5DHFA

Crystal structure of hrio2 nes peptide in complex with crm1-ran-ranbp1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
205
Chain Sequence
b'VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVPALAAQYEHDLEVAQTTALPDEDDDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 60
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dhfA00
4LJYA 2OXCA 4FCWA 2IYXA 3T1TA 4DCNA 1RRGA 1DAMA 5G3YA 4Z54A 3NG1A 3VR2A 1BMFD 1FMLA 5JI2E 1W46A 2QP3A 1CLUA 1JQLB 2QY9A 3QJYA 1Z63A 4P32A 4URXR 2ZRKA 1KSFX 4N0EA 4BE7B 2ZITA 3FOZA 4L9WA 3U3RA 4QC2A 4A4DA 3J81k 1E32A 2ZROA 4JLVA 2CMKA 4XH9B 3FE2A 3VU9A 3QXSA 4GMDA 2I1QA 4BLSA 2BHRA 3QF4B 5BQ5A 1WF3A 2RGAA 1RKBA 1ZC3A 2VHUA 2J7PA 2QBYB 1D6JA 3VR3A 4JJZA 2AFIE 4G5QA 3VNVA 5C2JB 5HE8A 1SVMA 2WWWA 3SYNA 4JLDA 4D82A 1E3MA 1UPTA 3X1XA 1Q1BA 3A1VA 2V6JA 2R65A 2J0VA 3GLGA 3HPQA 4AYXA 4W5JA 2W6JA 2C2HA 4QJ4A 4Q9HA 4XVUA 2WPDD 2QUZA 3FTQA 5KUTA 4I1VA 1TNDA 1E2HA 3C41J 4A8JC 3BXZA 4DXAA 3CBQA 3BFVA 4UNPA 2EYUA 1ZP6A 3SQWA 2Q3MA 5FUXA 1G19A 2X8AA 4LC1A 2YC2C 3BH7A 2JASA 1Z5ZA 1G291 2VP6A 1CTQA 3SJZA 1HV8A 3CX8A 1IN8A 1GDDA 2XAUA 1DAIA 4D6PA 2J0QA 4NDZA 1AKYA 3GLFE 3VKHA 1NVXQ 4ASUD 1D8TA 3RDPA 3FFBA 4BEJA 2O8EA 1XPUA 1E79D 1IJEA 4JJKA 4LDJA 4HAZA 4XJXA 4FIDA 3CZPA 1VMAA 3B2EA 1KYIA 1NVUQ 5FOUA 3K0SA 3V4RA 1O87A 1Z0AA 1ZBDA 4NL4H 3WYFA 2A2ZA 4G3XA 5ELXA 1C4OA 1N6HA 1VYTA 3RRYA 4LYJA 4OQLA 3F3YA 1YZNA 1LFDB 4PHGA 4BQSA 4M9SA 2IA5A 1YR8A 4L16A 1YRBA 3I73A 3ZDQA 2I3BA 1W0KA 4A1FA 5CM8B 4GZLA 2J41A 2W00A 4DSTA 1XMIA 2V9PA 4OL0A 4AC9A 4NYMQ 3O8CA 3U7HB 3ZZUA 1QRAA 1CS4C 1NY5A 2V1UA 1WXQA 4YDSA 3IIMA 4C0JA 5FBVB 4U5XA 4DUGD 3DM9B 3QXXA 4DIEA 3Q5DA 3MCAA 3PEYA 1WCV1 2CNWA 3TQCA 3QUSA 1E9SA 1N3BA 4QNMA 3OFND 1DG1G 2R44A 2NMVA 1N6LA 2V4ZA 1G5TA 1ZU4A 4XSHA 2JJ2D 4KBGA 2WWXA 4QHTA 2YKGA 1XTKA 2DYKA 3K1JA 2FFAA 2QSZA 1CJMA 3M0EA 4TWZA 2R6FA 3QKSB 3BAFA 1NLFA 2ZYWX 3C14C 4LYFA 5FOTA 4EQ6A 1ZIOA 2HYIC 2J0SA 3IGFA 2KI5A 1Z2CA 3FHOA 4LJAA 1T91A 2HCBA 2ODEA 1MABA 2QTHA 1G3RA 3VR5A 3Q3JB 3HYTA 1DOAA 2PLFA 1YR6A 4MYUA 2Z43A 5IT5A 4LJ6A 4AWXA 2J1LA 4RD1A 1E69A 3CW2A 3KTAB 1GUAA 4Q21A 4HZUB 4I4LA 4ESVA 5JJKA 1YKSA 4ZCMA 1GILA 2PMKA 2F6RA 3MD0A 3CR8A 4AI6A 2PL3A 2IYTA 2YOGA 1G8FA 5A0FA 2DFKB 4BPBA 1N6PA 4FW9A 1T5IA 3QVUA 3N2EA 4UNNA 5FUYA 1ZUIA 4HLUA 2QENA 4I81A 1AS0A 3B6EA 4LJ5A 1WDTA 4JVNA 5JEDA 3SR0A 3DM5A 4AKHA 1N0WA 2EFCB 4GDFA 1WA5A 5SZJA 1VYUA 3GLIB 2FFBA 3AVUA 1U98A 1R4AA 1W47A 3CPJB 5E3HA 3B8HA 2IX3A 1RJ9B 2XEXA 2QM7A 2H5EA 5E7IA 3IIJA 2IYSA 2VPPA 3K0AA 3SJCA 1OXTA 3A4LA 3FMPB 4C2TA 2CXXA 4F4IA 1L2TA 1IXSB 3VMFA 1KK1A 3CO5A 4QHSA 3OEED 4RCZA 5F98A 2DWOA 4CGZA 2FEOA 2QQEA 1E4YA 4JKIA 1HH4A 4W5WA 3AVWA 3LX5A 2QORA 2GJ9A 4P0TA 1OFUX 1IHUA 1GL6A 3ADCA 3H84A 2YNMA 3KJHA 1YZKA 3S1AA 2QT0A 1E9EA 1FQJA 4II7A 4Q1DA 3BS4A 3TUZC 2XTZA 1SKYE 2AWOA 3AKDA 4URZR 2XZOA 1XMJA 1ZINA 4QBGB 4CVNA 1XMSA 5CIWA 2NZJA 3X1DA 2OLKA 4PO8A 3I32A 3QE0A 3TK1A 3W34A 1P7CA 2IYRA 1M34E 1KK2A 1OH7A 2PJRA 1IOZA 4NCNA 5G41A 1IXRC 4HDOB 5CDFA 3W90A 1R5OA 1WMSA 4LWZA 5H68A 3B78A 4YMVA 3GLHA 4LBVA 1Z06A 2ZJ8A 3GJ0A 4M1SA 1JECA 4GT1A 3UMFA 4TLBA 2IF2A 3DMNA 3NH6A 2F1RA 2ZS9A 4B47A 4KLZA 2HLDD 1ZIPA 1ZNYA 1QHGA 2WWGA 3K0FB 3A37A 5JBQA 5AR1A 5FBRB 1T4GA 4KV9A 4Q48A 2ORIA 3SE0A 4EPXA 1OB5A 2BEJA 2VP5A 4N0DA 2AWNA 2FJUA 1Z08A 1W48A 3IEVA 1XPOA 2QBYA 1TU3A 1HA3A 4KSCA 4IVRA 3U7FB 1JR3D 4M9XA 3K70C 3QY0A 1II8B 5BN4A 5EUMA 1S9DA 3UXMA 4Q18A 4Z1MD 2J87A 4JBWA 5TMPA 1FUKA 2MSCB 4V03A 4CRWB 2IYQA 1ESMA 4G5SA 4HUQA 5LB4A 1U0HC 3BH0A 2D7DA 3DZ8A 1OH6A 4TQ9A 1S96A 2DFNA 2ONJA 1DE0A 4UQOA 1K6MA 4MQBA 3SU8A 3K0EA 1NIPA 4TN1A 2JLQA 1XEWX 721PA 4IOMA 3LO5A 2PMDA 5C18A 4DT1B 2XJ4A 2A5FA 2JDID 1H65A 1P9NA 1HUQA 1KI8A 2PH1A 4BFUA 3R9IA 1G18A 1QF9A 4KFTA 2IS4A 4ZDIA 5DYIA 2ZANA 4BGDA 1JAHA 4D0LB 2ZRCA 5CJ2A 4TTRA 2WJHA 4LJ7A 2VF8A 2BDTA 4NCHA 3WMFA 5CJPA 5D3MA 4L9SA 5JSZB 2FA9A 1F5NA 5CLLA 4DBLC 3U44B 1XCGB 4TSFA 3PXGA 4BLTA 1U81A 4C7OB 3WYAA 4QRHA 2V7QA 4NYJQ 4QGFA 5J47A 1U8AA 1DBSA 2QM8A 2F55A 1BYIA 4FCTA 3RS5A 3PG5A 2GBLC 1R0WA 1T6NA 4OI2A 2GK6A 3HU3A 4KFRA 3TR0A 4C4PA 1U9IC 1J90A 2OLJA 1VDZA 1V5WA 3GLHE 2DY1A 1KI6A 1NLYA 1N0UA 1CR4A 1D9XA 2ONKA 1GKYA 4JVMA 4TMZA 2ERXA 2H8KA 1T3SA 1KAGA 2GNOA 4A6XA 3QVVA 4TZ6A 2R6CA 4ZI3A 2F43B 3DO6A 1XTQA 4UJ3A 3AUXA 2B92A 1GRRA 3SS8A 3TKLA 1E2JA 2BBSA 2NPIA 1ZNXA 3QPWA 3LH5A 3UG7A 4B2LA 4JLKA 2F9LA 2ZEJA 2FZLA 3GQBA 3IDQA 3QKSA 1R8QA 4EKDA 3DDCA 2NO9A 1CF4A 2QAJA 5JRJA 4NU0A 5LPNA 1SULA 5DHAA 4JZKA 5E95A 3K70D 1ZNZA 2BCGY 4DLRA 3R8FA 3P20A 4MRVA 1WP9A 3PFIA 3H0KA 3LY5A 1SHKA 5J4KA 3GLFB 1TAGA 3ZD7A 5B57C 2JAQA 1AS2A 1UDXA 3IPXA 2DFTA 4MYHA 1TF2A 2GF9A 4MKGA 4Q1CA 1W0JD 4V0NA 3C5HA 3Q7QA 3QXCA 3KQHA 2IWHA 1RIFA 2Q21A 4OI4A 1TTTA 2NO1A 3GFTA 2Z83A 3KB1A 3MMPA 2BEKA 4DRZA 1TX4B 3TNFA 2VSOA 1F60A 5IRCD 2ZRPA 2F7SA 1B23P 3WHLA 1MV5A 4GP7A 5BW8A 4RD0A 1G4AE 3TGPA 4BLOA 5H70A 3U6KA 3D8BA 3CF0A 4Q9JA 5F2EA 3AVPA 1IBRA 1CU1A 3SHFA 2ZTSA 1TUEA 1YZTA 2VIIA 3P27A 4Q66C 2FPLA 4JT2A 4R9UC 4Q4LA 5FBWB 4UKDA 4XTRA 1XXHE 5CB6A 1EG7A 3G0HA 121PA 2VHCA 1HEIA 1E6CA 2BIFA 1JEEA 2FPMA 1E98A 3CIOA 2CL6X 4LBYA 4RZ3A 5FUVA 4A8JB 2H92A 3U4QA 5JHHB 1ZUNB 1XBTA 1X1RA 4JKYA 4B35A 3N70A 4TTQA 1H8HD 2L0XA 2VHQA 3KJEA 2V6IA 4YXWD 4AURA 4B48A 2OE2A 4DIDA 4Q19A 1LY1A 4D80A 3MGCA 3ASYA 4GNKA 2ZE5A 4Y0AA 4OKSA 2YWGA 2XOKA 4HAVA 1OYWA 2IC5A 4BUJA 3IEUA 2O8CB 4IXNA 3SYLA 1LF5A 1G6HA 1OH5A 4PSAA 3OIWA 5KHOC 2ZE8A 4HEJA 4Q47A 1OFHA 5DISB 3IHWA 3EIHA 3CNNA 1EFRA 4PX9A 3TJZA 3QI2A 2OFOA 4YMSA 1YZQA 5FL7A 2X77A 3KKQA 2G77B 3MLEA 4OJQA 4QL3A 5EXSA 4IXMA 1G8YA 3SBEA 2CJWA 4MH0R 3TVTA 4JS0A 2QTVB 3OAAD 3ZVRA 2WZQA 3AF0A 1OKKD 3RNLA 3NXSA 4JLAA 4IVPA 1PLJA 1RRCA 2A5YB 5JJLA 2J7KA 1LNZA 2AKYA 4OQXA 4BRUA 2IBMA 1IN6A 4I1SA 3DVLA 1SZPA 3CNOA 1KDOA 3I5XA 1CJUC 3OIVA 1S0UA 4XVRA 1Z28A 4WA7A 4B2IA 2DCUA 4F4JA 1BIFA 4TLAA 4LYHA 2FG5A 1NSTA 3BC1A 1VHTA 3N2IA 2GCOB 5FPKA 2JLRA 2ZUDA 5B2ZA 5BWMA 1E0KA 1E2EA 1S3SA 3I61A 2PBRA 1ZUHA 2ODBA 3FYHA 3RRNA 1X1SA 2A9KA 4UXIA 1YR7A 4FMDB 3KKNA 4PQFA 2XNDA 1IQPA 3QENA 1OIXA 3KFVA 1ZJ6A 2QP4A 2VQSA 4IKEA 3GJ3A 2VF7A 2BMEA 3PENA 1II8A 3UIEA 1MKYA 3B85A 1A1VA 4DLWA 5AUNB 4ABYA 3EW9A 1YR9A 4RY2A 3VHLB 1HQCA 4H1UA 5FPHA 2JLZA 3AKCA 2VHJA 4F4CA 5L3QA 4YC7A 2W2XA 4TLEA 4A0RA 5KTYA 4P4UA 4CEJB 2NPFA 1W4RA 4JBYA 3ZIAD 4BWYA 3EZFA 2CHQA 3IILA 2JGNA 2V8OA 2AD5A 4JVLA 1ZW6A 2YOHA 3NBFA 3QIAA 4W5HA 4BEBA 2AXPA 2QZ4A 3B1ZA 2VLIA 4OQFA 3GJXC 4DT1A 2IYVA 1E9AA 2WV9A 4HZIA 1JNYA 2P6NA 3AVVA 1W4AA 2KBFA 4KFUA 5DSZA 3FHCB 2JLUA 1ZMXA 2CCGA 3LWNA 3BGWA 1EK0A 2CLDX 2WPDA 4D81A 4NYJR 4WXPA 4FWTA 1NN1A 3BE4A 4XWKA 3W8RA 2D3WA 3NBZC 4NBSA 2QAGA 2VP2A 2HF9A 3PVSA 4JYBA 2PCLA 1MOZA 4C0KA 1SVIA 5JSZA 1TQ4A 3FPAA 1I4TD 4HB4A 4TL6A 3BFXA 1NMZA 4F7WA 4RD6A 1EX6A 1MH1A 2ZE6A 1ZM2A 2ZU0C 1W4CA 4CF7A 4PHHA 2XB2A 4G0NA 5F9FA 5KDOA 2XXAB 3AGPA 1Q21A 1GRNA 1R2QA 2RGNA 2YINC 3CKLA 4C3ZA 4C9BA 2Q9AA 4DJTA 4EUNA 3R7WA 3RS3A 3DKVA 4ASUA 1AS3A 3C4JA 1EX7A 2YC4C 3W3AA 1E79A 1G8GA 2BBWA 4EAQA 5FTKA 2G88A 3PQCA 4Q7MB 2BKEA 3WBKA 1DG3A 1KY2A 1HURA 1Z6XA 4ILEA 1CRPA 1BYUA 1ESNA 2I1VB 3VKGA 3K53A 1R7RA 3SEAA 421PA 1ZC4A 1XNJA 1D2MA 1KSHA 1LTQA 1P2VA 4YQFA 2WWHA 2NTYC 4B44A 5GVRA 2G0TA 5GJCA 1SXJC 3MFYA 3QEJA 4JMPA 4M2LA 5SZHB 5KU1A 5DHFA 3L8ZA 2C03A 3FB4A 1T0JB 1DTSA 2ZRBA 2WJVA 4HSEA 1GG2A 2GESA 2F3TA 3OFNA 2DWPA 1II9A 3CH5A 5AJWA 3KQNA 4ZDJA 1G8HA 1IONA 3AF2A 3AP3A 5DN6A 3OE7D 5J4HA 1Z0IA 1KO7A 5J4YA 1Z0FA 1E0SA 4B3CA 1Z0KA 1GSIA 1IY2A 3OEHA 1II0A 2QG6A 4KVGA 2ZS7A 1MO5A 2BV3A 2R6GA 3QKRA 2IS6A 2WBLC 5IHPA 4US1R 1K5GA 2CEAA 1G5PA 1NVVQ 2AD1A 2BCJQ 1KO8A 3M6AA 4JLOA 1OH8A 4R7ZA 2A3RA 3KQKA 1FOEB 2B6HA 3OIYA 2ANBA 4OHWA 2JCSA 1OV4A 3K70B 1G16A 1GTVA 4B75A 1ODFA 5EP3A 4Q4AB 4Q00A 4OQNA 1DVRA 2IYZA 1HT1E 3BH6A 4Q4JB 1D2EA 5DH9A 2ZRAA 1JEDA 1HYQA 3ND9A 2HCJB 1R5BA 4Q01A 1DAKA 4D4JA 1JALA 1TUIA 3THYA 5EP1A 3AKEA 3FMIA 1P73A 5IK2D 1RC8A 4CEHA 3SBDA 5M04A 1SVWA 3KUDA 1YZUA 1XB2A 2E9SA 1SXJE 2XZPA 1COWA 2BMDA 3NHBA 2FGKA 1VG1A 3THXB 5EZ6B 4IVQA 5B64A 1TL7C 4Q4HA 5FOXA 3PUXA 1X3SA 2O0KA 3LD9A 4BLRA 3EXAA 5KSPA 2MMCA 5LB2A 2VP4A 1NI3A 3LLMA 3BJIC 2GVZC 4NPHA 3X1YA 4DDTA 1N6KA 2VTKA 5AJZA 1G21E 1I4DD 2LKDA 2D62A 4OI1A 1G6OA 4FMBB 4DCVA 5HZKA 1KO4A 1MO4A 2Q3FA 1Z6YA 4GOXA 1OHHA 1KI4A 1Z6GA 2CE2X 5BYJA 4O2LA 3ZVNA 2HUPA 3GP8A 3TLXA 1YE8A 1K5DA 4ARZA 2GA8A 1SXJD 2E87A 2IL1A 4DSNA 4FWIB 2BM0A 5L8VA 4URVR 4Z51A 2W6ID 1UJ2A 4LHZA 1UKEA 1O3YA 4MGKR 1R6BX 2OFWA 4AG5A 4PPNA 1RW4A 4ZIRB 1I2DA 2F9MA 4UNSA 1XEXB 3F0TA 4CYMA 3BB4A 3N5CA 3O8BA 1M8PA 3Q7PA 4B3BA 1N6IA 1XXHB 3VTKA 1JPNA 3D3QA 4F93B 4TYYA 1AQYA 1OYYA 1MRNA 2QPTA 1BS1A 5FPSA 3PCRB 4JSYA 3H4MA 2GCOA 4B34A 1W36C 2A5GA 3W6PA 1LF0A 1XD9A 2WHXA 2BWJA 3CH4B 5BXQC 3EASA 1KHTA 1L8QA 2JJ1A 5CM9C 2BMJA 3ZS8A 3ZGXA 2FX3A 1KKLA 4OK5A 1PUJA 2ZRGA 2O8BB 3CPHA 1FQKA 4LHYA 5KPDA 1I4LD 3KB2A 4I1OA 4B76A 4KJZA 1CXZA 2IXFA 2VH5R 1XJCA 1NY6A 2JIZD 2DPXA 3AGQA 2VSXA 3RRMA 4PHFA 4MA4A 3C5CA 4URYR 4C0BA 2P5SA 2ZIAA 4D4KA 1QVAA 2ZJZA 2NO6A 1XCMA 5GJWC 3PUZA 4NH0A 2D2EA 1A2KC 3SN6A 3A4NA 2ZREA 2GRJA 3K9HA 4DLYA 4OHZA 4Q7KA 3C8UA 4C2UA 3B1YA 4QKQA 5DI9A 1X8LA 1VYVA 4GBMA 3NC0C 1E2KA 1XU4A 3K09C 5FI1B 3CONA 1RYHA 3GLGE 4TL8A 3E5HA 1E2PA 4UNQA 2UZIR 3EWAA 4QFMA 2XZLA 4GRAA 2IXGA 3HYRA 1WBBA 3AV0B 5FL3A 3TUJC 4A0FA 4WOPA 1S9HA 4Z1MA 2XTMA 3X2SA 1EWRA 3Q8XB 3KQLA 1AIPA 1UDWA 1W2HA 4PZYA 4AIIA 4M4SA 5FTJA 3R8CA 2GJKA 2IT1A 2OCAA 3H2YA 4DWJA 1LB1B 4OJKA 2O8DA 1VG9B 5JECA 2J7PD 2ZYTX 4XIGS 4PAQA 2ZUCA 1R8SA 221PA 3IBYA 1KOFA 3I4LA 3SC3A 4RZ2A 1EFUA 1Z29A 3K9NA 1Q1ZA 1QHXA 2ZJOA 3EA0A 5JS8A 1KAOA 3WMEA 3WY9A 2JLVA 3TQFA 2IHBA 2LKCA 4BLQA 2GZAA 2ZS8A 3T5GA 5J4LA 5F3WB 2YWFA 3RS4A 1E1QA 1Z83A 2W6JD 2ZR9A 4E22A 1SQ5A 1US8B 5C46F 3U5ZB 2CLSA 1QHHA 3DKPA 2ZAMA 5TXGA 5DGXA 2C96A 1P60A 1XDBA 4MGYR 4YMUA 4PSKA 3U7EB 4BRWA 4OI0A 621PA 2SHKA 4DLUA 1E2DA 5FOVA 3CF6R 2ZE7A 1E1RA 2Z4SA 2GF0A 5AUOB 3T35A 2WSSA 3UK6A 4PAMA 4JLJA 3U3MA 3QNUA 2B8WA 5C4GB 1W36D 2QI9C 2Q9BA 4US0R 3AVTA 1GP2A 4HLUC 3UMSA 1Q22A 2VRWA 2O8FB 1E9BA 3KJGA 2DWQA 1V43A 3KKMA 3BORA 2NIPA 2YHSA 2GILA 1E2NA 2ZU6A 1XTIA 2A7QA 2NGRA 1E96A 3AF4A 2NG1A 3P26A 5DO9A 3K0CA 3H86A 1IN7A 4EPRA 1L4UA 4PSVA 1P4SA 2CLCX 2MSDB 1FX0B 2GZDA 2A78A 4A6PA 1R0ZA 2J0UA 5FBLB 5HR5A 3AF1A 4IDOA 4Q1BA 4Z8YA 3I62A 4AD8A 2IK8A 1G8PA 4HYYA 1XD2B 4EFMA 4RD2A 1TQ2A 1W44A 1NVVR 1S8FA 3AP1A 3FHTA 1ZYUA 2WIBA 1S1MA 1FNNA 4YMWA 4C0SA 1RFLA 3GEEA 3LW8A 3ICQB 3NTUA 1KK0A 5FPYA 2H1LA 1KNQA 2UZ3A 4BASA 1TU4A 1JBKA 3JVVA 5EE1A 3SI7A 2GXAA 1KDPA 1KSJA 4PZLA 3REGA 2D74A 3EZ2A 4D4MA 5EE0A 2OAP1 5DLQC 3SZRA 2CNWD 4CW7A 3T1VA 3VNUA 1XPRA 3EZ7A 1LVGA 3BFKA 3OESA 3LW7A 5CB8A 4Q4AA 1KZ7B 2W0SA 2JJ8A 2RHMA 3GEIA 4DZZA 3UPUA 3L0PA 4RKFA 3ZS9A 2EYQA 3FMFA 3UMRA 3QF4A 1Z22A 3H1TA 2ZJAA 1W0JA 3L2OB 1Z0DA 1EFTA 3QG1A 1Q12A 5JCPA 4Q1AA 3ZYCA 4BFZA 5JEEA 3RYTC 2BKUA 3CZQA 2HJGA 2HYDA 3FVQA 4NYIQ 1G9XA 3I5YA 2CVHA 1Z3IX 1UBGA 2IS1A 4TMKA 4XD7A 3V9PA 1NLZA 4QBIA 4C0HA 4PC7A 1GWNA 2C77A 2PT5A 2ZJBA 2GKSA 1GITA 3SJAA 4OK3A 2PT7A 1Z6AA 2RCNA 4GMXA 4RZUA 3LRPA 1TPZA 4GSYA 3TIFA 3GJ5A 2FF7A 1RPZA 3KXIA 3FGNA 1LS1A 1GNRA 2RB4A 4V0MA 1LS6A 2IYWA 3NVAA 3RRZA 1QHSA 1H8EA 2FSIA 4TT3A 2JATA 3QSYA 1YU9A 2OCPA 2BVNA 4J0QA 2AK2A 2P5TB 4H1VA 5FOSA 4B3DA 4PXAA 3EPJA 1KY3A 3PUYA 2FDCA 2AK3A 1VECA 1JQJC 1QG4A 3CRQA 4M1YA 4O2RA 5EZ5A 2ZXUA 2EVWX 2C95A 1GIAA 1XEFA 1XMVA 3GJ4A 5E7MA 4RD3A 1E9RA 1T5LA 3B9QA 2FN4A 4FXPA 5GJVC 4NYMR 5BN5A 4A9AA 1VTKA 1TF5A 1U9IA 2PZGA 3DMDA 3LVQE 4UJ5A 5DNYB 3RC8A 3I1FA 5EQTA 4DLSA 5FTMA 4QM7A 2NO0A 1KIMA 3QBVA 4LV6A 3EAQA 4QM6A 4TYNA 1N5IA 4M53A 5L3RA 1X86B 2C9OA 2H7VA 2GXSA 4M22A 3OIUA 2NOAA 4Q03A 1HTWA 1GNPA 2WSMA 4M9ZA 1NJGA 3GJ8A 2YZ2A 4H9GA 4G5OA 5HTKA 3SOPA 5CDFE 2X1VA 4ZDWA 5AUQA 1F3OA 3SFVA 1F2UB 4ACAA 1A82A 4MYTA 2KBEA 4JT4A 3WRXC 3A6PC 5JJIA 1FTSA 3D7MA 1X8JA 3FMOB 3OZXA 5IDVA 2GK7A 4KBFA 2ANCA 1SXJB 3G5UA 3PEVA 3RS0A 2FOLA 4P33A 3B1XA 2CCKA 1VPLA 1S3GA 2ZR7A 3HU2A 3LBNA 5KPJA 1UKYA 5FPTA 2ECKA 4HAYA 1ELOA 3RWOA 5SZIA 2EW1A 2W83A 3L43A 2GJAA 3IIKA 4OBEA 2CK3D 5JWOA 3ZVMA 2WWIA 2DB3A 3AVXA 1KJZA 2BBTA 3TSZA 5F9HA 1GAJA 4L8GA 1P72A 4XVQA 2HV8A 2F1JA 2IUSA 1BOFA 2ZI4A 4NP6A 4YDHB 1OFTA 1G64A 1XF9A 2O0HA 4I99A 5HKKA 2ZPTX 4S35A 5DIFA 3FWYA 4MKIA 2QP9X 1L7VC 4HB2A 2BM1A 4D0GA 5BYKA 4V0KA 1SVSA 3D31A 4LV8B 2WTUA 3BBPA 2QL6A 2R8RA 4C30A 1U0LA 3QBTA 4GPTA 1ZM4A 3ZVLA 2ZRJA 2D06A 4B3FX 3KTAA 4HZUA 2ERYA 1QHYA 3WMGA 4GI7A 1XCPA 3AVQA 3TE6A 4LX0A 3WNBA 4V0ME 2EFGA 2G0NA 4P3YA 3MWYW 1G7RA 1NVWQ 5D3QA 2ZRDA 2X2FA 1S1CA 4RFSB 2ATXA 5DI3B 4E09A 2DR3A 3NBYC 2GEUA 1Q3HA 4JVSB 2ZI7A 1N6OA 5BN3A 2ZSAA 1OIWA 3VKWA 1F2TB 5JI3E 2W2TA 3UANA 1CIPA 2VO1A 4CT4B 2GCNA 3IQXA 4LV5B 4XWOA 2FEMA 3UG6A 3GLIA 4OK6A 2GXUA 4O3MA 2CL0X 1Q44A 2IWRA 2KSQA 1UKZA 1HQYE 1RJ9A 1US8A 3A58B 3BRWD 3CF2A 1LV7A 3TAUA 4DSUA 3U7GA 4MUAA 4NONA 3ONWA 4HATA 3EIEA 3VU9B 4DC9A 4HDCA 2FNAA 4M21A 4NKRA 1XD8A 4BFXA 1GL9B 2ZRFA 4IEIA 1S4QA 4M9QA 3CRRA 3L0OA 5FTLA 4LHVA 4WVFA 4PPFA 4KI0A 1J99A 3G82C 4TYQA 2C78A 1CULC 3I3SR 4UNRA 2YWHA 3WNCA 2Y8EA 2ZI3A 1IN4A 1PJRA 2YYZA 3GJ7A 3SYKA 3VFDA 1J8YF 1CR2A 2ATVA 1QVRA 1DEKA 4CEIB 4TQAA 3T1OA 4KITB 4DHEA 3BERA 2OILA 4TZ0A 4KVAA 2YVUA 4TTPA 4LOAA 3FKSA 2WJJA 3PJRA 4M0LA 1QDEA 2GEVA 2D4HA 4URWR 1M7GA 2LCFA 4YMTA 1IXZA 1M6NA 4HB0A 2HEIA 3ICEA 1XD2A 4TSFD 3A1SA 5E7JA 5L3VA 1KJYA 1NBMA 2ZSDA 4R71A 4EIWA 5JWRA 2B21A 4NTZA 2V7QD 2OFXA 1YZGA 4WZBE 5SZKB 3VR1A 1G7SA 3MAAC 2VEDA 4KHZA 1W36B 1P2TA 2MMGA 4FINA 4PR0A 5J40A 2RGXA 3P4XA 1OPXA 1KK3A 1PLLA 1MR3F 4JIMA 3CWQA 2XSZA 3LQRA 4IDPA 2O8EB 4B33A 1VG8A 2WMOB 1X6VA 4LPSA 4KSBA 4TMTA 3K0FA 3HDTA 2Z4RA 3DPUA 4NYIR 3TW8B 3BB1A 1XZQA 2FGJA 5KO2A 4BFVA 4Q1EA 4QXAA 4ZKEA 1NKSA 2QE7D 4V0LA 4PC3A 1OXVA 2FV8A 2PEYA 4BFYA 5GADl 2AXNA 1BMFA 4LY6A 4HB3A 5J4VA 2WAXA 5CYPA 3WXMA 4NMMA 5EP2A 1P9RA 1JJ7A 4DDWA 1XP8A 4CZ2A 2R2AA 1KJWA 3C7KA 2JLWA 2G1KA 1SKYB 3GLIE 2R6AA 4IW3B 4KYUA 1XJQA 3C16C 3GEHA 5HCIA 1AGRA 3IKJA 1BH2A 1C9KA 1UBFA 4RJLA 4BECA 4E03A 5K8IA 2QMHA 3GPLA 5JRZA 2QMOA 3MWLA 3ND8A 3CPEA 4IDQA 2Z5FA 1VCNA 1N25A 1XFAA 3NEYA 3V00A 2C9YA 4EQ6B 4AKGA 1G3QA 1MT0A 4AKEA 2ZETA 4QOSA 2G83A 4U00A 3JZAA 3Q72A 4POAA 2IUTA 1MABB 1NN3A 2UVQA 4IEEA 2XGJA 3SHWA 4D26A 4TL7A 2GJ8A 1QG2A 1LW7A 3QKUA 4EPWA 3OHMA 5KOYA 1XEWY 3A1UA 1E9CA 1G3MA 2J59A 1RZ3A 5EE5B 4BZPA 3U44A 3FKQA 1TF7A 2N42A 4B3XA 2FMXA 1UM8A 2A5JA 4C7OA 3WNDA 2FSFA 1JJVA 1P61B 1KKMA 2IF0A 1VCOA 4P4SB 1NBME 4PC6A 5KNCA 2BC9A 3LNCA 1PV4A 1SGWA 3B1WA 4ON9A 2I4IA 4A0GA 2J46A 4LSGA 5FOWA 3B82A 4RSGA 3W6OA 1E0JA 3RS2A 4KXFB 4XOIA 4WXRA 3RS7A 2XOKD 1FW6A 3ZLJA 4QBHA 1FZQA 2QA5A 2WKQA 2OM2A 2HXSA 3B1VA 2F43A 4L5BA 3EZ9A 1DADA 2KJQA 1CJVC 4KCGA 4E07A 2RGGA 2WKPA 2QAGC 1E2GA 1KDRA 2J45A 2WOOA 3CRW1 3SNHA 3TSOA 4MGZR 3NBXX 4IJMA 2IYUA 3WYGA 6Q21A 1AGPA 5FL7D 3K0AB 2G3YA 3V4FA 4DLVA 3IO5A 2WJGA 1CJKC 1KGDA 2VP9A 2BBOA 2ZSEA 3CB4A 1VKJA 4UXHA 4DUGA 1FNMA 1IN5A 4ZPXA 3BB3A 3BWDD 3CX7A 1N6RA 1NJFA 1VCIA 2FZ4A 1JXOA 1W5SA 4M8NE 3GLFA 3ZH9B 3EPLA 1WE2A 2RGNC 2JJ2A 4FD2A 2KB0A 4KODA 4DDVA 4F91B 1GL7A 2H16A 2OHFA 5CK4A 2OXRA 2ZI6A 1CJTC 4A2QA 2JIZA 2XJ9A 3KKPA 1P6XA 1JI0A 1UEJA 2WIAA 2RH5A 1NRJB 4KYIB 1RRPA 3A8TA 1N2CE 5ANRB 1VIAA 3VAAA 5IF9A 1D9ZA 1J8MF 4ZKDA 4OHVA 4P4TA 5DI3A 3KX2A 5TY0A 2XNDD 1P9WA 3LV8A 2IEZA 4IDHA 2FH5B 2P3SA 4O0MA 4Z8XA 3MUFA 1F2TA 3GLHB 3EPHA 3KXLA 3RC3A 4DSOA 3SQXA 3EX7C 4DCTA 3IBGA 5JCZA 3NEJA 5E4FA 4A8JA 3KFXA 3TBKA 4MKFA 3T06B 4EJSC 1T3LA 2VP0A 4FCVA 1KMHB 4ZCLA 4U02A 3A36A 3LBIA 4US2R 4X8MA 4KLNA 2D7CA 1WRBA 1KO5A 1E0AA 4Q1FA 4G5RA 1M1YE 2GEDA 4RKEA 5K8UA 3U3JA 3ASZA 2UKDA 3EA5A 1U2RA 2O8CA 1M7HA 5DE3A 2QMEA 2V54A 5EJEA 1KI3A 3AB3A 4QJ5A 4PC2A 3C15C 4CEIA 2IW3A 3I8XA 2TMKA 1NMYA 8OHMA 3EC2A 3NHAA 5FI0B 1NG9A 1W2GA 3MJHA 4HUQB 4ERNA 4F92B 4XWAA 2QRZA 2EFHB 4RCYA 2DFLA 2VA8A 1XTRA 3CWZA 3QG5A 5UKDA 4MDFA 3VX3A 1NNEA 4WBSA 3LFUA 3OEEA 1QHNA 4QHYA 4QJ3A 1B0UA 1ZM3A 4Q5IA 4IOKA 4OHYA 4JLBA 2X2EA 1RE0A 4DCSA 2QRNA 1XTSA 1CEEA 2W2VA 1Z47A 4JLPA 1A5TA 1I2MA 2C98A 3LA6A 3P32A 3THOA 1DAEA 1KDTA 4MUBA 3PUVA 3IHLA 4EFNA 1GM5A 1HT2E 1A2BA 2P6UA 4PQYA 3U3KA 1ZD1A 1AK2A 4WIAA 5KYKA 3U60B 4PANA 1DAGA 3DZDA 2EWVA 4LI0A 1M74A 3RLFA 3U3OA 4DLTA 3EIQA 3F5FA 4IFEA 4B32A 2IXEA 2WJYA 2HT6A 4F38A 3QQ5A 5D3MB 2JA1A 4HDQB 1GKUB 4HUTA 4RZXA 2Q0HA 2GWHA 5CLQA 3R9XA 1CBUA 1P3JA 1VG0B 3DHWC 1ZD9A 3HR7A 2O0JA 1UAAA 1DAFA 3LLUA 2Z0MA 3W9YA 1KI7A 1FMJA 2RAPA 2JLSA 2V3CC 2GHIA 3K09A 4EDHA 1DO0A 1A7JA 1ONBA 2HT1A 4HI0E 1HE8B 1TADA 4M1TA 2QU8A 3U61B 2HLDA 1KI6B 2EFEB 3CRMA 3QXHA 4AYTA 1IY1A 3EG5A 1OJLA 3AF3A 2C99A 2GJSA 4W7SA 4TQUS 1Z2AA 5JFGA 4UXJA 5AUPB 5DN6D 4LPKA 2EU8A 4OHXA 4IDNA 2GCPA 3AUYA 3KKOA 1D5CA 2OCBA 4CEJA 1AZTA 4LHWA 3OEHD 4TL9A 3CR7A 2A5DA 1J70A 5B58C 3I8SA 3AQ4A 2QT1A 2ZUBA 1FP6A 1JR3A 4NHOA 5EE3A 1KO1A 4DB2A 1UFQA 4DB4A 4HAUA 2W0MA 2RGCA 1XWIA 2Q6TA 4LRWA 3QXJA 1OLOA 4K8OA 4TLDA 821PA 1JR6A 3F8TA 3NDPA 1RYFA 5A4JA 1OF1A 1U90A 1YRAA 4FN5A 3E1SA 1G20E 4HLCA 2FSHA 2H18A 1KSGA 4IHQA 4LCBA 4PC1A 3QPUA 1YZLA 1M2OB 1WBDA 5TVKA 3SDZA 5C4MA 1DS6A 1TEVA 2OV2A 4ZI2A 2G6BA 4LZZA 5HPYB 1AM4D 2K5UA 3O8RA 4LUCA 4MRRA 1E2FA 2C9CA 2CVFA 3T12A 1K8RA 1RVDA 4TYWA 3K9LA 3AVYA 3FFAA 2XXAA 1Z6TA 5K8LA 4P4SA 2ZJ5A 1G7TA 2JDIA 1COWD 1ZVQA 1XRJA 2RGBA 2ORVA 1J2JA 1ZD8A 1L4YA 4R98A 1OXSC 1MO6A 1KTVA 1E4VA 1JAIA 1Y63A 2OZEA 4MRSA 5G3ZA 4PQRA 2VL7A 1EFHA 3JVUA 1YQTA 2B7BA 2PLRA 1NL3A 4P31A 5DYGA 2ZR0A 2RMKA 3U4QB 5KNBA 4M1MA 4JL5A 1S2MA 2AL7A 4B6FA 3CX6A 4D4LA 3OF5A 2VHTA 3RSLA 2BMFA 4DEYA 3EC1A 3L0IB 4Q02A 1OW3B 1OHHD 4BFTA 1P2SA 4CDGA 2DHRA 2OG2A 4MITA 4X8LA 3PR1A 4PTLA 2C8VA 2FFHA 4Q9IA 1X8KA 2B8TA 2FFQA 2NZ8A 2Q9CA 1U0JA 3HR8A 1UBCA 1P75A 4LGMA 4MGIR 1E2IA 2ZYUX 4M1KA 4OQMA 3W6NA 5L3SB 5LD2C 1SHZA 1SVOA 2PZEA 4JL8A 4BFWA 2F1IA 4OYHA 3NH9A 3A1WA 4EPYA 4ESHA 1SVLA 2GVDC 2JEOA 4RFVA 1W0KD 1NMXA 2CCJA 2EQBA 1NSFA 4O25A 3LXXA 2CK3A 3B60A 1G3IA 2XITA 1IAQA 2Q3HA 3T34A 3ZQJA 4TYPA 3REFA 1PVOA 2WICA 1AA9A 3DOEA 1FPMA 3I92A 2J5XA 1KI1A 3BD9A 5JLJA 2HDNB 3LQQA 2GAAA 4B2PA 4L15A 4C0QC 1JR3E 2CJWB 4HLDA 4LYAA 5EE9A 3WP0A 2JJ1D 2PCJA 2ZJYA 1JB1A 3HU1A 3MWJA 4QG7A 4WW0A 4JLNA 2AFHE 2IYLD 1GNQA 1N5JA 1E2LA 3K0CC 2WWYA 3Q5EA 4Q4JA 1VHLA 2HJVA 2OBNA 1G5RA 2VBCA 1DAHA 3PITA 4V0OA 2OO7A 4C0AC 3KZ1E 3WBJA 3KL4A 3LAWA 3RWMB 5AJXA 5EXTA 2IUUA 1BO6A 3A4MA 3HPRA 2CE7A 1Q20A 4LC0A 5AJYA 1F48A 3L8YA 1N5KA 3TMKA 2AN9A 3TVDA 4DVGA 2CHVA 5FTNA 1PZNA 1KMHA 2OSBA 3RSOA 1A4RA 1VIYA 1MO3A 3THXA 3T5DA 3THWB 3TSWA 1CRQA 4ZDKA 4FMCB 3ADDA 3W5IA 5EXPA 1TEXA 2FWRA 1HE1C 2PX3A 2QEQA 1U94A 1CR1A 2GAOA 1Z8FA 5JS7A 5H1YA 2WKRA 1OE0A 3NWJA 2REOA 4HAWA 2REBA 5FFMA 5KNDA 2OBMA 3CLVA 5J5CA 1GRQA 3QPVA 4FI3C 1DO2A 3SFZA 3B9PA 3HJNA 1E2QA 4DDUA 3ADKA 4A0HA 1H8HA 1W49A 1W5TA 3O8DA 5L3QB 1XJ0A 3GD7A 3AEZA 4LK2A 4YXWA 5FH9A 3PEWA 1EXMA 1N0VC 3K9GA 3MWKA 3TH5A 3W5JA 1UBEA 4TMXA 4Q9KA 4JLMA 3IQWA 1AJEA 2GBLA 2KE5A 4C0LA 3KQUA 1CR0A 1D2NA 3EARA 4DEXA 1ZNWA 4D2IA 2H57A 4TMWA 1FUUA 1YHNA 2R62A 3QKTA 1QZXA 2J3EA 2PZFA 2ZYVX 1Q3TA 3CUEF 5P21A 4KO8A 4GFDA 3QF7A 2ZSFA 1E1QD 1U8YA 1G7CA 3DEFA 3TRFA 4ZIRA 1XEXA 3TUIC 1WQ1R 1P5ZB 4S2EA 3B5JA 3T15A 4NCJA 1E94E 1XXHA 4EPVA 1FP7A 2QN6A 2G1JA 1JPJA 2G9NA 2IEYA 2QAGB 4QGHA 2F3RA 1UKVY 2WJIA 1E1RD 4AK9A 3PIRA 1G4UR 2W58A 4DLZA 1ETUA 2YV5A 4IFBA 2WSSD 4DLXA 3EPKA 3OAAA 3GFPA 1P62B 2REXB 1J7KA 1KNXA 1OKKA 2J9RA 2O8BA 4M1OA 5CIQA 2PEZA 5A5GA 3GFOA 2ZRHA 3Q9LA 2OBLA 5FBQB 1HY3A 1NG1A 3ZJYA 2XX3A 3CNLA 5G53C 2ASEA 1M7BA 4YLGA 2RGEA 4BFSA 3EZ6A 1Q1QA 5HZHA 2WWFA 4R2HA 2CBZA 3R7WB 1IM2A 1FFHA 4HAXA 4MKHA 5FR1A 4EFLA 1DPFA 4PO1A 2XNSA 1NP6A 2CL7X 5GJBA 2C5LA 2GETA 1KZGB 2YOFA 2AR7A 2ZQ5A 1AQUA 3L0SA 2IS2A 3M4YA 4DCUA 2QE7A 3RAPR 3TR5A 3R20A 5AWFC 3LDAA 3NC1C 3JZMA 4QBFA 3WRYC 3U6BA 5TARA 1OSNA 3E2IA 1DARA 1XZPA 1AN0A 4ITRC 3I72A 3IUYA 4TLCA 4FMCF 5KSZA 4GL2A 3AM1A 2ZRMA 4YONB 5KDDA 4K81B 2A30A 2GXQA 3X1ZA 4X8HA 2Z6VA 3KDSE 4V02A 2AX4A 3MG9A 4EJSB 5EUQB 5LDDC 3AVOA 3MJRA 2GDJA 4JL6A 4X8OA 4GZMA 2ZRLA 1ZU5A 1UEIA 1Q1EA 4M1WA 5HCNA 1OXUA 3ZIAA 2QQ0A 1OT3A 3GCGA 1EGAA 4ZO4A 2FE4A 3QKRB 4B43A 1C1YA 2P65A 2IYYA 1TMKA 3PV0A 1EFCA 4AKIA 3PEUA 1TQDA 3T1QA 4I1UA 4XD7D 2OCYC 4JSTA 4A36A 1CKEA 2QMUA 2WM9B 1VCMA 3FDIA 3Q85A 4B74A 3M1IA 2FU5C 1T9HA 2ZM5A 3DL0A 3UWOA 3TAHA 1ZM7A 1R0YA 1H8ED 1OFIA 4TT3D 4G01B 4LBZA 3THYB 4BLPA 3PUWA 2RGDA 2P6RA 3UWKA 3E70C 4CEHB 1GKIA 5TB5A 4B71A 2O8FA 3X1WA 2R9VA 1E99A 3BOSA 3O47A 2MSEB 2OUKA 4ZV4A 3GLGB 1OXXK 3VQTA 2JLXA 5G40A 2YJTD 4KU4A 4NZYA 2AKAB 1NF3A 3MSXA 1W1WA 4Q4HB 1FX0A 3KUCA 2YWEA 2ZRIA 4B3GA 3B13B 2ZI5A 2WVJA 2HF8A 3MRSA 1U99A 5L3SA 5LBIA 1N5LA 1IJFA 2P67A 5TV2A 2N1BA 3U2QA 5AJVB 2WMNB 5HE9A 4BZXA 4KAXA 1OB2A 4TMVA 5JWHA 3RVBA 2OESA 3T61A 4JBXA 4NCIA 3W8NA 1ANKA 5CK5A 3B7GA 3W3ZB 3WHKA 4U7DA 3NDBB 1P2UA 1OIVA 1QHIA 1PLKA 3DOFA 2BJVA 5CYOA 5TDHA 4B73A 4IRUB 4NCKA 4PFSA 4CIDA 4ARZB 2BJWA 4IOLA 2ZRNA 3LX8A 4QGGA 5KDLA 4XTCS 1R5NA 1CP2A 1YVDA 1ZRHA 1WB9A 2ORWA 3AP2A 4LBWA 1E2MA 3ETLA 3ADBA 1T8TA 2XB4A 3OE7A 1E9DA 3RABA 2GZHA 4WZAE 2RKOA 2B7CA 1T0HB 4A82A 1G1MA 1NKTA 2CHGA 1G41A 2OEPA 4MDEA 5KSYA 1KI9A 2D2FA 1F6BA 1KMQA 5H8WA 1G3UA 4G5GA 1ZCBA 5HKKD 2QROA 2V1XA 2NQ2C 4IOJA 3THWA 4W9MC 2EFDB 2QPAA 4Q9LA 3UATA 4AY2A 521PA 5C1BA 2XTNA 2DBYA 3AH8A 4MYCA 5FR2A 1BKDR 2ODWA 2IHYA 3IPYA 4MRPA 2JLYA 1YJ5A 4GOJA 1ZCAA 2O52A 2QTFA 3BK7A 1Y3AA 3KJIA 4URUR 5IK2A 1G17A 1GVNB 1TQ6A 4G1UC 1R10A 3VHXA 2P0EA 2QSYA 2V55B 4QNRA 4HLQB 2WOJA 4RD4A 3LVRE 2O5VA 4PHTA 1E9FA 3ZD6A 4A92A 2FPKA 3HWSA 2VYFA 2RHDA 3P1JA 3GJ6A 1EESA 2OAQ1 1Z07A 4KFSA 4D0NA 5K8TA 1GFIA 3QOFA 2HXYA 4PAOA 4E5UA 4N1AA 3IO3A 4PPGA 1UF9A 3R9WA 2WAYA 3AKYA 3QEOA 4Q7LA 1T3HA 1W7AA 1AZSC 1FTNA 1MRSA 1QBKC 1SVKA 3ECCA 4JYCA 1SKQA 3GMTA 2ZJ2A 4R2IA 2PX0A 4B6EA 5KSOA 2NO7A 5CITA 1F2UA 2FSGA 2F1HA 4A2WA 2P2LA 5JHGB 2E1RA 2AHOA 4BZQA 1FL9A 2O8DB 2ZI9A 2ZSBA 4EPTA 2QGZA 1RRFA 3LXRA 4WAUA 4AG6A 2CDNA 1SXJA 2QGNA 5EXXA 3L82B 4K46A 2QPOA 4PZZA 2QNRA 4GP6A 1DELA 1NN5A 2VSFA 2W6IA 1Q0UA 3RHFA 3TW4A 4NE2A 5B30A 2OT3B 5LD2B 4A15A 4D25A 2BOVA 1Z0JA 4XSGA 4AYWA 3BIFA 2ZVQX 5EP4A 4LJ4A 1EFRD 1QHHB 1R0XA 1GZSA 3FKSD 5AK0A 3UKDA 2C04A 2KWIA 2N46A 1T8UA 4Y0VA 4DKXA 1GOTA 5FUWA 1XTJA 1Q57A 3P4YA 4ZCIA 4QGAA 3ZZ0A 3ZZTA 3CRVA 3ZQ6A 1NBMD 5JMTA 1NIJA 2H17A 3VR6A 3HP1A 4ACBA 5GVSA 3S1AB 1N6NA 1AKEA 1KI2A 1JXMA 2EWWA 1W4BA 2ZVPX 4WZ6A 3EWSA 1NN0A 2XSZD 3D6TB 3K8YA 2X19A 3CM0A 4RVCA 3RANA 2R6DA 1UADA 3NIBA 4A2PA 1XX6A 3NKVA 4LHXA 4N3NA 3VR4A 4LJ9A 1EWQA 5JZVA 1ZAKA 3A1TA 4LJ8A 2J0UB 2LWIA 2PJZA 3LBHA 4MRNA 3WP1B 1U8ZA 2GTPA 4PO9A 3KXKA 3VX4A 1PUIA 4FMDF 2ODNA 1IY0A 2ZAOA 4GOKA 3SJBA 4L4UA 1ZM9A 4RFSA 4Q7JB 4EJSA 4CT5A 4PPQA
chains in the Genus database with same CATH superfamily
4UBJA 4GXNA 2HQRA 1RWOA 4ZT7A 4EGSA 2XUZA 4DV0B 4RGYA 3VR2A 3V8PA 1BMFD 3UYLA 1FMLA 2INGX 1OTYA 2ACWA 1ZVKA 3KKKA 5CDSA 5JI2E 1W46A 3Q88A 4G23A 4INZA 3L4JA 1PJAA 1JQLB 5EIFA 2QY9A 3L1JA 3CVUA 2DH6A 4UUQA 3QK7A 4URXR 2Y4OA 4JI8B 4EK9A 2W43A 1YBAA 4BGUA 4G8JA 3ZHRA 2GPBA 3FOZA 4L9WA 3O1LA 2F4NA 3OBIA 3TQTA 4A4DA 1YIDA 1E32A 5LQSA 3CQ9A 5AHOA 1IHYA 4FXOA 2Q28A 3QXSA 3OM8A 1UIRA 5AKYA 1K6JA 2B35A 3QF4B 1WZCA 2G4VA 3BWVA 2VHUA 1ZC3A 2GPYA 1HE2A 2XYRA 1D6JA 2B5OA 1TKRA 5F2NA 3DOHA 3H5TA 1D1PA 1TQ8A 1QV6A 1X7XA 2ZT6A 5TMEA 2WSLA 4I5IA 5F78A 1SAYA 1QVWA 1ZGCA 1R9NA 3HVJA 2Z09A 2Z1NA 3G2HA 3SYNA 3VR4H 4MWEA 1GCIA 4P7FA 3H4IA 3UAGA 2OBBA 3UM9A 3F7MA 4TXJA 3GRVA 4D9NA 3BF8A 1LRKA 3EZLA 1GD1O 1REQA 4B0OA 3TFOA 3FTQA 2QUZA 1LPPA 5I9LA 2WHRA 4J2HA 1PNVA 1TNDA 3GLKA 3TRHA 4PZDA 5BQFA 1I30A 2C07A 2ZG6A 1EK2A 1J1ZA 4DQUA 4E2ZA 4OLBA 3A2KA 3C5WP 1IHXA 2BAGA 3L8EA 3KZKA 4RADA 1DHRA 3WGOA 1A8PA 3RTDA 5FUXA 1AF7A 1YIAA 2BSAA 3JR3A 1SCQA 3OT1B 1V1RA 4QREA 4E94A 1USIA 3DT6A 5BMOA 1H3EA 2O2DA 4WK2B 3V48A 1GJRA 1QIDA 4F1KA 3CUUA 3CX8A 4DV2B 1GDDA 2WJPA 1DAIA 2IU6A 1JA9A 1JLHA 3WGMA 1L5KA 4D6PA 1Y37A 5JCOC 1C9MA 1IB6A 3PFNA 4ASUD 2Z57A 1FNDA 2R8ZA 4IXWA 3H1PA 4LQ4A 4RVHA 2RJNA 1X87A 1K8XB 2VHYA 1EBBA 1E79D 1JSZA 3VISA 4C87A 3G2QA 4EKEA 4TKVA 3C1UA 1M6WA 4HAZA 4FIDA 2CNOA 1BXRA 4NHEA 4ZGBA 5HQ3A 3HKEA 3K0SA 2QZPA 2PTHA 4Q7EA 1Z0AA 2X0KA 4NL4H 2A2ZA 1C4OA 1VYTA 3TW8A 2AVDA 4MVXA 5IEJA 1H0HA 1YZNA 3W8EA 4BQSA 3PE3A 4FLFA 1U7OA 3F3MA 4KR7A 1XDSA 1YRBA 3I73A 3NYWA 1B14A 1Z33A 2G7MC 4B5KA 5FNVB 2EKDA 2I4NA 4GZLA 3A9RA 2ZKIA 1MW9X 3RQSA 1VIMA 4EY8A 1BS9A 1WUKS 2XH8A 1KVUA 1QRAA 2HK9A 1NY5A 2RCYA 1JHQA 4RWZA 2Y6UA 3L6RA 3TGWA 4GECA 4BMYA 3J81A 1Q0RA 1RXSA 3K4HA 1T34A 1QIGA 4DIEA 5MGNA 4IRMA 1Z6PA 4LZJA 3TOXA 1XNQB 3JCZA 1W6UA 3M82A 4FFDA 4Y2YA 2CJPA 3IEMA 3QX3A 1E9SA 3O38A 2DBZA 3WZMA 1Z6ZA 4A03A 2ZBPA 1G5TA 2Q27A 1EI9A 2JKYA 3HDQA 2QY6A 4AAYA 5F1YA 4P36A 2P78A 3DDZX 4IQ8A 1MNQA 3VR0A 2M1ZA 3GFRA 3PNLA 3WOVA 9GPBA 2YKGA 1LLDA 1EA5A 1N5RA 1NT4A 1CJMA 1T3ZA 2DYKA 2FFAA 3K1JA 3V8QA 2C1XA 2QVGA 1Y7IA 3EGXB 4BV2A 2WTXA 2NU9A 3GQBB 3KSRA 3QKSB 4PG8A 4N3GA 4AZ3B 1NLFA 4EQ6A 5FOTA 1ATZA 3GH3A 3OLZA 3AJEA 5D6NA 5HS4A 3ILHA 4EHFA 1L7RA 1ZH6A 2ZT5A 1Z2CA 4DWOA 1FJ2A 4H6VA 4MINA 4PU0A 2HCBA 4ZQIA 4A6DA 1NJ5A 1P2FA 3UJ7A 1B7GO 1AN9A 1JEQA 2IEIA 5JSFA 4KKVA 4Y6GB 5HX7A 4NXMB 1Y4SA 3V1LA 4YPFA 3NHYA 1YR6A 4MYUA 3QSGA 3AUKA 4MMXB 5EJ2A 4AWXA 3DDOA 3RIXA 2BTQA 3ELDA 1DBVO 2B7LA 1EH5A 3FI9A 4FYKA 2OK8A 1RYMA 3CW2A 3KTAB 1XYVA 4YRTA 4HZUB 4WCFB 4WADA 4FNAA 3DTVD 5DGTA 2WNHA 1GAEO 1S8OA 1BFUA 2ZTHA 3PE6A 3ZBUA 1F7VA 1GILA 3L4SO 4J76A 3HDVA 3F9CA 3CR8A 4AI6A 2IYTA 1QV7A 4G84A 2B1RA 2IEBA 2F00A 3KXDA 3R6TA 1I7LA 4BPBA 1IE3A 1KEZA 1T5HX 5FUYA 3CVXA 3FNGA 1Q7EA 5H3HA 5JXGA 4I36A 4YUWA 5JEDA 1QC5A 2JFOA 3SR0A 1HNZB 1JUDA 3PHBE 4PVCA 1N0WA 4FX5A 3OCWA 2IYEA 3CE9A 3FLEA 3JAWA 3H2BA 3MM4A 5K4GA 4O33A 2FW9A 1P4GA 1QSGA 1L7BA 2G04A 2HWXA 4LISA 3ICOA 4X71A 1W47A 4Y2RA 1WWKA 4K6OA 1EB8A 1OT5A 3M5WA 1RJ9B 4WUTA 4YP0A 2QM7A 1J97A 2H5EA 4TWJA 2VPPA 2VZLA 1VHQA 2IYOA 5K6AA 1PGOA 1MB4A 2CFCA 3FMPB 3HBMA 3NPMA 1K66A 1E7YA 4CLOA 4OJYA 1FLAA 3QHAA 1IXSB 3VMFA 1KK1A 1ZR2A 3EHEA 2V0GA 2BKAA 4UATA 2BEUA 2DWOA 1NLUA 1PE0A 4ZVLA 1HH4A 1WXIA 2PUDA 1RHQA 4FYVA 1UXHA 2WQZA 5F7OA 5FNVF 3SCZA 3B7WA 2CD9A 3H84A 4LMAA 3S1AA 2PU7A 2QT0A 1ICEA 5DBHX 5JDCC 3HM9A 2FQ1A 2JJMA 4TOIA 2NV0A 4E33A 4KQEA 5HJ2A 4QBGB 4QLOA 4AO6A 2FZCA 5C3UA 3MHTA 4AUKA 2VYCA 1OAKA 4JD5A 1ML3A 3Q2OA 1NW8A 1ZFNA 1Z26A 1VI6A 2NZJA 2XUPA 3G8DA 2ZUEA 3CU5A 1AKNA 1OFUA 1VBMA 3EYAA 2E55A 4MQ6A 5AI8A 1K0FA 1NJ2A 2RC5A 2YW9A 5J2TF 2IYRA 1EBUA 2Q1TA 1JR2A 2C2ZA 2LTAA 4NEQA 1NNLA 5I7EA 3Q8KA 1IOZA 5KI6A 4ND5A 1V25A 2O2CA 3E22B 2BZGA 1R5OA 4P5DA 4Y2PA 1H1TA 3AUSA 3ZCSA 3GLHA 3I9NA 1Z06A 3GJ0A 3O4RA 1NM5A 5DF1A 1ISGA 3F2IA 4M1SA 3RYHB 1MPXA 2ACEA 1V39A 5LU9A 4R7TA 3TOCA 3SC4A 3ZV4A 4ZFNA 3W5DA 5C1OA 4LOKA 2PXXA 2P2DA 1O5OA 4CLXA 2ZYAA 4EKGA 4ZOQI 2FMUA 1B8PA 5D5HA 1BWSA 3I09A 1KFBB 1ZIPA 2TYSB 5CDTA 2VQ6A 4QUEA 4KUGA 2BGNA 5JBQA 1EDBA 5AR1A 5I5GA 5FBRB 1Y8AA 2OHIA 5G4KB 4JHLA 2ORIA 3C98A 1CS0B 2BEJA 2VP5A 3QUTA 2PZKA 3SYTA 3T95A 4EVSA 2Q5LA 3STWA 2I3AA 3CHYA 1TU3A 4ZQGA 4KSCA 5DTMA 7MHTA 2ZUWA 1YL6A 3PTZA 1ECPA 1KTIA 3G2NA 1JTVA 2YRWA 3CLKA 1BGWA 2O2ZA 4WECA 3HU5A 1U6JA 1QBGA 3B3JA 1XZDA 3VZDA 1S9DA 1ZR4A 4Q18A 3GNTA 2E4ZA 2AI2A 1BQ3A 3MRVA 1TFUA 1EJ6A 2H3HA 2MSCB 4WN3A 5DP2A 5CGZA 5ILGA 3JASA 4UUNA 4G5SA 4HUQA 1W52X 4F60A 3DMFA 1S96A 4DGSA 4XW2A 1AKVA 1TAHA 2X9VA 3N7UA 3JZDA 2HPAA 1GPUA 1ITZA 4ZP1A 3M49A 3SU8A 4C22A 3K0KA 5ALJA 1NIPA 3RTBA 2YV4A 4CXMA 3LMKA 3DE0X 4RENA 3PLAE 4RPGA 3VDXA 3L92A 1ZCJA 3MB8A 2XCQA 3PEFA 3LO5A 4LY0A 4QT0A 3PYXA 4DT1B 2PKWA 2XJ4A 2YQ4A 4QO7A 3RM3A 3URMA 4KJXA 2RHHA 3L4BC 2JDID 3K72B 1H65A 2QYOA 2PV0A 1HUQA 1KAHA 1KI8A 1O95C 1RMQA 2VJQA 2RHCA 3EGDA 3HZOA 1SQ0A 3L02A 3H42B 3JQRA 4HDAA 4UHHA 3ZQ4A 2IBTA 1YIOA 5DYIA 4MS1A 4WHMA 2CLEB 3LY9A 2H9YA 4JGGA 3WK7A 4EFDA 3N2ZB 3C7AA 3M6WA 1LNQA 5ER6A 1G8SA 1J2UA 2IZZA 2V3VA 4JP1A 3LUFA 1VJRA 3EIWA 1HEUA 4B4WA 4WH0A 1TZMA 5JSZB 2FA9A 3BMOA 5CLLA 4DBLC 4TSFA 5GPBA 2IE0A 2AVNA 1U81A 3F1KA 4NZMA 4C7OB 4QRHA 3W1VA 2V7QA 1ACLA 3T6KA 5J47A 1A7AA 3KUUA 4BO3A 3QNMA 4G4IA 3BICA 3NHMA 1BYIA 4RVFA 3DB1A 4AJEA 4DNFA 4KXYA 5EIHA 3PG5A 3ON5A 4KVFA 1NKVA 1KORA 2QJOA 1R0WA 3RAEC 5DXJA 2A1IA 1S8NA 4OI2A 1JT2A 1RI5A 2KPOA 1L3BA 2ZIXA 3A2MA 4H1TA 2OLJA 4OO3A 4EW2A 1ENPA 1C2TA 3X1MA 3PGJA 4L5AA 2JEZA 4W7HA 1N0UA 2W48A 5DM0A 3ZQKA 1D9XA 1NXXA 1GKYA 2ZTMA 1RDFA 2J4CA 1X1QA 3WWPA 1C1XA 3DGFC 4O2AB 2Q0QA 1T3SA 4U7PB 5CA0B 2VH2A 4TZ6A 3ORSA 4J29A 1QUEA 3AUXA 2B92A 1GRRA 2GK4A 5K6RA 1JVSA 1E2JA 1VSTA 4KG7A 2EBFX 5HXAA 3QLUA 5JSQA 1CFJA 2VF2A 1BJKA 4G36A 1JBEA 3ZW9A 3AR3A 5KAMA 2O05A 2FVYA 1XQWA 2GERA 2QAJA 5JRJA 5GV8A 3WVNA 5JYBA 5F5NA 5LPNA 1YH3A 5DHAA 1ATIA 4N0QA 4U6NA 2QTCA 1KL7A 1NX6A 3GEBA 1ZNZA 3L8MA 2FFRA 2FWAA 4MK4A 5IAEA 4BNUA 5JVDA 3P20A 3D8SA 3QU2A 4V0QA 4B7AA 2OXFA 3H0KA 3OUZA 2B0CA 1PDOA 1VXRA 3T54A 2KHZA 3EE6A 1KMCA 1BMDA 1NUPA 3O4JA 3GRYA 1PEAA 4MCHA 4BP3A 4S05A 2GAFA 2GF9A 1P1HA 3GUVA 4S1VA 4ZI7B 3KQHA 2IWHA 3EBPA 5TQVA 2Q21A 4OI4A 1TTTA 3PPVA 2FEAA 3LHKA 5B2EA 1LQTA 2Z83A 3G0IA 4YJGA 1HDCA 1BDBA 3HGQA 2CNNA 2ZRPA 1CJCA 4MVJH 4WD3A 1J0EA 4JJ8A 4RD0A 1Q0LA 5FBKA 4C4ZA 3AUJB 2AX3A 4HCJA 2H2DA 3D8BA 3DMGA 1RZRD 2XDAA 2JCBA 5AKIA 1GCAA 5T8KA 5DTQA 5U4QA 3NRCA 5SYNA 5K8JB 4DNPA 1XN4A 3AVPA 3C0KA 3JQ7A 5D1NA 1EXVA 3D6MA 3SHFA 3HCFA 1L6IA 1EUZA 3I52A 4F8YA 5FBWB 5CB6A 1W25A 3G0HA 121PA 2FFJA 2YMLA 1HEIA 1C1DA 4ZGGA 1E98A 4DCJA 2YWBA 2FUG1 1ZUNB 2FPGB 2W2MA 2OQIA 1LDMA 4ES6A 5JHHB 1IC6A 4B35A 1OX4A 3ZCQA 1UKBA 4FHZA 1C3LA 3LPLA 4OQYA 5E6RA 1T5TA 2PKXA 2VAVA 3M4JA 2VHQA 3SSNA 1FX1A 4E2YA 4U7JA 4EY7A 1DJMA 3E8MA 1GRVA 1MV8A 3MT0A 4AURA 5MF6A 5EOVA 3ACDA 3R41A 4EZEA 5BV8A 5CBPB 1EHYA 1LY1A 1B6TA 2HSWA 4DJTA 2JVIA 1IZZA 5JALA 3LCMA 1K6EA 3NZEA 4ZI5A 1SY7A 3JWIA 3EGOA 3VDRA 5C5EA 4HAVA 3KOXA 3P2KA 4P86A 1INLA 4IXNA 5FA5A 5JFOA 2ECFA 1LF5A 1PG0A 1V2GA 3MTDA 3IMGA 4CFZA 4QGSA 5KHOC 1C9YA 1OFHA 1G38A 1ADYA 4EO4A 1TUGA 2FSVA 1LH0A 1X74A 3ONEA 1V5IA 3NJRA 4C3OB 4E2WA 4DY6A 5LP6A 2R8EA 3EIHA 3BWEA 3IHWA 1UK7A 3CNNA 4GX5A 1XMPA 4RU1A 2C83A 3I5UA 5FL7A 4UTZA 1I0IA 2I3GA 4O2AF 4OJQA 4PRKA 4DDHA 2FMTA 2GS9A 4DF3A 1DL5A 4BWVA 2CJWA 5ES4B 1TQHA 1Y7LA 2XYVA 4JEUA 3ZVRA 3IEXA 1IM5A 1TYCA 4JV5B 1OKKD 4DILA 3FWPA 3I4FA 1MJGA 1BS2A 1TA9A 2J7KA 1OWLA 3AY3A 3O4IA 3PNBA 1IVNA 2AGVA 4OQXA 3FBWA 3UC5A 3DVLA 4I9HA 4XDYA 1SUAA 3CNOA 3GBSA 2AC7A 1UXKA 4NFHA 3G2PA 4WA7A 1G60A 1Y1KE 3ORRA 1W6RA 4YJ2F 2XKJE 3K6RA 5FQOA 3N0VA 5B55A 3EIFA 4YP7A 4DA0A 1ZAYA 1TJPB 3KSUA 2YVQA 2GCOB 5FPKA 2WHEA 3AWIA 2JLRA 3C6XA 4MR8A 5BWMA 3FNFA 4CKCB 4F8EA 3I0MA 1RADA 3N0RA 4FFLA 1ESCA 3BX1A 5G0SA 3CVWA 3I6IA 1L4GA 1XKTA 4FMDB 3AHGA 4P3PA 4PQFA 2XMCA 5LUBA 1DMSA 2WG1A 4I0WB 3QENA 3KZNA 1OIXA 3UT5A 5KMGA 2BRUC 4M37A 2WU3A 1JQ5A 4B8WA 2QP4A 5BYBA 4YRBA 3GRUA 3RLIA 2P8SA 2WT9A 2BMEA 2JIDA 5PNTA 3UKJA 3KKEA 1JHAA 1MKYA 1GTL1 2LDXA 3UIEA 1RQ7A 2BELA 1NC1A 1A1VA 3CG0A 4HFNA 3WTBA 4OEHA 1DKOA 1LRJA 1N8KA 4DLWA 2J3IA 2WUWE 5LYJA 4RF2A 1N57A 1YR9A 3IAXA 2H11A 2XYGA 3A6EA 3R5KA 5H3CA 3HB5X 3AKCA 5GM1A 5A7GA 2GHTA 3G0BA 5L3QA 2XZDA 1FIUA 2BH9A 5LL6P 1VL6A 4BNMA 2XVMA 4BNKA 3M9WA 4A0RA 5KTYA 2MINB 3VI4B 3GCXA 3K30A 3KC2A 4CEJB 1PV1A 3U16A 3ZU4A 2CHQA 2QUBA 3FRJA 1UOOA 1XRNA 4N3BA 3GN1A 3NBFA 1KAMA 4J75A 4FZ3A 1MC5A 3LT4A 5BUQA 3COJA 2JF0A 1NMQA 2AXPA 1AGYA 2YJGA 1PEKE 2QZ4A 4MI6A 4OQFA 3HA2A 5KJCA 3GJXC 1VFNA 1QCZA 4HYQA 1NF2A 1C7RA 2WV9A 2PL1A 2P6NA 3IUQA 3AVVA 3EFBA 2F9FA 1A2OA 1AKTA 2R47A 3COVA 4YAOA 4U2KA 1FYFA 2VJAA 2X0DA 3T3NA 4D81A 1DC3A 2A0UA 1WKBA 4FWTA 4OKIA 1NN1A 2FMIA 4XWKA 1Y80A 2D3WA 3IVXA 4O2BB 4QU9A 2VP2A 2X42A 3FMVA 1JDTA 1FS6A 1QCCA 5CH8A 2O23A 3ROZA 2PCLA 1MOZA 1SVIA 3R76A 3RJ9A 1W94A 1O0BA 5DBIA 3KD2A 3LC2O 4HGQA 4Z0HO 5CDGA 5B4TA 3WYNA 2OQ2A 3OJWA 4NSNA 4F6RA 4TL6A 2C92A 4BMVA 2ILTA 1EX6A 1HI9A 2ZU0C 3ROPA 1L6RA 4NBRA 3IBFA 5KYTA 1K7XB 2OV1A 1I4EB 1AQNA 3WYCA 3CUYA 1T0PA 3AGPA 2XXAB 1W2WB 1BE1A 5F7XA 1R2QA 3PBKA 1S8AA 2UUAB 2YINC 3CKLA 4C3ZA 1OI7A 4IDGA 4ASUA 4D6XA 3CTPA 1AS3A 3C4JA 6REQB 1E79A 1TRKA 4E14A 1N4AA 3AR4A 4MROA 5CW1A 3ET5A 4TVKA 4NNOA 3TGLA 1XK7A 2BKEA 1KY2A 2G36A 4O5OA 4ILEA 1CRPA 4A27A 3QFTA 4P3XA 1T15A 3DFZA 4Y6QA 4QJIA 2W6OA 2AOUB 5DGCA 4GS5A 3BN3A 2I1VB 4YA6A 1U5CA 4CIWA 5KTRA 3K53A 1YCDA 3KM0A 4TSRA 3SEAA 4YQYA 4K3VA 3GVHA 421PA 4YT4A 1VCHA 2FEPA 2F4VB 1KYTA 1D2MA 1D1QA 1NE7A 1P2VA 1I0ZA 2VDPB 3T99A 4BRZA 1YRQA 4EUFA 1MN6A 3T5BA 4YQFA 5KJFA 1QDLB 2BY4A 4IV5A 3BMNB 1SXJC 2ZBFA 1O4WA 1G98A 2C8LA 3AT1A 2R00A 1U1EA 3AEUB 3DE7X 3MFYA 4I3GA 3SBXA 4D9JA 5ECYA 2J5BA 2NXNA 3OOSA 4DABA 4YUZA 1VPWA 2IH5A 1T0JB 3ML1A 1SQSA 1DTSA 3H19A 4YQEA 3SMQA 2WJVA 1DEAA 3LKVA 1BWRA 2B34A 2GESA 2OD2A 3HXOA 3KQNA 1TUBB 5D5PA 4DMHA 2Q5CA 3UAYA 1G8HA 1IONA 2V7WA 4GYJA 5DN6A 3OE7D 4ZDJA 2QTZA 5J4HA 5J4YA 2QJFA 4B3CA 4I9NA 3UH0A 1PAUA 2P4UA 4IEFB 5JMWA 3OEHA 1HNXB 2BV3A 3QKRA 3FH0A 1NDQA 3W2HA 1W93A 3ZDDA 1BH6A 1NUTA 4TS1A 1RBZA 5K3SA 2CEAA 2PSEA 5KYGA 1P0IA 3C3BA 1MEEA 2J3MA 2OGUA 2WYOA 4L3VA 3DEYX 4WY2A 3UVEA 1OH8A 5A0TA 4QDUA 1FOEB 3OIYA 3KQKA 1QK3A 1BHO1 2ANBA 3E9RA 3A11A 3EDMA 3IR5A 3OBBA 4UU0A 5F7JA 2GYYA 3HB7A 4C4XA 5B3LA 5KYUB 1Y42X 4OLHA 3H2JA 2XD9A 2Z1MA 1VGRA 4NCXA 4OQNA 2POQX 3DAOA 4P3KA 4RF3A 2FZKA 3DJFA 3H5VA 2AJLI 2XV1A 3KETA 3QNWA 2HCJB 4FDAA 1DAKA 4HJXA 1JALA 3SZ3A 3SIPA 3THYA 1R0LA 4B85A 3TLAA 5IK2D 2Q2WA 4H7EA 1OI3A 1ZONA 2QN9A 1CDDA 4UM5A 5SYAA 4CEHA 3SBDA 3KUDA 4OB7A 2G40A 4J1TA 5KYWA 1ZISA 2GJ4A 1K7SN 1TIBA 2BKXA 5DM70 1COWA 2AQIA 4OQZA 1T2FA 5EZ6B 3ZHTA 5IXSA 4Q4HA 3VO9A 5AKGA 1X3SA 5IKPA 2O0KA 4BLRA 4IHKA 1SCUA 3CJRA 2QM0A 4N01A 3M5CA 2MMCA 3M81A 2O48X 5LB2A 3CYFA 3R75A 3S55A 3KHKA 4PX3A 1ULAA 3LLMA 4ZYZA 4OMUA 5ARDA 1VGQA 1R15A 3MELA 3KYJB 2VTKA 4E12A 3ENZA 5ER9A 5HFNA 1LQ2A 1YQWA 1G6OA 3RIHA 4BNTA 4DCVA 1MO4A 2RI0A 1Q0HA 1T36A 1EDDA 1FFCA 2XE4A 2PN1A 3I2IA 3OWHA 5JSUA 4B4OA 1V16A 2G5CA 3DD5A 4ZOLB 1HMPA 2DH5A 2CE2X 2DMRA 1J8FA 3GP8A 1HFKA 2B5WA 3OURA 4YWJA 3KR2A 3AIKA 2W6NA 2GPNA 4EG7A 1H5NA 3QM1A 4MUGA 3AFNA 3IAUA 1IHDA 3GYBA 4D9FA 2PMCA 3ZKWA 3QGMA 3WL5A 5L8VA 4DPMA 1HDGO 3UV6A 1UJMA 1UJ2A 4OSOA 4LHZA 4O4LA 4YDQA 1TM3E 3PXDA 3IJPA 3LC7O 5I7WA 2QUHA 2CNBA 1HF3A 2HSZA 2HC9A 4ALLA 5K0TA 4BV9A 1L5YA 3N5CA 4QQ8A 2J5KA 4B3BA 2MSNA 4X9XA 1QYCA 5KDOA 1CRWG 4BCDA 5HKLA 1AQYA 1QHEA 3ZLUA 4NZZA 2QSUA 5EKUA 2I4TA 4DSAA 2QPTA 3PFWO 1UWKA 2ZWMA 1RHKA 3H3XA 4FU0A 3RBZA 4QD3A 1GKLA 1M5UA 4JSYA 1P1BA 3F49S 2G28A 4IRXA 4B34A 2KMLA 2Q3JA 5ELMA 4RS3A 3EXHC 1LF0A 2WHXA 3CH4B 3S7ZA 4KFCA 4MJXA 1L7XA 4PLGA 1T43A 2BMJA 2ZDHA 2JK1A 1B0AA 2DFPA 1A88A 1UL1X 3OOEA 5LSAA 4DUYB 4G5YA 2O8BB 2HA4A 5KPDA 5K09A 1ID8A 4HG2A 3G9QA 3KB2A 1ZSVA 1PKEA 4PIPA 3W5HA 1Z2OX 3L93A 2ETXA 4GVPA 1XJCA 3LOPA 1PJ3A 2WF9A 3G2MA 1OI4A 2DPXA 2YW2A 3B5IA 3C5CA 4JBGA 2PUBA 1PL6A 4YMLA 3JQBC 2R79A 3VR4D 1YFJA 5ECGC 3P9KA 3E84A 1RXIA 2TMGA 4MYSA 5TEVA 1TJNA 4NH0A 4KXVA 3MRXA 3K2EA 1EUQA 1LC0A 5BOSB 3FRHA 3K9HA 4V1CI 4Y67A 3PHGA 3NVMB 4ZVVA 2QD4A 1F12A 4UOZA 4LW8A 2VYNA 4QKQA 1TVEA 5DI9A 1X8LA 1VYVA 2KQUA 4X1YB 1E2KA 1XU4A 3VPSA 1BKSB 3O8QA 4BKPA 3I6BA 3U9LA 3HJTA 1JI3A 1ODLA 3C87A 3AFOA 4UPDA 2ZAYA 3GZTB 4UNQA 1C3EA 3EWAA 2XIQA 5BWNA 4QFMA 1LGYA 2VHVA 3HYRA 1QZTA 1PO7A 1L5WA 2C4VA 3AV0B 1WBBA 1LLUA 3H97A 4WOPA 4C6HA 2GO1A 1ECGA 3BHJA 4B6SA 4Y0NA 5ESXA 1U0TA 4CDNA 1NTRA 3AB8A 4DIKA 1UMBA 2GZ2A 4H08A 4V24A 5FTJA 2JPDA 1E7SA 3V34A 1GZ3A 3EMDA 3IB6A 2CVOA 1NYRA 1QIJA 3OZ7A 4QXQA 5JECA 1V4BA 2MYPA 3VR3D 3OE5A 3P45A 4X3CA 3RFCA 1U2DC 3LE8A 3MUNA 4QVGA 1FS5A 1M1ZA 3SC3A 1EFUA 2OC9A 4I4TB 5EZYB 5KAPA 3VVLA 5B4VA 1EP1B 1QHXA 2ZJOA 2FRXA 4KACA 1BW9B 4X00A 2VATA 4FEYA 3IAM1 1KAOA 2VBFA 4PR3A 2ZYDA 3TQFA 1PQ4A 2LKCA 2P8JA 2GZAA 4Q4DA 2H3EA 3ZE0B 4BX9A 3RS4A 5F3WB 1XKQA 1XWFA 3CZMA 3U5ZB 4BNVA 1US8B 3U4MA 5C46F 2NUTB 2CLSA 1ORHA 2VRCD 3NBKA 4GQBA 2ZAMA 4XB2A 3HBLA 3WWOA 5HEKA 3VR5H 2IDKA 2OO5A 3O9ZA 4WDQA 3REQB 1XDBA 1G6Q1 4GNRA 1RAIA 4OI0A 5LOVB 2BHSA 2AZDA 2WIKA 3MPOA 1TZ2A 1BEEA 3HR4A 1ESZA 2Q4BA 1QP7A 1L7OA 1NXPA 5CLHA 3UA3A 4NBUA 2Z4SA 4Y1FA 5DLPA 2GF0A 4QPZA 5LBTA 3BXFA 3I28A 3I9V6 4Z4HA 4JLJA 1U2GA 4IZ6A 3HH8A 5DBOA 2BP7B 4YRAA 1TM5E 2B8WA 5BY2A 1T5SA 2VYQA 3GDGA 4GXRA 3RARA 3MGKA 3RSSA 1RI3A 1QTRA 2EZ9A 4FFBB 1QH1B 3P7MA 2O8FB 4HDRB 5A0VA 4RVNA 3AF4A 2HWKA 2NGRA 1ZL2A 2NG1A 5DO9A 2QXUA 3M9XA 3TLKA 4EYQA 4EPRA 1L4UA 4PSVA 2CLCX 1EWYA 1FX0B 2MSDB 1VMEA 1F4LA 3FFWA 3WOHA 3RHTA 3PQ7A 2J0UA 7ABPA 3I62A 5REQA 3DYBA 1BA3A 1CUAA 1J8QA 1QB8A 2QN2A 2IK8A 2PQ2A 1G8PA 3F5SA 4HYYA 1XD2B 4CM9A 5JROA 3RV4A 4RD2A 1LPAB 1EDZA 1TQ2A 1NVVR 1TB4A 1W44A 1QORA 4HNQA 1ZYUA 3QV2A 3D2AA 3A9CA 4YMWA 1FNNA 3PJFA 4TTIA 2JLCA 1VOTA 2VNAA 1EK6A 1Y89A 1DXHA 2UZAA 3K7EA 3VTZA 3GEEA 1FSPA 3ICQB 3QEAZ 1PG5A 4CCAA 1BDJA 3EUAA 4MULA 2P9FA 1E4OA 1FF9A 4BASA 3U09A 3LC0A 4MVJF 2HU7A 2OGWA 3IJRA 2JFBA 3H2ZA 3GI1A 4I3HA 5KS2A 1LDYA 3U40A 3HXPA 2YTZA 1LI5A 3T1VA 4CW7A 3PIDA 3EZ7A 2VQFB 1EXWA 3LW7A 1M1XB 2RH9B 3UMYA 1FVFA 2FEKA 1Z4KA 3AHEA 2JJ8A 1MHPA 1Q7BA 2H0AA 3D4OA 4FE3A 5H5JA 3V7FA 4KPEC 1XZGA 4G5XA 3QF4A 1VLZA 4BO0A 1Z22A 2GM5A 2ZCVA 3EN0A 3L2OB 1KFJB 1N5MA 3MJCA 3SX4A 4C89A 1Q12A 1SXIA 2HMVA 3ND6A 3WL6A 3DEJA 3ZYCA 4A8JA 4BFZA 4E5PA 5A9TA 5FV7A 5D7NA 3GVIA 4GZ3A 4IBOA 4CI9A 1WY5A 3MSCA 3OZIA 4FJ0A 4IZHA 3HLTA 4L0MA 1Z3IX 1UBGA 4PX5A 3S68A 3STHA 5C37A 3V9PA 3GGOA 2IKSA 4J03A 3ZGOA 3TEFA 1H9CA 2UUCB 3G1UA 2YUTA 2HHHB 1UR5A 2BZSA 1O57A 2PT7A 2XMDA 3QBEA 2XUDA 1TPZA 5A9SB 1KFKB 1LX6A 4GSYA 3TIFA 1RPZA 5ERGB 2V7XA 2CMFA 3MJSA 1GNRA 5ED0A 2RB4A 3TMAA 2FR0A 4BQFA 1F0PA 3HSKA 4X97A 1GG8A 5LQAA 1H8EA 1CUWA 1K4YA 2FSIA 3A1FA 3EDCA 2CXUA 3M34A 3OT1A 3FSEA 4TT3A 2EX4A 3TB4A 2JHCA 2EHJA 2G76A 4B79A 4DANA 2ZVDA 5KQRA 1KWKA 5FOSA 2YASA 1Q50A 3DAHA 2EKLA 4EB6A 3ABRB 3PUYA 4K0KB 3GJYA 1QG4A 3CRQA 3LPDA 4YJDA 5D87A 4G1CA 4M1YA 4O2RA 4AMZA 4F84A 5LOVF 1QO0D 2CY0A 3QX9A 1AQJA 1WQ4A 2CW5A 2FEWB 2RHOA 3VKVA 2WF8A 3VJLA 3IP9A 1D1SA 3SZOA 1QKKA 3WYEA 4K9SA 1GIAA 1XMVA 1NDUA 3QPBA 5I9SA 1JWBB 5E7MA 1MB0A 3PD1A 1N2XA 2I71A 4L27A 5MN5A 3NAGA 4LRQA 4A9AA 3F1LA 2JGAA 1JJIA 2HFKA 2RHTA 3CUTA 2I7XA 3OH8A 3A26A 1IPHA 1QGDA 1U3FA 1X70A 2QLMA 4TYNA 3DWGA 2EJUA 4LGCA 3RBAA 4NG5A 1W29A 1Y0BA 2A9VA 5FNVA 2NOAA 2O8NA 4QQNA 1HX7A 1HTWA 1P33A 2ID9A 4JP3A 4U7TB 1NOIA 1XG5A 4MUFA 4WQMA 2VQEB 3A1NA 1LK5A 1P3DA 4NG4A 3SOPA 4ZDWA 4J0FA 3SIRA 1F3OA 5ADUS 2ECQA 2O1WA 2Q3CA 2EKQA 3ZJ5A 4DPLA 1UEXC 2AW5A 2JC3A 3OZXA 4U7WA 1DUSA 3U49A 2V5VA 3WRYA 2GK7A 4KBFA 3RH0A 4B7XA 3RS0A 1VHJA 3TZKA 4P33A 1YB5A 3B1XA 3W78A 4KHPB 2YNMD 2ZR7A 3Q1LA 4J8PA 3UKOA 1PS9A 2HGSA 2YBDA 4WN9B 5EINA 1ELOA 4HPJB 3V4SA 2EW1A 4RV4A 3ZZ1A 4EL5A 1GPJA 3ANNA 2VAXA 2GEJA 3EGXA 4J0HA 3SSMA 3ZVMA 4GF5A 2POCA 2VT6A 1BFKA 2BBTA 2I8CA 3O21A 5C35A 4AJLA 3CEMA 3VZRA 4AZ3A 2DF8A 2FLKA 2EGGA 2OHHA 2V97A 1BOFA 1G21B 2JFPA 5LU8A 3M6VA 2DR2A 4PGAA 3AY0A 3AOEA 4I99A 4S35A 2H0RA 2QV7A 1P1JA 1FU7A 1NFFA 2KM1A 3DLTA 3R77A 5DIFA 3U4GA 4CCYB 4MKIA 4CUKA 4EHHA 4R2LA 3QVJA 1IUKA 4HB2A 4IIUA 1XUOA 4TWIA 4NU8X 1SVSA 3D31A 1W73A 4OHPA 5EIEA 4UBNA 4YY3B 1GYPA 1U0LA 1UBKS 4XQCA 1C2YA 1WLSA 3ZI7A 3QBTA 1XRLA 4GPTA 3ZVLA 4DG5A 4EMSA 2VBIA 1O9GA 3KTAA 3QVLA 4HZUA 4WCFA 3WMGA 1XCPA 3FG9A 4LF9B 1XVVA 1FJGB 2C4TA 3K9FC 5LM3A 2EFGA 1ZK3A 3AM4A 1I7DA 1ORIA 4K6GA 2ZRDA 4DBVO 1PDVA 3L1HA 3F6CA 4WZAA 4JASB 3IURA 1YZHA 1CNMA 1VKHA 2G5PA 3DEHA 3I0NA 2O1EA 3OF2A 4MPDA 4XEHA 3VO8A 1ABEA 1Q3HA 3O4FA 4G5FA 5CB4F 4LTDA 4X62B 2C9DA 1O58A 4J9VA 3CLUC 1Q16A 3ECAA 1F2TB 1DCTA 4TXLA 3TW0A 2NTNA 4CT4B 4L9AA 4QASA 5JMPA 3DA8A 3CKMA 3UHFA 4WKOA 1X94A 4OK6A 4KXMA 2Q1UA 4X94A 2C2YA 3RNOA 4DCPA 4COOA 1UKZA 1HQYE 1I33A 1RJ9A 3A58B 4XR4A 5DGDA 3IA2A 8ADHA 1UQUA 1YS4A 1X19A 3E81A 4ZYTA 3CS3A 1Y3FE 5AIAA 1D09A 2R7KA 3U26A 2D2XA 3VH2A 1Z15A 2QRQA 2HDHA 3VU9B 2Z6QA 3UQYS 5T57A 5B5SA 1XD8A 1O54A 2H1SA 4BFXA 1J5PA 2O2HA 4WOCA 1RXWA 1UT6A 4G0VA 1QGUB 1J99A 1G9SA 2C78A 2CLLB 4MV9A 3WNCA 2Y8EA 2ZI3A 1LC3A 4IX9A 1PJRA 2YYZA 3DCJA 1ODKA 3SVLA 1J8YF 4BVLA 5K2OA 2GAJA 2VYVA 1DEKA 1X7HA 4P83A 2VNSA 3HDHA 3D5QA 3TS1A 1V0JA 1DJPA 5L4SA 1PT9A 3T1OA 1YFZA 5CD1A 4AJJA 3GGGA 2YVUA 1SBIA 4WFIA 1EBFA 3FKSA 2J9ZB 3K8QA 2WJJA 1SHJA 2ZBQA 2OYCA 3PJRA 2GEVA 4URWR 5ALHA 4E6PA 2AUNA 1F38A 2RAFA 1BA2A 1F4PA 1UOEA 2HEIA 2QN7A 3DQPA 4IG9A 4R6XA 4RQAA 3PCXA 4ZEOA 4XXHA 4DNXA 2H1OA 1NBMA 3CUVA 1S5PA 5H83A 4G81A 4FVTA 2B21A 4QBKA 2XDYA 3UQZA 2OFXA 3E22A 4WZBE 4BO1A 1TAUA 2VEDA 4DR6B 1E4EB 4ZT2A 1V41E 3N0XA 1KK3A 4HDSB 3RYHA 1NBEA 4YR9A 3FM9A 3CWQA 3ZWPA 2XSZA 3VVBA 4Q24A 4UNIA 4F9FA 2R96A 4EG8A 4TTVA 2PUTA 3O95A 4IYRA 2O1SA 4MVJD 3BRQA 1SO8A 1PFGA 3NBAA 3BK2A 1X6VA 3DHVA 4QX6A 1SZDA 4YACA 4A8PA 4TMTA