3DDOA

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with by phosphate ion at 1.5a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
240
Chain Sequence
b'SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQKQTSHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
molecule tags Transferase
source organism Salmonella typhimurium
publication title X-RAY Structure of the Uridine Phosphorylase from Salmonella Typhimurium in Complex with by Phosphate Ion at 1.5A Resolution
rcsb
total genus 85
structure length 240
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ddoA00
2I8AA 4DAOA 3BL6A 3UAWA 4ECEA 4F2PA 2A0YA 3PNSA 1Q1GA 4PR3A 4UC0A 4L5CA 4DA7A 1U1DA 4FFSA 4YJKA 3PHCA 1A9PA 5F7OA 2ON6A 1PR0A 1TCUA 4H1TA 4D8XA 5F73A 5B7QA 4TS9A 1Z37A 3ENZA 3O6VA 3E9ZA 1Z39A 5B7NA 4EARA 1CG6A 1ZL2A 4TXJA 4LZWA 1PF7E 2XRFA 2RJ3A 2P4SA 1A9TA 3FWPA 4GKAA 1Z5OA 1VHJA 5F78A 1VFNA 5IFKA 1PR2A 3KUKA 3FOWA 1A69A 1NW4A 3QPBA 3DPSA 1Y6RA 4TXMA 5EFOA 1SQ6A 4TXHA 1JDUA 1Z5PA 5B7PA 1T0UA 4DA0A 2QDKA 3IOMA 1JPVA 3T94A 1U1EA 1V3QE 3UAXA 4L5AA 4I2VA 4M3NA 1C3XA 5EUBA 1PW7A 4WKNA 1ZOSA 1RSZA 4GLFA 1RXYA 4R31A 4QARA 1M73E 4M1EA 1YQQA 1WTAA 3OZBA 1TGYA 2GUWA 4BN0A 1OVGA 4DA6A 4OEHA 2IQ5A 4JWTA 2HWUA 5C80A 1JE1A 5CXSA 1U1FA 4PNPA 3O4VA 4DANA 2AI2A 3KVYA 4D9HA 3UAYA 1TGVA 1PK9A 1PWYE 4JP5A 1SD2A 4F3KA 1JYSA 1XE3A 1Y1SA 1TD1A 1T8WA 1T8RA 2HN9A 4BMYA 3MMSA 4DAEA 4DARA 1Z36A 1OV6A 4LKRA 3DDOA 1JP7A 1LV8A 4GLJA 4OY3A 3EMVA 1A9SA 1PBNA 2OC4A 1TCVA 1OU4A 4D8VA 2Q7OE 4NSNA 1JDSA 4WKBA 4M7WA 1PKEA 4GMHA 4JOSA 3MB8A 4F2WA 3LGSA 2H8GA 1OUMA 1ECPA 3EEIA 4DA8A 3NM4A 4QEZA 1JDTA 3UAVA 3F8WA 5CCDA 1Z38A 1RXCA 2OC9A 3KVVA 1JDZA 4EB8A 3D1VA 1RCTE 1RYZA 5JPCA 4NY1A 3DF9A 1N3IA 1ODJA 4BMXA 1ODKA 3BGSA 2QPLA 3EUEA 1VHWA 3OPVA 3KHSA 1YBFA 1SD1A 1RXUA 1Z35A 1LVUA 4QFBA 4F3CA 1RXSA 5B7GA 1I80A 4L0MA 1B8NA 3DP9A 4L5YA 1RR6A 1YR3A 3ONVA 2A0XA 3KVRA 1Z34A 3NM5A 2OECA 1K27A 2A0WA 3FNQA 1PR6A 4E1VA 4OJTA 2PGAA 1LX7A 3IEXA 1VMKA 3OZEA 5F77A 3INYA 5KB3A 3FB1A 3C74A 3BJEA 2OXFA 1RT9A 1U1GA 4TTJA 3K8OE 3TL6A 1JDVA 3BSFA 4G89A 4OGKA 4L6IA 1PK7A 1U1CA 4R2XA 1YQUA 1NC1A 3U40A 1OTXA 4BMZA 3E9RA 1G2OA 1Z5NA 4MCIA 4D98A 1ODLA 5CYGA 1FXUA 1Y1TA 4G8JA 4IP0A 3SCZA 4LDNA 4U2KA 1Z33A 5CCEA 3P0EA 1YRYE 5F7ZA 1ULBA 4MARA 4LNAA 4K6OA 1A9RA 1Y1RA 3OF3A 1RFGE 2AI3A 4YNBA 3NBQA 3ODGA 1ULAA 3FUCA 3OOEA 3K8QA 1NC3A 2B94A 4F1WA 5DK6A 1V45E 1SJ9A 5F7JA 1CB0A 1A9QA 1K9SA 3PNPA 5I3CA 4X24A 4QATA 4MCHA 5IU6A 4WKCA 4R2WA 3GB9A 2HRDA 3UT6A 1V48A 4LNHA 3P0FA 1ODIA 4TXNA 1V2HE 4WKOA 1Y1QA 3OCCA 4OF4A 3OZCA 4P54A 4OGLA 1T8YA 4YMLA 3OOHA 2QSUA 3DJFA 4TS3A 4TYMA 5ETJA 2BSXA 1V41E 2HSWA 4QASA 2QTTA 1PR4A 1Y6QA 3EUFA 1PR1A 3E0QA 1B8OA 2A8YA 5CYFA 3FAZA 4TXLA 1T8SA 5F7XA 1QE5A 5CXQA 4QAQA 3PHBE 3LBAA 2ISCA 1K3FA 2QTGA 1V4NA 2I4TA 4G41A 5F76A 5FAKA 4DABA 1A9OA 5EPUA 3GGSA 4D8YA 3KU4A 5K1ZA 3UAZA 2AC7A 4TTAA 1PR5A 3NM6B 4KN5A 1OTYA 3OZDA 3LA8A 2AI1A 1JE0A 4RJ2A 4YO8A 4NS1A 4WKPA 4TTIA
chains in the Genus database with same CATH superfamily
3Q7QA 2VHWA 3CO0S 3KEGA 2YHAA 1COZA 2FUG1 2HHJA 3EEBA 3Q3HA 1JFTA 1G6HA 3JD1A 1MU0A 1XNQB 3UK6A 4ND4A 1VMEA 2CY0A 3UMRA 2R68A 1Z3IX 2J9YB 3PC7A 4BNKA 2OCAA 4CN9A 5CTAA 3UAOA 4YRNA 3OPMA 1HC7A 1GYPA 3RS4A 4IV8A 2HMYB 4BX2A 1WSAA 2EFHB 3AZPA 4IY1A 4CEIB 4NAUA 5ESXA 1GVNB 3TPFA 3C41J 1GIAA 3OG9A 1GU1A 3QU9A 4OATA 3AETA 4HCJA 4UCFA 1S2LA 1W36D 1EU1A 4KIJA 4OA5A 2JAUA 4UUAA 5IANA 3PNLA 2UYHA 3L46A 4EMSA 3PEVA 3B53X 4ESEA 5L9AA 4D74A 5AM4A 2P40A 1MB0A 1RWKA 3QG5A 1XZ8A 5AXAA 4B9AA 4HNUA 1TCUA 1FX1A 1JUDA 1XMOB 1AUQA 4GO1A 1V9SA 1A8UA 4LOKA 5KYTA 3PWTA 5J43A 5IKPA 1KRWA 4EZBA 4OV6B 4C1BA 3WYBA 4RTKA 1DFIA 4TT3D 2QUKA 3OF5A 1MPXA 3GY0A 1KYVA 2ZIUB 3WGLA 2WA1A 1AQLA 1ZVMA 3IMEA 1J21A 1S89A 2LWIA 2VC2B 4GOMD 5JNUA 5DDIP 1NVXQ 3LKVA 2K6GA 2RBEA 1Z39A 2HXYA 5CK5A 3RG2A 1KO1A 2BFAA 4JUBA 5FWDA 4EECA 1J22A 4D6YA 1K89A 1X7XA 3W8DA 4CL2A 1H23A 1B6SA 1ZL2A 2Q4BA 3PXXA 2VWPA 1YCHA 4GDMA 4DJJA 4L4UA 4YUXA 4R69A 2H8KA 2XRFA 1XQ9A 4HNAB 3T5BA 1WD7A 2CJWB 2RC5A 3PCTA 1SXJA 1ZOIA 1YK1A 1F1JA 2XB8A 1EK6A 1BEEA 4RKFA 3FF1A 2P5UA 5T4EA 4MEBA 1OLXB 4YAWA 4MW5A 1K7EB 4IVPA 4QT0A 4U7WA 2G0AA 3ROPA 1T34A 4IO1A 1ZOPA 1KR5A 5G4KA 3VZPA 1Z29A 3MG9A 4D4HA 5E7QA 1L3IA 4HX2A 4N41A 3OZXA 3IUJA 2NQTA 4Y9SA 2BZ0A 2PGNA 1U3CA 4DXDA 2ZZKA 1JMKC 3P4UA 3WAKA 4M1OA 1C7FA 1ZJ6A 3CZ5A 4FKMA 5E1OA 3OZWA 2DR3A 2Y05A 1X15A 1JDUA 4LISA 1Z5PA 4Q9NA 3MW8A 5MFPA 3RREA 1DQPA 4ZQHA 1GADO 2IXEA 2BELA 1BH2A 4R9UC 2WU0A 1YJXA 5CJPA 3V7WA 2R6CA 4DOMA 5I9IA 1U3DA 2D3TA 1T3HA 3F8SA 5C18A 3GARA 4GL4A 1EXWA 1JEYB 1V3QE 1T2VA 2SKCA 2XVMA 1GUZA 1IZ8A 2YS6A 3BIXA 1SC3A 3UK0A 4UUBA 3AMVA 4MVCA 5A3RA 2CCJA 1W4CA 1XZPA 3RUHA 1JKIA 2JJ1D 3NUZA 3O3OB 2ANBA 4HQNA 3R7NA 4H1UA 4GOJA 5GPBA 3OY2A 1HYHA 2XGMA 1KU0A 3HSSA 5BOSA 3N6VA 1IG3A 1CQPA 3UATA 1OXKB 2Y71A 2ZZMA 1E9BA 4EO7A 2A57A 2X9VA 4PQRA 3C7KA 1YSCA 5K09A 5M3BA 1QLWA 2GEDA 2O8EA 1XA0A 5REQA 3H6GA 2D5LA 4UEQA 4CIBA 2GUWA 3AUSA 1KDYA 1VPLA 2VP6A 3D64A 4YCBA 1N5IA 1TVCA 4DA6A 4EHAA 4DFDA 1ZI8A 4P31A 2J5RA 4KE9A 2MIIA 1T5OA 3BRCA 4QPCA 3RTCA 2XXJA 2ZUCA 4X8LA 2ZYWX 4BB9A 4GSLA 4BTEA 4V0SA 3TQTA 3IAM1 4PR0A 4R5HA 1FFXA 1TC2A 1SCAA 3ZJ4A 4ZDWA 4DLTA 4OQNA 4RDXA 3V1YA 2TMKA 2NZYA 2W6JA 3LOUA 2P8JA 2OK7A 5T4FA 3E35A 3T41A 2C8JA 3MJRA 1CQIB 2I87A 1PW5A 3WVNA 2F8TA 1ZCJA 2VDOB 2X4GA 1JHMA 3GLKA 4IIHA 3FSRA 4BBPA 2R2GA 2EVWX 2IBMA 1SEVA 1U2GC 1L8QA 4C7BA 3AF5A 3G8CA 4GBJA 4QOFA 3U3KA 3K72B 1K4MA 1F2TA 2IITA 2G28A 5BVGB 3PCRB 2FK7A 5JD3A 1F0KA 5DNCA 1N2XA 5G0TA 1B15A 5E4FA 1ZZEA 3MTEA 1E66A 1FFYA 1V6AA 4M36A 4MCAA 1EFKA 3FUTA 4J2OA 4HOYA 3KSMA 3OKAA 1WXQA 1OU4A 3FLMA 4FKBA 1KORA 3R7FA 4LY0A 1BJTA 1COWA 5FUXA 3TDNA 1I1QB 2DHCA 2E48A 3WSWA 5BNTA 1V26A 3FTFA 1FRVA 1QHHB 1GAQA 1QHGA 3TSWA 1M1UA 2G36A 3JD4A 2YXEA 4B3TB 2HBRA 3LXRA 5FULA 3WLMA 1YA4A 1A4RA 4JI3B 1X6VA 3OIVA 3L0DA 1K6IA 4MW7A 3F1KA 4RXTA 4HB4A 4XWTA 3UHPA 2ZIFA 4PHTA 5LXTF 1ZH4A 1C1DB 1Z6GA 4N7RA 5DHAA 4Z49A 3MOIA 2FX5A 3BMCB 1JLSA 3KKEA 3L6UA 2KE5A 1ZGGA 4OJYA 2FKAA 2V5UA 3FXAA 4AN1A 1S7CA 3DEFA 1JQLB 3QM1A 5B2FA 2PLNA 4B7XA 3VBCA 3CEJA 3AW9A 3QLVC 4ZVOA 2G80A 5A62A 1IPFA 4QU5A 3KNZA 2CSXA 4NBSA 1KFJB 1JDTA 1T9BA 1G3UA 4A03A 3BGIA 1KO5A 3PUIA 4B8ZA 1Z38A 2I2FA 4FHZA 3M49A 1UT6A 2VRWA 5TT1A 1SVLA 4Q9KA 3X1XA 3GZTB 4WY5A 4CIXA 3KVVA 2V65A 1Q0SA 1O9BA 5CXUA 1JV2B 3C14C 4BTLA 2NUPA 1EDOA 3ZVMA 1D4ZA 4V0MA 5EP1A 4PSDA 3H3FA 1NL3A 2GM3A 4OL0A 3NRBA 1U65A 5THXA 3VR4H 1YDMA 4RKEA 3SBEA 2ZYIA 4G8DA 2DYKA 1AXGA 2FF7A 3FOBA 3FJOA 1X7DA 1LGYA 3AUYA 3VAZA 2IVFA 2ZKIA 4YJ2A 3O82A 4GZLA 3H5TA 4MJLA 4V38A 4H7DA 4E6EA 3PK0A 3ZXUB 3OLQA 1B7GO 3FE2A 2QGNA 3GJQA 5TQVA 2LKDA 3DO5A 3NBZC 4RETA 5CM8B 3T8YA 2ZJ6A 4LE1A 2P2LA 4JLVA 1R4MA 3UJ7A 4KKXB 2WWYA 2VYCA 1J90A 2EJVA 2GPBA 1SUWA 2OLKA 1KS2A 2ZI6A 3KR0A 3KXIA 3KOYA 4FMDF 4OQXA 4QFBA 1K75A 4V3BA 2UVQA 1II9A 1VKHA 1FS6A 3QKSA 3R40A 4S1NA 5TQ2B 4YP6A 2FN8A 5L3RA 1U7OA 1N7GA 4N5MA 5DYIA 3T7DA 4D3YA 3JQFC 2BZ1A 2Z2ZA 1Z9BA 4L5JA 2VAWA 1DQZA 2OSVA 4JP1A 4QM7A 3R6DA 4BFWA 3ZDDA 1DT5A 1FOEB 2YXBA 3ETDA 5HA5A 3M6AA 2F8SA 2OCGA 1R3DA 4WHMA 4WI1A 3TKLA 3VGJA 2JAXA 4OLAA 5DXJA 2BGWA 4XX0B 4O4JB 1D2HA 1Z08A 3BE4A 5ER9A 4CKCA 2WEKA 4YLYA 5K0SA 1KZGB 1FRZA 5E6RB 2OECA 3ELDA 1H6DA 3BG5A 3TNFA 3EGWA 2PX3A 3PQEA 5AJXA 1CRWG 1KI2A 1DIBA 3ACCA 4MX8A 4IIDA 1DXYA 2PFKA 4BOYA 5BSEA 5EIBC 4Y98A 5COAA 3NEPX 5EY5B 1H4VB 5E2IA 3T4XA 5EMNA 5HR5A 3K3PA 2EQ5A 2AFRA 2IYFA 2PXXA 1PVVA 4B9EA 4EDFA 4LYEA 2WU4A 4Q4HB 4TWRA 5HZMA 1J25A 1IHXA 4QG3A 3PI6A 1RACA 2YC4C 2YNMA 1P1JA 2ZSAA 4LMPA 4LV6A 3AR8A 4DKJA 1JDVA 1VBFA 3AFHA 3MTQA 1P1BA 2ZSFA 4IJ5A 4PYRA 4JHXA 3PE6A 4KFSA 1H2RS 3H1EA 5HILA 3B6JA 4QLBA 3BJIC 4L76A 1PK7A 4U6SA 3JAKB 4YY3B 2ZRLA 3JSXA 3K9LA 2GZMA 3QYFA 4D4KA 4LZPA 3T1TA 2BUAA 2PAFA 5FI1B 1KDRA 4L08A 4PN3A 2CW5A 3TGWA 4CM9A 4MCIA 2CDRA 4ZJUA 3NUQA 1O9HA 2COKA 2XCLA 3DG9A 3BAZA 3CRW1 5HK8A 5KYWA 2ZETA 3I9V6 1G3MA 1RYHA 3Q85A 2XD4A 4C5CA 2W22A 2F64A 3EN0A 1TW3A 3G7NA 2P0AA 2B7BA 2QD5A 3HYTA 1U8TA 3IXMA 3VC2A 5CR9A 5KNCH 2X5JO 2P2GA 4D6XA 1KQOA 4KP7A 4URUR 4YP9A 2W00A 2XUJA 1ZXBA 4QYIA 1G5FA 3LLMA 2WMDA 2WTUA 5AW3A 4U7HA 4MGZR 4P98A 2OBBA 1NSYA 2B4KA 1W73A 2FZVA 4ZPJA 1JQ5A 2FUG6 5CCEA 3GN2A 3GOQA 1B74A 3PC4A 1KJQA 4J0HA 1PI3A 3BS4A 2H2DA 4XCQA 3OFND 1C80A 3NG1A 1TCAA 3WGTA 3ROEA 4YRFA 4PN7A 4B4KA 3WFIA 4TMFA 4XVHA 5C8YB 1F48A 1ULBA 2XVAA 4EI8A 1MRNA 3DVRX 3WQSB 4UPDA 5J2TB 5BY2A 4MVJF 1P19A 1Z2PX 3IP9A 3G2NA 3HG7A 3FHTA 3KB6A 5BRAA 1J70A 2R6DA 5TARA 4TRNA 2D1YA 4QODA 3ZE9A 4X66B 2PKEA 2IK8A 3G1WA 4DKXA 1QGUA 3ND7A 1PJ4A 2FQ1A 1BDBA 3DW1X 1ZC4A 3GWGA 3NWEA 3OPNA 5L51A 5I45A 4Q9IA 3SYTA 3S2FA 2QUHA 3VX3A 2UZ3A 1Y8QA 4OBEA 5K6RA 3QVJA 3OIWA 1BOFA 1JSXA 1J9EA 2XMSA 2PKQO 3D3NA 1ZC3A 4EY6A 4I9HA 3ZCQA 4BX9A 3JAMA 1B14A 5H83A 2JIQA 2M2IA 2EZ4A 1YR8A 2VXBA 4CF3A 2I1VB 4RMGA 3C5WP 4R1PA 1E7WA 1TF2A 5KS2A 1OASA 2V1XA 2JA2A 4ESHA 1NNEA 5JCZA 2OD2A 4LNHA 2OHFA 1IM5A 1KP9A 1V8FA 3RIHA 3SOPA 4X3CA 3I6BA 5AVYA 1YAHA 2SICE 3WSVA 1Y1QA 1OX4B 4H59A 4LYJA 2F1OA 4DQKA 2NVUA 4YMGA 1FFXB 1YE8A 3QWFA 5H7XA 3HLTA 4PTLA 5EWJA 3UNXA 1ODTC 4AZ0A 5EQDA 3JARA 1II8A 1QIHA 4DCUA 1FYVA 2DEUA 1Y9AA 1ML4A 3EWAA 3MT7A 2XKBA 4RKWA 4Y9DA 4DCGA 3NHAA 4EQ6B 1LPSA 3K30A 4ZCSA 1BE0A 3R74A 2Q3LA 3H18A 2HY7A 4JP8A 1SUIA 1OYYA 4ZAZA 2II6A 4Y6GB 5EIEA 3KOWA 1R4ZA 5TVKA 2FPLA 5FFMA 1ULUA 1XCBA 5ITZA 2Q5HA 3OQPA 3WL3A 1QC5A 1X7ZA 1ZGHA 1FTQA 2YFQA 3EOZA 3I92A 1J33A 3KXDA 2PZBA 3NH6A 3CCBA 2PS9A 4HXGA 4W7HA 1EH5A 5K2OA 5FPSA 3I05A 4NNPA 2ZM6B 4DMHA 2V59A 4UVGA 5F7XA 3TFWA 4MITA 2XTNA 2XNKA 4RA6A 1EK1A 2J3EA 2VLIA 3VDMA 1Y48E 1G9XA 2QV7A 2PZGA 4NR0A 4MTCA 1HETA 1D7AA 2ATXA 4WK6A 2P8SA 3RUPA 4BX3A 5CA1A 3S40A 1FUYB 4CV2A 4RANA 1CEQA 3PYXA 1P2VA 2QAJA 1N2BA 3IQFA 3S8MA 1H2BA 2I22A 4KACA 4URYR 1YZHA 1ORRA 4MIOA 4PX5A 2JZNA 3RIEA 1MF7A 1DADA 4Q4CA 3DLIA 1SBTA 4WXEA 2XA1A 3R7WA 1MEJA 2VS1A 3JRNA 3LO5A 3TEMA 1Y98A 3H7AA 5LQSA 2DP4E 3D6TB 2IS1A 3CSUA 1C2YA 3Q6NA 3W7AA 3CGWA 2GPAA 3RTEA 2AV6A 4BJ6A 4DABA 4JD5A 5LL6P 1GA4A 1H3FA 1M2OB 1P1IA 2ATIA 4BJ3A 5CB4A 3HFRA 3SSAA 4U00A 4Z0NA 4GLBA 4CE6A 1SZJG 2XOKA 2IW3A 3W8EA 3FX2A 4GMKA 2QE6A 3PDIB 4Q3LA 5EXXA 3EYWA 3WMGA 1S5PA 2FMKA 3D2CA 3ED5A 3GBSA 3I8XA 1O4WA 4G0PA 2FKNA 4EAQA 3E5MA 3ADCA 1V9CA 1G8HA 1H8HD 1KJIA 2PMFA 2UZIR 3ZNNA 4DBZA 4J43A 3I39X 4Z4CA 5JVDA 5C35A 1DRUA 3ZZUA 3IS3A 2NTYC 4YYZA 3AEZA 4J3JA 5F4ZA 3QX9A 2DPGA 2LV8A 1KYTA 4Q6BA 2AOUA 1DO8A 1EDEA 2JHPA 5JWRA 1JIUA 2GILA 5TS2A 1EJ6A 5LU9A 1RM5A 2A94A 2YR0A 3B9QA 1JLLB 4FILA 3ZWQA 4MMXB 1AKVA 2JFHA 5BQXA 2HA4A 2VHCA 1JR6A 4QO8A 2FWMX 3MBOA 2V3CC 2IHZA 4XR9A 3RIXA 4MAMA 3TLAA 1UXJA 1F1BA 3AX6A 4U7PB 3IEKA 3A6HA 2QROA 2QRZA 5B1YA 2X76A 4IRMA 2AK3A 4GVPA 4RLFA 3BWEA 3JXEA 1YR7A 2VPXA 4HMPA 4OB8A 2R00C 4X8OA 3SIXA 2VHUA 3D4PA 1T5TA 3HFJA 1VB3A 3AG6A 1X94A 4UC0A 3BF8A 2X0DA 4K8RB 4DV1B 1XTBA 2IEAA 3L8FA 5EZ5A 1NG9A 4KAFA 3QW2A 3OIYA 1XPRA 1MUUA 2QRQA 5J9FA 4DBVO 3N74A 5D3ZA 1TCBA 2W6ID 1MJNA 4N76A 2IS2A 5DT9A 2PMDA 1NP7A 1RVV1 2BBOA 1KEUA 1MGOA 3DVAB 3O92A 5AKKA 1HG1A 1UOOA 4DR4B 4HEA6 2ON6A 1VHLA 2NTEA 3JWEA 2AA3A 2ZUVA 4MUBA 4ZYUA 3WLEA 4JI8B 2Q0SA 5GWXA 1BW9B 3T0FA 3UG7A 3K9BA 2DLCX 5LVAA 1E63A 2JGFA 4NEGA 4RZUA 3UJCA 4G9EA 3PL5A 4YRJA 4AF8A 3R41A 5JNRA 4JI7B 3L04A 1IBRA 4RS3A 3Q12A 3SLKA 4FHFA 1QDEA 2D8MA 1FNSA 3WQBA 3RFVA 3RVJA 3T7IA 4Z3DA 1G7TA 3L7OA 5KU7A 3JD3A 2KB0A 1SCNE 1JZQA 3NHMA 4YIKA 1Z25A 5AKGA 3PGJA 5CW2A 3JQGA 5KTKA 4X91A 4G4JA 2DUWA 2H4HA 3SLRA 3ZIAD 2BEVB 4BV9A 5CT8A 3MJTA 1P9RA 3A11A 1BMQA 3AIMA 4FE4A 5FUWA 1WMSA 1GP2A 3Q3GE 2F2TA 2ZGVA 3GLGA 3O38A 1OFGA 4JA0A 1U2ZA 2F1JA 5ITWA 2F3TA 3ENQA 3FOWA 4HB3A 2MCFA 1R6UA 1SUBA 4M76B 5LR6A 1S9HA 2OZVA 1MD9A 1IB6A 1Z0IA 1P2UA 3JQPA 4H31A 1GCAA 1OAOC 3UV6A 1CUSA 2XT6A 5F23A 2HNAA 4F3RA 3FCOA 3YASA 3OE4A 1YACA 1KI3A 3HY4A 1O58A 4QEKA 2VJMB 5EZYF 1V37A 4CT5A 3CVYA 4AY3A 2DBQA 4BU1A 4XEUA 1W1IA 1T0UA 4EZEA 3L77A 2VQ3A 1CETA 1T8PA 2X42A 4X6LA 2NUPB 1RAAA 2GF2A 4AVYA 3NDPA 4D9JA 5EQTA 1ZR2A 4DIOA 1BXGB 5I5GA 2AWNA 3SICE 1GPUA 3U3ZA 3ZGXA 2E4WA 2C77A 2XDAA 1CJSA 3BD8A 1A95A 5CXXA 2FPXA 3Q15C 2N75A 3QUSA 2H1VA 2Y1OA 1HR0B 3CVXA 1P6UA 1U0JA 1KYYA 3TUJC 4FM9A 5JSFA 2BGIA 1GLGA 3IDFA 1I6MA 2OR3A 1E79D 3DHNA 4KJXA 3WTBA 3RJZA 1PIWA 1JJBA 3P2IA 1DC6A 3S2GA 3WLQA 1RMYA 2IS6A 1YDGA 1B8VA 3PHGA 4E07A 1GZ3A 1H6AA 1KNQA 1RIIA 1RQNA 1YOBA 2RMKA 3FHJA 2ENWA 2Y0CA 3VYVA 3J81k 5HHTA 2PA3A 2VJMA 4Q24A 4CIDA 3HJFA 3UWKA 3VHXB 4JLDA 3ICPA 1JFFB 3A2NA 4YV7A 3T9FA 5KOJB 1E18A 1PE0A 2DWQA 3OLZA 2JLZA 2C42A 5AM2A 3R3UA 1RAIA 3KQUA 2NSYA 2O3QA 1JPNA 4P2BA 2HDHA 4L73A 1P5RA 1UXOA 2VT2A 2YH2A 3TZQA 4EJMA 2CN1A 3K9QO 4ITUA 3CN7A 3QX8A 5C1BA 5AW1A 4CG1A 1N0HA 1MLDA 1JA1A 1YBAA 2QAIA 1RM3A 3MWFA 4DG9A 1NVBA 3BXOA 1NAIA 2DOKA 4NV3A 2B92A 1BKYA 2CXXA 3WX0A 4BMXA 1ZI9A 3EIEA 3H16A 4ZO6A 2ZRDA 4BAGA 4KCGA 4GDFA 2Y2UA 1OZHA 2FSIA 2H7XA 1FU7A 4GZ5A 1QZXA 1UL1X 2GZ1A 4IIFA 4OH1A 3O9VA 3AXSA 1ADBA 2ZRBA 2Q07A 2O8VA 1XE3A 4KK4A 4KQ6A 1NUTA 3E0XA 5D86A 3RGGA 4G67A 3I1YA 3LT1A 3DFFA 4KI7A 4XQGA 5BW6B 3RRMA 2HN9A 3WHPA 5KOHA 1UZMA 4WFJA 4UAVA 5AI6A 2X1VA 1D0SA 4FGUA 1ZIPA 1MN6A 2E5FA 4L15A 5AH0A 5HJ5A 1VYVA 4XLZA 1FXWA 1XMXA 2GD6A 2XYHA 4MCJA 1UT8A 1PLLA 3FDZB 3LYHA 4Q4HA 3Q7PA 4LQLA 2D5BA 2P3QA 4GBGA 1HE4A 5IXYA 2WIGA 5LWHA 1LJUA 1T2FA 3EVBA 4QXQA 3I6QA 3A28A 1W36C 2TECE 2DHQA 4JR0A 1M1YB 5DPMA 3RYFB 4ZALA 4X20B 4F8EA 1OI3A 2JFVA 2RGGA 3AHCA 5BSKA 1FLDA 5JNVA 5CM2Z 1RZUA 4PSUA 4TRMA 4UAJA 1SBHA 2RIPA 4YBZA 1L6RA 5D84A 3RSOA 1ZD2P 2J8ZA 3KETA 2YXDA 4C87A 2IYPA 2D6FA 1MXFA 1S2OA 5GZ1A 2O50A 2WW8A 3UB3A 1YZKA 4RAOA 4ZV4A 2BUBA 1IIRA 1W94A 2J3KA 2XD9A 1ZIDA 1B41A 1MC8A 2NZVG 3FZEA 3IQIX 2P1RA 3K4HA 4HFNA 4G1FA 4Z1MA 5JSYA 2NUTA 3WGNA 5I9SA 1U7DA 2G8NA 2R62A 3T7AA 3KPVA 1GNPA 2XXAA 4J1SA 4R2KA 4ZCLA 3E7WA 3KFLA 1MCZA 4BLRA 1XSEA 4C0AC 4CM6A 3IIKA 3ZD9A 1YZQA 3BK2A 5IWCA 2WKQA 3I28A 3NETA 3LQRA 4TT8A 4DPLA 1H1LA 4CIYA 3EZ7A 3GJ7A 3PNQA 1FMCA 1AZWA 3IQEA 3V8EA 4E5YA 1XZBA 3WLPA 5JJLA 1Q7TA 1WD5A 3GA7A 3O0DA 2AFVA 2DPHA 2Q5EA 3DC2A 5JE8A 3VJKA 3EGXA 3WMEA 4S1TA 1E7SA 4MV4A 3TO5A 3L7MA 3QA9A 1ZDMA 4PCVA 4PRKA 1JVBA 1FTWA 2PWYA 5J4HA 5IVHA 2OK8A 3E8MA 3ZGNA 2IUFA 2J48A 1PJAA 1CDZA 3E4DA 3L6EA 4HGRA 4LF9B 3O9MA 1JJIA 3CTMA 3LUDA 1TKCA 4KMSA 4M9SA 2ZWPA 1E3IA 3FYUC 4MUFA 3ZWPA 4DDHA 5ITSA 1XA3A 1FVOA 3CG4A 1N3IA 1P1RA 3AT1A 5JATA 3WC4A 1SB8A 3GMIA 3TF5A 4X3OA 2WSSA 4NBUA 4RTJA 3I37X 3A9RA 3G2MA 4L57A 4TWAA 3DVSX 4HH4A 1N5DA 3BGSA 3CTPA 5JWHA 1K7FB 2RGAA 3NV9A 1BXRA 2FSVC 5T67A 1XAGA 4A5SA 2WM8A 1PNOA 4QPDA 2OAEA 3PDUA 4OHBA 4PZUA 3U61B 2I2XB 4ZXPA 4A2CA 3VPHA 2WJGA 3F3YA 3CUWA 3L41A 3PKJA 2XADA 3FGPA 2G9ZA 3TVDA 2ADFA 4LE0A 4MYHA 1DG1G 1QXSA 1NKVA 4EO4A 3H5IA 1U0RA 4U9HS 1D0VA 2PUVA 2ZSEA 3CS3A 3NCHA 2CLMB 4IWNA 2UUAB 1S2IA 5BNFA 2D7JA 1KAQA 1VL1A 3OTIA 3Q0EA 4IXMA 3TRIA 3DBLA 2FQYA 1PV2A 4XX1A 4AJOA 1XZDA 1J09A 2GHTA 4AW9A 1BVHA 1JYEA 1DTWB 1ESMA 1CX9B 2B4YA 2PGLA 3ICCA 3VUFA 2PGOA 3DP9A 1L5SA 1L4MA 1XTUA 2ECQA 1ADCA 2VDLB 2YWRA 1G16A 1BWPA 1B43A 4QOGA 4GICA 5SY4A 3K05A 3LKDA 1CS0A 4XA8A 2H48A 2QJRA 3L4BA 4NCBA 1K63A 2HYIC 5JZMA 2OFFA 1CJMA 3NM5A 2Z3WA 1HQDA 4KODA 5KWIA 4OI0A 2MYTA 2PGDA 1RFLA 2XIJA 4H0CA 3KFXA 4UTOA 1UXHA 5ISMA 1PR6A 1EHIA 1U4SA 3NOVA 4ZV9A 1MX5A 2AJDA 4M22A 4LGYA 3RCBA 5HE8A 2CUKA 2QZPA 3M3DA 4WNAB 1WXIA 3OA0A 5BYKA 4NOKA 3F5DA 4TUYF 5FOSA 2YUTA 3EW7A 4OXXA 1RWOA 3QQPA 4MVJA 5A9TA 2JCGA 1PZFA 1HDZA 1U5BB 2WJWA 3RJ9A 3UFBA 1L4HA 1R16A 1TQ8A 2F67A 2JFBA 5FBLB 4RM2A 1KMHB 4X1OA 3IODA 1M1XB 4FGLA 1G21A 2JLXA 4ZVRA 1IONA 4NDZA 2FGJA 2XYRA 1E3JA 5TDHA 3CUYA 4MKZA 3ROKA 4IJMA 4DLVA 4D3DA 2ZTHA 4TRRA 4AAYA 3KYCA 5DNDA 4BNXA 2AHOA 3OSUA 1CVLA 3I6IA 4R2XA 3TZ6A 1PFQA 5L95A 1TFRA 3CVVA 1PU2A 1R0YA 2XTAA 3GFQA 4ZKDA 4P86A 3GJ0A 4JGGA 4X61A 5FFNA 1QIFA 2B8EA 5EP3A 1V96A 3S70A 4RAQA 1KSJA 3CR8A 1I7DA 2DVMA 3E9RA 2OYSA 3LCVB 2XOXA 3MGAA 3N2GB 3NPMA 2FHSA 3VMFA 5COQA 5LQAA 3U0VA 1E3WB 2QPAA 3FBTA 1BMDA 2WDZA 1AKTA 2RHOA 3DWEX 3EW9A 1ODLA 3AETB 3JV7A 4UUOA 2I99A 4JVNA 2NU8B 1LLCA 2GNAA 3RVOA 5CBPB 5J3JA 3NVDA 4DW8A 3BXHA 1DKNA 1NZDA 4BBAA 3B13B 2DT8A 1GGFA 3KQMA 4KMMA 4WASA 4EX6A 1XN4A 2NU9B 3QBEA 4PY2A 3SCZA 1A82A 3CEPB 3BSYA 3FPEA 3HSYA 3W5AA 5IVKA 2FMTA 1ZICA 3EISA 2WTNA 1ESCA 1H6BA 5J2UB 1BS2A 1Z33A 3VSEA 4CKCB 1GCGA 3W0LB 3W8FA 1S8FA 1NUAA 3LDUA 3B3GA 2C04A 3G2LA 3UPUA 4JB8A 3NTUA 1RI5A 4JJZA 1NF9A 3G82C 3HB1A 3JWIA 2FRDA 3HYLA 4RU1A 3RFCA 2DULA 2Z30A 3U4CA 3TH5A 4HY3A 3NT5A 5JOQA 3QUBA 3C6ZA 4CMGA 2F3UA 1G5RA 2C54A 1WIWA 1FUEA 2YWBA 1J07A 5AVJA 4AZ3A 4B8WA 3I04A 2QN9A 3GJTA 1JBQA 1MT0A 2ACEA 3D3JA 4H7JA 3U1VA 4GNRA 4CEHA 5FPKA 3WKEA 1NN3A 4ENWA 2F43A 2A5GA 1VBNA 2CDAA 1NC3A 3FUVA 2ID9A 4ISCA 4KSBA 4JKOA 2KM1A 1AHHA 4RIIA 4BCBA 2VJCA 4EEZA 2HJRA 3IIMA 4I1SA 3QIAA 1MB2A 1WLSA 4XWAA 4DWOA 1YVDA 2W6QA 1H0RA 3COVA 4XARA 2C9MA 4MWTA 4X0EA 3GJYA 1QS0B 2EIXA 1DHRA 4A1OA 1C9EA 2CLCX 5AM5A 3T9AA 5EOVA 5JASA 5T4BA 5KWSA 3N5KA 1VYUA 2HXSA 4N0EA 3DB2A 4PXSA 1YA6A 2B69A 3UT6A 5LQJA 3TW0A 3U37A 3HS3A 3MGGA 4IJKA 2RHHA 1C0EA 2GSDA 1SURA 1V2HE 2ZPTX 3ROMA 1BA3A 3OY7A 4MV0A 1JILA 2UZAA 3HR8A 5B3JC 4P54A 3GLTA 2G3YA 2YV5A 1M5UA 3MCAA 1VSUA 3OOHA 1E9EA 1QP8A 5FNVB 2ZK7A 3P2KA 5LA6B 5IS2A 4V2UA 1KF0A 3FPFA 4GM4A 1XXLA 5CH3A 3RS0A 4MS4B 3ED1A 1RWPA 2AUTA 3TMAA 3IQZA 1IMJA 1QS0A 3BXFA 3ISJA 4L4RA 4MWCA 2GFIA 1JDPA 1YRQA 3O1IC 4P22A 2DWOA 3C3KA 2WHQA 3HUFA 4DVGA 3S8EA 2BE9A 2VHZA 3N6XA 1PR4A 3KP1A 1YL7A 1ACLA 1T4GA 5F9FA 2A86A 4QJ5A 2VJQA 1A88A 5FORA 1RAGA 1Z4MA 5TLSA 1J97A 1OYVA 2X4DA 4S3MA 4HFRA 2Q28A 5ALGA 2OHGA 1SVWA 2YWHA 1AHIA 4ZZ3A 4MQFA 5HPYB 4BB6A 1WX1A 3OZRA 4MZDA 2O20A 3A1CA 3JQ6A 1J00A 1E7YA 2B2CA 2WC1A 5KJ6A 4BBJA 2E1RA 2Y0BA 1K1EA 4ZHQF 5CXQA 2VDNB 3UEOA 1E9RA 2JGJA 2R7MA 5C37A 1JB9A 1F9AA 5HBGA 1FS4A 2IV2X 2YY6A 4B3MB 3F6YA 5IT5A 1KZ7B 3VR1A 3KCQA 2CZQA 1DRJA 3R5KA 1ZK2A 1LWNA 3KPJA 3BFXA 3LUGA 4ZVLA 4Y2JA 3E27A 4TV9F 2ZR0A 4I0WB 1JHZA 1YFZA 5IAGA 5CBKA 2XT9A 3HVKA 4EZIA 3BGDA 4GS5A 2YVAA 3ECAA 3S1LA 1E1CB 1ORHA 1P33A 2O2CA 3LPAA 5EJAA 1OT5A 2VIIA 1ND6A 2XF8A 1JA0A 1C9DB 3Q98A 5DHRA 3F9CA 2W0SA 5EKXA 3SVZA 3DAPA 1U3UA 3EVDA 3PF9A 3T95A 4X1IB 2VTVA 2RKBA 3K9HA 3PHLA 4DMGA 1XHLA 1Z74A 2RDMA 5FTMA 3QVXA 2P2CA 4Q3BA 2ZJOA 4QXOA 5HF8A 4F56A 3DE7X 3TW6A 3EVTA 3I01M 4MLCA 2CFCA 2IS4A 3RYTC 4C7OA 3D6JA 4JP2A 4Z99A 4D4GA 5ABPA 3B2EA 4MINA 1P74A 2ZI3A 2I65A 3H8WA 1SXHA 2XQFA 3ZXIA 2H9YA 1T2EA 4EPXA 3AUXA 3BCUA 5JARA 3FVQA 2AI1A 1JZTA 2QN7A 2HPHA 3LWZA 3H9EO 1HXHA 3C5VA 4LZLA 4QPJC 4GUDA 4V0KA 4YJ3F 4ZOLB 2IH4A 3U7IA 1YHZA 3E5NA 1J5PA 2FMXA 3C6YA 3JATB 4AJPA 4ZT2A 1K3UB 1JJAA 2QVLA 1UKYA 3BL6A 3QY9A 5F4BA 1K92A 3RRJA 4AMUA 4QSHA 4CYMA 1K8QA 2DHEA 2RGEA 3TRHA 1DX9A 3W3AD 5KWEA 1RAFA 1RYFA 4FGSA 1XTTA 4E11A 4FZRA 1TM7E 1TYCA 1V3UA 2EYUA 1YNOA 3S1AB 3D3WA 1KEKA 4RWEA 5IRCD 4N7JA 3WP1B 2VQFB 1XPJA 3E05A 1U1DA 1X42A 4O2BF 1Z63A 1VKOA 3OPQA 1IRXA 5KDOA 3OE5A 2OE2A 1QANA 2G7ZA 4MPRA 4TKVA 4BCDA 5D6NA 1EA5A 4FVTA 5K8JB 3C3PA 3MELA 3O4IA 1ZRHA 2JCYA 1K7YA 4LFAB 4IV0A 3B2QA 3C7AA 3KZVA 4TKZA 1L5YA 4MVJI 2XEDA 3TRJA 1AQNA 1DTWA 3ASYA 2HB6A 3PZRA 5H4HA 4GECA 5B7QA 2QRHA 1WG8A 2XNJA 2ZE5A 3DE0X 2VHEA 1BO6A 3IPLA 4MVJP 4MYDA 4MRSA 1NBOA 3ENZA 1FDSA 1PYGA 3GBVA 3B7PA 3M5CA 1TFUA 4M7PA 2ATCA 2IEIA 3M1IA 3MTGA 3KXPA 2OD7A 4ESOA 1FNNA 1N4DA 1QCZA 4LXGA 2OV2A 4DLAA 5E2AA 3VR0A 2C4NA 2C07A 1G5TA 2EX1A 3A9WA 4L6AA 3AI1A 1NAHA 2J5QA 2XVYA 2QU7A 4YLGA 3CWCA 4WNAA 4MKXA 3GLIA 5HX7A 1J2UA 7GPBA 5FH9A 1WZ2A 4TMKA 2BPOA 3NBMA 3CLTC 5E9QA 1BJRE 2DSNA 2C7BA 2DY1A 5CVDA 3RUCA 4WPGA 5LWQA 1IXSB 2BJWA 3ZHVA 1XRRA 1GGVA 1SG6A 4HAXA 1EQ2A 3EASA 3OLYA 3PXUA 3QEMB 3D6VA 3L0OA 5LP6C 1JDNA 3V8RA 4TVSA 4GM0A 4E94A 3K35A 5EIFA 1XVLA 4FR0A 3SEZA 3KEFA 3NJRA 4BVFA 4Z0PA 1XQXA 3QBJA 3U6KA 1I3MA 3KWMA 2Q4TA 5IVPA 1O4VA 3BJRA 4G4GA 2YIMA 4PVDA 3VKGA 4OHWA 1BNCA 3PRYA 3KQKA 3ONWA 3UAXA 3SS9X 3NHLA 4Y2QA 2VJYA 3OX1A 3CW2A 1NF2A 2JBHA 3H04A 2WY2D 1U7UA 1DFGA 2AD5A 4OOFA 3Q1KA 1YJBA 1YRAA 4HB2A 1GNRA 5G0WA 2OYRA 1DBRA 4ZZ2A 1Y9EA 2IU3A 2W2VA 2ICAA 4LZZA 4OQLA 4DQUA 4HATA 1PFYA 3KQVA 4WKNA 1A7AA 1YFJA 2BTOA 1ZM4A 3MOSA 2R79A 4ZOLF 1F12A 2ID4A 5UKDA 2BKUA 1PLJA 2VCEA 3HY3A 4M1EA 1XLTA 3EG5A 3W6UA 4IEFB 1WTAA 3HDQA 1TAHA 2UXBB 1FP6A 3B2NA 1X7YB 3R6GA 4KXFB 4BJ1A 3ULKA 3UGKA 5JROA 5KQGA 5J2UA 5M34A 4IEIA 3FNEA 5BW5A 3ZD7A 1J2RA 1NWHA 2LDBA 1BEUB 2SBTA 2IQ5A 3AIOA 5AUPB 1JTVA 2EW8A 3ZKAA 3RS2A 4OI4A 4AUKA 4C7MA 4O25A 2PBZA 2QKYA 1YMVA 3DE3X 2B36A 3BZWA 1D1TA 4RADA 4CXMA 5G1OA 3GEHA 4KGVA 3O4VA 5EUQB 1BS1A 3WBKA 3I5YA 1ZCAA 2BMVA 3ZNOA 1NONA 1KEEA 4NMXB 5IKMA 1I10A 1WZUA 1FS5A 1WF3A 3IVAA 3HFSA 5EIBD 4DE5A 1JS1X 2ZIXB 1A8HA 1N2CB 1T2NA 2X8WA 5DRTA 1UCFA 4OXIA 2CE7A 4LDAA 4KW7A 3HLYA 2O05A 3RC9A 5C1DA 2LVBA 4QU0A 2Z9BA 4GG1A 1LSOA 2XGOA 1JYSA 1XVAA 5CYPA 3SXPA 1M7HA 1J7JA 4IL5A 4D4LA 2ASEA 4L0QA 2QUAA 3EMKA 1TD1A 3O7WA 1P3Y1 1SB9A 1VLLA 4LA4A 3UIEA 2AEMA 2V97A 4DSNA 5K3OA 5JEEA 1QLHA 3E3MA 3IAAA 1X9GA 1Y8CA 1SVKA 1GPKA 1TIBA 1ZSNA 4OQ4A 5CA1F 5HQTA 3KOOA 4HXFB 1JWLA 4TQGA 1PSZA 3OQJA 4QX6A 5F3RA 4RD6A 3ZY5A 3CX4A 3ME5A 3UHFA 5H5JA 2NV0A 1JDBC 3RAEC 3U7RA 4D8VA 5A0FA 3RC7A 1U6KA 1G20E 1B1CA 2KYRA 2AQIA 4KMRA 5IDXA 3A3OA 4WKBA 3MTJA 4IJVA 4OK6A 5EIWA 5I9NA 5BUZA 1CUXA 5F64A 4KPUB 3T7TA 5ARBA 1F7VA 1PUXA 3ZYZA 3H86A 1XTPA 5C53B 1WW2A 4D1YA 4AZSA 1P80A 2IU4A 4D82A 4PLYA 1U11A 5AFSA 1FYWA 4BX0A 5JBNA 1EUCA 1GZUA 2FZ5A 4U2CA 1JAHA 2JHCA 2PLFA 1PEAA 2Z2KA 3INGA 4PLVA 4OHYA 3K6JA 5DT2A 3I09A 1XVTA 4IH9A 1HEYA 4MW1A 1NVVQ 1Z6AA 5HE9A 5BR1A 3IE1A 2H4YA 1ZD9A 3BAFA 4B4DA 1OUMA 4CF7A 1MIHA 1QSGA 1ULZA 2V4ZA 2WNSA 1WV0A 3A1TA 4TS1A 5TMEA 1M2FA 4YT8A 2RAUA 1Z47A 4N0DA 4CL8A 3DTYA 3UV3A 1XZKA 1BN6A 4OK3A 2VH1A 1GPNA 1WMDA 2E9SA 4BNHA 4LEIA 3EPLA 1H94A 4IOJA 1JGTA 3T3EA 2GAOA 2KHZA 9GPBA 3HKCA 4JJEA 2C7OA 5E7MA 2C3MA 5DO9A 3RFUA 5JYDA 3V8PA 5EWJB 5K4GA 5KOYA 5CDFA 1JWAB 3EZXA 3FTQA 2CC2A 1P9NA 1ZK4A 3DSRA 2PZ8A 4OAOA 4ZAFA 2C82A 3O5AA 4EW2A 5BPHA 3G8DA 4FXPA 1LC3A 1DO2A 3O95A 1HT1E 1QHXA 2OV8A 1VDZA 4HS9A 1H05A 2H7CA 3TXYA 3QPAA 5M5BA 1WE2A 1Q11A 4JJ4A 5CITA 4M2LA 5JS2A 3UTCA 4BQIA 3LV8A 5AJTA 1VL8A 2VF8A 3TCNA 4QHSA 4ABTA 1MMFB 3VDRA 3WGZA 5CK4A 2EX0A 2WV9A 2O7VA 3ICVA 1TYAE 2G5TA 5D3MB 3UCFA 5FUYA 2CEKA 3O8CA 3M4XA 1M0SA 2H2FA 5JYEA 4RHTA 1YTUA 1SU8A 2FW9A 1EP2B 3C3MA 2PJZA 1O5IA 1O6BA 2EDCA 5HOQA 1QV7A 16PKA 2H1LA 3K2BA 4NONA 3IVRA 5I4IA 1GYRA 4I4NA 2X9QA 2PD4A 1R6AA 4QFDA 3TDMA 3K2EA 3TAXA 1X8KA 1KH1A 1T9AA 2VP4A 1C41A 1X7WA 2HM7A 3BMQA 2PWAA 1P8JA 3OWOA 4EJ0A 5E9AA 3EHDA 4DB4A 4EK9A 4YV1A 1JSRA 5JFGA 4XQ0A 4QOJA 3RS8A 2G1KA 3O2JA 5FPPA 2YYZA 4RTLA 1AUVA 4E5MA 3RK4A 1UKVY 3GCXA 4B74A 4LJ9A 4HB0A 2QUIA 3CLVA 1KFEB 3VSDA 1B8NA 2AXEA 4NYJR 1VJRA 2Q6TA 2Q5LA 2XSZD 3LLSA 4YAUA 3EXIB 3U4MA 2OHVA 2QP9X 3EHEA 4L4SA 4D41A 2WYIA 4CG3A 4FFBB 2W37A 4BE7B 1RLMA 1PSDA 1TLTA 4EY5A 4NEHB 2QY9A 3N0RA 2AWOA 4JVSB 3AU9A 3I83A 1PZEA 1B42A 1HG0A 4CCYB 1G8GA 3OLWA 2XQVA 1E7MA 3AR9A 3N2EA 1VBKA 2FLWA 3H84A 3ILHA 3SJCA 1OXTA 3HA7A 1GR1A 3QX7A 3MGCA 3HWX1 4RF5A 4XQ9A 3M6LA 4BZPA 5JDIC 4M1ZA 1S6YA 1FYDA 2C99A 2PBFA 2PT6A 2IP1A 2VBCA 4MI6A 3QHAA 1RQRA 2RHRA 1Y5LA 2R6JA 4ROSA 2IU0A 3RBXA 3R5JA 4EGJA 2F3SA 1B8PA 5T8KC 2OZLA 5BQ5A 5DN6D 3UPTA 3RB8A 4WT7A 3HXLA 2ZG6A 2BEWB 4EPRA 1D3AA 1Z4KA 5AYVA 3T3OA 1D09A 3RW9A 1AUPA 4DN6A 1J9ZA 5HS6A 3G9ZA 1ZOOA 2BMEA 1VE1A 3MTAA 3PQ2A 3AVTA 4DQ0A 1E1RD 2IYXA 2E85A 5SYAA 1MXHA 3ZD8A 1NXQA 3L8CA 4C7KA 1IU9A 5AK3A 4MJ3A 2BR5A 2V6MA 3OM1A 1ZM2A 1YJAA 4PSCA 4BECA 1WUTA 5LD2C 2Q1WA 3PGXA 5D7NA 4IJQA 1LUAA 3BB1A 4PLZA 4TS4A 4PPYA 3ZXYA 3HJUA 3HXQA 1FXSA 2KMLA 2KLHA 1YS6A 2VF7A 3C8UA 4FFPA 4CLOB 1EFRD 1LVGA 1HEUA 1QHYA 3D3EA 4O2BA 1S7GA 4XRGA 1I33A 5AIBA 1KKLA 3ZGZA 5JJKA 3S27A 3VZRA 1KI1A 5A5DA 4XDHA 1M34A 4ON9A 2LPMA 3TB4A 2XMPA 4B2LA 2ODEA 3W4JA 4GF5A 4QYWA 1Z6PA 4MRAA 2A5YB 2YHUA 4KVGA 3HK2A 1LVHA 1V5FA 3HY6A 2BKXA 1JQKA 1AM4D 4EJSB 2RB5A 2IUUA 1AT1A 1E1MA 1LH0A 2P9HA 1NIJA 1ZISA 1FQKA 2NUTB 3GRRA 3IB3A 4GX2A 2VYQA 2YZ7A 2A9VA 1QAOA 3DAYA 3WYDA 1X1SA 2Q5OA 3PEEA 3BIOA 3NR2A 4L22A 3CH4B 4XWYA 4M0EA 3VO2A 3OQMA 1AKUA 3ZHUA 4JI0B 2HQBA 4YP7A 2BJHA 4LDPA 4H7PA 1NXPA 2ADMA 3EDOA 3VOAA 1EM6A 1X0XA 2I7TA 5IJ0B 3HL0A 1SOAA 2Y1XA 2YL2A 4GC5A 4N47A 3DLBA 4Y0AA 4P58A 4C6SA 2OG2A 2PUBA 1XZNA 4N54A 3WYCA 3PIDA 2DQZA 1NUPA 2YV2A 4H60A 5I4BA 3CG0A 1ULAA 1VXRA 1F60A 1G42A 1GAJA 1DQYA 1H0SA 4UXHA 2B94A 5DK6A 2X13A 4YI3A 4A0SA 3G79A 4IDDA 3KAJA 1GN9A 4KI0A 2DCUA 1KJ8A 3IUEA 2C5BA 3R3VA 4I08A 1X7ZB 2TSYB 3KSRA 1TI7A 4RVGA 2A2ZA 5LM3A 4E1AA 3OZAA 2FEKA 1U8YA 4GWLA 3FCCA 3WADA 5JYBA 4MCHA 2QD1A 3HO8A 3LVRE 3T1OA 5A3JA 3BRSA 4CR8A 3T1QA 5LLDA 1LTQA 4AECA 5J2UF 1ZMXA 3W79A 4KOEC 3D54D 1DIHA 2WJVA 1JLLA 3KJZA 3IUYA 1EP9A 4GOOD 4IIVA 1GZ4A 2X0JA 1TQHA 4MS3B 2NTNA 1P81A 1UM9B 1ZEJA 5JFTA 3RC8A 4TMZA 1ISRA 4QBTA 3KQOA 2PSEA 3Q3JB 1U5BA 4XFJA 5C4IA 4PBSA 1L1EA 1Y63A 3DA8A 3JD0A 4G3XA 2ZWIA 1JKXA 2XB9A 2LBPA 4XVQA 4J1NA 5DCWA 3LQQA 4YAOA 4AF7A 2VOEA 4LECA 2VWGA 3ONNA 3W4KA 4PYOA 3IULA 2GPSA 3DNMA 2W5UA 4MQFB 4PLGA 3EMBA 3H6KA 5EWLB 1RPNA 4YDQA 1K8YB 1H1LB 2CVHA 5D5PA 2DF8A 4RL6A 3TR0A 3T3MB 5E7JA 4JVOA 1ZWKA 1NLFA 1RWXA 2P3OA 2O2IA 4Y0VA 3LUFA 4KLZA 2NU6A 2C9YA 1L4NA 3KZOA 3EUFA 3G8YA 3NTRA 3C3JA 2RAVA 4RNDB 2P68A 3VVLA 2FPPB 1DC5A 3COSA 3GUCA 1FFWA 3C3CA 3S44A 5A2QA 2RH5A 4B09A 5CX1B 2X9LA 2HQOA 6CHYA 1E3MA 3PUXA 2GCOA 1A97A 4RH3A 2DFLA 3NHPA 4DLKA 2VDWA 3NJ4A 2J9FA 3U4IA 4UTXA 3C1TA 2X0NA 5G3YA 3VKFA 1IUOA 2EDAA 3HFGA 4ZEVA 1FSFA 1ORDA 1LTKA 1M2EA 2V5VA 3QIVA 4Y0NA 2HWWA 4LHZA 2WLTA 3SQXA 1FUKA 2R1TA 1OFVA 4WXRA 3GVHA 2GPNA 3L4SO 3T1HB 1CUDA 1K5DA 1UZLA 1Z26A 2ZS7A 2Q49A 1F8UA 4PO9A 1J1UA 1VG9B 3S0JA 3GROA 2VTDA 4F85A 1SAYA 1UOEA 3UWMA 4LRQA 2FAXA 4ZDKA 2QBYB 2V7TA 2IEZA 5F76A 1CV2A 4WXYB 1U7WA 5SZJA 1PL7A 1FFDA 5E3JA 2R0QC 3A14A 2X1MA 1AB5A 4J0KA 1N2SA 3WGYA 4XUDA 3KU4A 3AUUA 1AKQA 1NRXA 1NE7A 1TK2A 4RE5A 3FKSA 2QTMA 3AXTA 1ZIXA 1W96A 4FR2A 3KZCA 2PUJA 1Y4SA 1KMMA 1P73A 3GG9A 2HRQA 1YBHA 1FU4A 2O1EA 2QQFA 3OCZA 4TVBA 1CULC 2C2BA 4RDIA 3LDGA 4H16A 1GZDA 3GZ4A 4J16A 4JMLA 1QE0A 3ZY2A 4HDNB 1RWNA 4MGYR 4FI3F 4KN5A 5F2OA 4AB1A 5H3HA 1PZHA 5I8WA 4N40A 5SV2A 1KAGA 1E6LA 4ZA2A 1M6YA 3GJ3A 4EVSA 1A5ZA 1FFAA 1K86A 3LHDA 5E8RA 4RJ2A 4XQCA 1UC9A 1JKJB 1CHDA 1P0QA 1UXGA 2YWEA 3RRYA 3DXXA 3ZJYA 4A6XA 2YN4A 4CM1A 2QN1A 4HJXA 5K9ZA 2Q5FA 5LCXA 3R8XA 4Q48A 4EPYA 4DAOA 3TX6A 1Q1QA 3U09A 3OIUA 2PJUA 1ZUNA 4B4WA 3NRCA 2OFWA 2VDVE 5CFNA 1DC4A 3TIXB 2EYQA 1TZKA 4LJKA 4B79A 1T4DA 5BOSB 4P3XA 1SK9A 3H2SA 3TZLA 4L5CA 5JD6A 5FTLA 1AKMA 2VYNA 1LV7A 2FK8A 4G56A 4ARSA 1KP2A 1JKMA 3MBKA 1W5FA 1UC5B 1AU9A 1C9KA 1XVVA 3JYNA 4IIUA 4CDRA 2O1WA 3BTOA 4BWVA 4TL6A 2ZYGA 3D2BA 4LIPD 3BF7A 1Z5WA 1MRZA 2XRYA 3TBHA 3PRHA 2ZSBA 4MVXA 5EE3A 1ETUA 3LRTA 2H7VA 3SDBA 1MKYA 1QVZA 1X2EA 2D2EA 4JOQA 5D7BA 3UUFA 1CF4A 3L07A 3MUFA 2VZ0A 1FRQA 1NXTA 2IA5A 1TKAA 3GVPA 5DM4A 5EPEA 2E89A 4GI2A 2X0EA 4D8XA 4EG8A 4YRBA 3CR7A 2PZMA 3AZQA 4ZVPA 1YE5A 5SZHB 2E55A 4DQVA 2I4IA 1MB9A 1BCRA 3HDTA 1M8JA 3FZGA 3A1VA 1E98A 3E9ZA 1O5TA 1EFVA 3TNLA 3W3AH 5KU1A 4KOAA 1M3SA 3VNUA 4H17A 1JU3A 4AKEA 3AJ8A 5I7FA 2O8BA 4C01A 5I7UA 1NMYA 4KUEA 1BROA 3DLTA 1GQSA 1DEOA 4PBTA 5H02A 4YRDA 2IOHA 1XHFA 3ROGA 3AR5A 1YRLA 3S55A 2IUSA 2HIAA 5IABA 2P4SA 4C88A 1CQXA 3ABRB 3CRVA 3MT0A 1TAQA 1E8DA 3HCPA 3PX2A 1NKSA 2FR0A 2F1RA 3PV0A 4KNYA 5ERXA 2I6TA 2JEZA 1DJNA 1JU9A 1TTQB 1U2RA 1ZPDA 2VTEA 3F5SA 2PT7A 3FYHA 4IQ0A 5DX8A 5BSTA 1ZITA 5LZ2A 5HDQA 5AOCA 4F4CA 4D79A 4HPXB 4C89A 2RGNC 3GJ4A 1HUQA 4WCFB 4IR7A 3VC3A 3LD9A 1LDBA 2GN2A 4JOBA 1L5HB 4G0WA 2GVNA 1JQ3A 4B73A 1D2AA 1Q6YA 3H1AA 2OFXA 1I0ZA 3G89A 4L28A 1ZVVA 3TSZA 2C8KA 4OYYA 1C5KA 4AULA 4ID3A 2C5GA 3OIGA 4MW6A 1GA1A 1S8AA 4Q01A 1O95A 4Q12A 3PC8C 1Z5UA 3OZFA 2OBFA 1BVRA 1C3XA 3EF1A 3QPVA 2NP6A 1EE2A 1G55A 2VJLA 4IO0A 2A1TR 1DQNA 1WMAA 4KAXA 3SE7A 1J6UA 4A73A 1C7EA 4YJ2F 4RK1A 3UG6A 2O3SA 3OX2A 4FU0A 2E2WA 4IF4A 4R31A 3VPDA 1HZZA 1B6GA 3FFAA 5JHHB 2JASA 1A77A 1GOTA 1GPAA 1ONOA 3REQA 3QKTA 2PLAA 3AZOA 4JGIA 4RSRA 1TGYA 3CIOA 4B48A 4Z6KA 4M9XA 1KL7A 1I5OA 1RKQA 5CVVA 2GDJA 1MOZA 5YASA 2HRBA 3EXHA 4AI6A 3T5GA 1ECFA 1EFLA 4DDVA 1A5TA 5IP5A 4X8HA 2PKYX 3HMQA 2EGUA 3HH8A 4JODA 2AUNA 3HJCA 1FZQA 4EMUA 1U1FA 1Y8RB 2W4QA 3HNOA 4ZJPA 4U7JA 4ZI3A 3WKDA 3G8BA 2JFPA 3HCEA 1K6JA 2C4VA 3IAFA 3QU5A 1E2JA 3G3EA 4IYJA 2G83A 3EJWA 2ZYHA 3PF8A 2VSXA 3UWDA 4ESVA 1VE6A 2IPXA 3UAYA 3ZDRA 1L3CA 4DRYA 3AG5A 4S1WA 4Y2GA 3RH0A 1SA0A 2EZUA 4IXTA 4N82A 3T7EA 3ZCRA 2WMYA 3D7NA 4UVIA 2ONCA 1UDCA 3LX4A 1TT5B 4QZVA 4REOA 1BDIA 1IOLA 4C4YA 5JDCC 1I4TD 1J2JA 1T8RA 3EDMA 4GQIA 3KJNA 4K87A 3H75A 4BMYA 3TSCA 1Z36A 3OOYA 4IZOA 3HSKA 1LBSA 2PDAA 4BZXA 2QTAA 2YRXA 3ZHTA 2X58A 3FZNA 3K70D 4Q4DA 3BDIA 5E4YA 2O2EA 1ONPA 1SUAA 2IOFA 4BO4A 2X4IA 2GKOA 3AM3A 4YEDA 2ZR9A 3O1HB 1JSLA 3L8MA 2JNWA 5A9SA 4DIKA 1QRUA 1NSTA 4CPDA 4M83A 3L05A 1T5DX 4RLHA 4AZ3B 1TUBB 1X1AA 4G5OA 3KSZO 1BYIA 1OJLA 1LLDA 4RMNA 1LPBB 2ZLBA 3A1WA 1U9ZA 2PBLA 4LRUA 4PIMA 2G25A 4RK4A 4U5XA 4GHWA 3NATA 3HC7A 3VHQA 5DN6A 3NTOA 3S2SA 4REQA 1NJ5A 2CDBA 4X1KA 1QTQA 2RGDA 3PIIA 1CRQA 1HKUA 3KR2A 4IHJB 1ZQ9A 1O95D 5CPBA 3U3RA 1AN9A 3BJZA 1RD4A 3IJPA 1KDZA 2M6LA 4HGQA 4D99A 3FZQA 4B3DA 1VPDA 3GG2A 3ASVA 4A82A 1ZAYA 5TRTA 2R85A 3VSCA 4GQBA 3IALA 4NJMB 2G6TA 3I9JA 2JCSA 1WBJB 4LOJA 1NFQA 1HH4A 1H0KA 1M2VB 4XVUA 5KQPA 1LK0A 1XRLA 5I7WA 2R7KA 3KSDO 1GT91 3I3OA 1L5RA 4EW3A 3GHYA 4OUDB 3U1TA 1M1YA 4UTRA 4FFLA 2Q0XA 4IOLA 1A2OA 1NBAA 1Q74A 2CMGA 5KMGB 8MHTA 2AEFA 2X8JA 1AHNA 3LXUX 4G5QA 3O4FA 4H1VA 4QQFA 2AIRA 2AE2A 4J7UA 5HEKA 3UWSA 4IDQA 1NVAA 4CODB 1FQWA 1U0TA 2HTFA 2GFHA 4GYYA 4J0IA 1BCRB 1LNZA 4EEKA 3L02A 1ILWA 5CB4B 1M72A 2O0HA 4I3HA 3EXFB 4FB4A 2PXHA 3NT4A 4L74A 2GN1A 1A72A 5F5NA 2ISQA 3PXCX 2JH3A 4XIYA 4WAUA 2FEXA 2QAGB 2DLNA 1Y9JA 3VKWA 3QF4A 4RVCA 2IDMA 2Y99A 1GRVA 1KETA 1REQB 1V2GA 3PT5A 3OD1A 1V1MB 3OPVA 2YINC 2ZSJA 4ZOQI 1YGYA 1NW8A 4ARBA 1P2GA 3DL4A 2B0JA 1R6DA 1XMSA 3QFSA 4ILEA 3PE4A 2GK6A 4E2YA 1X7XB 4MRVA 2J0EA 4DLZA 1A5SB 2C3PA 4L27A 3ZHZA 1JHDA 1GKUB 4YT4A 3OT4A 4IDOA 4Q1BA 5A7GA 5JADA 2HC9A 3NKLA 3RRBA 5KIAA 3GUVA 5ICSA 4J0QA 4QOSA 2P9JA 5TE9A 3KX2A 1NBWB 1R10A 1DC3A 1V47A 1XTKA 2NM0A 2XUAA 2CUNA 2QI9C 4HQRA 1ZR4A 5GJBA 1A4XA 3RYIA 1WM1A 3KVRA 3P45A 1WY5A 3PDJA 4O4LF 3EAFA 1QU2A 1L4KA 2O2HA 3MPUA 4IFIA 2JPDA 1G0NA 3O4JA 1NPDA 1XYYA 2PGAA 2R84A 3KQHA 1Q6ZA 2MSDB 5FPYA 3DB1A 4LMBA 4OMDA 1A27A 2RSLA 1ZJZA 3N8GA 2WT4A 3DKPA 3EGCA 4QBKA 3OF2A 1QIJA 4YUAA 4OIMA 1WQ4A 1RE1A 5K0FA 4AS1A 2JLWA 4KR6A 4W63A 2YMPA 1DMSA 1QB8A 1VP9A 1XYGA 4WERA 3LQFA 5FPTA 1T3GA 1DHTA 1FMLA 4QTUB 4ZTUB 3ZHYA 2IKSA 3A4LA 1EFPA 4TV9A 3JATA 3NXKA 4FCTA 2DQSA 3I9OA 3TOXA 2P5TB 1CUYA 5LZ9A 3O31A 3IKVA 3O8NA 1QIIA 3NPAA 2Q3BA 3N2IA 3ZW9A 3V1MA 4ETWA 1MFPA 1PQ4A 2IYVA 3VMMA 5T6BA 3U40A 4DUPA 2ECFA 1JHXA 5CEFA 2CK3D 3EEOA 3NTVA 5MFZA 1EQUA 4XWKA 4V03A 4F9TA 4LC1A 2DTDA 2QWXA 3WIEA 1CFJA 2EEPA 2VCYA 3BHNA 4MI3A 5J47A 4DR5B 3L93A 4IILA 1K8XB 2H08A 1QHEA 1XLWA 2BUCA 3GEEA 3I9NA 3NHWA 3HCBA 3OMLA 4DCOA 2ONYA 4KIWA 2JG3A 2FFBA 1EG7A 3I34X 4EMTA 3DEYX 1C9YA 1WXGA 3D0RA 1YAJA 2E49A 2FJUA 5IWAB 5AW4A 2V6FA 2GBGA 3FWHA 3O94A 4H3HB 2ZYRA 1QWOA 3GFOA 2UZ4A 5KAMA 3ON5A 2CJXA 3P9KA 4ICIA 3P0EA 4TV8F 5JCXA 2N46A 4IVRA 3EAQA 1NBMA 1FW6A 1VE9A 1Y37A 1YT5A 1ZRNA 4N5NA 4PTZA 1JR3D 2AK2A 1H3NA 4O8ZA 2DM6A 1UAYA 3LXMA 2FEMA 3ENNA 4WEQA 4IDGA 4QM6A 3P0IA 3ZDXB 2YZGA 4LFBB 5CD1A 2I5PO 1CY7A 1I2AA 1K5PA 2H57A 2YMLA 4PZAA 5DYNA 3FBWA 3SC6A 4W4TA 5GM1A 3TAUA 3USES 2GDZA 2Z9DA 4XSVA 4CLXA 3FAKA 1N2GA 1MVOA 1EM8B 4DNQA 4JYPA 3H4VA 4RZQA 1SKMA 1KK3A 1ZKMA 4I2NA 2CBGA 4OHZA 3GZNA 3KOMA 4GR9A 3UK1A 3T3NA 4XCXA 1QAQA 4IFBA 1KPGA 1T1RA 3DV0B 4KDRA 4W7SA 4XCVA 4CIWA 4Y1GA 5COBA 2EV9A 1NDUA 3GGJA 3JQCA 3GELA 2J85A 5A02A 2D74A 2KI5A 3OPXA 3GLUA 4KTTE 5CH5A 2YWFA 3FPBA 2CL6X 3D8SA 4M55A 5CIWA 4ZAYA 1COWD 1XMIA 3EVNA 4CMCA 4R2WA 3FYUB 4W8OA 5LDHA 4CMIA 2CLEB 3DZDA 4GZ6A 4KPFC 3C2QA 5AI9A 2JIOA 2AQ8A 4DR7B 4QQ8A 4PRLA 5IUNC 1QE3A 2FNAA 1GG5A 4R3NA 1C1YA 4BFYA 1EGHA 3ZZ1A 4ZMSA 3N0WA 1U2TA 3F97A 5E7IA 3HUUA 1P29A 1WCWA 2VEOA 2C61A 3TPZA 2EGGA 1G41A 5E6SA 4JLKA 3QNMA 3REOA 3P9ZA 4TUYB 3UFXB 3HEMA 1OBVA 2CBXA 4RE6A 4UCQA 1UPCA 1VQ1A 1KAEA 3AEQA 4IHQA 4X1YA 4Z4FA 3OVMA 4AJKA 1JSZA 3THRA 3H2KA 1QAMA 1HBJA 3MUOA 4F9EA 3DJFA 3WRXA 1NUUA 2C7RA 2JBWA 3SHWA 4RGVA 3DOIA 3VTKA 4M9QA 2EL9A 2EFGA 3CBGA 3R7BA 2AJTA 1WZNA 2AN1A 1G6KA 1L7VC 3NKFA 3RE1A 3UC9A 1VI6A 1VE3A 3JALA 3D2LA 1L8OA 4WOPA 5D3QA 3B1XA 2XV1A 1ZRMA 3QBTA 4Q05A 1Y8QB 3A31A 4QJBA 1U8ZA 3LY7A 5SZKB 3QI7A 2QW0X 2VHTA 3OT5A 3W05A 5EE1A 5HM8A 3H0EA 2CJFA 4RPLA 1VJGA 3M6MD 4KB5A 4E03A 5FUQA 2RG7A 2RGWA 3OP4A 4I36A 3QSYA 1O1YA 2Q2OA 3F3MA 4QOEA 5IAKA 3L0YA 5B57C 4HNVA 5JH7B 2J3DA 2JA1A 2WJPA 5KYYA 8ABPA 4OFWA 4OHFA 5J2TA 2GEBA 2Y93A 3LCRA 3OTWA 2FWJA 2ODTX 3DPUA 2FMUA 3GNQA 3PHBE 3W78A 1U0FA 3EVGA 1AURA 1ZCZA 2EKLA 2VTKA 1SQSA 1W4AA 1KHTA 1Z5GA 4IH4A 1RW4A 4Q1AA 4QPPA 3ETEA 5F12A 3FGNA 2QTGA 1YOVA 2B37A 3HE3A 4NDNE 4UULA 3U13A 1IJEA 1O77A 3MZ0A 2HR1A 1HZJA 4F2WA 1L6IA 2FG6C 3AI3A 2V7BA 3A3NA 3LPCA 2IEGA 4EHLA 1F06A 4MWDA 4NXNB 1WP4A 4FR5A 4CTOA 1LDYA 1LI4A 4KQMA 2DPYA 1ISSA 2P9BA 2WJAA 3ZWBA 3HXMA 2AC7A 1OPRA 3FPKA 1G4HA 1PJCA 2N9UA 3BGWA 2VZ9A 5A1JA 3DTNA 3PEUA 3R7LA 4JK3A 3IE0A 3OQ6A 4INOA 4L9RA 4LF6B 3ZK8A 3DOOA 1YC5A 2AJBA 1Q12A 1M66A 1TYZA 4INAA 3NM6B 3B6MA 1U2EA 5CMLA 2GHRA 3I9V1 4G5GA 4ZMBA 2KS6A 1V7QA 4R98A 2RBKA 3VAYA 2PGJA 4ZAWA 3MXOA 3EX7C 1GTRA 2O3RA 2J6BA 5JXJA 5L53A 1PL0A 3W9YA 4QRHA 4MRPA 3THSA 3X1MA 2CVOA 5KSYA 2WIJA 3HU3A 3Q9LA 3RC3A 4L50A 4DGQA 5JRJA 1F0PA 2ZR7A 3D2AA 4TYNA 3FLAA 2AXNA 1QG2A 1GRQA 1QK5A 4ZZIA 4OQYA 2XR1A 4AMBA 3IEIA 4UFNA 5F1KA 5KJFA 2AZDA 3V4VB 1VGQA 4XDZA 5HRAA 4Q6WA 4F60A 2REQA 2GAAA 1ELOA 5ICFA 3ZHRA 3Q5EA 1SCUB 1J06A 2XJ4A 3D8TA 4V3CA 1IQRA 3K9CA 1Q3HA 4Q4JA 4TTVA 3HNPA 1RIFA 1A50B 1Z4JA 4HK4A 2HF7A 2F90A 4II7A 3CF2A 4KQGA 4BEVA 4YAGA 5KQMA 3IEVA 1TQ6A 2QNRA 4KK3A 3ZE7A 5EJ6A 4YRMA 1EVYA 2PD6A 1BDMA 2H1RA 4ALLA 1PV1A 1EGQA 2INGX 3OOJA 3VNSA 5KAPA 2FZ4A 4GOXA 1A8SA 2WHYA 4YJGB 3VR2D 3VV3A 4DTCA 4B6EA 3H5LA 4I4IA 5GONA 5KWVA 3PIRA 4BFCA 2ODAA 3LYLA 3CU5A 4H6PA 5THQA 4J6FA 2G6BA 4CV0A 1CK4A 1E9SA 1W85B 2ZZNA 1NJGA 1NYTA 3U4QB 4O1HA 2Z3ZA 2A9RA 2YHSA 2YX1A 2GN9A 3A27A 4GSKA 4YC7A 5K8IA 1V25A 4FDAA 4GXQA 5SZIA 3NW9A 5F51A 1E6UA 4OBWA 5TQ2A 2VA8A 3DMYA 2PH7A 3ZWWA 4BVAA 4DBLE 5I3ZA 4GC9A 2DUJA 1W5SA 2VQSA 2LNDA 3I2JA 2QJWA 2PZJA 1EX9A 1L7DA 4PYQA 1E5LA 2FZEA 2SCUB 1OLOA 2ZE6A 1GQFA 1NW9B 2GESA 4MDHA 5DCUA 3WNBA 5IC4A 4KV7A 2NUAA 1T2DA 1N0VC 3IX7A 5DNVA 3U7HB 2JB9A 4TZ0A 2E1PA 2VN8A 3PDIA 3PJEA 1XNHA 2IELA 1P77A 3R77A 4TTQA 2X2EA 2D62A 3N07A 4XR4A 2CLSA 2CZCA 2JFOA 3O2QB 3PXAA 4YJ2B 5H81A 3AP3A 4DV4B 2AN9A 3BPSA 4FD2A 2G04A 1DS6A 2WSYB 3TQRA 1K7XB 4GRDA 4P3KA 2AFIE 3W6ZA 2CBZA 3G7SA 3PUJA 4FNGA 3WZLA 3V4ZA 3EC1A 3BMCA 1E4EA 1M2NA 1G2QA 1ZLYA 3CZMA 3KSAC 3F5QA 4O4HB 3T54A 3K0HA 1WB5A 2ZI4A 4MUEA 1EK2A 1YKGA 1TVKA 4NBWA 3CBQA 5DWDA 2ES4A 3L6RA 4JV5B 5AW2A 1UBMS 3ADOA 2IIQA 3LGAA 1FK8A 2FSPA 3DKRA 3UMVA 3IERA 1CLEA 1Q21A 1QZUA 4J2HA 3WWCA 1WCV1 4Y7DA 3ORYA 4LJYA 1MPTA 4QQRA 5HMMA 2AYZA 1VHQA 1G3RA 2AFHB 4R84A 2HKIA 2ZVQX 2Z9CA 2GCEA 4KLRA 3G5AA 1ID8A 1K06A 3O2NA 5C1OA 1ZM9A 3AUFA 3P0RA 1UDRA 2YJ6A 4OQMA 2CVQA 4AD8A 2WNHA 4PLPA 3WGUA 1L7OA 4C0QC 1SXQA 3D59A 5I9TA 3RVSA 2IIVA 4CM3A 4F6CA 2OGUA 1QV6A 3F9RA 1ZUNB 3OEED 5KTTA 1LRKA 4Q82A 2IZOA 2OUKA 2CV0A 1J99A 2YDYA 2IYZA 4YRSA 2VEDA 1NASA 1N1MA 3QEMA 4HH0A 3E6AA 4M0PA 1Z2EA 3RAGA 3VPGA 3H11B 4AYWA 2B4TO 1KMQA 2HV9A 3DOJA 4JLSA 1W0CA 3PJFA 4D0RA 5C80A 1JE1A 3M7IA 4IKEA 4GKVA 2JLBA 1Y3AA 4ZRMA 4C3VA 4UTPA 1DCFA 4M9UA 1V11B 2ERYA 5KNDH 4MGHA 3SS8A 3KEMA 3OESA 4QELA 1GQOA 4TTRA 4B75A 3ZK9A 1JEQB 3U7FB 3KUUA 2FQWA 3VR3D 4M4SA 4ID9A 1QLJA 4KEAA 4Y2SA 2A33A 3F6CA 5LP1A 1CF2O 3EIHA 1MHTA 3CRQA 3NNNA 3N2YA 3S29A 1YJQA 3EEFA 1HYEA 2GN6A 5H59A 2RHLA 3UT5A 5GVRA 1BU8A 5GZ6A 5KUTA 2IZ7A 1NFFA 4X5OA 2UUCB 5EQFA 3UTDA 1ADGA 1OXVA 2BKAA 4FONA 5HKBA 1DOZA 2QYHA 4KWIA 4B4OA 5FV4A 3MMNA 2VRCA 4TV8A 4CMEA 4E12A 1T0JB 2W2KA 1LV8A 3RAFC 4JYBA 4M1KA 1Y8ZA 4KGDA 1G8JA 1YZGA 4N1AA 2XUFA 2GJ4A 5H3LA 2J3LA 2JFYA 3GFSA 5I7HA 3O8QA 3QI2A 1NDHA 3L1HA 1QO9A 3A7DA 4P81A 3AL2A 3HN2A 1IN6A 1Q7GA 3D3KA 4XDYA 1RCUA 5EP4A 2Q7OE 3V3KA 1CUFA 3GFTA 4HQLA 5IH3A 5AHOA 1YQEA 1WUYA 2O2DA 4J1QA 2NTVA 3D5EA 3WTCA 2RCYA 1XI2A 1M6WA 1PKEA 2P78A 4PIVA 2BH9A 2IDJA 5DB4A 3WLTA 2ANCA 1EUQA 3ZGYA 3GPLA 2X0IA 3O0TA 1EIZA 5DGCA 1CS0B 3P4XA 2OZPA 1JHUA 4FGKA 5JPDA 1YB7A 2HCTA 1ZD1A 3KZ1E 1PNQA 4YRZA 2V7XA 2GD1O 3HDGA 3OFKA 1RABA 2XXAB 2YW2A 1Z4IA 3CLSD 1OFTA 3MTIA 4BRSA 1LK7A 3RM3A 2DUMA 2J9RA 2HD4A 4N6NA 3TR6A 1AA6A 4ZI2A 3L40A 2QQGA 1VYHA 4UCWA 2PM8A 2AE1A 2XDYA 3ESXA 2GHQA 1U9JA 4FEEA 2OMKA 1NR1A 5EKSA 4CV3A 4Z1OA 1EE9A 3LDHA 3VU9A 2V9CA 4MW4A 4Q4AA 5TPWB 3WLHA 3IIIA 1U0SY 2I6FA 1U80A 1YKFA 4XPZA 4BO3A 5KDLA 4E5PA 2JBAA 4FNAA 3F8WA 1DV1A 3RS7A 2EWWA 5EN4A 3SE0A 3ZW8A 3NZEA 5EWMA 4CQLA 2OORA 3MA0A 4FOPA 3LPLA 1HT0A 1AK9A 2DRIA 4P4SA 3CNQS 4W9RA 2HT6A 4MVJG 2PMWB 1C7ZA 1OMOA 1YTLA 1O57A 3LTEA 4MLDA 2WVJA 5BMVA 3KIPA 4NFLA 5FBVB 3DL7A 1POWA 1UP4A 2BGNA 6AT1A 1WZEA 4HNSA 4RA9A 4XTRA 1PP4A 5I7AA 4ZN6A 5JS7A 2VQ6A 1WW8A 1ZK3A 3PCXA 1CJUC 2R8PA 1DCKA 1KK2A 1UJCA 1GN8A 2BFPA 2I78A 2ECOA 3OX3A 2C9DA 5KTSA 2NPFA 1JHRA 3ZNQA 4JC5A 5EIAA 1EXMA 1YBMA 4RPGA 3IH5A 5C9ZA 1LEHA 1Z35A 1N1DA 5DBFA 4BLQA 4XUCA 3PLNA 3RU9A 1LVUA 5TXGA 1UMDA 2ARKA 5K8UA 2CDCA 1GQRA 3PXEA 4R71A 1XDSA 2ZYAA 5DOVA 5E4JA 5GV7A 4X92A 1AV6A 2WD9A 3WYFA 1G3IA 2QLJA 5CEJA 1WULS 5K8CA 5IYZA 5FB3A 4O4HA 3AOEC 3HA2A 4EABA 4F38A 4KQCA 4ZOCA 3N70A 1RR6A 3RGWS 1R5JA 2YOGA 3MT9A 1CUEA 1UKEA 3OJOA 2WU3A 1ZU5A 4J49A 2AN5A 3USZA 2G07A 1IBMB 5DLDA 1SC9A 4PPQA 1JI0A 4KO8A 5HBRA 1C81A 4L8FA 1E7RA 1QUEA 1RM0A 3FNQA 3MFQA 4EDHA 3EF3A 1T5HX 4F2GA 2V0NA 4KU4A 4BDTA 2WABA 1H4SA 1ABEA 4H6VA 4Q7LA 1V9LA 4HS4A 4Q7KA 3VHRA 4RKRA 3VV2A 2O1SA 3G9TA 1V4BA 2VNIA 4ZAXA 3VTZA 1KHHA 3DH0A 4M49A 3GMSA 1TM2A 4R3WA 3LPNA 1XG5A 4J29A 5CYOA 2J0VA 2XAAA 4MV8A 3NS7A 1U1GA 1HEIA 4JX8A 4J4BA 5CHYA 2VATA 4KUHA 3PDWA 3K8OE 1XCMA 4AKGA 1D8AA 1R15A 3SYMA 1IWBB 3ZG6A 2ZJ8A 2OP1A 2Q1SA 4KRFA 4EYGA 2E18A 4KH1A 3K0CA 4G25A 4LYGA 4J6EA 1VIDA 3LQ4A 4Q66C 1NC1A 2JGDA 1R8QA 1N2JA 3EH1A 4J16C 1IEXA 4JFRA 4NU0A 2HF8A 1HK7A 1AGPA 3LP8A 1KDOA 1ZI6A 2G1UA 4DM3A 5LJIA 2C1ZA 4GP9A 5FBQB 3V97A 3CNOA 4V0NA 1S9DA 2E4XA 2ZQYA 3N86A 4RSHA 4Z2AA 3S1SA 4I1RA 5D6OA 1OKKA 5HF6A 2WFZA 2P9QA 2VYVD 4F2HA 5CYGA 3BZBA 3DDNA 1AKNA 3RRFA 4HWPA 4EHFA 2DXIA 3VNAA 5EHZA 4RFVA 3LCCA 1EVEA 1C4KA 2FP4B 3B3AA 1U3TA 3JQ9A 1W0KD 1J8YF 1C29B 3ET4A 1E2GA 1HYGA 3AHGA 4ZZ0A 1QOPB 1WRBA 1HDIA 1YWGO 3G0OA 5F52A 4B45A 3K5PA 3JALB 1Y3IA 5IJWA 3ITNA 3CLHA 2FPOA 3VI4B 2Q99A 2WNIA 5HMLA 1XL0A 4NYIQ 5ECWA 1JHQA 2EFDB 1M6VA 3BWDD 4F93B 1I2MA 4MARA 2KBFA 2VUSA 3JVEA 2G8LA 4QEDA 4P4NA 1VDMA 2Y77A 3D7KA 5AW0A 3GZJA 4KLCA 3ZZTA 3KQTA 1GLNA 1JW9B 1Z56C 1BGVA 4EI7A 1PEYA 5AIAA 4YNBA 4I4TB 1DEHA 1USUA 1DC7A 2Q21A 1O0SA 2J31A 3FRHA 3L84A 2NYAA 3DEIA 4M53A 4PHHA 4HAVA 1NYLA 1U4OA 5K0CA 4R1TA 4QNNA 3F90A 2CMKA 2XE4A 2DQ4A 3BSWA 3KKLA 2GZSA 1B6RA 1DAKA 1XXHA 4PQYA 3C1UA 1P4SA 3DTVD 4BNDB 4D0SA 1FNDA 1R8JA 2YVUA 1YS7A 1QDUA 2BP7B 2HSEA 4NYJQ 2G0TA 1N2OA 2WYVA 5LXTB 1C8LA 1SPBS 4FYWA 4EX7A 4R9VA 2GERA 4UNRA 3EGEA 4XAQA 1E96A 5CT9A 4KGZA 2HCFA 3GI1A 4P5EA 1U8AA 4DR1B 1FNBA 2QU8A 2Z56A 2G67A 2NGRA 3VOTA 4L2IB 2ZRNA 3M6IA 3I1JA 3TD2A 4F3TA 2CLDX 2VL7A 1WA5A 3CLSC 2IIPA 4KL8S 4XUGB 3WHKA 4A23A 1KJNA 4HNAA 3HBFA 4DV6B 3NNSA 2F9FA 2QRLA 3VOBA 2ZJFA 3V7YA 4CNBA 4DL9A 1BXKA 3V48A 4PW0A 2HA5A 2EBHX 2P9GA 1DAIA 2XTMA 1YRBA 2RKWA 1N2IA 2ZWMA 4FDVA 3K0BA 4L07A 1WTCA 2IW1A 2QMHA 4KV9A 3SU8A 4F6RA 1U9YA 5LOVB 5K4AA 3EODA 3DXFA 1ISMA 2I54A 3ESZA 3H9QA 4WY2A 5F5LA 3TXXA 4B44A 3FCEA 3R7AA 4BAZA 3K9NA 1W1WA 5DLEA 3NNDA 3UMJA 4NZNA 4ZGBA 4HEJA 2PMKA 4JIGA 1P7YA 3MFYA 5ELLA 2ZRPA 4P8RA 5ETJA 1CRLA 3K1TA 5ALFA 3VR6H 1Q1EA 1CU1A 2C4TA 3T0GA 1KWKA 2H4FA 1WDTA 1PGPA 1VIMA 4HT3B 5JD5A 3RT7A 2PXCA 2Q2NA 2XGJA 4DG8A 4F96A 1YZNA 4R2HA 1TYDE 3D02A 1FSGA 1DWPA 1KMNA 3Q0TA 3ZXSA 3I23A 2DWUA 3ICWA 4DVJA 4E4YA 3E5HA 4RTNA 3LFTA 4CDMA 1PEKE 2DUUA 2FEWB 3SZRA 1SR8A 1UPXA 3JARB 4DCCA 4KHPB 1T25A 1Q92A 3T9CA 1OZ0A 5MGBA 2AZTA 2OOKA 3H4TA 3JAWA 1M7GA 3PPIA 4OVKA 2QXTA 4UU7A 2BFEB 3DL2A 3D9QX 1E64A 1TE2A 4XYBA 3HM9A 4NICA 3DLPX 4DY4A 1TIPA 4YHBA 3QF4B 2QT9A 3S6JA 5K05A 2WFLA 3A6GA 4UU0A 4DC1A 3SWWA 2KX7A 2Q1TA 1DDGA 2HEGA 3NYRA 5G02A 4CKWA 5K0GA 2O8NA 1IZ7A 1YZUA 3RBVA 5KYUB 2P7HA 5F3WB 5HIAA 3SXJA 5LU8A 1Q84A 1VL6A 3MD9A 1W25A 1DKLA 5AKEA 2K5UA 4DWWA 4UOEA 4LY3A 1R6TA 3GGSA 3TTUA 1W36B 2A1IA 4HN2A 5CLJA 1IZ9A 3D8NA 2DH5A 4U7GA 5EJ7A 4TTAA 4B3BA 3HCFA 2FCRA 5DU2A 5BW4A 4XVRA 4QJIA 1L4GA 4FMPA 1XU9A 4LTDA 2AKAB 2WPDD 4HRVA 4JJFA 1LW6E 2I7XA 2QY6A 2XNSA 5JZOA 1HOTA 3ZY3A 3WIBA 2OGTA 4FB5A