5DHFA

Crystal structure of hrio2 nes peptide in complex with crm1-ran-ranbp1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
205
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 60
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dhfA00
4PPNA 4BPBA 4FIDA 1JNYA 4LC0A 1JJ7A 5FR1A 4AURA 1E9RA 1OIVA 3KKNA 4LYFA 2XNDA 3NBFA 3QOFA 4EPTA 1JPNA 3CW2A 4EUNA 3CONA 1XDBA 2H18A 4JKIA 4W9MC 5JJIA 1JEEA 1PUJA 1W36D 2R6CA 4A0RA 2GTPA 3ZJYA 2A78A 2R8RA 2ZTSA 2QMUA 4KI0A 1V5WA 2NPFA 4OQFA 1SVLA 3GPLA 4C3ZA 5GJBA 1AS2A 1O3YA 2VP5A 4TYQA 4A4DA 1XWIA 1WE2A 2NG1A 5FOVA 3PXGA 5JCZA 3KQNA 1UDXA 3X2SA 1ZINA 4L4UA 1BMFD 4EPYA 1AM4D 1J2JA 3CF6R 1W44A 4LJYA 1KSHA 1GL6A 2V1UA 2DFLA 2XEXA 3A4MA 4HZIA 4DVGA 2F43A 4RKEA 5B58C 2ZYTX 5F98A 3QIAA 1E9DA 1DEKA 1KK1A 1VIYA 2PJZA 4TQ9A 5CIWA 1XTIA 2G1JA 2OFOA 4MKFA 5EE1A 1IN6A 3LAWA 5H70A 3U7GA 1OFUX 1YE8A 4ACBA 2RCNA 2ZJ8A 4M22A 4XH9B 1RKBA 5HE9A 3KKPA 3TAHA 2A5GA 3MCAA 1F48A 4UKDA 4BE7B 4RZ2A 2J0UA 5AK0A 1GNRA 4U00A 4D4JA 3AVWA 1OHHA 2ZXUA 4JL6A 4DT1A 4IOLA 1CR2A 1VG0B 2D2EA 1ZC3A 2QUZA 4TMVA 2QQ0A 2YOFA 1JJVA 3A1TA 1JAIA 1G64A 4PO8A 1NIJA 1XTSA 2QPTA 4P32A 1UM8A 1R8QA 1UKEA 3GLHB 4B3BA 3SI7A 4XOIA 5B2ZA 4WZAE 1KMHB 2RGNC 3FMIA 4QBHA 1KJZA 3T34A 3NC1C 3A8TA 3F8TA 2OCYC 3BC1A 1E69A 8OHMA 1A4RA 2MMGA 3U4QB 4LHXA 2XB2A 1GUAA 2W0SA 4AKEA 2VA8A 4IOJA 2IS2A 2GEDA 2ZRNA 1W5SA 1VCNA 5GJVC 5C4GB 4DLWA 1VHTA 3FHOA 4D26A 2DHRA 1VECA 4ESHA 2QAGC 3DO6A 2DFTA 1D8TA 4MA4A 3CR8A 3R20A 2KI5A 2G9NA 1RPZA 2G3YA 3CR7A 4JVNA 3FFAA 1G4UR 2ZU6A 5FTLA 1ZNZA 3DHWC 4JBWA 4C2TA 1W0KA 2FPKA 3VTKA 5TVKA 4LBYA 1DOAA 4NYMQ 4RVCA 5JS7A 1S1CA 3IIKA 5DH9A 1X8JA 2OCPA 3T1OA 5IK2D 1MABB 4OBEA 4EIWA 1R0YA 2P5TB 1XD9A 4XIGS 1K5GA 4BUJA 3SEAA 5AJZA 1U9IA 5FOUA 1D9ZA 1XFAA 2H8KA 4D4MA 3P4XA 1G3IA 4LCBA 4P33A 4CDGA 2BBOA 2ZRAA 1OXSC 4NU0A 2I4IA 1E1QD 1GRNA 3KB2A 4DDWA 1R0XA 1YQTA 4I1OA 1M74A 2JJ8A 1E2FA 4NDZA 4Q1EA 4C2UA 3OAAA 2WICA 5DN6A 1MR3F 4KO8A 1EGAA 1ZNXA 3SYNA 2D4HA 5JHGB 1CLUA 4KITB 4F93B 4P0TA 1NIPA 2XZOA 1GG2A 4TMTA 4OJQA 4NONA 1N6IA 2YNMA 3W8RA 3L0SA 2OZEA 1G8PA 2C9YA 3BS4A 4HAVA 3ADDA 4M1OA 4DC9A 5TMPA 2JAQA 3OE7A 3EC2A 2GCPA 3PUXA 1U8ZA 2HYIC 3IHLA 2OT3B 5J4KA 4F4CA 3HPQA 3R9IA 3L0IB 1Y63A 1N0UA 2IYZA 1QG4A 2YV5A 4MGYR 2FV8A 3UPUA 1GOTA 4A2QA 4B43A 1N6LA 2WWFA 5KNDA 3BERA 4KYIB 2PCLA 3ADBA 2JCSA 4N3NA 2ODWA 4MYUA 3O47A 2JLZA 3BIFA 3IPXA 1ZM3A 3EPKA 2ZSBA 4US1R 5ELXA 3QXCA 4IRUB 4RSGA 3SOPA 4CGZA 1W1WA 2V1XA 1Q1ZA 2ZRPA 3OEED 3W6NA 1U0HC 3AF0A 2A2ZA 4NTZA 4QM6A 2J0UB 4H1UA 2O8CA 2GAOA 1ZD1A 2FOLA 2RB4A 1FP7A 4BLSA 2JDIA 3NXSA 2DWQA 4DT1B 5IHPA 1XJCA 3FKSD 3KKQA 1R0WA 2CEAA 2H5EA 4M9QA 5GVRA 2I1VB 4DUGD 1KSGA 2F55A 4PC2A 2J59A 2VP9A 2EFCB 2JIZD 1IQPA 5AUQA 1PV4A 1NBME 4AKGA 1N5JA 4LZZA 2NGRA 4JLVA 4L15A 3K70D 4M9SA 3QXXA 2IXFA 1CJMA 3QXJA 1XMJA 3UKDA 4CEHA 5JRJA 1PJRA 4HDQB 2ONKA 3I72A 4JLAA 5CK5A 2JJ1D 3LQQA 3GLFB 2IYLD 2CE7A 3AF4A 4V02A 5DI3A 2IYVA 3WMEA 4B3DA 1Y3AA 3ZD6A 4DLXA 1HY3A 3BRWD 1E2DA 3VR6A 3HYRA 3IO5A 4AD8A 1MO4A 1SVSA 4M8NE 2G88A 4KFUA 3U7HB 2CMKA 3B60A 3LDAA 1Z08A 2VP6A 3OF5A 2P6RA 4V0MA 2WJJA 3KJEA 5FOSA 3G5UA 2PT5A 4QBGB 3KUDA 3I3SR 5L8VA 3U60B 3GFOA 4HDCA 2K5UA 4RCYA 3TBKA 1P2VA 5EZ5A 2IC5A 4ITRC 2YWGA 4CF7A 4TZ0A 4Q7JB 1HT2E 1OH7A 2ZSDA 1S4QA 3EA0A 1XF9A 3NC0C 5HKKD 1ZM2A 3CM0A 4LJ8A 1II8A 3UMRA 2BJWA 2V55B 5EXSA 3RS5A 3W9YA 3CX8A 5LBIA 3CH5A 4M21A 3W8NA 2FZLA 4FW9A 1P2UA 4BFXA 3FTQA 1K5DA 2AXPA 2RAPA 2ONJA 3H2YA 2ZI9A 4B44A 2V9PA 2ZJZA 4B35A 1RJ9B 2GESA 1N6HA 3EZ6A 1UADA 3BB1A 3VMFA 2QTFA 6Q21A 1QZXA 3KJGA 4KODA 2G83A 3BB3A 2NZJA 2FFHA 2JLSA 2C9CA 4RD4A 4Q5IA 1XXHA 4A2PA 2WJHA 2J5XA 2GVZC 2ZPTX 3WYAA 3VNUA 1FMLA 2G77B 3ZVMA 1QBKC 4MGIR 4D4KA 2O8FA 1P5ZB 1RYFA 1UKZA 2PZGA 4TTQA 3EIHA 3SFVA 1TQ6A 2OE2A 2WV9A 4I99A 4QOSA 4DIDA 4TQAA 2QSYA 3K0CA 2CHGA 4HLUC 2KBEA 3NKVA 3AVTA 4MRVA 1G9XA 3GCGA 2BJVA 2WKPA 2HYDA 2BWJA 4FXPA 3W3AA 5B57C 2OO7A 3IEVA 2F6RA 2R62A 2HUPA 2IS4A 3MWKA 4HLDA 1M1YE 2ZS9A 4Y0AA 3GFTA 5J4HA 5KYKA 2VHQA 4Q1CA 2LKCA 3PCRB 2O8CB 5A4JA 1N6KA 4JYBA 1RVDA 3GJ6A 2WJIA 4E03A 3CX7A 3BGWA 1ANKA 1RIFA 2LCFA 4BZXA 5TY0A 5SZKB 4IOKA 2AK3A 2RMKA 2OSBA 4AC9A 3MMPA 4WW0A 2NPIA 1NVUQ 3MJRA 4HYYA 3U3MA 3B2EA 2B7BA 2J7KA 1T3LA 2QT0A 2F9LA 3BH6A 4UNRA 2HT6A 5CB8A 1XPUA 4KLNA 1CJUC 2GK7A 4QNRA 3SYLA 4A8JA 4TYWA 5JBQA 1W2HA 1DG1G 3IQXA 4NZYA 3T61A 1NVWQ 2VTKA 1T5IA 1ZAKA 4DKXA 2CJWA 1SQ5A 3SHFA 2J9RA 2OXRA 5IK2A 1K8RA 1N6RA 1CU1A 3M0EA 2PCJA 2MSEB 2LWIA 4ZDJA 3U61B 1J8MF 2AKAB 2O52A 2ZI6A 4TT3D 3VHLB 3TW8B 3ZZUA 3FHTA 1WBDA 1QVAA 1S3SA 3HU1A 3NVAA 1RRPA 1E1QA 3CPEA 1Z63A 3CBQA 4RZUA 2Q9CA 3QPVA 3TGPA 2FFBA 4M1MA 4AWXA 4LV8B 1KMQA 3V00A 4DCUA 3CRQA 1FFHA 3K0CC 2EVWX 1IY1A 5IF9A 2IYTA 3VNVA 1ZNYA 1P61B 3FE2A 4PSKA 2IYUA 2VHTA 2FA9A 2W2XA 3MWYW 3TIFA 4DSNA 4YC7A 4BECA 3SN6A 2F1JA 3A1SA 1T0JB 3Q7QA 1C4OA 2ZR7A 4JLMA 2QQEA 4M53A 4JVMA 1R0ZA 1DAEA 1EFRD 4ARZA 2CDNA 1TF2A 4DJTA 4QJ3A 5GADl 2C98A 4Q21A 3VU9B 4CYMA 3RABA 2EFEB 3QKUA 2JLUA 2ZS7A 1XXHB 4MGZR 1Z6AA 1F5NA 2NO6A 3GLGE 5H68A 3ZGXA 3U44A 1A1VA 2VSOA 2EQBA 3OEHD 3B1ZA 3OEEA 4B73A 1YRBA 3ICQB 3P4YA 3X1XA 1HEIA 1WP9A 4LOAA 1LS1A 3AGPA 5EXXA 3VQTA 1G1MA 1TAGA 3FKSA 4DXAA 1A7JA 5DISB 3I92A 5KDDA 1AS0A 1BOFA 1LVGA 3C8UA 4O2LA 4OHVA 1OFHA 4QHTA 5D3QA 4ZCLA 4BFUA 4DUGA 4TYNA 3CF2A 5E95A 2O8EA 2DWOA 3N2EA 3SQXA 5FPTA 1J7KA 3F0TA 4XTRA 1XEWY 1GWNA 4JZKA 1J90A 4YMWA 1FX0A 3WRXC 4E07A 3IBGA 4HAUA 4LI0A 3UATA 1DAHA 3AP3A 3N70A 1HV8A 2XITA 4MYHA 1VCMA 3C7KA 1HQCA 4OHWA 1C1YA 1XCPA 2JJ1A 3EWSA 4LHYA 4ZO4A 1T6NA 4AYXA 4AYTA 4HB4A 5KSOA 2HF9A 2DFNA 3T1TA 1U98A 3ZIAD 4N0DA 3WYFA 1GZSA 2WOOA 3RDPA 1TUEA 1EXMA 2DB3A 3NDBB 2IYQA 2QRNA 1YU9A 4D25A 4TYYA 3OESA 3GJXC 2Z4RA 3LQRA 3N2IA 4LJ4A 2QMOA 5M04A 2H92A 3AQ4A 2XXAA 5DNYB 4GL2A 3L2OB 3TUZC 5DYIA 4OQNA 2HT1A 3ADCA 2ZRHA 3PFIA 1NN5A 5JWRA 1E2LA 3U2QA 2CJWB 3QF4B 1Q0UA 2X1VA 1FUUA 3VKGA 3LA6A 4TL7A 5HKKA 1W0JD 3B9QA 1G8YA 1PZNA 3WBJA 1G3RA 1KO1A 1T8TA 1UEIA 2RHMA 4WXRA 2ODEA 3NIBA 3BFVA 3V9PA 1CKEA 4E09A 1WRBA 2QI9C 4D6PA 2Y8EA 4LYJA 3P32A 5GJCA 1TF7A 4B71A 4CEIA 1UJ2A 2WIAA 2V8OA 1MH1A 4TLCA 4B3FX 1IONA 4HLQB 1DAGA 1G6OA 4FINA 4DDTA 1SKQA 1GP2A 1JXMA 3L0OA 2F1RA 4O2RA 1Q3HA 3SNHA 3R8FA 1HTWA 1SULA 1ZVQA 2ERXA 1E2JA 2YOGA 2YWEA 3B7GA 5GVSA 2E1RA 1CJTC 3ZLJA 1D2MA 1VMAA 2F3RA 5J4YA 4GDFA 4YDSA 1KOFA 3THWA 3SJZA 4PPFA 1IHUA 4NYJQ 5KDLA 1JAHA 1T91A 2OG2A 4PC6A 5K8IA 1TQ4A 5HTKA 2QMEA 1X1RA 3B13B 4ARZB 5UKDA 1I4LD 4R2HA 3PIRA 4LJ6A 5FOXA 1KSFX 1QHXA 3KB1A 3Q9LA 2Z0MA 1IXRC 1TNDA 2B92A 1NP6A 4TMXA 4EJSA 4ERNA 4HLCA 5KPJA 3Q5EA 4ON9A 4EFMA 3SQWA 1E1RD 5K8TA 3A1VA 4FN5A 2PEYA 1XTRA 3BFXA 3CF0A 4NMMA 2YOHA 1AKYA 2DBYA 2AD5A 1WBBA 2C04A 2A5DA 2X8AA 3QENA 2YWHA 4RZXA 5FUVA 1DBSA 4JKYA 2CK3D 2JLXA 3RLFA 2EW1A 4YXWD 3K0AA 4JIMA 3EPHA 4NYJR 4A2WA 4I4LA 1IJFA 1E96A 1E6CA 3LXRA 4JLKA 1JECA 1MRNA 1W48A 3HR8A 1OW3B 3TR5A 3B1VA 5L3QA 1S0UA 3KZ1E 1SKYE 2Q6TA 1NBMD 2QSZA 3DZDA 3JZMA 2BIFA 5L3SA 3FMOB 2RGCA 1ZIPA 4FCTA 4PX9A 1SVKA 1XCMA 1ONBA 4TSFD 1Z6XA 4YMTA 3FYHA 2YVUA 3EIEA 4BZPA 4QBFA 2ATXA 3FGNA 1KK2A 2YC2C 4BFSA 1US8A 2F1HA 4DBLC 1H65A 3D3QA 5JHHB 2Z4SA 4HSEA 4OK5A 1XRJA 4TT3A 3IILA 4MITA 2AL7A 2ZRCA 3VKWA 1FTNA 1XZQA 1P73A 2VLIA 2ZAMA 1SXJB 1YZUA 2D06A 2XB4A 4IEIA 4KLZA 5EE9A 2XXAB 3CRW1 3KXIA 4RZ3A 2MMCA 1E2QA 1NJGA 1G5RA 5DYGA 1NF3A 4OI0A 1FOEB 4FMCB 3RWMB 4DLVA 2ZRDA 5E4FA 1Z2AA 4BLOA 5CK4A 4HAYA 2ATVA 2QP9X 2PT7A 4LJ9A 1G7CA 1E2HA 1MO3A 3W5JA 1TL7C 3AUXA 4LV5B 4MKHA 3LX8A 4OI4A 4MH0R 3ADKA 4FCWA 1GDDA 2FMXA 4WZBE 1VKJA 1DARA 4UJ3A 621PA 1KY3A 3NG1A 3EASA 2J87A 3T5DA 2FSIA 4U02A 4OQLA 5EP4A 1V43A 1EFRA 3PUVA 3QKRA 4UNSA 4WXPA 1E2IA 2HLDA 5G53C 1N0VC 4BLRA 4HZUA 2J1LA 1ETUA 4W5HA 1Z28A 2CBZA 4LPKA 4OQXA 4KSCA 5FR2A 1OH8A 1XNJA 1O87A 1Z0FA 2RGBA 2RGNA 4UNNA 5E7IA 5FBRB 2A5FA 3EZ2A 4C0LA 4MYTA 3OEHA 3C4JA 2QRZA 1F6BA 3K9GA 5BYKA 2V3CC 4UXIA 3WRYC 5KSZA 4G5OA 1XU4A 1FUKA 4GOKA 1E4YA 2ZSAA 3LBHA 4PC1A 4ACAA 3FOZA 2HV8A 5FBVB 1XD8A 2DYKA 3EA5A 5CYPA 3B1WA 2W83A 2QAGA 3GLHE 3H4MA 3JZAA 4HUQA 4EJSB 5DSZA 4IHQA 2IYSA 3GEHA 1AN0A 1M8PA 2V6JA 3LLUA 4EPWA 4DHEA 4GMXA 3GLIA 5EXPA 3QKTA 1OH5A 1X3SA 5DE3A 2DPXA 2J41A 3WP0A 1L2TA 4ZDWA 4IKEA 1UBFA 4US2R 3ETLA 4P4SA 1BIFA 1KGDA 3LFUA 1IXSB 1QHSA 2GETA 4BRWA 1UBCA 3K0AB 2CCKA 2NO1A 3DOFA 3A1UA 3EZFA 1YR9A 5HE8A 4IFBA 2RKOA 5L3QB 5JRZA 2BV3A 2A5YB 2C03A 3ZIAA 1Z6YA 3TUJC 1TPZA 3U7FB 3I73A 1Q1QA 4JLNA 4PC3A 4DWJA 5C46F 5L3SB 4OQMA 3PEWA 1X8LA 1QHGA 1WF3A 3KFXA 1Z0JA 4FMDB 2J0QA 3VHXA 4LV6A 3TUIC 3FDIA 3NHAA 2HJVA 3ZQJA 1VPLA 3W6OA 1K6MA 3X1YA 1YZKA 1KHTA 4AKHA 3QBVA 1N6PA 4M1SA 1FQKA 2ZR9A 3QVVA 1CS4C 1ZRHA 1G41A 3K9LA 1W0JA 4RFSA 3GD7A 2EYUA 4PHGA 2AXNA 5BW8A 1RYHA 3C5CA 1DTSA 3HDTA 1IJEA 1NSFA 3GJ0A 4IFEA 1YR7A 4Q1DA 2IWHA 4JBYA 5F9HA 4XVRA 4DLSA 3PUZA 2GJSA 3T06B 1MO6A 3BORA 3FPAA 2EFDB 2DY1A 1MKYA 4MRSA 4JL5A 4JVLA 3HP1A 4FD2A 4IW3B 3QNUA 2G6BA 2OLKA 4DDVA 2ZVQX 2OFWA 1PLKA 3RWOA 2Z83A 2O0JA 3I8SA 3A4LA 3P27A 1E9AA 2AKYA 3VAAA 2JLYA 1YRAA 4QKQA 4BEBA 3U6KA 4LUCA 1E2KA 3EXAA 3WHKA 1M7HA 2C99A 1H8ED 4DLRA 3AKDA 1VCOA 1U0LA 3QI2A 3KKOA 1XJQA 3AVUA 2ZVPX 4TN1A 1NI3A 3Q7PA 2EWWA 1G7SA 2GBLC 4HZUB 1OFIA 4M9XA 4LHZA 3GEEA 2ZJYA 3A36A 1GILA 3KX2A 2NMVA 1RC8A 1E1RA 1TU4A 4CRWB 2GDJA 1Q20A 3DMDA 3QQ5A 3U3KA 3X1WA 2ZQ5A 1OJLA 2OHFA 4FMCF 1U90A 1N25A 2R6AA 2OM2A 2XOKD 4BFZA 4AY2A 2R6DA 2WKRA 2VSFA 1E9FA 2W6JD 3SC3A 4EAQA 4ZIRA 3NDPA 3SBDA 1X6VA 1ZC4A 2CK3A 2DWPA 5DIFA 3T1QA 3ZVLA 1KI7A 1G19A 1E0SA 4PQYA 1ODFA 4QBIA 2QAGB 4PO9A 4LJAA 4Z1MD 4C0JA 3AVVA 1TQ2A 4PAQA 4DCVA 4IVQA 5CLQA 4NYMR 5HZKA 3GLIB 1J99A 1NBMA 3SZRA 5GJWC 3UMFA 4AK9A 3SHWA 2IHYA 2E87A 3S1AA 2I3BA 4G5RA 1QG2A 1G3UA 4PZYA 4TSFA 5G40A 3GLFE 1XMIA 4U7DA 3SS8A 4AG6A 4QJ4A 4BLPA 3K9HA 1OYYA 2ZJ5A 1CR0A 2AHOA 2RHDA 2PMKA 2F43B 1BKDR 2VBCA 1KYIA 2OCBA 3TQFA 2YYZA 3LY5A 1OT3A 3UWKA 2FDCA 4O0MA 2V4ZA 2JEOA 3CWZA 4D4LA 1OKKD 5KTYA 5DGXA 2ZR0A 3L8YA 1HQYE 2L0XA 1IN4A 2GXQA 4W7SA 2NTYC 1G6HA 4JT2A 1XTJA 3DPUA 3CX6A 1CF4A 2UVQA 3W3ZB 1G16A 1OIXA 4QC2A 4B75A 3EW9A 1TTTA 3RSOA 4PSAA 1W4BA 1AA9A 3CO5A 3H0KA 4DLYA 3EIQA 821PA 3K0EA 4TMWA 2JLWA 1IXZA 3LRPA 1ZM4A 3RHFA 5B30A 4GOJA 1OB5A 1XX6A 5FTMA 2BEJA 4ZKDA 5JSZA 4KXFB 1LTQA 2BC9A 4HLUA 2OV2A 4EFNA 1YVDA 1YZGA 1GKIA 2CE2X 2ZRBA 1GTVA 1QHIA 2B8WA 5FL7D 2QMHA 4NCHA 2ZRJA 2PL3A 4PO1A 1UKYA 2BMFA 3HYTA 2QL6A 2REXB 2FGKA 2PH1A 4ASUA 3WNDA 2B8TA 2ZRMA 4ZPXA 2VO1A 1IN5A 4FMDF 2GXUA 2JGNA 5TDHA 3WP1B 3IKJA 1P4SA 3NTUA 3EPJA 2OILA 3DM9B 4G0NA 4MUAA 4UNPA 5LB4A 2GXAA 1ELOA 1WXQA 2HF8A 1ZBDA 5JJKA 1HUQA 1Q22A 4KCGA 4HUTA 2C95A 4B3GA 2X2FA 4I1SA 5BN4A 1DAFA 1HH4A 1F2UA 2Q21A 4XTCS 3V4FA 1RRCA 4OK6A 4GT1A 4ZCIA 1H8HD 4H9GA 3TH5A 3GEIA 2QORA 2ORIA 4MGKR 4BQSA 3P20A 2PEZA 1HT1E 2BM0A 121PA 2W00A 1NY6A 1MV5A 4JLJA 3LVRE 1KI8A 3O8CA 1BMFA 2NOAA 4A6PA 1GM5A 2O8BA 3KJHA 5F2EA 4X8LA 4POAA 1JPJA 1IBRA 1LNZA 2FH5B 3THXA 3KQLA 4C0AC 2ODBA 1DAKA 3EAQA 1E98A 2CHQA 4GPTA 1LS6A 3DVLA 3IHWA 1NMZA 1GITA 3AKCA 3DL0A 1VCIA 3KXKA 5FUWA 4GMDA 2QT1A 5C18A 2IK8A 1DE0A 4C7OA 4O3MA 1D9XA 5IT5A 1XEXA 1JB1A 2BM1A 3U3JA 1E2EA 4KFSA 4JT4A 3AVPA 4B6FA 1P9NA 5E7MA 2XTZA 3T35A 3PR1A 1EESA 5SZIA 1CBUA 4RD2A 5LPNA 5LD2C 4L16A 1X86B 4R7ZA 4ZI2A 5AJWA 1OF1A 2QN6A 4OYHA 2ZI5A 4PTLA 2VHUA 2WWWA 2GF0A 2YC4C 4CEJA 1OIWA 2D7DA 3MGCA 2QAJA 2QENA 3RS3A 1A2KC 421PA 4RD3A 2V54A 3E70C 2QPOA 4DSUA 4N0EA 2B7CA 2WOJA 5J4VA 4Y0VA 3GJ5A 4XJXA 1E9CA 4TMKA 2CHVA 2ORWA 3RVBA 1YZTA 4JLBA 3TLXA 3TVDA 4DRZA 4IDPA 4CEHB 1P60A 4J0QA 3UG7A 3QSYA 1FL9A 2QU8A 2P5SA 1N3BA 1SVWA 1KAOA 1Z8FA 4Q01A 3B1YA 4K46A 1DVRA 1I2DA 2Q3FA 3BH7A 1NMXA 5DI3B 1CR4A 5EJEA 3AVXA 3UANA 4NCIA 3BXZA 2FSFA 1XXHE 4OHYA 4HB2A 2JASA 3KXLA 5HR5A 2GEVA 1NJFA 1OXXK 3B78A 5HCIA 3O8DA 2ZROA 3AF1A 1LY1A 1PLLA 3GJ4A 4GBMA 4HB3A 2HXYA 2N42A 2BHRA 2XNSA 3NH9A 4B74A 3WY9A 3OHMA 3DZ8A 3BJIC 3THOA 1G5PA 1I2MA 2FSGA 1Z5ZA 4M1WA 2XOKA 2KJQA 1RRFA 3OIYA 4H1VA 2ZEJA 2CXXA 2X77A 1BYUA 1VYUA 2YZ2A 2GJAA 1W36B 1L4UA 1GVNB 2PX0A 3M4YA 1II8B 2QA5A 4Q9HA 2WSSD 4G5GA 2XGJA 2FSHA 1VG1A 4Q9JA 2R9VA 2HEIA 2ERYA 3ASZA 3OIWA 3RS0A 4D82A 4LWZA 3I5XA 5KUTA 1XEFA 2QROA 4FWTA 1OV4A 3VX3A 3DMNA 1Z47A 1KNXA 2H17A 3QPUA 1OLOA 3D31A 1I4TD 1KI2A 1E0JA 2ZYWX 3SFZA 2VP0A 4JMPA 1R8SA 2ODNA 1S3GA 1RRGA 5FPKA 2BCJQ 4V0LA 1E0KA 1ZU4A 4XD7D 1E0AA 3QG5A 1KJYA 3CKLA 2E9SA 4URUR 2D74A 2W2TA 4NH0A 4PR0A 5BQ5A 1FQJA 2BEKA 3QUSA 3OFND 4Z8XA 4OHZA 1OKKA 3U3RA 4BLQA 4BZQA 2O8FB 5A5GA 2EYQA 2NIPA 1BH2A 4QG7A 2GF9A 3FKQA 1HE8B 4JBXA 2TMKA 4CVNA 2RGEA 1XEXB 4KBFA 2GHIA 3CIOA 4UQOA 1L8QA 4BGDA 3IUYA 3MWLA 3R7WA 3KQKA 4C0SA 3LV8A 4S2EA 2O8DA 3CB4A 5CDFE 1G7RA 4LPSA 1IN7A 1SZPA 1Z3IX 2GNOA 4MRNA 1G8GA 1E9EA 4Q19A 1A5TA 2JIZA 4I81A 2WJGA 3BD9A 1OFTA 3I61A 4Z54A 3W90A 4JS0A 3NH6A 4YMUA 2CL0X 3B9PA 1YJ5A 1CJVC 4LYAA 2QE7D 3A1WA 1IY0A 3SJCA 2J7PD 2WMNB 2CLCX 3IBYA 3Q8XB 4LYHA 5KO2A 4CEJB 4QXAA 5FOTA 5EE5B 3A4NA 4JJKA 1G8FA 1DAIA 1GRQA 4Q00A 2WMOB 4PHTA 2VYFA 3WBKA 1D5CA 2D62A 4KVGA 4A15A 3PJRA 2VP2A 1Q12A 2PLRA 3AP1A 4CZ2A 4F4IA 1G8HA 4RD0A 1GSIA 1P9WA 2FPMA 4YDHB 4KSBA 3CWQA 5TV2A 4LJ7A 2Q3MA 3QG1A 4A8JB 1T4GA 1RFLA 4NKRA 2YINC 1AGPA 1T9HA 1P2TA 2DFKB 2W0MA 3B6EA 4LBWA 1CP2A 4B33A 2GXSA 3EPLA 3UWOA 4B34A 1Z0KA 1M34E 1WDTA 2IEZA 4A0HA 1U81A 4TMZA 2IXEA 2CL7X 3REGA 1XBTA 2O0HA 4PZLA 3GJ7A 4Q9IA 2IX3A 4O25A 4PHFA 4G01B 1N5IA 2IUSA 4PAMA 5LB2A 5KU1A 2GILA 3ZD7A 2IUTA 2VP4A 1JBKA 4DCSA 1OHHD 2WPDD 4MUBA 3I4LA 1R2QA 3HPRA 5FL3A 4BFWA 2ZRGA 2OESA 2IL1A 2ZUDA 3KUCA 5CJPA 4TLDA 4TQUS 2AR7A 1D2EA 2PMDA 2IYRA 2FF7A 4W5JA 2HCBA 2NO9A 2FZ4A 4TL9A 4C0BA 4AG5A 4LHVA 2GWHA 4GFDA 3AM1A 2J46A 3IQWA 3DDCA 3PUYA 1MOZA 1IN8A 2ZI3A 2IT1A 3C5HA 2NO0A 2P3SA 3E1SA 3QVUA 4TTPA 4B2LA 3VR4A 1CEEA 1VTKA 1W49A 3QEJA 3WYGA 5FH9A 2A7QA 1XCGB 4JLPA 3JVVA 4NE2A 2ZUBA 1F2TA 1E9BA 1TADA 2HJGA 3AF2A 4IDQA 4B2IA 3U7EB 1N6NA 2BMJA 1EK0A 4HAWA 1R7RA 2AD1A 5EUMA 1CTQA 2X19A 1FMJA 1YZLA 3Q72A 4LK2A 2WWYA 5HCNA 3U44B 1SXJE 2C5LA 4HAXA 2ZE8A 1ZYUA 3MD0A 4ZKEA 3ZQ6A 3DKVA 3PITA 1NKSA 2FX3A 3VR1A 2P65A 3EG5A 3PUWA 3DEFA 2MSCB 3R7WB 5E3HA 4TZ6A 4PQRA 2J45A 2GZAA 3QKSA 4ZCMA 2AWOA 1SHKA 3SU8A 2O8EB 4Q1AA 2YHSA 3VFDA 5FTJA 4EDHA 3SR0A 4B2PA 1FX0B 3K70B 2IWRA 2IYWA 4IVPA 1NN1A 2XZLA 4URYR 1VIAA 2DR3A 3AKEA 4CT4B 2R65A 4U5XA 3LWNA 1KZGB 2GJKA 3RSLA 1N0WA 3FFBA 4FCVA 3QE0A 4RD1A 3R9WA 1SXJC 3OAAD 1SHZA 1L4YA 3EX7C 3K9NA 5JJLA 3RRMA 3TR0A 1G7TA 3TW4A 3O8BA 5P21A 2ZJBA 3UXMA 1II0A 1KO7A 3RRYA 1DO2A 4KYUA 1G17A 4TTRA 1I4DD 4G3XA 3IIMA 1NKTA 1ZMXA 2NO7A 2VQSA 4JSYA 5FPYA 3K09A 3SE0A 4X8HA 5D3MA 3GP8A 2A3RA 4BFYA 2I1QA 5AUOB 3BBPA 3KFVA 2J0SA 4L5BA 4NP6A 4X8MA 2ZRIA 5KDOA 1PUIA 1QHYA 2YJTD 4PC7A 2ZE6A 4FMBB 3QXHA 3EZ7A 4WZ6A 4XSHA 3TSZA 1P62B 4URZR 1XB2A 1T3SA 1VG8A 1XEWX 1ZIOA 2KE5A 3ZZTA 1UEJA 4KVAA 2WSSA 2A5JA 1N6OA 4A0GA 4D80A 3GLHA 3WMFA 1EFTA 1AS3A 5DLQC 1JI0A 2RGXA 1CRPA 1P6XA 2P2LA 4WVFA 1DAMA 2IF0A 4CEIB 3JVUA 2ZU0C 1KMHA 1KDPA 3B85A 3F5FA 4IEEA 4Q4AA 2JDID 3J81k 3D8BA 3UIEA 3R9XA 3RC3A 2HCJB 2QM8A 1RZ3A 1KIMA 3OZXA 4NCJA 4YONB 5JS8A 3U4QA 2KBFA 3IIJA 4YMSA 4JYCA 1BO6A 4US0R 3VR3A 1QHNA 2OXCA 3QXSA 1MRSA 3AB3A 2F7SA 1JR3E 4HB0A 3THWB 3OFNA 3M1IA 2BKEA 1M7GA 2ZSEA 2ZUCA 1UF9A 2YWFA 4DCNA 3I8XA 2W6ID 1E2NA 3KL4A 3TNFA 2P6NA 4KBGA 4R9UC 3ZVRA 2FFQA 1LF5A 2PLFA 2ZM5A 2VF8A 1GIAA 1F2TB 4DEXA 3N5CA 4A9AA 2ZI7A 2HDNB 1HA3A 4LC1A 1EFCA 2NQ2C 3LD9A 3RS7A 3SYKA 5BN5A 3A37A 4HEJA 4DCTA 2VL7A 1YKSA 3NEYA 4AYWA 4DZZA 3CH4B 2QE7A 2QNRA 2CVFA 1S9HA 3TKLA 4LJ5A 2BVNA 2J7PA 4WAUA 4EFLA 2GBLA 3K09C 2B6HA 2XSZD 1F3OA 3AVOA 3MWJA 4C4PA 2C9OA 2XJ9A 2OFXA 3P1JA 4E5UA 4DB2A 3QKSB 3HWSA 5LDDC 2GKSA 2UKDA 4G5QA 1U99A 2F9MA 3NEJA 4Q02A 3VR5A 5FFMA 4LY6A 5EQTA 4Q4JA 4HATA 3CRRA 1E32A 1KI6A 5EE3A 1S8FA 1W7AA 4A1FA 4F4JA 3B5JA 1XPRA 4A36A 3W5IA 2F1IA 2IS6A 2A9KA 3EARA 3TSWA 4HAZA 1LF0A 3LW7A 2D2FA 3LLMA 1GFIA 4G5SA 1ZM7A 3AVQA 1FPMA 4RD6A 4PSVA 2JLVA 1B23P 2WVJA 1US8B 1QHHA 3C41J 5KHOC 5EP1A 1UKVY 1G21E 4JVSB 1ZCAA 3CPJB 3PEVA 5KNBA 1NLFA 4QRHA 3GQBA 1E94E 3E5HA 5FI0B 3RC8A 1Q21A 5D3MB 4XWKA 1EX6A 4Q1BA 1KO4A 1ZD8A 1Z0AA 2JLRA 3IPYA 1R5OA 2WPDA 1T0HB 4I1VA 1XPOA 1UFQA 2Q9BA 3M6AA 5CJ2A 3D6TB 1ZW6A 3IO3A 3C15C 3WNCA 4MDEA 4DLZA 3A58B 2BKUA 2ZRKA 3GLIE 5JI3E 5AWFC 2FN4A 1Z29A 4Q4LA 1TMKA 3HU3A 2WWHA 1DG3A 1YZQA 4QGHA 3TQCA 4Q4AB 2V7QD 1ZUHA 3EWAA 1EWQA 1YR6A 4QM7A 2QP4A 5J5CA 1U8YA 4AKIA 1GNPA 3QKRB 1Q44A 2CVHA 4IDHA 3GLFA 3T15A 3GFPA 3THYA 4F7WA 1F60A 2AN9A 2AWNA 4AIIA 3MJHA 4C9BA 3B1XA 5CM8B 5FPHA 3V4RA 3C14C 5SZJA 5G3YA 5DI9A 1G4AE 4TLBA 4ABYA 4MKIA 3ZZ0A 4Q7LA 4PQFA 2Q9AA 3K1JA 1PVOA 1WQ1R 4II7A 3T12A 4Q18A 2ZE7A 1KK3A 5C1BA 1OSNA 3TE6A 2ZRFA 5AJVB 1LFDB 3I32A 4K81B 3I62A 2XAUA 4YXWA 1GNQA 3C16C 2ZJAA 5E7JA 4PXAA 5EP3A 4HUQB 2D7CA 3LBNA 3AF3A 2JATA 3RANA 3Q5DA 3LO5A 4PHHA 5FBQB 1Z6TA 2PZEA 1AQUA 3AV0B 1IAQA 4EPVA 1T5LA 2R2AA 5ANRB 4P4SB 1KAGA 2EWVA 4TWZA 1JQJC 5FBLB 2ZREA 1VHLA 1RJ9A 3LVQE 2CCGA 3P26A 1ZUIA 1J8YF 1W4CA 4LSGA 5FUXA 2ZJOA 4QJ5A 1WCV1 4KFRA 4YLGA 2R44A 2BMDA 4DIEA 1W2GA 5KPDA 4Q4JB 2QM7A 2H1LA 3MAAC 4NCNA 1KI6B 2RH5A 2WAYA 3B82A 1DS6A 1R4AA 1S2MA 721PA 5BYJA 1CRQA 4AI6A 4D2IA 4KFTA 2OBMA 4IXNA 2GRJA 2R6FA 2N1BA 2XJ4A 4LRWA 4BEJA 1PLJA 3OIUA 1M7BA 4Q9LA 1UAAA 2ZE5A 4BFTA 3PV0A 4OI2A 4Q7KA 1HYQA 2BCGY 3AUYA 1XTQA 5B64A 2GZDA 3L8ZA 2OCAA 4WIAA 3CZQA 3EZ9A 3TK1A 1NSTA 1QHHB 4RFSB 5EXTA 1W4RA 2GCNA 2H7VA 2GJ8A 1UDWA 1COWD 2QGZA 2ZYUX 4QHYA 1W5TA 1E4VA 3SDZA 4TLEA 4YQFA 4Q9KA 2ZYVX 3BOSA 1RW4A 2IS1A 2QTHA 3BE4A 3L43A 3VKHA 1Z06A 4JL8A 5L3RA 1FTSA 3FB4A 2FNAA 1EFHA 2J3EA 2V6IA 2VPPA 1U2RA 1EFUA 3T1VA 3WMGA 4ZI3A 5BXQC 5TXGA 3CLVA 1E79D 1CJKC 2WWXA 4D0GA 1NN0A 3EC1A 5FUYA 3O8RA 1KDRA 2ZITA 2O5VA 2Z43A 1KI9A 2QY9A 4DLTA 4ZDIA 1U0JA 4TYPA 1U9IC 1OYWA 2FG5A 1P2SA 2RGGA 4EPXA 4ZV4A 1B0UA 2VSXA 3BK7A 3FWYA 5FTKA 2ZI4A 2W6IA 1DO0A 3MRSA 1XP8A 3MFYA 3H84A 1SVIA 4LGMA 1YR8A 5EZ6B 3THYB 1CIPA 4LDJA 4OHXA 3CRMA 2XTNA 3WHLA 1Q1BA 1CXZA 1G20E 1OXUA 3ND8A 3MUFA 3NBYC 1XMVA 2HXSA 3F3YA 4V0OA 5EE0A 3ZS9A 5CB6A 3R8CA 5IRCD 1AZTA 3E2IA 5KNCA 4FI3C 3KQUA 4RFVA 5JLJA 3GMTA 3REFA 1UBGA 1DELA 1SXJD 1UPTA 1KTVA 4ZIRB 1U8AA 4UXHA 4QFMA 2NZ8A 4PPGA 5FOWA 2OAP1 1OH6A 2XSZA 2GCOA 4B6EA 4ESVA 1S1MA 2PZFA 4JSTA 4LBVA 2IW3A 2WSMA 3TJZA 1WMSA 2P6UA 1N2CE 4R2IA 1XZPA 2QTVB 2ZRLA 4F38A 5K8UA 3NBZC 4MRRA 4NBSA 3TMKA 1KJWA 2MSDB 1Z22A 5DHAA 3A6PC 3FVQA 4UJ5A 3S1AB 1A82A 2C78A 5KSPA 2ZS8A 2XZPA 1BYIA 5DHFA 1ESMA 1A2BA 4A6XA 4DLUA 1HE1C 1MT0A 4GOXA 1TF5A 3SJAA 2Q0HA 2JJ2D 3CNLA 4WA7A 4QGAA 4Q4HA 1R5NA 4V03A 3VU9A 1JALA 2QG6A 1TU3A 1EWRA 1Q57A 2FU5C 2WHXA 4IOMA 4D0LB 4XWOA 2WAXA 3AEZA 3LXXA 4V0ME 2FEMA 2H57A 2GVDC 2P67A 3KTAA 3MG9A 5J4LA 5JEDA 1OE0A 1BS1A 1QRAA 2AK2A 1LW7A 2CLDX 2WJVA 2WWGA 4URXR 4A82A 1E99A 1TUIA 4BWYA 1YZNA 2P0EA 1TEVA 3PEUA 3W6PA 2RGDA 4Q47A 3TSOA 4JLDA 4IXMA 1EX7A 4KAXA 4CW7A 2WJYA 5DO9A 3CNNA 1W4AA 1IOZA 4OK3A 1GRRA 4JJZA 2FPLA 2QEQA 4I1UA 4P4UA 2UZIR 3T5GA 4C0KA 4IVRA 5JSZB 2D3WA 3NHBA 2V7QA 3LX5A 1H8EA 1NG1A 2G1KA 1HURA 1R10A 2WM9B 2OUKA 2WBLC 4MYCA 1NLYA 5J40A 4R71A 3RNLA 2BBWA 1Z0DA 5AJXA 1CR1A 1G3MA 1M6NA 4A92A 1G18A 1ZU5A 5EP2A 5LD2B 5A0FA 1W36C 1FP6A 4KHZA 1X8KA 4RCZA 4K8OA 2DCUA 2GA8A 2AFHE 4L9SA 5CIQA 5JZVA 1X1SA 2ANBA 3RRNA 1Z0IA 4BLTA 4CT5A 1JR3D 3GLGA 4DB4A 1P3JA 4M1YA 3SBEA 1WB9A 3AVYA 4GP7A 5C2JB 2H16A 4HDOB 1VG9B 5H1YA 4DSTA 1JXOA 1KDTA 4E22A 2W6JA 1ZJ6A 2GAAA 5HPYB 1AQYA 2BMEA 4C0HA 3QF4A 1F2UB 2LKDA 1KO5A 4M0LA 2Z6VA 4PFSA 3W34A 4NYIQ 1FNNA 4Z1MA 3K8YA 4EKDA 3PG5A 1DPFA 5CDFA 3ECCA 2ZSFA 2BDTA 4HI0E 2G0NA 3FMPB 1P72A 3QF7A 2PJRA 1KZ7B 1NMYA 4DDUA 1S96A 1S9DA 5FI1B 3IDQA 4RY2A 3AH8A 4LHWA 2QP3A 2OAQ1 2ORVA 2O8BB 2FEOA 2GCOB 3HJNA 3ICEA 2BOVA 1L7VC 3LW8A 2CNWD 1EG7A 1JR6A 3ASYA 5FTNA 2EFGA 1WA5A 3H86A 2W2VA 3K0FA 2IHBA 3THXB 3BH0A 2AX4A 1R5BA 2C2HA 2WZQA 4MDFA 2QZ4A 5HZHA 2BBTA 3I1FA 3UG6A 1XD2A 1DADA 1NN3A 4F91B 4S35A 2VIIA 4NYIR 3GJ8A 1XJ0A 2R6GA 4XWAA 3VX4A 4C7OB 2FFAA 2QPAA 5JMTA 2GJ9A 4QNMA 2HLDD 4BASA 4Q4HB 3WNBA 1ZUNB 4OI1A 4NHOA 3TRFA 1E2PA 4XVUA 4LX0A 4DSOA 3RYTC 1ESNA 1NVVQ 3LNCA 1COWA 3KTAB 4C0QC 2CL6X 4IJMA 4B76A 3QJYA 4GI7A 5FPSA 1R6BX 3ZS8A 1QVRA 4V0NA 1FW6A 2XNDD 1Q1EA 3UMSA 1VYVA 4JLOA 4URVR 2EFHB 1SGWA 4ILEA 1ZM9A 1E2MA 4A8JC 5BWMA 3QPWA 2OLJA 3HR7A 3CNOA 4B3XA 5FL7A 4M2LA 4Z51A 5KSYA 3DKPA 1VYTA 2WWIA 2QBYA 3U3OA 3Q3JB 1E79A 3VR2A 3TVTA 3PQCA 1W46A 4P31A 4XSGA 4PZZA 4URWR 4RKFA 5H8WA 2X2EA 3MSXA 2IF2A 1NRJB 4QGGA 3I5YA 4MQBA 1GL9B 5BN3A 1AKEA 4Q48A 1GKUB 1NVVR 1GAJA 1TQDA 1CULC 3L0PA 3X1DA 4LBZA 3K0SA 3QBTA 4EQ6A 4B32A 3H1TA 4NCKA 1KI4A 1P9RA 5AJYA 5AR1A 2REOA 1H8HA 1OXVA 5JWOA 5G3ZA 3KJIA 4YMVA 2A30A 2IXGA 3SJBA 4CIDA 3U5ZB 2IUUA 3GLGB 2ZIAA 3DM5A 1AIPA 1XTKA 1YHNA 2FE4A 3FMFA 3KDSE 1N5LA 3QEOA 1ZD9A 1IY2A 1SXJA 2B21A 4L8GA 4MKGA 4TL8A 1D2NA 4ZDKA 4EPRA 3IEUA 5AUPB 4B48A 1KO8A 1VDZA 4M1KA 5G41A 1ZNWA 2KSQA 4GSYA 4WBSA 1XMSA 3RS2A 4B47A 3KQHA 1KI3A 4GNKA 3CZPA 5F3WB 5AUNB 2O0KA 221PA 1TEXA 4GZLA 2ANCA 4KV9A 1T8UA 2IYYA 2GK6A 4OJKA 4R98A 2XX3A 3UK6A 2VEDA 1SVMA 1D6JA 1J70A 1KY2A 2ASEA 4BRUA 4D81A 4OKSA 2OBNA 3ZH9B 2JJ2A 3BB4A 4GZMA 3ND9A 1P7CA 4G1UC 5TARA 3K0FB 2ECKA 3BWDD 4Q7MB 1G5TA 2FGJA 4PAOA 2Q3HA 2FJUA 3ZYCA 1XD2B 1N5KA 1JEDA 4WOPA 3RAPR 3X1ZA 4D0NA 2ZETA 1E3MA 3G82C 1Z6GA 5JCPA 3PEYA 2BBSA 3K70C 2QGNA 1W0KD 3BFKA 2GEUA 4PPQA 3U6BA 1Z83A 1ZP6A 4PANA 1AK2A 3L82B 2JA1A 2O8DB 1Q3TA 1MO5A 1G3QA 2VHJA 4M9ZA 3PVSA 1QDEA 5JWHA 1NG9A 1GL7A 4IDOA 3AKYA 1KKLA 3LBIA 2PX3A 1NVXQ 2G0TA 3OIVA 5FBWB 3HU2A 1II9A 3AP2A 4Z8YA 3TAUA 5KOYA 1QF9A 2SHKA 2FWRA 3CPHA 2CCJA 4M4SA 3NWJA 5EUQB 4B3CA 2C8VA 3Q85A 5DN6D 5JEEA 3DOEA 2WIBA 1E2GA 4UNQA 3RRZA 4KJZA 3CUEF 1KI1A 1NLZA 2N46A 2QBYB 2OBLA 3BAFA 2WKQA 4N1AA 5CITA 1FZQA 2PBRA 4P3YA 3OE7D 2VHCA 4QGFA 1T3HA 1Z2CA 2JLQA 2RGAA 4F92B 1RE0A 1JR3A 4A0FA 5SZHB 4GRAA 5JI2E 3QY0A 2Z5FA 4FWIB 3KKMA 4EQ6B 1LV7A 1P75A 1NL3A 2CLSA 1OXTA 3FHCB 1KK0A 5C4MA 1Z07A 2KB0A 4TLAA 2REBA 3RS4A 2AFIE 3K53A 1TX4B 1KSJA 2C77A 3IGFA 3LH5A 4V0KA 5L3VA 1UBEA 4OL0A 4W5WA 5K8LA 1W47A 1NY5A 2VF7A 2WTUA 3G0HA 1E9SA 3NBXX 1AGRA 5IDVA 4NL4H 1OB2A 1IM2A 1ZCBA 3CRVA 521PA 4BFVA 1OPXA 2IA5A 2F3TA 2UZ3A 4RJLA 2IYXA 3MLEA 2ZAOA 1KDOA 3GJ3A 4M1TA 3AGQA 4P4TA 2CNWA 4MRPA 2W58A 4Q66C 5JECA 1NNEA 1AJEA 1FNMA 3D7MA 1JQLB 1LB1B 3B8HA 4NPHA 2VH5R 1M2OB 3ZVNA 1C9KA 4XD7A 2EU8A 1U94A 4Q1FA 3ZDQA 1KKMA 4EJSC 1SKYB 1G291 4X8OA 2IBMA 2ZJ2A 4L9WA 1AZSC 2ZANA 3WXMA 2OEPA 5CYOA 4XVQA 4IDNA 4QHSA 4TL6A 4DEYA 2C96A 3ONWA 4KU4A 5CM9C 2GZHA 2KWIA 1MABA 4GP6A 4ASUD 2VRWA 5J47A 2XTMA 1GKYA 1SVOA 2J0VA 4Q03A 4QL3A 5F9FA 3PENA 1KNQA 4UXJA 5TB5A 4C30A 2IEYA 2YKGA 5JFGA 5CLLA
chains in the Genus database with same CATH superfamily
4PPNA 4FIDA 1JNYA 4LC0A 4AURA 1GGHA 1E9RA 2Y92A 3AR4A 1SD1A 1OIVA 3KKNA 4HWSA 4NV1A 3ZXIA 4JUCA 4CL8A 5CIYA 2XCIA 2A0YA 4UE3S 1IHPA 1NR7A 4P34A 5C8YF 3CONA 3ZK8A 4JKIA 2AMJA 1W93A 3L41A 1PUJA 4A0RA 2GTPA 3CMCO 4KXYA 3AF6A 1O8CA 1L5QA 2ZTSA 4O2BF 4ZO6A 3RYCA 1HX7A 3ZV7A 1FXWA 4OQFA 3AKZA 1FP4A 3FUCA 3GPLA 3DFMA 4F21A 5FULA 1O3YA 3SOZA 4I1RA 1RYEA 1CE8A 3HCFA 5CX1A 1L5NA 3VTFA 3X2SA 4BGEA 4CQLA 3OZ7A 2Y3IA 3G2PA 3OUTA 4NENB 4EPYA 3HZZA 3I0MA 1V3QE 3CF6R 3P2OA 4ZZ2A 3A4MA 3IPCA 4QREA 3CX4A 3WWPA 3ABQB 2FPWA 1QZTA 4F3CA 1YBFA 2X8WA 2QUIA 3EQ9A 2ECFA 4IJQA 1E9DA 3O91A 1KK1A 3OVMA 3H5TA 5BV0A 5T6BA 4Q4CA 3DOCA 5CIWA 2G1JA 2ZTLA 3R2JA 4MKFA 3Q8WA 5EE1A 3TOCA 4HMQA 1YE8A 1M2VB 4ACBA 2ZJ8A 3BKXA 3G59A 4MR9A 5LZ4A 4E30A 1F48A 1O95D 2XIQA 3DV0A 3B53X 5C7IO 1OHHA 3L9WA 1JYEA 4EOGA 4UUQA 1XA0A 2GBPA 1P0CA 5SICE 1K3TA 1VG0B 2BLNA 2RC5A 3ZCUA 2YOFA 5P8WA 1SRRA 1JAIA 1DKUA 1SUEA 3SR4A 4DQLA 2O9JA 6REQB 1UM8A 2P69A 1R8QA 1UKEA 3BXXA 4PVDA 5GONF 3LGAA 3TLCA 2Q4RA 2AW5A 2ET6A 4FNGA 5J3JA 3PCTA 1KMHB 2HSDA 1EVYA 3E9NA 3ZE2B 4C3UA 3QEMB 3NS7A 5BT8A 5CA0A 1KJZA 2AUTA 2R8EA 3T34A 1UXHA 3WLMA 5JTUA 5F4ZA 1E69A 4M8LA 1A4RA 4O4JA 5K3BA 4LXYA 4RQBA 2DT5A 2W11A 4FT2A 3HKEB 4OJTA 5DBEX 1OBCA 3EZXA 3WGHA 2CXOA 4CN9A 3QA9A 2WIFA 3RD5A 1U8EA 2Y1WA 3RJMA 2OGSA 1RWXA 4N5IX 4K9SA 1VHTA 5A02A 4D26A 2FVXA 3SVLA 1JYSA 2ZAYA 4QO8A 1YQDA 1VECA 2H1IA 3IV7A 3NETA 4HO1X 3U7JA 1F4LA 3JCZA 4YRTA 4MA4A 1CUWA 1WY7A 2V5UA 1BQEA 2G3YA 4JVNA 4DV5B 2CJPA 1HYEA 1DQNA 1VB3A 2ZU6A 2ZJ6A 5CGZA 1D2RA 1DJOA 1V16A 2H2AA 2W9XA 3F9RA 3O4HA 4MR8A 4Y1FA 1OLSB 4GC5A 5AKHA 1KBOA 1QFMA 4NYMQ 5AVYA 3J81A 1DC5A 1QX3A 3OZAA 5JS7A 1S1CA 5DH9A 2WFAA 4KQMA 2AC2A 4JXXA 3GBSA 1OTHA 4A2CA 1R0YA 5F76A 1E62A 1MC8A 1T0PA 3KHUA 3MTGA 1KJNA 1QVZA 2M1ZA 2OK8A 4N3CA 2H8KA 3P4XA 2MYUA 3ZDYB 1NV9A 1ZRMA 2BBOA 3U13A 2AJDA 2XIJA 4R16A 1BJRE 3KB2A 3P9YA 1ZI9A 3O1LA 4DDWA 4HT3B 1YQTA 3GUZA 3NHUA 3KCNA 3OEWA 5FFFA 2JJ8A 1E2FA 3MZ0A 4NDZA 4HDRA 3OAAA 1NWHA 1UBHS 2R60A 2Y68A 2YR0A 2YWCA 2C3MA 3SYNA 4QSHA 4KITB 3RYCB 3L0CA 3FOBA 2LBPA 4MUYA 3F3MA 3VC2A 1FP4B 1U7ZA 4NONA 1N6IA 2YNMA 4UPVA 3PQFA 3L0SA 4P36A 3W8RA 1QYWA 3RSQA 4D8WA 2OV8A 4K6OA 1LH0A 4DJDC 5LP1A 2H6EA 3PE6A 2JAQA 3EC2A 3H5RA 1CE8B 2GCPA 1VKOA 2V9ZA 4E5PA 4CQLB 3L0IB 4WBNF 5EC8A 4LZNA 4J3NA 3RUIA 4JBIA 5CJJA 1K9SA 4GGMX 5G02A 4ALNA 5KQRA 3NTRA 4B43A 2B61A 2V7UA 5EJ7A 2Q62A 3IEKA 4D0RA 1TEZA 2LXNA 3LSYA 3I34X 5AQEA 1IOLA 2B6NA 1M8KA 4M54A 1TC1A 4E2FA 3O47A 3R0XA 4YUXA 1KH3A 1TMGE 2ZSBA 1QOPB 2ID7A 4QPDA 3QXCA 3RYHB 5ELXA 1I3CA 4RSGA 4EGSA 4IYRA 1QLWA 4DR1B 3OEED 1M5TA 4I08A 4MR9B 3IUEA 3W6NA 1U0HC 4GVPA 4F60A 1EDBA 3DV0B 4MZDA 4F6LA 3MXTA 2GAOA 1ZD1A 4X93A 1XPJA 1HETA 2RB4A 1FP7A 2JDIA 3NXSA 2W2LD 1N75A 3LWZA 1PCXA 1XJCA 3FKSD 4QU8A 5D1HA 5BW6B 2GKGA 1Z6QA 1UBSB 2H5EA 4M9QA 4DUGD 2F55A 2V74B 1ZCZA 4MW9A 1H0HA 2FDXA 3JTEA 2VP9A 3NW9A 2WB2A 2FG6C 4KX5A 3C3BA 1IQPA 2FR0A 2PIAA 1NBME 3T1NA 3VAZA 4RKYA 3RVQA 1NM5A 1LPMA 2JB9A 3BXEA 4ZCPA 2GM9A 3QXXA 4GXQA 4PG7A 4FBLA 4LVOA 1CJMA 3WIVA 1ZLYA 4TS3A 1ADGA 1XMJA 3UKDA 5JSFA 1PNQA 5F7OA 2HIMA 3S29A 4JLAA 3CVVA 1RXSA 3BVPA 2Q4EA 1JTVA 4LF9B 4X9XA 1NJ6A 2HX1A 3IJPA 3NHLA 1QF7A 3F73A 3N59A 5C9ZA 2X6QA 2WTBA 3AOEC 3RIGA 4PLCA 4O6VA 3IO5A 4MVJD 1JDVA 2GM3A 2BFNA 1MO4A 2M6KA 2G88A 3I9V1 1M6WA 2H1WA 5CG2A 1G2IA 3DXFA 1TUBA 2HZ7A 1Z08A 4I3FA 4KE9A 4AX4A 1KVRA 4MCHA 3HV0A 4DV2B 3KJEA 3AB8A 3DAPA 3IAS6 1E6EA 4FJ1A 3N2GB 3JYLA 1CY7A 2Q4OA 3CKMA 3PJGA 4MR8B 4XJTA 3GFOA 1RAFA 3CIFA 4QX6A 3F9IA 5JDCC 3D6JA 3GEGA 2YWGA 1VSBA 5DXAA 3U1TA 1AUXA 2G5PA 1UAYA 3ZI4A 3L07A 1GPLA 1CQIA 1QSGA 1Y9AA 2FQ1A 3ADOA 3CNBA 3LC2O 2OK7A 5IASA 3HXKA 1L5FA 4IUCS 4UAVA 1CIVA 1L7OA 2BJWA 3W04A 1W0CA 2LD4A 1XXLA 4FLEA 2EX0A 3K4PA 4CCWA 4AF7A 2ZYSA 2PSFA 1QC5A 2WKSA 3LYUA 1YQGA 4KVZA 1F12A 4YTEA 2YN0A 5KYXB 4HJRA 4M1ZA 4UFPA 1DC7A 4RAQA 1L7DA 2AXPA 3KO8A 1FBNA 1KZ1A 2VUHB 1EQAA 1J24A 1WM1A 2P6PA 2ZI9A 2R11A 5JYDA 3TLZA 5IXJA 3W7AA 1WEHA 1UANA 1PZFA 1UBOS 1RXEA 2ZJ4A 1UADA 3LUDA 5TQ2A 4FU0A 2XQJA 3K5HA 1DXHA 3VMFA 3ZDAA 3FOCA 4QXRA 1EPUA 3F4BA 1CW2B 2WSYB 2GHTA 4KODA 3BB3A 5LZ7A 3EFBA 1XFDA 2AMYA 2FW1A 3FDJA 2YWRA 1XXHA 4Q5IA 1MNQA 1WMDA 3PNOA 4AW9A 2VDRB 3GDGA 4B82A 5B2EA 4W8OA 4F2DA 3ZVMA 1QBKC 4Q7QA 1T0UA 1UQTA 2QMYA 2PZGA 1AG9A 1BX1A 2XT6A 4TTQA 1VYHA 3L49A 1JH9A 1XAIA 4QOSA 4F56A 4Q34A 3RUCA 3BJRA 3NQ41 3D6UA 3DKRA 2P9QA 1A8HA 1V2GA 1QH0A 2VR1A 1UPFA 3NKVA 4HLUC 4IH1A 4MRVA 4AJLA 1N77A 4YGXB 3W3AA 4RGVA 2VJMB 1VBFA 4J0EA 1RIIA 4YJKA 5FX2A 4GGPA 2DRIA 2QN8A 3WTBA 1DL5A 2ST1A 4F84A 1M1YE 2HMAA 2ZS9A 5AW3A 5KYKA 5F1KA 1B26A 1P1FA 2WT4A 3FLMA 3IVRA 3RK1A 4LJRA 1XTZA 5A4JA 1N6KA 2XKKA 4KQ6A 3SQDA 4RF2A 2XWBF 2UAGA 3GJ6A 3GH3A 2BZSA 2BEVA 2XE7A 3EYAA 3CX7A 4RY8A 1ANKA 2ZIEA 1J20A 2BTOA 3U16A 5TY0A 2C8JA 4KO3S 1U6IA 5SZKB 4IOKA 2AK3A 3DBRA 4E13A 2PYIA 3L8CA 2I2CA 3MMPA 1Q3KA 4XA8A 4LC9A 5DPMA 2NPIA 1NVUQ 1V71A 1VA4A 3KV1A 4N49A 5I9TA 3T3HA 2ICAA 2J6IA 4CTJA 4JYMA 3PTAA 1T3LA 2Y4NA 1Y81A 2F9LA 3DZBA 3EEYA 5LA6A 2HFJA 2G1PA 1BVHA 2NT3A 5CB8A 1XPUA 3B5EA 1SUFA 3HEMA 1IEVA 2GK7A 4D42A 3CG4A 2B1IA 3F6SA 4GRIA 1H2WA 4A8JA 4TYWA 3I0ZA 2BFEB 3CZMA 2PLNA 4NZYA 1H05A 1ZAKA 4CG1A 1T36A 2EGGA 1KXJA 3ZNPA 2J9RA 2GM5A 2X8BA 3VDNB 3ADPA 3PXCX 4K9LA 5JFOA 1NNUA 1XDUA 1CU1A 1PZGA 3QNWA 4FQ7A 1V37A 3M0EA 5FB3A 4B3TB 4MS4B 4DM3A 5IYZA 4HFRA 2VZ0A 2P3LA 1M1UA 1EEHA 4UOEA 3VHLB 2UYOA 2J32A 1IE3A 1PEAA 4XQEA 4YT2A 5F2KA 3BFJA 1JMYA 1GPBA 1PFUA 1S3SA 2JLCA 3WWOA 4EJ0A 1I30A 4HY3A 4F0JA 5JSHA 4RMNA 1E1QA 3H2IA 2IDKA 5FQOA 5F7JA 4ARSA 3TKAA 2FZWA 3CBQA 2Q9CA 5BMVB 3TGPA 4AWXA 2BZGA 3G0OA 2C9DA 2DC1A 4BRZA 5HF6A 3HCDA 3UAWA 2FUG1 3FNIA 5K0JA 5KQLA 2COKA 5BWOA 3G7SA 3VR0A 1ODTC 3K0CC 1UC9A 3H9BA 1P0IA 1DT3A 1GG5A 3KJQA 4N5NA 3VNVA 1C9JA 3KKKA 1JAZA 3PKZA 4DYDA 3V7NA 1KYXA 5A4AA 2VHTA 2I3DA 1GR1A 3O4GA 1KZ6A 3M6XA 3OQ1A 1UC4B 1QV9A 4L51A 3SN6A 1SCUB 3PQDA 3A1SA 1T0JB 4R8RA 1C4OA 3LKBA 1WDWB 1R16A 4HUJA 4M53A 3U9LA 5KQSA 5CBPB 2FOIA 5TQ2B 1DAEA 3WISA 3GRZA 3WGKA 2CDNA 4KH1A 3TIVA 2OGUA 2V5VA 4OPMA 4QYSA 2YXLA 4WTOA 5TT0A 4LHEA 4BNNA 3ZDZB 5JYBA 4Q21A 4IRMA 4YECA 1Q2XA 1T1IA 4H7FA 2EFEB 3EHDA 1RD4A 1XXHB 4DV6B 2J9FB 5EKTA 4AJOA 1D09A 2H63A 3QLUA 1IRIA 2A88A 5H68A 2OCIA 1VLHA 3P2YA 3ZGXA 3U44A 4PYNA 2VSOA 2EQBA 1N8SA 4CGYA 4IDFA 8ATCA 4I4TB 5LMCA 3TO5A 5E3IA 1E6LA 4F2HA 1HEIA 1WP9A 3IE0A 2Y0PA 3TQRA 1KIFA 2Y0EA 3ED5A 3HN2A 4LOAA 3AGPA 5FI3A 1WSWA 5JMOA 1TAGA 4C43A 5IVHA 4DJ5X 5E1BA 4LWPA 4KWTA 1BOFA 4UTVA 3LDHA 1RT9A 4TYNA 1NQUA 2VA9A 3ACDA 3CF2A 3QLJA 5E95A 1TM7E 1CNFA 1FDRA 2JGEA 2XQIA 3FZNA 3KUKA 4LXUA 3RM3A 3SSMA 5FPTA 2PKRA 3IOEA 1SCNE 1XEWY 4FFDA 4JZKA 4OSOA 3K92A 4ZJYA 5LU9A 3IBGA 2I03A 4OMDA 3H16A 3UATA 3V7YA 5ADVA 3HGQA 3BXPA 3MWGA 1UC5B 1A50B 1VCMA 4PCVA 4ZD6A 4E1BA 4QVIA 5CCDA 3FPGA 1TGVA 4OHWA 1Z56C 1XGKA 1C1YA 2XPCA 1S2LA 3R5HA 4J76A 1XCPA 2IIVA 3R3VA 4FI3F 1IM8A 3SS9X 4QAJA 4K87A 3W5SA 4FJ0A 4G2TA 3JD1A 3HYLA 1T6NA 1TDJA 1W5BA 4OJMX 3DBRB 2L69A 4AX8A 4RELA 4TGLA 3EAGA 3QRWA 1KOJA 1F9AA 3C4QA 2FEKA 1JR4A 3T1TA 1MAHA 3GDWA 1NW9B 1AKWA 3RFCA 3VZBA 1YB7A 3O73A 1BROA 2WOOA 3RDPA 2DB3A 3NDBB 5LA6B 3W8EA 1KDZA 3UPTA 4H4CA 3GJXC 4Y6GB 3GWZA 3K9FC 3HACA 4J2TA 1OX6A 2QMOA 2UXBB 2G7ZA 4BBJA 2HT1A 1X7DA 3SFTA 1QR2A 4ZC1A 3VI4B 1T2EA 3WV5A 1AMNA 5JWRA 1T36B 2R7MA 2W4IA 2O8VA 3VKGA 3G2HA 4F5YA 2N75A 2I29A 3JQ9A 2D8AA 1FDOA 5T4BA 1PZNA 4CLDA 1L8OA 1FFCA 2ZGVA 3ECAA 3HGTA 4QA9A 9ABPA 4H0NA 3DVAA 2VQ6A 1T8TA 2Q45A 3OG9A 2YXEA 3OJXA 1TRHA 4G9EA 3VHQA 3KXDA 1CKEA 4E09A 4IYJA 4N3BA 1GZVA 2Y8EA 3LYAA 2ZIGA 4JEIA 5GJCA 3VA7A 5DT2A 3ZHSA 4EUKA 4TLMB 3D2LA 4B3FX 1I4OA 3GFGA 2VCEA 3C3YA 1NZDA 3OKAA 3IUJA 1XCLA 2PRKA 1SD5A 1JZTA 3ODPA 1XL1A 5L4NA 3DCYA 5A03A 5KS2A 2CHUA 2F1RA 3KOZA 4R2LA 1EVJA 4QDUA 4D9NA 1EFKA 2QW1A 1HM5A 1ZVQA 2ERXA 3G5TA 1KXZA 3NAZA 4IQGA 2VJOA 1D2MA 4AM8A 1BVYF 1K6IA 1THGA 1KU0A 2F3RA 4I1YA 4NFHA 2P4UA 4KAFA 4RO0A 5J4YA 1QB7A 2NU6A 2EP7A 1KOFA 1Y8RB 3KQYA 3R3YA 5IEBA 4DBVO 3THWA 3A2MA 4GQIA 4JU8A 2OG2A 3A4VA 2PWPA 1A1SA 2XV1A 2RFLA 2XD4A 3DOOA 3GGPA 3L7YA 3LC7O 3VZDA 4X41A 5ICFA 5AHKA 3FSGA 4O2AF 1D4ZA 1X1RA 1TFUA 1VKRA 2C1ZA 2GN8A 2GASA 2P30A 2P3OA 3B13B 4JAVC 4LJ6A 4D4IA 5KTRA 5FOXA 4WXYB 1QHXA 4CHTA 4GYJA 1NP6A 4RM3A 4TMXA 1PN3A 5ERYA 4DR2B 4TXHA 4TPKA 5H02A 3UTDA 4FOOA 3SQWA 1U2SA 1XTBA 4BQPA 1NLUA 1TJYA 2GN6A 4FN5A 4NMLA 2PEYA 1JQEA 2WJ3A 3AILA 3BFXA 3K2QA 2PU7A 3HP7A 4X84A 2W2KA 2DBYA 2IZOA 5D00A 4K86A 2Y99A 1WBBA 3I9OA 3KZKA 4DCPA 2OZPA 4RZXA 5FUVA 1DBSA 4ZZ3A 2CK3D 4GBED 4N7MA 5CFQA 3AHDA 3H18A 4YXWD 3GAMA 1QVWA 1CDZA 2XWQA 3RFVA 4G0UA 4NYJR 5JNLA 1KAHA 4TSRA 5KJ1A 4P7KA 3RHZA 2PD6A 3HR8A 2MWMA 5ENDA 1OZ0A 3DD1A 1S0UA 1DOZA 4RH1A 2PWBA 1MTOA 1L4EA 1MX9A 1SKYE 2DTXA 2PSHA 1NBMD 2Q6TA 4Q3DA 5AVVA 3FOFC 5LQAA 5EIFA 4NOKA 4YT5A 4PG6A 2RGCA 4RVHA 1C1XA 1AK9A 3ZWPA 5A0VA 1ONBA 3IAXA 1Z6XA 2XRFA 4TSFD 1BN7A 1TVKB 3KUUA 3OPQA 4QJBA 3WWYA 4KIJA 5JJ5A 2GEFA 3K0BA 3RTDA 3E0QA 1EXWA 3OTIA 5HIMA 2A9PA 2TRSB 1FXUA 2IQIA 3MJFA 1WMFA 1NJ1A 2YYYA 1NATA 3HKCA 1NNSA 2PL5A 1US8A 4CM5A 2B83A 4QT4A 3D3QA 4BP9A 2FZEA 4WWHA 2Q6KA 5JHHB 3H5NA 4ZVKA 4PYOA 1VI6A 1ADYA 4GKBA 2RHLA 4X1OA 1XRJA 1VC2A 1FUEA 1L0BA 3A14A 3K2IA 2AL7A 4W1PA 3RK0A 4L72A 5AP9A 4DDHA 2IU3A 3QUQA 1FTNA 3SEQA 1P73A 2M6RA 4C21A 1SXJB 3CN9A 2G4CA 2EJUA 2KLHA 4XSVA 5CPFA 3KXIA 3ZD8A 1NT4A 4L57A 4RZ3A 3ZHVA 5B6IA 5KJFA 1KWKA 4KKXB 1E5XA 4KE6A 5IDQA 1IULA 1E2QA 3ZDRA 1G5RA 1NF3A 1QCZA 3DB1A 4LOHA 4RHFA 4Y30A 2ZRDA 2BPOA 2PYDA 4OH1A 5A2QA 5IG2A 5C53B 4BLOA 4HAYA 3UY4A 2ATVA 1HLGA 2R1TB 3CJRA 3P2MA 3WJAA 3WL8A 1OBVA 3DVAB 1RAHA 3E3OA 3TW6A 1MO3A 4H1TA 4ZYUA 4LV5B 2CLMB 2V0CA 1U3GA 4EP1A 3U49A 4QLBA 8ABPA 4KGZA 5TRTA 4GEKA 3ADKA 4FCWA 4MV9A 4RMIA 3WYDA 1I6WA 3OCZA 1QO9A 4OV6B 1JKXA 1WXWA 2NSLA 1PJLA 2NU9A 3RSGA 3WL7A 4U9UA 3ZBUA 4K28A 5JDIA 3IQEA 1O9BA 1XYVA 2VZLA 3P8ZA 4RHUA 5EP4A 4B17A 4Z4QA 1FK8A 1V43A 2G40A 2MTBA 4D4GA 2VBFA 3X1JA 3PUVA 5A4KA 3PICA 3W05A 4XGIA 4UNSA 3JQQA 1GGFA 5HDQA 1YCDA 3VBEA 1QYDA 1N0VC 2Q1TA 1PT9A 1ETUA 1DCFA 1P1CA 1IK6A 1ACJA 3A4YA 1JIQA 4LPKA 1GUBA 1V8ZA 4V2IA 3TJMA 3TNJA 3U5TA 1IBLB 1BCSB 1XNJA 2RGNA 2RGBA 3DAYA 3IQDB 5FBRB 2ZSIA 3ST7A 2A5FA 3IVGA 4FS8A 1PR2A 4Y2XA 5AKXA 4DFDA 4Z4HA 4L6IA 1OD6A 3UENA 4UXIA 1AURA 2Z8ZA 1XDGA 1OI2A 2PS9A 4JMLA 4G5OA 2CXQA 4GGOA 4GOKA 5JAIA 3BBLA 1AY0A 1E4YA 4ID9A 3QYJA 4EGCB 2ZSAA 5HUJA 1CUZA 5LMNB 4G25A 3WRWA 2WU1A 2Q1YA 4YJFA 1D0SA 3T7TA 4C2BA 3EA5A 1NW8A 3QFTA 1PJ4A 2ZUFA 2PS0A 2QAGA 3GLHE 5LVAA 1PL6A 1VFNA 2YHIB 2A86A 2IH4A 2IYSA 2HK6A 1M8PA 2A0KA 4JI8B 2IP2A 3B7PA 3ELBA 3P45A 3K32A 4GMXA 4EPWA 1BU8A 2QN7A 4ZHSA 4I2VA 3OURA 3GLIA 4HDNA 2W2KB 3DYBA 4B3MB 2FHSA 4QU5A 3T7DA 1H94A 1QUEA 1L2TA 3ELUA 4US2R 3ETLA 4E3WA 3RAFC 1BIFA 5AHWA 2FP3A 2GETA 3KEFA 4MPJA 1N7HA 2EC5A 2MYNA 5HFJA 2ZQZA 1YDHA 3UAGA 1NW3A 3R09A 5EWMA 3HTXA 2VJYA 1RQXA 2F3SA 1NJSA 1PQ4A 3PNQA 1ZN2A 1I3KA 1NU8A 1RJGA 1N3YA 1I0ZA 1YVEI 3KEOA 1KRWA 1XK7A 3C1AA 1THTA 3ZIAA 2XECA 3FTNA 1Z6YA 4HQNA 1TPZA 5EAIA 4ZYLA 4AY5A 1BHSA 2I3GA 3QVLA 4OQMA 5B58T 1HRKA 4EVSA 1CUSA 3KFXA 3PIDA 1Z0JA 3VHXA 3WJ2A 3TUIC 5LFAA 5TLSA 1VPLA 2PGIA 1K6MA 1PG2A 3W6OA 2VDQB 2NZVG 3O3NB 1JJFA 1JIUA 3SC4A 1I0LA 4NBNA 5DTEA 4E5NA 4BB6A 4MB2A 2ZR9A 3PHGA 1KDYA 4B09A 1QGUA 2YJ4A 4PSDA 2XQKA 3MYRA 1W0JA 3UAVA 1FRVA 3GD7A 3R7DA 2W2OA 2AXNA 2WMYA 5BWNA 5BW8A 5K03A 4NU6A 1DTSA 3HDTA 3HUDA 1FQOA 3D2BA 2C7QA 4M1EA 4A0QA 2NP6A 1YASA 3G2MA 4IFEA 4Q1DA 3VDXA 1T2NA 4EYOA 4B7CA 4FOPA 3TTTA 5EIEA 2R7KA 3HCWA 2A8YA 3UVEA 4TV9F 1W6RA 1X70A 1XNQB 3FPAA 3L4SO 4JH0A 1ZDMA 7ADHA 2JCBA 3C3DA 5CVEA 4MRSA 3DHNA 1IPHA 4JL5A 4NVRA 4IW3B 2OPBA 1BVRA 2CLOB 4MQEA 5F4BA 4DTCA 1D1SA 1ZITA 2C00A 1WPQA 2J31A 1ZUWA 3ET5A 2QG4A 1NQXA 2I3ZA 3RWOA 3I8SA 5GAJA 4HXEB 2XCUA 4XCXA 3V8RA 1YRAA 5DOZA 3ZHUA 1Q2UA 4ND5A 4BEBA 3HCPA 4A15A 3L6RA 2NU9B 3SHTA 3T5MA 3IOCA 2JAHA 5EFZA 4BIMA 3ZDBA 5BPHA 2Z5VA 1VFPA 1XJQA 3OLZA 3OX4A 4GXNA 4TN1A 4F3RA 1NI3A 3UAOA 1G7SA 2C9MA 2AZMA 4CQJA 5BSWA 5F64A 4PGMA 3SC6A 2O07A 1KBZA 1CUBA 1QFYA 2JVJA 3AXTA 2G82A 1WB5A 4GPIB 1UDBA 4A10A 1PX2A 1EXVA 3HKBB 2VT6A 3E3LA 5FUQA 1BE6A 3W3AH 1MAVA 1TU4A 1ZOSA 5CXUA 5ARDA 5A3QA 2PZBA 1VKHA 2YJNA 4FMCF 2R66A 3TLGA 1YSCA 2R6AA 2QN9A 4Z4FA 2R6DA 4LW8A 1WXIA 4N9WA 3V8BA 3EGOA 3SBDA 1D4AA 1SBNE 1X6VA 1ZC4A 2C5BA 4RTKA 4O1IA 3ZVLA 1Z2DA 1TEHA 2WF8A 3K8OE 1GZ4A 3WNZA 4CMJA 1ODFA 2QAGB 4LJAA 1WXHA 4FX5A 2B99A 1GNVA 1NU6A 2EKZA 1LDGA 2O7VA 1TQ2A 2R5NA 4R1PA 2QTVA 3FHJA 5JISA 1AO3A 5M29A 4TKZA 2FF5A 4ARUA 3GLIB 1DC6A 3GNLA 2QV0A 4K6KA 1RQGA 4HDNB 3SZRA 1GNTA 3SHWA 2D1RA 1Z4NA 3ZTWA 4G5RA 4DA8A 1VMDA 1Z3CA 1ZD3A 4D8UA 2MDTA 2YHUA 1QG2A 1G3UA 4PX3A 3QTTA 4G8CA 3GLFE 1T4MA 4U7DA 1R8XA 3SS8A 2DTEA 2ONZA 3FH0A 4PWZA 3U9TA 3V6MA 2ZJ5A 4JI6B 4CWAA 2RHDA 3MFQA 1SHJA 2F43B 1PX0A 2HRQA 4I66A 2QLTA 5IDYA 1OU4A 3SNKA 2CLHB 1E6UA 2CB0A 2OCBA 2C7VA 3R4CA 1M2JA 3LY5A 1Q6ZA 4PNZA 2OGZA 1XTPA 2R6R1 3LT5A 4LYGA 3OE5A 1QWSA 5T5QA 2W42A 4O0MA 1VIDA 3DBHB 3OQVA 1E7WA 4D4LA 5KTYA 3WIOA 1RWKA 5DGXA 3ICCA 1M83A 2ZR0A 4BKMA 4DSAA 2VDUE 3LUJA 3H65A 4W7SA 3P2KA 4KWEA 5HIIA 2EZ4A 5DHSA 2R8OA 4HEQA 3DPUA 3CX6A 4ZT2A 3M6FA 1CF4A 2CWDA 3K96A 2OCGA 4RJ2A 1G16A 1UBNA 4BO6A 5A5VA 6LDHA 1IJKA 1W4BA 5AKGA 5CEFA 1AA9A 3CO5A 3W7BA 3SF8A 1RYBA 2JFFA 4DR4B 3IAFA 2HHCA 3OETA 4OLJA 5E6RB 3WOHA 1JQAA 1N2CA 3Q0EA 5A5FA 1F1JA 4L4RA 4BNWA 2B78A 4P7GA 3RVDA 3VSEA 4AMBA 1ZM4A 2R8YA 4L22A 5B30A 4JXKA 4KJXA 3RJTA 4ZKDA 2RI0A 1JA1A 2BC9A 3DEYX 1XLWA 4BO9A 1T1JA 4RTJA 4DA6A 1PD0A 1SHTX 3NDJA 1E7QA 1QHIA 1KFKB 2NU7A 3JSAA 3WIUA 5DIZA 3D1VA 3ONFA 3IMKA 3KJZA 4ER0A 5LQUA 4N39A 2ZRJA 3K5PA 3FIJA 3L7JA 4PO1A 4OGFA 2BMFA 3GT7A 4JK3A 1ATZA 5K0NA 4ASUA 4NNOA 2ZRMA 3BCHA 2CXPA 3PFWO 4L0CA 1OX4A 4B8WA 4TKVA 3EPJA 3ZKAA 1P4SA 3ORSA 5EHZA 2OILA 4M83A 1SKAA 1ZXLA 4UNPA 3V4VB 1ELOA 3ASUA 3HJTA 4RJKA 2H1FA 1AT1A 1Z4PX 4PFJA 4Y1RB 1BXZA 4EFKA 5CYGA 1VJ0A 1NXXA 1ZBDA 3R77A 5K4HA 1TTQB 5B4VA 1I0IA 1FP1D 2H1RA 3HL4A 2BCEA 1PFYA 4I1SA 3KQMA 4JNCA 5K2MA 4JBHA 1A2QA 3EIOA 1ZMRA 3U4GA 5LP6A 1I6MA 3CJQA 3IP1A 3OECA 4OK6A 3OM1A 3ULKA 4H9GA 4S1WA 4GIBA 2WHPB 1SG0A 2MJLA 2C5SA 1LU9A 2ORIA 2VYQA 1U3CA 2AI2A 4MGKR 3WK9A 4ARAA 4BQSA 2BM0A 5BRNA 2OBFA 3ES9A 1ND6A 121PA 4BZWA 2HO4A 3MWEA 1QE0A 5JBNA 2W00A 4AROA 2DHEA 3TBHA 5CBKA 1PR1A 1SCDA 4BMDA 4E5KA 1MAUA 2XODA 3WL4A 1JDSA 4UE6A 4DA9A 3O8CA 4LQCA 3KJHA 4K05A 2PKWA 4DNPA 5CDGA 4X8LA 3UK0A 1SKBA 3KDAA 5ALKA 3WJ7A 3KSZO 4POAA 1C7FA 1TYEB 3IERA 1ESDA 4HBGA 3VOBA 2FH5B 4CQMB 4DV0B 1I9CA 3IQGX 4C0AC 4G0QA 3KQLA 5K3OA 4GPTA 1UAGA 4BJ1A 2JGDA 5NLLA 3IELA 3FR7A 4CE6A 1LD3A 4FZRA 2C54A 3JWGA 2FXIA 1PFWA 3NT4A 3PR3A 4K26A 4RL4A 4YJ2F 3CGGA 4QOHA 3BILA 3FWHA 3UJHA 4XEUA 3DL0A 5KMGA 1SOMA 5LZ8A 1PJ8A 2QT1A 4ML3A 4DLAA 2FWNA 3LHDA 4I1IA 3WTCA 3ZJTA 1VL8A 4MARA 5IT5A 4FYIA 1RPJA 1JB1A 5AESA 3JQ8A 4YAWA 1KP3A 4MTLA 3TSCA 1V0JA 2EZTA 1C4KA 1G20B 3F8SA 1ZVKA 4H7HA 4HYTA 3OMXA 1P9NA 4TOIA 2Q1SA 3ROQA 1PTJA 2QSJA 1H1LA 4PSUA 3T35A 3W5UA 3W9BA 1UMDA 1WZ2A 3NI2A 2Q41A 3CLHA 4BVBA 3S70A 3F46A 1M0EA 1PWYE 2P9BA 1F5SA 1CZRA 2H2DA 4R7ZA 4ZI2A 2OHHA 3IAEA 1V9CA 4ZI7F 1U5BB 1I4WA 3OQJA 2MYTA 2H2GA 1SU7A 1V8FA 1CQXA 2GF0A 3HLYA 3WHPA 4BO8A 2D7DA 2PAFA 3MGCA 4MRMB 3NU1A 1E1YA 3WS7A 3M9XA 2QENA 3K9WA 3Q3CA 2CN1A 1YS7A 2DXIA 5EYPA 3WB0A 2V54A 1RWWA 4Y2JA 3V8EA 4G1FA 3WZMA 2DFPA 1N2CB 1K08A 4MQMA 3AZQA 5TPZA 3N3BC 4ND2A 3IDFA 5J4VA 4J16A 3GJ5A 3LPMA 5JS6A 1AV7A 1L5ZA 2BM9A 2ORWA 3TLXA 3TVDA 2CLLB 3W7VA 1TKBA 4AIRA 2PWAA 4G63A 4JCCA 2LUOA 4PR3A 4CKWA 3UG7A 1L7NA 2VNJA 1ZJYA 1YJCA 2P5SA 1JT2A 2HHLA 3L1IA 4LRUA 1Z8FA 3J7TA 4GD3Q 3W5DA 2NU7B 4K46A 1I2DA 1W76A 1P9OA 2H29A 4UEKA 5THKA 2W4QA 4BX2A 1R1DA 3UANA 1K7CA 3R3WA 4A6EA 2Q5HA 4DCJA 1QV6A 5HNKA 3H75A 4ZOAA 2R5WA 2H9AA 5H80A 2ZW9A 1YQ9A 1YQUA 2GEVA 2XMSA 3B78A 4MYDA 3AF1A 1OX4B 3C7DB 4M0MA 2H5IA 3B6MA 3PYLA 4PLVA 1UK9A 4HB3A 4TKVB 3URMA 3DGEC 1XCJA 1X74A 3HA2A 3NH9A 4D9EA 1QDLB 1SOWA 2FMHA 1SHUX 2XUDA 3EJWA 3UK1A 1QX4A 2EARA 2HEGA 1FLVA 1G5PA 1KP9A 4E88A 2XOKA 3GX1A 3SJ7A 1MAAA 1CWUA 2BFFA 3OIYA 4OFWA 1VYUA 4O3FA 2CV1A 1L4UA 1QGAA 5AVOA 1H2ZA 3GYBA 5AI6A 3PCXA 4ODIA 3QMMA 2XGJA 5A5EA 1XZAA 2P8SA 3BRSA 3PRJA 4HS4A 1VG1A 2X40A 4YQYA 5EEHA 4Z2YA 4W8GA 1F6WA 2R9VA 3Q7TA 4Q9JA 5FV4A 3LRTA 4C3VA 5BURA 1X1DA 2GD2A 4IL5A 1XEFA 2JKVA 4V3CA 3MWEB 2QTTA 4EBBA 5KYYB 1VBKA 1OV4A 1N4DA 4XYMA 4DR7B 2W6QA 1KNXA 2H17A 2KM1A 3DKIA 3D31A 2BKVA 5DM1A 1I4TD 1TVEA 4RAOA 2D00A 4IQ0A 3TF5A 3S4YA 3BQMB 3SFZA 4EI2A 3HVJA 3KE8A 1N7GA 4JMPA 2ODNA 4Y9TA 1WQ4A 4G0PA 2FRDC 2I2WA 2FWJA 1LLFA 1QIDA 2VNIA 1TCBA 4IGIA 2D74A 2W2TA 2JGDB 3R6TA 4PR0A 2HB6A 4WN9B 1GEEA 5HIAA 5JANA 3UZUA 1CVIA 4OHKA 4WJKB 2O8FB 4XGQA 3TQOA 2EYQA 1WX1A 5C32A 1BH2A 4QG7A 2GF9A 2VI5A 3R0ZA 2AVNA 1KL7A 4TYMA 3LI2A 4JBXA 3TIGA 4PIPA 3DMYA 1CCWA 2GHIA 4YRRA 3Q15C 3B3AA 5EPOA 4UQOA 4J2OA 3MWLA 1ZGZA 1YGYA 3TL2A 2O4UX 4RXUA 5J63A 2O8DA 5JPDA 5CDFE 4NE9A 2FZKA 3K8QA 3O95A 1F8XA 1K27A 1B3RA 1WLSA 1G8GA 4MRNA 1Q1GA 4BNTA 3LZDA 1GCOA 3ZQ4A 1H1LB 1QCYA 1ZMBA 3ZWOA 1OFTA 1KZHA 3W90A 2ETXA 5EJ6A 1VBNA 5CLFA 2CL0X 1YFJA 1CJVC 2QE7D 4G0YA 1U2EA 3VSAA 4CMGA 3D3KA 3Q8XB 4LYHA 4J8PA 1XDSA 4QXAA 1ORRA 1RI1A 2F1OA 5EE5B 4NC9A 3BWXA 3A4NA 4JJKA 1YK0A 3MS2A 1OMOA 2JIBA 3JVEA 4PHTA 3WBKA 4KR0A 3PWKA 4KVGA 4LCEA 1Q12A 3FWNA 4CZ2A 1A8QA 2C0PA 4RM2A 1G8HA 5I8WA 1LJLA 4CBVA 2WM3A 1E7SA 1E3IA 3A0RB 3N2KA 4YRJA 4MI9A 1DWUA 4CKWB 1MB0A 2P2GA 4ZT7A 5TV2A 2R0QC 4EHDA 3AI3A 5L6MB 2DFKB 3B6EA 3HO6A 4LBWA 4XQ9A 2GKOA 1XL0A 4NIMA 1B43A 2ZB8A 2Q5LA 2FX2A 1FS6A 3JYHA 2VAVA 2PFSA 1JBQA 3ABZA 2C58A 1M1NB 1RYZA 1Z0KA 4HEHA 5HFNA 4WUTA 4TMZA 2IXEA 1MC4A 1Q7EA 1XBTA 2CHEA 4DJAA 4Z4EA 4Q9IA 1FSGA 4K1LA 4PHFA 1UZLA 4BDSA 5DTRA 3PRKE 4UU8A 2XY4A 3NCHA 4OREX 4DLBA 3D5QA 5KU1A 1GGJA 3F97A 4B44A 3RADC 2IUTA 2VP4A 4PZCA 2AOVA 4DCSA 3R3XA 2BFFB 2IPLA