4DCOA 1M1NB 2PLRA 3PKZA 4E2FA 4ZZ3A 4MUMA 3BRCA 4MRPA 5U4XA 3OY7A 3V1YA 3E9QA 3H5VA 4AU1A 821PA 1BMQA 1PDWA 3NU1A 1IY9A 1WRBA 5AW2A 1Z6YA 1A8HA 2A4MA 3P2YA 1NN3A 2CF5A 2FEKA 2JIZD 5B36A 5GONA 3D7RA 4RTMA 3LFHA 4RBNA 1TYZA 3R09A 3R3ZA 4D9IA 3KVVA 3QWFA 4Q1AA 3QHAA 3EPKA 1XNQB 3OM8A 5CXXA 4C0AC 3LK6A 2RBKA 1T15A 4K6FA 5B6PA 3A1UA 4S1PA 2GPTA 3EIEA 4WE3A 3C1UA 3Q7QA 4TTQA 1U2GA 3TG8A 3T5DA 2XNDD 4FKBA 4Q4AB 3K9BA 4QASA 4DZTA 4ZYXA 1W9MA 4MB0A 4UREA 3WB1A 3DBIA 2F1IA 2P9BA 3GG9A 4AP6A 4CNQA 2VXCA 1VGQA 2ZWPA 1FW8A 3KE9A 4G5XA 4YXWD 3O3MB 4I3GA 4OAQA 4YJDA 4PWZA 4LSGA 3KR9A 4DA6A 1NT2A 1WF3A 2L17A 2O23A 3IAFA 3RYTC 5I3ZA 4C0JA 2BT4A 2XTAA 3CU5A 4LF8B 1EX7A 2LPMA 2V1XA 1BX0A 4CDRA 1XIVA 4OHVA 2CNDA 3FYUB 4Z3DA 3D0RA 2GLTA 3O4HA 3AO0B 3QF7A 1CF2O 5DYWA 3UUGA 3HUFA 1DAGA 3N05A 3PRKE 1ZOOA 4J1TA 1A76A 2YFQA 4J0FA 4JA0A 4PHFA 2AQHA 4KFSA 1TKAA 2AOUA 5CNMA 3LZ6A 3PI7A 3I6QA 1KS2A 1NWHA 5CA1A 4PR0A 4G0NA 4UUAA 10MHA 1FYVA 5A9SA 1W0KA 3EUEA 5SV2A 3VOBA 1VTKA 4ND7A 4G0VA 2AUNA 2EKZA 1T0PA 5G4KA 3S55A 1G41A 1TD1A 3DZ8A 4JAVC 2PG3A 1QAMA 5CU7A 3ZKWA 4XIIA 1JHUA 4MVJH 1UIMA 3W2TA 4GGPA 4R0NA 5TGDA 1WETA 1SBNE 2VPPA 5C1PA 4QG3A 1ZH6A 1H22A 3RTGA 2RIRA 1CYDA 2SKCA 3L1JA 4AK9A 2AGVA 3D8UA 3GT3A 2FHSA 3DMDA 3ILSA 4B7CA 1I3CA 1PZEA 2GXQA 2IPNA 3AW9A 2A1TR 1I4OA 4OHRA 4UEQA 4Q7QA 3NDBB 1DC7A 4PS1A 4NLLA 2E4WA 3PVSA 5JOQA 1HORA 3HYTA 4NEHB 2H18A 5ALGA 1TJNA 3G8DA 5BXQC 1PT9A 2WT8A 2OBFA 3AFNA 3VR3A 5HS4A 3UKOA 1LBTA 1ZD2P 2HJRA 3W5HA 5LP1A 2CMKA 2BGJA 3DPSA 1SVWA 1GTRA 4D25A 4OMFG 2VK4A 1DT3A 1X0VA 3WFJA 1ODJA 4PHCA 4Q3EA 2VSYA 1CF9A 3EDMA 3F6RA 3NWJA 4HLDA 4J0KA 3I61A 4J90A 3SBXA 1FSFA 1ZC3A 1AGPA 1GIAA 1U8AA 3ENVA 3RUEA 4F97A 3VSBA 3IP3A 5FL3A 4WZBB 2MR6A 3VDRA 4JJKA 4CM7A 4EK9A 2VYFA 4GSLA 1PD0A 3ODGA 5ANRB 4LOKA 3HXLA 4TRRA 3IKLA 3UJBA 4PYQA 3H2ZA 4HLUC 1K7EB 3HG7A 4LRQA 1R8JA 4GKAA 4Y2GA 4UEJA 3FR8A 3LY9A 5DPMA 4L72A 3ZK8A 1ISMA 1CJVC 4ETMA 2OV6A 1S2NA 1Q0LA 2YWGA 2UZ1A 5HM8A 3AJEA 3JWEA 3VPXA 1AQIA 4BZXA 4QJBA 2QD4A 3PXBA 1KAMA 4H7DA 3CLKA 4MI1A 1Z18A 1DUIA 1EFKA 1F2UB 1ZUNA 3HCCA 3KSZO 4EHAA 1Z63A 1Z73A 3ABZA 1Z0UA 4CM3A 3RDPA 1IPFA 1TEXA 4W1RA 2GEFA 2C0CA 2C7QA 3MJSA 4O4JF 3U9SA 3ADDA 2XVMA 2HY7A 1X94A 1IRIA 2JI4A 4MV6A 3K0KA 3N3AC 4FCVA 1DPGA 1HUQA 3I1IA 4PEVA 4FDTA 3ZLUA 1ISSA 3PK0A 2VF2A 3GJ0A 2W2OA 2IDMA 3VYSB 3NBKA 3NIGB 5DBHX 5E1BA 2EARA 4R1MA 5INTA 3Q40A 2ZAYA 3AZOA 3GR6A 3KEMA 2DHQA 1EA5A 5EZYF 2GK4A 3QFRA 2JH3A 1IIRA 4PHHA 3TZEA 3AKDA 1FRNA 3PUHA 4GVLA 5MGNA 4IFTA 3DOCA 5A3QA 2UXBB 1L8LA 4ZCLA 2DCMA 4GR5A 3V8QA 1YRWA 3OQIA 1AH2A 2VYVA 1FJXA 1T8PA 3HU1A 3RUHA 5MN6A 4F3KA 3OUTA 3U16A 3I5MA 3QU7A 3I1FA 2FWJA 3SM3A 1MEOA 1RTTA 1G21E 1E5XA 1IG0A 1MO4A 2GYVA 3EG9A 1UP7A 1WZUA 3I45A 3OZCA 5FA8A 2C9BA 4CLEA 4TUYF 2QPTA 2BEUB 2E4XA 3JU3A 4OKNA 2Q1TA 4NYJR 2BTOA 2GN4A 3DAYA 4Z86A 5EESA 3V9PA 5DOVA 2GASA 1H5QA 3Q3JB 4MCIA 1G6HA 1MFPA 3GLGE 2C96A 1EG2A 1JIXA 2P11A 1A7KA 1DAEA 1YB5A 1ZM9A 2VHXA 4O3FA 5EYPB 3KK0A 5GMOA 1YHYA 3ZDEA 4A2CA 5HRAA 4N5NA 2VSOA 1PGQA 1MVNA 1SVOA 3DE2X 4LQLA 1J5EB 3FLBA 2W93A 1F3LA 4HZGA 2B78A 3RM3A 3TPCA 4LY3A 3QUCA 5FV7A 1JJIA 4H17A 4X8LA 3B85A 2NW6A 1J0CA 1B0PA 1ODCA 1TX4B 1CZHA 1G21A 3A2KA 4HVTA 1UFKA 2O59A 2YWJA 1KJ8A 4EVIA 3O7WA 2BWJA 5ISMA 3QE2A 1J4AA 4HQNA 3NCHA 5JPDA 3L8MA 1T8SA 1ZPDA 1DIOB 2J5XA 4YEDA 4PX3A 1DRVA 4XGNA 1CS4C 3RYFA 3VU9B 4C20A 2EXXA 3LXXA 3THRA 4A0SA 2ANCA 5BW8A 1T1JA 1P19A 2BI7A 1LBHA 3FZEA 3GN1A 4WOJA 2C4KA 3QOYA 2IHTA 2PBRA 3HC7A 4P2BA 1NU8A 1SULA 1N9GB 4C7JA 4DFDA 2CUTA 4DLBA 3RNLA 3UJCA 5AJXA 1USWA 4ZVMA 1YV9A 2Z08A 2CXRA 4I0WB 4P7KA 5AFSA 2DWQA 3T38A 1HPLA 1KKMA 1XD8A 4HWOA 3ZI7A 1IJFA 3RU9A 3EY4A 3C15C 1E9CA 1RQLA 5KOHB 1IH8A 1J49A 1UC8A 4JC0A 4I1SA 5F2OA 3BK2A 2M32A 1XI2A 1HH4A 3N2LA 1Q7TA 2BDTA 1JAYA 1DG1G 1Q77A 2Q8QA 3KHTA 4IIBA 1T1SA 1L7NA 2P0EA 4KGXA 3RRJA 3RAPR 5CFNA 2BLNA 3SU8A 2I80A 4LVUA 3WK4A 5CVVA 4WV3A 5JPIA 5EZSA 1CPYA 1C0LA 2HXYA 2Q5LA 4CCYB 2HF2A 1A5TA 4KQHA 3CRZA 4PXSA 4Y1RA 4ZTBA 1N4AA 2LDBA 4S2UA 1LXCA 2F1JA 1PS0A 3AYZB 3KOUA 5KHAA 1WZ2A 3B1VA 4Z51A 4QO7A 1NYLA 1E2IA 1G8KA 3UHFA 4TRJA 4XYGA 1E2PA 3EODA 4EG7A 1YCHA 4X94A 5IHXA 3G1UA 2XXAB 5A06A 4P32A 2CXOA 1E69A 1NUTA 3WB0A 1VB3A 5CVTA 4CMKA 3RUFA 4UFOA 1JKIA 1E8NA 1XQYA 3FJ1A 3IAUA 3VV2A 5JMWA 3VO9A 2QZZA 1R15A 1RQPA 3LCRA 4US2R 4KRGA 2D8MA 3B6IA 3MMXA 3ZCXA 3JALB 3IIMA 3TQSA 4OYLA 3ZJUA 1Y9JA 3MUOA 1LH0A 3ECAA 4MX8A 1C8BA 4NTZA 4IYRA 4XUEA 1OILA 3S2EA 1I01A 5FYDA 3BCHA 3M7IA 1KYYA 1UXOA 1AHPA 1SOWA 1VYVA 3JVEA 3BWBA 5EJGA 1VIDA 3PNYA 3BRWD 2HMYB 3OO1A 4NIMA 1KYVA 4PGMA 3C8MA 4JT2A 4WWHA 1LBQA 2R6AA 3OIFA 4HSEA 4XH9B 5G3ZA 5H3CA 5HE9A 3KB2A 1KYZA 1PK9A 3MC1A 4ZGGA 2FKNA 1TM4E 2NTYC 5KWJA 1JV2B 2A6PA 4QOFA 4HB3A 5J5CA 3A26A 3R5TA 2N1MA 4H1HA 2XAUA 1J97A 3BTUA 3GA7A 4KN9S 5F7JA 5FWYA 3C48A 3PHIA 3U44B 2UV8A 1XRQA 2NXEA 2PWPA 5FRDA 1P2TA 1L1RA 521PA 1YDHA 1M34B 1RQNA 2ZRCA 2PSDA 1MIOB 1RLTA 1GGMA 2CLSA 3MCAA 4J8PA 1E77A 4P5EA 1SC6A 1XMIA 1LDMA 2B1JA 3Q88A 4FGZA 3CJRA 4IO1A 4V0LA 1PNOA 3DFIA 3V34A 4EMSA 3BX1A 1T9AA 3E1SA 3HFGA 1QORA 3JPYA 3J7TA 5K3AA 1XT6A 1M5UA 2R1UA 4G9BA 4MS1B 3IJRA 4B8ZA 4YMLA 5FUMA 5LP6F 3U7QB 1NF2A 2WYOA 1H6DA 1P0FA 2ZJAA 4YAFA 3JVDA 2XMRA 4L3OA 4XQ0A 4EYEA 1USIA 1NKVA 5CDTA 1SCKA 3RR2A 5FR1A 2QM0A 3G2HA 1L5YA 4GGMX 3PU6A 3WRVA 4AKGA 3N8IA 2DUWA 3P5BA 1QQBA 4RJ2A 4A2QA 1ZY2A 4M8IA 3RTCA 4ZAZA 2JEOA 3HN7A 3G85A 3E8MA 3LCMA 4QDZA 4EPXA 1XHFA 4EUFA 5G0WA 2JEYA 2P79A 3KWFA 3VVMA 1ZS9A 2CD7A 3K2BA 4O1MA 1EHYA 4G84A 4M21A 3WSWA 1MORA 3NZEA 3EF0A 4YCBA 2X5KO 3IP8A 3FCEA 3G68A 4O4HA 3WQBA 1HT1E 1IBKB 1I13A 4U2DA 4BQSA 2AG5A 3ON5A 1ZLYA 5JXJA 2R47A 1FDIA 3U3OA 3EEOA 4KLAA 2A5DA 2EHDA 5CIQA 3VKWA 6CHYA 3KIPA 4JP1A 3HLTA 4M7OA 3RUAA 1CE8A 3GJRA 5TVKA 1DVRA 5JBIA 3NP7A 5K3CA 2FK8A 1DJPA 3K15A 4LN1A 3MOIA 4Q21A 3RE1A 4LY0A 3PQCA 1FC0A 3PX7A 2BFCA 5KQRA 2AIRA 3GFBA 5AOAA 2HT1A 3RC8A 4AMVA 1EX9A 1JU9A 3HR8A 2PWAA 4BWYA 4KTVE 1FPMA 3HHPA 4F3CA 2O3UA 3FTPA 4MVJP 3PUZA 4J4BA 4R31A 4V0NA 3LUAA 4BCBA 3NJRA 4J0IA 3E3NA 1Z28A 4CQMB 4ZO4A 5AK4A 5BR7A 1AGNA 3KXPA 4J9UE 5F51A 4BNVA 3L1KA 3PDCA 3HU5A 4A0QA 2IBSA 3B6EA 1M2OB 4KWEA 2BH2A 2HR1A 1RZVA 1L5SA 1UZAA 2C5BA 2O3RA 2OBXA 5BSHA 1SD2A 4O29A 4CEHB 4XLTA 3C8UA 1US8B 2NAPA 3AR8A 4K2HA 4F2PA 3UAYA 4X3PA 2P9GA 8LDHA 2QMZA 2BKLA 1CUUA 4BFYA 1L8QA 1E4YA 2PYIA 2V6MA 4P36A 5FA6A 1T0IA 2X2FA 4MWGA 4DLYA 4IZIA 5B4UA 5BW4A 2GI4A 1BIFA 1Y7HA 3AUFA 4LYHA 3BUSA 2WW8A 3IEMA 4FHDA 5FAXA 1J2EA 1YBFA 2JJ2A 3QQPA 1KBZA 4TV9F 1CY2A 3CCCA 2GA8A 3RAEC 1CEYA 2RGGA 5IKPA 2J0QA 3C7TA 2W2KA 5A4JA 3TO5A 3GFVA 4F9GA 3VPCA 4CMEC 3U4MA 3ETCA 3TCNA 3ETHA 1A7JA 3CA8A 5IH3A 1E2FA 4IXNA 3N9IA 2CBGA 1FNSA 3WSTA 4Y6SA 1MX5A 4AYWA 5H8WA 3VNVA 1H6CA 1EU1A 3IV9A 4TXLA 1P18A 3KQUA 4PZ9A 3L84A 4WLEA 4CQJA 3WQSB 3JZFA 2P2DA 2ALJA 4PZAA 2VAPA 1TU4A 3OMXA 3ABOB 1NFQA 5CAEA 1MQ8B 3A6JA 4R54A 3AQIA 4HN4B 1LEHA 2CCGA 1KE1A 3HI6A 4M86A 1YKFA 2XMSA 1CY8A 3AKZA 1OXMA 4AO7A 3LVBA 1VL0A 3AOEC 3FOAA 3H0EA 3IQIX 3RSHA 2GJ9A 3QEAZ 4JHXA 5AXAA 2ZKIA 4AICA 3KFLA 5TPZA 1YNOA 1XCPA 1O94C 3ED5A 4EABA 1BVRA 2I65A 4JLOA 4E08A 1FLAA 3HBFA 1JIJA 3IAM6 4WLOA 2ZSDA 1JA1A 2W90A 1N8KA 1X3SA 4C3OB 3KQHA 3I2YX 4MPTA 1XMXA 1Y8QA 2EZ4A 3D6AA 2G77B 5JAHA 5FH9A 2CYBA 2EYQA 3JQBA 2QY9A 3D6UA 1ESZA 1EVKA 2AZDA 3HWSA 1OAOC 2J3IA 4KNWA 4N0PA 5CUQA 4E5SA 1WXDA 3DEYX 3OHSX 4AROA 2UUCB 2P5TB 4ENRA 1C3EA 2H11A 5JS7A 3JQGB 4WNCA 1MVOA 3VTZA 4C4OA 2DH6A 3ZNOA 5EWMA 3W04A 5IYZF 3AUSA 1MABA 3HKBA 3OE7A 4OGKA 5DBFA 1U7PA 1GNVA 4XD7D 1H2HA 1Z8HA 3INYA 1E5LA 4BZWA 1XHEA 2PUAA 3N2NA 2O54A 2C92A 1XK6A 1LGYA 4JVSB 1EJ6A 1L1EA 1DC8A 1V7ZA 3WLSA 3C3BA 1N78A 2V7PA 1MJFA 4E12A 1P44A 4PQYA 1ORTA 3RFVA 3SR3A 4FCCA 4IICA 2Q5JA 4QQRA 1ACMA 1DIHA 3F6SA 1CW2B 1NN0A 4TQGA 4CT0A 3N75A 3VHRA 4UTOA 4XQCA 1L8OA 4JLNA 1PG2A 2BD0A 1DCFA 1U80A 2GN2A 4I99A 3KJHA 4TROA 5JVDF 2G1UA 3OD1A 2G5TA 4HVCA 5CT5A 5DB4A 4ZVNA 1QAQA 1E61A 2J46A 2R96A 3UC9A 4LNUB 1ONSA 4ER5A 3HO6A 4JXZA 1OB5A 3FUVA 2YFYA 1A97A 1LRJA 3Q10A 3V42A 1N6PA 2W6PA 2NLOA 1KZGB 5BN4A 5HRCA 1Q1NA 3RSZA 1QE5A 4AZTA 1QPGA 4HGZA 3ZJVA 1RT9A 1M33A 2XUDA 2XCOA 3HY6A 4G1UC 1EM6A 1NSTA 3SXUB 2Y67A 1U0SY 4DWWA 2HIHA 1NLMA 1OX6A 1XK7A 3DKIA 3LRPA 4QAQA 4B4KA 1HDEA 1PCXA 5A4KA 4TKVB 5TQ2A 3AGQA 4ZI5A 1IJEA 2H5IA 2QAGA 2L2QA 3OZEA 4YPVA 3NWPA 2MR5A 4QICA 3AB8A 4PGGA 2MHCA 1XNGA 4JIGA 4BS9A 1YL6A 2Y0CA 3AR3A 4OLFA 4YRAA 2Z9BA 5CNJA 5FTNA 2NX2A 1YDEA 3K0AB 4AB1A 1DXHA 2C5GA 1OIXA 4ENUA 3G02A 3CMCO 4HAUA 4L28A 5E0KB 2AMYA 5HE8A 1O4VA 3DHYA 1YTUA 2I66A 1XA4A 4BNHA 1M1YB 1CD5A 2WYWA 3IPLA 2PPLA 1NUHA 3MG9A 4PQFA 4DTCA 4CEJA 2ZCVA 1Y7PA 4KPUB 2W2LA 3R6LA 2AWOA 4N7MA 3A9CA 3ZWXA 1JDPA 3WMFA 2O8CA 2R8OA 1VC2A 4G5QA 5DLPA 2J6CA 4X92A 3I04A 1QHHB 1JHYA 2DAPA 5I3CA 3K4QA 4XIJA 1FF9A 4WDQA 1W5AA 1WMBA 1WVGA 3M1AA 4YAJA 3ZI4A 2NTJA 5AJTA 3Q9LA 5FTWA 3COYA 3OA0A 2QD5A 4J43A 4N0MA 4OA8A 2VJMA 2YTZA 2H1RA 5BYJA 1C50A 1YBVA 3C6QA 2OAGA 2OG2A 3ANNA 4EVSA 4LI3X 1NJSA 2Q1YA 3NUGA 4FWIB 1H5NA 1S6YA 4Q12A 3GT7A 4WXMA 3SJAA 5LZ8A 1PLJA 2HNAA 3LQFA 3EOAI 3CLVA 1Q0RA 3SG0A 4D96A 5HP4A 4BO1A 1W8IA 1ND5A 1SIUA 2I55A 1PL6A 1Q15A 5DM2A 5KAMA 2IZZA 4FOSA 4NYIQ 2IH2A 1ZH0A 4N6OA 4CKEA 4AG3A 3SP1A 1M7HA 2ZATA 4ARBA 4ETIA 4J2HA 1UFVA 1SQSA 5ABPA 2AHRA 1UH5A 4S35A 1E2QA 1G6Q1 5ICMA 4GM1A 4G67A 2W6JA 4S1NA 5DISB 2VDKB 3TAHA 5CLJA 3R3HA 3HMQA 1UZLA 3R5XA 5ILOA 4EB6B 2K7FA 1Y9AA 2VZ8A 2O8FB 5DXJA 3STYA 1HEUA 1ORRA 1OGJA 1WUKS 2V98A 4HWKA 5MFPA 3RIEA 4OO3A 1B74A 4JU8A 4LBVA 3FOCA 1V1MA 3H65A 3RRZA 1QQAA 1N3IA 5F77A 5T3UA 1ZIOA 3F73A 2VH1A 2PY6A 3QXSA 4PTYA 1BCRA 2II6A 1SVLA 3DZBA 4BBJA 1ADGA 3MOGA 3FTEA 1W4CA 4QAJA 2QS9A 4UMFA 5IVIA 3VNAA 4BZQA 1SQ0A 2PZJA 5A5FA 1CB7A 3QVWA 2JKVA 2IL1A 1A04A 3KPVA 4FE4A 3TRFA 3WHKA 3E8XA 3THWA 4DA0A 4ZEVA 3I34X 3GRYA 1NVTA 1Z74A 3ISTA 3ZR4B 1QS0A 4DPLA 4N3NA 4O4HF 3MWKA 4FBLA 4A8JC 3AVVA 4YRDA 1MG5A 5HFAA 3W2IA 3EZNA 5DTMA 4C14A 2JGDB 4CDNA 1U4NA 2D13A 1A9XA 2TS1A 4BO8A 3UENA 2NO7A 4ZJPA 2YWDA 5DRYA 3GK3A 4DANA 1T5SA 1NM5C 4IRXA 3KD2A 3LPAA 1SXHA 5D84A 1H94A 1NXQA 5JS8A 2DECA 4M83A 1GYPA 3NEJA 4GRDA 3DFKA 1QH1B 1YJAA 5I9LA 3QEBZ 1K8RA 2ZE8A 3FOFC 3T4UA 1QMPA 1Z4JA 1IM5A 2GBLC 1EVYA 2V7VA 2VHZA 4BLSA 2CB9A 4MPRA 3QPDA 4YH1A 4GHWA 1W2GA 4ND8A 1JJAA 5JS2A 3KVOA 4QXOA 4ZOBA 2WSIA 3O3NB 3T1VA 2NSYA 2HU5A 1AZLA 1CUIA 3SYNA 4X64B 3DTVB 3K8QA 5CT8A 4G5SA 2JBAB 4PFJA 1Q11A 1PQPA 2QX9A 1FLDA 1CZKA 3OBIA 2CHGA 4JLAA 3C8HA 2ORWA 3W5BA 3EA0A 3AVWA 5DEIA 4M37A 4EHDA 1YVUA 1E0DA 2OLKA 3JZMA 3OQMA 2O7SA 2IJGX 4PHGA 2H08A 3D8HA 1Y4ZA 1EWVA 1J2YA 2X41A 3A36A 3OT1A 4Y0VA 4XWOA 2MMCA 1YHZA 3DAFA 4EKNB 3TD6A 1JDNA 1X8JA 1YR7A 3JQAD 1EP9A 1W30A 1Z4NA 1B3BA 2DE0X 3MBOA 4XE5A 3T34A 4DUPA 4EF4A 4YX9A 5M5BA 1JEQB 4A26A 3AM3A 4E5MA 1GCOA 1AKWA 1XVUA 3PQ7A 5G0TA 3F7MA 4NCHA 2CLKB 1O95A 2I2WA 2IFTA 3LG2A 1ISGA 3FCCA 3LVRE 3FNRA 3MRVA 5I7HA 2J0UB 4XB2A 1WMDA 2G7MC 3FHJA 3ZV3A 4B3BA 2GJ8A 5AM2A 1RYBA 3HUTA 3K05A 2GA9A 5DSTA 2R86A 4DR2B 1JFFB 3WJ7A 1XCGB 1XEAA 1WMEA 3P9PA 3NOVA 1M72A 5LQUA 3B2QA 2VAXA 4PQEA 1L5OA 3ONWA 3W6PA 3OE4A 4XRRA 4KYVA 2WSSD 3R9KA 3S2FA 3T1TA 2BSQA 5KNBA 3CINA 4B80A 2CCJA 3BHMA 1M75A 2P9HA 4P3YA 3TSOA 3PNKA 1WP4A 3CX7A 4MB6A 2R97A 4GOJA 3BXXA 4X45A 2HN9A 4XDHA 1CUDA 2DUJA 3K53A 3O8QB 2QJTA 1V1RB 1VRCA 2XE6A 4W5QA 2ZI5A 1J8DA 2AL7A 4DA8A 3U5ZB 2LR0A 2QQEA 2DFPA 1I94B 1FY2A 4D0RA 4KITB 4MGKR 3C3YA 3DB1A 3KVYA 3RYCB 3L1UA 4UUQA 5DYGA 4RULA 3L1IA 1JZTA 2DBQA 4X0EA 4MVXA 1PWYE 5ALOA 5EIBD 1PL7A 2GTHA 3K94A 1PNTA 1JQDA 4DXAA 3RF6A 4F9EA 2D4HA 3FROA 1O87A 1OU4A 3V8BA 1DDIA 3N2ZB 1EAYA 1JYSA 1R6XA 1NNLA 2QJOA 3G1TA 2DUMA 3OVMA 4KP7A 4P4NA 2PH7A 2D1FA 3PJEA 5FNVA 4K0KB 1P33A 4OP1A 3CSSA 4ZZ0A 2VTBB 4HNAA 2QUBA 1Y9EA 1X86B 4BE4A 2O7QA 3Q7RA 4E6PA 2JJ1D 1E63A 1U99A 4KXWA 2PEZA 2EIHA 5FLXA 2WF7A 3FPFA 3L6UA 4GYYA 5FJIA 4CM1A 4RTJA 2R6CA 2H07A 3PZBA 2FZ4A 4XSVA 3KKOA 2WJYA 2J3EA 5BSRA 4ZTZB 4LJ9A 2HPVA 2YZNA 3EDQA 3LPLA 2EDCA 4JLBA 4XGRA 4YK7A 1HBJA 1V3UA 1JIIA 2NTNA 4FEEA 4KMOA 4YCCA 5CA0B 3CVUA 5EHQA 1YRBA 3EGCA 3E82A 1UOEA 1RLIA 3LH5A 3ENQA 3QXJA 3H8WA 1E3IA 1PYOA 2ZQZA 1D1PA 1T1GA 4JLUA 1JZSA 4DNOA 2J33A 2Z57A 3SF8B 2VH5R 2YXLA 4H08A 2UZ3A 4MRSA 3T3IA 3H5RA 1GLVA 3W3ZB 4D5GA 3O3CA 2WVJA 2E2WA 2KLBA 1AZSC 1HNZB 1A1SA 1QHYA 4PVDA 1R37A 2H3EA 2VQ3A 1FFHA 2I6QA 4L07A 2MU1A 1Z8DA 4FOLA 4MUAA 1DUSA 1N6IA 3A1FA 3AX6A 4N65A 5A1TA 1DTEA 1F20A 3W5SA 2AC4A 5CCBA 3BSWA 1USKA 5CW2A 3ROXA 4X6XA 3G2OA 3MTEA 1D2GA 5ICSA 3ZGVA 3R9WA 4UEKA 4XSHA 3KWMA 5DGXA 1UJ6A 5C81A 1M66A 4GZMA 2KSQA 1KBOA 5CNKA 2GEJA 4HNHA 1Y6RA 2OP1A 1Y4AE 2EW1A 2NU6B 1PR9A 2PXHA 2X58A 3N0VA 3ZVRA 3MZ0A 1QVWA 3N3BC 3Q15C 2F4VB 1ZESA 2QENA 1JG7A 2Y6VA 3B5JA 1JW9B 3IP1A 3D4LA 1GCGA 2PV7A 3INTA 1RS0A 4NYJQ 1AHNA 1VG0B 4OHOA 4A4DA 4DT1A 5AW5A 3NUZA 5JARA 1PR2A 4NC9A 2IXEA 2VH2A 4PW0A 3SDZA 2X5NA 2J1LA 3ZWKA 2VFAA 4KAAA 4AKTA 5IUJC 2HMVA 3BVPA 3NHLA 4BV3A 2XTJA 1QGED 1ZG3A 2G9UA 1MGPA 5ESWA 4FX5A 2IUEA 4ID3A 3KEFA 1LI5A 1HF3A 2ZCUA 4OK6A 1PWZA 2YMLA 3NNNA 3HABA 4MUEA 1KDZA 3TMKA 4E15A 4DQUA 5REQA 1CEXA 1DPFA 4MVJE 4LTDA 4WNAA 1KKUA 3A2MA 4ZOLB 4QJ3A 3IE2A 3VPSA 4YMSA 2QBYB 4EL5A 3BFKA 4Z5XA 4TGLA 2O3SA 1HV8A 1HE3A 2RH8A 3GMTA 1KK1A 4MDYA 2JI9A 1LVHA 1ZNQO 2CWDA 3IHKA 3MB5A 4FW9A 1BD3A 3FR7A 4HQ0A 4TV8B 1H2WA 4D6XA 3OPQA 4MW2A 1V5EA 3EJWA 2FR0A 1LC0A 2R5FA 2Z30A 3LTEA 4OTZA 2XSZD 2PMEA 1TA9A 1TKRA 3U31A 1IZ9A 1YQEA 2WD7B 3AEKB 3WLOA 5L3VA 3NBMA 2ZB3A 1Q3TA 3D4PA 4MVJA 1NVVR 2GX6A 5CX1A 5ALIA 3UOGA 3VV3A 2LNDA 1PSDA 2G8LA 1TK3A 3C3EA 3BCUA 2VO1A 2QW0X 2VSXA 4P8RA 4TWBA 3PQ4A 3M6FA 1EWRA 4IFEA 3UK1A 1HLPA 2PT7A 4LJ6A 1GSIA 5TR9A 3KOMA 2PQ0A 2Z3WA 3LKVA 2X4LA 1KARA 2I4LA 1DQYA 3L1HA 3ZI0A 4CF7A 1JDSA 3LM8A 1NQUA 2MSNA 2QMHA 3P9XA 3QXGA 2QRNA 4BWVA 1L7DA 3HJFA 1KK3A 3AH8A 1SH7A 3MT9A 1GTMA 3LGSA 5DSZA 1PJBA 4IIJA 4X63A 5CH8A 5DWVA 2DC1A 4NEGA 5KQSA 5C5IA 1YZVA 1TI7A 4GOMD 3M6AA 4IXWA 3UWSA 2DHDA 3SKYA 3ZWDA 4HGOA 4AC9A 4BEBA 2ZRJA 4AF6A 4UUMA 3FM9A 5LA6A 4ID9A 2FZEA 1UBCA 3SI7A 2ZSUA 1DQPA 2F9MA 5EJ6A 2WU3A 2X6QA 4D4IA 1E9SA 2D5IA 4KAFA 3EEFA 3VZDA 1DO0A 2C2ZA 1YUBA 1VHLA 3V46A 4G1EB 5K09A 1DTSA 3LCVB 1KMHB 1IUPA 1WMFA 1KPHA 1S02A 4M1EA 2LWIA 4EGFA 3DVQX 3CY6A 5HKAA 1K8XB 4HB0A 3D2AA 3MTQA 4ROTA 4WN3A 1PDVA 4LYFA 4UU0A 3UHOA 3ZTWA 5KOIA 1RHJA 1EFPB 4NPHA 1SK9A 5TMBA 1GVHA 3HB1A 5BVGA 5LOVF 3AFIA 4BRUA 2RGEA 3SSOA 4D0NA 1UPBA 4C4RA 3IESA 3H2KA 3QVSA 4HZIA 3SIRA 4PONA 4NDAA 2PZBA 3WYEA 1J9GA 4JOSA 3SC3A 3ZDQA 4X00A 1Y7LA 2VJNA 4OHBA 2FPIA 3FNBA 2C0QA 3FBGA 4D82A 3GD7A 1VIVA 1C7IA 4LOJA 5LBIA 1L5LA 3B6MA 4FFBA 5TMEA 5AQ1A 1FMFA 1G9XA 1W85A 2O20A 4ND2A 1VMIA 1OFUA 5K1ZA 1NP3A 2JS7A 4F84A 3QHPA 3DLAA 4PR3A 4XUGB 5FTMA 2RG7A 2E1RA 2J6HA 5I7VA 1YZGA 1G16A 3CNQS 4ZO8A 3W06A 3IL2A 2JKZA 3CF0A 2WAMA 3L8CA 4BATA 3F0TA 3GPLA 1QKKA 4UFPA 3ZEIA 4W4TA 4BAUA 3G2PA 1VCOA 1ZVQA 3Q8LA 4FZ3A 3T3NA 4WW0A 2G3YA 5IZCA 3QE3A 4IUDS 4R05A 1O5OA 3JYPA 1SO8A 1MJGA 1ORIA 3ROTA 1JAIA 2GCGA 3JTEA 4BX2A 3QJGA 5IVHA 3MJHA 4HRVA 4TM8A 2RI0A 1P0IA 1T4DA 3SSNA 4FBGA 1OKKA 4JB3A 1UKAA 1Q0TA 1VL5A 4OUDB 3NH6A 1FMCA 3NUQA 1UM8A 3BSYA 2C54A 2I54A 2PIAA 2Q0HA 4ZO9A 3TW4A 4ANFA 4WA8A 1I0IA 4HGNA 3C8DA 4CJXA 3EGEA 2PH1A 2D59A 2ZU0C 3SJCA 4EX7A 4BNTA 1C9DB 1J1ZA 4V03A 1ODIA 4PO8A 3ZLJA 2GZSA 2J41A 4NBKA 1U81A 5EINA 1EGAA 4EUHA 4ZAVA 2HSJA 3A6KA 3ZU6A 1A98A 2JHAA 3JVIA 4GP7A 2H48A 2ZAGA 4XDYA 4X3OA 5M04A 1XFDA 1GSAA 1AB6A 1A9TA 3ABSB 2J67A 1SCBA 2QROA 1BWQA 2FE1A 3FSGD 1NG1A 5ALUA 3V8PA 1DARA 2H7XA 2UVPB 2ZCJA 4J75A 2D5LA 3ZDYB 4DABA 3C3MA 2ISCA 4MLPA 5LQKA 4MIKA 5C35A 4IWNA 1S3GA 5B37A 4CMIB 2H4FA 4H2DA 5BOSB 4ESOA 1DP4A 2NV6A 1H0RA 1A9OA 5CFPA 4OHXA 3E2PA 4IDAA 3GGCA 1HFEL 1W5SA 3L92A 1IXRC 2W2QA 4I8DA 2AMLA 4KJZA 5FT9A 2PM8A 4PQRA 4DG9A 4RD3A 3C3AA 1EFDN 3TPZA 1HL7A 1FLNA 2WSBA 1PU2A 1JU4A 3KQSA 1Z8NA 4PFQA 4DDMA 2D4AA 2VPWA 3NJ8A 4HWRA 1V48A 4Z9FA 4ZDJA 2CEKA 2CB0A 4PLVA 3KVRA 4N5LA 3SXPA 1S8AA 1YONA 3TPFA 2OO5A 1NJ1A 1G60A 4O59O 4R8LA 2XYRA 2FP4A 2CUNA 1LBIA 4H3VA 2XNDA 4J6FA 4UUPA 3V2IA 4WZAB 3U7FB 3LX4A 4NZYA 1XEWX 4XGQA 3PHCA 1QYIA 2FEPA 4XRGA 1EUQA 2BKVA 4IW3B 4YXWA 3S68A 4ABYA 1PFKA 4IMRA 3HA7A 4E7PA 2PK3A 1A7UA 4M0DA 4O4IB 5CFOA 1FMJA 1E5QA 3R7WB 3G0HA 5CLQA 3WL5A 3QVMA 2HT6A 3UPDA 3HXMA 4EL0A 4LNHA 3B9QA 3BF7A 3HJBA 4KLNA 4YYZA 5JRZA 1XZHA 5E3HA 2YHAA 3U6BA 1IVSA 2HU2A 2ID8A 1GU0A 1UMCB 2R87A 3VKGA 3KYJB 4P53A 5KOJB 4JZKA 3PHBE 1XMQB 2HW8A 4IEEA 3EVAA 3AM4A 3KWJA 3EDCA 5AIBA 1GWNA 1DUVG 5IUKC 2JCVA 5J43A 1Y1LA 1W93A 2GKSA 2JARA 4FDUA 2JGKA 1OFUX 4OQ4A 1JFSA 2JLVA 1U8FO 1LLFA 1VKJA 2ZJFA 1A7AA 5FHRA 5GONB 5A6SA 2WPDD 3GWZA 1R00A 2DT5A 1B8OA 3PL5A 1PTKA 4L75A 4Y1GA 4UTZA 3G9XA 4MUYA 1IY8A 3B70A 3D31A 3NAGA 1BOFA 3HJAA 4IDNA 2TMYA 3T35A 5JZVA 4P80A 3M6IA 2Q9AA 3BL6A 5JSYA 2HB6A 4E5NA 5KQPA 1RWWA 4GX5A 1A8IA 2PNFA 4LOAA 2QRHA 5HGXA 4PLZA 1ZSVA 2XXJA 4P54A 1FVXA 3U9LA 1OBHA 5JLAA 2VTKA 1EXNA 2WKQA 4WEQA 2H59A 1QGDA 2YHSA 4FFSA 1J22A 3QWBA 2WPNA 1ADFA 3ETEA 3QV1A 4M1ZA 3VH1A 2QLFA 3TTUA 4MRMA 4H3SA 1PJ4A 1L7XA 1UT6A 3VDQA 3V33A 2WB4A 5LZ2A 3RIXA 1GA4A 1F5NA 2OHVA 4RXUA 2YS7A 4Z2AA 1YRAA 2QG9A 5HFNA 3HPQA 4MW1A 2AOUB 3B1YA 5FI5A 2BR5A 3TVTA 3K0HA 2O9JA 5FUXA 1IWPB 3VZPA 5CA1B 4IF4A 1M6VA 4M1KA 1S2MA 4Q93A 5HF9A 3KKQA 2Z8ZA 1BNCA 4BNFA 2XZOA 3IE1A 1B26A 4KQXA 5F1YA 4O63O 5G4KB 1TM7E 2PUHA 3T4XA 5FQOA 2JJ8A 3CPSA 3KP1A 2GZ3A 4Q9DA 3RJTA 2C8KA 3RO7A 2EQ5A 5TRTA 1T2CA 1Y63A 1Z35A 2Q5CA 4OI1A 1P7CA 2NADA 5I4KA 1FQOA 2DHEA 4OBXA 3DJYA 4TTSA 3G0OA 3EPLA 2C20A 3TIVA 3VNBA 4Z7JA 4I8XA 5DGIA 1YJQA 4WOKA 3Q3HA 3R6TA 3ZS9A 2H0RA 3HJTA 3W9UA 2NZVG 1WDLA 3F78A 2J48A 3SE7A 1ZM7A 2C78A 2DQKA 2GEVA 2VOEA 2PKXA 4HEQA 1ODTC 1B0ZA 2ANBA 3JV7A 4R2MA 2R48A 4L7VA 1N75A 3CZ4A 2K4MA 2ZJ5A 1EJ0A 3UYLA 4BNKA 5H4HA 2HCTA 4REMA 4I5IA 3C39A 2PL5A 3EFHA 2O0LA 1DLIA 2R6GA 2R8BA 3I9V6 3R5HA 4GYKA 4OOEA 1I5EA 4Q3KA 3SIWA 3SLRA 4BIIA 1HZZC 4HWGA 5J4LA 2HQ1A 5EFOA 2OWEA 4ARIA 3H4MA 4UBKA 1A9SA 4X7RA 2JFPA 3UBTA 2BONA 3G2MA 1YK1A 3WHLA 4INJA 5CM9C 5TEVA 1Y0BA 4OGWA 4D8XA 3ENKA 4UVGA 4KQ9A 2QYTA 4RKEA 4M0PA 5ECWA 1GCUA 1JQ3A 1QFXA 1VHWA 2W2NA 4AJKA 5BQ3A 2VRNA 4AJHA 1T2EA 1P4GA 2OA0A 2NYRA 1Z5GA 1KOJA 9GPBA 2UZ1B 5KYWA 3SJ7A 1QGUA 1DU4A 3TNYA 1MEEA 1OX4A 1X2EA 2J9XB 3CLHA 4LHVA 2CXSA 4QJ5A 4EHHA 1FDOA 4IJWA 1B8VA 3LPMA 1R9JA 1BMFD 4DQKA 1P0PA 3ML1A 2EWMA 4EFKA 1ZUNB 4ZZIA 4FR2A 1WCV1 2WR8A 4KQ2A 2GZHA 1XVVA 4EOGA 2AKEA 4EW2A 1W7AA 4XYEA 4D26A 1KU6A 3ER9A 5LQRA 2QW1A 1CC1S 5AM0A 5I9BA 2EFDB 1GARA 4B3IA 4LIPD 2FUCA 2WU0A 2INGX 2IIQA 4ZWNA 3IT3A 2IU0A 2Q3BA 2VG8A 4YPOA 4ENWA 3U4QA 2HH9A 3MAJA 3Q2KA 1YDGA 4RHTA 1CUYA 5KYYA 1Z5UA 2L19A 1ZI9A 3GJXC 3ND7A 4CKXA 3TK1A 4D41A 2PBLA 2HO5A 2XQKA 3K9LA 3M33A 1GV0A 4CETA 2GTPA 2C8VA 1MAUA 2C58A 4GXNA 1OIVA 3FPGA 3OE1A 3E18A 2P2CA 2OGWA 3UXYA 5BYKA 3KJXA 3REOA 2SHKA 2FN4A 3ZU5A 3OQIB 3MJEA 4H7KA 1V3QE 4MRNA 3M89A 4LI0A 4QTTB 2CNNA 1U2EA 1PVOA 2QRKA 1GTVA 4P3PA 3G7UA 1GRCA 3DCYA 4ALKA 1C1HA 1AGYA 1A96A 5I8ZA 2Y4NA 3GRUA 1UXGA 4OBEA 2FR8A 1JALA 1ZVJA 3EG9B 3MLEA 5H5JA 5CBPA 4MPDA 4AZ3A 4INZA 4ASUD 1YRQA 5EMMA 2OK8A 1EDBA 1IOZA 5A0VA 2YR0A 2XYVA 4NR0A 5TX7A 3MS7A 3ZVLA 3LYLA 3DLHA 4EY5A 2EAUA 4AMYA 1LC3A 1G5RA 3NKLA 4WACA 3H6HA 1NHGA 1W9HA 2LUOA 1UFRA 3CUWA 3EGDA 3G59A 3I3OA 3RRFA 3O82A 5IRCD 4OHMA 1NBME 4MKGA 4N5DA 3PIIA 5CH5A 1R74A 1P77A 3EIWA 3QJ5A 1H4TA 4HF7A 1XC7A 4KV7A 2LXNA 3L6CA 1N6HA 1OTYA 1PFUA 2UVQA 3BZUA 3MWLA 1RE1A 2F9FA 3U3XA 5CDYA 3T99A 5KWIA 4UVDA 1RYYA 2E6UX 2JI8A 2R60A 2X40A 3D5EA 5JISA 1QF6A 5JJLA 1RAIA 5IWCA 1WP9A 3I53A 5GP1A 4Q4JA 1ODKA 4MDFA 1VP9A 1X74A 1VPVA 1S2OA 2IYOA 2P30A 1U0OC 5DM0A 3F3MA 3U7IA 3A6GA 3SXJA 4XWGA 1Z0ZA 1NW6A 3FF1A 1XCMA 3MWFA 4BKOA 4LCEA 3A9UA 2WJVA 4FE7A 3AY6A 4GRAA 1LD3A 1GUYA 2BCJQ 3AHCA 3LQQA 2A9VA 3NXSA 1E2EA 1YZFA 5AM4A 2TECE 4HSGA 4P4SA 4XFKA 4Z0PA 1NUPA 1MPTA 1TIKA 3QHQA 3T61A 4QPNA 4PC3A 1P1BA 4ZQGA 4J0EA 3JXEA 3BD7A 5AVZA 4M0KA 2JL1A 2C2XA 2BSAA 3H83A 1RXVA 4WMLA 4LZNA 1KI3A 4Y1RB 3MPUA 4JROA 3W5AA 1YE8A 4CT5A 1O5TA 1UEXC 1GCIA 2RGXA 4LFBB 2ZWIA 4A6EA 1TVMA 1EE2A 2YWBA 3VR4D 1H8HD 1SXJB 2PZKA 5DNCA 2FPMA 1CUZA 3QTBA 3CWCA 1WNTA 2DJIA 5ULLA 2BDEA 1GFWA 3ZHTA 2CXXA 1VBMA 2YXEA 3WGVA 1H6AA 2XWQA 1CTQA 4BQEA 1N6NA 3ZW8A 4G4JA 4DQXA 1VLQA 5C1IA 5BV2P 4JBYA 1FTGA 1T13A 1Y80A 3MW8A 5GY7A 1ST3A 1ZOPA 2RGNA 4FQ5A 4ZDIA 1MD9A 1MUUA 5E38A 4EGJA 3CRW1 1Q0PA 2G70A 2ZIGA 3MMNA 4KVZA 5E7JA 4FBMA 4HDRA 5KYTA 3BD9A 2B36A 1JUDA 2HA0A 2XIQA 3B3AA 4PN7A 2HCFA 1F4PA 2PGJA 3HPRA 4KN5A 1USGA 2QRMA 4XX1A 3PHLA 1R4NA 3H84A 4JVNA 2O3JA 4B1FA 5M29A 4AKIA 3A0RB 3T3EA 5K45A 3NGXA 4IMPA 4PYIA 4DZZA 2VSNA 3PDUA 1MO3A 3WL4A 4RAQA 3D6JA 4LYAA 3I5AA 4DY6A 3KU1A 1R0XA 3DBHA 4MWEA 3OKFA 1TCCA 3DMNA 1BJRE 5HF5A 5LU8A 3BZWA 3K1TA 3TOCA 2LIVA 4MA5A 3QQ5A 5JO9A 1ZP6A 4KNVA 2XQGA 1DEXA 1Q92A 2HSEA 1AB5A 1L5MA 2COKA 4DG8A 3TSCA 3CZQA 3ZD7A 1P29A 4MP8A 1C9YA 3ORYA 5E6RA 1PR0A 5J58A 3OLWA 4G1FA 2TMDA 3QX7A 2X5JO 2Y0EA 1U90A 3H8JA 5C8YF 1GUZA 3R8FA 2YV2A 1Q1AA 1RAFA 4V0KA 1KE2A 5GPBA 4DBLE 1K5PA 5AXBA 1VPDA 3OUUA 2D0OB 1BX1A 5MF6A 4DMHA 1EDEA 1Q17A 1D4FA 1YJXA 2X5OA 4LSZA 2XQFA 3OZUA 3WLFA 5NULA 1H4SA 2WTUA 2PS0A 4L85A 4RKYA 4QQKA 4WJLA 1YQUA 4NBVA 1TZMA 4P9NA 4B7UA 5L9AA 3KYBA 4RIIA 1YB4A 2CDAA 2H1FA 3TW8A 1UKYA 3B3GA 5E7QA 5IUNC 2R79A 1JQ5A 3IP6A 5EJIA 2Z2IA 5DF1A 2I6UA 1VBFA 3UM9A 3JAKA 4U3JA 4F5DA 1MAAA 3REFA 3K20A 1ONOA 3QELA 2AFHE 3HEAA 2HL6A 2Q1UA 3WWOA 9ABPA 4O1IA 2PFGA 1IUOA 3KAPA 3C41J 4N3BA 3HDGA 1CE8B 3QM1A 1XCJA 2HV9A 3OZBA 3E3OA 4DYDA 1I1QB 1VLMA 3STXA 3TW0A 2F8SA 3BE5A 4GPBA 4DYHA 4QA9A 4R3NA 1OXUA 2H4ZA 1XU7A 2BFCB 2HRRA 4MRRA 3STWA 2B6HA 4KR0A 4UZSA 5C32A 1KTVA 3WRXC 4X7MA 1F6DA 1MB3A 3GA5A 4YAGA 3GX1A 3KD3A 3LLMA 1WS6A 1I2MA 2C2KA 2W2VA 3KEGA 4JEUA 1ZDMA 3UHJA 3ZHSA 1EVEA 5K3EA 4ZU1X 2AFHA 3KTAA 4K40A 1E3LA 3UT0A 4EDHA 4EZBA 4UDYX 1O6ZA 1XAHA 1OUMA 3HVIA 2BEVA 3MT0A 3O4RA 2YHBA 2Q2WA 3F4LA 1PWXA 1Z06A 2R8RA 1A88A 3C70A 1SOUA 3L0YA 1KZ4A 3Q9UA 4PZUA 1P72A 4D1YA 4KR7A 2VP2A 1ORWA 1RHKA 4B3RB 2Y68A 3LHIA 1E4OA 1NBEA 1N7HA 2ATEA 2VJQA 2X8LA 3S1LA 4XDGA 3DONA 3SCZA 3O83A 2APJA 4MQUA 1KZHA 4BQOA 3MJTA 4TS4A 3LJKA 3BJEA 2QW8A 4QGBA 3RK1A 2OD2A 2X4GA 2WWWA 2Z4TA 1WIWA 3EE6A 4O08A 4F2HA 3A25A 2QGZA 1SEPA 1Z2AA 4LX8A 2PGAA 1NLZA 2W2KB 3UICA 2YXDA 3GMSA 1D2HA 4OP2A 4Y98A 4ZI3A 3IV6A 1W4LA 5FTLA 3UV3A 2ZR0A 4U9HS 2WU8A 4XD7A 3WL3A 2NUBA 2OV2A 4FILA 2DLNA 1GILA 3LF1A 5AI4A 3GRKA 5BSMA 3K9NA 1UBHS 3AOGA 3I6IA 5AXDA 5HIAA 3PSAA 2HRBA 3D6MA 4RQTA 3E3AA 3E9YA 3M6WA 3KCNA 3OWOA 1XZDA 3Q72A 4KHZA 2P9TA 5CAEB 2YMPA 5E3JA 3RS2A 1VSUA 1SOVA 1PT8A 2EJWA 3LKDA 4ALMA 2GJAA 3DMPA 1P2GA 5HKBA 4K9LA 1UBTS 2CL0X 1LPPA 4I1RA 4RLFA 4JLPA 2YC4C 3TNFA 1Z9BA 7AT1A 4JJ8A 3ROMA 4BFXA 1OT3A 3Q3CA 5F78A 3JARA 4UATA 4C4YA 1NNI1 3LXMA 1UDCA 1ZHFA 1HMPA 4IIYA 4FDAA 4YJKA 1W76A 5F52A 3W4KA 1U8EA 4C2BA 1KJQA 3UMMA 4JK3A 1MQ9A 2C7VA 3FMOB 1Y8QB 1OASA 2ZJYA 3QITA 4GF5A 3R6DA 4DLSA 4X60A 2W42A 4AS1A 5C5CA 5G40A 1CY1A 3Q1KA 3NNSA 3FX2A 4IOMA 4NBRA 1XYGA 4R2IA 1RYDA 2ZIZA 1TF2A 1YQDA 3E3MA 1E79D 2BMVA 2BKUA 3GGPA 3LBHA 3RVQA 5EQFA 4UM7A 3VA7A 2Q9CA 4I50A 5EWMB 1F0YA 2HCJB 3HKBB 1MABB 4OHYA 3DVSX 3T5CA 3TJZA 3OM9A 2GILA 1JDVA 2AJ8A 5BPFA 3MGAA 3VR4H 2A5LA 2I1WA 4DA9A 3A4LA 3L8DA 4D99A 2CMGA 2WT9A 4GEGA 2X2EA 2A0WA 1P81A 4UHKA 2IEBA 1AVTA 5EPOA 3L9WA 2AI1A 3U37A 3PV0A 2Q6LA 3ZWQA 4G5RA 3ILXA 1G98A 4XEHA 2R9VA 3V97A 3ZYCA 3M3HA 2V45A 1RKXA 1U98A 1OXTA 2F48A 1I10A 1XZ8A 1G5PA 1QRDA 3G1WA 4W1SA 5AKZA 3GROA 1L4UA 2KYRA 1QZZA 1TVCA 3CH5A 1WUIS 2IX9A 2XEXA 4D0LB 4DJ5X 4XX0A 4BLQA 4M3NA 3HK2A 3OJEA 4AJ1A 1EKXA 1U65A 5BN4B 1GPMA 1Y34E 1SBQA 4KCGA 3V1TC 1D4OA 1GY8A 1DS6A 1I7LA 4AJPA 4ZZ2A 5TQ2B 3R77A 1GO2A 2NG1A 4BO4A 1JHRA 4D3YA 2WWHA 1OZAA 3D6VA 3JZDA 2DZDA 1ODFA 3OETA 1NF9A 2FSVA 1JJ7A 4H0CA 4I6JA 4F21A 4LK2A 4ZN6A 1AUVA 2ZRPA 1SG9A 1XV5A 2KQUA 3KPYA 5D6OA 3PTLA 1GKUB 3NM5A 1A1VA 3TJMA 4XUDA 1I32A 1Q14A 4LFCB 1K4KA 5DXAA 4AY2A 3CVWA 1I51A 3AIKA 4AUNA 3REGA 5JLJA 2CC2A 4NMWA 2Q62A 2QVBA 1YDFA 4Y2VA 2P7HA 3D59A 1A8UA 5K0LA 4Q24A 3PJRA 3VO2A 1L4NA 3AY7A 4Q01A 2O8CB 3MSXA 4NVRA 2B8NA 2IHYA 5UKDA 5HIJA 2EF1A 3JWPA 3DOFA 4C7OA 4DQVA 2HXSA 2Q4TA 4NARA 2FPPA 5CIWA 1CQZA 2AR7A 3O6VA 1IG3A 3BTSA 5JYBA 2WJ3A 4YJ2A 1NY6A 4NX2A 4QDUA 4ZGBA 2VJMB 3TE7A 1T6NA 1KK2A 3LA8A 3O1IC 2GHTA 3GFRA 1MB0A 3SE0A 1U3CA 2AJTA 2W6NA 1O94D 3MPOA 4PG8A 3FMGA 4QQNA 2V0CA 1DX6A 1F8YA 4K9KA 4FXOA 1R4ZA 1P7YA 2GH1A 3A4YA 3FFBA 3Q5EA 3JQFA 3TZLA 3W77A 4S1WA 2GJKA 5CJ2A 4GLOA 1A77A 4CKEB 1LWNA 2AXPA 2NP6A 1P4HA 3HA2A 5CX4A 1SGWA 3UFBA 2WKPA 1P60A 1T5HX 3BBPA 3GELA 4K9MA 4P0TA 1RDFA 5FWXA 5LLDA 4ZRMA 1ZD4A 4GLBA 4P4TA 3W05A 2G9VA 1X7DA 1JJFA 2GFHA 3GOHA 5ESXA 3WNQA 1F2VA 1NI4A 4IIFA 2BEJA 2C4WA 2GT1A 2ZYAA 4MAAA 4JJAA 2E9SA 3KQLA 3UT5A 1ZNZA 4X95A 1UBEA 3UV6A 1M0TA 2J87A 3HL4A 2C82A 4LG1A 1V1MB 1JXAA 2GD6A 4KYIB 4RVSA 3UMRA 3B1WA 2BTQA 3FRJA 4G81A 4PPGA 5AYVA 3CW9A 3G88A 3H75A 5CGZA 1BCRB 1Z2PX 4EPVA 2VJBA 3I64A 4B09A 4REQA 4Z4HA 3PFBA 2ZJ0A 2P90A 1C7JA 1HDIA 1GLNA 3RTAA 1FFXB 4QOIA 1ZGHA 4CLXA 1G5IA 3MLBA 1KJIA 4LJ7A 2HSZA 4IHKA 1Z88A 4F1WA 4YAUA 2QIPA 3THWB 2CHEA 2DTDA 3JQAA 5K20A 2WM3A 3PB3A 2GETA 3QX8A 4JJEA 4UTVA 2Z83A 3H1TA 1QS0B 3LIIA 5KVCA 1GGJA 2W9XA 3QPAA 4HC4A 4B7ZA 4CL0A 4ARUA 3OCYA 1IN6A 4RTOA 4C4PA 3FJYA 3TTSA 1HQCA 4KIUA 4TVOA 4B6JA 1A9XB 3DAOA 2Q4EA 1D8AA 1T5DX 2GJSA 3E58A