5DHFA

Crystal structure of hrio2 nes peptide in complex with crm1-ran-ranbp1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
205
Chain Sequence
b'VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVPALAAQYEHDLEVAQTTALPDEDDDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
molecule tags Transport protein
source organism Homo sapiens
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
total genus 60
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dhfA00
1K5GA 4DUGD 1N5IA 3QXSA 1NBMA 2GRJA 3FKSD 4ILEA 3RRNA 5L3QB 1SZPA 5HCNA 3PVSA 1H8ED 3BC1A 3VR4A 1A82A 1EWRA 4GOKA 4G5QA 2WWHA 4JLPA 1YE8A 4FCVA 2BC9A 1EWQA 5HE8A 2QP9X 3VAAA 2GNOA 4BWYA 1CKEA 1CR2A 1ZU5A 1T8TA 4JT2A 1XXHB 1ZMXA 2WWWA 3Q5DA 4OL0A 1GUAA 3ONWA 4JVLA 2ZR7A 3U7HB 4OI1A 4FMBB 3IKJA 2NG1A 4M8NE 1IN6A 3GLHA 4WW0A 1H8HD 1KSJA 1YR8A 1QRAA 3EWAA 3IIJA 2EYQA 2P3SA 4HDQB 4IW3B 3CRQA 3FFAA 1IJFA 1UDXA 5SZIA 4A9AA 4HYYA 3MGCA 4RD6A 2ORVA 4LY6A 3B8HA 1E2MA 4DDUA 5CITA 3VNUA 3K0CA 2BEJA 1FQKA 5DGXA 4BASA 1ETUA 1W48A 2QGZA 5KO2A 521PA 2RHMA 4CT4B 2RGNC 3FOZA 2A5FA 1DAIA 1FQJA 5EXXA 4KSBA 5SZHB 2QQEA 4RVCA 5JS8A 1KJYA 2ZUBA 1E9FA 5B30A 1MRSA 2VHCA 4LV5B 1E9RA 3AQ4A 2A30A 3CNLA 5KU1A 4HDCA 3T15A 2YINC 2ATVA 5CB8A 5DN6A 2NOAA 4A2WA 1U8YA 2VP9A 3A6PC 1RW4A 1L4UA 4BFUA 2EFGA 1Z0FA 1XCGB 1O87A 4WA7A 3AF0A 4KFSA 1Z0AA 4R2HA 5CJ2A 5C18A 5K8UA 2IA5A 1YU9A 3IDQA 2GA8A 2Q3HA 1R6BX 3L43A 1OIWA 3V00A 1CRPA 5AUQA 3MD0A 3KJHA 2WIBA 3P1JA 3KFVA 2P6NA 1KMHB 1GVNB 2IYTA 3BXZA 3IIMA 5JZVA 3FB4A 3Q7PA 2ZRKA 3K8YA 1E69A 3R7WB 5F9FA 4Q21A 4Q7KA 3K9LA 3W3ZB 4GP6A 2ZE7A 4DT1B 3W3AA 4LHXA 4MYCA 1W46A 2VSOA 4U00A 1ESMA 4JS0A 2C9OA 4TYWA 1Q3TA 1A5TA 1XD2A 2DFNA 3QKSA 4GFDA 2R6GA 3R9XA 1Q12A 1QHIA 2O8BB 2OCBA 3KXKA 4DCUA 2V3CC 4U5XA 2G0TA 1TADA 1CR4A 2O0HA 2HCJB 3KTAB 1G1MA 3WHKA 1TQ6A 1TNDA 3KQLA 1P5ZB 2QSYA 1N0WA 4JJKA 1IXRC 3U7EB 4EPWA 1R10A 1RC8A 1W4AA 1L8QA 3TQCA 1S9DA 4TZ6A 5JRJA 2Z4RA 4Q4AB 2IS1A 2BJWA 2WPDA 1QVAA 2ZJ2A 1XEFA 2V8OA 4X8OA 3Q5EA 1G6OA 1W36D 3CX7A 4XOIA 4DEYA 2ZI7A 3GLGE 3CNNA 3PUXA 3U7GA 4XSGA 4NL4H 4URYR 1E9AA 5IK2D 3ZD7A 5IHPA 1EFUA 2G88A 3M0EA 4B73A 2JJ1D 1M8PA 4BEJA 1OH5A 4HB4A 4ERNA 3AVVA 2B8TA 3QPVA 2QTFA 2QT0A 1PUIA 5CM9C 1L4YA 3GEIA 3W90A 1T5LA 2W0SA 1E98A 2VHJA 2WWFA 3EX7C 2AX4A 1J90A 1FTSA 1Z2AA 2G6BA 4WBSA 2YOFA 3CPHA 2GEDA 4OQMA 5B57C 3WYGA 3JZAA 2JLSA 1OPXA 3W34A 5DI3B 4G0NA 2WHXA 1JJVA 3ICEA 1W1WA 5AJYA 4D4LA 1LVGA 4BLQA 4ARZB 4BGDA 3VHXA 1N6IA 3QKSB 3QJYA 5AR1A 5BQ5A 4AWXA 4US2R 2G3YA 2FDCA 3E1SA 4MGKR 4CZ2A 2EQBA 2FZ4A 4RZ2A 4AKGA 2HJVA 2D06A 1HQCA 2BHRA 4TLBA 4LOAA 2D62A 4LJ4A 1E4VA 4DSNA 4FN5A 4HAYA 2QL6A 4QKQA 4O2RA 5FFMA 4M0LA 3GJ7A 4OYHA 4IHQA 2OILA 3U4QA 2DWOA 5AUNB 1T9HA 2ZTSA 2QEQA 3X2SA 3HYRA 3PUYA 1YZGA 3W5IA 3ECCA 3K9HA 4LPSA 1HT1E 3CWZA 4DB2A 4OQXA 4Q02A 3U7FB 2D74A 5HZKA 3GFOA 1YZUA 3K70B 4DLXA 1XTRA 1KO7A 3NH6A 2ZREA 2O8CB 3AF3A 1NY5A 3VR3A 4K46A 4S35A 4LBWA 3LFUA 4Z8YA 4CVNA 1P2SA 4MUAA 2IXEA 1XEWX 1JB1A 1T3SA 3NEJA 4PQRA 3B1ZA 5JBQA 1CBUA 2CJWB 3RS3A 1AN0A 3BRWD 4QBHA 1ZNWA 4Q47A 2ZVQX 1GIAA 1JNYA 2V9PA 3RDPA 3HP1A 1EG7A 4QGAA 3SI7A 1Q1EA 3UWKA 3I62A 2QM7A 5DNYB 2ZJZA 2FPLA 1G18A 4JVNA 1AIPA 4B43A 3FE2A 2YWEA 3B1XA 2GXSA 1J70A 2VIIA 2PZGA 3S1AB 2WAXA 1CJMA 1XD2B 3AGPA 1W0JA 2FJUA 2OESA 2QGNA 3NHAA 4GRAA 4PQYA 1G7SA 1D9XA 2JGNA 1FP7A 821PA 2C2HA 1JQLB 121PA 1VHTA 3IPYA 3RSLA 5C4MA 1AZTA 1XRJA 2ZQ5A 3W6OA 2JDID 1CF4A 5BN3A 2Z43A 1X8JA 2ZU0C 4DBLC 4BZQA 1HY3A 1NJGA 1KKMA 3EIQA 3FHOA 3SDZA 3NC1C 3AH8A 2C96A 4Q4HB 4WZAE 1VTKA 2IT1A 2ORWA 1CJTC 2X77A 3VX4A 4B3BA 4YMTA 3EG5A 1Q20A 1MABA 4Q9HA 1NIPA 4BFSA 1JALA 1I4LD 1W4BA 5EE3A 1VPLA 1WXQA 4N0EA 1Z6TA 2BJVA 4RKFA 4LJYA 1EXMA 2H57A 4D4KA 1WMSA 1NVXQ 1UJ2A 2N46A 1G8PA 1OXXK 3KL4A 2R6FA 3B6EA 5FL3A 1AQUA 4NZYA 2H17A 2H92A 5J40A 3K9GA 1E9DA 4EJSB 1OIVA 5FOVA 5EZ6B 4EPYA 2RGGA 3Q3JB 5EQTA 3N5CA 3Q8XB 3AF2A 3SEAA 1HT2E 2YKGA 1Z83A 3WBKA 2DYKA 2XZLA 1NG1A 1SVKA 1G6HA 2ZXUA 3THXB 2KSQA 3I61A 3AVOA 4JBYA 3TK1A 2PZEA 1DADA 1VG9B 4TWZA 2GZHA 4V03A 5TV2A 4EKDA 3P26A 1KK0A 1VCNA 2GZDA 3T12A 3AUYA 2ZJOA 3KXLA 4TMTA 4A15A 1XPRA 1IN8A 3I8XA 5JCPA 3GJ3A 1SVOA 1D5CA 3KB1A 4FIDA 5EUQB 4DDTA 3BGWA 1WRBA 4JL8A 5KDLA 4OHWA 1YR6A 1KHTA 4C0KA 1E2HA 2XSZD 3KJGA 5HPYB 2F1RA 2IYYA 2BMFA 5HR5A 5EE0A 4HZIA 1UKYA 2BMDA 4KBGA 3RS2A 1NVWQ 1NJFA 2C77A 1T91A 4I4LA 1A2BA 4M1MA 3SQXA 1FTNA 3HPQA 3GPLA 3LV8A 1X8KA 1JEDA 1ZP6A 2CL7X 2IS2A 4F38A 2YHSA 3VQTA 3ZVMA 2OHFA 3GLIE 1E2QA 1KTVA 3NBYC 3OAAA 4ACBA 4OI2A 4LZZA 4M4SA 1ZAKA 4QRHA 1EFCA 5DLQC 1U99A 4F4CA 2YWGA 3QPWA 3TIFA 3CB4A 2ZJBA 4H9GA 4OBEA 2QG6A 1COWA 2ZR0A 2NO9A 3SQWA 1AK2A 3ZVNA 2BVNA 3CX6A 1SKQA 3LX8A 1PJRA 1TQ2A 2GXQA 1EK0A 4NBSA 2HYIC 2LWIA 4FCWA 2HXSA 3LAWA 2VF7A 1F2UB 4HLUC 3TH5A 4BRWA 1FUKA 4W7SA 3DL0A 4V0ME 1TUIA 3OIWA 1MRNA 1FFHA 1VYVA 1IXSB 1Z3IX 2ODBA 2ZI3A 1ZUIA 1KY2A 2JCSA 3SBEA 4V0NA 1CULC 3FMOB 4Q7JB 4QBIA 2D2EA 1MO6A 3GLFE 2WKQA 1Z07A 1AKEA 2NO0A 1FNNA 4QBGB 4RZUA 4TL8A 4DRZA 4ESHA 3DOFA 1RJ9B 2OXCA 1I2DA 2R65A 1H8HA 2ZUDA 3KUDA 4M1KA 3T61A 1B23P 4NE2A 4M53A 2CLCX 5JI2E 2GVZC 1T3LA 2CE2X 2W6ID 4F92B 4HZUA 1KO4A 3IEUA 1E1RD 2Z83A 4TT3D 2QPTA 1FX0B 2I3BA 4NMMA 2NO1A 2NMVA 4I1SA 4NYIQ 3LW7A 3NWJA 4RD4A 1LS1A 5IF9A 1E2PA 4BPBA 2AD1A 1OXTA 4Q9KA 5TARA 1OFTA 2B7BA 2W00A 2MMGA 3ASZA 1S96A 2P0EA 3ZYCA 1DPFA 4URXR 4O2LA 2ZIAA 4JLAA 3QPUA 4B3XA 5HKKA 3O8RA 1T6NA 1D8TA 5FTMA 5H8WA 4WZ6A 1FX0A 4YQFA 5JMTA 2J87A 2RGCA 4HZUB 4B75A 2AR7A 5DO9A 3AP1A 4RD2A 4FMCF 1JR3A 3QI2A 2WJHA 1W36C 1Z8FA 1SVSA 4M21A 3QE0A 1H65A 1DAMA 3EXAA 5SZJA 2X8AA 1G7CA 1NSFA 3I72A 2REXB 4TYQA 3ZZ0A 4B3GA 1FUUA 4Q03A 4GP7A 3ZJYA 2IHYA 1KI3A 4FW9A 2ERYA 2GBLC 3UATA 1N6LA 1G64A 3BOSA 3KDSE 1F5NA 2PT7A 2YYZA 4BFXA 3EC1A 2X1VA 2V6IA 3WYFA 4B35A 1RYHA 1KAGA 3BH7A 3JVUA 4PHHA 4QHYA 4EPVA 3UG7A 5DSZA 4PXAA 4GL2A 1F2UA 2BCJQ 4WXPA 3T5DA 1LNZA 4MQBA 3KQNA 2D4HA 4FMCB 4M22A 4MUBA 3SHFA 3WY9A 1UKVY 1WB9A 3W5JA 4A8JA 3KFXA 1XD9A 1LTQA 4GSYA 4L9SA 4P4SB 1TF5A 5FOWA 4LV8B 3H86A 5AWFC 3TUIC 1YVDA 4AYXA 1M7HA 3D7MA 4EFMA 1OH8A 2ZJYA 4C0JA 1Z6XA 2J46A 2VP6A 1SXJA 2HF9A 4KFTA 2VP4A 1GWNA 1VDZA 2ECKA 4KI0A 4MYTA 4GBMA 5E7MA 4BFTA 4I99A 3GEEA 3T5GA 2PX0A 2DWQA 2I1VB 3DMDA 4B74A 2XGJA 2CHVA 2H18A 1Z0KA 4Q4HA 1E2GA 1XU4A 2GWHA 1GP2A 3K09A 1KDOA 2QY9A 5J5CA 2O8EA 1QHHB 2BCGY 2HJGA 4O0MA 4MRNA 1PVOA 2GEVA 1FMJA 1Q3HA 3R8FA 2QMEA 4B6FA 2GF9A 4DCNA 1X8LA 4KHZA 2ZS9A 2CCGA 4XSHA 1E2LA 2FN4A 2A5DA 1S2MA 4ZO4A 2RAPA 2J0VA 5JWOA 4DIEA 1CU1A 3IUYA 2ZJ8A 1FW6A 3EWSA 1QHYA 2YOGA 3LO5A 4PO9A 4PSVA 2JLXA 3QXCA 4G1UC 5EP2A 2YJTD 1XWIA 1D2NA 1KJWA 2NQ2C 3DZ8A 4YLGA 4P33A 3A36A 1G8YA 2EW1A 2FEMA 3G0HA 4OI4A 4KAXA 1G4AE 3OIYA 1ZD9A 4HB0A 2JJ2A 1NN5A 4D80A 1Q44A 2PCJA 3REGA 2VLIA 4QHSA 5KYKA 3F5FA 1OKKD 5LB4A 4OK5A 4EJSA 1G9XA 1P2UA 2IC5A 2W6JD 1W2GA 2GAOA 4GZMA 3KKOA 1VCIA 4MH0R 3G5UA 2GETA 1LW7A 2K5UA 3VR1A 3E70C 4M1WA 1P62B 2PEZA 3PEYA 5HTKA 1WQ1R 4Q48A 1BS1A 4HAWA 3SJBA 1DARA 3V4RA 5C4GB 3RLFA 4IVPA 1VG8A 2ZS7A 3GLGA 4MDEA 4FMDF 4KFUA 4RCYA 1II8B 5AJWA 2Z0MA 3LLMA 4UXJA 1OB2A 1WCV1 2CK3D 3NVAA 1IN7A 1E1QA 4TYYA 1MO3A 4A36A 2A2ZA 3MMPA 3H84A 1DO0A 2HV8A 4NTZA 4W9MC 2EFDB 1N6OA 5KTYA 5DH9A 3RHFA 5FPYA 2CVHA 1BMFA 1X1RA 1SULA 1GTVA 4JVMA 2F43B 1ZW6A 2J0SA 4HUTA 3HU1A 3FPAA 2WPDD 1D6JA 2PEYA 1KNQA 4AIIA 1JPNA 2ZI4A 4B6EA 4U02A 3F8TA 1E2KA 4TMVA 4CEHB 5JEEA 3P4XA 5D3QA 3UMRA 3MWJA 3I5XA 1CJKC 2GCOA 3SJZA 2J0QA 4PPNA 2ZRLA 1G41A 1BYIA 3S1AA 2BWJA 3U3RA 4Q1EA 3QSYA 3U61B 4K81B 1BOFA 1ELOA 4N0DA 1G3QA 3U3JA 5BYKA 1W49A 2GAAA 3UWOA 4ACAA 3THYA 1F2TA 4Q01A 3ADCA 2V1UA 2HLDD 4TMZA 3ZQ6A 4PZYA 4KLZA 5KPJA 1E2FA 1R5NA 3TUJC 2OAQ1 3AB3A 3C14C 3PEVA 5FI0B 3RRMA 3VR5A 4PHGA 4JLDA 4CDGA 1OH6A 5KDOA 4DB4A 1YKSA 4LHZA 1ZNYA 4KV9A 4ON9A 4D4MA 4KCGA 3K70C 3VU9A 1ZM4A 4HLUA 4CYMA 3L0SA 3I8SA 4D81A 1BH2A 5FL7A 4BRUA 3BS4A 3W6PA 1S9HA 5D3MB 2QU8A 2FOLA 3MFYA 1AS3A 1UDWA 1XP8A 3I32A 4QNMA 4DLVA 2QSZA 1ZM2A 2QENA 4WAUA 1J7KA 5EP4A 3K70D 2PLFA 1GNRA 1NBME 1DG1G 1G17A 5KHOC 3MJRA 1SVIA 3O8BA 5K8TA 4MYUA 2CDNA 2DFTA 4MKGA 4US0R 1JAIA 1RIFA 5DI9A 2QPAA 1OHHD 1CP2A 3NG1A 4HSEA 1P7CA 1JJ7A 2XSZA 4RJLA 2ZRMA 3H2YA 2ZRPA 3U4QB 2D3WA 1NG9A 3DO6A 3EA5A 2WKRA 2V7QD 3L8ZA 4AG5A 1GRRA 1TMKA 2FFBA 3M4YA 4DVGA 4CGZA 4Z1MA 1XEWY 4LDJA 1QHXA 4LJAA 3PUZA 4C0BA 2QQ0A 4DT1A 3GLHE 4L15A 1R0ZA 4ZDIA 1G19A 1SQ5A 2ANCA 2ZS8A 4PO8A 1E2JA 1KIMA 1DAEA 2IYXA 2OFWA 3O8CA 1US8A 3LY5A 5FUYA 4CIDA 2WSMA 3FYHA 1XZPA 4TLCA 1S3GA 3W9YA 1EESA 3A4MA 3U6KA 4F91B 4GNKA 1P3JA 4DEXA 3QKRB 1RYFA 2XJ4A 3PFIA 4D6PA 5BWMA 4OJKA 3BERA 1BKDR 1FL9A 4Q9IA 1VCOA 2P6RA 2CVFA 5EJEA 3L82B 3KB2A 4AI6A 1YZNA 1W47A 2YOHA 1RRGA 1ZD1A 1HYQA 1ZC4A 3BFVA 3LWNA 1GL9B 5TVKA 1DAFA 2OLKA 1E4YA 1KI6A 1KSGA 4TLAA 1LF0A 3NBFA 2F1IA 2UZIR 3KKMA 4A0FA 1U9IA 4CT5A 5JI3E 2AWOA 2Q9BA 3A4NA 2QRNA 1KO8A 3B1WA 2FPMA 4JBXA 1G20E 2QNRA 4PPFA 4ITRC 1KK2A 4LJ8A 3E2IA 4QXAA 5AJZA 1U90A 3TMKA 4MDFA 4HUQA 3WNDA 1WP9A 4Q4LA 2FFHA 1N3BA 1YQTA 2XX3A 1UF9A 4HLQB 3IBGA 1Z2CA 2F1HA 4S2EA 3MWYW 2SHKA 1G8GA 2EFCB 3CF6R 4PC6A 5HKKD 2W6JA 1HE1C 4I1UA 2ZRGA 1ZNZA 4B44A 2O8BA 1BMFD 5HE9A 2FFAA 3TSZA 1CIPA 3DMNA 4XVRA 3AV0B 3TE6A 1TU3A 4EFLA 2MSDB 4JSYA 3VNVA 4RFSA 2RGBA 4US1R 3B7GA 3LXXA 3EAQA 3HJNA 5KDDA 3CUEF 1NI3A 4LC0A 1IN5A 1KZGB 3A8TA 5FUWA 3U3MA 2ZANA 1N2CE 3HYTA 1N0UA 2XXAB 2O0KA 4Q7MB 4B3DA 1YZKA 2PX3A 1ZINA 2GCPA 3NDPA 2FE4A 3SOPA 3TQFA 2GDJA 3W8NA 4LJ6A 4DXAA 5TB5A 3AF4A 1OKKA 2ZRNA 5FUVA 1OYWA 4UKDA 2JJ2D 4IDPA 2NPIA 4TL7A 3GFPA 5JHGB 5L3QA 1HTWA 2FPKA 2V7QA 3SFVA 3FWYA 4OK6A 1NLFA 5EZ5A 2GTPA 3HR8A 1G5RA 4JLNA 2YWFA 4UNNA 4C0HA 3AVXA 1L7VC 4NCHA 2RMKA 3AVTA 2GXUA 3DDCA 1F48A 4IDNA 4JLBA 4W5WA 1Q22A 3AKYA 4TMKA 2J59A 3IHWA 4CEIB 2ONKA 2HT1A 4C3ZA 1ZC3A 2JLZA 2ZETA 2AN9A 3ZDQA 4PSKA 5AK0A 4EPTA 1W7AA 5JHHB 1KI8A 4ZCLA 3DM5A 2WJYA 1DELA 2RGDA 4TTRA 3ZIAD 4P32A 3I5YA 1CJUC 5ANRB 1W0KD 2L0XA 1BO6A 1N6PA 5KSZA 3RYTC 5KSPA 4ZCMA 3C16C 5FL7D 1GITA 3LBNA 3Q9LA 4ZI3A 2P2LA 3TR5A 1UKZA 4G5SA 3C5HA 4JLKA 1ESNA 2Z4SA 3B78A 4LV6A 3W8RA 4A0HA 4XTRA 1ZIPA 1NVVR 5FPTA 3B1YA 2BBSA 1W36B 2ZSBA 2IW3A 4AK9A 2QAGA 5G53C 2C9YA 2VHUA 4LBYA 3OFND 1TEXA 2ZSAA 3ADKA 4XD7D 1ZUNB 2R6CA 1OSNA 4LUCA 3TR0A 1Q0UA 4QM6A 1XCPA 1G291 5A4JA 5J4VA 5LBIA 3OE7A 4UNRA 2E9SA 1OV4A 1KJZA 5K8LA 2VHTA 2XOKA 4V02A 2AL7A 4QJ5A 3IPXA 1EFRD 2ZRDA 1YJ5A 1M2OB 2C04A 5FPHA 4Y0VA 2VRWA 4PX9A 2CL6X 2RKOA 3CR8A 3T06B 2XZPA 1PLKA 3K53A 4HAUA 2BMJA 2OFXA 2OFOA 2P67A 1E0SA 3Q72A 3QXXA 2WM9B 1J2JA 2YVUA 4QGFA 4WZBE 2R6DA 1XXHE 3CBQA 3QVUA 1D2MA 1RJ9A 3GJ5A 4Q00A 1UKEA 4X8MA 4W5JA 3EPKA 5TDHA 4NYIR 4B2IA 1Z63A 4PC3A 4HB2A 4GI7A 5J4LA 1NBMD 5CDFA 3WRYC 5EE9A 1SVWA 5TY0A 1NN3A 4O25A 2FX3A 2VBCA 2ZYWX 3AEZA 4LC1A 2BV3A 4HDOB 1VHLA 5LPNA 2FWRA 1HUQA 2NZ8A 2J5XA 5KSOA 2QTVB 3QKTA 3A58B 3GP8A 1D2EA 1VKJA 1VYUA 1ZUHA 2IHBA 3LA6A 3R9WA 4ESVA 2OO7A 5KNBA 2HUPA 4P3YA 3HDTA 1JQJC 2Q0HA 4KXFB 4A0GA 3THWA 2YC4C 3MRSA 3ZLJA 1LFDB 1EGAA 4AKHA 3NHBA 1JPJA 4AC9A 2LKDA 3I3SR 1B0UA 4UQOA 4E03A 3QNUA 4DKXA 2JDIA 1P6XA 2CNWD 4FD2A 5DYGA 1S1CA 3EPHA 2W6IA 4BEBA 4TQ9A 1AJEA 3WP1B 4B2PA 4X8HA 1QVRA 2XNDA 1RPZA 2J0UB 1T0HB 4B32A 4ZDJA 5IRCD 3WNCA 2J7PA 5F98A 3FTQA 1U94A 3A1VA 3PUVA 5J4YA 1R8SA 1SVMA 2NTYC 1SXJE 2WWXA 3I73A 3L0PA 5JFGA 4OHYA 3UXMA 4BECA 1X1SA 4NH0A 1PZNA 4TTQA 5FOXA 3OIUA 1U9IC 3CR7A 4QHTA 1Q1QA 4YMVA 3CH5A 3L0IB 2QAJA 1HH4A 1MV5A 4C2UA 2CL0X 1NLYA 1DVRA 4TSFA 1JR6A 4OK3A 4V0KA 4YONB 2OT3B 2Z5FA 4R9UC 2F3RA 5JCZA 5GVSA 3QUSA 1OFUX 4OJQA 221PA 1DE0A 1J8MF 5CLQA 1P73A 3MWKA 4JVSB 4C0LA 5AJVB 2D7DA 5DHAA 2DB3A 3F3YA 1FPMA 4DLZA 1OHHA 2H8KA 3RS0A 3EW9A 4B48A 2JASA 3FVQA 3GJ6A 5F9HA 3PCRB 3CF2A 1YR9A 4PFSA 1ZCBA 3H0KA 1IN4A 3HPRA 1G7TA 4PAQA 3SR0A 4NCIA 2C95A 4K8OA 1W2HA 4CRWB 1KI4A 4IEIA 4P4TA 2CNWA 2ZI6A 2EVWX 3R9IA 1Z47A 5G40A 1QF9A 4LYHA 3T1OA 1N5JA 4A1FA 3BWDD 4TTPA 2IYSA 2BBWA 3A4LA 2VH5R 5DISB 2FH5B 4XVUA 3DHWC 1T5IA 3SS8A 4MKFA 2AFHE 1GOTA 5H1YA 4HLDA 3THOA 4B3FX 4Y0AA 3KKNA 2ASEA 2J1LA 4LRWA 4B71A 2ZI9A 4RSGA 4XIGS 3ZVRA 4DWJA 1CR0A 1Z28A 4PZZA 4XH9B 1S1MA 2XTZA 5G3YA 3OEEA 2ZE6A 2REBA 1AM4D 2EFEB 5C2JB 1ZRHA 2MSCB 2QAGB 3H4MA 3QG1A 3QENA 1KAOA 1VYTA 1S3SA 3N2EA 1U8ZA 4EPXA 2X2FA 5DYIA 4E09A 1MH1A 2IK8A 1S4QA 1LY1A 3SBDA 4JSTA 3REFA 4FXPA 3IGFA 3EZ2A 4BLPA 4NCKA 2QP4A 1E3MA 5J47A 1G7RA 1AS2A 3F0TA 4TT3A 4LJ7A 1VCMA 4DZZA 1NRJB 2GEUA 2ZE5A 2D2FA 4BFWA 1U2RA 1CTQA 3T34A 1R0YA 1OW3B 4GPTA 4KO8A 5EUMA 3GMTA 2WMOB 1NN1A 2ORIA 5JJKA 1OFHA 1ZM3A 2JA1A 5F3WB 3GLFA 4QJ4A 4GZLA 3U44B 3ND8A 1S8FA 4LYJA 2ZRJA 3U60B 4KITB 4II7A 2CJWA 1IM2A 2B92A 4JKIA 1JEEA 4DDWA 1Z6AA 1TUEA 4LHVA 1PLLA 1IXZA 3ZQJA 4W5HA 2IYZA 1IAQA 4BZXA 1E32A 3TW4A 2HXYA 4MITA 4Q66C 2O8CA 1WF3A 4KYUA 2J41A 4MYHA 1HE8B 3PITA 4XD7A 4KODA 1R0XA 3ZVLA 5J4HA 3DOEA 5HCIA 2WOOA 1GL7A 3O8DA 3QXHA 3QKRA 4AY2A 3IEVA 1IHUA 4YXWD 1KYIA 1X86B 1QHSA 1EFTA 1US8B 2ZUCA 2ZJAA 1HURA 3FFBA 3NC0C 4RD1A 3FMIA 1MOZA 2ZYVX 2R8RA 4BLOA 1MR3F 2Q9CA 3OAAD 2UKDA 2XB4A 3SYLA 4JYBA 1IQPA 1P75A 5AUOB 4XVQA 5TXGA 5A5GA 4M9XA 2XB2A 1Z6GA 1IY0A 2FNAA 5FI1B 4L5BA 4PZLA 1NVUQ 3K09C 4ARZA 4NPHA 1AGRA 2GJKA 2BBOA 3P32A 4AKIA 1KSFX 3KQUA 2BKUA 3SJCA 1TTTA 2QMHA 3AKEA 1I4TD 1NF3A 2W2VA 1KI1A 2W0MA 2ZRHA 4XWAA 4O3MA 2C99A 4MGIR 4YXWA 4A6XA 3VKWA 2XOKD 3AVWA 3PIRA 4L9WA 3TSWA 4UNQA 1KO5A 1W5TA 1YR7A 1C4OA 3IBYA 4NU0A 5EXTA 1RRPA 2A7QA 3M1IA 1HA3A 1GILA 4HB3A 2VQSA 4OQLA 4JMPA 2MMCA 3B9QA 2BMEA 3KZ1E 4TLEA 2GK6A 4D0NA 1E0AA 3OFNA 5H70A 2HEIA 5LD2B 4JLJA 1VMAA 1E9SA 3SN6A 4BUJA 3BE4A 4M9ZA 5E3HA 2FMXA 3VKHA 4EIWA 2WMNB 1EX6A 4NHOA 3OEHA 2BDTA 4UJ3A 2KE5A 5FR2A 1NLZA 4LI0A 4ZPXA 4EAQA 2OCYC 4NDZA 1FOEB 2XNDD 5AJXA 1GM5A 4R71A 3THYB 2C8VA 5FOTA 4GDFA 4J0QA 2GKSA 2GJSA 4JKYA 1U0LA 3BB4A 1R4AA 5DIFA 2GCOB 3GJ8A 3QEOA 4GOXA 1XTKA 5FTNA 1XEXA 5B58C 2WVJA 4RCZA 4H1VA 1G4UR 2ZI5A 4QNRA 4AURA 1E9EA 2G1KA 3QOFA 3FKSA 4L4UA 1JR3D 3O47A 2IUTA 4FWTA 4DUGA 2R2AA 4QM7A 2P65A 3SHWA 2XEXA 3WXMA 4F93B 2ZAMA 3CPEA 1JBKA 3CONA 4PQFA 3KUCA 4BFYA 2CHQA 5KOYA 1GG2A 3AVYA 1NIJA 5FUXA 4KFRA 3KJIA 4PTLA 1TF2A 3K0AB 1II8A 2ZRAA 2ODEA 2ZU6A 2J3EA 3GLGB 4B33A 4JBWA 1W0JD 4XJXA 2PMKA 2Q3MA 2VYFA 3CO5A 3NTUA 3IO3A 3TRFA 3CWQA 2CXXA 2WJVA 2H16A 3OHMA 3SZRA 3UANA 2REOA 5LD2C 3RANA 2IL1A 3B82A 3C7KA 4HAVA 4P0TA 4M1SA 5H68A 4A2QA 2OZEA 3A1WA 4JJZA 2VA8A 2GJAA 1NN0A 4PO1A 1AS0A 1E79D 1KY3A 2IBMA 3ZS9A 4DSTA 2QBYB 1NKTA 1KK1A 1X3SA 3CRVA 1ZYUA 2CCJA 2G9NA 3SNHA 4RD3A 1F2TB 2AFIE 2FF7A 2KJQA 3QF4A 4D2IA 1P4SA 1XZQA 1PUJA 1CXZA 3RS7A 1GZSA 1OT3A 4WOPA 3AVQA 3CNOA 3CKLA 5FTJA 1SHZA 3PV0A 3LD9A 5FBVB 3WBJA 3AF1A 1G8HA 5M04A 1XF9A 3GLHB 3LRPA 3SYKA 3FMFA 4JIMA 4NYMR 5DE3A 3BD9A 3TLXA 1COWD 4OQNA 4C7OB 1GRNA 4IOLA 3TKLA 2OUKA 1I4DD 2GF0A 1VG1A 2OCPA 721PA 3D3QA 1AGPA 4UXIA 2H5EA 3WP0A 4LBZA 4V0MA 1DAGA 5BYJA 3FHTA 5P21A 1GKIA 3ZIAA 1VG0B 2IYRA 1A1VA 4TZ0A 2CEAA 2G77B 3ZGXA 4BFVA 4BE7B 4EPRA 2OAP1 1HV8A 1V5WA 3I1FA 5BXQC 3CZPA 4Q18A 3SJAA 621PA 5EP3A 1N25A 1YHNA 4ZIRA 5FBQB 1Q21A 4QG7A 4L16A 2BIFA 2YV5A 2WWIA 3LNCA 3SU8A 1N6NA 4PAOA 3SE0A 2W58A 3VMFA 4Z51A 2I1QA 1AA9A 1OXUA 2BM1A 2O5VA 4HAXA 4LGMA 2B21A 1H8EA 1DO2A 5GADl 2F3TA 5AUPB 1CLUA 1UBGA 1K5DA 1Q57A 2RGXA 3X1DA 3B2EA 4EFNA 3U2QA 1K6MA 3GLIB 3QIAA 3GEHA 4ZDWA 4PSAA 3V9PA 5C46F 2NZJA 1XNJA 3UIEA 1R8QA 1ZU4A 3EZ9A 3LBIA 1GL6A 4DC9A 5IK2A 2LCFA 2BEKA 5E7IA 3TSOA 4OHXA 5GJWC 2IXFA 4LYAA 4NONA 1XTIA 3AUXA 3GJXC 5GJBA 1MO4A 4FCTA 1Q1BA 5ELXA 2ZYUX 2YZ2A 4IOKA 1E0KA 3ZD6A 3L0OA 1U98A 4D0GA 2H7VA 5LB2A 2QMUA 3L2OB 4DSUA 1PV4A 3TVTA 2NO6A 3VFDA 3SFZA 1Z22A 1QHHA 5JRZA 2DR3A 2IEYA 3HWSA 2IS6A 3NXSA 3EASA 2RGEA 1O3YA 1OFIA 2V55B 2FU5C 3LBHA 2ZM5A 4ASUA 5CM8B 3SC3A 1RE0A 4D26A 3DZDA 2O0JA 2A3RA 4CW7A 1ZJ6A 3H1TA 1ZM7A 4Q9LA 1GKUB 3LVQE 1XCMA 1R7RA 1EFRA 3KKQA 3B85A 2VTKA 3CRMA 4C4PA 3R20A 3B13B 3BK7A 2JIZD 2UVQA 3PENA 1F3OA 2ZRCA 4LHYA 1L2TA 3C4JA 2GCNA 2JATA 5SZKB 1E9BA 1T4GA 2ZRBA 3FKQA 3BJIC 3RRZA 5KNCA 1XTSA 1QG4A 4QOSA 4QJ3A 3T35A 3BH0A 3CF0A 3K0EA 1OIXA 1XJQA 3WYAA 2WJGA 4E5UA 2IYVA 1UBEA 3LXRA 4EUNA 1ZBDA 1HQYE 4A2PA 1GSIA 4E07A 3MUFA 4URZR 3OF5A 4WVFA 4C0AC 2CE7A 4C9BA 4D0LB 2YC2C 2DBYA 2QN6A 3NBZC 1KKLA 3B1VA 1EFHA 3B60A 3PG5A 5GJCA 1G3IA 2R44A 1SGWA 2HCBA 2OXRA 1WDTA 3VR6A 2OM2A 4LBVA 2X2EA 4DHEA 2OLJA 2GK7A 3WNBA 2CLSA 2JLWA 4H1UA 3DM9B 3VR2A 3D6TB 4OI0A 3EZFA 2G83A 2O8DB 4WIAA 3U6BA 4EDHA 1E1QD 4HI0E 2CMKA 4DLWA 5JWRA 3X1YA 2IWRA 2N1BA 4BLSA 4M2LA 2CCKA 2AKAB 2W2XA 2BKEA 3NIBA 5GJVC 4X8LA 4B76A 4C30A 2V54A 3CLVA 1UPTA 3RABA 4BLTA 4XWKA 3BFKA 4IFBA 5JEDA 1D9ZA 4RD0A 4JT4A 4KSCA 4TQUS 3MCAA 1CS4C 4N3NA 1T3HA 3D31A 1LF5A 4FI3C 4DIDA 3KJEA 3UK6A 3AVUA 1KI2A 2OBMA 4ABYA 1SXJD 2HT6A 1KDTA 1OXSC 1UADA 4PC7A 1Y63A 1RZ3A 3I92A 3TAUA 4Q9JA 4YMWA 4YMSA 2JLVA 3BORA 4B3CA 1T8UA 2FGJA 5L3VA 4LYFA 1TQ4A 4XTCS 4IEEA 3KXIA 3K0FB 4PHTA 5L8VA 4Q1CA 5HZHA 4IOJA 3WRXC 1CJVC 2QPOA 3ICQB 4QBFA 2V4ZA 2PJRA 2WSSA 1XMSA 3MAAC 4XWOA 1ZD8A 5FBLB 3LQQA 5GVRA 5EXPA 2YWHA 1MKYA 1DBSA 4TL9A 4TMXA 1E2NA 1U0HC 1JXOA 2EFHB 4Q1DA 1R2QA 1TU4A 3GJ0A 4Q1FA 3Q85A 2QAGC 1W4RA 2WKPA 1YZLA 3TVDA 3PUWA 4Q4JA 2B6HA 4NCJA 4BLRA 1GNPA 3NDBB 1UM8A 2HLDA 2ONJA 2VP2A 2IXGA 3K1JA 2OV2A 3GLIA 4CEJB 1GRQA 1QZXA 1RVDA 1E2EA 3LVRE 1KI9A 2UZ3A 4IDOA 2V1XA 2KBFA 3AP3A 4F4JA 5G41A 3CIOA 3MWLA 5A0FA 3CRW1 2BOVA 3ZZUA 1P60A 1XPOA 3U5ZB 2VSFA 4M1YA 3N2IA 1IONA 4G5RA 1XB2A 2WWGA 4ZIRB 2DCUA 2XAUA 4RY2A 1E6CA 1YZQA 2G1JA 2AD5A 2JAQA 3LX5A 4AG6A 4DCSA 2VEDA 4IFEA 2J7PD 4RFVA 4DSOA 5B64A 2ZAOA 3LW8A 3RWMB 2QUZA 3DPUA 1P72A 2JJ8A 4NYJQ 3RRYA 1G3RA 1JXMA 4TYPA 3UPUA 3A1TA 2XXAA 2AXPA 3BB3A 4DLTA 2AKYA 3C5CA 4TYNA 1C1YA 2Q3FA 1AZSC 4AYTA 2F1JA 2O8FB 3UMFA 3CRRA 1DAHA 5BW8A 3PEUA 3RC3A 4LWZA 2ZJ5A 4IDQA 4DLYA 4IDHA 1JI0A 4Q1AA 1NMZA 4EJSC 4GMXA 3EIEA 5L3SA 3T1TA 1M7BA 3R8CA 2QE7D 4TLDA 4GOJA 1FMLA 2JLYA 2I4IA 3GD7A 2HDNB 2AHOA 3THXA 3QF4B 2FZLA 1Z0JA 1P2TA 3AKCA 4JLMA 1RFLA 4HLCA 4KBFA 1CEEA 1IOZA 4I81A 4RZXA 1DTSA 3BIFA 3PR1A 4EQ6A 1KGDA 4QL3A 1FZQA 1NSTA 2R9VA 3TNFA 2MSEB 1II9A 2KBEA 4M9QA 1AQYA 1N6HA 5EXSA 2A9KA 4CEIA 3PXGA 2FSIA 3MLEA 3FDIA 3UMSA 5KUTA 5FH9A 3NKVA 2PMDA 4A8JC 4D4JA 1ZVQA 3IILA 2LKCA 3DEFA 5F2EA 2ZSEA 2FSHA 3KX2A 2PZFA 2ZROA 2ZVPX 4JLVA 2XZOA 3TGPA 1W44A 1KI6B 4KVAA 2ZSDA 3A37A 1QHNA 1TAGA 1LS6A 3V4FA 3OEHD 4KLNA 4Q19A 1YRBA 2GILA 1UBFA 4G3XA 3K0AA 5G3ZA 1DAKA 2ZPTX 3VKGA 1MABB 1OYYA 2XNSA 3UKDA 3A1SA 4A0RA 3BAFA 1RRFA 2C5LA 1TF7A 2WJIA 2FSFA 1NMYA 2WZQA 1Z29A 3M6AA 1W4CA 2FGKA 5CIWA 3RAPR 2VF8A 4RKEA 4LJ5A 1OB5A 1A4RA 3N70A 4A6PA 5IT5A 4C7OA 2NGRA 1E9CA 4RFSB 2OE2A 4WXRA 2R6AA 2Y8EA 2Z6VA 1A7JA 1P9RA 4OKSA 1V43A 4HATA 5DHFA 4BFZA 4YMUA 1GAJA 4POAA 5B2ZA 2FFQA 1C9KA 4N1AA 5E95A 1G3UA 4HAZA 4PHFA 3QVVA 3TBKA 2ZITA 4C0SA 4DLRA 4UXHA 1IJEA 4M1OA 3QY0A 1WBBA 1Z6YA 1T0JB 3OIVA 3AM1A 1G21E 2AXNA 2FSGA 1P61B 2H1LA 3T1QA 4DDVA 2QBYA 4HUQB 3CH4B 1OF1A 1S0UA 1XX6A 1BYUA 4QGGA 2XJ9A 2O52A 4IXMA 2BM0A 5FTLA 3LLUA 4B47A 1WA5A 1X6VA 4P4UA 1U0JA 2DHRA 5FBWB 1ZIOA 1IY2A 3IIKA 4NYJR 3IQWA 2GJ9A 5FR1A 3BB1A 3VU9B 2N42A 2AK2A 1GFIA 3EARA 5CK5A 1XMVA 2ZYTX 1JAHA 1NY6A 1NMXA 4Q4AA 2IYQA 1E79A 2A5JA 1ZCAA 2PJZA 3JZMA 2B8WA 1KOFA 1TX4B 3EPJA 4UNPA 4D25A 3P4YA 5BN4A 4ASUD 3IO5A 2FA9A 2GVDC 1TEVA 3KKPA 1F60A 3WMFA 3KTAA 4LPKA 4NKRA 3AP2A 2IUUA 4CF7A 2QI9C 1UBCA 2JLUA 3RC8A 4UNSA 2WOJA 2BBTA 3RWOA 4CEHA 2Q21A 5JLJA 1AKYA 1KMQA 4MRVA 3ADBA 1XEXB 4DLSA 2GZAA 4PANA 4MA4A 3R7WA 3B5JA 2OG2A 2A5YB 2IF2A 3VX3A 3C15C 2A5GA 4MRSA 1KMHA 2E87A 2F43A 3HU2A 2QMOA 3GQBA 4G5GA 2PBRA 4R98A 5EP1A 1SKYE 3FGNA 5C1BA 5KPDA 2ZSFA 4FWIB 1KSHA 3GCGA 5DI3A 1Z5ZA 4RZ3A 4DCTA 3OESA 4I1OA 4AKEA 6Q21A 1E2DA 1XTQA 1P9NA 2P5SA 1P9WA 3LDAA 1VIYA 2FV8A 3DKVA 5CB6A 2J9RA 5JECA 4B34A 3OEED 4OQFA 3AKDA 4KU4A 1Q1ZA 3C8UA 8OHMA 1M34E 4TQAA 3X1XA 1QHGA 2YNMA 3CW2A 2ZEJA 4G5OA 2E1RA 2WAYA 3CX8A 3MSXA 2OBNA 2ERXA 5D3MA 1ODFA 2CLDX 3NEYA 4NYMQ 2B7CA 3WHLA 5LDDC 1Z0DA 2WJJA 4LX0A 3GJ4A 5E4FA 5L3RA 4ZKDA 2WTUA 1OE0A 1VECA 1ZNXA 3IHLA 4JYCA 3GLFB 2XTMA 5FTKA 1XFAA 2OEPA 2GJ8A 3ZS8A 2F9LA 2ZE8A 1LB1B 2VP0A 3DVLA 4MGZR 2PH1A 3ZH9B 1KDRA 2GESA 3FHCB 4R2IA 1N5KA 2RGAA 2R62A 5FOSA 3K0CC 2A78A 4JLOA 1W0KA 3TJZA 2WSSD 1XDBA 1SXJC 2AWNA 3EA0A 1E2IA 4KYIB 5CK4A 4D82A 2EYUA 3PQCA 1VIAA 4M9SA 2D7CA 3QG5A 4LK2A 1QBKC 1OJLA 2ATXA 2Q6TA 4OHZA 4MKIA 3P27A 3I4LA 4IVQA 4NP6A 1J99A 1SVLA 4QC2A 1EX7A 1U8AA 4IRUB 4JL5A 4A4DA 2QT1A 2WICA 4TL6A 4A82A 4ZDKA 2GXAA 2O8EB 2C78A 1BIFA 4NCNA 3QQ5A 4URVR 2EU8A 4ZKEA 1XXHA 4Q1BA 2J7KA 3QBTA 3P20A 2HYDA 2QZ4A 4JL6A 3EC2A 4PC2A 5FBRB 3X1ZA 3ZZTA 4UJ5A 1IBRA 2PCLA 5CDFE 5JJIA 1KK3A 5E7JA 4IJMA 4KVGA 2NO7A 1DEKA 2PLRA 5TMPA 2OBLA 2X19A 3D8BA 1Y3AA 4BZPA 1NKSA 1UAAA 2C98A 3AVPA 2KB0A 1FP6A 2P5TB 1KZ7B 1K8RA 4MRPA 4URUR 4A92A 1XTJA 1KI7A 1E1RA 3ND9A 3EPLA 2HF8A 2KI5A 3TW8B 1Z06A 4A8JB 1N5LA 1NP6A 3W6NA 3U44A 1KDPA 1SHKA 2QE7A 3QEJA 3U3OA 3LH5A 3A1UA 1XBTA 1YRAA 5JS7A 2IYWA 1FNMA 2P6UA 3T1VA 1E94E 2F6RA 3BH6A 4EQ6B 3EZ6A 2RHDA 4V0LA 3B9PA 4CEJA 2QROA 1OXVA 2FG5A 2IYUA 3L8YA 4R7ZA 5K8IA 4C0QC 5JJLA 3CM0A 2JIZA 4Q4JB 5IDVA 3MG9A 1MO5A 5L3SB 2AK3A 1GDDA 2JLRA 4QGHA 3BFXA 3DKPA 1MT0A 1N6RA 1E96A 3RSOA 3FMPB 3K0SA 1G5TA 3KQHA 2JJ1A 2RCNA 1TL7C 3ETLA 2OSBA 2O8FA 2VO1A 3RS4A 2QRZA 1CR1A 4GT1A 3EZ7A 3QKUA 3Q7QA 2IEZA 1OH7A 4M1TA 2IYLD 2W2TA 2RGNA 3K0FA 3NBXX 2DWPA 2W83A 2CK3A 2NIPA 4PPGA 5BN5A 3RVBA 2J45A 1J8YF 1LV7A 4Q5IA 2J0UA 3BBPA 3MJHA 4MKHA 1JECA 2GBLA 1M7GA 1IY1A 4IKEA 3LQRA 3EIHA 3NH9A 4TMWA 1Z08A 1P2VA 1SXJB 1XMJA 2ODWA 4MGYR 3HR7A 1QG2A 4DJTA 4P4SA 2ZRIA 3WMGA 1SKYB 1ANKA 4HEJA 5KSYA 2JLQA 3THWB 1UFQA 1RRCA 2Q9AA 4YDSA 4FINA 1YZTA 1NNEA 2OCAA 4TN1A 2IS4A 3QF7A 4I1VA 3OE7D 421PA 5JSZA 1E99A 2VPPA 1DS6A 1PLJA 3VTKA 2O8DA 2QA5A 2RB4A 4URWR 5FPKA 4LCBA 2IX3A 1II0A 4KJZA 4LHWA 2QTHA 1W5SA 2WIAA 2CBZA 2CHGA 3JVVA 1TQDA 2EWWA 3G82C 1GKYA 4AD8A 2FEOA 4YC7A 1N6KA 2QP3A 3CZQA 2QORA 1KO1A 4GMDA 2IUSA 2V6JA 4IXNA 1HEIA 1OLOA 1M1YE 1ONBA 1XMIA 5CYPA 4F7WA 2VHQA 1U81A 2IF0A 4Q7LA 5DN6D 4G01B 1ZM9A 3CPJB 1A2KC 2XTNA 5EE1A 1G16A 1WE2A 4DLUA 1NVVQ 2WV9A 2DFLA 3QXJA 4YDHB 2PL3A 2F55A 4JZKA 5CIQA 2QM8A 3PEWA 2VP5A 4PC1A 3U3KA 2VSXA 1F6BA 2GHIA 3C41J 2G0NA 4TSFD 5EE5B 1N0VC 2DY1A 2EWVA 3OZXA 3IQXA 1R0WA 4P31A 4LJ9A 2WWYA 1UEJA 1TPZA 4B2LA 2RH5A 3TAHA 3KQKA 4PR0A 3WMEA 1G5PA 2ZRFA 5UKDA 1XJCA 1R5OA 1E0JA 4Z54A 2ODNA 3AGQA 3J81k 3PJRA 1M6NA 5FPSA 3VHLB 3HU3A 3K9NA 4IVRA 2ZR9A 4V0OA 5CYOA 5J4KA 1XPUA 4MRRA 1NL3A 2XITA 4E22A 1WBDA 1JR3E 5JWHA 1DOAA 1KNXA 2TMKA 4QFMA 3RNLA 2PT5A 4PAMA 5FOUA 1CRQA 3UG6A 4ZI2A 5CLLA 4IOMA 1DG3A 4AYWA 1RKBA 3E5HA 2VL7A 3SYNA 4OHVA 1XJ0A 1G3MA 5KNDA 1M74A 4F4IA 2C03A 1R5BA 3ASYA 4C2TA 2ANBA 3TUZC 2NPFA 3ADDA 2IWHA 1GNQA 2KWIA 4PPQA 4DCVA 2F7SA 2WBLC 4LSGA 2JEOA 1I2MA 1QDEA 2F9MA 5CJPA 3RS5A 1XD8A 2DFKB 5JSZB 2C9CA 4FMDB 4ZCIA 1Z0IA 3GFTA 4L8GA 4BQSA 3QBVA 3X1WA 1G8FA 4Z8XA 4Z1MD 2DPXA 4ZV4A 1UEIA 4U7DA
chains in the Genus database with same CATH superfamily
1K5GA 3OZFA 4DUGD 1SCUA 3B1FA 3WDKA 3BXPA 1Q7CA 3ZHYA 5GIPE 1UWLA 5CIYA 1SZPA 1SBZA 3OWOA 1RXIA 3PVSA 1H8ED 1Y34E 3GRKA 4NOJA 3VR4A 4O1MA 1Q0RA 1RYYA 1L6RA 2XWSA 5GONB 1YE8A 4RLSA 1N8NA 2BC9A 1EZ1A 4NR0A 5F2OA 4KQ9A 5HE8A 1R0BA 1UKBA 1HC7A 2QP9X 1P8AA 3A3YA 3FOBA 4L4SA 2GNOA 5C8YB 1YVEI 3FUVA 1PZXA 4RPIA 5H3HA 2NO5A 2Z1DA 3GJSA 1CR2A 1FFAA 1ZU5A 4BKUA 2PX4A 1K88A 4HD8A 4OL0A 4LGVA 1OVMA 3ASVA 1B1AA 2IHUA 5TVGA 4C3UA 4QTUB 2RAVA 2E3JA 1D0VA 3GLTA 1GG9A 4JJ4A 4FMBB 3MCTA 4MVJG 5DBGA 4M0MA 5THXA 1IN6A 3GLHA 4JQYA 4XR4A 3A6HA 2EYQA 2B4YA 2HF2A 1V16A 2P3SA 2Z3WA 3A9RA 3L8FA 5FYQA 3SFTA 5AW8A 3PFNA 1SOMA 1VPTA 5DXJA 4IL5A 4EY5A 5I7AA 5CFRA 1OLXB 3GIWA 3G0OA 4XDYA 1YDMA 5E9AA 4YV1A 2IH5A 3B8HA 1SG0A 3ENVA 3HKBB 4DDUA 3VNUA 1M6EX 5DGXA 2JD0A 1SHTX 4CMBA 3LCMA 1BNCA 1IHPA 4LJKA 3EMBA 3R7BA 3RI3A 4BASA 1PNTA 2J3IA 2ZIGA 1YS7A 1ZVVA 2OQIA 5TQ2A 2NZYA 3M5PA 3IOBA 3DDUA 1PGPA 4OHCA 1FQJA 4O4HF 1GPNA 3MSCA 1U8EA 2GM9A 2PS1A 4MKRA 5K3BA 5KNBH 5FNVB 1E6LA 4R8KA 1NSYA 5ALWA 1MRSA 2GB4A 2HHJA 1ZOSA 3LOQA 1DKUA 2I6SA 2PZLA 2OHOA 2NXWA 3HKCB 2VA9A 5TPZA 2YINC 5G1PA 2ATVA 2DTEA 2GARA 3KOOA 1X80A 5FUBA 2CFOA 5CB8A 3V1NA 2UUBB 4LFAB 1VKOA 3B3QA 1TYDE 1S7CA 1DBVO 2H2GA 2G9UA 5JISA 3W5SA 1L4UA 2GASA 2VWHA 3AR4A 4R1OA 5BW5A 2P9CA 6ADHA 1JGTA 1QHFA 4PHCA 3UK1A 3GUHA 3ZOZA 4CM6A 1D03A 2Q27A 2IP4A 2Z6UA 3QM1A 4JP8A 5CCBA 3AF0A 5CJ2A 5K8UA 2HA4A 1YO6A 3AXSA 5ICGA 1A95A 6PFKA 3U7QA 2X8JA 3MINB 4KLRA 5B3AA 4ZPJA 1DBIA 1ADBA 4DR2B 3DEHA 5BSKA 3MD0A 3NC4A 5YASA 1RXVA 2J07A 2ADMA 2WIBA 3BZUA 3F6BX 3O84A 3UW3A 3KFVA 4PEVA 4M99A 5JASA 1KHHA 1GVNB 1KMHB 3BXZA 3OFVA 2IY9A 3K8YA 2ZZNA 4BFCA 2ZDQA 3M9WA 5F9FA 2IZ5A 1EDEA 1S8AA 2NVUB 2HSDA 4QDOA 4C5BA 5JS6A 4GP6A 4XCXA 5B53A 4LHXA 2AQKA 4KUEA 3KWLA 2D1RA 1M5UA 2CFTA 3H8JA 2VSOA 3PPXA 2C9OA 5LIPA 3NJ8A 1VFPA 3LP6A 1K08A 2I3ZA 2R6GA 3AOEC 2AFRA 2OSVA 1QHIA 2OCBA 3MIIA 1RI3A 3W5DA 4U5XA 3D2BA 3HLYA 2HCJB 2O0HA 3ISTA 3WHKA 2AFHA 2NUTB 1P5ZB 1A2QA 1N0WA 2YICA 3GG9A 1R10A 3KZXA 2MR6A 4F2DA 1IB0A 1XE3A 4BJ1A 1S9DA 5IDXA 2NP6A 2C2WA 3RUAA 2ESRA 1CB7A 5C53B 1YQXA 2OVBA 4FJ0A 1DKPA 2ODQA 3NBAA 5DM1A 1S01A 1ULZA 3TMAA 3H4TA 4OFZA 5JPIA 3EFOA 3EQ2A 2LTAA 5I4KA 3U7GA 4PPYA 3D2AA 2X6QA 5IK2D 3ZD7A 3UB4A 1GCGA 1EFUA 1K9SA 1M8PA 4R9NA 4ZVRA 1C29B 1QH8B 3P0IA 4O4IB 4HB4A 5AM1A 1OH5A 5JH7A 3QPVA 2G9VA 3ORQA 5FHRA 1V6CA 4ZGBA 5CM9C 1QDUA 4CJXA 4ZOQI 2W0SA 3GAAA 2R1ZA 1XRQA 4BRSA 4K9RA 1AUPA 1QX3A 1E98A 1ADFA 1RC0A 2BFMA 2FQYA 2IGBA 2VHJA 3OCJA 2QTWB 2W6CX 2WWFA 2UYYA 1BD3A 4PCAA 3RTDA 1J90A 5B55A 5HZMA 3R6TA 1TGYA 2P7HA 3VNRA 5AKXA 3QTBA 4X44A 4L72A 3STYA 4BVKA 3WKEA 2DUWA 2QDXA 4TKUA 2FI1A 2RI0A 4UTPA 2VDPB 4G0NA 4F6CA 4QYSA 5IVKA 3NOOA 3R7SA 5IG2A 4HDKA 2OZVA 3CJTA 1GY8A 3VZCA 4KXYA 4HR7A 3ZGYA 4LYDA 3QKSB 3T5TA 4US2R 5AVXA 3H2ZA 1TAUA 2G3YA 1TYEB 4L4XA 3ZR4B 2PMFA 4ZTZB 2FDCA 1H0KA 1B16A 2F3SA 3K32A 2FZ4A 4RZ2A 3TIGA 4AKGA 3IUQA 4EBBA 1VKNA 1F0NA 1HQCA 4XAQA 2PMWB 2GRUA 2Q1XA 1JDSA 5TQ0B 1ORWA 4DSNA 4FN5A 2YHIA 3NYQA 1SUPA 2PJDA 4O2RA 1TO6A 4PCUA 3KQMA 4IILA 2RHHA 4Y1RA 2FZEA 3TQIA 1K4KA 2DXIA 2BSXA 5D86A 1X7XA 4FYIA 4EJ0A 2JGLA 3A06A 2DWOA 3KPWA 2I4NA 3UB2A 5AUNB 2RGRA 3X2SA 5JTTA 4EI9A 3HYRA 1V7QA 3IEKA 3W5IA 3K9HA 1G0OA 1XTZA 4LPSA 1FLVA 4EYEA 2AJTA 3F49S 3ZWPA 4K1LA 3HP4A 4OQQA 4DR1B 2CDBA 4Q02A 4O2AF 3U7FB 3JPWA 2N9UA 3C87A 3VDRA 1Z0UA 2VPTA 1KWKA 3GFOA 4DLXA 4L5AA 3PSAA 4HDRB 3RD5A 2IIVA 2JI6A 3E3MA 1E5XA 3WK4A 2HQOA 1Y6RA 3VR3A 5HIMA 3M2TA 1NW8A 5EMMA 3ZWXA 3B51X 2OC9A 5ALIA 3LFUA 4CVNA 1XEWX 2AE1A 1T3SA 5JBQA 3B1ZA 1O58A 2UYQA 3GDOA 2NYVA 1M1NB 3JQ7B 1ICEA 4NWIA 1CBUA 5CW2A 1SOVA 1ZNQO 4INZA 1D1QA 5HK9A 3BRWD 2VH2A 3OTGA 5CCXA 4QELA 4TWBA 4DXHA 4QBHA 3UA3A 5T3YA 1FFYA 4Q47A 3BAZA 3O8QA 1JNYA 1CY0A 1XROA 1EG7A 1U3CA 2QTAA 3HP1A 3JQBA 5A4FS 1PHRA 3HZRA 3SI7A 3WYCA 2YUTA 4TV9F 3VZQA 1Q1EA 1XZAA 2WR8A 1RD4A 1SQ6A 5DNYB 1T4CB 1G18A 2X4GA 1AIPA 3E58A 1A4UA 4JVNA 3OPNA 4B43A 4J75A 2GXSA 5TX7A 4QTYA 3SSMA 1S7GA 2PZGA 3C45A 1CJMA 1O97D 4IIEA 1WPQA 3AGPA 4CM9A 1K6IA 2EBHX 3H0CA 1G7SA 2PSDA 3AYXB 3GRFA 5AXDA 5DJ5A 4YMLA 1FP7A 3EXIA 4AXBA 4RTOA 1JQLB 121PA 3ROQA 3RSLA 3C0KA 3FZNA 2PBZA 1RWBA 2IY7A 4L8FA 1AKVA 2NU8B 3U0BA 3W2GA 1NOKA 4D56A 3U09A 1CF4A 4JBHA 1PJ3A 4H15A 3RG8A 2XUDA 1X8JA 4IICA 1HY3A 4FFNA 5HJ5A 2XYHA 3SDZA 2XCSB 1TVKA 3OT1B 4Z4IA 4V2UA 2WJWA 3S70A 2HUNA 1H5NA 1T35A 3OMWA 3OOHA 2C96A 3VDNB 1E1YA 4MQ6A 1V1JA 4F1KA 2CFCA 4OHKA 3ESCA 1YAHA 2X77A 4WFKA 3TLMA 3VX4A 3ZBUA 4YMTA 1K4MA 3EG5A 4BO2A 3ZGZA 3I3OA 3MN1A 5BQPA 2E6UX 3PE4A 3ZXYA 3EEOA 1G21A 3GFVA 5AICA 1JALA 5BO5A 5CBPA 4I5IA 5HWSA 1VPLA 1B8UA 1FQOA 4HMOA 4EJ2A 2G8NA 2NPOA 3AQIA 2UUPA 4RKFA 4UDNA 1EXMA 3KNZA 1K3TA 4Z7OB 2H57A 2QUBA 4QTXA 2FZ5A 4C22A 3IBSA 1J9EA 3FUWA 3OJOA 4FFBA 1K1EA 4YWHA 3FHJA 5FBKA 3N7AA 2NT4A 2B2CA 2WMYA 3MT7A 2QSJA 3BGSA 2H17A 4I08A 3K9GA 5KVQA 1E9DA 1NT2A 4EJSB 1C0PA 3FWNA 1CUEA 5FOVA 2Y0PA 5EZ6B 1LI7A 1L5WA 4MIEA 3AU9A 2K4MA 4MQUA 3N5CA 1ODJA 3S6JA 2BF7A 2E4YA 3D8RA 2Z2KA 1HT2E 1XZNA 2OGTA 2Y76A 1JYEA 3GRPA 4ND2A 4WTOA 1QAOA 1H23A 5A05A 5AESA 5KKNB 1JEYA 4J0GA 2HU8A 4OBBA 4MXDA 4QA9A 1VE1A 3SE7A 1G6HA 3KBOA 2ZXUA 2HI0A 1N34B 1P1CA 4GI2A 2J9ZB 5HGXA 4AT1A 3AVOA 3DUFB 3TZLA 1TT5B 1DADA 2PZEA 4TWZA 2GZHA 2A1IA 4V03A 3USES 1NZDA 3V2IA 3ZTYA 3P26A 5KTPA 3JXEA 2AOTA 5HKBA 1Q7BA 4HXEB 5NULA 2GZDA 4C43A 4HS4A 3K9CA 3JTEA 1GGEA 3T1YB 1QYRA 3GJ3A 3IVGA 4FIDA 4DDTA 3MNFA 4F2HA 2XIJA 3OT5A 4W1SA 1EHCA 4J8PA 1M54A 4JHXA 5KDLA 5IUJC 1BA3A 1YR6A 1BE8A 3MBOA 1KHTA 3HA5A 5BR8B 1SVNA 2V5UA 1E2HA 5AKEA 1Q1AA 5HPYB 2IYYA 5LYYA 2VTVA 5EE0A 4HZIA 1GLVA 2BMDA 1S3IA 1URPA 2ET6A 2PHZA 2ZT7A 3G1TA 2C77A 4I4LA 5LWQA 1VE7A 2E7ZA 2D0PB 1FTNA 3GPLA 1XTTA 3QMPA 3SX0A 3PI7A 2F8TA 2IS2A 4R2WA 1C5KA 1Z75A 1XAGA 4ZVMA 5LP6B 1E2QA 2D5LA 2IX9A 3TTSA 1KRWA 2FW0A 1EFCA 1KP2A 1Z7YA 4AJLA 3BG5A 4F4CA 3UJNA 3CB4A 2ZJBA 1K0FA 3E8MA 1DV2A 4H9GA 4OBEA 2YR0A 3Q9SA 3NAZA 4R2LA 4NBWA 3ZVNA 1BCSB 3LT4A 1U8FO 1CQWA 1UFKA 5EZYF 3Q2IA 3FXAA 1SKQA 3T7EA 4BNIA 4MIOA 3SQMA 4ZOAA 5E3JA 2ZWOA 4WKOA 2HXSA 1CUVA 1GEGA 5JNTA 1F2UB 1R0KA 4HLUC 4P81A 1PX0A 2BY4A 5EQDA 1GT91 3OIWA 4TV9A 1PJ4A 1QS0A 5G4LA 1VYVA 1IXSB 1ZD4A 2XCUA 5HRUA 1V9SA 3FUCA 2E21A 2FR0A 2WD7B 1YVPA 5JYBA 3MT9A 4LOLA 2H63A 5G0SA 1FDOA 2VVTA 5DNWA 4V0NA 4R8MA 2V9ZA 1Z5GA 3S28A 3PC4A 5JJBA 5JZSA 2Y92A 1I51A 1MLDA 2WKQA 1Z07A 4FILA 4FLMA 1FNNA 4ESHA 1FU7A 1M1YA 5FWXB 3DOFA 3FHLA 1I2DA 3KUDA 1OU4A 2ZUDA 3NP9A 3RUEA 4P35A 4M86A 4EHHA 3GZ4A 4ZHSA 3SVZA 1WR8A 4FR2A 5L6MB 4G97A 1DLIA 1KJ8A 1ZW1A 1PJ8A 1XZMA 2OD2A 2P9GA 3I6ZA 3OP1A 3K2EA 4P38A 4WFIA 4X1IB 1C80A 3EBLA 1HO3A 4HZUA 3N74A 1KO4A 3IEUA 4B7AA 4E08A 2QPTA 5BV8A 1X7HA 4NMMA 3UCXA 2MU1A 1WF6A 3QX7A 2BGRA 3MK31 4AWBA 4NYIQ 1QF6A 3LW7A 1LS1A 4YJ2F 3VR0A 4BPBA 3CFYA 1U0EA 2AD1A 3OU2A 2WFZA 4MA5A 3MELA 2I34A 2VYCA 5TGTA 2W00A 4PF1A 1Z6ZA 1O6GA 3MHPA 3ZYCA 4HMQA 4ZJYA 1R8YA 1T15A 4KJXA 4XZ3A 1EG2A 3D3NA 3MJSA 5L53A 4FYHA 2O7QA 1CZHA 2QRLA 4O2LA 2V7BA 5BSMA 2BH2A 2QPLA 3B9RA 2YXDA 1ODTC 4YQFA 5JMTA 2J87A 5HA5A 3L7BA 4MPDA 1UH5A 4B75A 2J85A 5DO9A 1RI1A 2LCIA 1U65A 4WL0A 4AP9A 1Y1PA 3JAKB 3EB9A 3LNTA 4RD2A 4WX2B 1J07A 4FMCF 1JR3A 3QI2A 2WJHA 4PLWA 3FCXA 2NXNA 3F2IA 1RVV1 5LDHA 1UIMA 4A16A 3R7FA 1CB0A 3AZQA 3DDNA 3QE0A 1QE0A 3PNVA 1A69A 2EJBA 1YDGA 2NZVG 2AOTB 2REXB 3I72A 4YCLA 4D4GA 4CIVA 2NU7A 1FUUA 2IV3A 3SC2A 4ZZ1A 2IXTA 1Y48E 1JQKA 4GEGA 2IHYA 4J29A 3ECAA 4GMKA 3ZDXB 5M7EA 1RWOA 3LQ1A 1QUFA 5TPWB 2PT7A 5B2EA 5LUBA 3TX2A 1TZJA 4MV5A 3VUFA 1TC1A 1N2CB 1QGUA 2D1QA 4EPVA 4PHHA 1YB2A 4QLOA 1LRLA 3HVUA 1AF7A 1V8BA 2ATCA 4BGIA 2P4SA 3T5AA 1DC5A 1UDCA 2PUHA 3KLMX 3T5DA 4TXLA 1K3FA 1NUSA 4W7IA 4IGKA 2D4HA 4FMCB 1NYQA 1W5FA 4OB7A 1B0ZA 2ZIXA 4DY4A 4BX3A 2E5WA 3O90A 4ESOA 1PR9A 1T8SA 4GSYA 4P4SB 3U13A 4L9SA 1EWYA 3TUIC 5BXYA 3BL8A 5AWFC 1I0IA 3LUCA 3LMKA 2P35A 4J9UE 1ILEA 2J9FA 3HRIA 3R5KA 3KV1A 1DSSG 4GR5A 1OGYA 2J46A 3HHEA 2QQ5A 1Y3IA 4X95A 3RV3A 2HF9A 3MOIA 2FYTA 3U7IA 5FEUA 2ZUFA 2AFIB 1GWNA 2OWDA 1P77A 2ECKA 2QYHA 1OFVA 3GBSA 3VSAA 3ZW9A 1KBZA 1UCFA 1GGMA 3F2VA 5IAOA 4LVCA 4YJ2B 5DX1A 3F7NA 1X1DA 1P2GA 3RVJA 4MCJA 1XLWA 5EWLA 2X8WA 1E2GA 1TOAA 4D9BA 2R85A 2GWHA 5JYDA 3GGGA 3RUPA 1PR4A 1PTKA 4JJ6A 3P8ZA 1YQWA 5J5CA 4KSYA 4GR4A 4J3JA 3H7IA 4B82A 4B6SA 2HJGA 3IHKA 1PVOA 1M6YA 3GW8A 4EZIA 2AF3C 5CDSA 3R8FA 4PGAA 4B6FA 5AI0A 2FMKA 2GF9A 4D7AA 3QVGB 4LYEA 2VDRB 4MV7A 4XSHA 1E2LA 3UV7A 3RYCA 4DV3B 1JLLA 1S2MA 4Q82A 3QE9Y 3LY9A 4HRAA 2O8NA 1FW6A 1QHYA 3QXCA 2NV0A 3I0MA 2YJTD 4WJKB 1NONA 1XWIA 3F7TA 3E6AA 4KPFC 2CXQA 3CT4A 2NQ2C 4YLGA 2BRUC 2EW1A 2FEMA 3NT4A 4RUKA 1SRQA 3L8DA 2Y66A 4HB0A 3IE0A 4KQXA 5F1OA 1RLTA 1TKRA 2JJ2A 1Q44A 4MUJA 4CWAA 5KTMA 4QHSA 1OOEA 3Q98A 5K05A 4WXYB 5EG5A 1Y1QA 2A1UB 1G9XA 1P2UA 2PIAA 1QYVA 2IC5A 2W6JD 1FXWA 1W2GA 2A8YA 2X4IA 2XGSA 1XTBA 3I2HA 4I55F 3ES9A 4UD6A 2R60A 2GETA 1LW7A 2VPIA 3G5UA 3LRTA 4RDHA 1J2YA 5H9VA 3B36A 4RY9A 5E8RA 2P68A 4AZVA 1B00A 3OPYB 3TW8A 4ZCRA 5BSWA 3VNBA 1EM8A 4Q48A 5CEEA 4HAWA 3R3HA 4LRTB 1BXGB 1DARA 2BFFA 3G2IA 3LVBA 1Y4DE 4M8KA 5LP6F 2BFPA 3G8AA 3FVVA 4JJ8A 3GFSA 4L0DA 4RXMA 4MV8A 3ZJUA 4KFUA 5JAMA 4EVSA 5HOQA 2ZVJA 1X13A 3LLMA 1Z73A 3WXBA 1NV9A 2WFMA 4KQKA 5LLDA 3UT6A 4TYYA 2YFHA 3O26A 1MO3A 4YA6A 3T9CA 3TLEA 4CN9A 4ZZ3A 1AG9A 2ZYDA 2HV8A 2C5AA 4A36A 3AU8A 3PT9A 4ZO9A 4TKMA 3RAJA 1QVWA 3EDMA 3QWIA 4M9UA 2DMRA 1SULA 1UZMA 2IIPA 2QVBA 2G5PA 1QFZA 2VHWA 4B3IA 2Q6VA 2O7RA 3HU1A 3FPAA 5KYNA 2PGJA 3ER6A 2YHIB 5KYUA 1AKMA 1UM9A 3TDNA 1JPNA 3AJEA 3WG9A 4AIIA 1LI5A 4U02A 1BQ3A 4J91A 2AG1A 3H2GA 4TMVA 4CEHB 1O5OA 2Q7XA 2XMZA 3M1YA 3P4XA 3FI9A 3UWDA 2PG3A 4EH1A 3MWJA 2GCOA 4RIFA 3VYRB 4AKTA 2I7VA 4JDPA 4Q1EA 1VJRA 3QU9A 2GLXA 2QD1A 4FE4A 3U61B 1JBQA 1ELOA 2H3HA 1U80A 1E3EA 4HDKB 4KDRA 3R5HA 4ZVVA 1I6MA 4ACAA 1G2IA 5HKLA 3L84A 3HZHA 3JWPA 4Q01A 3PB3A 4G81A 1H6DA 3G2PA 3TRHA 4LVOA 3OFSA 1TRHA 4M38A 3ZJ4A 5KPJA 3PEVA 4TTJA 2P11A 4JLDA 1P7ZA 1W34A 4MWZA 4S1VA 4DB4A 3A0RB 5K3CA 5JARA 2ABWA 4MB6A 4B6JA 5A02A 2VRNA 1YD7A 3U7JA 3HMQA 1QE5A 5FLKA 4L8LA 3W7BA 3VU9A 4CYMA 4R16A 1RWVA 1TPYA 3UFBA 3ONEA 1I6LA 2WFLA 4D81A 1VJDA 5FL7A 1UBUS 2IZZA 3W6PA 2VT6A 1UFOA 1S9HA 1TU0A 2QU8A 1XKTA 2AMJA 4MIYA 4DMHA 3MFYA 1UDWA 4P92A 4DLVA 1WLSA 2AH5A 5ED4A 2FDXA 2AC4A 1Y8QA 1U9CA 1UK6A 2AC7A 2OCLA 3A4VA 1MQ8B 4HWTA 4WAUA 4YCAA 5EP4A 2QLJA 3SX4A 3VM6A 5KHOC 1NBME 1DG1G 2FCRA 2CYBA 2FEKA 2MWMA 2ODTX 2VHXA 3GX1A 1HYBA 3H65A 1AB6A 1JAYA 1XP5A 3O8BA 1HTBA 3OQBA 3A28A 3PC3A 4I4TF 4MKGA 4YGYA 1JAIA 5DI9A 1UMBA 2EX0A 5E4YA 4TXJA 4FFPA 2FN9A 2QPAA 4E5VA 5KWVA 2YMMA 5REQA 1P7YA 3W5CA 1N2EA 2CNLA 2J3MA 1XJ5A 3EG9B 3MZ0A 2D3WA 3IUNA 4H6VA 1U3WA 3X1KA 3QFRA 4ENSA 4MIKA 4JI6B 3SIPA 3IEPA 2H11A 4YY3B 1TMKA 2FFBA 2OQVA 2F62A 1WSAA 2Q1YA 3MM4A 3PUZA 5HXAA 2F4VB 1EK2A 3CWCA 3H87A 5ADWA 1QP0A 1R0ZA 2LR0A 3MMZA 2NVUA 2V7GA 2C1EA 2XUGA 4B0PA 4BU0A 2ANCA 2ZUEA 3E4DA 1C7QA 4B8ZA 4CM5A 3L1VA 3VHXB 4MLZA 3ZZ1A 5ALRA 4KN6A 4BUZA 5K2MA 5EERA 2V97A 2OXEA 1K8XB 1AX9A 2XUPA 3LY5A 3NRJA 4R1PA 4BBZA 3O8CA 2Q6OA 4R2XA 3FYHA 4MQEB 3PFHA 5B6PA 1MMFB 3B3JA 3RTEA 3WVNA 1P3JA 1ID8A 3QKRB 1U0GA 1O94A 1ZWKA 2BZSA 1Y5LA 2FPRA 2A84A 2V8BA 4QEDA 4YJHA 5K0LA 5BWMA 4OJKA 5CDGA 1BKDR 1BHQ1 4Q9IA 1VL6A 2BFCB 1YS6A 3WWEA 4GXQA 4AI6A 2Q5CA 1GL9B 3OQ6A 1V5IA 2WWVD 3OIFA 1E4YA 3FZYA 4PLVA 3VR5H 2Z04A 1CRWG 4I6JA 1HYEA 4DEVA 3ICPA 3DHEA 1MJ5A 2WDPA 5EUBA 2TMYA 4A0FA 5KEIA 2E4UA 5JY6A 2Q9BA 2ZFUA 3HUTA 1KO8A 3C70A 4QT4A 5HG0A 5BSFA 5KNLA 2TS1A 4PPFA 4ITRC 1KK2A 4QXAA 3E2IA 4ENQA 3RTGA 3ICVA 1XHEA 2PRIA 1WBJB 2FFHA 4IPTA 1F14A 2JK1A 3DWIA 3O0TA 5DM4A 1YQTA 3W04A 5CCDA 2DT5A 1M1ZA 3UPDA 4ZMBA 5KZMB 3VAZA 2DWCA 3JYNA 3IDOA 1UF9A 2YZKA 2CMHA 1MB9A 3IBGA 4JT8A 4CKCA 1Z2CA 3EQZA 2JK0A 5EMHA 3QLUC 2WAOA 2SHKA 2EFCB 3RFXA 3ZXIA 4OMFG 5L8VA 4TM8A 4I1UA 1WL8A 4XIYA 5EHZA 5E4JA 4CLEA 1ISMA 1SIUA 2FFAA 2PWAA 3DW1X 2CD7A 4Q6WA 3ONNA 3WMWA 3DF7A 1PR2A 3KZVA 3TE6A 1XDDA 1FTWA 4MI9A 1H5QA 5TMDA 5HUHA 1B4DA 1KAHA 4NULA 5C8XA 4AZ3A 1A97A 2RGBA 1CY6A 3KT3A 1IPFA 3C8MA 3EAQA 1QBGA 2ZYSA 4QWWA 3KDPA 4R1MA 4ZYUA 5TLSA 4EG1A 3IMGA 5ALQA 3AFMA 2FW6A 5JUWA 1VHDA 1YI8A 3A8TA 2XQFA 3NBUA 1PL8A 4CI0B 3HYTA 5A3QA 1ISJA 2LGJA 2P4EA 3JQAD 4W8GA 1IOWA 1VMDA 3UHJA 1L1QA 1M10A 2FE4A 3NAGA 5GONA 5B1SA 3W8NA 4LJ6A 4B3MB 2JGFA 1IUKA 4Z4EA 2QRJA 3HEAA 4Z7NB 4X7PA 5A0TA 1OYWA 1A5BB 4KRGA 1QQ6A 4Z3OA 4TL7A 3GFPA 4QJIA 3WLTA 1BHJA 4EW6A 4ZXFA 3PCXA 3JYHA 3ZDDA 1UBNA 1RLJA 1NLFA 2Z57A 5EZ5A 2VDMB 1M5RA 4I8XA 4WUTA 5EGSA 1UMKA 4BMOB 2M98A 2YWFA 1L7VC 1K0UA 2VS1A 3P9YA 3R5XA 1Z35A 3IPCA 3DDCA 2WJZB 3NANA 4IDNA 4JLBA 4W5WA 3N86A 3AKYA 3JQ9C 4X3PA 4DCJA 3AIIA 2G06A 2HNBA 3Q2KA 1FFDA 3NWEA 4K6FA 2ZETA 5IBQA 4EPTA 5AK0A 4A91A 2XVYA 3B1JA 3U3XA 4QOEA 2WJYA 3DDWA 4TTRA 2B1JA 4P32A 1T2DA 3CKYA 1CJUC 5ANRB 2L0XA 2AI3A 1Z2PX 3FDFA 3QFHA 3WGOA 3K72B 4MVJH 5BRNA 2YJNA 2I4TA 2F8SA 4NIMA 3D6FA 5CXSA 3REQA 3HA7A 3S2GA 4MS1A 2P2LA 3EEYA 1UKZA 4G5SA 2UZ1A 4JLKA 1XKLA 4G67A 3DMFA 3G2LA 4XTRA 3BZBA 3RYHB 1ZL0A 1JLLB 4GOMD 2DU8A 5FPTA 1XKQA 1PJSA 3B1YA 1W36B 3QVGA 3SDBA 1P2BA 2JHCA 4L4YA 4L74A 2V7VA 1SXPA 3ANYB 1Z45A 4I46A 2VHUA 4JBGA 2BZ1A 3OFND 4NEHB 1JHDA 4WEOA 5GM2A 4E5PA 5IVDA 2MR5A 4XD7D 4UCXA 1WU7A 2P0AA 4MEBA 4D42A 3IA7A 2X9NA 2GCGA 3JQCA 1MAHA 1SUAA 3AYZB 3TINA 5IANA 1W85B 2NVOA 2AYXA 1YZHA 2E9SA 2LZ0A 5AVTA 4P4LA 5A2QA 3KWJA 4MOWA 4IHKA 3NGMA 2I1WA 4WT7A 3IJEB 3ND7A 4X41A 2B83A 2W2LD 3A1FA 1RHJA 4BWFB 5DPMA 1JSRA 3IPXA 2BMWA 3ZHCA 3IAM6 3T7SA 1YJ5A 2IYNA 1M2OB 1TJ5A 2C04A 4DM4A 1WDLA 4Y0VA 1AGXA 2HU7A 3CR8A 4EQZA 3SZUA 4LJRA 3C3AA 3FUTA 3D8NA 3NAMA 3GF4A 2Q1UA 4URHA 4GAEA 3BF7A 3GJZA 3QQPA 2G28A 1QGYA 2R6DA 3HBNA 5FNVF 1XXHE 4BNFA 2HQRA 4ZVTA 4AS2A 4I1PA 2EATA 3FZGA 5JIBA 2WWYA 4MQMA 3PGJA 4MW6A 5TDHA 3HQ4O 2TMGA 4NYIR 1TAQA 1J1ZA 3PXDA 1X92A 4BUCA 3WK9A 3SLGA 2RH8A 1DC4A 3PNBA 3EVGA 4Q34A 4M7OA 3WRXA 3G0IA 4ZT2A 3DVAA 3G2MA 5CDFA 3KQOA 1H1TA 4KXQA 2LE0A 3PE6A 1ZK0A 5EE9A 3WRYC 1SVWA 3H2BA 3O82A 5TY0A 3PGMA 1D04A 1F20A 5KIAA 2FX3A 1MIOA 1PO7A 5EVCA 4BQIA 1VHLA 2G9RA 1FNBA 2NZ8A 2EKLA 4PBRA 4YWJA 5KSOA 5D1HA 3UUGA 5MFPA 5HM8A 1RRVA 1THTA 1VKJA 1ZD5A 4UUBA 2IHBA 2NTEA 2FETA 4X65B 2QM0A 1GJRA 2HUPA 2J6CA 2C00A 3HDTA 3CLHA 4Y2HA 4A0GA 3EQ9A 4CM1A 1N3IA 4GPEA 1NXWA 1UJ4A 3WLKX 2A9FA 4GYYA 5JD5A 1JPJA 2EGHA 1U04A 4UQOA 1P6UA 2SKDA 1P6XA 1PL7A 1R6DA 4DKXA 1F3LA 1S1CA 5F7XA 4ETNA 1AJEA 1KERA 4MP6A 1IAVA 4F1WA 5F3RA 4A10A 1WZNA 1I94B 3N0VA 3W5BA 4FGJA 5BN5B 2J7PA 4NAHA 2YVKA 4Y2QA 4KQFA 1ZHOA 1SXJE 3KYIB 1H4TA 3RBAA 5HX7A 4R7TA 1A9ZA 3UXMA 5ES4B 2BR4A 5ENDA 2P9FA 2NAPA 2PK3A 1XA3A 4NH0A 5T64A 3TKYA 1VLLA 3MXTA 1P2DA 3PTAA 1U9IC 1Y6JA 3CR7A 3GUVA 3AR7A 2P91A 5AHRA 1HYGA 3O8OB 2D0DA 1J22A 5THKA 1UMCA 3RU9A 5ELLA 1HH4A 1J4AA 1IJKA 2WV7A 3QELA 4WD3A 2CL0X 2Q8QA 4YRFA 4XUCA 1KYWA 3MCWA 3DTYA 5M2QA 1M1YB 3WMRA 4KREA 2IKQA 1TCCA 1IZ0A 3QLJA 1M2EA 5BURA 2UXBB 2OT3B 1TCAA 2MT9A 2HTFA 2Z5FA 3FJOA 5KTOA 4OJQA 221PA 1VKRA 1DE0A 3DYVA 4NJOA 1R8JA 4REMA 2Y1WA 3HGTA 2Z5VA 3FNFA 2P9JA 5CLQA 1YIOA 1QU3A 2PUBA 1OASA 1I8TA 2H1FA 1DIOB 2Q0QA 3HZOA 4PNHA 3UWPA 2BEWB 3F3YA 2G82A 2A86A 3G7UA 2RSLA 2XMGA 4OU4A 3ZCQA 4ZICA 5ITVA 1KAEA 3TOVA 3T5CA 1B0AA 3IT1A 1LD3A 3VPGA 3DXFA 3PCRB 5H0IA 4NAUA 8ATCA 2Z8ZA 3WYBA 4PE5B 4AULA 1BCSA 1U5BA 2IOFA 1IN4A 1H3FA 1G7TA 3PPVA 4NCIA 5C7OO 2C95A 3ZE2B 3RM3A 1DHTA 1QR2A 1SCBA 1KI4A 2AR0A 3DE2X 4P4TA 5A6SB 1B8NA 3ZIUA 3DEKA 2PKEA 4DR7B 4EI2A 5LZ5A 1YDEA 4A23A 2BBWA 2J3JA 5HF8A 1Q50A 4GSLA 4U7GA 4MUYA 1R66A 4JI1B 4XVUA 2H4ZA 3DHWC 5H82A 2WUGA 1QONA 1AD2A 4MKFA 2XA2A 5H1YA 1CQPA 3THOA 5E6SB 5D3ZA 4ZQBA 2VTDA 3UT5A 2P2SA 3SSAA 1JVSA 1Q95A 4NF2A 5BR4A 4RETA 2GDZA 4IMRA 3WMXA 2ASEA 4B71A 4POOA 3VRHA 1ISHA 1FDTA 3N6VA 4XIGS 4X3OA 1FJ2A 1Z28A 1CR0A 2R97A 2UUOA 1FP4B 1WU8A 1PJTA 4HH0A 3TTTA 2O5EA 1JW9B 2ZE6A 1FA9A 2REBA 3ZCSA 1AM4D 1QO0A 2EFEB 3JQEA 4GKBA 5CDUA 2FG7C 2MSCB 5KWSA 3H4MA 4V2IA 3H5IA 1OI3A 1SOUA 2O1EA 4B83A 4MW1A 1VYTA 5HIJA 3FR7A 3N2EA 3N2ZB 4EPXA 1VPEA 5DYIA 1SKBA 5U4XA 2YKGA 2IK8A 3VOSA 1LY1A 1P7PA 1B74A 2WLSA 5FBZA 2O2GA 3QRWA 4HDSA 1PI3A 2E4ZA 2IP1A 5ALFA 5I8ZA 4P7GA 1NM5C 4LJ7A 1RHUA 1NRJB 3BMXA 4RAOA 2D2FA 4BFWA 4XARA 4OJTA 1U2RA 3G2HA 4BE4A 1OW3B 4HVLA 3GMTA 4GC9A 2QW0X 4LKOA 3WFJA 1UP7A 4HFJA 2JA1A 1ZM3A 5BNWA 3GLFA 4NXMB 4GZLA 3RFCA 2CEKA 2G80A 1C3LA 4LYJA 2HPHA 3U60B 1RBQA 1O8CA 3N2KB 4CM4B 1IM2A 1JFFB 4PFKA 4JKIA 1YS4A 1S3FA 2K7FA 1ZIYA 1JSCA 1TUEA 2HWKA 2H48A 3DMRA 4FC7A 4Y6SA 4RIGA 4EDFA 1IXZA 4W5HA 3WL3A 5GTDA 1XMQB 2VDVE 3TW4A 5CVJA 4H7EA 1RJDA 1QO9A 2ACKA 2R5FA 3AEUB 3AI2A 4MYHA 3SHVA 2O8CA 2HHAA 5LMZA 3PITA 3Q88A 4KODA 3S27A 2PFSA 3UJPA 5J43A 1ZAYA 1UAYA 2B30A 2H4FA 1WSBA 3M9LA 5J5VA 1LQ2A 3G2KA 2CYAA 1Q15A 3LPMA 2WM3A 3CO0S 2YWXA 3KOWA 1JDNA 3QXHA 1C9MA 1UPXA 2FF5A 2HA2A 2G67A 2XYPA 2X0FA 4AROA 1VQ1A 4ZVQA 1QHSA 4G4SO 5E4TA 2Z5GA 2ZUCA 2ZJAA 1YMUA 2ALJA 2H1RA 1MOZA 1Z6PA 4EYGA 4L08A 2OGWA 1EDZA 2R8RA 5JADA 3SYLA 4FOTA 2HPAA 3TZBA 1AQIA 1RM0A 1U8UA 2FPGA 4W5OA 4E5YA 3AEYA 2JCVA 3DFFA 4HX5A 2CJXA 2ZRQA 1E1DA 4KE9A 4L5BA 1R18A 4PZLA 4ARZA 3TFOA 3A2KA 4UVDA 4WK4B 2BBOA 4HCJA 2E89A 4IIBA 3NBMA 3W5UA 2QVCA 3WGMA 3KQUA 4AQDA 3EE6A 4O3FA 1ML4A 5K3FB 4U6NA 1LBIA 3GPIA 1GQFA 1V3VA 3GUZA 1XNGA 3M4JA 3VKWA 2XOKD 1VLVA 4G6ZA 3FPFA 2EG5A 4UNQA 3TSWA 5KS2A 1FFSA 3TJMA 1KVRA 1W5TA 4FUTA 1NQAO 4NU0A 3HVRA 4ZJZA 1P4AA 1RRPA 4N3GA 2AVNA 1EXVA 2WG0A 4EYOA 2RK6A 3ENWA 1HA3A 1GILA 1I7LA 4EHFA 4JMPA 4OEHA 4JUCA 3KM0A 1RWNA 2CVOA 2K87A 3G1UA 1EINA 4GLLA 4E12A 3AR3A 1E0AA 2C5FA 2VRBA 5H70A 5K0TA 5MGNA 2Y1KA 3IBTA 3FLBA 1F17A 3KXPA 5AI4A 3LCJA 2I6GA 1OBCA 1VMAA 1E9SA 4KQGA 1E6KA 3N0TA 4TRRA 2X22A 2XD4A 4I9FA 4M9ZA 2BDUA 4RMIA 1U9ZA 2NVWA 2WMNB 1YB1A 3CPSA 3R0JA 4GI1A 3E4CA 3LYLA 3PRJA 3OWXA 3V1KA 1EQ2A 3ZNQA 2KE5A 2A57A 3L93A 2GN4A 4I36A 4P7BA 4EAQA 2HZ7A 2VC2B 3E61A 4NDZA 3OY2A 2WD9A 3ZDAA 2XNDD 4GPD1