5DHFA

Crystal structure of hrio2 nes peptide in complex with crm1-ran-ranbp1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
205
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dhfA00
1IOZA 5KUTA 3OIVA 3L0PA 1E79A 4BLQA 1E4VA 4HLDA 1W36B 3K8YA 2FJUA 4LRWA 3TSZA 2IWRA 1MT0A 3W6OA 4XTRA 3EZ6A 4W5JA 4JZKA 2Q3FA 1COWA 2AR7A 2FX3A 2J46A 5CDFE 2G0TA 1QHHA 2E9SA 4JL5A 2OE2A 1QHHB 2V54A 4BEBA 3D6TB 3AVUA 4KBFA 4LJ6A 4OHYA 2QRNA 3CR7A 3GEHA 2ORVA 3CLVA 1DE0A 4QGAA 2PJRA 1XCMA 3CRQA 3IQXA 3X1WA 4URVR 5HKKA 1DADA 1RRFA 3L43A 4DVGA 2QGNA 4GP7A 2BMJA 3THXB 1IQPA 3K0CA 2F9LA 5FBLB 2V1XA 4TTQA 5FOWA 3SNHA 5CYPA 4EFMA 4B74A 1UDXA 2HDNB 2Z6VA 2C9OA 4TLBA 4TL6A 4HDOB 2JLRA 2QTFA 4KJZA 3QXCA 2WMOB 4YQFA 3QXSA 1VHLA 4CEJA 3FE2A 3IILA 2BJVA 4Z51A 3SFVA 3QY0A 1WB9A 1MKYA 4KFUA 1XD8A 4GZLA 3QPUA 4DLVA 1C9KA 5FI0B 3VR6A 4TL7A 3A37A 4JYCA 1LY1A 1SVMA 3C7KA 3TAHA 3H4MA 4FWIB 4P4SA 2REOA 2W2VA 2RGCA 2JLYA 2NO0A 2WIAA 3QVVA 3GJ6A 2ORWA 1ZCAA 4CDGA 1S1CA 1KI6A 2OM2A 1B0UA 4B3GA 1FNMA 1VMAA 2V9PA 4W7SA 1Z0IA 4TSFA 2HT1A 5FTLA 3IDQA 3THWB 5LD2B 1TF5A 3GJ8A 3B60A 3GQBA 3VU9A 1ZNXA 2NO7A 4LY6A 3W34A 5GJBA 4AYTA 2VH5R 2BM1A 1UPTA 3CX7A 2ZVQX 1A2BA 2GCPA 3AKEA 4DDVA 3UATA 2KWIA 4KO8A 1Z5ZA 4P33A 1M34E 1G3RA 1OIVA 4EPRA 4CGZA 3SYNA 2CE7A 4TT3D 4CVNA 3AVWA 2OZEA 3FMOB 3PUYA 4M1OA 4AYXA 2JEOA 1ZMXA 2P67A 1W0KA 4FMCB 2GXAA 1XTSA 3AUXA 5FL7D 4K8OA 4PQFA 2VRWA 3EAQA 2YZ2A 1GAJA 1XD2A 4ZKEA 4D81A 1OIWA 2W6JD 2AWNA 2ZUBA 4L15A 3RSOA 2F1RA 1SXJC 4URYR 4BFYA 3EIEA 4QC2A 4N0EA 4D4LA 4C7OA 5DI3A 5DI3B 1NMYA 1VG9B 1U0HC 1Z6AA 4H1UA 1UKEA 1G8PA 2F1IA 3F3YA 1XMVA 3QUSA 4A0GA 2ZYTX 4MUAA 4B3DA 2IYRA 5AJXA 2ZRCA 4F91B 1G4UR 1P9NA 1MRNA 4JJKA 4HUQA 4LK2A 2P65A 2QBYB 1NBMA 2ZRDA 2JJ2A 4K46A 4M1WA 3WHKA 1T6NA 1VCMA 4IDQA 4OHWA 5K8LA 2IS2A 2HEIA 2I4IA 4Z1MD 1H8HD 2QE7D 3HDTA 1CJUC 1DAIA 4H1VA 4F4IA 5FOVA 5FUYA 2REBA 4NCKA 4HUTA 2ZJYA 5M04A 2AXNA 3G82C 1N5JA 2YC4C 4R2IA 1CRQA 4YLGA 3UKDA 121PA 3E5HA 1YZQA 1UM8A 2P5SA 2HUPA 1J90A 2C04A 2B8TA 2HCBA 4WAUA 4OQNA 4RD6A 1KDTA 2J3EA 4LV8B 4M1MA 1P2SA 4CEIB 1NBME 1OE0A 2CLSA 2EFEB 1VECA 1DAEA 5BYJA 4BLSA 1FQJA 2H17A 2P5TB 1GM5A 3R9IA 2J7KA 1YZTA 2H8KA 3U4QA 3LBHA 3LLMA 1E2MA 1JJVA 3KUCA 2PX3A 3KUDA 4IHQA 3BH6A 3RS2A 3NHBA 2JDID 3GJ3A 3I32A 3S1AB 1QVAA 3LNCA 4HB4A 2B7CA 2QROA 1DOAA 4LGMA 3U6KA 2RGNA 4UKDA 5L3SA 5L3SB 2NIPA 2VP4A 1KK1A 1NLFA 4BPBA 1SQ5A 4ITRC 3U7EB 3SBEA 1XPOA 2JLUA 2BCJQ 4RFSB 4PXAA 1WE2A 1MH1A 5JEEA 1FX0B 1XF9A 1KO7A 1OKKD 3MSXA 3Q7QA 2IXGA 4IKEA 2ZI5A 1PV4A 1PLJA 3B5JA 1LW7A 1BMFD 4MRRA 3K09A 4Q19A 1SVWA 3SJBA 3V00A 4DT1A 3ZDQA 3RS0A 4PSVA 4IW3B 3U3RA 2BMFA 4I1OA 5EJEA 2CK3D 1IJEA 1ELOA 4QBFA 4TYYA 4Z54A 2ZRKA 4EPVA 2OLKA 1GIAA 4M0LA 5G3ZA 4UQOA 2QENA 3A1SA 3EXAA 1F60A 1FUUA 4RVCA 5CM9C 4DSOA 1R7RA 5GADl 5KO2A 1OH5A 1ZYUA 4M22A 3Q72A 2VHCA 1ZVQA 3AGPA 1TADA 5KSYA 3X2SA 4I1VA 2R6FA 1O3YA 1E2PA 2RGDA 5DH9A 3V4RA 2V3CC 5TMPA 3B6EA 5ELXA 4A4DA 5BW8A 1N6OA 1UBCA 4QGHA 3ZS8A 3GFPA 1S3GA 3PFIA 3SDZA 3FKSD 4PSKA 1W48A 4Q18A 5CB8A 4D4KA 1FNNA 1P60A 3T35A 2OXCA 3BFKA 1LNZA 3IHWA 4R7ZA 2G0NA 2OLJA 4V03A 5DLQC 4B6FA 4DJTA 5HKKD 1G8YA 2BC9A 4PHHA 2LCFA 2DFNA 3U3JA 2ZXUA 1NSTA 3IPXA 3TW8B 1IM2A 1OH7A 1KSJA 3U3OA 3Q5DA 3CPJB 1IN5A 1XFAA 1ONBA 2XXAA 4GMDA 2XXAB 1ZC4A 3G5UA 2VO1A 3K0AA 3QIAA 3K0AB 3SJZA 1XMSA 4I1SA 3DM9B 2GHIA 5FOTA 3Q9LA 1F2TA 2VQSA 3EASA 4PZLA 4ABYA 2V55B 4IOLA 1HV8A 2F1JA 4Q48A 4D4MA 1PLKA 1WP9A 1P2UA 1EFUA 3DL0A 1KSHA 3LW7A 2RHDA 4M9SA 1KDOA 2D7CA 3QPWA 3WYGA 4AG6A 4KYIB 3EWAA 2OG2A 4M9ZA 1HUQA 4MYCA 5J4HA 2IS6A 1FQKA 821PA 2Q3MA 2C9CA 2UVQA 4D26A 1TUEA 4JBXA 4EKDA 3HU1A 4YDSA 2W2XA 2GTPA 3ZQJA 5CLQA 1R2QA 1Z0AA 4PFSA 3V9PA 1P2VA 2QI9C 4HB3A 5JI2E 2Q21A 1DVRA 3LRPA 4D80A 4EPWA 4ZCMA 1JBKA 4A6PA 4LBVA 4KU4A 3C15C 1AGPA 1MV5A 2CBZA 3FGNA 3AH8A 4B2PA 2ZE8A 3C5HA 3LQRA 2VP2A 2XTZA 1SVKA 3EC2A 4FW9A 1QHGA 1YVDA 3VMFA 4ON9A 1JNYA 1G1MA 2PT7A 3A36A 2KBFA 5F9FA 4D0NA 2VL7A 4UXJA 4OL0A 5J4VA 2OXRA 2B7BA 2PJZA 4NCHA 1IY2A 1LS6A 2BEJA 3GLIB 1G5TA 1E9SA 1GFIA 3VX4A 4D2IA 4OHXA 1L8QA 4LV6A 5EZ5A 3KKPA 1Q1EA 1SVOA 5IK2A 4BLOA 1G64A 1EFCA 1N6RA 2CLDX 2G3YA 3AP1A 3AVOA 1KKMA 2E1RA 2ZR7A 3CX8A 1U9IC 1YRBA 1II0A 4KLNA 1ZM4A 2FFAA 1J99A 4FMDF 5FBVB 4TLAA 5E3HA 3KDSE 3W3AA 4LHZA 1E4YA 1L2TA 1JR3A 1N3BA 2AN9A 4OI1A 4MUBA 4BFUA 3ETLA 5IHPA 1SXJA 4L9WA 5J47A 2QY9A 1Q1ZA 1DAGA 4EQ6A 2O8EA 2H92A 4RCZA 2XITA 4EQ6B 3GLIE 2QPOA 3L0OA 4C4PA 2EFGA 2D3WA 4P0TA 3ZVNA 2ORIA 2ZSDA 5CM8B 1N6LA 5DIFA 3ONWA 3SYKA 3OEEA 4PPGA 2KBEA 1FL9A 2AD5A 2I1QA 2W0MA 4XVRA 3KKNA 1KZ7B 2I1VB 1W4BA 2GILA 3B8HA 2O8FB 2ZRLA 4LYJA 3WYAA 3LXRA 2RCNA 3SHFA 2VSFA 3KQHA 1W36C 1M7GA 3B7GA 5EXPA 3GCGA 2R6AA 1NG9A 3B9PA 5D3QA 1BYUA 1OPXA 2DR3A 4PC6A 4AD8A 2F3RA 3VR2A 5TY0A 5LDDC 1U8ZA 2XSZD 4XWOA 1UADA 2CDNA 2I3BA 4OQXA 4PO9A 1GTVA 4FCVA 4NHOA 5FPYA 4P4TA 4Q03A 5E7JA 4B71A 4KYUA 4YXWD 2HJGA 4L5BA 4DLUA 2AL7A 1N6KA 4JLDA 2HYIC 3FFBA 4B73A 2JA1A 2FSGA 2C78A 1IJFA 4FCWA 2QZ4A 3CO5A 3MWYW 5IDVA 4PPQA 3P4YA 4Q1DA 4DHEA 4C9BA 1W4RA 2DWPA 4JLPA 4B3FX 3PEVA 4OQMA 1Q22A 3UMRA 3BH7A 2GZDA 4LJYA 3K0SA 1SKYB 4URZR 3MRSA 4NBSA 2PZGA 4CF7A 4NONA 1SZPA 1YZUA 2ZETA 3CIOA 2J7PD 4DWJA 1G5PA 4DLWA 2N1BA 2R6CA 1RRPA 1GP2A 1S96A 3B78A 5D3MA 1T9HA 3L0SA 4B44A 1DBSA 2WKPA 3FHCB 3LV8A 2AK2A 2RH5A 3TVDA 2O8BA 1U94A 4Q21A 4AK9A 5TV2A 3BS4A 4U5XA 2W0SA 4FCTA 3NDBB 1P62B 2OESA 3PQCA 5FPKA 2GK6A 3TSOA 4ASUD 2XZOA 1CEEA 2FU5C 4M1YA 3KZ1E 3BH0A 1VHTA 2GWHA 2KJQA 2ZJAA 2ZI9A 1J70A 2ANBA 1US8A 2VBCA 3IEUA 4B35A 4Q7KA 4IOKA 1T3SA 5LD2C 4L16A 3TSWA 1E6CA 3AM1A 3OEHD 2WBLC 4RCYA 1I4TD 3UG6A 2OEPA 1Q20A 2ZJ5A 2DY1A 2VLIA 5FBRB 1XU4A 1OIXA 4DC9A 4AKGA 3BJIC 2KSQA 1E2IA 4NCJA 2FN4A 5B2ZA 4UNNA 3AEZA 1E9DA 3CW2A 3THYA 5E4FA 3THYB 2GXUA 2ZRMA 2CVHA 1RFLA 1DAHA 1E0JA 3BK7A 3E1SA 4Q7JB 5HCIA 2IWHA 3WNCA 2IS4A 4HZUB 2ZI3A 2PT5A 2EU8A 2IEYA 3KB2A 1NIJA 5G40A 1SVIA 4OK3A 3RWMB 4TMTA 3BGWA 4V0ME 5C4GB 3LX5A 5KOYA 4PO8A 1EWQA 1G291 2FZ4A 1XWIA 1M8PA 3ZIAA 4NMMA 1NG1A 4A92A 1NI3A 1QHXA 2IYWA 1VYUA 1XNJA 5KYKA 1G6HA 4Y0VA 1GILA 3GEEA 5BQ5A 2R2AA 4Q4LA 4MKHA 4IOMA 2NMVA 3MUFA 1IY1A 2C98A 3ZD6A 1XZPA 2ZYUX 2HF8A 2BOVA 1PVOA 4PZYA 4WW0A 4S2EA 3W5JA 4TQUS 1OXSC 1XJCA 3PCRB 5A4JA 4EPXA 1KMHA 2Q6TA 4QHYA 3T5DA 1JXMA 4RFVA 4AURA 2G88A 3GJ5A 4QG7A 1FFHA 5AR1A 3QSYA 4PZZA 2ZRJA 1ZIPA 1U90A 2XNDD 2GZAA 4F93B 4PANA 4RD2A 1JQJC 3SQXA 2V6JA 4ZI2A 4LPSA 3LH5A 3ICQB 1CLUA 5JEDA 2WOOA 4EPYA 1N6IA 1CJKC 4RZ3A 5FTJA 5GJWC 4PHFA 4Q9KA 4DCTA 4TLEA 1E96A 2QT0A 3GLGB 4OHVA 5EP3A 2VA8A 2IYVA 3VHLB 2QQEA 1CR4A 1CJMA 4PR0A 3LQQA 4M4SA 1OHHD 1KO1A 2GJSA 1Z0JA 1KI2A 2IF0A 1Z8FA 2R8RA 4RJLA 3GEIA 5IK2D 4A0RA 5HR5A 1N0UA 1VCNA 3P4XA 2YNMA 1OYYA 3TJZA 2QU8A 4JL6A 721PA 5L3VA 4HLCA 3KQUA 2NTYC 3MWKA 2VHTA 2ZQ5A 3AF0A 3CBQA 3B2EA 5C2JB 3QXJA 1SXJD 3GLGE 2ZRNA 4B2LA 4LC1A 2RAPA 2B92A 3CPEA 2QEQA 2YWEA 2PEZA 3DHWC 5DO9A 4DLRA 3KKOA 1N2CE 4DDUA 5CITA 2ODEA 1P2TA 1S1MA 3LA6A 4MGYR 3NTUA 3OEED 1KMQA 3GJ7A 1QBKC 2QAGC 1U9IA 2G77B 4LPKA 3D3QA 3AVYA 2CMKA 1Q21A 2PL3A 2ZR9A 4KCGA 4PHGA 4MDFA 1F2UA 3JVUA 2ONJA 1H8EA 2QMOA 3REGA 4JMPA 4BEJA 3CF2A 2XB2A 4Q1AA 5EZ6B 2GJ8A 2IYUA 1QHIA 3QXHA 2ZREA 3QKUA 1KK3A 4AG5A 1YQTA 4LDJA 3TLXA 5CDFA 3THOA 1I4DD 3KXLA 1YZNA 1EK0A 2WV9A 3ND9A 2ZRIA 4URXR 2ZU6A 3W90A 3WP1B 3FKQA 2ZIAA 1ZUHA 4NCNA 4ZDJA 1W5SA 1KO5A 1U0JA 3K1JA 2IYLD 2GK7A 3OF5A 2IHBA 1SHZA 3RS3A 2WPDD 4BZXA 4IDHA 3PG5A 1XMIA 2PBRA 3UWOA 4TWZA 4BECA 4D0LB 2X8AA 2WIBA 1CU1A 3R9XA 4JKIA 2KI5A 2DCUA 3NVAA 2WWWA 2A2ZA 5DI9A 2G6BA 1XD9A 2VSOA 2ERXA 1TAGA 2IUSA 5HE8A 2J59A 4Q1BA 1LVGA 5B58C 1LV7A 1AGRA 1Q44A 1DS6A 1AZSC 3NBXX 1N6HA 4Z8XA 4Q4AB 1KI7A 2RGAA 4M9XA 4HAYA 1M7BA 3K0FA 3K0FB 4F4CA 1E2DA 2F43A 1ZJ6A 2F43B 4A6XA 4GL2A 2IF2A 1RVDA 3VNVA 3U7GA 3MWJA 3LAWA 1E2HA 2DWQA 1XCPA 4II7A 4CT4B 3THXA 1Z83A 2YOFA 5C4MA 3CWQA 5EP1A 4LCBA 2QSYA 2FPMA 3BB4A 1E9FA 5JJKA 3W5IA 3EPKA 2FZLA 3KTAB 4RZXA 3FMIA 1M2OB 1UF9A 3CUEF 3OFNA 4KXFB 1G21E 1FP6A 4Q1CA 3I62A 2QSZA 221PA 3R20A 2IXFA 2IX3A 2QMEA 1VKJA 3BB1A 5L3QA 1BS1A 4D82A 3GD7A 4EAQA 5L3QB 3JZMA 1B23P 5TB5A 5JFGA 4IDNA 4MRSA 1XP8A 1Y3AA 3FWYA 4XD7A 3O8RA 1G17A 2GVDC 1MO4A 4ZV4A 4A9AA 3MD0A 3AKYA 3ZVLA 3QOFA 2HF9A 3HYRA 4LWZA 3N5CA 4MGZR 4DEXA 3OIWA 3QNUA 1QVRA 1GG2A 4Q7LA 2ZJOA 1Z22A 5TXGA 4KI0A 4DB4A 5BYKA 2IYTA 4NYJQ 3KJEA 2WJIA 5DN6D 3THWA 3QG5A 1J7KA 4LJ4A 2IA5A 2OO7A 4QHSA 4V0NA 4GNKA 3NIBA 5C18A 1L7VC 5TDHA 3QKRA 3EW9A 3QKRB 5CLLA 3QXXA 1XDBA 3VHXA 5FH9A 1PUJA 3T1TA 3C14C 4C0LA 4S35A 3MG9A 1NP6A 4ARZB 5AK0A 3SU8A 1JR6A 2OBMA 4LSGA 4XIGS 2ZRFA 621PA 5FOXA 3EZ7A 2JLSA 4UNRA 1R5NA 2F1HA 3LLUA 1G3IA 1QG4A 4P31A 1G19A 2DHRA 4MYTA 2Z83A 3IO5A 4JLOA 1NN3A 4LUCA 1GL9B 4U00A 1CP2A 2AFIE 3T12A 2DB3A 1OJLA 3K70B 5G41A 3IO3A 3RHFA 1XEXB 3LXXA 2P6RA 1HTWA 3KX2A 2V6IA 1GNQA 3P27A 2WTUA 2AHOA 1E69A 5FUVA 4DXAA 4D6PA 4DBLC 2A5GA 4MGIR 1KO4A 1KSGA 3TIFA 4AKIA 2J0VA 1L4YA 2OCBA 3O8DA 3TRFA 2BEKA 3QKSB 2RGEA 1AQYA 2P0EA 1KK0A 3KJIA 3RANA 3MJHA 4A2QA 2O0HA 1Z0DA 3M4YA 2BBOA 1R6BX 1UBFA 2GAAA 5HE9A 1N25A 1HY3A 1Z3IX 3C4JA 1ZNZA 2H18A 3QEJA 2QBYA 4HB0A 1FTSA 1OLOA 1TU4A 4NTZA 3K53A 2HT6A 2NQ2C 1KDPA 4POAA 4FD2A 3A4LA 1HURA 1JXOA 3B1XA 3DZ8A 1YZGA 2PZFA 4WOPA 4BZQA 4XWAA 2YVUA 1GZSA 4WVFA 1G3QA 2Z4RA 2YJTD 4LHVA 3RLFA 2YWFA 2ZM5A 2H5EA 1BH2A 1JPNA 3HR7A 3TR5A 3MAAC 1IHUA 1A2KC 3UMSA 5BXQC 4PPFA 1DAMA 5AJWA 1WRBA 3M1IA 4ZI3A 3R8FA 4B75A 2ZE6A 2JIZA 4CRWB 2ERYA 1WA5A 4IVPA 2J9RA 4CEIA 1XX6A 4I99A 5JHHB 1E9CA 4DCNA 4LBZA 2GF9A 4BLPA 1RRGA 2EQBA 1D6JA 4ACAA 2QL6A 1N0VC 1P72A 2B6HA 3FHOA 1Z47A 3TKLA 5EXTA 3TGPA 3QENA 1VYTA 4OQFA 2DFKB 1Q1BA 1U2RA 2XZLA 1E2QA 1P61B 3CNOA 3S1AA 4A0HA 4I1UA 3WMFA 3H2YA 1E2NA 3LBNA 1YE8A 2UZ3A 1MRSA 3IIKA 1G3MA 1NN5A 2ZS7A 4UXIA 4IFBA 4RFSA 2X19A 3NWJA 1FX0A 1ZUIA 4QL3A 2BVNA 1NVXQ 3HPQA 4PC3A 3T5GA 1N0WA 3W6NA 5UKDA 4ESVA 2C2HA 2O8CA 3TR0A 2O8CB 3IKJA 3SS8A 2W83A 1M1YE 5B64A 3TUJC 2D4HA 1LS1A 1CJTC 2ZJZA 3VAAA 2VF8A 3R7WB 1MOZA 3HWSA 4PPNA 4Q7MB 3U2QA 2QAGA 2ZI4A 2QAGB 2MMCA 2C8VA 3B13B 1P73A 4MYUA 1QRAA 4GFDA 1E79D 4MKFA 3BXZA 2BMDA 4JLMA 2GA8A 2VEDA 1X8JA 4NYMQ 2GZHA 1NLYA 1VCIA 3CNNA 2BKEA 1Z6XA 1S2MA 4FI3C 3ZYCA 3NC1C 1FMLA 1RJ9A 1COWD 1NJGA 1RJ9B 3FVQA 1U81A 4R71A 2GEUA 3QF4B 2OV2A 4QOSA 1RPZA 1S8FA 2RMKA 5FR2A 5CB6A 2HYDA 4JL8A 5AJZA 2WSMA 2VHJA 2PLFA 3NKVA 3ECCA 4KVAA 2IYSA 1OSNA 1OYWA 3QJYA 4HLUC 5LPNA 1NLZA 4Q02A 3ZZTA 3PITA 4Q9LA 3X1XA 3AVQA 1KAOA 1U8YA 3IGFA 4PC2A 1KGDA 2H7VA 1CR0A 2ODNA 1KI8A 3A1TA 4RKEA 3ND8A 4U02A 4JLVA 2XNSA 2L0XA 2XGJA 3RRNA 4GT1A 4Q4JB 3ZZ0A 2XZPA 3OFND 3OE7A 3FMPB 1NY6A 4DRZA 3QEOA 5K8IA 5KPDA 1Z06A 1OFUX 4I4LA 3UMFA 3KB1A 3B9QA 4L4UA 2WZQA 3RC8A 3CZPA 3D31A 4LC0A 3T1QA 5JZVA 2MSCB 2OAP1 2IBMA 3H0KA 1U98A 1L4UA 2QN6A 1T0HB 4GSYA 1MO5A 1X1SA 1GWNA 2F7SA 3MMPA 3I73A 4NYIQ 1G4AE 4QHTA 4ZKDA 2A7QA 1C4OA 4FINA 3QKTA 4ILEA 2XB4A 1W44A 1FTNA 3AKCA 3M0EA 2WICA 5DSZA 2G1KA 2JASA 5CJPA 1W0JA 3HU3A 4LYFA 4TTPA 3I8XA 4PC1A 4TSFD 2BHRA 1D5CA 2ZSFA 4NYJR 4PSAA 4Q4HB 1LFDB 1UDWA 2RB4A 4ESHA 3TE6A 4EDHA 2IYYA 4DUGA 1CJVC 2RGBA 3WNBA 5JJLA 2QP3A 5KHOC 3PUZA 3ZH9B 2WWHA 1ZM2A 2YHSA 3B82A 3B1YA 1AS2A 2OILA 4R2HA 1TL7C 3RS5A 1S9HA 1J8YF 1KYIA 3BRWD 3DMDA 2KE5A 3IQWA 4M21A 2O8DB 1OXXK 1NIPA 1ZM7A 2DBYA 4V0KA 1HT2E 4LJAA 2QT1A 3PJRA 1Z6TA 1W0KD 2NZ8A 3X1DA 3FPAA 3P1JA 4KVGA 4YDHB 4PC7A 3T34A 3OIUA 1UJ2A 3SEAA 2CNWA 2Z5FA 4DIEA 1X1RA 3DOEA 4RZUA 3GLIA 3OAAA 1KOFA 4M2LA 1YR8A 2H16A 3AF4A 3ADDA 1XBTA 5JS7A 3K9LA 1OFTA 2O52A 4LJ5A 2ZS9A 5EP2A 3FB4A 2WAYA 4A15A 2ATVA 4YMUA 1TU3A 5FFMA 4CEHB 4URWR 2EVWX 3CF6R 2ZE7A 2V4ZA 2ZSEA 1JI0A 2DWOA 4O2LA 1EXMA 3I4LA 1E9AA 4HB2A 4Q9IA 3PENA 6Q21A 1NBMD 1UKVY 2JJ2D 4XVUA 2QPTA 3JZAA 5JWHA 4MRVA 1PZNA 1ZM3A 4WXPA 3TUZC 3O8BA 4Y0AA 4QXAA 2ZU0C 4G1UC 2AK3A 1Q3TA 4MH0R 2J0UB 1YZKA 4KSCA 2NPIA 5H68A 3WBKA 3IBGA 4XTCS 3CF0A 2PCJA 3GJ4A 5JJIA 4BFZA 1CXZA 1EFHA 2ZSAA 1E9EA 3CONA 3AVXA 5BN4A 3KXKA 3RWOA 1XPRA 1M6NA 1GSIA 2Q9BA 1KNQA 3UXMA 2BBTA 3O8CA 1NF3A 4B6EA 2O8FA 2FA9A 1KI1A 2QMUA 1FPMA 2EW1A 1NVWQ 2NPFA 1ZNWA 2EFCB 2OCAA 4QRHA 3E70C 1E1QA 2GF0A 5KDDA 5GVSA 4JLJA 4BWYA 2VPPA 2IT1A 3CZQA 3Q85A 2ZEJA 2OFOA 1I2MA 4PO1A 1RIFA 2GCNA 1QHYA 4QBHA 4YMTA 1XB2A 2ZI7A 1GKUB 4FMCF 5CIWA 1GDDA 2XX3A 2CCGA 2ZROA 4QBIA 3QBVA 1T3LA 3PEUA 3PUVA 2N42A 1VG0B 3SYLA 3RNLA 5JMTA 4RY2A 4RZ2A 4DLTA 1XEWY 3U3MA 3T61A 3VNUA 2WSSA 2A5YB 3HJNA 5CK5A 2YWGA 1WMSA 4G5OA 3ADCA 4WIAA 4PX9A 1A1VA 3IBYA 3UANA 3R8CA 1II8B 1KIMA 2W6IA 3L8ZA 3VTKA 2JJ1A 2J1LA 1FMJA 4B48A 4HAXA 1EFRA 1FOEB 4XJXA 2XTNA 2ANCA 3TQFA 3BOSA 2YWHA 4EUNA 1OF1A 2QA5A 3PUWA 3W9YA 5JWOA 1CIPA 1UBGA 1IONA 4ZDIA 1T4GA 4B33A 2ZSBA 4BLRA 2WWFA 2Q0HA 4LBYA 2HCJB 4UNQA 2FOLA 3AF1A 4UNPA 1JAHA 2CCJA 4NYMR 4ERNA 3U60B 1G8FA 2R65A 1T8UA 1LF0A 1SVSA 1SHKA 2OUKA 2IHYA 4A8JB 1SKYE 2V8OA 3GPLA 2GXSA 3EPHA 4OYHA 4GZMA 1G7CA 3AF3A 2PEYA 3WMGA 2WOJA 1FP7A 2WVJA 4AWXA 3GJXC 2C9YA 4LYHA 1YKSA 4V0MA 1RYHA 2LKCA 1ZRHA 5CIQA 3IPYA 3GLHB 5JWRA 4E03A 3GFOA 1HEIA 2GCOA 2GCOB 3CKLA 2ZUDA 1N5LA 3U7HB 5KNDA 2BM0A 4IRUB 4NP6A 4XVQA 4HAWA 1OH6A 3OESA 2DPXA 3PIRA 4FIDA 4IFEA 1KO8A 4AC9A 1FUKA 3LDAA 3ICEA 1V43A 2YYZA 1XCGB 4HZUA 5FL3A 4Q9HA 4DLSA 3K70C 5FTKA 1BOFA 4QNRA 2AD1A 1E9RA 2FEOA 4C0KA 3GMTA 4HLUA 1BO6A 3EZ2A 3GLHE 5G53C 4D4JA 2WWYA 4BE7B 2BIFA 2CL0X 3NBZC 4QGGA 4NYIR 3VKHA 5J4LA 1HT1E 5DYGA 3LW8A 2JLXA 4AY2A 3ZVMA 1TUIA 1RE0A 2IUTA 5H70A 3GLFB 3PEYA 2CCKA 1JECA 5EE3A 2FSIA 2UZIR 1T5IA 2ECKA 4MKIA 3GFTA 5F3WB 1W0JD 3DZDA 5H8WA 4CW7A 2JLWA 2VF7A 1N6PA 1E2JA 5EXSA 2OBNA 1II9A 1FW6A 2XJ4A 4G01B 4GDFA 3W6PA 2OCPA 2ZS8A 4TLDA 5K8TA 5FPTA 4QNMA 1E2GA 2ZANA 1IN7A 1G7SA 4MGKR 2FFBA 2SHKA 1JB1A 1E2FA 1S3SA 2O5VA 1A5TA 2GKSA 1IN4A 4EFLA 1E0AA 2J45A 4KFRA 4LYAA 4TMXA 4DLXA 3GLFE 2F9MA 3NBYC 3ZZUA 1TQDA 3VFDA 3PR1A 2ZITA 3LX8A 4W5WA 1YHNA 2BBWA 3TW4A 4L9SA 2QRZA 1GNRA 1OT3A 1XXHA 1XXHB 3NHAA 2CNWD 1GRNA 3GLGA 1M74A 2WJVA 4WZBE 4W5HA 3W8NA 4B3CA 2PH1A 2ZJ2A 2GESA 4WBSA 4GBMA 4JVSB 4X8LA 1ETUA 2AKYA 3IEVA 4TYWA 1DELA 2GAOA 3C8UA 3HR8A 1Q57A 4US0R 5TARA 1VCOA 5DHFA 3AUYA 5J4YA 4IDOA 4DSUA 3UIEA 4TZ6A 1AZTA 1GUAA 3QVUA 2BDTA 2WKRA 4CIDA 3TVTA 1AS0A 3QG1A 5JECA 3CRW1 4V0LA 3RABA 2AX4A 1ZD8A 5FUXA 2KB0A 3KL4A 4Z1MA 1RC8A 1XXHE 5IRCD 5F98A 1JR3D 1H8HA 1GITA 2QE7A 4BZPA 5SZKB 2GXQA 4C0AC 3DM5A 4KFTA 3BD9A 2F3TA 2QM7A 1OXUA 2XOKA 5ANRB 2NZJA 3VR5A 4GOKA 4EPTA 4A1FA 2N46A 2QTHA 3IIMA 2CHQA 1TF2A 3EX7C 3EZFA 1D9XA 3BBPA 1OFIA 5FOSA 3D7MA 3KQKA 4JBWA 4JVNA 3BIFA 3Q5EA 2QGZA 4HAVA 3O47A 1CBUA 1F48A 2A3RA 2VHQA 3RDPA 2GJ9A 4X8HA 4M1TA 1HE1C 4B32A 3I5YA 4OQLA 3P20A 2NO9A 1AIPA 3ASYA 5GJVC 4EJSB 1K6MA 1LTQA 1Q12A 1RRCA 4LJ8A 4Q66C 4US1R 3T06B 2JDIA 1T3HA 3MJRA 1Z2AA 1AK2A 1G8HA 4CZ2A 4FMBB 4Q5IA 2BCGY 2J87A 2MSEB 1N6NA 1W1WA 3BWDD 4QKQA 2WM9B 4YONB 5BN3A 2GETA 4F7WA 2ZR0A 3DMNA 4RD4A 1ZIOA 1NN1A 4M8NE 1GL6A 4NCIA 1R8QA 1BMFA 4BUJA 3ZS9A 2K5UA 3EG5A 2RKOA 4BFTA 5JHGB 2QNRA 3TNFA 4BGDA 3SE0A 4OKSA 4QGFA 1P75A 1W47A 1JAIA 1MO6A 2WJJA 3NXSA 5JCPA 1AM4D 1OXVA 2BBSA 3DKVA 4WZ6A 3FHTA 4Q4AA 2YV5A 3SOPA 3EWSA 5JSZB 1P6XA 1WXQA 4BRUA 1WDTA 1LB1B 1NKSA 4PHTA 1ESMA 2HJVA 3LVQE 1S9DA 3AVPA 1YU9A 2WJYA 4LX0A 3FFAA 3MCAA 5K8UA 1SGWA 2JLVA 4PAMA 1F6BA 4YMVA 5CK4A 2B21A 1SULA 2OFXA 4TTRA 5JBQA 3KTAA 2LKDA 3FKSA 1KTVA 1E0KA 4ZDWA 1E98A 4M1KA 5CJ2A 2CE2X 5KPJA 4HZIA 4TQ9A 3UK6A 4Q00A 3EA0A 1IXZA 2NO6A 3VKGA 4JIMA 1GNPA 3FTQA 4EFNA 3L0IB 2PMKA 2ZJ8A 4UNSA 5EE5B 5HPYB 1ZP6A 2QP9X 1K8RA 3BFXA 1WBDA 3LFUA 3WRXC 2XJ9A 4MDEA 2LWIA 2R44A 3HU2A 1XTQA 3N2EA 1E2KA 3AVVA 2IXEA 2FGJA 1ZNYA 2FSHA 4CEJB 2O0KA 2O0JA 1KJZA 2J5XA 4Q47A 2YOGA 3HP1A 4G5SA 5FR1A 1KHTA 1R0ZA 1E99A 1XZQA 3LVRE 2X77A 4FMDB 1ZBDA 1P9RA 3RVBA 1Z0FA 1AA9A 1I2DA 2FMXA 4LJ9A 4KITB 2CLCX 3FDIA 4LHYA 4XOIA 1D2MA 3TAUA 3F8TA 4TL9A 4P4SB 3V4FA 1G3UA 1QZXA 4ARZA 3AP2A 3WHLA 2REXB 3NG1A 1AKYA 3A4MA 2VSXA 5AUPB 3KKMA 5L8VA 3ZIAD 1F3OA 3Q3JB 1XJQA 1KI6B 2WKQA 3EIQA 4O25A 4NH0A 3Q7PA 5HCNA 2C03A 5EQTA 4A0FA 5FTNA 4LI0A 4DZZA 4BRWA 1UAAA 2HLDA 3M6AA 2J0QA 4P3YA 3DEFA 1D8TA 4QJ4A 1GRRA 5DE3A 1XEXA 1YRAA 3VU9B 1H65A 3KJGA 4A2PA 3OIYA 1KKLA 5E7MA 2F6RA 1HE8B 4OK5A 2CHVA 4R9UC 4RD3A 1X6VA 2ASEA 2ZRPA 2CVFA 1MR3F 1S4QA 2G1JA 3ZGXA 1IXRC 3QKSA 1QHNA 3ZQ6A 1XRJA 2J41A 3CWZA 3R9WA 3PXGA 3I61A 3T1OA 4XSGA 1TX4B 2FNAA 4DKXA 2CHGA 4HDQB 1Q1QA 1PJRA 5FBQB 5FPSA 1NY5A 2IEZA 4IVQA 4K81B 5A0FA 1G8GA 1VPLA 4L8GA 4KAXA 2JLZA 5A5GA 1G20E 1TQ6A 4MITA 3H1TA 2ODWA 4D0GA 1U99A 1OB5A 1WQ1R 3JVVA 1PUIA 1XD2B 1KDRA 1G16A 1Z63A 2FFHA 3A6PC 4C7OB 2VP5A 1WBBA 3SJAA 1G9XA 1NL3A 3NDPA 2NO1A 4NU0A 4TMVA 1Z2CA 3RAPR 4TYPA 1W2GA 4DSNA 4DSTA 4X8MA 1DEKA 5DYIA 1SVLA 3U44A 3U44B 2GNOA 4PAQA 3SQWA 1CULC 1KNXA 2QORA 5J4KA 2IS1A 5F9HA 2UKDA 5IF9A 3T1VA 3AQ4A 4HUQB 4OI2A 4R98A 3A8TA 2QUZA 5JLJA 1D2EA 4JT4A 3EARA 4XWKA 4DCSA 4HDCA 1Q3HA 2H57A 3F5FA 2F55A 1U0LA 4V0OA 1A82A 4V02A 5C46F 2XOKD 4XH9B 5E95A 4C30A 3I5XA 4KFSA 1NRJB 3SI7A 1IAQA 3VR3A 4UJ3A 2D7DA 2OT3B 3CRVA 1VYVA 3N2IA 2WWGA 3BB3A 2YOHA 2VYFA 2ZRHA 3OHMA 1TTTA 2Z4SA 2ZTSA 3LY5A 1C1YA 1G7RA 1H8ED 4B47A 1E2LA 1W4CA 2IC5A 3RRZA 4TL8A 1IBRA 2FPKA 1RZ3A 1JJ7A 2GBLC 2RHMA 2HXSA 3W3ZB 3FOZA 2D62A 2FGKA 1XEFA 2IK8A 4XSHA 3U4QB 2XSZA 4QM6A 5BN5A 1CRPA 1F5NA 3TK1A 5KSOA 2HV8A 3I1FA 1Z0KA 4YXWA 5EE1A 4DLYA 1KI9A 5TVKA 3C41J 4A8JC 1XEWX 4C0BA 2V1UA 1JEDA 4NKRA 3R7WA 4QJ3A 1VIAA 2EFHB 2IL1A 4AI6A 2X1VA 2A78A 4IOJA 4C0QC 3WBJA 4TQAA 2GVZC 2BMEA 4M53A 3X1YA 3UPUA 2PZEA 4WZAE 3CH5A 1A4RA 1R4AA 4JSTA 2FH5B 1YR9A 2JJ8A 2XEXA 1W36D 4HYYA 2Z43A 2XTMA 2EWVA 3WYFA 2MSDB 2PMDA 3AV0B 1DO2A 4DT1B 1W7AA 5EE0A 2Q3HA 1JALA 3A58B 3P32A 4KBGA 5LB4A 1PLLA 1T91A 2FFQA 1P9WA 4BLTA 1X8LA 2J7PA 2X2EA 1Z6GA 3QF4A 2OSBA 1N5KA 2GDJA 4TMZA 4LHWA 1ZU5A 5JI3E 4QM7A 4QFMA 3WXMA 5DISB 4NZYA 3J81k 3X1ZA 3RSLA 3EPJA 2A9KA 4PAOA 4C3ZA 1NVVQ 2ZE5A 4DCUA 1Z07A 2RGGA 3MLEA 1E9BA 8OHMA 4C0JA 3PVSA 3EIHA 3BE4A 3AVTA 1O87A 2CL7X 1EGAA 3H84A 2B8WA 1VG1A 2QG6A 4ASUA 4OHZA 3LWNA 1WF3A 1KZGB 1Z08A 4OK6A 3DVLA 1TQ2A 4Q4JA 5J5CA 3SJCA 421PA 1T5LA 2GEDA 4LZZA 4WXRA 1W2HA 1R8SA 3QI2A 1E94E 4ZPXA 5GJCA 2ZRAA 5SZJA 2G83A 3RRMA 4RD1A 3OEHA 3VX3A 3I92A 1YZLA 1RKBA 1MO3A 3A4NA 1A7JA 1R10A 4GPTA 2AWOA 3I3SR 1WCV1 1Z29A 3PUXA 3WRYC 4XD7D 1X86B 1TEVA 2C96A 3QQ5A 1V5WA 4X8OA 4GI7A 3K9HA 5BWMA 1Z28A 2X2FA 2VP9A 1KY3A 2QP4A 4MRNA 3A1WA 4OJQA 3K0EA 4KV9A 3HPRA 4JLBA 2C95A 4LBWA 4HAZA 4ZDKA 2EWWA 1EESA 4GP6A 5KSPA 2ZYWX 1ODFA 3BFVA 4IJMA 3NBFA 4JS0A 4JJZA 2VIIA 1W4AA 3ASZA 1TPZA 1F2TB 1XTRA 2FPLA 4Q4HA 4GRAA 1JEEA 4IEEA 4NL4H 2D2FA 4DDTA 1ZW6A 1UEIA 4CT5A 1UBEA 4EIWA 3CRMA 4FN5A 3WNDA 4A82A 2DFTA 5KDOA 4TN1A 1RYFA 2BJWA 4TLCA 1KK2A 4BFXA 3DPUA 1TNDA 3Q8XB 4H9GA 2J0SA 1BYIA 3EZ9A 2O8DA 2W00A 4B3BA 4YMWA 5E7IA 3DDCA 1AN0A 1ZINA 5P21A 5JRJA 4PTLA 4AKEA 2A5DA 3U7FB 1W46A 1G5RA 1R0YA 1E0SA 1G41A 1VDZA 2HLDD 2PX0A 3K70D 4DEYA 4TMWA 3DKPA 4P32A 4J0QA 5HZKA 3IHLA 3SR0A 4F38A 2IYXA 2P6NA 2ZPTX 1TEXA 4DB2A 4Q1EA 1IXSB 1CR2A 5G3YA 2FDCA 1DAKA 2FV8A 4N1AA 2ATXA 5LB2A 3MWLA 3AGQA 3NH9A 2V7QA 4GMXA 2XNDA 3HYTA 4E09A 4KLZA 2Z0MA 1ESNA 1T8TA 3F0TA 1UKYA 1FZQA 4RD0A 1EFTA 3KXIA 4CEHA 1QG2A 1ZD1A 2IYQA 1DTSA 4JLNA 2W2TA 5EUQB 3FYHA 4BFSA 1E1RA 1DARA 3CNLA 4GOXA 1K5DA 3BERA 4B43A 1R0XA 2E87A 4LJ7A 5FPHA 1E2EA 2VP6A 2R9VA 1CKEA 4EJSC 5JS8A 3CPHA 4ZO4A 4TYQA 1OHHA 3AB3A 4E5UA 2J0UA 3VQTA 1NMZA 3CR8A 3U6BA 4JSYA 4ZIRA 1W49A 4ZIRB 2Y8EA 3ZLJA 5SZIA 2ZYVX 2ZRBA 4A36A 3LD9A 1CR1A 4OJKA 3CRRA 3UG7A 2VHUA 1R5OA 1GL7A 3RS4A 1X8KA 3NEYA 1D2NA 2P6UA 3MFYA 5JRZA 1M7HA 2JLQA 4KSBA 5J40A 3A1UA 3SC3A 2JIZD 4TYNA 1EG7A 4HSEA 1EX7A 1QF9A 1SXJB 4IEIA 3L82B 2DFLA 4IXNA 5AWFC 3ADBA 1AKEA 2O8EB 3K9GA 1HH4A 1Q0UA 1DO0A 3K9NA 2JGNA 2IW3A 2Q9AA 3AP3A 3N70A 4B76A 3L8YA 3OZXA 4JBYA 2GJAA 4JYBA 3SFZA 4MKGA 1GRQA 3A1VA 3B1WA 3EPLA 4HATA 3B85A 4LHXA 2ZUCA 2D74A 1YR6A 3D8BA 4BQSA 2NOAA 4G5GA 1NN0A 2JATA 4UXHA 1RW4A 5EUMA 1NJFA 4N3NA 1JR3E 1VTKA 3RS7A 2ONKA 2BWJA 1DG3A 2P3SA 1SXJE 3WP0A 1XPUA 3NC0C 1E32A 3VR1A 1TF7A 4URUR 1II8A 3WY9A 3TH5A 1KI4A 2AFHE 2WPDA 5HZHA 3QBTA 1XMJA 2QQ0A 5FTMA 1ZCBA 2OBLA 2FWRA 4OBEA 1G6OA 3BAFA 2ZVPX 4Q01A 3WMEA 5H1YA 4HAUA 1DAFA 1OW3B 3IIJA 3K0CC 4ACBA 5AJVB 4D25A 3TMKA 3ZD7A 2GBLA 4AYWA 1P7CA 3SN6A 1GVNB 2FEMA 2H1LA 4Z8YA 2IYZA 4Q1FA 3TUIC 2XAUA 4C0SA 3IUYA 4N0DA 2OAQ1 2QM8A 5FUWA 4A8JA 2JCSA 5FI1B 4BFWA 521PA 4F4JA 3W8RA 1NVUQ 4C2TA 4P4UA 2NGRA 1AQUA 5D3MB 2BV3A 4U7DA 5AJYA 4G3XA 1KJWA 4G0NA 4B34A 3GLHA 2ODBA 4MYHA 1ZD9A 2P2LA 3I72A 4MA4A 3B1ZA 2GRJA 1NVVR 2O8BB 5L3RA 1Y63A 1E3MA 1TMKA 2JAQA 2C5LA 4DDWA 1CS4C 1GKIA 5EE9A 4IDPA 4C2UA 3EC1A 2YKGA 2DYKA 1US8B 4FWTA 3OE7D 4IVRA 5KDLA 5F2EA 5HTKA 4AIIA 4TMKA 5DNYB 4LV5B 2RGXA 1I4LD 3ADKA 1Z6YA 3P26A 2QMHA 5FOUA 4OI4A 1IY0A 5KSZA 4G5QA 1BKDR 1P4SA 2WJHA 4JLAA 4E22A 5KNBA 5KTYA 3LO5A 2WHXA 3E2IA 1S0UA 1T0JB 1K5GA 2GJKA 3GLFA 2FSFA 4I81A 4NE2A 4BFVA 5DN6A 1KI3A 4YC7A 3KFVA 1KAGA 5SZHB 1LF5A 5AUQA 5DGXA 2AXPA 2G9NA 4E07A 2MMGA 5IT5A 1NKTA 1XJ0A 2Q9CA 4RSGA 4KHZA 2HXYA 1EX6A 4NDZA 3PV0A 2CL6X 1DPFA 3FMFA 3TQCA 4B2IA 4DUGD 2ZAOA 3KFXA 1P3JA 2VP0A 3H86A 4JLKA 2D06A 2OHFA 5C1BA 1XTJA 3NH6A 3TBKA 2ZRGA 2EYQA 5GVRA 2R6GA 1QHSA 3BORA 4TT3A 2NG1A 1QDEA 1XTKA 2A5JA 3AKDA 1R0WA 2FE4A 4DLZA 2C99A 2FF7A 2WWIA 4JKYA 3SBDA 5AUOB 4OI0A 2VTKA 5B57C 4GOJA 1NNEA 3REFA 4C0HA 4US2R 2EFDB 1VG8A 1P5ZB 2FG5A 2PLRA 3CX6A 5FL7A 3QF7A 4PQYA 2A5FA 1N5IA 5DHAA 4DCVA 4O2RA 1NSFA 2BKUA 1OV4A 1KMHB 2W6JA 2OCYC 1ANKA 2WMNB 1AJEA 1AS3A 2YINC 1VIYA 2A30A 5EP4A 1YJ5A 1GKYA 4CYMA 1IN8A 3VKWA 1EWRA 1G7TA 2WAXA 3BC1A 4O3MA 4MRPA 3OAAD 2EYUA 1YR7A 2V7QD 1D9ZA 4JVLA 1OXTA 3CB4A 3CM0A 3QE0A 4HLQB 1ZAKA 4M1SA 2CJWA 5FBWB 1OB2A 2CJWB 4HI0E 2ZJBA 4MQBA 1UKZA 2OFWA 4TZ0A 4WA7A 2CXXA 4QBGB 1E1RD 5KU1A 2YC2C 1J8MF 3ZVRA 1BIFA 1R5BA 1NMXA 4NPHA 1IN6A 1ZU4A 4F92B 1OH8A 3RC3A 1HYQA 1UFQA 3UWKA 2GEVA 5LBIA 2ZAMA 1KSFX 2TMKA 2AKAB 4B3XA 4FXPA 4YMSA 1ZC3A 3VR4A 1U8AA 5JCZA 2RGNC 5KNCA 2R6DA 3KQNA 1UEJA 2WJGA 3PEWA 3QPVA 3U61B 4RKFA 4LOAA 3T15A 1HQYE 1GOTA 3G0HA 4Q9JA 1TQ4A 4EJSA 3U5ZB 1J2JA 2D2EA 3K09C 3L2OB 1CF4A 1HA3A 4DIDA 1E1QD 4G5RA 4ZCLA 1DG1G 5AUNB 3B1VA 3AF2A 1ZM9A 4UJ5A 3KKQA 3KQLA 3LBIA 4BASA 3SZRA 3CH4B 3C16C 4M9QA 5CYOA 4W9MC 1KY2A 2C77A 3NEJA 3SHWA 4PQRA 3I8SA 2ZI6A 3RYTC 1MABA 2PCLA 1MABB 4IXMA 2CEAA 3EA5A 3ZJYA 1G18A 1F2UB 3U3KA 1KJYA 1CTQA 1X3SA 3GP8A 4AKHA 1OKKA 5EXXA 4HEJA 1JQLB 4KODA 4O0MA 2QPAA 4QJ5A 1JPJA 3DO6A 2WSSD 4JVMA 3C5CA 1HQCA 3DOFA 3RRYA 2CK3A 4A2WA 2QAJA 2QTVB 3KJHA 1XTIA 2R62A 2W6ID 1OFHA 2WWXA 2JJ1D 3MGCA 4ZCIA 5B30A 3GJ0A 1W5TA 4JT2A 5JSZA 2IUUA 1ZUNB 1EFRD 1SKQA 2W58A
chains in the Genus database with same CATH superfamily
3MINA 4M6WA 4BLQA 4M9UA 4AUKA 1VBFA 2F9FA 2Q4OA 4QOJA 4HLDA 4U0KA 1W36B 3K8YA 1NKVA 2R8BA 4KUGA 2XF2A 3E81A 2IWRA 2WYUA 3W6OA 4O1HA 1R6TA 4Q4DA 5CEEA 2GARA 4W5JA 3WFZA 3TE7A 4MQ6A 4JZKA 4RGVA 4PPYA 2HSGA 2AR7A 2GGSA 2QJOA 4E2XA 5CDFE 2G0TA 3VOBA 4FS8A 2KM1A 1ORTA 4BEBA 2OE2A 2QX9A 1KEWA 4KVZA 3SQLA 4KBFA 4X62B 1ST3A 4LJ6A 3PD7A 3W4KA 2QRNA 4RK5A 3O7MA 3GEHA 4OHYA 4L3WA 1L5VA 3VDMA 1K7CA 1YO6A 3WGTA 2CXQA 1DE0A 3CLVA 5F78A 4CF4A 3EWNA 1NTOA 4L7VA 3CRQA 2OGUA 4FOTA 2JK1A 3X1WA 2AJLI 3A3PA 1GUDA 2ESRA 1RBMA 2UZ1A 1M6VB 2UZ1B 4F2DA 3H19A 4YCDA 1A5AB 2Y66A 5HXAA 3K0CA 1NRIA 2F9LA 3CLUC 3PFCA 4YPVA 5KVSA 5CYPA 2XI4A 3T8YA 1TCAA 1SCJA 2HDNB 3DBRA 3DBRB 4FT4A 4TLBA 4TL6A 1GCAA 4BKOA 5BNTA 5KNDD 2Y4NA 2YW2A 4YFVA 4H4EA 3QXSA 2PWPA 3SIPA 5C80A 4CEJA 4MUKA 3FE2A 5KTRA 1SHUX 1FXWF 3IILA 2BJVA 4GKVA 1X80A 1GLGA 2APJA 2X41A 1X80B 5EMKA 2QR3A 3TX2A 3TG8A 3GH3A 1U4NA 4FE3A 5FI0B 3VR6A 1W35A 4TS1A 2Y92A 4F3CA 2I6GA 3FCSB 2XCTB 4HYQA 4YREA 1SVMA 2JIPA 3C7KA 4HWKA 2VOEA 3H4MA 3L6RA 8GPBA 4HSGA 4KGXA 1L0BA 3EH2A 4PBTA 3T3PB 5A2GA 2RGCA 1E5QA 3WX0A 1XHLA 3IJEB 3QVVA 3HDVA 2O5EA 2GPTA 2VH2A 3E8MA 5CH5A 3ZJTA 2VPYA 1EQUA 3CUWA 2FWMX 2W2KA 4CDGA 2VHWA 2W2KB 4X7BA 5ES3A 3TLAA 4GUAA 1B0UA 4NWIA 1FNMA 3KOMA 4X1YA 1N1MA 3EGOA 2P5YA 4LTDA 4D3YA 1KPHA 4D8UA 4X97A 5FTLA 2FP4B 4ID3A 3MUOA 3GBVA 2OMEA 3TEJA 2JD0A 3VU9A 4AS2A 4DXHA 5L95A 1J8FA 4D9HA 5K45A 4LY6A 1MPXA 1XELA 4WLUA 4HEA1 4ZA2A 4KGDA 2B99A 1GYRA 4WXEA 3RBXA 1U0TA 1XLVA 1A2BA 2JI6A 2ZVQX 3CLTD 2VZ8A 4U1RA 3UUGA 1PWEA 5ALSA 4TVOA 4ZCRA 4DDVA 4P93A 4ETWA 4UTPA 1IDOA 4KO8A 1Z5ZA 2WM8A 1M34E 5BRNA 3UC5A 4BNVA 4BU1A 1JU3A 1PT6A 3SYNA 4JEUA 1P1HA 2XVZA 2MTBA 3FH0A 1JGTA 5EL0A 4EGSA 1E20A 1NSYA 1K0UA 2XE6A 5AKXA 4M1OA 4AS3A 1I8TA 4G89A 1N9ZA 2BFCA 3PWSA 2OO3A 1YI8A 3OT5A 3ZV4A 1S4MA 4IIYA 3NS7A 1I01A 5KTKA 5LBTA 1ITZA 2Q5HA 5FWXA 4DLBA 5ESWA 3EAQA 4N18A 4P4NA 1QRDA 1OIWA 2G17A 4HZGA 4EG8A 1XTVA 4E33A 1ABFA 1OAKA 2ZUBA 4ND2A 3RSOA 1INLA 1RZVA 2F1RA 3L8FA 3I9MA 1BRMA 4HNAB 2WLTA 4URYR 3ZE9A 1T35A 3Q41A 5INTA 1EIWA 5KQGA 2B4QA 1NMYA 1VG9B 1U0HC 2QSUA 2VQ3A 2WJ4A 1W29A 2CF6A 3LVFO 3OETA 3TCXB 2IX9A 2G04A 2F1IA 2XYVA 3F3YA 2OGSA 4L4XA 4LE1A 4PQEA 4U2DA 1D6NA 4XCQA 1RM5A 2ASVA 1H3FA 2QQFA 3LT0A 5F1OA 5BORA 4K05A 2ZRCA 4F91B 5DF1A 2Y77A 2R86A 5JQGF 1G4UR 2R79A 4Y9DA 3MMZA 5HFAA 2CGEA 1RWVA 2ECOA 3KYIB 3M6FA 5FNVB 4N5DA 3K1AA 1Z35A 4JJKA 4LK2A 5F5XA 4JI1B 1KHHA 2WVAA 3IULA 3RTAA 4K46A 3N2NA 4M1WA 1KVTA 5TPZD 4QAQA 2WHEA 4ZFNA 3GD5A 3OCYA 3K5PA 4MQFA 4MQFB 4N7RA 1VOTA 4IDQA 3T3GA 3WHKA 4EMBA 1TIBA 3Q8LA 2HEIA 4Z1MD 1NVDA 1V7ZA 3O4IA 4WJKB 4F2WA 4Z7QB 2QE7D 4GOND 4EJSC 3JQAB 5CVTA 4CIBA 1P2BA 4KTTE 4Y6PA 5JTTA 3K15A 2OORA 4H1VA 4CTOA 3I45A 2C0CA 2EOAA 2AFRA 2ZJYA 3FETA 1N5JA 4YGYA 1CRQA 3SYMA 3UKDA 121PA 5KOHA 1HNZB 4GKAA 1UM8A 2IDZA 4UHFA 4PG5A 5LQAA 1O2DA 3RFUA 4M0DA 2C04A 2I7XA 5JDCA 4FHGA 1CY7A 3OQ6A 4OQNA 3BCSA 4C2AA 4DSAA 5DYWA 5KNCD 1ZMRA 4O2BF 2FX2A 1DTEA 1RWNA 5C7IO 1P2SA 2ZCJA 2P0AA 1WVGA 2DM6A 1NBME 2GERA 3I12A 4TTVA 4WZAA 5AICA 5DBHX 5ALOA 3L7MA 1U8UA 3ESDA 3R6DA 2H17A 1NFRA 2P5TB 1U3TA 4M0CA 5ALLA 5DVZA 5NULA 5IT0A 3LBHA 1RPAA 2I5PO 2VDMB 3F46A 2XRMA 1JJVA 1OX4A 2HJRA 2WIGA 5JALA 3GRAA 1DKNA 3BH6A 3KHUA 4ZI7F 1H9BA 4B9AA 3H8SA 1DWPA 3I32A 3CH6A 3L1JA 5K09A 1NV9A 1NE7A 3PE3A 1DU4A 1FMFA 2AEFA 1RHQA 2V7PA 3PHBE 4EG1A 1DOAA 1UXOA 3NFYA 2QQ5A 4F3YA 5L3SA 3U6KA 5L3SB 2PUFA 4RADA 4EX7A 3FIUA 1SQ5A 4ITRC 3U7EB 4YYZA 5DM70 1XPOA 1CUGA 2BZ0A 1CVLA 2HIMA 2L19A 3HC7A 4CCSA 4F5EA 4LF6B 1MH1A 3CVWA 1QK3A 3PBKA 4X61A 1TM7E 4B6JA 4NFLA 4GX0A 1YRLA 4DR5B 5AYVA 1P3DA 4NH4A 3GGPA 1DG9A 1OX5A 1J42A 1ETHA 3V00A 3GR6A 3H1BA 4X0EA 4Z5XA 5BSKA 2OHHA 4R1SA 4MQUA 2BMFA 4I1OA 1IJEA 1CCWA 1LPBB 3WV5A 4EUEA 5CGQB 4Z54A 3QMVA 4AT1A 2ZRKA 4AY4A 1ZOIA 5DBOA 1QVZA 5G0VA 4M0LA 1CZRA 3ZCTA 1AQNA 3EXAA 1I7SB 1F60A 4ZHSA 4QD3A 5KO2A 1U3DA 3H7AA 1OH5A 1VSQA 2BFDA 3A6DA 2BFDB 3BTOA 1JSXA 3AI1A 2VHCA 2Z2YA 3U4CA 3VKVA 1RXYA 3N07A 3TG2A 3FWPA 5KSYA 1EZ1A 4O1IA 4EY8A 1V4NA 3ZV6A 4PG6A 1Y8RA 2IE8A 3M6IA 5JRDS 5KX5F 1LX6A 3UYLA 2V3CC 5ELXA 2QRMA 2B25A 4CKBA 4CKBB 2VYND 2OECA 3IERA 3MN1A 3OSUA 3JD3A 4QGHA 3TL6A 3ZV7A 1VJTA 5JU6A 2G76A 1S3GA 3E1KA 4ZVVA 5JD3A 1K7SN 3FSGA 1AN9A 4KO3S 3FFWA 3SDZA 5A5EA 2IH5A 2RK3A 4BMZA 4XARA 2BGJA 4Q18A 5CB8A 5LU9A 1ZCJA 1P60A 2OXCA 5H7XA 5GZ1A 2HJWA 4R7ZA 1QYVA 4KQHA 4AP5A 4B6FA 2ONCA 2P9BA 2QF7A 4X20A 4AZSA 2LRHA 4HRXA 2BC9A 5TMBA 1QO9A 4DJTA 1I7DA 2VUTA 2FEAA 5HEKA 1URPA 2LD4A 1U1IA 1XZMA 3EFEA 4CLEA 2WP8J 4OUKX 3C6XA 1Y3BE 1PKXA 2ZBQA 4DAOA 4ZEMA 4O2AF 2OMKA 4AZ0B 1IM2A 5K01A 1ZA2A 1DKLA 3AHJA 2Q5FA 2QRGA 4YJFA 3Q5DA 4YJFB 2MSWA 3MFQA 4G86A 2B1IA 2MCFA 2NX2A 3D2AA 1MF7A 1ONBA 2Q4TA 4HWPA 5F35A 3EFHA 5K1ZA 3S7TA 4CNBA 2XXAB 3TSAA 2G1UA 2DTXA 4EB8A 2VO1A 2J6IA 2WJ6A 3SJZA 1VJ0A 1XMSA 3HUTA 3UAXA 2HKIA 3QPBA 4Y67A 1K8QA 1N2IA 2HADA 3GZNB 2ZTUA 1Z17A 2I99A 3LE8A 1TOAA 1F2TA 3ZHCA 2TMYA 4PZLA 4D4MA 3KLOA 4HVAA 4Q48A 3EF3A 1YMVA 4G23A 4G8JA 6GPBA 1O0SA 2I3ZA 1EFUA 1YSCA 1DQYA 3EHEA 3QYJA 4LKRA 4ZVPA 2RHDA 3PNQA 1KDOA 2CLOB 4FMPA 3F5MA 1MP0A 1N8SA 1QMGA 3BWVA 3GRZA 4IMRA 3WYGA 2ZXEA 4KYIB 3E7XA 2OG2A 4MARA 1HUQA 2QTZA 4M9ZA 4RJJA 5J4HA 2IUEA 4KK3A 2Q3MA 4NV3A 3VJRA 1K4MA 2W6CX 4J0HA 3KYJB 5EMNA 2BFNA 3EDMA 3F4LA 4D26A 5MGNA 4DV0B 4MNTA 2WTNA 3A3OA 1DRKA 2R2GA 1EJ6A 1NATA 3HU1A 4RABA 4YDSA 5F9MA 3H5IA 1LQ2A 4N12A 4W5TA 1C2YA 3PXEA 4HL6A 4PFSA 4BMNA 3EQ2A 4XWWA 5HA5A 3ESZA 3DCIA 3PQ5A 2ZVDA 2PKYX 2QN3A 3QPCA 3TQHA 1SAYA 5BR1A 1DVRA 1M5TA 1VFNA 3LRPA 3FVVA 4B80A 1RTKA 2YN4A 3OZUA 4IQ4A 1DIGA 3F6BX 4LBVA 3V46A 4KIUA 4EI9A 1UPBA 2AW3A 2CBZA 3BWXA 2HBZA 1PZMA 4CPDA 3GGSA 3AH8A 4GE3A 1P19A 3EDQA 4B2PA 3C7DB 1UXHA 1EP1B 1RRKA 2VP2A 2XTZA 4FW9A 4DA8A 3EZLA 1L4GA 3PNOA 3MTQA 3V1MA 4UOEA 4FYPA 4JBGA 4DJEC 1HQKA 5FWDA 3BSSA 5TLSA 2Q6VA 4IGIA 2FN9A 5E0OA 4FJ2A 3U26A 3PXAA 5CLFA 2OXRA 2BFBB 5G1PA 2PJZA 1J6UA 4NCHA 4OXKA 3TQTA 3SEZA 4BWVA 2O20A 4GPEA 4WLVA 1Q5PA 1THTA 3TOZA 4CMAA 4W7HA 3D5QA 5D7BA 3GLIB 1QAQA 1E9SA 3FG9A 5HF8A 2HNKA 1LFAA 3B1KA 1JXAA 1OAOC 1AUOA 4BO1A 4DRXB 4LV6A 4RANA 3KKPA 3IURA 5IK2A 1JIJA 4CGYA 1UWLA 3GLRA 4X1KA 4U63A 3G0OA 4X1KB 4CI9A 3VDRA 2F59A 3IOBA 1KKMA 2HJ9A 4OOEA 2NQTA 3VC1A 4AX8A 3EOBI 4WADA 3ZDAA 1KS2A 2FFAA 4FMDF 4JI0B 3LFTA 4EJ6A 3HCAA 1T1RA 2XXAA 1L2TA 1N3BA 2I2WA 3ETLA 4J9UE 4CG0A 4C7BA 4R1TA 2QY9A 2W2LA 4EGFA 5DTJA 1CZUA 1S7GA 4RCZA 2XITA 1N3YA 3MM4A 2QPOA 1L5OA 5BOVA 3L0OA 2FPUA 4C4PA 3ZVNA 2V45A 2ORIA 3IAM6 4U2EA 1Q7BA 1N6LA 4ZTBA 3V1NA 5DIFA 4CTMA 2DHDA 4JGBA 3SYKA 1K2WA 1RLJA 1U9ZA 5EWLB 1X9HA 3A28A 5ED0A 2I1VB 5ALQA 4OFXA 1EX9A 3VR3D 3P8ZA 1FDWA 4LGCA 3O1IC 2COEA 2ZRLA 4LYJA 3OJOA 4MWOA 1KYQA 1YNOA 3LXRA 2RCNA 1EYZA 3SHFA 2VSFA 4KXXA 4X66B 3KQHA 3ZKWA 3CGGA 4IR7A 3ZKWB 4MUIA 1PJTA 3B9PA 4AD8A 3QWBA 3TIVA 4LY9A 1U8ZA 2ODQA 2X5KO 3N1UA 1ARZA 2CDNA 4N6OA 5BSGA 1CVIA 1LX7A 2F67A 2SKCA 4FCVA 4I4IA 4FFSA 5E7JA 4B71A 4YXWD 4RTKA 4L5BA 4PS0A 1HZJA 2VZ0A 4YWHA 2RKWA 3AEUA 3D1LA 1WOMA 3AEUB 1ECGA 3FX2A 4YTEA 5LC1A 2W2PA 2HYIC 3B53X 1IRXA 2JA1A 1R66A 4UVHA 4G0UA 1WCYA 3VZQA 3CXUA 1AG9A 5J3JA 1SWWA 2ZDGA 2QZ4A 3MWYW 4FDVA 4HPJB 1Y1RA 5IDVA 3P4YA 1SOWA 2Y1FA 4EAAA 1PQUA 1YQDA 1IBLB 2P3QA 2H59A 3GC6A 3HZRA 3KC2A 2EIXA 1I30A 2PSSA 4JLPA 4NOMA 4LJRA 4DUYB 2P2GA 3MVEA 1DP4A 5B1DA 2JEYA 3VSDA 3NP9A 3BH7A 4RF2A 2GZDA 4LJYA 4ARAA 2ZIEA 1EWTA 1EUCB 1YJAA 3CBGA 3MRSA 4NBSA 4LOIA 3M34A 1R6UA 2HIAA 3CZ5A 3LPCA 1YZUA 4GLFA 2IPXA 3R4VA 2C4NA 4CM1A 4TV8B 4DLWA 4EM6A 2N1BA 4MS1B 1AMUA 1S96A 2E5FA 4EKYA 4YRPA 2PT9A 4QYTA 4BC0A 3DQQA 3K6KA 1TM1E 1UOPA 4NG4A 4KMRA 2L18A 5KYWA 2WYOA 5KYWB 5TV2A 1MDBA 2GN1A 4WKCA 5D51S 4Q7EA 4ND3A 3LDHA 2FEXA 4DJ5X 5MN6A 3N8NA 3HCNA 4YAFA 3PQCA 5SYNA 2HQ1A 2HY7A 4I55A 5F7OA 2D0IA 1Z2EA 1FS6A 4QQNA 2OO5C 3KZ1E 1GAWA 3CZCA 4AQ7A 4ETMA 1DI0A 1JLLA 2C0PA 3SC2A 1JLLB 4TRRA 4XJSA 1R6VA 3PEEA 3U37A 5LOVA 4L2IA 2CZGA 4FD3A 5GTDA 4L2IB 5JZ9A 3BE8A 5LD2C 7ABPA 2BY4A 3AOGA 3LC1O 2YZKA 3PWZA 3DA8A 3STWA 2G5CA 1MJGM 1ORIA 1P74A 1GGEA 1ZFNA 2YUTA 3B7PA 4RCYA 2OEPA 4AMYA 4EY6A 2GT1A 2QTBA 3GJRA 3ZGZA 2PL1A 1T9CA 2QM3A 2QVBA 2GD0A 4AKGA 1PJCA 5EJMA 2Z6QA 4P82A 4HTAA 2XCUA 1QGED 2KSQA 1E2IA 3A1DA 3JV7A 1AB6A 4E70A 4ZGWA 2ZJ0A 1QE5A 3TXXA 4N8SA 3ZR4B 3CW2A 3JQPA 1BMDA 1EXWA 2ZRMA 4Q3OA 1RFLA 3E1SA 4B5LA 5HCIA 1L4FA 3WNCA 1KEUA 2DQ4A 3L1UA 5IH3A 5BPHA 2PT5A 2EU8A 3KCNA 5HF6A 1SVIA 3PKZA 5G0SA 4TMTA 4V0ME 3VNBA 3O2QB 5KOYA 3LC0A 3RGWS 2F90A 4PO8A 4ND8A 3KLPX 3UGTA 5K9ZA 5TQ2A 1TAHA 3PQEA 1TCVA 4WJZA 1Q77A 5K3FA 3IAHA 4JXKA 4CQLB 1ZD4A 3GOHA 4GGOA 1XNJA 1GEEA 1L6RA 3C1TA 3IODA 4W5RA 4OLBA 4TZKA 4AO8A 1E4OA 5TSDA 3MIZA 2QTCA 1ZGGA 3A25A 1AA6A 1JIXA 1FBTA 2JFXA 1A27A 3DP7A 4ZT7A 1HDGO 2X0DA 3X3HA 3ZD6A 3JARB 1QYIA 2HF8A 3HEBA 3LT5A 4RQAA 4PZYA 4WW0A 4OHBA 4RDIA 1NP3A 2BSAA 3PQ3A 1GTSA 1OXSC 5BW5A 2HR1A 2RH9B 5ESRA 1I4WA 2FN8A 1BE8A 1IZ7A 1JXMA 3HVHA 4AURA 2AFVA 2G88A 4QG7A 1RAAA 1L5GB 5B3AA 2D5IA 1RPJA 2R1VB 2QL9A 5AR1A 4E08A 4PZZA 1N2OA 4PG7A 1SZDA 3RW9A 3F97A 5F2KA 3KSDO 2FN3A 1NDQA 4GPD1 1PQ4A 4TKVB 5CXUA 4ZVTA 2QN1A 4ENPA 5C35A 4F93B 1Q16A 1ZIDA 3PHGA 3C8HA 4W9NA 2O7QA 3O8OB 2QB5A 4RD2A 2CXUA 3X1JA 3OO0A 3SQXA 3NTVA 1DMRA 3V48A 2D6FA 1Q83A 4F06A 4JXXA 3ICQB 4YRLA 4JJAA 2CUNA 5K4AA 5DULA 3OPYB 4P5DA 4HYTA 4UHEA 3PC3A 1RAGA 4NNOA 5FTJA 3KSZO 5GJWC 4XIJA 4PIMA 3EDOA 3K9WA 4MUMA 1SN7A 4OHVA 5EP3A 2NTVA 2R1ZA 3CW8X 3VHLB 3KETA 3FOFC 1Z25A 3Q8KA 3DHYA 4B6RA 5D01A 4OP2A 2DH6A 3OT1B 4BX8A 4A0RA 1VCNA 4RM2A 2YNMA 4AXXA 3PKJA 3WB0A 3K4HA 3Q88A 2BKVA 2PRIA 3OM8A 2WU3A 5JSZA 1TCBA 3MMXA 3EW7A 3H42B 4QATA 2BUBA 3MWKA 2VHTA 4JR1A 4N7JA 1SUIA 1FK8A 1T10A 5C1IA 4ZAGA 1RJFA 1AKWA 1U2GC 3V5NA 2R68A 3IAM1 3O38A 2ICAA 3BWYA 1WQ4A 2E4ZA 3IAAA 2RAPA 2ZATA 4HKTA 1WZUA 5AVRA 4ZRNA 4NULA 2YWEA 1TKCA 1YDEA 1YE3A 3KKOA 3GXOA 1NXPA 2JF0A 4PXSA 5IEJA 2FI1A 3LA6A 1P2TA 1S1MA 2A92A 1VBKA 2FUCA 2E4UA 1QFSA 1QBKC 1M1NA 2P0YA 2QAGC 2CXPA 2QRPA 3GJ7A 4IHKA 4TWAA 1Q21A 5IEBA 4WRRA 1U0GA 3DPIA 2FWNA 3UAWA 2RKBA 4EF4A 4V2IA 4TS4A 3U31A 1UODA 1XU9A 4JMPA 4KZPA 2PS0A 4BN5A 4I5DA 1JX6A 4GXQA 4FSXA 4O2AB 3IELA 4XGKA 3SHTA 2C7BA 1ES9A 4Q6BA 2RG1A 4Q82A 2J09A 4ZOCA 3A14A 2ZREA 1JHYA 1KK3A 3ZHOA 3V8VA 3X2EA 5K6AA 3K1ZA 1YQTA 4IBOA 1LLUA 2C5GA 1JPVA 1YZNA 2D59A 2GQ0A 2WV9A 3K0KA 2WSLA 4GYWA 2G1AA 5HMLA 5AW3A 4URXR 4HQOA 3G2QA 2IEDA 1RWQA 2ZIAA 4QBKA 4WNCA 3D6VA 1QIGA 4GX2A 4RF4A 3K1JA 1KO5A 4LXGA 3THSA 2IYLD 4EG7A 2DSNA 2IHBA 2WPDD 4DA0A 1X42A 2N47A 2QUHA 4C05A 1KR5A 2PBRA 3UWOA 3LQFA 3DMPA 1U2QA 2RCYA 4KQ1A 2X8AA 2JGIA 2XIJA 4JKIA 2EBFX 4YJ2B 4NATA 2WEKA 4WINA 3I52A 3V8NA 1TAQA 2A2ZA 4JFAA 5KNDH 1PV4A 4V1CA 1PYDA 4OQEA 1V1JA 2G4CA 2IUSA 2XUQA 1BN7A 4NU5A 4GAEA 4Q1BA 4F21A 4IKOA 3SHVA 1XXLA 4GI1A 3WK8A 3VOSA 1BDJA 3NBXX 4WQMA 5FWAA 4Q4AB 1RXCA 1KI7A 4M9XA 1IHXA 5AMXA 5KOJA 5LQCA 3K0FA 2Z2JA 3K0FB 4GPZA 1E2DA 3NBQA 3MJSA 5FJJA 2PZBA 2JBWA 2E85A 1VSBA 2A8YA 2ZSKA 4AJHA 1E2HA 2DWQA 1ACJA 2ZR8A 3FCYA 1YB4A 3KUUA 1GLNA 1CD5A 2PX6A 2QUAA 3D5TA 3JQCA 3SXPA 1B3BA 1Q0SA 4I8IA 1WEHA 5EP1A 4LCBA 2GD6A 1XDSA 3PGLA 3QYAA 3CH7A 2HWWA 2BLNA 5CFOA 5JROA 4CLRB 1MXFA 4FGLA 4GSKA 4KXFB 1V3UA 3EGWA 1Y3IA 1G21E 2CC2A 2RIRA 4B6GA 1J0BA 4D02A 3UF0A 4EY7A 3KLMX 1NVTA 1TJ3A 2RARA 2LP4Y 5JR3A 1C0PA 1VKJA 3ILVA 4BJ1A 1WDLA 5L3QA 4D82A 5L3QB 2CXSA 3CB2A 1I2ZA 3RU2A 4IDNA 3KYBA 1FFBA 2BFEA 2J3DA 2IPMA 3SMQA 3PX3A 4XD7A 2O3SA 3GXBA 1G17A 5KNBD 1NVMB 1NBIA 2VPTA 2VAMA 1LH0A 2IVFA 3EMKA 2CLKB 2WPNA 3OURA 1YC5A 3AKYA 3QOFA 2QRQA 1D09A 3BCHA 3FYTA 1XROA 2EHDA 2AI1A 3IMCA 3OFKA 1I36A 3KQTA 2W93A 4K6KA 4KP7A 2E48A 2I22A 2JNWA 3DDUA 2J3QA 1YS2X 3FFXA 3F74A 1GG2A 1UPAA 3FWKA 4IV5A 4BP1A 5AFSA 3H16A 2Z8ZA 3HUDA 2AFIB 2G28A 3GDFA 4NYJQ 2I6SA 3COJA 1KVQA 2WJIA 3THWA 1J7KA 4V0NA 2IA5A 3PYXA 4WASA 1XRPA 3S5JA 1FVOA 3HA7A 5TDHA 3EW9A 1SVNA 2GM4A 2BE9A 3QXXA 2DKFA 2RB5A 1PUJA 1J00A 2Q49A 2Y4OA 3AWDA 3JRNA 1NP6A 4OMFG 2HU2A 3SU8A 4BO2A 1OWLA 1NYLA 2ECQA 2FMKA 4XIGS 5FOXA 4DIUA 621PA 1C9DB 2BL4A 1SXPA 2HX1A 3MOSA 1R5NA 2F1HA 5BNZA 5IJWA 3ZK7A 4DR2B 5TVGA 3G1TA 2Z83A 3IO5A 4JLOA 1NN3A 4ZQBA 2DB3A 4TM7A 4FX5A 4RE5A 5F77A 4QUDA 4ABTA 4RXUA 2VDOB 2SBTA 3V1TC 3LXXA 3PYLA 4G0YA 4PVCA 1HTWA 1L8LA 4OATA 4EA6A 3GU3A 1BCSB 5DHTA 4R8KA 1TD9A 4V38A 4MGIR 1KO4A 1Z9BA 4WKPA 2NYRA 2VDUE 3FAKA 3L93A 2JFBA 3MT8A 1DJNA 1R0BA 1WB5A 2J0VA 2B5OA 3WQBA 1U3UA 3KAKA 2UVPA 3C6ZA 2UVPB 2P0EA 4X3PA 3PNKA 1JL3A 3MJHA 2GZ2A 2WQ7A 4B1FA 3ZHTA 2UU9B 2E4AA 2AYXA 2QXYA 3Q1LA 3E22A 1Z0DA 1ZKDA 3M4YA 3E22B 3QP9A 1KP9A 1UMBB 2GAAA 4JJ6A 3JW8A 3OEWA 1B0PA 1N25A 4ZWNA 5IXJA 1HY3A 3C4JA 3S6JA 4AJ9A 4ZXFA 1WUTA 2H31A 3QEJA 5KNCH 4ZOQI 1GPJA 1OLOA 3IUJA 4AUEA 2FZKA 4POAA 2FPXA 2NQ2C 2CJFA 4O3FA 2GYVA 4NBVA 3S2SA 1TVCA 4TTIA 1JQ5A 1HURA 4ZAXA 3B1XA 3HB0A 4XM2A 3WQSB 3SDSA 2HDWA 4CLHA 2AYZA 3PYMA 1L7MA 5BWCA 3ZDCA 1G3QA 1RI1A 2BRUA 3RS9A 3T9BA 3ZWDA 3JQFC 5FRDA 1JVBA 3EUWA 4LHVA 16PKA 4NZZA 5TNXA 2H5EA 4TSKA 1AOXA 2UYYA 2QHXA 5BXQC 3KZOA 3PGKA 3U48A 1KQGA 1TA0A 2WM3A 3M1IA 4CTKA 1JLRA 1H3EA 3VYVA 4L76A 1JQDA 1S2DA 1PSWA 1WA5A 2MYTA 3G85A 2J9RA 1XX6A 3QZUA 4OUDA 1JU4A 4KIGA 4RMGA 4DCNA 2GF9A 4RHEA 1GLVA 1RRGA 1YR1A 1KRXA 3QKIA 1EP9A 1ZJ5A 5JNSA 1GD1O 1M1YA 2B6HA 5EC8A 2XKBA 1M1YB 1Z47A 3NHRA 1P2DA 4BGUA 1XMXA 3QENA 4DAEA 1K86A 1U2RA 1FRZA 3JQGB 2ZUTA 3RIXA 2FXVA 5CD1A 2XZLA 2RHOA 2R25B 4QICA 2R1TA 4C3OB 4GVXA 3U9SA 3LBNA 1ND5A 4U2GA 5SY9A 4PZPA 1BSVA 1GZ5A 3DDHA 4IFTA 4FVTA 3KWJA 2ZS7A 4UXIA 4OXIA 4IFBA 3RKUA 1KP3A 3ETEA 4H3VA 2XEDA 1TVMA 2PMCA 2BVNA 2DBQA 3G2PA 3HPQA 1VE9A 3N2GA 5JNRA 3L06A 3NHUA 1X1AA 3OUZA 2Q7XA 2B2CA 3IKJA 5K51A 1Z0ZA 2W83A 5DRYA 4E2ZA 1IM5A 3CG0A 3R1IA 1E6KA 5FADA 3BK1A 1ISPA 3LCRA 1K7EB 5EIAA 4ARBA 2M2IA 4WN3A 3Q11A 1EDZA 3N86A 2O2IA 3FBGA 4I3GA 4Q7MB 1VCHA 3BHNA 1NBWB 2IXBA 2XNCA 4RMNA 4ZMRA 4FYWA 3OC6A 5I5EA 3FSRA 4MYUA 1A5BB 1VSTA 2OD9A 2OA0A 1QRAA 2ADFA 3BILA 4MYRA 1XQYA 4MKFA 3BXZA 4QPCA 3LCMA 3T4XA 4NOKA 2YWRA 1X8JA 2AG1A 2GZHA 3IEMA 2XMPA 2I34A 3ANLA 3W78A 5JJ5A 4INJA 4ZVMA 1E4EA 1S2MA 2X14A 4INZA 5FWNA 1L9KA 1FMLA 1JEQB 1COWD 4UAGA 1R9NA 3FVQA 4MHOA 4NEHB 4QQ8A 5I8ZA 3RVOA 3ZI7A 1EI9A 1ZX1A 4U7FA 4J0JA 1Q7EA 1S8FA 2RMKA 3GVHA 4JUFA 4QOSA 5FR2A 2HYDA 1RPZA 2D1QA 1QWSA 1QANA 2WSMA 1YR3A 2VHJA 2Z9CA 3M6MD 4L8VA 3ECCA 1Q0ZA 3O4VA 2IYSA 5EJ8A 3MBKA 1H69A 4RSRA 2F62A 2PSFA 3IDZA 5P8WA 1NLZA 4KX5A 3PITA 4R2XA 3X1XA 1ADFA 1KAOA 4FBGA 3VMMA 1FU4A 4AO6A 4PC2A 4YR9A 1MU0A 3SX4A 2CVOA 4Q3NA 2G25A 1HSZA 1UBRS 1V3VA 1C1DB 4RKEA 2PH3A 4U02A 2XNSA 2L0XA 1MJHA 3OZ7A 3IYLW 2XGJA 3DTVA 3FVRA 3UKJA 1ZOLA 3FMPB 2MU1A 5DM1A 5BSEA 4LQ4A 4DRZA 4DWVA 1T3GA 1EINA 3NU1A 4G1VA 1OFUX 4KLRA 1UUFA 1CRZA 2QYTA 7MDHA 3CZPA 3RC8A 1U2ZA 1B42A 2W6QA 2ILVA 4ZQIA 2ID7A 2OAP1 2ACEA 1GZUA 3E8SA 3ISTA 2IBMA 1RWKA 3H0KA 1U98A 3LUPA 3WC4A 3DF7A 1T0HB 2D4AA 2PV7A 1BH6A 1MO5A 2Y2UA 3O92A 4GSYA 4QFBA 4A8HA 4P7JA 3L8MA 2OQVA 1NNUA 4ZKDA 3U09A 1QONA 1G66A 4DM4A 3OT4A 5JBNA 3QTLA 3NOOA 1DINA 2RAUA 4FINA 1LPAB 3QKTA 1FYDA 4ILEA 1W93A 2W8ZA 4EKIA 2BR4A 4ZVQA 3QA3E 5LNK6 2WICA 4XUDA 1W0JA 3HI6A 3HU3A 3WSTA 5HJEA 1L4BA 4TTPA 1Y6ZA 3I8XA 1XWWA 3AEQA 1D5CA 3AEQB 4TUYA 4Y98A 4NYJR 3A11A 1UZAA 1MAHA 4TUYB 5FI3A 1MOPA 1LFDB 3REQB 3EGDA 3ZKAA 3TE6A 4F6RA 3HFJA 4F9FA 4RW0A 1B6GA 1T24A 1FDTA 2QP3A 4O4JF 4Q6WA 3ISVA 4CM6A 1EHIA 1ZM2A 3UM9A 4GNRA 1QGUA 2B2XA 2OILA 1QGUB 4R2HA 5AKIA 5F33A 5LA6A 1S9HA 2W43A 1KYIA 1U3CA 2PZMA 3IQWA 2PT6A 4M21A 1KQ3A 4HXGA 2O8DB 1OXXK 1NIPA 1ZM7A 3B3QA 3C39A 4KHPB 2YBDA 3GFBA 4MWBA 4YECA 5BR7A 1BS2A 2X7JA 1XJWA 3A4IA 2FUG6 1JB9A 1DJQA 1JVSA 3K2BA 4QPNA 4ZICA 3FPAA 5JMPA 2FW0A 3OJFA 4PC7A 4CKEB 1UJ2A 3RTBA 4OQ4A 2Q1SA 3VU1A 4HR7A 1Q0PA 4YR7A 4ENSA 5I7WA 3MWFA 1POWA 1X1RA 5A7GA 2Z57A 1EWYA 1OC2A 3DOEA 1X1TA 3CLRD 4FR2A 3ZG6A 1QCYA 3OAAA 4FDUA 3OCUA 3GLVA 2P1DA 1CEXA 2ZBVA 4ZP1A 5HKKA 3AUSA 2FZWA 1F9EA 2H16A 5IABA 4F84A 3RSFA 1IUNA 5IM5A 2BELA 4YCJA 2EKDA 2XXJA 2O52A 3AHCA 1NR1A 3CTPA 4XX0A 1F0YA 4QAJA 4UD6A 4XX0B 5IBQA 3QVWA 4YMUA 5CA1F 1ISFA 3KBOA 3QLUA 1VI5A 4Y2RA 4CEHB 3CF6R 3ZTTA 2V4ZA 2PRSA 1XVIA 3I4LA 6Q21A 1E9AA 4HB2A 3PENA 1TC2A 3SBOA 1NBMD 1CUCA 1UDBA 1UKVY 2CXNA 1TM4E 5JCJD 5TS2A 3M3PA 1A98A 3IEXA 4MRVA 4WXPA 1FFXA 3MLBA 1D2AA 4ZAFA 1FFXB 4Y0AA 4E2WA 3DXYA 4I5IA 4O29A 2OXFA 1XO1A 4MH0R 2FRVA 1QP7A 2JRLA 4DEVA 3FDJA 2RJNA 5JJCA 2Y9PB 3G5AA 2WD9A 4RS4A 1P1RA 3ORQA 2AOVA 3SPXA 5FLXA 3LFHA 1DAOA 4KQ6A 4GLOA 3RWOA 3KT3A 5T5QA 2B1RA 2KYRA 3OUUA 4B6EA 2WK1A 4UM9B 4JA2A 3FVTA 1KI1A 2C3OA 4LWPA 2QMUA 3TQQA 4BN4A 3VPXA 1L5MA 4BQEA 1ZNWA 2NZ2A 2O7SA 2EFCB 2CDCA 5E1OA 4QRHA 2AUMA 3E70C 3LHKA 5B6JA 2O48X 1HNXB 1EHYA 4IJWA 2VPPA 3S5UA 4Q7QA 3L4BA 4EW6A 1Z4QA 4H16A 1I2MA 4PO1A 3ZLVA 2GCNA 1DC4A 5KTNA 1QHYA 2NUTA 5BV0A 2NUTB 2NV6A 4CODB 5A3VA 1U7DA 1RHMA 4MEAA 3KR1A 3NT4A 2ZROA 1KE1A 1YL6A 2EIHA 2W98A 2GTIA 3PEUA 3PUVA 2XMGA 4JEHA 4LS3A 5CPBA 2GM3A 4RZ2A 1RHKA 4DLTA 3T61A 3QE2A 1KWKA 1WOYA 4TRJA 2JIMA 4MJLA 1JEAA 2GEFA 3IBYA 3B6KA 1ZW1A 4B40A 3ULKA 2PNJA 2BGRA 2J6CA 3L8ZA 3FY4A 3M7IA 4GD3Q 2I6XA 3SM9A 4URFA 4B48A 2D8AA 4HAXA 1EFRA 5COBA 4XJXA 4A73A 2AN1A 2PX2A 3D6NB 3WSWA 4XE5A 1ISSA 4ZYYA 4IJ6A 3TQFA 5BVHA 4UMEA 1T8PA 4QDJA 2HU7A 1J56A 3ZGLA 3PUWA 4K26A 1CIPA 1ULUA 2GA9A 3T5PA 1IONA 4ZDIA 1MVOA 5DM60 5IZCA 3F71A 3TKAA 3EQZA 4CR8A 2K2QB 2ZSBA 4KN8A 5C2JB 2R0QC 3H2JA 1NASA 2Q0HA 1E18A 3HY4A 4I3FA 4K9NA 3SLGA 3WYBA 4UNPA 2CCJA 2DBRA 1E1MA 2I71A 3E7DA 2WABA 3HB7A 2D1RA 3T9EA 4ZGGA 3QEBZ 1PNTA 2UAGA 4GU5A 4OX9B 2EKBA 1SHKA 2GN2A 3BCRA 4FFWA 3GPLA 1SKYE 2V8OA 2CFRA 2H07A 2JI7A 1SH7A 2QK4A 3DV0A 4OD0A 5K6TA 4GZMA 4LIPD 3EPHA 3ILXA 1YOVA 1ZLYA 2PEYA 4FT2A 3GGDA 3IUPA 3EIUA 4QX6A 1Q6YA 1ND6A 3HBJA 4WDRA 2A9PA 3AOEA 4XXHA 4O33A 5J5AA 3ZI0A 5EIBD 4IIGA 2AJCA 1ULAA 4WN9A 1WPGA 1H94A 2DFVA 1U28A 4E03A 3GUCA 3ECAA 4YROA 2AV6A 3IC5A 3IOYA 3UV7A 4MV3A 1KXJA 1N5LA 3C3XA 3U7HB