5DHFA

Crystal structure of hrio2 nes peptide in complex with crm1-ran-ranbp1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
205
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 60
structure length 205
sequence length 208
ec nomenclature
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dhfA00
3KX2A 3NDBB 4PFSA 3IQXA 5EUQB 1ODFA 2BIFA 3PVSA 4XH9B 4BRUA 1IJFA 4A0HA 4TMWA 4DSUA 3SYNA 4B75A 1J99A 4DC9A 5KSYA 1QG2A 2CCJA 3LH5A 4B2LA 2ZIAA 3CPJB 1ZCBA 3CRMA 3P32A 4LRWA 3TUIC 3PEYA 1WXQA 3BE4A 4TL9A 621PA 1OH6A 2BJVA 3BB4A 4AY2A 3HJNA 4BFZA 2D4HA 4P4UA 1A7JA 3K0AA 5H68A 3WHKA 1UDWA 1COWA 3WNDA 3N5CA 2SHKA 4NCJA 5EP2A 1IY2A 2FH5B 5CDFE 4FCWA 1L8QA 3RRZA 4UKDA 1GZSA 3I8XA 4WVFA 3IEVA 4KHZA 2CCKA 2CE2X 2Q9AA 4F38A 1HY3A 1H65A 3C7KA 4CYMA 1E2GA 1ZCAA 3NHAA 4PHGA 4U5XA 5EE9A 1G7RA 3UK6A 3LO5A 3JVVA 4TYWA 1NVXQ 4ON9A 2WV9A 1NBME 1OYYA 4LOAA 3MWLA 4B71A 4PQFA 1J8MF 4L4UA 1CR0A 2F3TA 4PC7A 3L0IB 3GLIA 4GOXA 1T0HB 3WRXC 1SXJB 3WNCA 4M1SA 4B34A 1P62B 3D31A 4Q66C 3LVQE 4R2HA 3JZAA 4XWOA 2EFEB 4FMCF 2IYWA 4URVR 3IQWA 1N5JA 4IDHA 2FFQA 2RB4A 2PJRA 5DH9A 3SE0A 1B0UA 1IXSB 4XSGA 1VG1A 1XWIA 5IF9A 1QVAA 1Z28A 2QU8A 4E22A 3LBHA 3U7EB 5JZVA 3LD9A 1QBKC 4IVPA 3O8CA 3WYGA 1AS0A 2W6JA 4R2IA 4Y0VA 1NIPA 2KE5A 5AJVB 2XNDD 4Q9KA 3CRRA 5FR2A 5BXQC 5IT5A 1EFCA 1GILA 2FPLA 1G6OA 4CEHA 2RGXA 1CTQA 3GLIB 3AQ4A 4W7SA 3BORA 2R6DA 5F3WB 2W83A 2D7CA 3E70C 2XSZA 1AJEA 4LSGA 1R5BA 1HH4A 3UMFA 4II7A 3CUEF 2FGKA 2CL0X 3ECCA 3TLXA 2VPPA 2ATXA 2ZU6A 1T3HA 3DPUA 3CO5A 3OHMA 1R0ZA 5A5GA 2PMDA 1ESNA 1RVDA 3BRWD 3IUYA 3ZVRA 1HT2E 4U00A 3EZFA 3I1FA 5EE5B 2HLDA 1NY5A 2ZJYA 4NONA 2BOVA 2ZSBA 3EZ2A 4AURA 5KNCA 3ADDA 1OPXA 2EW1A 4ESHA 221PA 4QHYA 1KK1A 1G19A 3U3KA 3WP1B 1N5KA 4DSOA 1U94A 3MUFA 1GVNB 5C4MA 1M1YE 2IYRA 1I2DA 5KOYA 1EFUA 2R6FA 4JZKA 5JS8A 4LV8B 1G3QA 1H8ED 5FTJA 4BECA 1OIWA 2ZRKA 1KHTA 1AQYA 3QXHA 3IPYA 1W0JD 4IVQA 1Z6AA 2G83A 3EAQA 2ZRIA 1S3SA 3HYTA 5JI3E 1G3IA 3PENA 4I1SA 3RSOA 4AYXA 4E5UA 3WYFA 4TMXA 2ZAOA 4QFMA 3BC1A 1DS6A 5DYGA 3PUWA 3WMEA 2OCYC 1M7HA 1G7SA 1RZ3A 4TYPA 4Z51A 3LW8A 1ZBDA 2Z83A 4L9SA 3ZVLA 1J70A 2WWFA 1II0A 4XD7D 1TTTA 2J0SA 5J4YA 2EWWA 4ZCIA 1G7TA 2A5FA 4HB2A 2FFHA 1KDPA 3LAWA 2OSBA 4MUBA 2BCGY 3GJXC 3OZXA 1MO4A 2KI5A 3C14C 2D3WA 2F9LA 5EP1A 3C15C 1OFTA 2WWXA 1NN5A 3G82C 4BLPA 3JZMA 2CDNA 2H7VA 5KNBA 1QHHB 2BM1A 2G6BA 1JBKA 2V6IA 2PEZA 5GVSA 2AK2A 4ZKEA 2QP9X 3PG5A 1TEXA 4NCKA 4O2LA 4MDEA 4JKYA 3DEFA 1K5GA 2RHDA 2ZI5A 1Z0JA 2OBLA 1AS3A 3PV0A 1PLKA 3Q72A 3VHLB 5E7JA 1XEXB 1KO7A 4V0OA 2Y8EA 1KDRA 2R6GA 4TQ9A 4BLSA 1A2BA 1G4UR 3AVQA 5CK4A 4P4SB 1GDDA 3IPXA 2ZJ5A 4DLTA 4XSHA 1XJCA 1UKYA 521PA 5GJWC 4F7WA 3R7WB 3QE0A 2ORIA 1RKBA 2HT1A 2QTFA 3B6EA 5FBRB 3TBKA 3AKYA 3I73A 1YZTA 4O3MA 1UBFA 1QHSA 4CRWB 1YZKA 2HV8A 2VEDA 4YMUA 5DNYB 5IK2D 1E4YA 2ZE6A 1LV7A 2RAPA 1JEDA 1OIVA 4TZ0A 1DPFA 4OYHA 5KPDA 2QGZA 1W5SA 1SVKA 1PUJA 3W5JA 1IY1A 1M6NA 2CVHA 5AJZA 4B48A 1HE1C 3PIRA 4BZXA 4LPSA 1YU9A 4FINA 4OQLA 5JHHB 3RAPR 1NRJB 1XMVA 3AKEA 3FHCB 3DM9B 1EESA 2OAP1 3RVBA 5DHAA 3FGNA 1R0XA 1S96A 3GEIA 1A5TA 2QI9C 3FMFA 2AD5A 1XEFA 3GCGA 1KZ7B 3EPJA 2JDID 3KXKA 2A3RA 4Q9LA 1DADA 2VIIA 2WJVA 3BB3A 3GJ8A 5BN3A 3BH7A 4QL3A 4A4DA 4UNRA 3K8YA 2AHOA 1X3SA 4LI0A 1XPOA 1LY1A 4F4CA 1OB2A 4N0EA 1US8B 3K70C 1P72A 1DAIA 1ZU5A 5TXGA 3RABA 3TUJC 2PCLA 4HUQA 1Z2CA 2VBCA 2V1UA 3FFBA 4URUR 5IDVA 1II8B 1KMHB 1Z08A 2IYZA 4RKFA 4OI1A 1SHKA 3IIKA 3SOPA 1I4TD 3CNOA 4URZR 2DWPA 2XGJA 1XP8A 3W3AA 1SVWA 4LJ6A 3QKTA 4N1AA 1CJKC 1SVIA 1S1CA 1W49A 2BKUA 2WSMA 3BH0A 2A7QA 3MSXA 4QHSA 5FFMA 3MD0A 3UXMA 1TL7C 2GKSA 4ZIRB 3QKSB 1QHHA 1WF3A 1X8KA 1VCOA 2D62A 3QPWA 1ZM9A 3B13B 4FMCB 2ZRDA 4LC1A 4NYMR 1CR1A 4WW0A 4Q7JB 1COWD 4M0LA 4UNPA 4B3GA 2IYLD 5FUWA 4C0QC 2REBA 2V8OA 4UNNA 4B3CA 1PJRA 3PUVA 1OIXA 4MYUA 2F6RA 3CZQA 4V02A 5KHOC 4CEJB 3SN6A 1F2TA 4KVAA 1VYUA 4Q4JB 2ZUCA 4Q48A 1KTVA 1WB9A 2ZANA 1UBEA 1SKYB 1DG3A 2GXAA 3ZH9B 1H8HD 1KMQA 1R0WA 2OZEA 2JLVA 3IIJA 1QZXA 3GLGA 1DAGA 4FIDA 4NKRA 3K0CA 3VU9B 5EE0A 2G77B 1BMFD 3SJZA 2ZS9A 4ASUA 3AVPA 1NBMD 1T3SA 1R4AA 1HA3A 1DOAA 1RW4A 1XCMA 2AL7A 4XWAA 3PR1A 2JDIA 1UKVY 4FD2A 5HPYB 1KI1A 1P2TA 1P9WA 1OSNA 3W3ZB 3LFUA 3U3JA 5EP3A 1UPTA 4Q47A 3TKLA 3GLHA 1YHNA 3T12A 4OJQA 3I3SR 2XTNA 4DHEA 3R8FA 3C5CA 4LJ9A 3OFND 2GRJA 2GETA 4NDZA 2V55B 4QRHA 1HQCA 4EDHA 1YZUA 2OUKA 2NPFA 2C9CA 3RNLA 4BLQA 2ZRJA 2ZRNA 4LJ7A 1P7CA 1E9SA 3WRYC 2QROA 2W0SA 4HAVA 4OI2A 3V00A 2NQ2C 1XU4A 1G3RA 3EZ7A 1KY3A 3U61B 2XAUA 4PAOA 4QG7A 5EZ6B 4FCTA 5FTNA 4LPKA 2RGCA 1C1YA 2FSFA 1TQ6A 3KQNA 3H86A 4DB4A 2QY9A 4CIDA 2WTUA 3QJYA 2HT6A 3KTAB 4B47A 4YXWD 2FA9A 1R7RA 4M9SA 1BO6A 1R8QA 3FWYA 3ZLJA 3MG9A 1MRNA 3PEVA 4HLCA 4JSTA 3TIFA 2ZROA 2GJ8A 2RMKA 1DE0A 3CZPA 3BFVA 4ACAA 1U99A 1UDXA 2UZIR 3F8TA 4NL4H 4DSNA 5J4LA 4KYUA 1Z22A 2BEKA 4DRZA 4OI4A 3ZVMA 4CEIA 1N0UA 2BBOA 3AUYA 2ZS8A 4JLDA 4JLVA 4NYMQ 1G21E 1Z3IX 1Z63A 2FWRA 4EKDA 2OFXA 3HU1A 3R9XA 1BS1A 3MLEA 4LYAA 4LJ5A 2J7KA 4LV5B 2G0NA 1E9EA 1KJZA 1NJFA 4M4SA 4Q7KA 2ZU0C 5TDHA 1CJTC 1IM2A 1D9ZA 1W0JA 2BMJA 3B7GA 3ZIAA 3I5YA 3LBNA 2QPTA 2ZSEA 1II9A 4EUNA 1N6NA 1E9AA 4EQ6A 1P61B 4I1UA 1DARA 1EWRA 2OLKA 2RGAA 1PLLA 3MFYA 2O8BA 1W0KD 3HWSA 1NN3A 1Z2AA 1SXJE 3T1TA 1QF9A 4IFEA 1E0AA 1ZUIA 4IOJA 1TUEA 2YOGA 4ZCLA 2IXFA 4JL6A 4C2UA 1E3MA 1I4LD 1KZGB 4UXJA 3RS5A 2G1JA 1XDBA 1TU4A 2PL3A 4DLUA 4NPHA 5L3RA 3CRW1 1SVOA 2QG6A 4Q00A 5KNDA 2QMHA 3GPLA 2XEXA 1KI6A 2FGJA 1ZJ6A 3QPVA 4DLSA 4LUCA 3IO3A 1EX7A 1YR6A 1Q44A 2B21A 1TU3A 2YVUA 3IHWA 2QE7A 3KKMA 3ICEA 5EZ5A 1RRPA 3VTKA 2IS4A 4AK9A 2P65A 3GLGE 1G5RA 5JWRA 1YRBA 3SJCA 2J0QA 1JNYA 5AK0A 2GF9A 3GEEA 2QMUA 3DOEA 4RD2A 1A2KC 5K8TA 3IHLA 3KKOA 1E1RA 2NG1A 4Z8XA 3SBEA 3AP3A 4DCSA 3CF6R 2FPMA 5F9HA 2QAGB 4I4LA 2P5TB 5DE3A 2ANCA 1E4VA 2O0JA 1R0YA 1LFDB 2OFWA 1KO5A 4W5JA 3KKQA 5H1YA 1N0WA 3C4JA 3HYRA 3V4FA 1MRSA 5JRJA 5EQTA 2B7CA 2X1VA 2ZR0A 2VP5A 3DHWC 2R65A 3L8YA 3SHWA 3RRMA 3G5UA 4KLNA 2GCOA 3TSZA 1T8TA 2C04A 3A1TA 3TR0A 2R62A 4WA7A 4B2IA 5IK2A 2QZ4A 5TB5A 3UKDA 1TMKA 1S1MA 5E4FA 2F43A 3U3MA 3GFOA 2IC5A 5CK5A 4D81A 3VKGA 3D8BA 4IOKA 1G5PA 4F93B 1XBTA 2PZFA 3KB2A 1T3LA 2RHMA 3A1UA 4D82A 5TVKA 5HE8A 4KFRA 2IYYA 4KFSA 4S35A 3AKDA 3REGA 4B6EA 1U2RA 4BFWA 2BMFA 2J0UB 1IN4A 2JJ1A 4DJTA 2QAGC 1A1VA 2OO7A 4LV6A 2GAOA 4CEIB 4DLVA 5J4KA 4OKSA 1E2IA 1Q1ZA 2GXUA 3EX7C 3PEUA 5H70A 2QSYA 1FL9A 1R6BX 5JI2E 3FVQA 3VAAA 4P4SA 1D2NA 1E9FA 1UKZA 2YZ2A 1O3YA 2V54A 3P4YA 4IW3B 1GP2A 4LJ8A 1Z07A 1SXJA 2OCAA 3ETLA 2QORA 4URXR 2YNMA 2VLIA 3EW9A 3NH9A 4PPFA 2YINC 1LF5A 3OAAA 1YR8A 4IJMA 3T1VA 2F3RA 2GTPA 5FPHA 2IYUA 1F2UA 3TMKA 3UMRA 2V9PA 1RFLA 4D0NA 2W6IA 3GLIE 4M1KA 1L2TA 2CHVA 3EZ6A 4DCNA 1LS1A 3ADKA 2B6HA 4M53A 1BH2A 4UQOA 5FUYA 4QBHA 2JLYA 2XXAA 4C7OA 5KUTA 4A36A 5CYPA 5AR1A 1MO6A 2IEYA 2GK7A 4BLOA 1K8RA 4UJ5A 5AJWA 5B58C 1G41A 1E9BA 2ZE8A 3AH8A 3Q8XB 3WHLA 4ZKDA 2ZREA 1BOFA 2VRWA 5E3HA 3CX6A 4URYR 3CF0A 2NMVA 3HU2A 4MRSA 3CRVA 4L8GA 4PC6A 3KKPA 3B1VA 3HPQA 3LXXA 4PO9A 2O8CA 4NYIR 2ZJBA 4AYTA 1FQKA 3ZDQA 4CGZA 1E6CA 4G5OA 2IW3A 4PANA 1GG2A 2QL6A 4S2EA 4B3FX 1Q1QA 2XTMA 5JFGA 2OXCA 3AVVA 4EAQA 3NEYA 4GBMA 2WWGA 1X6VA 4BZQA 3CM0A 2A5YB 2EQBA 1N6RA 1VG9B 4PPGA 4MDFA 5L3VA 4KCGA 4OBEA 2WMOB 4Z54A 1ZM7A 2JJ8A 1W36B 5FBQB 3LQQA 4BEJA 1QHYA 4WOPA 1F48A 4NH0A 4BQSA 1T91A 2LCFA 3MMPA 1KSFX 4B35A 1NI3A 2ZI6A 4GOKA 1KKMA 3EC1A 1TQ4A 3KUDA 3HP1A 5AUQA 4LYHA 2GVDC 2ZJAA 2V7QD 4ACBA 1WP9A 2PX0A 3N70A 2KSQA 3NBYC 3TK1A 5L3SB 2ZRCA 3LVRE 4N3NA 2F55A 3GEHA 2GAAA 2IYTA 2W2VA 1ZAKA 4HAUA 1KSJA 3EARA 3QG1A 2VP9A 1ZNYA 4EPWA 2J9RA 2A30A 3L43A 1ZUHA 4G5GA 1BIFA 1FTNA 1KI7A 3GD7A 1KO1A 5AJXA 5JJLA 1NKTA 2WWIA 2O0KA 1P6XA 3DVLA 1EFTA 2CK3D 4TL8A 2D7DA 2AXNA 1EWQA 2GJSA 1I4DD 2IUSA 4LHVA 4JIMA 1IQPA 4PHTA 2JLWA 3TUZC 4A15A 4Q7LA 1MABB 2F1RA 4LHWA 2GF0A 2ZRHA 3TAUA 1XD2A 1XFAA 1HTWA 4C0SA 4RD0A 4G5RA 1N25A 3SJAA 1E94E 3DZDA 4LBZA 2EFCB 1FUUA 1PLJA 4JL5A 4UJ3A 2ZRAA 4YONB 2YV5A 2JCSA 4ZDWA 1G5TA 2GVZC 4G1UC 1RRGA 3IIMA 4TLAA 4IEEA 2NO0A 4C7OB 5AUNB 1AGPA 2EU8A 4KBGA 3WMGA 3NBFA 1Q1EA 1CEEA 1ZM4A 1F5NA 1IXRC 1GKUB 2WOJA 4JVMA 3BJIC 1U9IC 3KQLA 1IY0A 5AUOB 2CL6X 4R9UC 5KDOA 4MKHA 4PZLA 4BEBA 3H0KA 3FE2A 5BN5A 2O8EA 4POAA 1VCNA 1W4RA 2CNWA 3W8RA 3ZIAD 4MH0R 1OYWA 2HLDD 2ZE5A 5JJKA 1EK0A 2KWIA 5E95A 3HDTA 5DI9A 5FL3A 1E79D 2P6NA 4JJKA 3K09A 1FZQA 4A2PA 1JR3D 1DO0A 1TEVA 2RGGA 2DFNA 3MWYW 4RY2A 1K5DA 2RKOA 5DYIA 4JVSB 1V43A 1E2QA 3FMIA 5L3QB 3PEWA 3TSOA 1TAGA 1FNNA 2KJQA 4E07A 4MGIR 1QHXA 1Q21A 3FDIA 3E5HA 2PCJA 1ZD8A 3K0SA 3GJ3A 2YC2C 1DVRA 1N6KA 1WBDA 1KDTA 1Z29A 1NMXA 4QBGB 4W5HA 5EUMA 2VHCA 2QE7D 1X8JA 1F6BA 2XZLA 1Z6TA 5DI3B 4WZBE 2A5DA 4ABYA 3IBGA 1DELA 3BFXA 2ZQ5A 4KBFA 4PQRA 4Q9HA 3H4MA 1XPUA 2ZI9A 1KJYA 2ZAMA 5A0FA 1XTQA 4NYJR 1J7KA 1NL3A 4US2R 1WBBA 4K46A 1GITA 2J59A 1UADA 4DCVA 2DWQA 1GNQA 4H1UA 4Q7MB 3G0HA 5A4JA 4PTLA 4GPTA 3K70B 2N42A 2PZGA 3QOFA 4V0NA 1XTJA 3VR6A 4TMTA 5FI0B 4TTRA 2HCJB 3FKQA 3QXXA 4HSEA 4IEIA 4G3XA 5J40A 5JCPA 1ZP6A 3OEHA 2WOOA 1II8A 1W4BA 3LA6A 4US0R 1VG0B 2LWIA 3GLFB 3O8DA 1UBGA 4XTRA 1MT0A 1NVVQ 2YC4C 2GJKA 2YJTD 1ZW6A 1KI6B 2DFLA 5JECA 1CBUA 3EASA 4A6PA 2HJVA 1TADA 2FJUA 1XMIA 1JECA 4DVGA 2GILA 3DMDA 2IXGA 2FG5A 1XTIA 1NBMA 2PBRA 4HLQB 4ZIRA 1ONBA 2WHXA 2BBSA 2Q3FA 3BK7A 2VSFA 3EA5A 2QM7A 3QBVA 1R5NA 2OBMA 3EXAA 4AD8A 5DLQC 1ETUA 4BFUA 2GJAA 5CJPA 4QGHA 3A1VA 2XB4A 3DOFA 3QI2A 4O2RA 2P6RA 1S9DA 2WVJA 1Q1BA 2E9SA 3SJBA 1KJWA 3GQBA 4JLAA 5FR1A 1F2TB 1PZNA 5JWOA 4TYYA 5CYOA 3DM5A 1GNPA 4HZIA 2ZUBA 3OIUA 1FX0B 1N5IA 5HKKA 3EPKA 4BZPA 4LGMA 4OHXA 2QT1A 1T8UA 2A2ZA 3MGCA 3S1AB 2P67A 1G8GA 4QNRA 1Z8FA 2OXRA 4Q19A 2EFHB 1G9XA 4M2LA 4F4JA 1AGRA 3UMSA 3T1QA 2VHJA 1JB1A 1XD8A 2HDNB 1XZPA 3AGQA 1VCMA 1RRCA 4GL2A 1KI3A 1J2JA 4B2PA 1WRBA 3P20A 4WZ6A 1LB1B 8OHMA 2VHTA 2D06A 2HXSA 3RC8A 2CBZA 1U8AA 2C96A 2W6JD 3VX3A 3WNBA 3OIYA 4DT1B 3R8CA 1NG9A 3AM1A 1U90A 1XXHA 1OB5A 4JSYA 3ZS8A 1NLFA 2JLSA 3Q85A 3CF2A 1FPMA 3L0OA 5B57C 5JJIA 1NIJA 1JI0A 4M21A 4NCIA 4HDOB 4B3XA 4AG6A 3ZYCA 5BYJA 4TTQA 3ZD6A 4KYIB 1HT1E 1M7BA 5CJ2A 4KXFB 2I4IA 4D25A 4XVUA 4PSAA 3T61A 4GI7A 5GVRA 2AKYA 2CLCX 2O8DA 3AP1A 3B9QA 2GBLA 1NKSA 1YZGA 4DLRA 5DO9A 2WM9B 4CF7A 3PUYA 3AVOA 3L82B 1ZIOA 5CLLA 2WPDD 4DEYA 4B44A 2JJ2D 2OCPA 3A1SA 1DEKA 4TL7A 2P0EA 4UXHA 3A1WA 4NCNA 3KQKA 1E0JA 3TR5A 1D2MA 3RS7A 1EG7A 1VG8A 1OKKA 2IHYA 4V0KA 1XCGB 3B9PA 1RYHA 2KB0A 2XITA 5FI1B 4ARZB 4NP6A 2G3YA 3LX8A 4EJSC 3FKSA 1ANKA 3PXGA 1JJ7A 2QQEA 4DWJA 4Q9IA 4D4LA 1IN7A 3Q5EA 5J47A 2V7QA 3K0FB 3X2SA 2ZXUA 1JEEA 2ZRBA 5BWMA 3LWNA 3FOZA 2OILA 3RWMB 1Z0AA 2RGNC 1Z5ZA 3B1ZA 3OIWA 1NMZA 1TNDA 3FFAA 4RFSB 2AFHE 4FMDB 1KGDA 3I8SA 5JEDA 2IF2A 3ZZUA 1GRNA 1U81A 1T5LA 1ZVQA 2VQSA 5FH9A 2DB3A 2QENA 4BFXA 2XX3A 2Z43A 2Q3HA 1BYIA 2QEQA 1DO2A 1E96A 1N6HA 3OE7A 2XTZA 1M7GA 3CBQA 2C8VA 3AVWA 2CHGA 4QGGA 5UKDA 3TAHA 4EQ6B 2WBLC 4KO8A 2ZE7A 5TY0A 3RS3A 4D0GA 3QG5A 4JLNA 4JYCA 1YR7A 4IXNA 4ARZA 1VHLA 2C78A 3F0TA 4TMKA 1CJVC 4C3ZA 1FQJA 3BH6A 3P4XA 3EWAA 4MGKR 3ZGXA 4YMTA 3K0FA 1KO8A 2IT1A 1GWNA 4TYQA 3P26A 2GHIA 4ZDIA 3HR7A 4TLDA 4C4PA 3AEZA 3BIFA 3TRFA 2Z0MA 1W47A 2OG2A 4D4MA 1YRAA 5EXXA 1KOFA 1GNRA 2WZQA 2AK3A 3THYB 2C98A 5EJEA 2LKDA 5JSZB 3THXB 4CEHB 4XIGS 1NN1A 4HDQB 1CRQA 1OF1A 1XXHB 3KUCA 4A92A 4P33A 4X8OA 3AVUA 4LBVA 1E9RA 2ZSAA 4MKIA 1SVLA 2MMGA 5G3YA 3SR0A 1JAIA 1AZTA 2Q3MA 4I1OA 3L8ZA 2LKCA 3KL4A 1Z83A 4MRRA 2O0HA 4JLBA 3WY9A 3KJIA 2ODNA 4ASUD 1EGAA 1ELOA 3AVYA 4PC1A 3BAFA 2GCNA 1XJ0A 4TT3A 2IS2A 1CU1A 1WMSA 3HU3A 4Q21A 2ZUDA 1GM5A 5TMPA 1NSFA 2JIZA 3FKSD 1CXZA 3QEOA 1OHHA 4OK3A 2GCOB 5FOVA 1AS2A 1VCIA 3N2EA 3V9PA 3THXA 1XEWX 2Z4SA 5DN6D 2JAQA 2IX3A 2GDJA 1E1QD 1PVOA 4CW7A 1KAOA 2H5EA 1WDTA 2ZSDA 4PC3A 4RVCA 1ZM2A 2DYKA 3ASZA 3QKRB 2QMEA 5CIWA 4C30A 2XJ4A 1A82A 2FMXA 2HCBA 3EIQA 1RC8A 4EPXA 3LLUA 3B78A 5FTMA 5FPYA 1U8ZA 2W6ID 1FFHA 3CWZA 5FL7D 4FI3C 3OE7D 3VNUA 2J0UA 3VR3A 3QIAA 3RC3A 3ZQJA 2GA8A 2ANBA 5CM8B 4JMPA 2WJYA 4Q18A 4RFSA 1W2HA 4PPQA 5C4GB 4BFVA 1KDOA 3U7HB 2DPXA 2BC9A 3X1WA 3KQHA 1JR3E 2V4ZA 3L2OB 3PFIA 1SXJC 5KDLA 1GAJA 1UKEA 3K70D 1E2FA 2ZETA 1E32A 4M1YA 2FPKA 4JBYA 2OESA 2WICA 4KODA 3K0AB 4M1OA 2FSGA 2HXYA 3KDSE 4K8OA 4GT1A 5M04A 5FTKA 4B73A 2W58A 3W9YA 2QA5A 4WIAA 4LYJA 1ZNZA 4PZYA 2O8FA 2HUPA 1XF9A 3NG1A 1JALA 4ZDJA 2CLSA 4DUGA 4WBSA 4WXPA 1NP6A 3ND8A 2PX3A 4JKIA 3U7GA 1XTSA 2VF7A 1CIPA 1D6JA 3JVUA 5KU1A 1JJVA 3R9WA 2QT0A 3EIHA 421PA 1NVWQ 5BYKA 1K6MA 2VP4A 2WKPA 4B6FA 1RPZA 4Q1BA 3ADBA 4AI6A 2E87A 3B82A 4JLKA 4MUAA 2F1JA 2ZI7A 3OIVA 4XVRA 4L5BA 4DCTA 2CJWA 2EWVA 1Y3AA 1XXHE 4C2TA 1RIFA 4I99A 4RD4A 4TMVA 1E9DA 4IHQA 2O8BB 1DAHA 3CIOA 4QJ3A 2OBNA 4RD1A 2BMEA 1KK3A 1Z47A 1NMYA 4QBIA 4OQNA 4MYHA 4JVLA 2Q0HA 4PR0A 1GRRA 2YWEA 3U60B 3OESA 3ZZ0A 1GL6A 1H8EA 5LBIA 2XNDA 3EA0A 4MRNA 4A0FA 4EFMA 2Q9BA 3B2EA 2PLFA 2JJ1D 2WJJA 3DKVA 2V3CC 2W2TA 1N0VC 3ONWA 1MO3A 1IAQA 1TUIA 2OEPA 5DSZA 1AA9A 1QVRA 1JPJA 4A2WA 1VDZA 1G20E 3PCRB 2JA1A 1P2SA 1Q3HA 3X1XA 3L0SA 1MH1A 4AWXA 2C5LA 3QKRA 4US1R 2IF0A 1E2LA 1NJGA 1SXJD 2D2FA 2NOAA 4YMVA 3HR8A 2JLRA 5D3MB 1NLYA 4WAUA 1W4AA 4HAWA 1W2GA 4AC9A 2B7BA 3PUXA 2A78A 5FBLB 3AF1A 2IWHA 1E0SA 1TF5A 3V4RA 1S4QA 2QTVB 4RD3A 1MABA 5SZKB 4QBFA 5EE1A 1NLZA 1OFHA 1XEXA 4KITB 3FPAA 1XD2B 3K9NA 2OE2A 5HCIA 4YDHB 4QJ5A 2ONJA 2QBYB 5GJBA 4DUGD 1YR9A 2OV2A 2WAYA 2WIAA 3TW4A 1NF3A 1FP7A 2YHSA 5G3ZA 3IGFA 3A58B 4LDJA 4HUTA 1GTVA 1H8HA 2F43B 4OI0A 1FNMA 4JLMA 4TSFD 2NPIA 3FTQA 1MOZA 3GJ7A 2VYFA 5KPJA 3NBXX 2ODEA 5C18A 2JLXA 3THWA 1JQLB 3LDAA 3QENA 5C2JB 4PAMA 1EFRD 4KFUA 2R6CA 1Z0DA 3FMOB 2AKAB 1KSGA 5FOTA 2HEIA 1X8LA 1JR3A 3E2IA 1E98A 3QQ5A 3CLVA 1WA5A 3AV0B 5CB6A 2GZHA 1W5TA 3GP8A 3LRPA 1OE0A 4G5SA 1OH8A 2XB2A 2YWGA 4NTZA 5SZIA 3Q7QA 1CLUA 2ZPTX 1GOTA 1SHZA 2K5UA 4LWZA 4RCZA 3REFA 3WBKA 3L0PA 4L9WA 1YKSA 4LHZA 5LB4A 1RJ9A 3W90A 2ZJZA 1TQ2A 2E1RA 1HQYE 3NEJA 4HEJA 3RS2A 2X19A 3OAAD 5FOSA 1E9CA 1X86B 4EPYA 5KYKA 2FZLA 5E7IA 5FBWB 1AIPA 2I1QA 3VU9A 2AWNA 4RFVA 4F91B 2WSSA 4TQUS 3UG7A 4DEXA 2JGNA 3SC3A 1OH5A 1NG1A 4Q1DA 5G53C 2FOLA 3U4QB 1E69A 4Y0AA 3QY0A 3T5DA 4JVNA 3K9LA 3NXSA 2EYUA 3NIBA 5CM9C 3CWQA 4CZ2A 5FUVA 3SYLA 1SVMA 3T15A 4RZ2A 3UWKA 3NDPA 4DKXA 5KTYA 2CLDX 1Z0KA 4TL6A 1IONA 1XMJA 2FNAA 2QM8A 3B85A 4YMWA 3M6AA 1RE0A 2H57A 5E7MA 3SEAA 5F98A 4ESVA 3KXIA 4IDOA 4ZO4A 1ZD1A 2IS6A 1C4OA 4OHYA 4LHYA 5DISB 1T0JB 2H17A 1SVSA 4HI0E 4PO8A 3T06B 1P9NA 1E2JA 4Z8YA 1TPZA 3AKCA 4CT5A 2ATVA 4YMSA 3AGPA 6Q21A 2HF8A 4JS0A 4V0LA 1S0UA 2W00A 5H8WA 2WKQA 3KXLA 5JRZA 5GJVC 1YQTA 5CLQA 1G8PA 2XZOA 1GL9B 1XJQA 2F7SA 1U0LA 3I92A 1XEWY 4CEJA 1F3OA 1M74A 2D74A 2NZJA 3T1OA 1EFRA 2REOA 5SZJA 4FXPA 2QBYA 2JLQA 5EXSA 2VTKA 4M9QA 1PUIA 2TMKA 2XNSA 3OF5A 4KSCA 3KQUA 4MKGA 2B8TA 2UKDA 3EG5A 4X8MA 3VNVA 2WIBA 3NWJA 3THWB 4PPNA 1ZIPA 2W2XA 2J7PA 1Z6YA 2VSOA 3U7FB 5ELXA 1Q20A 3FMPB 1Z06A 4OJKA 1E2HA 5FPTA 5HCNA 4GP6A 4D2IA 1NNEA 3AF4A 4G0NA 3KB1A 1T9HA 2FN4A 3AP2A 1T6NA 3EC2A 4JJZA 2GZDA 4HZUA 1P9RA 4PHHA 2C99A 1G7CA 4C0KA 3DO6A 5SZHB 3A8TA 1N5LA 4D26A 4B3BA 1OXUA 4RD6A 4MA4A 3R7WA 5FPSA 3AF2A 1E1RD 2IYSA 3BXZA 3LY5A 4QM6A 2J41A 3GJ0A 1U0JA 5CITA 1DAKA 4FMBB 4DB2A 4N0DA 5P21A 1FTSA 1S8FA 4RZ3A 2R44A 2HJGA 4GRAA 3KJHA 4D6PA 2WKRA 3QVVA 4FMDF 1OJLA 1P73A 5L8VA 3I32A 1GFIA 4F4IA 3BERA 3VKHA 2QAJA 1LVGA 3EIEA 1S2MA 1XTRA 5EXPA 2PT7A 4URWR 3EPLA 4HZUB 1Y63A 1VHTA 4DLYA 4PO1A 4B76A 2C95A 3EWSA 3KJGA 4MGYR 2HF9A 1KAGA 2FF7A 4PSKA 4BASA 2J0VA 4AKEA 4NU0A 3CKLA 2BCJQ 4DDVA 3F3YA 5LPNA 4HB4A 1GUAA 1N6LA 2ZJ2A 3RS0A 4OQMA 1Q3TA 2BHRA 3A4LA 1KI9A 3LLMA 5FPKA 2BMDA 2CE7A 4MRVA 4DLWA 1CKEA 2GXSA 3OEED 1W46A 4JT2A 4EFNA 3GLGB 1ZMXA 1XD9A 2H1LA 2IHBA 2ZM5A 5K8IA 2X77A 4LZZA 4PQYA 4HAXA 1SULA 1G17A 3TQCA 5IRCD 1OKKD 1P2VA 2J87A 2WJHA 5FOUA 5JHGB 3BWDD 4UNQA 1OXTA 2BKEA 3UWOA 5IHPA 3QKUA 3CNLA 4DZZA 4EJSB 1D9XA 1J90A 3I72A 1KKLA 4FWIB 4TN1A 1P5ZB 4DDTA 1KK2A 4U7DA 2OM2A 2UVQA 1OXSC 1OXVA 1W4CA 1ZRHA 3CPHA 2G9NA 4DIEA 5L3QA 1RYFA 2GBLC 4KV9A 1ZYUA 4GNKA 3ZJYA 3VR1A 5EXTA 3TGPA 1G64A 1KMHA 3A37A 4LY6A 3U2QA 4V03A 4BE7B 2FFBA 1QHNA 1D8TA 4OK6A 1T5IA 3SBDA 4HAYA 4TLEA 1UEJA 2P2LA 1NVVR 3QXCA 4LJ4A 3RRYA 2R6AA 3A4NA 2JATA 1Z0FA 3SFZA 5KO2A 2BEJA 1KI2A 1ZC3A 4MYTA 4BLRA 4L15A 3GJ4A 1CJUC 4OHZA 4JL8A 2D2EA 4M9ZA 4E03A 5FBVB 4JLJA 3W6OA 5JBQA 4KFTA 4KI0A 5GJCA 4HATA 2VSXA 2BJWA 1G8YA 3MJHA 2IL1A 2RGNA 2PZEA 4BFSA 1W7AA 1XCPA 4A82A 1W36C 1P60A 2Q21A 2NO1A 2YWHA 3CX7A 4NZYA 1CS4C 1FMJA 1T4GA 2QN6A 1AN0A 4HLDA 1VPLA 4KJZA 2V6JA 3ND9A 3LXRA 2GK6A 3UIEA 4BLTA 4JYBA 4Q5IA 4AIIA 2ZR7A 2Z4RA 2CK3A 1EFHA 4P32A 2CL7X 5TARA 1LNZA 1UAAA 4O25A 1CR2A 3I4LA 4GMDA 2I3BA 2OHFA 2RH5A 2ZITA 4A8JB 3OEHD 3U3RA 2QSZA 1WQ1R 5K8UA 2ERXA 4LJYA 1O87A 4Q4AA 4B74A 4LYFA 2DCUA 5LB2A 1JXOA 721PA 4A0RA 1TX4B 3GFTA 3QSYA 4M1MA 4QHTA 4G5QA 3TH5A 3Q9LA 1NY6A 4BWYA 3AVTA 3CNNA 4L16A 4EPTA 3UG6A 4TYNA 1QG4A 4MRPA 1VMAA 2NZ8A 2WJIA 3TJZA 1SZPA 1P2UA 4QOSA 3U44B 821PA 4P0TA 3SQXA 3A36A 3ADCA 1V5WA 3N2IA 5KSZA 1JAHA 2YKGA 2PH1A 1IN8A 1E1QA 4D80A 1KYIA 3B1YA 2OLJA 4OK5A 2EYQA 2CHQA 3F5FA 1BMFA 1GL7A 2VL7A 1FOEB 2P5SA 2EVWX 1UM8A 2OAQ1 4X8LA 2DBYA 3CW2A 3S1AA 2NGRA 3VR4A 3KZ1E 2BDTA 3QF4B 4XVQA 2A5JA 1AQUA 2AN9A 2WSSD 3P27A 2XSZD 4Q1AA 3W6NA 2BM0A 2F9MA 2X2EA 4M22A 3RS4A 3T34A 2GCPA 5FOWA 1OLOA 4LC0A 3AF0A 2GEUA 4CDGA 3CONA 4LBYA 3RANA 4C0BA 3NH6A 4LK2A 3B1XA 2JASA 3QPUA 4XD7A 2OFOA 2N46A 4TZ6A 3U44A 1G8HA 2PMKA 2NO9A 4O0MA 4P31A 1P75A 4PZZA 3NC0C 1VIYA 4JBWA 4RZXA 3TVTA 4YDSA 2BV3A 4I1VA 4P4TA 2YWFA 3BOSA 2QAGA 3J81k 1LW7A 3K0CC 4MQBA 4MKFA 5L3SA 3O8RA 2J5XA 4YQFA 1FP6A 5B2ZA 1GIAA 2JLZA 4KAXA 3VFDA 1C9KA 4ILEA 3TQFA 4CVNA 1XX6A 3DKPA 3A6PC 2X8AA 1NSTA 4HAZA 4XOIA 2RGDA 2WWHA 2DWOA 2VH5R 1VECA 2HYDA 1IBRA 3W5IA 4OL0A 3E1SA 4W5WA 1OH7A 1JXMA 4TWZA 4KVGA 3O47A 1KK0A 2OT3B 3DZ8A 3MJRA 1GKYA 1FW6A 2O8DB 5LD2B 1VKJA 1ZNWA 4AKHA 4XTCS 3LW7A 2FFAA 5AJYA 4B43A 2XOKD 4DSTA 2XZPA 3D6TB 2FZ4A 4A8JA 4BUJA 2ZRPA 3PJRA 1U98A 4A8JC 4TLCA 1MV5A 3C8UA 1HUQA 2ZRLA 1DG1G 4JT4A 1KI8A 2JEOA 2Z5FA 4M1WA 1P4SA 3CPEA 3SQWA 1EXMA 2QGNA 4JBXA 2EFDB 5B64A 2F1IA 2GXQA 2ORVA 3BD9A 1J8YF 1G4AE 1E99A 1GRQA 3NTUA 4ZV4A 3TNFA 3OFNA 3WXMA 3LX5A 1NN0A 4PC2A 1RRFA 2ZYUX 4NCHA 3WYAA 3GLHE 4TQAA 1G291 2O8EB 4TT3D 2P6UA 4OQFA 2IK8A 1W0KA 3CR7A 4NE2A 1F2UB 3FYHA 2MMCA 2JIZD 2BVNA 2ONKA 2ZI4A 3CR8A 4C9BA 3SU8A 3U6KA 2ZS7A 2NIPA 4MGZR 1OFUX 2MSDB 4W9MC 2H8KA 2W0MA 4C0JA 5G41A 1UBCA 2XXAB 2YYZA 1KO4A 3QUSA 3W34A 4HUQB 4G01B 1W48A 4FW9A 5BN4A 3TVDA 3QF4A 1FMLA 2VP6A 4Q01A 5HR5A 4YLGA 5ANRB 1XMSA 3FHOA 3W6PA 1VIAA 2C2HA 1G3MA 4GP7A 3T35A 4QM7A 1KI4A 2IYXA 5FL7A 1YVDA 4AKIA 1YE8A 1FUKA 3CX8A 4FN5A 3KFVA 4RJLA 1ZNXA 1LTQA 3NKVA 2ERYA 2GZAA 4K81B 3THYA 1ESMA 2YOHA 1OT3A 1E2PA 3UPUA 2ZRGA 3IDQA 5DI3A 3QXSA 5G40A 3SNHA 3GMTA 1YJ5A 2QP4A 1CP2A 4GOJA 2FE4A 2VO1A 4OHVA 4WZAE 4B3DA 1DAEA 3NBZC 4Q4LA 3ZS9A 5HZHA 1E2NA 3R20A 4QXAA 3VX4A 4R71A 1HE8B 4GDFA 1XNJA 4TMZA 4FCVA 3WMFA 3LQRA 2R8RA 5FTLA 5JS7A 1LF0A 2QPOA 4NYJQ 4GSYA 3SDZA 4TTPA 4D0LB 1N3BA 2AR7A 4GZLA 1XTKA 1E0KA 1QHIA 4C0LA 4DDWA 3IO5A 3C41J 4QKQA 2IS1A 2ZYTX 2J1LA 4H9GA 4UXIA 2FEMA 1N2CE 1R10A 3TSWA 2FV8A 1EX6A 1G3UA 2QQ0A 4IDQA 1S3GA 1OFIA 1SKYE 2PEYA 3QEJA 5TV2A 4RSGA 2J45A 2WPDA 3QNUA 2R2AA 1QRAA 2MSCB 4LHXA 2CEAA 2O52A 1SGWA 1YZNA 5CB8A 3RSLA 3K53A 3BBPA 2NO6A 4EPRA 2Q9CA 5DGXA 2IWRA 4M9XA 1AZSC 3H2YA 2CCGA 2IA5A 5KSPA 5BW8A 2B92A 2C9OA 2IEZA 4Q03A 1U9IA 5LDDC 2G0TA 2QP3A 2VF8A 3WP0A 1UF9A 1ZD9A 4KSBA 2IBMA 1ZU4A 4NBSA 3THOA 2HYIC 1Z0IA 3NVAA 1XRJA 1G8FA 1SKQA 1GSIA 3MAAC 2O5VA 2VHUA 4XJXA 3X1YA 1MO5A 4Z1MA 4ZDKA 3FHTA 3WBJA 2CVFA 3ICQB 121PA 2ZJ8A 1D2EA 1L4UA 3AVXA 4BPBA 1R5OA 1TF7A 4EJSA 3K09C 4DBLC 2ODBA 2BBWA 1VTKA 2FX3A 4M8NE 5JCZA 4LJAA 5C1BA 2ZEJA 3I62A 4Q1FA 2ZRFA 1F60A 3K1JA 3O8BA 4IRUB 4JLPA 5EP4A 4ZI2A 1SQ5A 4HLUA 2C9YA 3K9GA 2GEDA 4EIWA 3U4QA 4HLUC 4PXAA 1IOZA 4MYCA 3SHFA 1QHGA 2QNRA 1OXXK 4B32A 1AKEA 2BBTA 2C03A 4QJ4A 4R98A 3SFVA 2JJ2A 4DT1A 3Q7PA 1MR3F 4KU4A 4AKGA 1DAMA 1X1SA 1ZINA 3TE6A 2FU5C 2XJ9A 4RCYA 4DDUA 2PJZA 3FB4A 4A1FA 5B30A 1IJEA 2G1KA 4X8HA 3VHXA 3W8NA 3U6BA 1HYQA 1X1RA 2CJWB 1XB2A 1G18A 1KNXA 3CRQA 4M1TA 3X1ZA 4A0GA 4IDNA 5JEEA 2ECKA 2PLRA 4IOLA 3SZRA 2NTYC 3RYTC 1IN6A 1HURA 1CF4A 3MWKA 1KIMA 4PAQA 3ASYA 4A2QA 2J3EA 4NHOA 4IVRA 2FEOA 1OW3B 1KY2A 2FSHA 2H16A 2KBEA 4Q4HA 1M34E 1N6IA 3I61A 2Z6VA 4ERNA 4OHWA 4C0HA 2ASEA 5F9FA 1N6OA 1WE2A 1US8A 2QMOA 2C77A 3DDCA 2GWHA 3UANA 4LCBA 2DR3A 3VKWA 5LD2C 3BS4A 4Q1EA 4I81A 5J4VA 4ZPXA 2WWYA 4Q4AB 1BYUA 1G6HA 2DY1A 2IUUA 1S9HA 3I5XA 3ZQ6A 1OHHD 1VYVA 3AF3A 4DXAA 4B33A 1JPNA 3D7MA 3CH4B 2Q6TA 2IXEA 5JMTA 1E2DA 3LV8A 3ZZTA 3B1WA 2MSEB 2PT5A 3CH5A 4GZMA 3NC1C 1UJ2A 4YXWA 2IYVA 3U5ZB 3EPHA 3C16C 4V0MA 5D3MA 2QRNA 3QKSA 4PX9A 4Z1MD 1AKYA 2RGBA 2VHQA 4BGDA 4A6XA 5AUPB 5F2EA 3DL0A 4C0AC 2L0XA 1E2KA 1G16A 2REXB 3AUXA 5HTKA 1IXZA 1E2EA 1A4RA 1M8PA 3GLFE 4J0QA 1KSHA 3RHFA 4UNSA 4DIDA 2ZRMA 4WXRA 3IKJA 4CT4B 4HYYA 1G1MA 4TSFA 3KKNA 2AXPA 3IBYA 4DLZA 2OCBA 3DMNA 3GLFA 3B5JA 3KJEA 3M0EA 3GFPA 2H18A 5D3QA 3H84A 3RWOA 3OEEA 5BQ5A 2XOKA 2VP2A 1KNQA 2WMNB 4QNMA 1UEIA 2B8WA 3BB1A 3PQCA 4KLZA 1XPRA 4IXMA 1VYTA 3GLHB 3U3OA 4QGFA 1L7VC 2GNOA 3AB3A 2DHRA 3ZD7A 3M4YA 1WCV1 2IUTA 4F92B 5HZKA 4LX0A 2CMKA 2J46A 3R9IA 3CB4A 4IOMA 4IFBA 3TW8B 4BFYA 4P3YA 2A9KA 4QC2A 4V0ME 2P3SA 1CJMA 3QF7A 2X2FA 5HKKD 2YOFA 2WJGA 4HB0A 1ZUNB 1Q12A 3MRSA 3MWJA 2ZJOA 4E09A 2ORWA 5GADl 1PV4A 2AFIE 2GJ9A 3Q3JB 1RJ9B 3BFKA 5FUXA 2ZTSA 3QVUA 5K8LA 1P3JA 1U8YA 3K0EA 3SYKA 1W44A 5DIFA 2ZR9A 2G88A 5DHFA 1CR4A 5KDDA 1DBSA 1Q57A 5HE9A 3P1JA 4DLXA 2A5GA 4D4KA 4RKEA 3KTAA 3VMFA 4PSVA 2QUZA 4EFLA 1IHUA 3B8HA 1IN5A 4Q4HB 1CRPA 1D5CA 4A9AA 2R9VA 3A4MA 3T5GA 2J7PD 5C46F 1W36D 2DFKB 5AWFC 3SS8A 1N6PA 3M1IA 2ZSFA 4ZCMA 1Q0UA 4HDCA 1UFQA 2ZI3A 4Q9JA 1TF2A 2RGEA 2BWJA 2JLUA 4EPVA 1R8SA 4TLBA 4ZI3A 3PUZA 4AYWA 5J4HA 2QRZA 2NO7A 5KSOA 1MKYA 3PITA 2QPAA 4ITRC 2ZVQX 3VQTA 3ZVNA 2KBFA 2ZYWX 1HEIA 2AX4A 1JR6A 1QDEA 3K9HA 2ZVPX 4IKEA 1BKDR 1Q22A 1L4YA 2AWOA 3RLFA 1XZQA 1OV4A 1U0HC 3LNCA 1AK2A 3Q5DA 1I2MA 5FOXA 1NVUQ 1Z6GA 2CNWD 2O8CB 3MCAA 3QBTA 3VR5A 1Z6XA 3VR2A 4AG5A 4YC7A 1JQJC 3QXJA 1ZC4A 1W1WA 3KFXA 5J5CA 5JSZA 1M2OB 4GMXA 2QTHA 2F1HA 1E79A 1E2MA 4HB3A 2ZYVX 3IEUA 4H1VA 4Q1CA 4RZUA 3RDPA 3C5HA 1HV8A 1TQDA 1FX0A 3NHBA 1YZLA 3RRNA 2WAXA 3X1DA 2FSIA 4PHFA 5CIQA 4BFTA 5JLJA 1GKIA 3GJ6A 5CDFA 1YZQA 2O8FB 2CXXA 4D4JA 2I1VB 4NMMA 3SI7A 3UATA 2VP0A 2RCNA 3B60A 2WWWA 2EFGA 5JWHA 4IDPA 2V1XA 3EZ9A 1CULC 1R2QA 2IYQA 1DAFA 4LBWA 2AD1A 3H1TA 4DCUA 1ZM3A 1B23P 4QGAA 2H92A 2UZ3A 2GEVA 1DTSA 3BGWA 2FDCA 2GESA 3HPRA 2N1BA 4JLOA 4R7ZA 4MITA 2ODWA 2DFTA 4NYIQ 4XWKA 5DN6A 2VA8A 1LS6A 4Q4JA 4U02A 5EE3A 4OQXA 1AM4D 3IILA 4FWTA 3LBIA 3GJ5A 4Q02A 4GFDA 4BRWA 3D3QA
chains in the Genus database with same CATH superfamily
2DLDA 2EJCA 3HRIA 1ZR2A 2AJ8A 1CRZA 5DM0A 3QU7A 1VJ5A 3NDBB 4PFSA 1L3CA 2PYZA 4UBMA 4EA9A 2BY4A 1WKCA 4RKRA 2CW5A 4YTEA 1QYRA 4Q4DA 4YJ2B 2DBZA 3AHDA 1L5KA 3UYKA 4BRUA 5LJLA 2UXDB 4RELA 3DF7A 2CKDA 3LJKA 4B75A 1G5HA 3LH5A 4Z4HA 5K3SA 1NW6A 2ZIAA 4JQYA 3INYA 3AI2A 3CPJB 3DT8A 3AOEC 3K4HA 3NTLA 4Z9AA 3IJ5A 4ZU1X 4EZIA 2AFVA 2WT9A 3HNPA 3P32A 4LRWA 2IV7A 5DHPA 3AMVA 2PUTA 3UV3A 621PA 1MIOA 1QIDA 3TVYA 2BJVA 1WO8A 2Q1UA 1GPMA 3EGCA 3H2IA 1FYWA 3CNQS 2W70A 1A7JA 3K0AA 4WBNF 3KWFA 2V7WA 5BOSB 3OJOA 4ESOA 5T7BA 3O8QA 2NZVG 3GMIA 3CV3A 4M8LA 1GZUA 2SHKA 3CEHA 4IKOA 5EP2A 3FBTA 2Z57A 3GLKA 3PC4A 1L8QA 3GZ4A 2BF7A 2ZBDA 3MF4A 3QFCA 2W2LA 4JUBA 2JFQA 4MUFA 4XWTA 4QDOA 5TR9A 3I8XA 3IEVA 2QOEA 2CE2X 3EUAA 3EQ7A 4G9EA 5ENVA 2V7XA 5EE9A 2WT4A 3UK6A 2A1TS 3A3YA 3K9FC 2GO7A 4MYRA 1NBME 3TW6A 4BLWA 3OTQA 3AL0C 3P71T 1DCMA 3MWLA 3QWFA 3PQ4A 3D0OA 4PLTA 1ZH2A 2VFAA 3TI7A 4L85A 3TNYA 1X1QA 4L5CA 2F3TA 2PUHA 4OAQA 4PC7A 1P5HA 3L0IB 3T9EA 4URFA 4GOXA 1CERA 4Z2YA 3U62A 3WRXC 4U6SA 1PBTA 3UJBA 2PHZA 4C20A 2WP8J 4FMCF 1I7PA 3HWX1 1EK5A 2DQYA 4URVR 1N5JA 2PJRA 1T9AA 4XEUA 1PGQA 2VBIA 4J16A 1EB8A 4O29A 2VJMB 3C43A 2PAFA 3MCZA 4OMDA 1BWPA 1Z28A 5ALMA 2QU8A 1O94D 3TD6A 2JGEA 1JB9A 1IIRA 3GEPA 5BNFA 4DPKA 1ML3A 2GHQA 1CV2A 4NEGA 2GEJA 2AGVA 4A8PA 1O95C 2HA5A 1DLJA 4MP8A 4Y0VA 1NIPA 3TKYA 4EELA 1BGVA 3BL6A 4IRMA 5B58T 5BWNA 1GTRA 1Y1TA 4QU8A 3LWBA 4G6ZA 4REMA 5AJVB 2AVDA 1XDWA 5FR2A 3IT2A 4IH9A 2D1TA 3VSCA 5CAEA 5BQFA 3ETJA 2FPLA 5A5DA 3QEMB 2I87A 2AFHB 3GN2A 5HBGA 2RGXA 1CTQA 1C3JA 4K0KB 2OUIA 1M6VA 1I80A 3OKFA 5F3WB 3JYOA 3L8FA 2D7CA 4BO2A 2WVGA 2XSZA 2QG4A 3H5TA 2FEXA 1XYYA 3USES 3CA8A 2H1FA 3OOHA 4II7A 1DDIA 2Z5VA 1VL0A 4Q12A 3VJKA 3ECCA 5C5IA 3ND6A 1ECCA 1U6JA 2VPPA 2ATXA 1MAUA 1F4PA 3CO5A 1R0ZA 3IQEA 5ENDA 1L5VA 1D0IA 3M3PA 4FB4A 3ZWDA 5IJZA 2RK3A 5CXSA 3ZVRA 5AOCA 4BUCA 3L8GA 3FUTA 2Q27A 4I8XA 4M7PA 4XLTA 3E9YA 1FP4B 4IS3A 1I6MA 4F9TA 2TMYA 4QUGA 2PX5A 4ESHA 5I6DA 4QHYA 1AKVA 1KK1A 3U3KA 1JH8A 3VH1A 1SXQA 5J63A 1N5KA 3ZBQA 1NXTA 1N8NA 2DX7A 1RE1A 4ND8A 2OHHA 1GVNB 2NUTB 2P6MA 1Z2NX 1ZRSA 2IYRA 1I2DA 3COPA 4JJAA 4PAWA 2PGOA 4E2WA 5KOYA 3DMGA 1QV7A 3TLGA 5BV2P 5JSKA 1AU9A 3Q10A 1H8ED 5E4YA 2AYXA 4NJMA 1V45E 3TBHA 1AQYA 3IPYA 1W0JD 4WN9A 2OZLA 3D5EA 3Q0IA 4HXGA 5ALRA 4MW6A 2IEBA 2HV9A 3GB9A 3CJTA 4RJIA 2ZRIA 1S3SA 1A88A 3HYTA 1JIVA 1G3IA 2R6R1 3LY9A 3MXOA 3R5XA 1SPBS 2DT8A 4MCAA 3WYFA 4BNTA 4UUPA 3IUEA 4GPD1 4BL5A 3LA8A 3BC1A 1UJMA 2Q4RA 1JUDA 1DS6A 5DYGA 5IBPA 1K8XB 3WMEA 5C35A 1M7HA 1G7SA 3QYAA 4TYPA 1E6LA 5D7NA 3BHMA 4WNAA 1ESEA 4CMCA 4L9SA 1W29A 3BE8A 4F1KA 1XEAA 2B3TA 1NI4B 3DJYA 1GU0A 1QFZA 2GPSA 3AONB 1TTTA 4YUZA 2VZLA 4QT4A 1PSDA 1Q7BA 1T9GS 4QTXA 5DTMA 1XAGA 3LAWA 1KDPA 3HDJA 3TF5A 4MWEA 4M8IA 3PVZA 3KXDA 1HNXB 4Q24A 1CUHA 3C14C 4S1PA 5CLFA 1EGVB 1NN5A 4FFOA 1AHHA 2GFQA 3BWEA 3JZMA 4HQ6A 3UAVA 5KNBA 4Y0NA 5F23A 4KQXA 3GWGA 3ZNPA 2PEZA 4C6TB 3E9EA 4Y6SA 2AK2A 3BXPA 2QP9X 1ICIA 4JB3A 3M5PA 1WV1A 4JKYA 3DEFA 3KAJA 2HSGA 1N1DA 1RCUA 2RHDA 2Y68A 2ZI5A 4Y9UA 1Z0JA 3VHLB 1AS3A 2FHPA 1PLKA 3FAKA 3H75A 3PV0A 3Q72A 5K0GA 2V7UA 2Y8EA 1KDRA 1KL7A 2Y77A 3P0RA 4GBJA 5DRTA 1G4UR 1STOA 5JROA 4PXSA 1MC1A 4CL3A 4HEA1 1U1GA 4R1OA 1GDDA 4FNAA 1YFKA 4RU1A 4DLTA 1XJCA 3ORRA 4JN6B 4O1HA 5AVVA 4NBUA 2NUPB 4UBNA 4OB8A 1QX3A 5KTNA 3PFFA 2HWUA 4N3CA 3AKYA 2GERA 4DNQA 5AVRA 3AIMA 3CJQA 1IZZA 4GU5A 1RRKA 2DPYA 1KBZA 1OCEA 1UJ5A 2P30A 4EEZA 2R0QC 2PUVA 4KXUA 4WZAB 4MWCA 4RTLA 1KZYC 4ZAFA 1T5BA 5FWXA 4YRRA 3RUAA 1V4VA 1E4YA 2H2HA 2ZWOA 1LV7A 3GBPA 1OIVA 4TZ0A 4RTKA 4OYHA 1BE6A 2FLVA 3Q7IA 5H4GA 1NHGA 3MJSA 1W5SA 3Q3IA 2E5LB 1KZ9A 3S5UA 1U0RA 1QUFA 1KEEB 3JAWA 1WOMA 1MVOA 1Q1GA 3BJRA 4AJHA 1UAAA 4FUQA 4B48A 3PIRA 3PJFA 4FINA 1NQXA 4OQLA 4HD8A 3RAPR 2YV4A 3AZQA 4Q3BA 5KJEA 3DNMA 3FHCB 3FOBA 1FMTA 3ZD8A 4ZAVA 2YYAA 3HB4X 4QXQA 3SXJA 4MYSA 3GEIA 3I09A 1A5TA 4R1UA 4XWYA 5K0LA 2WIJA 5I4KA 5I9MA 2LIVA 1R74A 2JDID 2J6CA 1DZIA 5F5NA 3LECA 4ZT2A 4KQHA 1DADA 4Q9LA 3IX7A 4YV1A 2R8EA 4PLYA 1VB3A 3AY3A 2Q4DA 4EA6A 4GG1A 5BN3A 3S2YA 2XUQA 1AXEA 3BH7A 4UNRA 4CFSA 3O90A 3SBXA 3B1KA 3HKEA 3K8YA 1E6MA 3RJMA 4LI0A 3NP9A 3OUZA 4LZOA 4OFWA 3EFOB 3O4VA 1OB2A 1ZIXA 4UHKA 1US8B 4YJ2F 4QDZA 1SZJG 4GWLA 2HX1A 1DAIA 1ZU5A 2G25A 1J22A 3HB5X 4ZVLA 5TXGA 3RABA 5A4AA 2G1UA 3QWIA 2ZKLA 4J3NA 2X0IA 3A2LA 1WAMA 4URUR 5K09A 1Z08A 3FM9A 4H60A 5DV9A 4MVXA 3GRPA 4CL0A 1AO3A 1JDZA 2M2IA 3IAAA 4TUYB 2P3LA 1YJCA 4BGIA 4PNZA 3DHNA 2J32A 1XP8A 1BJKA 3AJEA 2Q49A 1CJKC 2WSMA 3TL3A 4EABA 2WSYB 3BH0A 2JCYA 5K9ZA 2PTHA 3UXYA 2Q8PA 3HDHA 4IRXA 4FNGA 1CE8B 2UUPA 16PKA 3O6VA 4J90A 4LRQA 5AKZA 4C14A 4EHJA 1QHHA 1X8KA 1LNQA 4MQUA 4NYMR 2A0UA 4LC1A 1P2DA 1W6RA 2XQFA 4KRYA 2WTNA 2Y0EA 1COWD 2A6PA 4UNPA 3RASA 1YRWA 3MINB 4UNNA 3WK5A 3G0OA 4DQDA 4QEKA 4F3CA 2OZPA 3OPMA 4PBSA 2UZ1A 2RHGB 2PWYA 3KSDO 2VPQA 4CEJB 3FZGA 1PRYA 3E23A 1VYUA 2YMQA 4KVAA 2CXUA 3RSHA 2GAIA 3DTYA 4L0QA 3TX2A 2N3ZA 4C4YA 3WGZA 1WDWB 3OZ7A 4HNGA 2WY2D 4UEQA 3U13A 3BIJA 3D59A 3W8EA 3VH3A 4MUGA 2WMYA 2QDXA 2CFOA 2CKMA 2VCEA 4FKBA 3W5UA 1HX7A 4FIDA 3PHHA 1EDOA 4NKRA 3JAKB 4KPUB 1HZZC 2G77B 3SJZA 4ZCRA 1WL8A 3IEIA 2B8EA 2PO7A 1NJSA 3TGLA 2VDNB 1FUEA 1HA3A 1R4AA 3C7AA 3AY0A 5E4TA 3UB4A 3ZDRA 3NHPA 5JC1A 4UPDA 1MORA 1ZSVA 3X1JA 1A71A 2CWDA 4IWYA 1FYDA 4RGVA 1HEYA 3WV5A 2G40A 5HPYB 1P2TA 5HS4A 5L7WA 4P0PB 3EFEA 3B3JA 3FGPA 4E21A 3LFUA 3PT9A 2SCUA 5EP3A 2HADA 4KREA 3E5NA 1TPYA 2VEOA 4O2BB 2RHTA 2VTBB 1H66A 1BJTA 3DDOA 1Q16A 2AMVA 4DTIA 1J39A 3SFTA 5A9SA 1Y80A 3R8FA 1HOTA 3C5CA 1AGYA 3JATA 4CLEA 5KNDD 2OBYA 3BWVA 3DMPA 1V7CA 1FP2A 2GETA 5CX1A 2PWAA 2I7CA 1T1JA 5K5EA 1HQCA 2I33A 3OQ1A 1YZUA 2OUKA 3VYSB 2C9CA 7ADHA 4YIHA 3VR0A 4RVSA 4QBKA 2X42A 2EWMA 2QROA 2XMSA 1TW3A 1OILA 1WXDA 2ACEA 1JVSA 2YXEA 3M6LA 2NQ2C 3F90A 1RPAA 1XU4A 2X14A 1KY3A 3ASUA 1P1KA 4MR8A 5DGHA 4B2YA 1E8NA 2QTLA 2R1TA 2VF2A 2LDBA 3UJAA 4JENA 2RGCA 4ZXPA 3INGA 1XJ5A 2M6KA 1C1YA 5JV5A 2I5PO 1KP3A 2YWDA 4MW4A 2FR1A 4RSMA 4WX2B 3QUTA 5D1NA 4F06A 3HXOA 3T52A 4G86A 3LK7A 3QJYA 5FA5A 4JBGA 4B47A 3S28A 1U7UA 4PS0A 3K0HA 1CT9A 4MZXA 1YH3A 1R8QA 1U2ZA 3ZLJA 1PT9A 1J9ZA 4MYDA 4HLCA 4JSTA 2H2DA 4BP1A 4BVHA 1PK7A 1TIPA 2ZROA 5EKXA 4ZHQF 3HK2A 5ELLA 4I1IA 4F84A 1FS6A 3M1LA 1U99A 3F8TA 4RHUA 2H4XA 1EYZA 2GAFA 5ALVA 4I1YA 3DR5A 5M3BA 1IUNA 3T5TA 4DRZA 2O2JA 1TRHA 3PHBE 4LHEA 5EIXA 4PYIA 2WU0A 3AUAA 4B45A 2UYYA 4JLDA 1U4OA 2PLAA 1K27A 1X92A 4QZVA 5JAPA 1V5EA 2Q6IA 3R4VA 3RUEA 4MRAA 4DUYB 2C2OA 1BWRA 5CAEB 4R2MA 1BS1A 3MLEA 4D3YA 1DBWA 1MPXA 2OWDA 2G0NA 4LV5B 1E9EA 3BFJA 4MWTA 4CLOA 3N7TA 3CY6A 1CJTC 4DV6B 4OFXA 4XDYA 1WXWA 1P19A 2ZBVA 3LBNA 4F46A 2QR2A 1ZA1A 3DE5X 2ZSEA 4R31A 1II9A 4C7XA 4EUNA 3DWGA 2WIFA 2RI0A 4FC6A 1I2ZA 1U04A 1P61B 1PL0A 1U9YA 1DARA 1AHIA 2BGTA 3GAFA 3M2PA 4G0YA 4GLBA 3NAZA 2OLKA 2W2KA 5D6OA 4AZWA 3QMWA 1PYDA 2PZLA 2UVPB 2VYVD 2O8BA 5AHRA 1NN3A 4HYTA 5AW5A 2WFZA 4XJVA 4TVOA 2SNIE 4IFEA 1ZUIA 3RYHB 3WL7A 1DT5A 4DC0A 3L41A 4JR0A 3E3MA 1UK8A 1TUEA 2FOIA 2YOGA 4ZCLA 5K3FB 4Q93A 1E20A 4JL6A 3TL6A 4LWPA 4FFBB 1I4LD 4YWJA 1E3MA 3RS5A 3EYWA 5L3RA 2PL3A 4NPHA 4UUMA 3CRW1 4AZ0B 3VDMA 3PYXA 4Q00A 4RGQA 1A4IA 1OWMA 2KMLA 4HWSA 5A03A 5K4HA 4I8DA 2XEXA 3N8GA 4UTZA 3I04A 1Q50A 3RF7A 3NBUA 2NV0A 3QPVA 4Q1VA 3CB2A 4RANA 2ZOSA 4LUCA 3IO3A 4RPHA 2A88A 3Q8WA 5G02A 1M1YA 1TU3A 3IHWA 4IV5A 2QE7A 3KLBA 4K88A 3Q40A 1R0BA 2JNWA 2IS4A 3ZV3A 3EIOA 4K9RA 4AK9A 1Q3KA 5JY6A 1QH1B 1JNYA 3OC0A 3GEEA 1KAEA 2QMUA 3F6PA 3MXTA 1P80A 2A92A 4JGBA 5E1DA 5AJUA 4B4UA 3ETEA 2CJPA 2D0DA 3LHKA 3KKOA 4V39A 4IIBA 1Q91A 2OZLB 5JYDA 3HSKA 4BQFA 1XVTA 1R6TA 2H48A 1R0YA 2O0JA 3NRCA 5EMHA 4JUFA 5FQOA 2VA9A 2Y0DA 3D6JA 1KEUA 3OZVA 4AY6A 1JH9A 4IZIA 4OATA 1NXQA 1QSGA 3V4FA 2B7CA 3JQFA 2QD4A 2F4VB 3EVAA 1LGYA 1PW7A 2JB9A 2R65A 4HR7A 4I5GA 1BDJA 3NT4A 4UPVA 5E6SA 5F5XA 3V2GA 2P8JA 2Y1KA 1V48A 2P5YA 2GCOA 1E18A 4M54A 3TSZA 3C3CA 4E4RA 2PRKA 4TVKA 4GMFA 3LWDA 2C04A 2PR2A 1EP1B 5AYVA 4NICA 2XGMA 1ADJA 1S1MA 1OWLA 1TMKA 4GR4A 4KWIA 2P0AA 5ALDA 2JBAA 4IBOA 4QDJA 2H1IA 3MWFA 3N0XA 1BROA 5CK5A 4MHOA 4XLZA 1K8YB 4F93B 3F74A 2RD2A 2RHMA 6ABPA 5LP1A 4Q3NA 1WCWA 3UJ9A 4KFSA 2IYYA 1RZUA 3HL0A 3REGA 2NW6A 4OYYA 2H1OA 4B6EA 1U2RA 4DJ5X 2B98A 4TLLB 3WO1A 5C1OA 2NV6A 1Z6ZA 2OO7A 3FSJX 4YJHA 4YFVA 1ZJYA 1YZFA 2AIRA 3PC8C 2LR0A 3CRNA 1MB9A 4OKSA 2GXUA 4JXKA 4DLVA 1J5XA 2B0JA 4YCLA 5LP6F 1E92A 1DIHA 4IEFB 3VUFA 3EX7C 1GAXA 3LUDA 2ACKA 2FMKA 3IAEA 1L5NA 4W5NA 1FC0A 4UD2A 1MJGA 2FFJA 1R0SA 1V6SA 2NQTA 3R8XA 3VAAA 1E9FA 1AZWA 3C6YA 2XRZA 2O7RA 3ZCRA 2OMKA 1I4OA 4OXIA 3KCQA 2V54A 4K6KA 1IWPB 2IV3A 1GP2A 2C84A 4TMYA 2I55A 3ESCA 3R3SA 3FWNA 1NBIA 2QORA 3CKYA 5CX4A 4JI3B 1SC9A 1YL5A 4CM4A 3ZXUB 1A76A 2O06A 1OC4A 2VLIA 2M1ZA 3DSRA 1LF5A 3I64A 3NH9A 4IH4A 4ZQFA 2F3RA 1A7AA 1Z9BA 3MJVA 3M70A 1J42A 3TMKA 1F2UA 3ESAA 4K9KA 1RFLA 3HDVA 4HN9A 4D0NA 1MOQA 2CHVA 4D8XA 1TECE 1LS1A 4KWCA 1VB5A 4DGSA 4LWQA 3IVXA 4WOCA 3IAUA 4IIUA 5HG0A 3L46A 4QELA 4BO0A 1C7QA 2R8ZA 3OH8A 4A36A 4YJ3A 3IUJA 5CYPA 5AR1A 1JVNA 3QPDA 2VRCD 4K6CA 3UWSA 1K8RA 1LZLA 1QS0A 1JSRA 3CR3C 1G41A 1OXMA 1E9BA 1J7JA 2B5VA 3IT1A 4Y6PA 2ZE8A 4BO4A 1GZ4A 3AH8A 2JS7A 2ZREA 4IQGA 4KOAA 3WGGA 3K2EA 3DXYA 1LK0A 1E3DA 4N3GA 1YTLA 3G9ZA 3HU2A 4OUDA 5LA6B 2NMVA 1IU9A 4L8GA 1FDIA 5GQSA 3D02A 4PO9A 3HPQA 2O8CA 4RE5A 1P0FA 3OZUA 2IZ6A 2WYUA 1SD2A 2NX2A 4MMZB 2ZJBA 4XYEA 3OBBA 4BP9A 2FEKA 3JASB 2E7ZA 4Q7EA 3WWZA 1GEEA 4PE5B 4CGZA 4UM7A 1C1XA 1EDBA 1W88A 5CPFA 5DTEA 1JAZA 4FZJA 4YN3A 4E7OA 5JNUA 1CUGA 1R9NA 1GQ2A 1I5OA 1Z82A 2NWQA 3O2NA 5DX1A 4A2CA 2AKEA 2CLKB 2DPHA 4A3SA 3KYJB 4OH7A 3GN1A 3L7KA 2HTFA 2O1XA 3L9XA 1T0BA 3DE6X 3NJRA 4BNKA 4BZQA 1JEYB 4AXBA 3JAMA 1ARZA 2DE0X 1N6RA 4P58A 4WJLA 4UTPA 2XMDA 2YRFA 3A1EA 3GCWA 4OBEA 3OU7A 2NP6A 1UODA 3GLTA 4K8RB 3EZNA 1JX6A 1L5HB 2LIPA 1XQ9A 4FJ2A 4MI9A 1YSCA 3VJMA 3IPLA 1Z7EA 4TUYA 2EJTA 4WOPA 5CH5A 3GPBA 4LVOA 2F8SA 3WRWA 5DEOA 3R4CA 4QUEA 3FYCA 4WXEA 3RQIA 4GE3A 1XFDA 1W6UA 3LSTA 3PHIA 4UOQA 3W2FA 2RE8A 1KKMA 3EC1A 5AUQA 3RG8A 2FQ1A 1JA0A 2ZJAA 5CVEA 1KZ6A 4L4RA 1N2SA 3TK1A 3T7SA 4AX4A 3TD9A 5L4LA 3KKKA 1ID1A 3MINA 3WVNA 4OEHA 4C29A 4J4BA 5CG1A 1QYVA 3KJZA 2LZ0A 2PBZA 3EARA 3QG1A 2VP9A 3P0EA 5B12A 4EPWA 2J9RA 3BICA 4WZBA 4G5GA 3LPCA 1WZNA 3N2YA 4YRDA 5ITVA 3KBBA 3DVLA 3FD8A 1LQ2A 1EFTA 1SCUA 2HBRA 3V7UA 2D7DA 1EWQA 4DUZB 2ZWPA 3DBOB 4IGIA 4JIMA 4MB6A 4RNCA 5EJ7A 2FUG6 1JJBA 4TPKA 5AH0A 1VSVA 2EF0A 3SF8B 4D96A 3A6LA 5LXTA 1CZUA 1K6EA 2IELA 4FOLA 3RRXA 1AX9A 4ZEMA 5M29A 2C7OA 1T0IA 1XD2A 1NF9A 2PM8A 4C0SA 4I4TB 2VUUA 4HVCA 4F3KA 1OI2A 4X45A 2R8BA 1P3DA 4E33A 1SD1A 3E81A 4N5LA 4CQNA 3PQ5A 4LXIA 1D3AA 4BC1A 1EJ2A 4ED9A 3ZWBA 3VDQA 4HWOA 5LZ4A 1G5TA 4MUNA 1RRGA 1GXSB 2AEFA 2YZ7A 4L74A 5AM3A 1SCAA 1FFEA 4Y2UA 2V6GA 2P2YA 4X1IB 3L6CA 2EU8A 1QM5A 3COYA 4NVRA 1FSSA 1PFVA 4GPEA 1RM4A 2GWRA 4L07A 1Z5UA 3R0XA 1I4EB 3E9DA 3GIDA 5IJWA 5TQJA 2Y76A 2CT8A 3NPAA 1U9IC 1XDGA 1KEZA 4DSAA 5JZMA 5CX1B 3FNFA 3ZIUA 1PJQA 3ETDA 1NW7A 4MKHA 4KR0A 3C6QA 3QLUA 3H0KA 4IIEA 4POAA 4V2IA 1V8PA 1U3WA 3AUKA 3K35A 4K03A 3ZIAD 4DREA 4MH0R 2Y67A 3M6MD 4L73A 1OYWA 2HLDD 3EXHC 5G0WA 3SSNA 3U80A 2KWIA 4PX2A 5JPCA 3HDTA 2V74B 2IZZA 3OICA 1G4HA 3HJBA 3L01A 3UF0A 1V7QA 5H9VA 3URKA 4A2PA 5LQNA 1YC5A 1DO0A 1TEVA 1UC4B 1T2UA 1LRJA 5TSDA 1GDTA 3M49A 1VI2A 1LPMA 5DYIA 4KOEC 4E5PA 3WAGA 1P2FA 3PTZA 3FMIA 4MUJA 1E6KA 3JQAB 4D43A 4AW9A 2OHJA 1TD9A 1TO2E 4MGIR 2Z8YA 3WXBA 4FYMA 4UC0A 1K6JA 3JVDA 5BPFA 4XGNA 3FDIA 1I3CA 2XVXA 4D8UA 2CL5A 3MZ0A 3GJ3A 5AI4A 3RM3A 3V8VA 4E1AA 3BMNA 1CUFA 3N0RA 4KUHA 5FXMA 4O4JB 4K6OA 1WBDA 2EKZA 1KDTA 1Z29A 4Z4GA 5EIAA 5IX8A 4GYWA 1L9KA 1T9ZA 3TN7A 4W5HA 4EHHA 1FVXA 2AOUA 2JI6A 2VR1A 3H99A 5DHTA 3S7TA 1GZ6A 1BXGA 3WIEA 5EHNA 4ABYA 3NETA 2ZQ5A 5IT4A 1P5JA 2N47A 2X15A 1LWOA 5TC4A 2Q4TA 1F2VA 2VSNA 2WWVD 4BB6A 2ZAMA 3D8RA 3K6KA 4GR9A 4UVEA 4F3YA 1PTJC 1AA6A 1J7KA 1NL3A 1P3Y1 3O92A 1A9YA 5D5HA 1I7SB 1RXIA 1KVQA 1GITA 3GFSA 4NEHB 4FP9A 1M66A 4OSEA 4DCVA 5LQKA 4H1UA 1LJ8A 2Q45A 4UAUA 1J9EA 4TTAA 4BO7A 1Q7EA 2B37A 1E3IA 1U2QA 5A4JA 1WHTB 2ZFUA 4L4YA 5A0TA 2YZNA 1G59A 7REQA 3H5RA 5IAOA 5KJ6A 4RY0A 3FF1A 2AN3A 1D0SA 2X5XA 4YI3A 5ALPA 1NYLA 1FMFA 3FKQA 1TYCA 4G3XA 5J40A 3PHJA 5AK4A 1ZP6A 4YLYA 4XUEA 1TUGA 5CD9A 2WOOA 3QBJA 1II8A 5BSKA 3PEEA 1T5TA 2NT3A 3GLFB 4J9VA 3ULKA 3U81A 1EM8A 1LRLA 1O08A 2YC4C 2IDJA 3SSAA 1D07A 4B6RA 4EYSA 4Z4FA 4QDUA 1R8YA 2Q6KA 1XMIA 5DP2A 4V1CB 4AZTA 4JBIA 1BE0A 1CUCA 1HSZA 2VUHB 1BVHA 3DH0A 1XRPA 4JUAA 3E9RA 3L92A 1H2XA 1ZWLA 2WVHA 1MB3A 3UHPA 2BBSA 2Q3FA 3WYCA 2NLOA 3NHMA 3BK7A 4RMJA 1I3LA 2X86A 2QRVB 3EA5A 4X00A 2QM7A 3QBVA 4WOBA 1XU9A 3EXAA 3O4GA 3OQJA 3GPDG 1NPTO 3PFHA 4CR8A 1Y7IA 3UJNA 3A1VA 2ZCVA 2VZEA 1CHDA 4QARA 3TJMA 2P6RA 1BZYA 2XXJA 1Q1BA 2E9SA 2ZIUB 3GGDA 4TGLA 4E3ZA 4OSPA 3GHYA 2I91A 4TYYA 4B85A 1V95A 1ECLA 1IG3A 1QZ3A 2Q5FA 1FX0B 1N5IA 3OIUA 4HZIA 4OUKX 1Y33E 3MQFA 2F62A 5C7OO 5E6UB 1ISGA 4LGMA 3HVRA 2QT1A 2A2ZA 2I03A 5KHAA 3D54D 3LY7A 4PGGA 3TLBA 1G8GA 4DMFA 1OFVA 3QYFA 4IDGA 3NIDB 1LLFA 3IBFA 4RJJA 2OXRA 2A9VA 3HEAA 4OXQA 1G9XA 2GZRA 2CF5A 2V3VA 3AOGA 4M88A 1MLDA 5A6VA 4RV9A 4JJ6A 2NU9A 1WLYA 1RQNA 3NHFA 5FORA 3T1QA 1RRCA 2ZZMA 4UDOA 3FR7A 6GPBA 3SQMA 2CXQA 2I8AA 2WF5A 3OIDA 5EWJB 5KTRA 1WRBA 1NT2A 3P20A 4JP1A 2Y92A 2D06A 4YJGB 5JXHA 1EDZA 2RHBA 2O3SA 3SDSA 3RC8A 4U8GA 3L8HA 1XYVA 4DT1B 4PGMA 3WNBA 4U39A 1USUA 2E5WA 4L1KA 2JBHA 2IV2X 4JSYA 2QTWB 2QIPA 1YBVA 4X3CA 4L3VA 4GVXA 4MPPA 4ZQGA 1FPMA 1H1LB 5K2MA 4WXMA 4G8DA 5B57C 5DXJA 3VO2A 4TV9B 3VVCA 4UBKA 3ZV5A 4GOND 1VRVA 4HDOB 1Q6ZA 2FZKA 4AG6A 1EE9A 1JFLA 1LK5A 4EHDA 2R7MA 4TTQA 3ZD6A 2I54A 5IT9A 1QO9A 4WVLA 2Z6AA 5CJ2A 2CXTA 3HYNA 2JFHA 3ON5A 3PD0A 3JD1A 2OSVA 2AKYA 2O8DA 3GQVA 3K05A 3EHDA 1H0RA 4QU5A 4V0RA 1YZGA 3DMHA 3NCTA 4GQAA 1B0PA 4KH1A 2YDYA 3WMXA 3HYCA 4ENTA 3FI0A 3AVOA 3UHAA 3CGGA 1ZIOA 2C31A 3KDAA 4HEHA 4B44A 2JJ2D 5KBYA 1H6CA 1COZA 2XECA 4TL7A 3A1WA 4RHEA 3VH2A 3MOSA 3JWPA 2FQQA 4JJGA 5K6AC 1RCFA 4E88A 1OKKA 2IHYA 2C7GA 3B9PA 4NJEB 1RYHA 4ARZB 1N2XA 2XITA 4O4IA 3RUHA 4NP6A 2G3YA 5KOIA 1LVUA 2RG7A 4ZEOA 3FKSA 4EJSC 1W75A 2DULA 2O2DA 2VJLA 3PXGA 1JJ7A 3KHKA 4Q6WA 5KI6A 1WZIA 1VL5A 2H5JA 4D4LA 5J47A 1M54A 1NC1A 2V7QA 2ZUVA 3IURA 5EC8A 4CODB 5BWMA 4JV5B 1NW5A 4MINA 2AZMA 3E18A 3L6UA 4GPIB 3Q3GE 1Z0AA 3B1ZA 4KKVA 4LCJA 3CTMA 1O96B 3E9MA 4JOCA 3LTEA 1AF4A 2H9IA 2LXNA 3HXTA 4WHMA 4IF4A 3SC4A 3ILYA 4DR2B 1KGDA 2H7XA 2J5KA 1REQB 3HY4A 4MVCA 2JHCA 2QENA 2BF4A 5K8VA 1OLSB 4AJ2A 1UANA 4UDXX 1YXMA 3L7OA 3MERA 3T5AA 3CBQA 3NUGA 1DX9A 1RYBA 2QW8A 3TAHA 1J00A 5EPEA 1NVAA 3RS3A 4NLLA 3S6JA 3GUUA 4QLBA 1EA5A 1YR7A 2C78A 2CNBA 3F0TA 3WE7A 2FQWA 1CJVC 2H2IA 1FQJA 2VTDA 3ICVA 1YB2A 3DEJA 3ITDA 4KPGA 3NV9A 4TV8B 5AKGA 3S99A 4X5OA 1N1EA 2PZBA 4GZ6A 3ZV7A 4EVIA 1G6KA 1O9HA 3KHSA 5E9JA 4C3OB 4YMTA 3UENA 3GRZA 2DUNA 5K0FA 2Q1TA 5GOZA 2P40A 1GWNA 2EERA 5HNKA 1VSQA 4LMBA 3N2ZB 2V7VA 3H1GA 4ZDIA 4MV9A 5CNMA 3UGKA 1ZISA 1H6DA 3GLQA 4CKBB 3TRFA 4KG7A 3WLPA 4D4MA 1HMPA 3FPCA 1KOFA 2HHAA 3LRXA 3WKAA 3AERA 3CXUA 1ZVKA 1IJBA 2Q7XA 3AFHA 2QUJA 5JSZB 3THXB 4WECA 3EF0A 1DAOA 3JPYA 3O73A 4G37A 4CEHB 1O0BA 2VBFA 1CRQA 1OF1A 3DXFA 5JVDF 2CNKA 4X8OA 3WICA 3AVUA 3AEQA 2MMGA 2OXEA 4DS3A 3G13A 4DZRA 4DABA 4EEXA 1J56A 1GZVA 1JAIA 2VDLB 1DINA 3R23A 4KSYA 3K5WA 2Q3MA 3OKCA 2M9MA 2J3DA 1HFKA 2QTNA 1ESZA 4M0MA 1NFRA 1PZGA 4AJKA 1TCAA 4MRRA 2L2QA 1TVKB 1YBAA 2V9CA 2Z1NA 4QFCA 3WY9A 5EIOA 4C4XA 4WXYB 1EGAA 3U1TA 3AVYA 2ID9A 2Q50A 1XJ0A 1P81A 2PZMA 1HL7A 1KQ3A 1FFGA 2J9GA 3BGOS 3PGJA 2I2XB 3IQHX 1ZOPA 2EJVA 2ZUDA 3F46A 4TKVB 4YBRA 3T7TA 3WIOA 2O23A 2VDPB 1HNNA 2G17A 3R5HA 4B0PA 4ZMSA 5TMPA 1Z25A 4JK3A 3HVJA 4KV7A 1OHHA 4OK3A 2IYNA 1Y3HA 4K9OA 5FOVA 1AS2A 4X1OA 3AOEA 1EA7A 1A7UA 1HDCA 3BXEA 2Z4SA 3M2TA 4LMPA 2JAQA 5DN6D 4URHA 2GDJA 3QH4A 1CDEA 1KAOA 2I2BA 1FB5A 1NUQA 2ZSDA 1RPNA 2CVQA 4G8CA 1ZM2A 2GVNA 3G6WA 4EEKA 5E9AA 1PDOA 4ABTA 4WTOA 2KW5A 3H4VA 2IE8A 3OOSA 4X1IA 5ICFA 3EIQA 3E9ZA 2OV4A 1RC8A 3LLUA 1YC2A 4GC5A 1CUVA 1TCUA 1VJCA 1HFWA 3ABIA 1W0CA 2XCLA 3OFVA 1EJ0A 3QVGB 5FL7D 3OE7D 1TAQA 2ZTUA 3RC3A 2JG3A 4R8KA 1P44A 4JC4A 5JXGA 3EZGA 5LMZA 3MPUA 1J25A 3VPXA 3ZNNA 4RFSA 1PG2A 5MN6A 4EGCB 4QULA 3WOVA 3FTPA 2CUZA 3NIWA 1ZZEA 5G1PA 3PFNA 1WB5A 1SXJC 1WJGA 1GAJA 3H2KA 4G0OA 5A3SA 4E11A 3K70D 4HGOA 1DC8A 1E2FA 2LVBA 2ZB2A 3W5CA 4QXPA 1F14A 4M6WB 1E32A 4M1YA 2FQXA 4D3FA 4JBYA 3BDIA 4FT4A 4KODA 4K9SA 4KBYA 1XOIA 1T2NA 2EIHA 2FSGA 2HXYA 4K8OA 1EHIA 3I0ZA 3O3NB 4RCVA 2RI1A 2W58A 4B73A 4DV5B 2QA5A 2XMRA 4LYJA 3JQAD 1D04A 4HHEA 1DHRA 3T9AA 2R7LA 1JWLA 1EUYA 1QFMA 3D3EA 3R3XA 2AXQA 3RGGA 4F86A 1GZDA 2CLSA 4DUGA 1NU8A 4H1HA 4J16C 1Q2UA 3O21A 4RMIA 3W3AD 2XUDA 1S2IA 2O8VA 4J7AA 3KVYA 3RC2A 3DLTA 4BNYA 1CIPA 1VP3A 3L7CA 3FUCA 1OZFA 1L4FA 4RSHA 1Q6YA 1RWXA 3FA2A 1JSXA 3I12A 3PTLA 2OFFA 4RA9A 5IZ4A 2OBXA 1H2YA 3KEFA 2RBKA 3AXSA 4B6FA 3FTDA 1RPZA 3W5AA 4AI6A 4DNFA 4DG8A 4Q3KA 3RJZA 1C1DA 1J0DA 4MUAA 2FWNA 2QN8A 3GIWA 3GZNB 5CR9A 2FN7A 1BXGB 3OIVA 2QV7A 4FDUA 2EWVA 5B1YA 1YZYA 1XXHE 1QJCA 1AK1A 4C2TA 3IESA 3OQIA 4ER7A 4QJ3A 1U0NA 2BH9A 1Z47A 2PLWA 4OQNA 4JNCA 3O4FA 4JVLA 1S8OA 2WU8A 3IT3A 4WN9B 3OESA 4MCIA 4YR9A 1Z0SA 4MVWA 2B4QA 1H8EA 2PKXA 3I04M 4CHGA 4CM6A 3K0BA 1RBQA 1QIKA 1QGYA 4PYNA 1F0YA 2JJ1D 3A31A 3DKVA 2CEKA 4I55F 4XW2A 3TSCA 1WUTA 2PL9A 4X62B 3QJ5A 2V3CC 1K0UA 1Y6QA 3FDJA 3O9ZA 4JY7A 1TUIA 4B81A 2OEPA 1UPXA 1MIHA 4NMWA 5KB3A 4NAHA 2QVGA 5EWMB 1ND5A 1QVRA 2BFBA 5CVVA 4QU9A 1ISSA 3F8SA 5HGXA 5H82A 3UWMA 2G9RA 1P2SA 2JA1A 3AY7A 2IKQA 2J6BA 5CXUA 3PUIA 1KYVA 2C2YA 3EQ9A 2C5LA 4BX0A 2FJ0A 1LU9A 1TRKA 3DG9A 4RW0A 4WERA 1UQTA 3AHHA 3HR8A 2JLRA 1EBBA 3HBFA 4Y6QA 3U4IA 1HDRA 1POXA 2PKEA 4HAWA 4P4LA 2B7BA 2GK4A 2UYHA 3GNQA 1GGEA 1HXHA 1Y6JA 2XUGA 3NHKA 8ABPA 5AW6A 1TF5A 3V4RA 1S4QA 4RD3A 1PHRA 1BGWA 4GZ3A 5E1MA 4EG1A 5EE1A 4MO2A 1NLZA 2NVOA 3DV2A 3P9YA 4LYGA 4CF4A 1V1JA 3FPAA 4P2GA 1VPWA 2ZQYA 2OE2A