4I08A

Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
243
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Oxidoreductase
total genus 88
structure length 243
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i08A00
1YH3A 1Y8QA 2DPGA 4DBZA 1B14A 1NFQA 1WW8A 5HTOA 1OC4A 3DBRA 1TVEA 4BNWA 4I8XA 5A3VA 1KEUA 3A1NA 1P1HA 3CZRA 2B83A 2GN8A 3PPIA 2OFPA 2O2SA 3LF1A 1I2ZA 2HJSA 2GN9A 2RAFA 3FBTA 3RD5A 4ZN6A 3TFOA 2O4CA 5H82A 2RHRA 3BTOA 4FW8A 4Q3CA 4RPKA 4NK5A 1PJSA 2WM3A 4KOAA 3TZCA 3OEYA 3TZ6A 1YBVA 1Q1NA 5CDSA 1PGOA 3F5QA 1R66A 3ONDA 1OZAA 4E13A 3RVDA 5G0UA 3MWEB 2DUWA 4MOWA 4FDAA 3PTZA 4JCOA 2JD2A 4FIZA 1JWAB 1ENPA 1ZK3A 4R1TA 2QZZA 4XB1A 4EBFA 3LF2A 1OBFO 3LT4A 2ZB8A 1K5HA 1NQOA 4AJKA 1M76A 4R69A 3BZUA 1OAAA 3T7CA 4ZU3A 2PGDA 3IP1A 4FS3A 5DBGA 3GG9A 3QJ5A 1EFKA 1Q7CA 3E9QA 4WEOA 5BNTA 4PG8A 1P3DA 1C0PA 2CFCA 2JFFA 1I33A 4OSOA 4U7WA 4MVJF 4CM6A 4O5OA 1F14A 2EERA 1LQTA 5KJFA 2BF7A 4RF2A 1NFFA 1R0KA 2YFQA 2Y93A 3PRJA 1GPDG 1EDOA 2CMDA 4EGFA 5IAAA 3LU1A 4OXKA 3MOIA 4RF4A 1HTBA 3JYOA 4NR0A 1GUYA 1VKNA 4AL4A 3F46A 2JFHA 2Q2WA 2RCYA 3G17A 4XR4A 1E7QA 1UP4A 1V3VA 4WCDA 3G79A 2PFGA 3VAZA 2VWPA 2EV9A 4IDGA 1GR0A 3RBZA 4BGIA 1I2BA 1P0FA 4RGBA 3IJPA 3ZU3A 3RKUA 3GGPA 1E3JA 1UXHA 1VI2A 1ZVMA 1IL0A 2PZMA 1B3BA 2HK8A 4RLSA 3UW3A 2BKAA 2Z1NA 2NVUA 2D8AA 2FWMX 4RVSA 5JO0A 2QRKA 4CV1A 3P5SA 2DM6A 5G4KA 4DC0A 3DBHA 3R0IA 4DMMA 1VL6A 4DMLA 1DFGA 5DZSA 3WWYA 1D1SA 3SC4A 3TWOA 4ZQGA 1E7RA 3ZV3A 4AJ1A 1B15A 2OOSA 4IIVA 5HBRA 3RASA 2FY8A 5JMPA 3PJDA 3JTMA 4U5QA 4ZD6A 2OO5A 3BMQA 1ZMOA 4JK3A 2GASA 3ZDFA 2ZTVA 4IM7A 4M8SA 4ND2A 1WXDA 2PD4A 3OJEA 3W4JA 4KMSA 4G65A 1R12A 1X0VA 3MEQA 2YUTA 4BNJA 4B3JA 3N74A 4AJEA 4BKOA 2CVOA 4CM9A 1WNTA 3MWDB 4CV0A 4DPLA 5KWEA 4AJHA 1D3AA 3SBOA 3WFJA 3WR5A 1ZSYA 4QXMA 1LDBA 1ZNQO 1R0LA 4D43A 3A9WA 5JMWA 2NU7A 2HMVA 5CFZA 5EINA 1LTHR 1I01A 3JQAD 1E3EA 4GH5A 3WQSB 4PLYA 5FWNA 1GCUA 3IKTA 3QWAA 3ETEA 4W9NA 1FDTA 3KV3O 2HRBA 4DQVA 3HHPA 3PJFA 2X0RA 3OQBA 4N5MA 4YEDA 4ALIA 1U9JA 1IHXA 1U8XX 1Y8QB 4XIJA 2G76A 5DBFA 1HL3A 2YJZA 5DNAA 3RJ9A 3DBRB 5C5IA 2JHFA 1HDRA 3IKVA 3JYNA 1GAEO 1HSZA 1T25A 2D4AA 3AK4A 2EKPA 5ES3A 1SB8A 1YONA 2G5CA 4TQGA 4A0SA 5U4QA 4QO8A 4XQEA 3ZNOA 2GSDA 2DKNA 2P91A 3TZQA 2VTEA 4IS3A 4DIFA 4BNHA 2OUIA 1EEHA 4YAEA 1YB4A 3AU9A 4NZ9A 4CM1A 2DFDA 2GGSA 2YHUA 4HKTA 2C7VA 1PWXA 1ZXBA 4KP7A 4XGNA 2Y99A 4JP2A 2C29D 3L0DA 4Y67A 4DYVA 2B4RO 2AG8A 5C7OO 3PLNA 4HNHA 4DYDA 1QYXA 3QV1A 1KOLA 1PL7A 1K3TA 4BGVA 5L95A 2VT3A 1E3SA 1MG5A 3QA9A 4MPDA 4RLHA 1YXMA 4WPGA 4M87A 4M55A 4BKPA 2V7PA 4B4WA 5KNLA 2X0NA 2JAHA 4DPMA 2VTDA 2H9IA 3VVCA 4PLHA 3WQQA 1E7SA 2UYYA 1Y5RA 2JL1A 4BKRA 2NACA 5T57A 2VHZA 3OEWA 4P38A 4WJZA 3DZHA 4OIMA 1HE3A 2ZCUA 4AJLA 1H2HA 4E5PA 4ZJUA 3UCEA 4R3NA 4AICA 5JFOA 1O0SA 3GVIA 1W4ZA 4J0EA 1XG5A 3LYLA 3OA2A 3UN1A 5KJCA 2YZ7A 3JYLA 2IEBA 4CLOA 4P4LA 2ZB3A 3LT2A 3ZU4A 5JAZA 5TF4A 3DOOA 3PQFA 1HDYA 3JQ6A 4IDEA 1WDKA 4RDHA 3JQFC 4IDAA 3ITKA 5EN4A 2C82A 4Z9XA 3ZW8A 5ILGA 4MVJA 1RYEA 2E48A 3EZYA 2YQ4A 3PVZA 2PGLA 4YQYA 3L9WA 4IZHA 4CMGA 4E2WA 3VTZA 2GRAA 4RPJA 5F5NA 1G0OA 5A3JA 3MCVA 2AA3A 2VQ3A 3FSRA 1FMCA 2NVUB 1O6ZA 1AHIA 1IZ0A 4JJFA 2AEFA 5G4KB 4RPLA 4ZVVA 5BNFA 1ADGA 3WYCA 4YA6A 2ZQYA 4QQRA 2C5AA 2UV8A 4LGVA 3RQSA 3ZNPA 1DC6A 1LLUA 3B1JA 3WGIA 1IULA 2QX7A 3PK0A 4BUCA 4PLZA 1VKOA 3Q0EA 3JD1A 2PR2A 4W6ZA 2PH5A 3BMQB 4RPHA 3DZGA 3WGOA 3SVTA 2JFGA 2HMWA 2DC1A 2NQ8A 1ISFA 2VUSA 3U4HA 3TNLA 4ZQFA 4YT2A 1H6AA 3ZWCA 3DL2A 3AW9A 2VWGA 1E6EA 1LJ8A 2PK3A 4ZA2A 2EW8A 4P8RA 4D3DA 1KVUA 1M66A 4LSWA 4DLLA 2Q4EA 4RPGA 4J0FA 4D41A 2B37A 1I10A 4IDCA 3NJ8A 3RU7A 1GU7A 2JCXA 4NG5A 1U1IA 2HMUA 2O7SA 4WOKA 1HZZA 3WBBA 4F6CA 5AXAA 4I5DA 3QE3A 4HX5A 4A5OA 3FBGA 3WFIA 4J7CA 5COQA 3ETGA 2YFHA 2Q46A 1MFZA 4OHUA 4MJLA 3JQ8B 4R68A 1SOWA 3CMMA 1LX6A 2WE8A 4GKBA 5JYEA 4CR6A 3ZNNA 4ZICA 1ISMA 5CDUA 4DIOA 4BO6A 3NDRA 3O8QB 3WQRA 4BNTA 1KVSA 1GL3A 2ZYDA 1JKJA 2SCUA 2ZB4A 4QX6A 2ZKLA 4K9DA 4BO3A 3WBFA 5JO9A 1LXCA 2O4UX 1QG6A 4GVXA 4OSPA 2EP7A 4RL6A 4CQLB 2Q2VA 3D4PA 1VLLA 1Q0QA 5CDGA 1R4MA 3IUSA 3HG7A 1UXGA 5A04A 2X1HA 3FTPA 2DAPA 4PLVA 1H93A 3JYQA 5C7IO 1TI7A 2AXQA 2V6FA 2QRJA 1VPDA 3D64A 3TN7A 3FWNA 4FCCA 3DB2A 2D3TA 1IUKA 3GMSA 4RF3A 4DXHA 1L7DA 3RUIA 1N8KA 1X15A 1E92A 4KQWA 2ZTUA 3WLFA 1BDBA 1IZ9A 5CG2A 2BGMA 4A27A 3SJUA 3VH2A 1GYQA 4R5HA 5TNXA 1NVMB 2FP4A 5U9CA 1I30A 4WEQA 3MTJA 1OOEA 5A9SA 3K6JA 5C37A 2VHVA 4KWHA 4NFYA 4ND5A 1R4NA 3DTYA 3S55A 3PYMA 4O6VA 5T6BA 1AHHA 1DLJA 1GV0A 4UUOA 1IHYA 2YDYA 9LDTA 1Q7BA 3C1TA 3NTOA 3ZCXA 3E1KA 5COAA 4D79A 2V6MA 1I3LA 2QRLA 4FJ0A 4NJMA 5KVQA 4CLOB 4HFRA 1KEWA 5K0ZA 1LRKA 5H81A 3FNEA 3FR8A 3I9MA 3TQHA 1ZIDA 3TOXA 5L3ZA 3WSWA 1KC1A 4QECA 3IQDB 4L4XA 4J4BA 2PWZA 3NGLA 1X13A 1E5QA 1GZ3A 1MA0A 1PWZA 4RQTA 3V8BA 4CUJA 5IXSA 4NI5A 4AJNA 4UUMA 2D5AA 5DCUA 5LDGA 2FR8A 2NLOA 3INRA 1I3MA 1Q0HA 4HBGA 4YR9A 2DPHA 2I65A 5ICMA 4TRRA 4XQGA 3RKRA 3BMCA 4BO7A 1IYZA 1GEEA 1RM4A 1F12A 4TMFA 1YKFA 5I7EA 1LLCA 4LK3A 3C8MA 1NHWA 4GI2A 5HRUA 1WPQA 1BMDA 1OI7A 7ADHA 2O3RA 1XDWA 3E9NA 1XHLA 4GGPA 1ISHA 4XEHA 5HWSA 4RVGA 3VHRA 1L7EA 3I9LA 4B4VA 5F1OA 5CDYA 1M6WA 4GPD1 1U28A 1QSGA 1Y81A 4IXTA 3RUEA 2IZ1A 3ZNQA 2YV3A 4J1TA 1K2WA 4BO1A 1ADBA 2NSDA 1HETA 4NNJA 3GVPA 1DHRA 1LA2A 3JQBA 1UDCA 3VTFA 3ZHZA 1IOLA 5A4DA 2Z5LA 3Q2KA 3GNQA 4CM4A 2I9PA 4R01A 1JVBA 1ZW1A 4R1SA 4PLPA 4L75A 2OP0A 3AJRA 1HT0A 1FXSA 3UFXA 4W7HA 3RU9A 3OJFA 4IUYA 4YDRA 5IF3A 2BFMA 1YJQA 2FZEA 4MIEA 4TVOA 3DZKA 5GY7A 3R3SA 3K5PA 5AXCA 4XQ9A 1UH5A 1DC5A 3OQ6A 3C7CB 2FRDA 1WAMA 4FGWA 1HDZA 5ER9A 4A03A 3ANMA 1M75A 4H7PA 3GN1A 1EVIA 1SOVA 1KVQA 3I9KA 3H9EO 4NFSA 3JQBC 3P7MA 2QW8A 1GQYA 3PZBA 4UVGA 1DPGA 3DZFA 2W2LA 3HDQA 1UUFA 2GR9A 3BMOB 3NDIA 1J49A 5DT9A 4BO2A 1EQ2A 4L4RA 3NUGA 1B8PA 1CERA 5KIAA 1KVRA 4EEXA 3OJLA 4IQGA 1ZXLA 1T2FA 5A03A 3EZLA 1WZIA 1T1SA 3NJ4A 1KY5A 3C1AA 4EZBA 1P31A 4Y6PA 2Y0EA 4OKNA 2NUAA 1VL8A 2W90A 1WP4A 2UDPA 1XQ1A 3QSGA 4NBUA 2O3JA 1YL7A 1PGJA 3LZ6A 2EJWA 1GADO 1B7GO 5KJ6A 2HCTA 1DJQA 2Q1SA 3F5SA 3GGOA 3K92A 1WDMA 3QWBA 4OYRA 4EJMA 2PLAA 3AUTA 5BSEA 3V5NA 1HLPA 1HWYA 5ENVA 5KOIA 1PTJA 5THKA 4YAKA 5FFFA 2I3AA 3IMFA 1J6UA 4RVHA 3VKUA 1WMAA 5IDQA 5I8ZA 1ZK0A 4XKJA 1PJ4A 2X4GA 4N5LA 1PJBA 3K73O 1AGNA 2OORA 3GAFA 4J16A 3QY9A 2CDCA 2PKRA 3HSKA 3LC1O 1EBUA 2HMSA 3AUUA 1CQJA 1YL5A 2DT5A 2NU6A 3BTVA 1JAYA 3AY7A 4HXYA 1SB9A 4M49A 5A9SB 1TLTA 4JQCA 2BRUA 1I32A 1R4NB 3L4BA 3NT4A 3CTMA 3ENNA 4ND1A 4RJTA 3JYPA 1YB5A 4P4NA 5GZ3A 4AJPA 4JLWA 2A4KA 4BS9A 5G2OA 3ADOA 3B1FA 3WGZA 4Q39A 2Y68A 1F8GA 1DO8A 3DFZA 1IPEA 4NJMB 1A4IA 3QQPA 2ZTMA 5FI5A 3QVWA 1BGVA 5A9TA 5DOZA 4J2OA 1H5QA 4MVJM 4DIBA 4YPOA 5EQDA 4U0JA 8LDHA 1HLDA 3ORFA 1N1EA 3KSZO 3EGOA 2Q1TA 2VHWA 3L4BC 2CF6A 1U3WA 4OH1A 3SEFA 5JE8A 4Y6SA 1Z45A 4BHTA 1Y1PA 3AY3A 5BSHA 1W8DA 3Q11A 3LLVA 3VVBA 3I4CA 5ILOA 4NJOA 4JP3A 4ZQHA 1GTMA 3NT5A 5JAQA 4CUZA 4EUHA 5BT9A 4PZCA 4BKQA 3WG9A 1PJTA 3NT2A 5DCYA 4MIOA 4GQAA 5IDXA 1N2SA 4H15A 3IL2A 3UCFA 1PQUA 2WD8A 3A4VA 5B1YA 4JBGA 2FR0A 1B3RA 3BHIA 5IZ4A 4AFNA 1Q7GA 2ZQZA 1QXSA 1CYDA 3IDSA 3VH4A 4CM4B 1LLDA 1BTOA 4KDFA 3PDJA 4XQCA 4YVFA 1PJCA 2O2YA 2OXIA 2VNSA 2OZPA 4B79A 4YT4A 1NNUA 1LBEA 1YJ8A 2C54A 3OIGA 3WX0A 3GNSA 3KYBA 5L4SA 5CAEA 3PFFA 2A92A 4AJ4A 1VC2A 2VYVD 3PHJA 1DHTA 3T7EA 4G81A 2YYYA 4PG4A 3RC2A 4CODB 2P9GA 4BOYA 3E82A 5EPOA 5CEEA 5L45A 1H9BA 4B3HA 3OF2A 1D7OA 3ZU5A 4OO3A 3W8EA 3G0OA 5FI3A 2BGKA 3OP4A 4CMEA 1NBOA 2QYSA 4CM8B 1K0UA 2OBYA 3V2HA 5TLSA 1R0SA 2BI7A 4J1NA 5JDCA 5F1PA 3JV7A 2JKVA 1O8CA 2NTNA 3DQPA 5KVCA 1YS4A 2VYNA 1GDHA 3WYEA 4RV9A 3OJ0A 5CHEA 2Y0DA 3UXYA 3RC7A 4YTEA 1EVJA 2GF2A 1D1TA 2AE1A 3TL3A 4O59O 2C59A 2E37A 4LN1A 1D8AA 1BDMA 4EUFA 3F3SA 2DTDA 4IPTA 4ID9A 4E2ZA 2D0IA 2H6EA 4BQPA 1R15A 3DZJA 4BNYA 2FHSA 2PA3A 1NPDA 4CMEC 1NYTA 4DPKA 4Z0TA 1Z6ZA 4L4SA 4NMHA 1O95A 3K2EA 1K6XA 3ZN2A 1O94A 2VRBA 4FC7A 4ILKA 2WYWA 5COBA 4NBTA 1VRWA 2FZWA 5HM8A 2PY6A 5JDCC 5JCJD 3AFMA 2GYYA 4U8GA 1T2EA 1U2DA 3EYWA 4DVJA 2QQ5A 1Z74A 3I9JA 2CF5A 3KO8A 1ZCJA 2WE7A 4MP8A 4BNLA 2WWRA 1R37A 1MXHA 4FGSA 2YQ5A 5CDTA 4MVJP 3NEPX 2X9VA 1N7GA 2BHLA 2Y1GA 1ZK1A 3Q3CA 4GX2A 2RHCA 2I67A 5IJZA 4MKZA 1FDWA 2WD7A 1VSUA 2O50A 4IZIA 5DBIA 3DWFA 4CR8A 4XWYA 5JPIA 3NGXA 1V35A 1ENYA 2X58A 4XD2A 3H3JA 3RIHA 3F9IA 3H65A 1H6BA 4BVAA 3STHA 2ZYAA 4CMCA 3ITDA 2X5KO 4HP8A 4IMPA 1LRLA 1HXHA 3ETDA 2VOJA 1TXGA 4KUHA 4BV8A 3U4DA 3PXXA 1LU9A 1Z82A 4ZRNA 3TZHA 2E4AA 4I1IA 1EZ4A 1ISGA 1X7GA 4IINA 1K89A 3FI9A 1I3NA 1ENOA 5F3RA 1T2DA 4GSKA 2EXXA 4RVFA 1Y5MA 3E5MA 3DFUA 3DOCA 4HFMA 3RCBA 1E1LA 4PZDA 1A7KA 5ENDA 1SEVA 1OMOA 2IYPA 2VNAA 3BYZA 3O38A 4GSLA 1AXGA 4PCVA 2Y66A 2PZKA 4HFNA 1DLIA 2NTVA 1LRJA 3GN2A 4FFNA 4YQZA 4P4GA 3NDJA 3DMYA 3VPXA 5DCWA 4DUPA 3W4KA 3GVCA 1QV7A 3JCZA 4J4TA 5G4LA 4DRYA 1HSOA 3S1LA 4OMUA 1HE4A 1PU2A 2AQHA 5I9MA 2O23A 1EFLA 1P9LA 4E3ZA 2Z95A 1PZFA 3W4IA 4TZTA 1XWFA 4TRMA 3FNFA 1XIVA 2R00A 4MKXA 3JQ9A 3JQAB 4J3FA 1LDMA 4GWGA 3QVOA 3VZQA 3WJAA 1MV8A 2DBZA 3JQEA 5T67A 4UUPA 4DLBA 4FFLA 1QR6A 1DSSG 3BHMA 4PFJA 1A4UA 1YGYA 2W98A 3L6EA 1QMGA 3GHYA 1VJTA 2IRWA 2PD6A 1A71A 2EGHA 3COSA 1UXIA 3JQ8A 4PZEA 1RM5A 1YDWA 3MTGA 1A9ZA 3GEGA 3PIIA 2OBNA 4ALMA 2OMEA 1P1IA 5CG1A 4YB8A 5F21A 4MVJI 3EAGA 3F4BA 3UVEA 4TRNA 2R00C 3UOGA 4GX0A 3TPCA 3JQ9C 3ZZNA 1N7HA 1UDBA 2UAGA 3KSDO 2VOEA 3O8QA 4CMBA 4LRSB 1C3VA 2PGJA 4W9NC 4OGWA 1GZ4A 4J90A 1YRLA 1DIHA 2CNBA 3AI1A 3GFGA 3FF4A 1ONOA 2Q2QA 3S2IA 3HZZA 4CQMA 1QORA 3NV9A 1B0AA 5DP1A 3WSVA 4CQLA 5T64A 3DAGA 4KUGA 5JYDA 1U5AA 5JY6A 4GMGA 1I0ZA 3WS7A 2CZCA 1JN0A 5DOVA 1P44A 1NVTA 1DOHA 1M6HA 3MZ0A 2D59A 4E5KA 1GY8A 4DL9A 2X23A 3RSHA 1F8FA 2VYND 3I6QA 5ITVA 1CJCA 1A72A 3GGGA 1NPYA 5IN5A 3M6IA 2EIHA 3KHUA 3CE6A 3CZMA 4BNZA 2FPGA 5EMHA 4Y9DA 4IBOA 1N5DA 3ABIA 5TIIA 4MDHA 1EUCA 2C20A 4D0SA 3BMNA 3H9QA 4BNIA 3WTBA 3VH3A 3G3EA 3UF0A 1XELA 4BNUA 3ADPA 3D5QA 3ZHXA 2WD7B 3DAFA 3H5NA 5IZCA 3LVFO 1QLHA 3U9LA 3UUWA 5KKCA 1P33A 3WIEA 1V0JA 4A73A 4BNMA 4B7CA 1L1FA 4U0KA 3ZWYA 4XCVA 2FMUA 3HB5X 3WYBA 1ARZA 3GDGA 1U8FO 1YDEA 2W4QA 3UICA 1DDOA 3U4CA 1ZO8A 4I5EA 1I5RA 2BD0A 3H9JA 3WNVA 1GPJA 2Q49A 3NAQA 3VDQA 4Z0HO 4BO4A 3DDNA 5CPFA 1V3UA 4UEKA 1GV1A 4G2NA 4NFHA 2PH3A 4WNIA 1JTVA 2WTBA 4CLEA 1U3VA 3U3XA 4CM7A 3K31A 1R16A 4KWIA 2GDZA 2H63A 2CDAA 5IZCC 3JQCA 3GR6A 1E1KA 3EUWA 2VWQA 4HWKA 3TOZA 3PWZA 3KETA 4JJIA 4J1SA 5T5QA 2ZTLA 3W1VA 4WLFA 4PIVA 1XKQA 1ULUA 1SBYA 2I99A 1ZZEA 4QT0A 5EERA 5L51A 1MXFA 4B3IA 4FJ1A 1NR1A 1XR3A 1RM3A 2HJRA 2ZIZA 4BGEA 1EE2A 3SC6A 3DTTA 3QP9A 3RJ5A 1UXKA 5B37A 3V2UA 3PHLA 2AE2A 4NK4A 4A7PA 3RFXA 5HA5A 3C3XA 4B7XA 3KEQA 3PHIA 3I23A 1CIVA 1KEPA 4U6QA 1SAYA 1LC3A 4P22A 5TS3A 3JQ7A 3K8ZA 3U0BA 4I5GA 4UVIA 1G1AA 5TSDA 3D4OA 4UULA 4TROA 1DRWA 2X86A 5JBIA 3FHLA 4UUNA 5AQ1A 4MVJG 5I8WA 4ALLA 1LSOA 4BNXA 3H6KA 1PQPA 3DHYA 2QHXA 4OKIA 4ZQEA 1YOVA 1YO6A 2W2KB 3KTDA 3PYXA 4Q3AA 1I3KA 2UUOA 3PGJA 4CM9D 3HE3A 1PJLA 2Y1OA 1NX6A 4GAEA 4JN6B 3BMOA 4Z6KA 5JY1A 4G5HA 5A06A 1PR9A 2FN7A 4J7UA 2QG4A 3ROQA 1PGPA 3H5AA 3FR7A 3U62A 3KUXA 1P77A 4QUKA 2AG5A 1U3UA 2J5QA 2G17A 5B4TA 1XSEA 1VJ0A 3LT0A 1NPTO 1XYGA 1UXJA 1X7HA 3LDHA 4IDFA 1Y7TA 2X0IA 4J49A 5MDHA 3VC7A 2Y67A 3W8DA 2IZZA 2CVQA 1H9AA 3DHEA 2IODA 2TMGA 1X7DA 1V9LA 1IY8A 2EW2A 1U5CA 3TFQA 4CQMB 3PDUA 4M54A 3DO5A 1KY4A 3MJVA 4CMIB 5JXWA 4RZHA 5I7SA 1I24A 5TC4A 3EK2A 4M86A 1LSUA 1CWUA 4CLDA 4PLGA 4JNKA 3C24A 3KVOA 5L9AA 2B5WA 7MDHA 4BO8A 9LDBA 1EMDA 1XA0A 1DIAA 3U09A 2YW9A 2F00A 1PL6A 2VZ9A 5GMOA 3OJOA 3EVTA 3I4FA 4Q3NA 1Y8RB 2AQ8A 3JQDA 2VHYA 1WZEA 1I8TA 3ZV6A 4BO0A 3L4SO 4WCFA 5TJ9A 4MIYA 3GLQA 3W6ZA 3CIFA 4Y98A 3TJRA 3F47A 3MJ4A 3CPSA 2GZ3A 3ZWNA 3BMNB 5FEUA 3F4LA 3WMWA 5KKAA 4XX0A 1SC6A 3Q1LA 1PS0A 3PJEA 5IDWA 3GEMA 3LLSA 2PKQP 3AI3A 4HV4A 1E6WA 4E6PA 5KCZA 4YJFB 2O7QA 4E5NA 2WJPA 4BQRA 4OXNA 3ROMA 1OFGA 1ADCA 2UVDA 3UH1A 3GZNA 3H2SA 4BNFA 4C4OA 2GCGA 1QLJA 4Z3KA 2NADA 3DC2A 4Q3EA 4U6SA 2EEZA 4WUVA 4EI2A 4WCFC 3S2FA 5TQVA 3LT1A 1HF3A 3GY0A 2B0JA 2FOIA 5B4VA 3ZWPA 3TZKA 3U5TA 2WDZA 1HDCA 5CEJA 1Y6JA 3FCOA 1Q0LA 3D4NA 4CLXA 4Y6RA 3QLJA 1IE3A 5DN9A 1BXKA 5DULA 5EL0A 4R1UA 1N1GA 3R3JA 2PZLA 3L6OO 4GX5A 1NXQA 4CV3A 3OM9A 5TT1A 4MINA 6LDHA 3TRIA 4GLOA 4YBZA 2J3HA 3PEFA 3QHAA 3K30A 4PLFA 3NRCA 1WLYA 2AEMA 4L74A 4JJGA 4QFCA 4R3WA 5EIOA 4LVCA 2O3SA 4MVJD 1JLLA 1H6DA 2IXAA 1VM6A 4W82A 4FC6A 4UVDA 3ZWMA 1G6KA 3GH3A 4BNKA 1PJ3A 2PZJA 1YL6A 1M2WA 1NQAO 2O3TA 2GZ1A 3I6IA 3TF5A 3DAPA 2VUTA 4B7UA 4K1LA 2DTEA 4OQYA 2BI8A 4J4HA 2C0CA 5L4NA 3JQ7B 1FDSA 2EF1A 3BTUA 4KTVE 2EKQA 4CJXA 3SJ7A 1E6UA 3W6UA 3WXBA 1P45A 3H5RA 2HMTA 5G0SA 3PFWO 5A9RA 4O1MA 3BTSA 3D3EA 3IUPA 2CUKA 3FPLA 1YOVB 2Q50A 5AVOA 1NR7A 3HN2A 1GYRA 3AI2A 4RVUA 4YT8A 1SPXA 2R6JA 2OHXA 2AW5A 2E82A 4S1VA 4YJGA 3P19A 4B8WA 4RO0A 1Q2XA 5JC8A 4CM8A 3GF4A 3ZU2A 4NU6A 1A27A 4EJ6A 3ZHYA 4IY1A 4BMNA 1K6IA 2O3QA 4FPXA 1XU7A 4TVBA 4MO2A 1PZHA 4CLRA 3M2PA 4ND3A 2OGUA 4B8ZA 3VPHA 1BG6A 3KXDA 4O0LA 2BGLA 2EWMA 2IE0A 3KYDB 4GKVA 3GFBA 4XYLA 1ZK4A 5L7WA 3DONA 4JBIA 4WLEA 1BXGA 1HRDA 4UEOA 4EW6A 3GDFA 3CKYA 3X2EA 3DEYX 1KETA 4XDZA 4ALNA 1BWSA 4K26A 3HADA 4QTZA 4OM8A 3RFVA 1F17A 4EJ0A 4PGFA 3ULKA 3GG2A 1B8VA 5I7FA 3WGYA 2WMDA 5KVVA 2YV1A 4J9UE 3GRKA 4J7XA 1ZFNA 1H2BA 4CMHA 4E30A 1DAPA 1ENZA 3BA1A 3R1IA 2D1YA 3Q9NA 2V65A 5A05A 1RYDA 1LC0A 4N5NA 4DTIA 4FFPA 4J9VA 3ZHBA 2J5RA 3JD2A 4WCFB 5AOVA 1JKFA 1A9YA 1QYWA 1K6JA 4RORA 1FDUA 2HO5A 4BKUA 2XAAA 3D5TA 4GWKA 3KYCA 3ZWVA 1UZNA 2NVWA 3O9ZA 4FOSA 4I08A 4TKMA 1PS9A 5LC1A 1BHSA 4JXKA 3ZWOA 4IJWA 1BW9A 4YYZA 3RBVA 1BXZA 5ITWA 3QVXA 4DQXA 1JQBA 4QSMA 2YDXA 3T4EA 1Y9AA 1V8BA 2C2XA 1U4SA 4CL3A 3GZNB 3HFGA 3RAJA 4R5MA 3RUFA 3V1UA 2HSDA 2V6GA 3H9UA 1KS9A 2DBRA 2G0TA 3RUDA 2QYTA 3AY6A 4XGIA 1H6CA 4PVCA 3UKOA 3HQ4O 4R16A 2OP1A 3PWKA 1XCBA 4A26A 4AVYA 4FB5A 3RUHA 3UAGA 4WK6A 1NAIA 1LI4A 4LCJA 3QWFA 3EW7A 4D45A 1J0XO 3INGA 1E0DA 4WASA 2I5PO 1LDEA 1X14A 4OOFA 5DF1A 4GL4A 1PSDA 1FDVA 5T8KA 4XGKA 3PQEA 1JKIA 2Y0CA 1PEDA 3VZSA 2O48X 2X6TA 2NV6A 2DBQA 4JBHA 5L4LA 3GAZA 4LRTB 4LW8A 1ID1A 4TWRA 3UHAA 3LSYA 1GZ6A 4BB5A 4OQZA 1TA4A 4DGSA 2Q99A 2HDHA 4CM3A 2X0JA 3PGXA 4QFDA 3WB9A 3FN4A 1NASA 3GT0A 4ZGWA 1DIBA 3BAZA 5KJ1A 5TRTA 1YBAA 1NVGA 2C5EA 4BO9A 3C1OA 3JQAA 1PJ2A 2EHDA 1DAOA 2JD1A 4NBWA 5TT0A 2DVMA 4NPCA 1NWHA 2FSVA 3OHSX 3AM4A 1JAXA 1QYVA 2P5YA 5T8KC 2ZCVA 1I36A 4IS2A 2VCYA 1BVUA 1NWCA 2BELA 3AU8A 4YACA 5FF9A 4WKGA 1WWKA 1MLDA 4W4TA 4WLUA 1EDZA 1VE9A 2NWQA 4EEZA 4Y8VA 3OIFA 4ND4A 5G0VA 5C3MA 4XRRA 3QVTA 5AYVA 2J3KA 4YRAA 4YJGB 4HUJA 3ZW9A 3AWDA 1QKIA 3KLPX 4MVJE 5I9NA 1EK6A 4BGUA 2ET6A 3P2YA 4BV9A 4RDIA 4XJTA 4XYEA 1MUUA 2CD9A 1HE5A 3ZV5A 4CLRB 2G1UA 4JIGA 3HDYA 3D3WB 4IQ8A 5B4UA 3ZGYA 1Z75A 4YT5A 4E2XA 2XXBA 3I3OA 3IJRA 1CEQA 3DBLB 1NM5A 4J2HA 1DRVA 1PZGA 1YQDA 1LDNA 3NTQA 3VPGA 3PIDA 3GC6A 3C85A 2BFPA 4BNVA 4C7KA 2W2LD 4CMJA 1BXGB 4D0RA 4I9UA 1W0CA 4BIIA 3AM3A 3I83A 1XLTA 3WTCA 3QIVA 3K9QO 3EY4A 1E1NA 2QIOA 1TT7A 3BHJA 1TEHA 2GPTA 1UP7A 4F3YA 2UUPA 3OFSA 3E48A 3V1TC 4FOOA 4KDEA 3L9XA 3H7AA 1HDOA 4D3SA 1C0LA 1R6DA 1KVTA 3EVNA 1E1MA 3P2OA 2ZYGA 1B16A 3Q6IA 4YJDA 4ALKA 1YQGA 3AOEA 3WMXA 1XEAA 4NIMA 4YAGA 1B8UA 4YAIA 3KYCB 1HDXA 3KRTA 4HNGA 3GHHA 5JCXA 1JVSA 4IQ0A 1C14A 3PHGA 4WOJA 3OBBA 1BW9B 5F1KA 4D42A 3DBVO 1SNYA 4YXFA 1GUZA 2J5KA 2RH4A 4GVLA 1NQ5A 1JWBB 2DFVA 1MX3A 3FNHA 1ISJA 1B2LA 2GLXA 1LQUA 3ICPA 1LDGA 2Z1MA 2VRCA 2IYOA 3I52A 6ADHA 3AOEC 5IFLA 1NTOA 5B12A 1EUDA 1DC3A 4K6CA 3TDKA 2AQIA 4R41A 3WGQA 4RCVA 1CF2O 1BRMA 4O63O 3HN7A 2BH9A 5HS6A 1KYQA 1CETA 3R6DA 3OETA 4OJNA 2ILTA 3PZRA 2OL4A 4F46A 2BLLA 3LC7O 3F1KA 1GQQA 2IDZA 3DMTA 2Y05A 1PZEA 1E3IA 4KUEA 4YJHA 4XYGA 2J3IA 4OAQA 4CR7A 3PHHA 2V6BA 4NH4A 3GRPA 3S8MA 5L40A 4Q3DA 2Q45A 5H83A 2O3UA 2ZK7A 3E9MA 5JAMA 3WWZA 2EKLA 3WJ7A 5JAIA 5DDIP 3GOHA 5MGBA 2WEKA 1SEPA 1ZSVA 2G82A 3NX4A 4II3A 3DHNA 4CMKA 4YWJA 1RPNA 2CDBA 4C7JA 3JQGA 4AJ2A 5BNIA 3NTRA 4A10A 3MJTA 4MKRA 4ZQBA 3H9GA 3ONFA 1T4DA 1HYEA 1YE3A 4URFA 3GVHA 1XGKA 1V6AA 4IJVA 3VDRA 3JD3A 3CUKA 2NQTA 3DMTC 4BB6A 2DQ4A 2W2KA 1P0CA 2B35A 4IXWA 1KBZA 4K6FA 5J23A 2JCYA 3WGHA 4DQUA 1UZMA 1V3TA 3VPFA 3CEAA 2FSSA 2D5CA 4FN4A 3JSAA 1CDOA 2HQ1A 4E2YA 1MGOA 2A94A 4NHEA 3K96A 3V2GA 4ZHSA 2D2IA 2JAPA 2NU8A 4J91A 1SCUA 1QP8A 2HUNA 4R51A 3E5RA 4I5FA 4CMAA 1XQ6A 4MVJH 2P4HX 3HJAA 4L9RA 1F0YA 3ZH2A 5BQFA 1E7YA 1JU9A 5BR7A 3VPSA 4FFOA 1C1XA 3OECA 2VT2A 5EJ2A 1MP0A 1C0IA 3IP3A 2Y1EA 2GERA 1KERA 4HFJA 1DEHA 1QYCA 2VHXA 4CMIA 2HU2A 4RQUA 4TKLA 2P4QA 3ASUA 3WGTA 1C1DA 1HDGO 2RIRA 2YHIA 1PJQA 4LISA 2NU9A 4E33A 2B36A 1NHGA 1HKUA 2FR1A 2R2GA 3GPIA 1NAHA 3L77A 2ZB7A 4WLOA 1EBFA 3IC5A 1Y8RA 3GEDA 2B4TO 1JW9B 4IGFA 2H5LA 3PI7A 2H1SA 4AJIA 1ZJYA 2IZ0A 1LUAA 2NVBA 5I9LA 4DA9A 4FD3A 5JC1A 4XIYA 1FJHA 5A5FA 3LC2O 4DREA 3E03A 4OOEA 4BO5A 4IJUA 2EJVA 3PP8A 1PR3A 1E7WA 3JD0A 4RVDA 3ANLA 4XB2A 2EP5A 3RBXA 3WDSA 3QWHA 1DXYA 1ZH8A 2CSUA 4PLCA 2X5OA 3I9NA 4ROSA 4YJFA 4NDNE 3JQFA 3ZI0A 4DWVA 4IIUA 4L8VA 3MOGA 4ALJA 4OL9A 3OIDA 3ROPA 4PLWA 1ML3A 2BFOA 1HZJA 1VL0A 2JCVA 4E4YA 3IAHA 1T2AA 3IIEA 4XDYA 3VKVA 2A35A 2VUUA 1UP6A 3E18A 1PGNA 3HFSA 2HAEA 3O26A 2PD3A 3DR3A 3SLKA 3GUCA 1EVYA 1TT5A 1Z7BA 3FNGA 3B6ZA 5L53A 3IS3A 1HYHA 1ZSNA 4BNNA 1DRUA 1HE2A 3KLMX 1ORRA 4XJSA 4E5YA 4HADA 1W73A 2P9CA 2AEJA 3CINA 1E3WA 4UEJA 3TSCA 4DLAA 1ZKMA 2HK9A 4YJHB 1WDLA 4FJ2A 5TGDA 2VWHA 2VRCD 3D0OA 5AXBA 4PG5A 2FPIA 1P1JA 2A9FA 4LSMA 3F6YA 3PJGA 5CP8A 4GX1A 2B5VA 3OQ1A 3DBHB 1KC3A 2BMAA 2I76A 4UAGA 3JQGB 3HDHA 1DIGA 1ZUD1 1NQTA 4R1NA 4XYBA 5A02A 1YQXA 2P2SA 1IB6A 1DJNA 4WLVA 3CH6A 1PL8A 1J5PA 1RKXA 2GO1A 3B20A 4WNCA 5JSFA 1ZEMA 4PRKA 2I3GA 1Z7EA 2GUGA 2VZ0A 2WSBA 2DTXA 3G49A 3GPDG 5L7TA 3S2GA 2WYVA 3KOUA 1ONPA 4E21A 1Y9EA 1F06A 3GVXA 5KVSA 3A28A 4Z9FA 2ZJ1A 1M67A 3M1LA 2NNLD 3BIOA 1T1RA 4YRDA 1JA9A 1MC5A 2DBVO 3S2EA 3HWRA 4AJOA 3K2BA 3L07A 3PQDA 3DXFA 1HYGA 3FTNA 4N54A 1DFIA 5HS4A 3GUYA 3B1KA 1U4OA 3AM5A 3GZ4A 3ZWXA 1RM0A 4M89A 1UR5A 1Z73A 3ICCA 4NBVA 1GUFA 3RI3A 1C0KA 4GMFA 1W6UA 2BFAA 3ASVA 1UZLA 3HUDA 3RUAA 1BSVA 1PIWA 1C1XB 1FK8A 1SO8A 1SZJG 4E32A 3KYDA 3G1TA 4N18A 3C7AA 3VZRA 3FPCA 2HKIA 4JX8A 5ER6A 4A2CA 1E77A 1OC2A 1WVGA 4QO7A 4KTTE 3AUSA 4WECA 4KQXA 3MJEA 1C1DB 3LQFA 4K28A 1H0KA 2YHIB 2WYUA 4XR9A 5AXDA 4BNGA 1ULSA 2Y1FA 4CL8A 3PWSA 1N92A 3GNTA 3OICA 3KB6A 1U2GA 4R9RA 4EYEA 3KSUA 4F45A 4YRBA 2CVZA 1QV6A 1VJ1A 1YBMA 4IGEA 2CY0A 2PNFA 4CQMD 5CEFA 4CUKA 3GMDA 3PLRA 4R54A 2Y1CA 2JHGA 1PS8A 3OA0A 5JS6A 5IG2A 1KEVA 3QVSA 4XYMA 2PKQO 3HDJA 1EUZA 1U7HA 4L73A 3ZV4A 3ZWBA 1AE1A 3MJCA 2IEDA 1T26A 3ZWWA 1LDYA 4XA8A 3CSDA 4BMSA 3HNPA 5F5LA 4FR5A 4PG6A 5JLAA 4E0BA 1N9GA 4CM5A 1T4BA 2C7GA 2B4QA 4FFMA 3E8XA 2LDXA 1GD1O 2Y1DA 1EE9A 1U7TA 4II2A 5IN4A 3D1LA 3EC7A 1YB1A 5ADHA 1PGQA 2HRZA 4NBRA 4ONEA 5G0WA 2YV2A 1SMKA 4IJKA 3X2FA 4BMVA 4UVEA 4WE3A 4LCEA 1FF9A 4ITUA 3SLGA 1TT5B 1D4FA 1GEGA 4S3MA 4LVUA 4HY3A 3OMLA 5JNLA 1J4AA 5K6AA 1UJMA 5U1PA 1TB4A 1DC4A 4TZKA 4FQ8A 3GK3A 2C2YA 2Q3EA 1E3WB 4MP3A 3VH1A 4E5MA 2E49A 1I2CA 4DC1A 2DLDA 1NP3A 2DUUA 3BXXA 1LSSA 2FPPA 2J8ZA 4JGBA 2F1KA 2LDBA 4R9SA 3GA0A 1ONNA 5L7YA 1UDAA 3KM0A 4D46A 3NKLA 3RWBA 5IDYA 4TSKA 1WMBA 2I66A 4PLTA 5ICSA 4NU5A 3WOHA 4L0QA 2VZ8A 1CRWG 1ADFA 4B4OA 3H3FA 1T24A 3WGGA 4J6FA 1HEUA 4AJJA 4TRJA 2GNAA 1DBVO 2DU8A 2X9NA 1JDJA 1ZEJA 3I1JA 5K6AC 2XXJA 5THQA 4DBVO 2VYVA 2GZ2A 4JROA 3AOGA 3FRJA 3RROA 4B4UA 1AXEA 2GN6A 4FSHA 2AHRA 5EQFA 1E3LA 4Z0PA 4I9NA 3ST7A 5BSFA 2XOXA 4F6LA 3O03A 1P1FA 2PTGA 4GBJA 5TJHA 1P1KA 1VSVA 4R4JA 2POQX 1IPFA 1ZMTA 3NYWA 3F1LA 2JD0A 4Z3DA 2QZ9A 2Q1WA 4J1QA 2YY7A 2XPCA 4Q3BA 2NM0A 4LMPA 2AQKA 2NTJA 2AMFA 5BSGA 1GCOA 1UAYA 4OXYA 1E7MA 3D3WA 4YAJA 3FWZA 4RZIA 1MB4A 1MFPA 3DBLA 4X54A 3Q2IA 2J6IA 1ZK2A 5TX7A 3ON5A 1UAGA 4ESOA 3ANNA 2RBEA 1AN9A 3O4RA 1ZBQA 5JCJA 4YCAA 1LLQA 3WLEA 3INTA 4D3FA 1E5LA 3AFNA 4UREA 1AUPA 4D7AA 5A1TA 3M2TA 1ZJZA 2ZJ0A 1U3TA 2VN8A 4IDBA 1GQ2A 1PX0A 2XF8A 3RUCA 3E6AA 3FD8A 5GZ1A 4E31A 1A7AA 3MJSA 3N7UA 4EITA 2EGGA 3U4IA 4FBGA 3WNQA 1R4MB 4AG3A 3U49A 1P1RA 3A14A 3G1UA 1XU9A 1YVEI 1GFSA 3VOSA 3AUAA 4I9HA 4D44A 2IXBA 4FFRA 1G0NA 3ZWAA 2I6TA 3QRWA 1X1EA 3M1AA 4QEDA 5LDHA 1CQIA 4N7RA 1N9GB 2X5JO 1DIRA 1NFRA 2C07A 3GDOA 4WGGA 4IDDA 4EUEA 1T2CA 2X9GA 3A06A 3B70A 3EMKA 4BL5A 4RF5A 2J3JA 5K9ZA 3T4XA 1B26A 3IOYA 3H8VA 4GLLA 1DB3A 4PN3A 3PYLA 2X22A 3WIDA 4Q9NA 4W7IA 4M1QA 4PVDA 5C7LO 1MC4A 1O5IA 3EDMA 3OSUA 1LSJA 2HLPA 2B69A 4PRLA 3N58A 1H94A 3OH8A 2ZATA 3VZPA 4INAA 4PG7A 3RFTA 1GYPA 3CXRA 4Z9YA 3CMCO 4XRGA 3QW2A 1LNQA 2HK7A 5FYDA 1DFHA 5GZ6A 2Q4BA 1EQUA 2RH8A 1LEHA 3EHEA 2X8LA 3L6DA 4MP6A 1EVZA 4KZPA 3ROKA 3UCXA 5JW6A 4CPDA 3D7LA 4CLHA 5KTKA 2W8ZA 4GGOA 4EDFA 1A5ZA 3RC1A 3KEOA 1O9BA 3SX2A 1RWBA 5A5EA 3DOJA 4UVHA 4W99A 3KZVA 2GN4A 1KIFA 3BMCB 3Q9UA 1ISIA 2PV7A 5CPBA 1P74A 1QRRA 3GQVA 4CV2A 4J43A 3DZIA 5G0TA 3JD4A 1PQWA 1EK5A 2E6UX 4H16A 4ZRMA 4IMRA 8ADHA 1BVRA 3TL2A 3WICA 5JDIA 2X7HA 4L76A 2GD1O 1QYDA 3QWIA 3W8FA 5IXYA 3I9OA 2JJYA 4WLNA 5KJEA 5I7VA 4E12A 3C7DB 3DZBA 2P5UA 4NQZA 3SXPA 3V1YA 1S7CA 3HB4X 4H3VA 5DP2A 1MG0A 2P9EA 5LCXA 3ENKA 3ONEA 1YWGO 2Q1UA 3H4VA 5EESA 3I5MA 1X1TA 3KBOA 4XZ3A 1X0XA 2P68A 3LK7A 1O89A 3H2ZA 4LMRA 2EG9A 3UGKA 2TMDA 1RJWA 3RC9A 5JDIC 1S6YA
chains in the Genus database with same CATH superfamily
1E9RA 1MTOA 2CCGA 2Q62A 3OZWA 3T5TA 3CO5A 3IERA 4KN6A 2WJJA 1OC4A 3O1LA 4RA6A 2C0QA 2ECQA 1AG9A 3IILA 5A3VA 3I45A 3MMNA 4BNWA 4EJ2A 1KWGA 1P1HA 4DUGA 1C80A 2VNHA 1CVRA 1J56A 1RXUA 2AX3A 3PPIA 3UM9A 3OTHA 4DIMA 2ZJ5A 1QANA 1EK1A 3NWOA 2VG8A 3ILSA 3G02A 1T5IA 3LF1A 3RD5A 3TFOA 1Y4UA 2QV0A 3O8BA 3JASB 5M7EA 4LOJA 1AF4A 1G6Q1 2QUKA 1P60A 4FMDB 4HLDA 4EPWA 3KQLA 4NK5A 3MG9A 4FVTA 1PJSA 2X14A 4KOAA 1ZJ6A 2QP9X 2MSKA 3LLCA 4PYQA 4YUWA 1C4KA 4Y2PA 5E4YA 4RD3A 2QAGB 5K09A 5GP1A 4TS3A 2DMRA 1DAHA 2BKUA 2YWEA 1FTNA 3F5QA 3RS7A 4B6FA 5ALUA 4E13A 2K2QB 1S89A 2G40A 1D0VA 3WL6A 2V7QD 3ZJTA 2AOUA 1L7OA 4MOWA 4ZEXA 4MV4A 1ZAKA 3L01A 2G9UA 3T7IA 1A97A 1E1YA 4DC9A 3N07A 4UM9B 5K0NA 1TU3A 2YZ2A 5BV2P 2QTAA 3OD1A 1ENPA 1XTKA 4R84A 1NSFA 1NN1A 3KC2A 1EXDA 3TG8A 4G5OA 1G21E 1OBFO 4UBJA 5D2CA 3RKSA 4F71A 3HS3A 3L6BA 1XQWA 1COWD 1A9XB 5LXTF 2R8ZA 1M76A 3B3JA 4A4DA 2CJPA 1QRUA 2FEAA 2WF8A 4MK4A 3OOYA 1NG9A 4KAAA 1YZLA 4UE2A 4REMA 5BPHA 1EFKA 4U2KA 1SKYB 2Z2ZA 5KS2A 1UEIA 3T5CA 1C0PA 1DO0A 4CM6A 3UJCA 3VTAA 4A6PA 2RH5A 2DPXA 3A6KA 3BH6A 5EA2A 1DKNA 1A8IA 2JGJA 3VDNB 2FYTA 4RS4A 1P5FA 2BF7A 4C0WA 7GPBA 2PUGA 4D0GA 4RF2A 3TLCA 4DCSA 3QYFA 1NFFA 1LI7A 1R0KA 3HA2A 2OO3A 5EPEA 1EEXB 3L7OA 1EDOA 3ENVA 3TLAA 1I6LA 3VR5D 3L5OA 4XCQA 3EPJA 4HMQA 1Z3IX 4H3HB 3UK2A 5LQJA 1UZUA 3A4TA 2IHUA 5A6SA 2DKOA 1K7FB 1YA4A 1SBQA 4RF4A 1FBNA 1HTBA 4JOBA 4PX2A 3ETJA 4AL4A 3F46A 2GEFA 4CDMA 1Z22A 3IUQA 4EAAA 1ZCZA 1E7QA 1V3VA 1W5SA 4OP2A 3L5KA 1XRMA 3V55A 2GS9A 2PFGA 3VAZA 3QLVA 2EV9A 2XUHA 3CEMA 1I2BA 3HCEA 4YJ2B 2V0GA 1O58A 3B5JA 4OQLA 1M0EA 2VF2A 4HNQA 5EP2A 3F7NA 3OQNA 1E2PA 3ZZ0A 3IH5A 3IUJA 3WL5A 4MVWA 3WJ2A 1IL0A 1CZNA 3JX9A 3M9LA 4OD0A 4Z9AA 4B9AA 1KSHA 2ZBUA 5E2AA 4R1LA 5EE9A 6AT1A 3LBAA 2D8AA 4N5DA 3CZQA 1P5HA 1Y98A 2QRKA 3F6CA 3NOVA 1U4NA 2DM6A 1O77A 4XSGA 4JLAA 1P5ZB 3G0CA 1HDEA 2GJ9A 1JLHA 5CJPA 4DNFA 4DMMA 1NIJA 1DFGA 4Y2YA 4D4IA 1VCIA 3SC4A 4JLUA 2WWYA 3ZV3A 1SULA 3NEAA 1CUAA 5AKLA 3CRNA 2PFSA 3GLHA 5ALMA 5HBRA 2WMYA 5CLIA 4OI1A 1M7GA 5EUCA 4U5QA 5JMPA 3RASA 2OO5A 2IUUA 3BMQA 2CHQA 3CO0S 4KMMA 3HKDA 5AHRA 2FFRA 3W05A 4DMKA 4ZK2A 1LW7A 2AN5A 4OB7A 1MMFB 2J7KA 2Q3BA 2F59A 1OIXA 4JHLA 4M8SA 4NYJQ 4TL9A 3T9CA 3W4JA 4R71A 3LXMA 1R12A 4G65A 4GIBA 3CB4A 4MRNA 4B3JA 1KO8A 4ID3A 1CJKC 2FQYA 3HMKA 4ZT3A 1AQUA 5IBQA 4CM9A 1TPYA 1WNTA 3MWDB 4DPLA 2X8AA 5BW4A 1RI1A 1D3AA 2AI2A 3O4VA 1NVAA 4QNNA 3SBOA 3O8NA 3WR5A 5IYZB 2WJGA 4ZAWA 1XDZA 4X71A 4C6TA 5C8ZA 2HMVA 1BX3A 1KFCB 4X93A 3EOBI 1KH3A 5ALKA 3E9CA 4I66A 2IHBA 4F2DA 3E2IA 4POOA 3QOXA 3OFVA 3ETEA 4W9NA 2I9KA 1L8QA 2HRBA 3X1JA 1F8UA 2FUCA 4HGPA 2VP3A 1QG0A 2QRZA 2X0RA 4N5MA 4V0RA 1U9JA 4XIJA 4ALIA 4Z2AA 2G76A 4GUDA 1O6FA 1JHPA 1F6WA 2YJZA 4HG2A 3RJ9A 3TINA 4ENTA 5C5IA 3NETA 2DQYA 5JI2E 1GDDA 3QXJA 4JQYA 1SHTX 1G6OA 2CHFA 3AQIA 1HSZA 1LK7A 1T25A 3EZXA 2GEUA 3JZAA 3U19A 3PUIA 2P9JA 1SB8A 1ZNXA 1KFKB 4J0KA 4TKVA 4A0SA 3HFRA 3EF1A 3R6LA 3ZNOA 4XQEA 5F1YA 5D01A 1PV2A 4K9NA 1Z5NA 3DE0X 1JF8A 4YAOA 4DSOA 1IXYA 3TZQA 4F1JA 4IS3A 3K6SA 2YHBA 1EEHA 6REQA 4YAEA 1XMOB 1YB4A 3AU9A 3RHFA 1HRKA 1L5ZA 3HVKA 4NZ9A 5KCMA 5HRCA 2DFDA 2YHUA 2JJ2D 3O3CA 4HKTA 3I6ZA 4JUFA 2C7VA 1PWXA 3FRIA 4ZVPA 2EL9A 2D7DA 4C06A 2Y99A 1NSYA 4UNPA 2OM6A 5FUBA 1JZSA 3M5CA 2B4RO 4LWZA 4QU5A 1TLFA 1FUUA 4DYVA 4MEAA 4E4RA 3PLNA 4YONB 5CFQA 4DYDA 5K8UA 4K9MA 4H0NA 3I01A 4GXRA 2ERXA 2PIDA 1Q50A 3BGSA 3OZSA 1MABA 5GONF 2W9XA 1MG5A 2XJ4A 2D06A 3B3GA 3QA9A 4AJ9A 2ID7A 4BEWA 4WPGA 2IHKA 4M87A 4MR8B 4U2EA 1OYYA 5FD8A 3FYUB 3HYCA 5KNLA 1PUJA 4KWEA 4MV0A 5IAOA 2ROQA 2XUOA 4NOKA 4FWBA 4FI3C 1E2FA 1SVNA 1M8JA 2VTDA 5AM5A 1MAHA 1RJDA 3FZGA 4OLHA 3VNUA 1GTL1 1N0HA 4UUQA 3Q3EA 4REQA 5BWCA 1Y5RA 3RVSA 2JL1A 1YU9A 4Z7OB 1SURA 2ID8A 1B93A 3NZEA 2HQBA 2OFXA 1JH9A 1A5BB 4Z8YA 1YRBA 2NACA 4K9KA 3BFKA 4GYJA 4AYTA 3GIWA 2C99A 3A6PC 3OEWA 5HIJA 3DZHA 3X3HA 2FJ0A 5HDBB 2OVFA 1SFRA 4UDNA 5AI5A 4EJFA 4EB0A 1M2HA 1HNXB 2JLBA 3CLRD 1QR2A 4I3HA 4ZJUA 3UCEA 1DUSA 1UDRA 2R1UA 4LZOA 1NF9A 1P19A 4R3NA 1F9EA 1YIOA 5SZIA 3U31A 4YRNA 5HW0A 3GVIA 5CDHA 1UT5A 4Z49A 4G37A 3SP1A 1FS6A 2WINI 3JYLA 3CH7A 4RHEA 1XN4A 5LMCA 4P4LA 4YMLA 2ZB3A 1D6MA 5BR4A 4BPRA 3NNDA 1YKSA 3PF8A 4TS4A 1EM8B 2GB4A 4GPBA 5CYFA 1J33A 2AL7A 3TMAA 1WDKA 4IDAA 3ITKA 5EIHA 3ZLVA 4AO8A 2GHTA 1W96A 4RV4A 2DFTA 1QNLA 4JEHA 3WZMA 1PK7A 3HKBB 3I9V6 4E6EA 2PLRA 4E2WA 4CMGA 2C4KA 1G8GA 2QMOA 3WXMA 3FVVA 3WAKA 5FKJA 1T0HB 4EY6A 5A3JA 1YB7A 4M38A 4NCIA 5HIKA 3G8YA 1DDIA 3FSRA 3SCZA 3VMMA 3WV4A 3QLEA 2NVUB 5CM2Z 3F3YA 2CB0A 3AP2A 4YMUA 1O6ZA 4MV5A 3CJTA 5AI4A 4ZVNA 1ACMA 2AEFA 2JGDA 4RPLA 1CS4C 2ECKA 4MQFB 3A6GA 3NBYC 1C0EA 2MR5A 4W7SA 2ZQYA 4QQRA 4YA6A 3RQSA 4LGVA 2OGTA 5DRYA 1DC6A 4IX1A 3LFTA 3CU5A 2WUWE 5GJBA 3OHMA 1T9DA 2WIDA 3PK0A 4CTJA 1K68A 2P40A 4PLZA 5HYVA 1A9TA 3SNKA 3A6ZA 2ONJA 4RANA 3QKUA 3FYHA 3SVTA 2JLQA 4DNOA 1EFRD 2I6XA 1N2OA 3FMVA 4QSHA 2VAPA 4AULA 1JALA 5DTRA 1ISFA 1U0HC 2JGNA 3OQHA 5LM3A 4FHDA 4H0CA 4YT2A 2XUFA 4S1WA 3A1WA 5AKIA 4G1UC 5BYAA 3DL2A 1HE8B 3AW9A 1LJ8A 1K7SN 4ZA2A 4PPQA 4D3DA 3TAXA 4LSWA 3DT6A 3QELA 1DCKA 2HNAA 2PVSA 4RK1A 4Q66C 3CT4A 1UC4B 4UFPA 5LJLA 2JCXA 3P9RA 1QVAA 4NG5A 4LHVA 5EC8A 4F72A 5KTNA 2BFEB 3UUEA 1RRPA 6Q21A 4M99A 5JOQA 4EHNA 3OIYA 4IHJB 4DCTA 4I5DA 3NANA 2NYAA 2H59A 3USZA 2YWFA 2JBAA 3D4IA 3O91A 3FBGA 4G5SA 3WFIA 5DYNA 3HUEA 4INZA 4LJRA 5D51S 1MU0A 3EDOA 2H31A 3ETGA 2YFHA 2Q46A 1MFZA 3EDCA 4KIFA 4N7BA 3EULA 1RW4A 4AF6A 1SOWA 5DMXA 2WE8A 3UJHA 4CDGA 3O3NB 4CR6A 5JYEA 4WERA 4I1YA 3M6UA 2CXTA 5CDUA 4CCYB 1V2HE 3KE9A 3D8UA 4I4TB 1G2OA 5ADWA 1Y7HA 1V5EA 2DY1A 3NDRA 1KVSA 3O8QB 4KITB 4JI3B 1Y7LA 4YDQA 1GL3A 3FZYA 3U1BA 1HZZC 4UTXA 2FZGA 4S0ZA 4QX6A 3F74A 1OD6A 3FPGA 3RAGA 3W2HA 5LP1A 1IZ8A 5JO9A 1L2TA 1LXCA 2O4UX 1E98A 4FEEA 3AERA 5I7HA 3T3MB 2C92A 1MORA 3FFWA 3TKAA 1C3XA 2EP7A 2ASEA 4FHEA 4RL6A 2Q2VA 821PA 2OSBA 2ENUA 4I8DA 5FV7A 1L5VA 3UAOA 4LZJA 2FB9A 3HG7A 3OM0A 4M98A 5F9FA 4DFDA 3SHFA 1D8TA 4UZEA 1EB9A 2ISSD 4JUAA 4WKCA 3PX7A 4QT4A 2QRJA 4FU0A 2NMVA 3TN7A 3FWNA 4M22A 3SLRA 1CUCA 4BP8A 4RF3A 1IUKA 4MZDA 4Q7KA 3H2IA 2D00A 3Q1KA 5EZYB 3RUIA 3GUUA 1X15A 2OC9A 1E92A 1X77A 4P5EA 4ESHA 2JLUA 4HDKA 4YJ2F 4PZZA 1EGVB 3CNNA 3REQA 4UNRA 4A2QA 1CUWA 1GCAA 2VJKA 2WWWA 3HCCA 3VR3D 2ADMA 3PBKA 2OXFA 4RSHA 1I30A 1SGWA 5D3ZA 3VAYA 4MWCA 1OOEA 1FNSA 2X4LA 3AVVA 5EKDA 4TWIA 1CRLA 1Y4SA 4KWHA 1NVBA 1OKKD 4K88A 2MSEB 1EFVB 3PYMA 5GONA 3S55A 2O5CA 4KXQA 2WAAA 5T6BA 4MHSA 3AINA 1DLJA 1GV0A 1ZRMA 1G41A 4HGOA 4X1KB 1OLXA 3SDZA 4D8XA 1BA2A 3H6HA 3BK2A 1Q7BA 2V03A 4QUIA 3NTOA 1PFYA 1TEXA 3ZCXA 4HRYA 4Z4GA 1ZVJA 3H04A 2AEEA 2Z9DA 3K94A 4GHWA 1TK3A 3COJA 4DR3B 2GSWA 2MINA 3T7AA 2H3HA 3VM6A 2RMKA 1RAAA 1V4BA 2HLNA 3HDGA 4WXEA 5L3ZA 4RQTA 3TQHA 3WSWA 1W36C 4C2UA 2E4VA 3GLTA 4K9LA 4Q9HA 2VK1A 4M0KA 4WT7A 2Q3DA 1P18A 1GZ3A 1JDNA 1PWZA 4NS4A 1NBHA 4GM1A 1BYIA 3AETB 2JGFA 4RVCA 4Z86A 5JROA 1RWMA 3I2GA 1XNRB 2H65A 2FR8A 2NLOA 5GIOE 2G63A 3KSRA 2PWYA 3GROA 3R5SA 4WESA 4DQLA 3W04A 5IYZF 3V1KA 1B41A 3AIIA 1PRYA 4CF7A 3W3ZB 4ZDJA 3OM1A 1S3IA 4D3XA 2LWIA 1QTIA 1OI7A 2PX6A 4KQIA 3D8NA 4P3NA 4JQOA 4NJEB 4A8JC 1QRDA 3E23A 1NVFA 1ISHA 4PZYA 4GYYA 2ZR9A 3H83A 3K0SA 4P4UA 3VHRA 3P9SA 1L7EA 1JG7A 1GOTA 1Z2EA 2OLEA 2XDYA 5F1OA 4B4VA 5LMUB 1SRQA 2X9LA 3DCNA 3ND8A 4GPD1 4N7MA 3BJZA 3WI7A 3SIWA 4E7OA 2B5OA 2ETXA 4TLBA 3ZNQA 4HLCA 4J1TA 1FP2A 2P9HA 2YC4C 4LDQA 4MLPA 4Y6OA 5FNVA 3W3AH 5J3JA 3GVPA 1Z0SA 3AQ4A 1Q21A 5JFTA 2CE2X 4JEUA 1EIZA 2WIJA 3REOA 1IOLA 4Y2QA 2Z8YA 2W11A 5HZMA 1WV0A 3W78A 1UMDA 4R1SA 3EIFA 1JLKA 1V45E 1E9DA 1N6KA 3O90A 5DYYA 1QB7A 5A4MS 1IVYA 2FZ4A 3UFXA 4W7HA 5BMVF 2BCGY 3QNWA 3RU9A 3OJFA 4L5AA 3RU2A 1QTRA 1T6NA 1PNQA 1ZISA 1H23A 4AECA 5IF3A 2DT8A 1FFWA 2GCNA 1EX7A 5ALXA 3OM8A 3DZKA 2QZSA 5K4GA 3OKFA 3BWMA 4HO1X 3C7CB 5KYVA 5K0TA 2RGXA 3H8WA 4QASA 8GPBA 3ANMA 3P1JA 1SOVA 1KVQA 4KNVA 4NFSA 3MTDA 3PPVA 1GQYA 3DZFA 3DAYA 4Q4DA 5CLGA 3HDQA 1D2RA 1ORIA 2Q21A 1T0UA 3AR4A 3JASA 2JVJA 2HIHA 3FCXA 3NDIA 5DT9A 3R7SA 1G9TA 4L4RA 3NUGA 1H2EA 3VKWA 1LD3A 1TCUA 3EEBA 2OFWA 2YOHA 4ZOLA 4BJ6A 1W5EA 5IC4A 2QAGA 2YS6A 1QIEA 1WZIA 1HORA 1T1SA 2J67A 3P32A 4GYWA 4XTCS 5CVJA 5DB4A 3C1AA 2MDTA 1ZS9A 2Y0EA 3VR0A 1ABBA 1PEKE 1NV9A 2UDPA 1XQ1A 3QSGA 3TNDA 2FRDC 4NBUA 4BLUA 1ZONA 1STOA 1B7GO 5KJ6A 3I01M 1RNLA 2Q1SA 4FYJA 4NYMR 1WDMA 2MR6A 2PX5A 4QJ5A 3VDXA 1SIBE 4G6ZA 3TLZA 1L7BA 5ALWA 4R6WA 2XI4A 5CXUA 3SXJA 3WRYA 3MMSA 4TLAA 1A9XA 5F73A 3D6AA 1Y6ZA 4OCZA 4PNEA 4YAKA 1V1RA 3T9FA 1L4MA 2I3AA 4BMOB 1Q1EA 3BXZA 1G66A 3J7AC 3VKUA 4IL5A 2GESA 2W6ZA 2ZR0A 3GXOA 3L02A 1ZHOA 5I8ZA 3DDZX 4YFYA 1PW5A 4N5LA 1BCRB 5K3CA 2ATCA 4C05A 1QMPA 2WKSA 5IPFA 5FOVA 1W36B 1V5WA 3RGGA 3MPOA 2CDCA 3HSKA 2ZIVB 3OQVA 1H1TA 2HMSA 2RGGA 3TUZC 3PB3A 1R8JA 2NU6A 3ZE1B 1DOZA 4KXFB 3IVAA 1N2BA 4HXYA 1LPPA 2GRJA 2VR1A 4CQJA 1P4SA 3KU1A 1MCZA 1SXJC 3VHXB 5DWQA 2AR7A 4H1HA 1L5NA 1ZGAA 1T3GA 1I32A 3UGQA 1AOXA 3L4BA 3ZQ6A 1AS2A 3CTMA 1PTJC 4PHCA 1YB5A 1QIGA 1TCBA 3STYA 3EFBA 7REQB 4FCTA 3LXXA 1JXMA 2A4KA 2A3NA 4ZVRA 1E9VA 2C04A 4DLUA 4JFRA 4Q15A 2YNMC 4RYLA 4TTQA 1L5GB 3WVNA 2C4TA 1DO8A 3ROTA 3IQFA 3MCTA 2VDLB 3BILA 3SYRA 3JAMA 3SR3A 4PPYA 1EKXA 4TL6A 1FYXA 5JT1A 3G88A 4QYIA 2OORC 3W2GA 2X3UA 5K0SA 3NO4A 5DOZA 1PFUA 3ID6C 1OLUA 3MWYW 3KZCA 4J2OA 3IRVA 2CGEA 4BJ5A 4DIBA 2FKNA 4W5TA 2CNWA 1GP2A 1Z8DA 4M9QA 1SUDA 3UPDA 1O9HA 1Z0AA 3FUWA 2FZVA 1C4OA 4KFCA 3O0DA 2QPOA 1L1QA 1R88A 3EGOA 5ERXA 2PJRA 5CFPA 2O2DA 1X1SA 4WVLA 1TQ2A 4ZCSA 4BHTA 3KKKA 2B9EA 3AY3A 4B6JA 1W8DA 1PD0A 2NZJA 3LLVA 4RHXA 2P3SA 3FNBA 5BWNA 2GBCA 4NJOA 3RYFA 2WNHA 4CUZA 4P35A 4NMWA 3FJOA 4O4LB 2JH3A 4P7JA 4UHHA 4IHJF 1NR5A 4RACA 5BT9A 1XALA 1P7YA 4YCNA 4QM7A 4OP3A 5KNCA 4MIOA 5CNMA 2MCFA 1J70A 2EBWA 1UMBA 1U7WA 3R4VA 4RU1A 1Y37A 1N2SA 3SQWA 3H4TA 3ZLJA 4J03A 5HUQA 1KAGA 1XTBA 2OECA 3MTQA 1ADYA 2WRZA 4KBGA 3NHUA 4QEKA 3V4SA 1YT5A 3ZCUA 1TJNA 5AUQA 2QRMA 1V39A 4F4UA 1N5JA 3TXAA 2I71A 1MW8X 2O14A 3B48A 2GZDA 2ZAYA 1BTOA 2ONYA 2VPIA 4I4TF 1EQAA 1AKYA 4KVGA 5CXXA 2VNSA 4UU8A 4YVFA 1NW8A 3QYAA 5E9JA 4RNDB 3W5VA 3AVXA 2IDJA 1R1DA 1M2KA 1W76A 1YS1X 5EI5A 3MMPA 4AWXA 3T99A 1ZUIA 4N0MA 2Y8EA 3V80A 1Q2UA 4AJ4A 2ZXEA 2DHCA 3FBWA 2IXGA 2P5TB 5ERGB 1KQNA 3D02A 2PEZA 2WJIA 4LRUA 3KZNA 1E9EA 4MGZR 5AHXA 1XO1A 1RYZA 3SIPA 5KQLA 5CEEA 1H9BA 1G4UR 4TYWA 3OF2A 2QGZA 2IOYA 1WZUA 1U7ZA 3HEAA 3W8NA 4B6EA 3W8EA 3RW9A 2HHHB 2EKDA 3CX8A 1QOPB 3HRIA 4FILA 1TEZA 4NP6A 1I4OA 1JAHA 2JANA 2ZVQX 4CMEA 4CIXA 1YQUA 1MX1A 1YR9A 4HEA1 2O8DB 2X0KA 5EZYF 1UF9A 2BI7A 4R9NA 3X1WA 5F1PA 3ZY5A 2NTNA 1O8CA 1ZGBA 2WIBA 3NOXA 4ANFA 1T6ZA 5CIYA 5BMVA 3ISTA 3WYEA 4B3XA 4FINA 2F9FA 3UXYA 1YJAA 2PR7A 1Z3CA 2QR2A 3BM5A 4NONA 4YCSA 1LGYA 2YV4A 4YTEA 1QP0A 1SCQA 3GEEA 4M83A 4GBGA 3ZUGA 4EUKA 3STTA 1P2VA 2BT4A 1BGWA 2F3SA 2ODPA 2NUAB 3F3SA 4RAOA 1A9RA 4E2ZA 3EQ2A 4HGZA 1RYHA 4M8LA 4DNXA 2ACEA 3QJGA 3V42A 5IANA 4M9ZA 5LKAA 2FHSA 4JKIA 3TSOA 1NYTA 3N6RA 4ERNA 4EZEA 1O95A 3CR3C 3IBFA 5DTEA 1YQTA 5LQMA 5AKEA 2VRBA 1VL1A 4KN9S 4ILKA 1CXZA 5FLKA 2ZU6A 2XT0A 4GC5A 4NF2A 4OHRA 1VPEA 1GFZA 4HH3C 1UM9B 1SIWA 4QE3A 3ZJVA 3HNRA 2OV4A 2GYYA 3FYSA 3TOVA 1T2EA 1U2DA 2I2BA 4MYDA 5K3SA 4R2XA 5K2MA 4RXTA 2OHIA 3I9JA 3N7TA 4GR9A 5ALDA 4JX9A 2CF5A 1ZCJA 1SU6A 1I94B 1FXWF 2IDKA 1W29A 4FGSA 2YQ5A 4CZ2A 4QYTA 2XB6A 3C7KA 2HTEA 2QL5A 1E9SA 3Q12A 3HYTA 3NEPX 1NP7A 4GR4A 4RK7A 5CNJA 1N7GA 4I5IA 1XD8A 2Y1GA 3IA7A 4FNGA 4GX2A 4JR1A 5CTJA 2I67A 1XLVA 4KXWA 1M1ZA 1QFYA 2V7EA 3MOSA 4C07A 3RIYA 1GLVA 4AXXA 1IRXA 3RIHA 1ENYA 3IHKA 1VPLA 3W5BA 2PUCA 4H3SA 3LHKA 5LB4A 1F20A 3H65A 3LPLA 3SM9A 1ECJA 5HZHA 3IIJA 4CMCA 3MT9A 2BFBB 2WICA 3AXSA 4FEGA 3K4QA 2UZ1B 4JUIA 1DC7A 1SKBA 3EMBA 3MTBA 3PC2A 2CNNA 4JASB 1T8UA 2P35A 5EAIA 2VOJA 1NBMA 1EWYA 1GUBA 1IWOA 5KYXA 2FW9A 4A16A 1UBEA 4GOND 3E1GA 3WLOA 2OQVA 1ISGA 2FK8A 3FCSB 1A82A 3UJ6A 1CZKA 3KPYA 3ZJUA 3DVAA 4BMPB 2ZUVA 1T2DA 3UJ9A 3DM5A 5EKTA 3VPCA 3BJRA 4X92A 4U9UA 3IPRA 4BX8A 3E5MA 1T34A 5D85A 2V9ZA 1E1LA 3GLFE 4PPFA 1JQAA 3ECSA 1OMOA 1WMDA 3BYZA 4MQFA 1UM8A 4D8VA 4G4JA 5CBKA 4V0LA 3AR7A 2FG7C 3DXZA 4NENB 5CLHA 4HFNA 3ELWA 2V5VA 2A59A 3F7TA 3Q8XB 2W37A 4H6WA 2VQEB 4KDRA 2AGVA 3GN2A 1WKVA 3DWEX 1MOSA 5U4XA 1TIPA 2PX8A 3IAAA 1XRLA 4EGJA 3DMYA 5BOSB 4OMFG 3PDWA 5HCUA 4GE3A 4R2LA 1VCNA 3GVCA 3WB0A 3JCZA 4RZQA 2LNDA 3L79A 3NALA 4OMUA 1X70A 3MQ2A 4OHCA 4EG6A 2K7ZA 4QHYA 3KP1A 4G1BA 2NTEA 1QPGA 2I7CA 4LWPA 2O23A 3S40A 4HQ6A 1JLSA 2QN8A 3H2KA 4BP3A 4DTCA 5JU6A 4E3ZA 5IK2D 4ZCRA 3Q8WA 4UDYX 2Z95A 5EFZA 1PZFA 1MVOA 2Z8YM 1V8OA 3LW8A 4AMUA 4TZTA 1JJBA 4Y2UA 2PCLA 1XIVA 4L27A 3T35A 4MKXA 4EHIA 2HF2A 2YR0A 4J3FA 1DQNA 2EC5A 3QEAZ 4CKBB 3A2NA 5JRDS 4CKZA 5JZSA 3UTCA 1MV8A 2BFEA 2X6RA 1E2HA 1MJGA 3CC8A 4FFLA 4IHJA 1QR6A 1ND6A 1WCIA 3KDSE 4DLBA 2WAOA 4RH0A 2DXIA 1YGYA 2BUAA 3VU0A 5DNUA 3DVRX 5ITZA 2OXRA 1Z25A 4EY7A 2I1LA 1B1CA 2RH9B 1EGMB 1OASA 2BDTA 1K9VF 4ABTA 3JZDA 4KCGA 1MN6A 4PPNA 5H3LA 5BRNA 4UARA 4IIJB 3TIGA 2B98A 2RGEA 3O2QB 5CG1A 4YB8A 4GKAA 3IUBA 3K4HA 1G42A 2X3YA 3O4HA 3EAGA 4RENA 3F4BA 4GMHA 4TRNA 4YRLA 1GGEA 3UOGA 4GX0A 4UTOA 4I4TA 1OPXA 2UAGA 3O8QA 4DAEA 1NKVA 4JL6A 3ZD7A 1BWRA 5E6SB 1JPUA 1C3VA 4W9NC 1FNDA 1GZ4A 4DLPA 3S4YA 5K99A 1OYVA 1NT2A 4G0XA 2VFAA 1H2AS 4IG9A 4YP7A 3V4PB 2EX0A 3NATA 4CQMA 4KREA 4K8OA 1QU3A 4WY8A 4HMPA 4XUEA 5KUTA 3DAGA 1GGJA 1F2TB 1NVDA 1TJ5A 2J33A 3LX6A 3URMA 2YHAA 4FFWA 1OHHA 1SXIA 2AN1A 4UHDA 4X5OA 2CZCA 2Y2UA 4RLQA 4QXQA 2V0NA 2YC2C 4Y1GA 2XMQA 1FSZA 2I4MA 3RAFC 1NVTA 2OE2A 1BOFA 2YVUA 2ZREA 2ZIXB 2TS1A 1A9SA 1KQ3A 5ADVA 3A6LA 4GOOD 4KPUB 4JEIA 1I4EB 1RQNA 2C4WA 2ZETA 3LZDA 3ORYA 5LZ5A 1AU9A 2BZ1A 2C1EA 3GGGA 4FOLA 3IBTA 4D9IA 3SQXA 3KWMA 4F1WA 4F7WA 2FZ5A 2J3DA 3CZAA 3E7WA 2HADA 2JJ1A 3KHUA 3NHWA 5EMHA 4QDTA 1N5DA 5CK5A 1GVNB 1IXKA 1G1MA 2YMQA 2IEAA 2PL5A 4MDHA 5LZ7A 4ZVOA 5TIIA 1MHTA 4W8OA 5BXYA 1Q1GA 3HXPA 3H9QA 1TTPB 3VU1A 2XNDD 4LXHA 3VH3A 1LX7A 3UF0A 1XELA 4WUTA 2YVAA 3ADPA 1TO2E 1H1LB 2AJTA 4X1KA 2QZJA 2MSLA 3QYPA 3QFCA 4YAFA 4EVSA 3H5NA 4MAAA 5IZCA 1KOGA 1MC8A 3LPMA 3LVFO 3OLQA 3V1MA 3KJHA 3FYTA 2MTBA 1BS9A 1V43A 2HIAA 3GJ8A 3WIEA 1RJ9B 1RHQA 4W5OA 2V45A 4GM0A 1YR2A 3FTEA 2IYTA 5ADUS 5DHRA 1FRQA 1M54A 2VSXA 4UW9A 4I55A 1CIPA 1QHEA 2ATEA 1LPOA 2X8JA 4OK6A 1WUTA 2VDPB 3IQZA 2FKAA 3OY7A 2ZJFA 1KK3A 3O2NA 4J3JA 3EQ9A 4E46A 1CZLA 1XCLA 1FXWA 2Y9PB 3R3WA 4I5EA 2GZRA 3YASA 3WO1A 2BD0A 3H9JA 2F48A 2Q49A 3WNVA 1QHNA 3ZW7A 3NAQA 3LX4A 1QPBA 2HEIA 3AUYA 3OAAD 4IO0A 1T8YA 2NPOA 3D6MA 4QU0A 4U7PB 3K9WA 4JYBA 4BO4A 1V3UA 1QYRA 3OLCX 1Q7TA 4LQ4A 4UEKA 5A0VA 1C9DB 3HJUA 1JTVA 4WMLA 2WTBA 4CM7A 2QTZA 4FHFA 4N5IX 3H1BA 1R16A 4BLPA 5HVNA 2Q3FA 4NJEA 1E1KA 1OFTA 4HWKA 2VAMA 4BN4A 3QTBA 3MA0A 2GZMA 1AHPA 1V6SA 2O5VA 4DJAA 2PJZA 3EWIA 4J1SA 3A2KA 4G36A 4DR5B 3A3KA 4O33A 3P94A 4ACAA 1PI3A 3QUCA 3HBNA 1I0LA 2OM2A 5DNVA 3LFHA 2YUIA 4BFXA 1ZZEA 4QT0A 5EERA 4ZKDA 1YCGA 2P2DA 1KMIY 5BSVA 1MXFA 4RTNA 2HXYA 1U8AA 1Q20A 1RM3A 2HJRA 3V8MA 4BU0A 4LX0A 3SC2B 3WRXA 5CA0B 5LQRA 1D6JA 5FPPA 3HLYA 2FNAA 5B37A 3V2UA 2AVDA 3PHLA 1RLIA 4A7PA 2F64A 5G1NA 3SICE 1V5FA 4F86A 3C3XA 4B7XA 3PHIA 3KKQA 1H2XA 3NYIA 1A95A 1P2GA 5CDSA 1KEPA 1R10A 1LC3A 1SAYA 3B9QA 5EIWA 1UBTS 3K8ZA 3TTWA 3U0BA 4QQ8A 5BQXA 5TSDA 3D4OA 7YASA 1DRWA 2XYPA 1DKUA 5FTMA 4BEJA 4OFXA 5E4JA 4CI0B 4F4FA 4MKGA 5AQ1A 1VXRA 5JBIA 4ALLA 2BL4A 4ZYXA 1LSOA 2ZUUA 3OZXA 2PZFA 4W1PA 4LYGA 4C4SA 1U2QA 3DHYA 4FE7A 1HTWA 4UHCA 4ZQEA 2PJUA 1YO6A 1ZICA 2RGNC 3BKXA 2YFYA 1RRFA 4OJYA 1TJ3A 3HMQA 3KTDA 3MELA 4Q3AA 2WA1A 1PVOA 4JITA 1I3KA 3LLUA 3V3KA 5J47A 3KAKA 4XXHA 1N2GA 1C7QA 4X3CA 3WO0A 1BDHA 1VHJA 2C4VA 3KOWA 1W1WA 5J2TB 4W1SA 2FQXA 2YY5A 3ZVLA 1V26A 2IEZA 2QN6A 2CXNA 4D1YA 5A06A 3R7FA 3LDGA 1C8BA 4NYIR 1N5LA 3U16A 2EQAA 4R7TA 3H5AA 3FR7A 4OMDA 4QUKA 3QY0A 3ZGLA 2VSQA 5KWSA 1U3UA 4B0OA 3GLIA 2K5UA 1NN0A 3ZXSA 1UXJA 3C3BA 4P7FA 2AIRA 3GD5A 1DBPA 3K35A 4TSFA 4X8HA 1R3DA 2IPOA 5B1DA 4ZT5A 5A3RA 2OBFA 5EWJA 3DMRA 4L9SA 1GSHA 4UJ3A 3VYVA 1H9AA 5HTKA 3DHEA 2PSJA 4LZAA 2TMGA 3A4NA 3DWGA 1IY8A 2EW2A 2ZE8A 3IVGA 3AR8A 4PSCA 4PZLA 4QWWA 5AHWA 1GDTA 1XF9A 3DO5A 1KY4A 4LXGA 4QUDA 4KX5A 1XU4A 3TMYA 1W4RA 4BO3A 4BVJA 1UXOA 3FVRA 5I7SA 1GPWB 1VSTA 2CK3A 1JMYA 3DJFA 5TC4A 3EK2A 5SYNA 2BBWA 1YZGA 2PYZA 1JHRA 4R1QA 4DLTA 3AEUB 1SUEA 3HBAA 4B6SA 4TWZA 3BS4A 5L9AA 1ZRSA 5F76A 3CG4A 1MVLA 1UK8A 2CNDA 2NU9B 4FBMA 7MDHA 5LPNA 4B31A 9LDBA 1XA0A 2G0AA 1DIAA 3FG9A 2B2NA 2F00A 1PL6A 2P2NA 2YW9A 2EIXA 3FWPA 1QHYA 2G06A 4G01B 4KRXA 2PUEA 2Q3CA 2XUAA 4Q3NA 2W42A 2G1KA 5HOEA 2DR3A 1IXSB 1I8TA 2VQ6A 4LZWA 1WCYA 4MPTA 2FPGB 5LLSA 3R7LA 2UUAB 1M2JA 3HY3A 1JBQA 2A9JA 2WJZB 3A1TA 4HQLA 2C42A 4MIYA 3CIFA 5FI1B 2GJAA 3F47A 3CPSA 4HL6A 4N0EA 1GA4A 1H85A 5DRTA 1S1MA 1WBJB 1ZESA 2QMZA 2UUCB 4C7MA 1SU4A 4KQEA 2X2OA 3H97A 2QNIA 3HU5A 1OAOA 1DMSA 1WMFA 5MN4A 3KVVA 3LLSA 2GPSA 4P54A 3CX7A 1JEQB 3N2EA 2VYFA 5KCZA 1JEYB 3T94A 4YJFB 2O7QA 3DOFA 4CCSA 2LVBA 4WTOA 5KKNB 3RADC 4IKOA 1EUQA 1ZC4A 4R1PA 1OFGA 3BORA 2B7LA 2C3MA 3VO2A 3H2SA 3OZ7A 4BNFA 4CGZA 2GCGA 1R64A 4Z3KA 3CWZA 2C8JA 1E69A 2EEZA 3P8ZA 3ES9A 3OZFA 4EI2A 4YCLA 5TQVA 1PT9A 3GY0A 2FV8A 3NCHA 3U9TA 3RG8A 3ZWPA 2WDZA 2JIMA 3FCOA 2X0EA 5INTA 1MX9A 1Q0LA 5T4EA 4NMLA 3QFSA 1E99A 4NESA 4Y6RA 4DCNA 1IE3A 5BN3B 2Z5FA 4HLQB 2D2EA 2HBZA 1GXSB 4KO2S 2OFOA 3OKPA 2PZLA 2W8BB 1OLOA 2VLBA 2F1RA 3BERA 1AZSC 2FLWA 1KDOA 2AYXA 1NXQA 4JT2A 4D6XA 4CV3A 3ZWKA 4FS8A 3TRIA 3EC2A 4GLOA 5ALIA 1OWPA 2J3HA 2OEPA 2QP3A 1WB4A 3D8BA 3CUWA 4RSRA 1SQGA 1CLUA 3K30A 3NFRA 1RAGA 3NRCA 4TKUA 1KMHB 4JJGA 2P8JA 4MTLA 4UKDA 4M0MA 1K4YA 3ONVA 3PG5A 4R3WA 1V41E 1ZWKA 2GRUA 3TTYA 1ADJA 2IXAA 1K3UB 4H1UA 3AVPA 4QPPA 1G6KA 1KKUA 2O57A 4BNKA 4Q5IA 2PZJA 3MRVA 1TKRA 4RLFA 4IIJF 5DK4A 4GU5A 3SHOA 1BU5A 5KI6A 3P2JA 5CR9A 4DS3A 3J81A 2L42A 3PUXA 4F6RB 1AH2A 3BFJA 3ZLUA 1RRKA 2G9RA 2OA0A 3I6IA 3WOVA 4KXVA 1J2RA 1P72A 3N3BC 5CB4B 4PAMA 2VUTA 4GXNA 5FWDA 2FTKE 1E18A 1FDSA 3IXLA 4O2BF 3RVRA 4B48A 5BVHB 1F2UB 5GOTA 3GLGE 2H8KA 4OUKX 1L8LA 3RSOA 4RHTA 5G0SA 1J09A 1TC2A 1G21B 3L7CA 2QJTA 3UT5B 4RH3A 1YVPA 1MJGM 5A9RA 2ID9A 3D3EA 1O4VA 2CUKA 3FPLA 3SF8B 1F0KA 1SA0B 2Q50A 3JWIA 4EYGA 2FF7A 5DJ5A 1NR7A 4H77A 1J20A 2FEKA 2ZBRA 3HN2A 3AI2A 1D09A 3ENZA 1MJ5A 3HRHA 1U7XA 4JT9A 1SPXA 3L4KA 2G1PA 2SKEA 4HNUA 4WZZA 4YHHB 3AGQA 2JPDA 3P19A 1JHQA 1IEXA 3EEYA 3EWSA 1LF0A 1BDJA 1PZXA 3PD1A 2M6RA 4NU6A 2NP7A 1V9SA 4HAUA 1OBOA 3DP9A 2PRJA 3VZDA 2XT9A 3W2TA 4AKTA 1K6IA 3KTFA 1V4NA 3MWFA 3TZLA 2ECFA 4FPXA 4ZALA 1JIKA 2GARA 1CUHA 1YVDA 4TVBA 3L8YA 2Y77A 3MAAC 3DLPX 4K03A 2NZ2A 1SKUA 4NU0A 4OP1A 3MAGA 1Q1ZA 2AI3A 2ID4A 2JLVA 1J24A 4UAVA 3D6VA 3KXDA 2HSWA 2GN2A 3V2IA 3GRRA 3UAYA 4IWYA 2BGLA 4GKVA 2AT1A 4EPYA 1MAAA 2V7TA 1ISSA 1C4WA 4K3VA 4K6KA 4BASA 4DMHA 3DONA 4JBIA 4WLEA 4D2IA 5TMPA 1KZ4A 3EF0A 5EZQA 4UEOA 4GBMA 1W9MA 1COWA 1H22A 2W6NA 1S8OA 4F5EA 1MZPA 1YSCA 1ESMA 1AV6A 1KETA 4BTVA 4XDZA 1K1EA 1XVIA 4ALNA 2C31A 3HADA 4ENVA 3X1ZA 2Z4RA 2CC2A 1ECLA 1UFRA 4PGFA 3BD7A 3SR4A 3GG2A 4MS3A 2F1HA 4EJ0A 1RXVA 2IYLD 3GRKA 3MINA 3KDAA 5EVCA 1ZFNA 3O75A 2QQ0A 4KOEC 2P9BA 4TYPA 2TYSB 3NH6A 4U7DA 1EWQA 3R0XA 1WZNA 2N9UA 4MRAA 3Q9NA 3FMIA 2RKBA 5KO2A 1SCIA 3KKOA 1IJFA 5FBQB 4F11A 3ZHBA 1AA6A 3JD2A 1RCUA 2LUOA 3QW4B 4I3GA 5AOVA 4G9EA 2XZPA 4EDHA 1HK7A 4URWR 1HGXA 5DWVA 5GM1A 4RORA 3SSMA 1FDUA 2J0EA 3VR5A 4U1RA 3VR5H 3D5TA 2G04A 4GWKA 4OLJA 3KYCA 4G1VA