4I08A

Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
243
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
total genus 88
structure length 243
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i08A00
1WXDA 3C1OA 2X8LA 3X2FA 3F4LA 3O38A 4YVFA 4AJIA 3LU1A 2DTXA 5HS6A 2W2LD 3EGOA 2C07A 3IKTA 2I67A 1GQ2A 1E5LA 1LLDA 3NDIA 4KTVE 4E31A 1QP8A 4BKOA 1DLIA 1O94A 2DTEA 1MC4A 2QX7A 1F14A 1NR7A 2VWHA 3GH3A 3JQDA 3I5MA 5IJZA 2W4QA 3A28A 2D8AA 1QYDA 1YE3A 2O4UX 1ZEJA 3I6QA 2J3JA 4UREA 1G6KA 4I1IA 4OH1A 4FQ8A 3PYMA 3QSGA 4G5HA 3UHAA 4DMLA 3QWIA 3H2SA 1GZ4A 1ZSNA 2BLLA 3G3EA 3RBZA 1Z82A 2JFFA 3NTOA 1V6AA 3PXXA 4XQ9A 3B1JA 2AE2A 1UDBA 1GDHA 4CMIB 5BNFA 2C54A 2X0JA 3VPGA 4LVUA 1ZCJA 2X22A 3VZSA 3OJOA 3HDJA 3I4CA 3Q3CA 1IB6A 4Z0HO 5DP2A 5G0SA 4D41A 2V6BA 3Q6IA 4Z9XA 2D4AA 1M75A 2FR8A 3IUPA 4OHUA 3FRJA 1HEUA 5B4VA 5AXDA 4BNGA 3F3SA 4LVCA 4EJ6A 3DOOA 5A02A 1I8TA 3RC1A 3H6KA 3VKVA 1SOVA 3GNSA 1Y5MA 4DC0A 1ZBQA 4GH5A 1W73A 1XHLA 4LMPA 3JQAA 1PJLA 3GZ4A 2FSSA 4RO0A 1P31A 2B37A 3GVHA 3GUYA 3U4HA 5AQ1A 3VPHA 3ZGYA 2HU2A 4PFJA 4W82A 1XR3A 3UCXA 3GA0A 3V1TC 1F17A 2FSVA 3EY4A 2PZLA 1L1FA 3OICA 1DFHA 2VWGA 4BNUA 4DPLA 2NWQA 2I65A 1VL0A 2EHDA 1P0CA 5TT0A 1ULSA 3I9OA 4UVDA 1E1NA 1KEPA 3DHNA 4CM5A 2IE0A 1U5CA 1DAPA 2VRBA 4XDZA 2A4KA 2CDBA 4IDGA 2Z1MA 4BNTA 4ND5A 4BO1A 3JQCA 2P5UA 3AOEA 2JKVA 1I24A 1XYGA 5H81A 4J4TA 4XX0A 5THQA 2NSDA 3RUDA 1K6XA 1LJ8A 4J7XA 1RM0A 3GGOA 3CH6A 2CFCA 3K96A 1NQ5A 3PI7A 1DJNA 4W7HA 1RM5A 3WWZA 4NR0A 2E49A 3SLGA 5FI5A 3H9QA 3KO8A 4KWIA 4JX8A 2YHUA 1MLDA 4GKBA 2CNBA 2PNFA 2OUIA 4W4TA 3AK4A 4IDFA 1ZUD1 1DDOA 2IZ0A 3GDGA 2Y1GA 4CLHA 4K1LA 1VJTA 3PHLA 5FF9A 1DLJA 2FPGA 2J5KA 2EW2A 2PGJA 2W8ZA 1LQTA 3GZNA 3KUXA 1JKFA 3ZI0A 4G2NA 3L77A 3BHJA 4Y6SA 4RVDA 3RUCA 4RJTA 2R6JA 3KRTA 2VHZA 2X5OA 4B7CA 2VHVA 3LT2A 2Z95A 3HE3A 1JQBA 4CMEC 6LDHA 2NQ8A 1KC3A 2FRDA 4OXNA 2C5EA 3WQRA 3PHJA 4E30A 4YT2A 4YJGB 3ZU5A 2FHSA 3Q1LA 3UAGA 2CF6A 4WCDA 5JS6A 2WM3A 3U3XA 5LDHA 5T5QA 4RPLA 4GQAA 2VUUA 4W9NA 3AOGA 3G17A 1A5ZA 4NJOA 3ZV4A 5GZ6A 1A9ZA 4S3MA 5DDIP 2J8ZA 1DOHA 4G65A 4U8GA 3M1LA 3TNLA 4BNWA 4KWHA 3AM3A 2ZTUA 3IP1A 5JDCC 1BW9A 5GZ3A 3ITDA 4B4WA 4EJMA 4OGWA 4DTIA 2CDAA 3L6EA 5ENVA 2EW8A 2VN8A 1DRUA 3QWFA 1JA9A 2J3IA 4I5GA 3WDSA 1Z7EA 1LQUA 4MJLA 2PLAA 2W2LA 2XF8A 4ONEA 1HF3A 1WAMA 3EW7A 1D1SA 3JQBA 2O7QA 3I4FA 4R54A 4A26A 1ZK1A 3PGXA 5KKCA 5F1OA 3OIDA 3GZNB 3JQAD 3U4DA 4EUEA 3P2OA 1EDOA 1U28A 4WCFA 5IG2A 1VKOA 2Y1CA 4PLHA 3TSCA 1JAXA 3WFJA 3CPSA 3G1UA 1VM6A 2I5PO 5HRUA 3JD4A 2HDHA 1SPXA 3EVTA 4RVUA 3JQFA 1B16A 3INGA 3KEOA 4TRRA 3OA2A 4RF2A 4CODB 1UR5A 3H3JA 3KSZO 3ZWNA 3VH1A 1EMDA 3BTVA 2V7PA 1PTJA 1YBMA 3HB5X 1EEHA 4KDFA 1K0UA 5L3ZA 4BO5A 3F47A 2WSBA 2Y1EA 4NBUA 3ZWCA 1PS9A 2PV7A 1EK5A 3PVZA 5F3RA 1KVQA 1VL8A 3D1LA 2NU8A 1QMGA 5B12A 4MDHA 1H0KA 2Y67A 4RCVA 4X54A 3S1LA 4BVAA 3NGLA 4NK4A 2JAPA 3QVOA 3I9LA 1OOEA 4WLFA 1NWHA 4LN1A 4YEDA 4MOWA 4CMIA 3Q9NA 4Z0TA 3V2HA 5HTOA 3RC2A 3RKUA 5COBA 2O50A 3MEQA 4EBFA 4J43A 3PEFA 2JHGA 3TRIA 1KVUA 1CIVA 3ICCA 1Q7GA 3SXPA 4J49A 4KUGA 3WJAA 3I52A 5DBGA 1DFIA 1ARZA 2PD4A 2A35A 3UH1A 2GCGA 5G0TA 3AWDA 2DLDA 5IZ4A 4KQWA 4WEOA 3T7CA 3CINA 1QYCA 4D79A 4I8XA 1WNTA 3NTQA 2AHRA 4PLGA 3TFOA 3JYPA 4XRRA 3JV7A 3QRWA 4LK3A 4J4BA 3RBXA 1EQUA 4NJMA 4RF3A 3ROMA 1LC3A 2O3JA 5C37A 1UXGA 2P4HX 4R9SA 4A0SA 1HE4A 4L4SA 1X7DA 4N54A 4F6CA 2E82A 3PHGA 3RUHA 5DCYA 1C0LA 2NADA 2VYNA 4XRGA 2DPHA 1Y6JA 2EGGA 4RF5A 2D5CA 3GG2A 4CQMA 1QV7A 4LSWA 2EKPA 3GFBA 1A27A 3WYBA 4E21A 1DFGA 3GEGA 4CLDA 1LDBA 3KYDB 4WLNA 2BMAA 1XELA 1EVJA 3P5SA 1R4NA 4YJDA 2EKQA 3DBHA 4RLHA 5I8ZA 5JYEA 2NUAA 2ZIZA 4PN3A 5FI3A 2VWPA 1PSDA 1ENOA 3OP4A 5I7EA 2GNAA 3CIFA 1GTMA 1PEDA 3PQDA 4BO8A 5JW6A 1MGOA 3BAZA 4LISA 2X0IA 4D44A 4R9RA 4FC7A 4U0KA 3QHAA 1A4IA 2X6TA 4FGSA 3IDSA 3AUSA 1PJ2A 4DLBA 1K89A 4Z0PA 2A9FA 3S2FA 4AFNA 4CLXA 1Y8RB 1O8CA 2Y1FA 3BXXA 1X7HA 2WD7A 1DPGA 2O2SA 4M87A 4NBRA 5U9CA 1D1TA 3LDHA 3JYNA 5L9AA 2VYND 3C1TA 3WLFA 4CLOA 1HSZA 4PLWA 2WTBA 1LLCA 3PP8A 2F00A 3QVXA 4R51A 1XA0A 5EL0A 1BSVA 1T1SA 4MP3A 1YBVA 1PGOA 2DPGA 1SEPA 4J7CA 5CDSA 1KIFA 1ISMA 1SB8A 3OHSX 4ZRMA 4ALIA 3AI1A 3D0OA 3GF4A 1K2WA 3H5NA 3ZWPA 3BMOA 3JQ9A 5L40A 1QSGA 5JAMA 5JY1A 1NHWA 3VVCA 1P1KA 1PL8A 2X4GA 5THKA 2DKNA 3DZFA 4AVYA 1IUKA 3BYZA 4MO2A 1R12A 2X9GA 1H9BA 4MINA 4TRMA 3TZQA 1AUPA 4O59O 2IXAA 2UYYA 3O26A 2YQ5A 4E13A 4DIBA 3JQ9C 3D4NA 2GPTA 3SJ7A 1LI4A 4YACA 2TMGA 3DXFA 3QWHA 4BB6A 4MPDA 2DBRA 4CR8A 1LXCA 4PVCA 5A4DA 5JXWA 2AQKA 5K6AA 1B3BA 3BIOA 2X9NA 3WJ7A 2VTEA 4OJNA 1E0DA 2ZTVA 3D3EA 5B37A 3WQQA 4BNVA 3HJAA 4A5OA 4RF4A 1GUZA 1A7AA 4B3IA 1E7YA 3JQ7B 1U2GA 5TRTA 3K92A 4U0JA 4AJJA 3JD1A 5F5NA 4RPHA 2E37A 3ONEA 4IIVA 4M1QA 5DCWA 2BFPA 2OP0A 4UAGA 3JQGB 4XQGA 4F46A 3AY3A 2R00A 2NU9A 2OMEA 4PLVA 3H5AA 4NNJA 2D3TA 3ZU2A 5A03A 1UH5A 3G49A 4FJ0A 3DO5A 5L53A 3FNHA 3OF2A 5ER9A 4XJTA 3V1UA 1GV1A 3RASA 3WGHA 2JD0A 3LT1A 2AEFA 4P4NA 3QQPA 3DAGA 1Y5RA 1XSEA 4YAJA 1LU9A 4N5NA 3FR7A 1PGQA 1EBUA 1QYVA 2YJZA 5TS3A 3HDHA 3TOXA 3UGKA 4DREA 2QYSA 3DTYA 1LRKA 4OIMA 1PZEA 5LCXA 2J3KA 5LC1A 4DMMA 1OZAA 1PJSA 1GV0A 2EKLA 2G5CA 4NHEA 3M2TA 2ZCUA 3IJRA 4CPDA 1ID1A 5CHEA 3GAZA 3PIDA 4B7UA 1HLDA 4E12A 3RVDA 1SMKA 3NV9A 1GYQA 3ADOA 2DUUA 4DIOA 5H82A 1Q2XA 5JC8A 4LW8A 3DBLA 4PRLA 3SLKA 2PD6A 2Z5LA 4J1TA 4CMHA 1PJ4A 4K6CA 1NFFA 4PG6A 5T8KA 1N1EA 2QRKA 5EIOA 2DVMA 3A4VA 3F6YA 2DBQA 4I5FA 2DFVA 4KUEA 2D2IA 5IFLA 2Y0EA 4UUPA 1NYTA 3O03A 4AJPA 1NAIA 4IDCA 4IZHA 3WYEA 1UZNA 1H93A 1S6YA 2VOEA 1EZ4A 1XG5A 5JC1A 3F1KA 1PZFA 4DLAA 4WOJA 1BG6A 3NT5A 4P22A 4CV3A 2ZATA 1DRVA 4E0BA 3FBTA 5EINA 3ICPA 3V2UA 4GWKA 4MVJP 5L4LA 4JK3A 1C1DA 3UUWA 1VRWA 2X58A 4GSLA 3BMCA 3KEQA 3NX4A 1PX0A 4ZVVA 3B6ZA 1RWBA 4OSOA 4GGOA 2HMSA 5ES3A 5CDUA 2OBNA 4JJIA 3T4XA 3U62A 4BNLA 1C0IA 5KJ1A 2HK8A 2P9CA 3ZWAA 1VL6A 1JLLA 5JAQA 3UF0A 4FS3A 3R1IA 3GVCA 3Q11A 5ICMA 1B26A 1AN9A 4CV0A 2LDBA 3S2GA 4BNMA 1ZO8A 2EJWA 1FXSA 4ZRNA 3UXYA 2AEJA 3PQEA 1HRDA 2Y05A 1IPFA 3OSUA 3DBLB 4GWGA 5TJ9A 3ZH2A 2D1YA 1PS0A 2PGDA 5EN4A 1QYWA 4TROA 3JQ6A 1PGJA 1LSSA 3DMYA 5HA5A 2GN6A 1H6BA 3F5SA 3H9JA 1DIGA 3I9MA 3PYXA 4WASA 4R01A 3KHUA 3K2BA 3VH4A 3FNFA 1N7GA 4ILKA 4OKIA 5IDWA 1E3WA 1G0OA 4J16A 3OIGA 1SO8A 1A71A 4H16A 2YV1A 1PQPA 1N7HA 4LMRA 3QWBA 4RZHA 4CLRB 4E2YA 1GCOA 3ORFA 5A5FA 4D43A 1GY8A 3K30A 1W0CA 3GUCA 4QECA 3DZHA 1PJCA 5KKAA 1YWGO 2NLOA 1CWUA 1LDEA 1M2WA 2C7GA 4RVHA 4N18A 3E6AA 5TX7A 1YQXA 1Z73A 4RPKA 4DQVA 1U2DA 4FBGA 2YDXA 2PD3A 2EGHA 3FBGA 1U8FO 3OA0A 3DFZA 5JAIA 1JU9A 1R0KA 1U3VA 3Q9UA 1RM3A 1LLQA 1WP4A 1X0XA 4IS3A 2NVUB 3TZHA 1PU2A 3LC7O 3AJRA 2JJYA 2FWMX 3DC2A 4JNKA 4GMFA 4TZKA 1IZ0A 2QRJA 2PWZA 1DB3A 1F06A 3TZCA 2GERA 5IAAA 3O8QA 1MG0A 4CQMB 4OQZA 3PHHA 3RFTA 3E8XA 3TF5A 3ENNA 3CMCO 4CJXA 3DHEA 2PKQP 1BW9B 2AA3A 4D0SA 1LA2A 2H6EA 5A9SA 4N7RA 1NXQA 4J2HA 3VPFA 2Q45A 2PKQO 3ITKA 3OMLA 2JFGA 1Y81A 5G0UA 1TI7A 2QHXA 3WIEA 4CQLB 1PJTA 3ETGA 1LEHA 4IXWA 4HP8A 1KY4A 1DC3A 3SJUA 1JW9B 1LDGA 3UCFA 4FB5A 2BGKA 3DAFA 5DN9A 4MIEA 3MJCA 4YT4A 5ILOA 3GRPA 3R6DA 4AJKA 3SEFA 1H94A 1WZEA 4L73A 1ZJZA 2Y0DA 1U4OA 3P7MA 1E77A 4ZGWA 5G4KB 1UZMA 4FFPA 3BMNB 1N2SA 1BVRA 4IS2A 4NZ9A 3EYWA 3LC1O 1LRLA 2HAEA 2EP5A 1BDMA 4IMPA 2EV9A 1FDSA 1X7GA 3FR8A 4HV4A 3A9WA 2X1HA 5A9RA 2O23A 1R4MA 1ZSYA 2Y0CA 1UAYA 3E9QA 4GPD1 3GN1A 4XYLA 3U5TA 3AOEC 1DC5A 3WSVA 4BO6A 4PZCA 2V6GA 5C7OO 1T2EA 2HK9A 4MVJA 3GMDA 1ISGA 2OO5A 3RSHA 1E6WA 4KTTE 5JYDA 3LT4A 3LF2A 2I3AA 4RVGA 4UEKA 3DBVO 2X9VA 3N74A 3MJEA 1MA0A 3W6UA 3DL2A 4AJ4A 4IIUA 7MDHA 1EBFA 1UXHA 1U3WA 3PJGA 3NYWA 2Y93A 3NJ8A 3NDJA 4QX6A 4QFDA 3TL3A 1BWSA 5AOVA 1DHTA 4L4XA 3ZHYA 2AEMA 4J7UA 2WYUA 4WE3A 5G0WA 1JKIA 5H83A 2OP1A 3FNGA 1SB9A 1GZ3A 1XDWA 3ZWVA 2NVWA 4BKPA 4YAGA 3N7UA 1BXGB 3PFFA 4B8ZA 4GKVA 1E1LA 2C2XA 4IJUA 4XGKA 1DO8A 4R5MA 2C5AA 1XQ6A 1P1IA 2P9EA 4KQXA 5G4KA 4YWJA 1ZK2A 3GNTA 4EJ0A 2VYVD 3DMTA 1ZKMA 1YONA 5A05A 4RDIA 3VDQA 4TVOA 1NFQA 1EVZA 1U9JA 1ENPA 2C20A 2W90A 2OZPA 2POQX 3I3OA 3NDRA 1E7QA 2ZTMA 4B4UA 3VZPA 3KETA 1RPNA 2WYWA 1WMAA 1JTVA 4IDBA 4II2A 3FPLA 3PQFA 4NFYA 1E3LA 3L0DA 1JKJA 2B4QA 3C7CB 5CDGA 3ROQA 3VZQA 1LC0A 1R4MB 4BGVA 1XGKA 4UUMA 3LQFA 4HXYA 1VKNA 4RORA 4J3FA 1TT5B 1FDTA 1VSUA 1XWFA 1NM5A 4IM7A 1K6JA 5K6AC 2VWQA 1SAYA 3FTPA 3C8MA 4ALMA 2BGLA 1X15A 4INAA 4BOYA 1H2BA 3VPXA 3L9WA 3WMXA 3AM5A 4XIYA 3WOHA 3D3WB 1BDBA 3TDKA 4E2ZA 1VSVA 4O1MA 4FSHA 3KB6A 5I7VA 2E6UX 3WIDA 4IDAA 5KCZA 4OKNA 3H8VA 4JJFA 1P9LA 4HWKA 3WGTA 2X7HA 1ADBA 3PK0A 1QR6A 4EITA 3E1KA 2ZYDA 3B20A 3GC6A 3WSWA 1I3NA 4WNIA 3U4CA 5JNLA 3WMWA 4RLSA 3JYQA 1SNYA 4JP2A 1NNUA 3FPCA 3K5PA 1R6DA 4J91A 5GY7A 1DIBA 3WS7A 2AQ8A 3ANMA 4AJHA 1ISJA 1NPTO 4XDYA 4FDAA 3V8BA 2FPIA 4J9VA 4RDHA 1N9GB 1W6UA 1R15A 5DNAA 3MJ4A 4IJWA 5TJHA 4CMKA 3HDQA 4CM6A 2H1SA 3E18A 6ADHA 5EMHA 2C82A 2Y99A 4NK5A 4DPKA 5C7LO 1GCUA 1NP3A 2GO1A 3MTGA 4FOSA 4FFMA 1QKIA 2Q3EA 4D0RA 5F5LA 4GX2A 5FYDA 3MWEB 4BGIA 1HT0A 1ZXBA 5EESA 4UULA 4XA8A 4CUKA 5JDIC 3AM4A 3OJ0A 3ZNQA 3CZMA 4R5HA 2Q4BA 4PZDA 3EMKA 4DQUA 4PLYA 2GUGA 1D4FA 3A14A 1YQDA 4I9NA 3WNVA 4CM4B 2G0TA 4U6QA 4MP8A 3LC2O 4YPOA 1ZXLA 1NWCA 1RJWA 1DIRA 1ZW1A 4QQRA 4YA6A 4NI5A 3WLEA 5I9NA 1AXGA 3QIVA 2CUKA 3X2EA 2QZZA 3K31A 4QTZA 2AE1A 3F1LA 2B35A 1EVYA 1T4BA 3JTMA 3WQSB 1GR0A 4AL4A 1GQYA 5ITVA 3FD8A 2OL4A 1RKXA 3LLSA 4XB1A 4BO9A 1Q0QA 1GPJA 5JE8A 1PS8A 3P2YA 4GMGA 5KJEA 1AGNA 2DC1A 2HK7A 2E4AA 2AW5A 4YTEA 1OC2A 2NVUA 4KDEA 3AU8A 4KZPA 4B8WA 4TKMA 2I99A 3GVPA 1YL7A 1IPEA 1GAEO 3JQEA 4JBIA 4R3WA 1J49A 1OI7A 2DBVO 4NBWA 3I23A 5T6BA 4BNKA 5KVVA 3D4OA 1XIVA 4Q3NA 3U4IA 4UVIA 2D5AA 1UP4A 4DBVO 1CJCA 3IJPA 3FHLA 1YXMA 4E3ZA 2ZB8A 3QJ5A 3QVTA 5BQFA 3H7AA 4NPCA 4HBGA 3WICA 1GUFA 2VZ0A 4HNHA 2O2YA 1NVTA 4QUKA 3AFMA 4WLVA 3QW2A 3ZN2A 4OM8A 4E5MA 5B4TA 2JD1A 4DXHA 3Q2KA 4YJGA 8ADHA 2AQIA 4WLEA 3ABIA 4II3A 1N1GA 1DIAA 4N5MA 4YCAA 4ALJA 4YRAA 2B5VA 1I33A 5KJFA 1YRLA 4NQZA 1NTOA 5L4SA 3GEDA 4HFJA 4XKJA 4AJEA 4E5PA 5CEJA 3GRKA 4ZHSA 4Q3BA 1T2DA 3K73O 2BFMA 4CM8B 1CETA 3OECA 2DAPA 3FSRA 3BTOA 2IEDA 3PJFA 3PLRA 2VHWA 3DDNA 4LGVA 3PJDA 4UVEA 1A72A 2BH9A 2QQ5A 4DIFA 1GQQA 4E33A 4BNIA 4ZU3A 1HDOA 4NIMA 3JQFC 3NT4A 5A9TA 1PZHA 1Q7BA 3ZNNA 1PR3A 1U1IA 2NU6A 3AI3A 4AJLA 3GQVA 4CQLA 3WYCA 3I9NA 3RKRA 4WCFC 4H7PA 2O4CA 2JD2A 4UUOA 2O3TA 2BHLA 3ZNPA 4L75A 4MVJM 4YB8A 1SEVA 5TT1A 3RUEA 1R66A 3GG9A 4YAEA 4EDFA 1C14A 1DC4A 5ILGA 2VRCA 3BMCB 3DFUA 2VOJA 2YW9A 4BS9A 1C1DB 1WZIA 5JMWA 2AG5A 1YO6A 3Q0EA 1HE5A 4R1UA 1T26A 4L0QA 4IPTA 4CM1A 1PWXA 4BNFA 1C0PA 3INTA 3F9IA 3M6IA 3ULKA 2IYOA 2X5KO 3EVNA 1P74A 1J0XO 1P45A 2WJPA 3I9JA 4KOAA 5JDCA 3PWKA 3S2IA 3KZVA 2P2SA 5JLAA 2YUTA 3NEPX 3GDOA 1VI2A 5KWEA 2GZ3A 4CV1A 2NU7A 2QZ9A 1W8DA 3ASVA 3GHHA 4TQGA 3OEWA 4D42A 3NGXA 5JO9A 1HDRA 5A3JA 3DAPA 4CLEA 3GR6A 1E1MA 1EQ2A 3AUAA 2VNSA 2UV8A 1CQJA 1H6DA 3HNPA 3VDRA 3OQBA 2UVDA 2NTJA 2IXBA 2UDPA 3ZWYA 3HADA 3WGZA 3JD2A 1E6UA 3JQ8A 4ND2A 3LSYA 2BD0A 2CMDA 1B2LA 1NVMB 1YQGA 5DOVA 3ANLA 3WR5A 5JFOA 1AE1A 5C3MA 1B8PA 4FN4A 3PWZA 3CSDA 3OBBA 2B36A 1DHRA 3PDUA 3R3JA 4NFHA 5F1PA 1W4ZA 4BKRA 2B5WA 1EFKA 3R0IA 2ILTA 3JYLA 1J4AA 1ZJYA 3GFGA 1GEGA 3ASUA 3KSDO 3AUUA 4IY1A 4FCCA 5FEUA 4E5YA 4BQPA 3ANNA 2IDZA 3UCEA 2C29D 1VJ0A 3OQ1A 2ET6A 2PK3A 1SC6A 3BMQB 2J6IA 2PR2A 1LSJA 3HUDA 2X23A 2AG8A 2ZCVA 2FR0A 3KOUA 1VPDA 1AHIA 3AI2A 1ZVMA 2LDXA 3L07A 3W8FA 3FCOA 5T64A 5U4QA 3NJ4A 1P1RA 5CP8A 4BO7A 4CUJA 1HDCA 1H6AA 2VHXA 3JCZA 5AXBA 5T8KC 1Q1NA 2DFDA 5FFFA 1ENZA 3G79A 4TMFA 5L7WA 3NT2A 4FFRA 4RV9A 4WEQA 1IL0A 2TMDA 2JL1A 3SBOA 3H5RA 3V1YA 1HZJA 4BHTA 1MV8A 1YB1A 1XKQA 2PY6A 4AJ2A 3SC4A 2Y66A 3EUWA 1E3SA 4JLWA 4K6FA 2BF7A 4UEOA 4A7PA 4RGBA 1H2HA 1KOLA 1R0LA 3H65A 2CDCA 4ZQEA 3W4IA 1TB4A 2FPPA 4WK6A 3P19A 2XAAA 4GX1A 5GMOA 4O0LA 4B79A 3HWRA 4DUPA 5IN5A 3QY9A 3K6JA 1PZGA 1KETA 4D7AA 1EUDA 4CR6A 2JCVA 5TSDA 3ZDFA 4BV8A 5I7SA 5T57A 4RPJA 1PQWA 1YDWA 3D4PA 1LDNA 3GHYA 2FZEA 4P4LA 2I3GA 2PZMA 2PFGA 1HDZA 1NQAO 2RH8A 4BNJA 5KVCA 2UAGA 4BMSA 3PZRA 1F8FA 1I3LA 1PQUA 2X0RA 4HKTA 5DCUA 4NU5A 4RVFA 1T1RA 2NNLD 4R68A 3M1AA 1MB4A 4HX5A 5JY6A 2YQ4A 4EEZA 5AXCA 1ZMOA 3IS3A 2V6MA 3I6IA 3DOJA 2OFPA 3VC7A 1KS9A 3DHYA 4K9DA 1B8UA 2X5JO 4NFSA 9LDTA 4UUNA 3MJSA 4FGWA 1SCUA 4PLZA 4XIJA 4J4HA 4JBGA 2JCXA 3JQGA 4P38A 3W8EA 1ZK0A 2GF2A 1IZ9A 1HTBA 1P1FA 1ZH8A 3KBOA 1LDMA 3D5QA 1J5PA 1Z75A 3KYCB 2WDZA 4H15A 4PG5A 4XYGA 1ZZEA 5G2OA 9LDBA 2GN4A 5FWNA 2Q99A 4W7IA 3MOIA 3IUSA 1N9GA 2J5QA 1LNQA 1O5IA 4L8VA 4ZQHA 3TPCA 2DUWA 5U1PA 2C59A 5BNTA 3JD3A 4CM9A 2W2KA 2IZ1A 1V3TA 2RHCA 2Z1NA 4NBVA 4XEHA 4ND4A 5A3VA 4TVBA 1DBVO 2XOXA 4BNZA 4CMGA 4FOOA 1JN0A 4TRNA 3TJRA 4CUZA 3RIHA 1IE3A 4E2XA 2YHIA 1T2FA 1XCBA 1U5AA 1HWYA 3DR3A 4OSPA 1L7EA 4ESOA 1JWBB 1ML3A 2P9GA 1R0SA 4GX5A 3M2PA 4ZICA 1DEHA 2Q4EA 2BRUA 1V3UA 1RYDA 1CDOA 4BO3A 3AY7A 2BI8A 5AXAA 1TXGA 2RIRA 1T24A 1E7SA 4RPGA 3MZ0A 4I5EA 4ZQFA 5TC4A 4R16A 3OFSA 1ZK3A 2HO5A 4GAEA 3NKLA 1CQIA 4WLUA 5KNLA 3VVBA 1U4SA 1N8KA 2EG9A 1K6IA 1FJHA 2GDZA 4BIIA 4GSKA 1Y8QA 4CR7A 3G1TA 4YAIA 2ZB4A 4MP6A 3KXDA 1MFZA 3GDFA 2GD1O 3MOGA 3VH2A 4JP3A 4GLLA 2Y1DA 4MKXA 3WXBA 4CM9D 4XR4A 4NJMB 5CPBA 1ONPA 4ALKA 3DMTC 4IMRA 4NMHA 1M66A 1MC5A 1HE3A 4G81A 1V35A 4CLOB 2YYYA 4YJHB 4AG3A 1MX3A 4RQUA 1LRJA 1GPDG 4Y6RA 4M55A 5JSFA 4BKUA 4GBJA 5IXYA 3GGPA 1EE9A 1O6ZA 3VKUA 1Q7CA 1QLHA 4WOKA 3F4BA 4Q3DA 1KYQA 2I66A 3TQHA 4BNYA 1YOVA 3FTNA 1T2AA 1Y9AA 3EAGA 1TT5A 5C7IO 1PJQA 3G0OA 1HKUA 1NR1A 3AY6A 4M49A 1WDMA 1YGYA 1NX6A 1U8XX 4XD2A 2Q46A 3OJLA 5BSHA 1HZZA 2QG4A 4YRBA 1I10A 2PTGA 4IUYA 4ZQBA 5KIAA 2YDYA 1EK6A 1FDVA 3PHIA 2NTVA 4E5NA 4WNCA 5MDHA 3L4BA 2DBZA 3KYCA 4NH4A 4DPMA 3DZJA 3QWAA 5TLSA 1D8AA 2JHFA 1ONNA 4PG7A 3HDYA 1QXSA 4JROA 4Q3EA 1FMCA 1YKFA 2QYTA 1ISHA 1V8BA 1B0AA 3FI9A 4JGBA 4YJHA 1F8GA 3PYLA 1XLTA 4BNHA 3CUKA 1YL6A 1UDCA 4U6SA 3RJ5A 3RU7A 5EQFA 2BI7A 4R69A 5ITWA 5K0ZA 5COQA 4BGEA 3LLVA 3TN7A 1NFRA 4FIZA 3QV1A 1S7CA 4PRKA 3PGJA 5IZCC 4FJ1A 4A10A 2C7VA 1D3AA 1DIHA 4ZA2A 4A27A 3PZBA 3KV3O 4MVJI 3RD5A 4DL9A 4E2WA 4CMBA 2AMFA 2DQ4A 1WPQA 2E48A 5EJ2A 2Q2WA 4BKQA 4GVLA 3ZWBA 2NVBA 2PZKA 3KYDA 3N58A 4ZQGA 2ZB3A 5DULA 3H2ZA 2R2GA 2HJSA 1K3TA 4PIVA 2GASA 4QO8A 3U0BA 3B70A 5IF3A 1MXHA 1BXGA 2EF1A 3E48A 4FFNA 3OJEA 3OEYA 1ADCA 1GL3A 4J1QA 2GGSA 5L7YA 4QFCA 3TWOA 2GN9A 3JSAA 1ENYA 4H3VA 5G4LA 4C4OA 4Q9NA 2HMTA 4DA9A 3BHIA 2ZJ0A 2GR9A 1D7OA 3HN7A 2VCYA 4ZD6A 4IGEA 3ON5A 1LDYA 1A7KA 3PFWO 5A06A 1EFLA 4TKLA 1CF2O 2O3SA 3JD0A 4L9RA 3NAQA 4U7WA 4XYMA 5DBFA 3GVXA 4FD3A 4FFLA 3JQBC 3B1FA 4NU6A 1DRWA 2ZKLA 4Z9FA 4PG8A 2DM6A 5TIIA 3RUIA 4O5OA 4K28A 3AUTA 4RVSA 1FF9A 3GLQA 4FR5A 3BZUA 1V0JA 4ND3A 4OQYA 3GNQA 3QE3A 3EHEA 4TSKA 2JCYA 2GRAA 2NACA 2Q1UA 2IRWA 3BHMA 5K9ZA 4LCJA 3W6ZA 2HMVA 3DZBA 5BSFA 1Q0LA 4WLOA 7ADHA 2VHYA 4IZIA 1UP6A 4Y67A 4XCVA 4PG4A 3TFQA 3IQDB 5A1TA 3VTZA 5HS4A 2DT5A 2H63A 1HDGO 1YS4A 2PKRA 3S2EA 4BL5A 2YFHA 3CXRA 2GSDA 1R4NB 3CEAA 4P4GA 4TZTA 3A1NA 3DBRA 5JO0A 1ULUA 5I8WA 4CMEA 5BNIA 5KJ6A 1BRMA 1RM4A 4YYZA 1HDXA 1LTHR 2P4QA 1X13A 1JAYA 1H6CA 2X86A 3VZRA 4WPGA 1GADO 4WJZA 2RH4A 3HFSA 5TGDA 1QORA 2O48X 1Y1PA 4YR9A 3BMNA 1SOWA 1HYGA 1QV6A 4Z9YA 4ID9A 5ER6A 5KTKA 2D59A 1EUZA 1B7GO 4W6ZA 5C5IA 1E3WB 3D5TA 4DWVA 2OGUA 3ENKA 3RC9A 3DWFA 1EVIA 1M76A 5IXSA 2HQ1A 1YL5A 3UICA 4TRJA 3VH3A 1YH3A 3GN2A 4OO3A 2VZ9A 4QXMA 1ONOA 1C1XA 1H9AA 2I76A 1I3KA 4WUVA 3L6OO 1GU7A 1ADFA 2C2YA 2XXJA 3C7DB 3DZIA 1Y8QB 3K8ZA 4PLPA 3SVTA 2HKIA 3EZLA 4KP7A 4MKZA 1P3DA 4UVGA 1B3RA 1E92A 4L4RA 4E32A 3E5RA 4R3NA 4OXYA 1JVBA 3I9KA 4PVDA 2Y68A 2HMWA 3DONA 3GMSA 4J0EA 4CM3A 4M86A 3ZWOA 2Q2QA 4IJKA 3WTBA 3GOHA 3IOYA 3C85A 4WKGA 1TT7A 1P44A 4XGIA 1GEEA 4NG5A 3RBVA 3UOGA 3ZCXA 5HBRA 3WTCA 1KBZA 4U5QA 3ZV3A 5A5EA 4R1TA 4BO4A 2VUTA 3GPDG 2CVQA 3AFNA 3RJ9A 4CQMD 1UUFA 3COSA 1OMOA 4YT5A 1PWZA 3WFIA 3AW9A 4HY3A 5CEFA 1CRWG 1BMDA 3ZNOA 4XQCA 2A94A 2VT2A 5I9MA 2PGLA 5JPIA 4IDDA 4PZEA 2R00C 2NQTA 2VTDA 4ND1A 3RC7A 1I01A 4Z3KA 3AU9A 1XEAA 2YFQA 1ADGA 1KEVA 3STHA 3LZ6A 2WE7A 1DAOA 4FJ2A 1MG5A 2VZ8A 1R16A 2P91A 3NUGA 2ZTLA 4OOFA 4M8SA 1IULA 5ADHA 2OORA 4DYVA 4M89A 1SZJG 4OOEA 3BTUA 5BT9A 3OQ6A 2IODA 5BR7A 1P33A 1ZFNA 3UVEA 4J2OA 5A04A 1H5QA 2YV3A 3ST7A 3HN2A 3L4BC 4YBZA 3RU9A 1GUYA 1EUCA 2PH5A 3NRCA 4K26A 3WGGA 3HHPA 4HADA 1B15A 1O89A 3F46A 2JAHA 2C0CA 1Y8RA 5CEEA 3C1AA 5DF1A 4L74A 3VPSA 1KY5A 1B14A 4XJSA 1E3JA 1U7TA 1AHHA 1ZSVA 4W99A 5AVOA 1I3MA 2RHRA 3ZW9A 2B0JA 1I30A 3GY0A 1HETA 1UAGA 3PPIA 2EWMA 4YAKA 2HMUA 3PWSA 4MKRA 1E7MA 1JWAB 1YOVB 1CERA 4WECA 3WGIA 3QLJA 4C7JA 3WWYA 2EP7A 1XU7A 4CMAA 3KLPX 3ETEA 3FWNA 3EDMA 3KTDA 4CV2A 3F5QA 1WDLA 2SCUA 3JQAB 4F45A 3ONFA 3OM9A 4BV9A 4DYDA 3CMMA 4EYEA 3NTRA 4NDNE 5B4UA 4KMSA 4XQEA 4IQ8A 1Z7BA 4OXKA 5CAEA 3LF1A 3BTSA 5G0VA 4HNGA 3DZGA 1N5DA 3QVWA 4I5DA 2Y1OA 1YB5A 4DRYA 1VC2A 2BFAA 3DOCA 4MIYA 1PJ3A 1M67A 3DBHB 2OOSA 5CDTA 1HYHA 2HUNA 3H4VA 2NM0A 4ITUA 1TEHA 1F0YA 1FDWA 1HDYA 2FR1A 3UW3A 4CMJA 2VRCD 2QW8A 3WGYA 1CYDA 3RROA 3OETA 5JCXA 3WBFA 1NPYA 3GAFA 2IYPA 2UUOA 2YZ7A 1BXKA 5AYVA 2CSUA 5HM8A 3IP3A 3CZRA 4Y6PA 3UFXA 2YHIB 4AJOA 4FPXA 3GK3A 2G17A 3O8QB 3OIFA 2ZJ1A 1Y7TA 3BMOB 3ADPA 3WNQA 4KUHA 3K2EA 1WWKA 3ZWWA 3QVSA 4EZBA 1FDUA 2GLXA 5TF4A 2FP4A 1FK8A 3TL2A 3HQ4O 3ONDA 4P8RA 5I7FA 3WBBA 4IQGA 5A9SB 3KYBA 3JQ8B 5JAZA 3LT0A 1E3IA 4CM7A 4QO7A 2O7SA 4Z6KA 1U7HA 1UZLA 4CM4A 1B8VA 1T25A 3CKYA 4IGFA 4IJVA 5DP1A 4RZIA 3H9EO 5F1KA 1E6EA 2P5YA 1NBOA 4ALNA 3E9NA 1NVGA 1A4UA 2WWRA 3INRA 3L9XA 4B4VA 4CMCA 4IXTA 3E03A 1P1JA 3HB4X 1E5QA 4AJ1A 4A2CA 5KJCA 4YXFA 4YT8A 4LSMA 2BGMA 1MXFA 1O95A 2HRZA 3MJTA 4QSMA 3T7EA 1X0VA 4LRTB 4IBOA 4RL6A 3W8DA 1LLUA 1LUAA 3RUFA 4E4YA 5CPFA 5EERA 1HSOA 2VYVA 2X0NA 1ISIA 4CL8A 5J23A 2I6TA 5IDQA 1GZ6A 1QRRA 1GYRA 1PL6A 1WMBA 4Y8VA 2NV6A 4MVJF 5MGBA 2PZJA 1NHGA 3UKOA 1UXIA 1AXEA 4DVJA 1IY8A 4OL9A 4OAQA 1T2CA 3ZU3A 3BA1A 1NPDA 4D45A 4ALLA 2NTNA 5COAA 2EXXA 5L45A 2Q1TA 3SX2A 2HRBA 4HUJA 2RBEA 1IYZA 1C1XB 2HSDA 3GPIA 4TWRA 2WEKA 3EC7A 1I2BA 2QIOA 3LVFO 4OMUA 5CFZA 3K9QO 5BSGA 3PRJA 5ENDA 4R1SA 1G1AA 4J6FA 1HYEA 2CVZA 3MJVA 1A9YA 1BGVA 2V6FA 1BVUA 1EDZA 1XU9A 4I08A 1E1KA 4WGGA 4XZ3A 5L7TA 4EUFA 2Q1SA 1UXJA 4O63O 2WD8A 4GX0A 5DT9A 3VHRA 4C7KA 2F1KA 3HFGA 4M54A 1ZNQO 3H9UA 1LSUA 4XB2A 4F6LA 5ICSA 4I9UA 4B3HA 1P77A 1KC1A 4YJFB 1YJQA 1ZMTA 2B83A 2WD7B 1WLYA 4BNNA 3B1KA 4DBZA 3V5NA 3E82A 2CVOA 1ZEMA 3PDJA 5L4NA 3ZHBA 2O3QA 1LSOA 3ZW8A 4E5KA 4BMNA 4J90A 3ZWXA 3OJFA 3L4SO 3KLMX 1HLPA 4PGFA 1HL3A 3IL2A 3U9LA 3HG7A 4IINA 2WE8A 4HFRA 3CTMA 4J0FA 5KVQA 4JJGA 3TZ6A 1NQTA 4FC6A 3ZV6A 4XGNA 3VTFA 3T4EA 2H9IA 4JIGA 2EJVA 4JN6B 4W9NC 1I5RA 1XQ1A 4BNXA 2ZYGA 3U49A 1OFGA 3JYOA 3EZYA 1MP0A 1QLJA 4MVJE 3I83A 3V2GA 3VOSA 3ZZNA 3HSKA 2P68A 1J6UA 3C7AA 4MVJH 3IAHA 2W2KB 1BTOA 5JCJA 3RFVA 2GN8A 3SC6A 4J1SA 5KOIA 1QG6A 3W4JA 3ZHZA 3A06A 4YQZA 4HFMA 2CY0A 4URFA 3IMFA 4MIOA 4QT0A 4YQYA 4R41A 5EPOA 1NAHA 3JQ7A 3S55A 3D3WA 4E6PA 1YBAA 1U3TA 2Q50A 5CDYA 3WGOA 1TLTA 1UP7A 1MFPA 4A73A 4AICA 2VNAA 2QRLA 4MVJD 3VAZA 4CL3A 1I2ZA 1NQOA 3DZKA 1LBEA 4JXKA 4UVHA 4BMVA 3QP9A 2G82A 5F21A 3MTJA 2BFOA 4ZN6A 4WCFB 3ROPA 3ROKA 2AQHA 3C24A 2ZQYA 4IDEA 4EGFA 5I9LA 1BHSA 5IDXA 3KSUA 2A92A 4DC1A 3DBRB 1DJQA 3H3FA 2O3RA 3LYLA 1E3EA 1P0FA 2GZ2A 4BO2A 1KVSA 1RYEA 2AXQA 3RAJA 2GYYA 3OH8A 3IC5A 4FFOA 3UN1A 4YJFA 3DTTA 3W1VA 5CG2A 3WGQA 1OC4A 4EI2A 1BXZA 3GEMA 4R1NA 1JDJA 5IZCA 3DB2A 4DQXA 2B69A 5B1YA 1KEWA 1PL7A 4IQ0A 1K5HA 2H5LA 3BMQA 3I1JA 1UXKA 4LCEA 4BUCA 2EERA 3CE6A 2G1UA 3FF4A 1OAAA 2CF5A 8LDHA 1LX6A 2FOIA 1HXHA 1C3VA 2ZK7A 3RUAA 2XXBA 4CM8A 1X1TA 3FN4A 3U09A 1O9BA 1E7RA 3TOZA 4PLTA 3E9MA 1T4DA 1PJBA 5T67A 5TNXA 1OBFO 3HZZA 1NASA 2BELA 2VT3A 5BSEA 2OHXA 2YV2A 4Y98A 3MWDB 3E5MA 1U3UA 4DLLA 1PGPA 4I9HA 1KVTA 4HFNA 3D7LA 4RQTA 5CG1A 3DQPA 2I9PA 4AJNA 2FMUA 1DXYA 1L7DA 1QYXA 1TVEA 4D46A 3ZHXA 4JQCA 5HWSA 2V65A 3ZU4A 1EE2A 1ZK4A 2HCTA 2JFHA 3MCVA 4PLCA 3RCBA 2G76A 4GGPA 4NBTA 1I36A 1UDAA 1VE9A 2CD9A 2FZWA 5JBIA 5L51A 4B3JA 1CEQA 4CLRA 4UEJA 5KVSA 1Z45A 4EUHA 3H9GA 1Q0HA 1YDEA 4BGUA 2CZCA 4D3SA 4Q39A 2W98A 4JBHA 2BKAA 1WVGA 1YVEI 3GGGA 5IDYA 4YRDA 2Q2VA 5DOZA 3QA9A 4ZJUA 3KVOA 4F3YA 4BQRA 2VQ3A 5JCJD 2B4RO 3O9ZA 4LRSB 1ISFA 2B4TO 3TZKA 5IN4A 3KM0A 1Z6ZA 1I32A 4XWYA 3PLNA 1P1HA 3PIIA 4L76A 2IZZA 3Q2IA 1PIWA 2FN7A 1I0ZA 1V3VA 1MUUA 1X1EA 3R3SA 4J1NA 1PGNA 4J9UE 2OXIA 1ZIDA 2FY8A 2RCYA 2IEBA 1I2CA 4GI2A 3FWZA 1GD1O 4GL4A 4EEXA 1YJ8A 5DBIA 2Q1WA 5GZ1A 2WYVA 3GVIA 3W4KA 5DZSA 3RWBA 3DEYX 2YY7A 3WG9A 4Z3DA 1JVSA 1GFSA 2VUSA 1KERA 2PH3A 3D64A 1VLLA 3RFXA 2EEZA 4D3FA 1IHYA 2HLPA 3ETDA 1C0KA 1M6HA 1UJMA 2ZYAA 4QEDA 4Y9DA 3IKVA 2RAFA 3WX0A 4BO0A 2EIHA 4FW8A 2WMDA 5LDGA 1X14A 2GZ1A 4PCVA 1R37A 1DSSG 3L6DA 4JCOA 5TQVA 1V9LA 2Q49A 3PJEA 2D0IA 2J5RA 4PLFA 4EW6A 1WW8A 3O4RA 5JDIA 1KVRA 1TA4A 1KEUA 2ZB7A 4O6VA 2OBYA 3LK7A 1Z74A 4XYBA 1F12A 4MVJG 2XPCA 1IOLA 4XYEA 1ORRA 4S1VA 4GVXA 2ZQZA 3IIEA 4XR9A 1PR9A 1SBYA 4D3DA 1YB4A 2DU8A 3GT0A 3PTZA 1O0SA 1E7WA 4ROSA 2J3HA 3ZV5A 4DGSA 4GLOA 3WB9A 4YDRA 1M6WA 5L95A 4A03A 1Y9EA 3C3XA 1IHXA 2HJRA 2O3UA 1G0NA 1HE2A 1DC6A 4OYRA 1N92A 3RI3A 2PA3A 4BB5A 4N5LA 3FNEA 1VJ1A 2DTDA 3EK2A 4B7XA 1WDKA 2UUPA 5EQDA 3S8MA 1GYPA 4R4JA 4B4OA 4Q3AA 3ZWMA 3RQSA 5JMPA 4Q3CA
chains in the Genus database with same CATH superfamily
1WXDA 2G8NA 1A04A 5J5AA 3D31A 2ENUA 4R6WA 4ZT5A 1Q21A 1GKKA 3SJCA 4V3CA 3GPLA 4TVKA 3LU1A 2CLEB 1LLDA 1SUSA 4D25A 2IYWA 1QP8A 4PAQA 4I1YA 1V4BA 1DLIA 1O94A 3IILA 3THRA 2QX7A 1F14A 4LHSA 4REQB 4GM4A 4FD2A 4UC0A 1Z5OA 3I5MA 4M9ZA 4P32A 4Y6OA 2D8AA 1QYDA 3P94A 4LQDA 1ZEJA 3I6QA 4UREA 2B9EA 4FFSA 1VSTA 4YCSA 3WLPA 2AC2A 2ICAA 3G8AA 4G5HA 4K9KA 3UHAA 4BFZA 5M29A 3WRYA 1OBOA 2H11A 3OCYA 3V8NA 3RBZA 1X9IA 1QVRA 1U8YA 1Z82A 1C30A 2WU4A 3K4HA 1A9PA 2OORC 1TZ2A 2YKGA 3GLHB 4RJIA 3HXPA 2VIIA 3IKLA 3VSCA 3YASA 3KQNA 1ABFA 1J1UA 5IKMA 1V6SA 2X0JA 2HFJA 3VPGA 5I9BA 1ECFA 1OXBB 2GPJA 4MR8B 5KS2A 2C7RA 3C48A 1XN4A 1ZAKA 5LA6A 3O2JA 3Q6IA 2JBAA 2D4AA 2MOKA 2P3SA 3B6MA 3QEMA 1IXZA 3OEHD 4Z9XA 1TADA 4MWGA 3WWOA 3W5BA 3RVOA 1WSBA 2AUTA 2B2XA 1HEUA 2JATA 3FRJA 3LGXA 4KBGA 4WDQA 4YECA 5EVCA 3ZDBA 3P4YA 3PNMA 3W3AH 1RZRD 4LVCA 5A02A 3DOOA 2H3HA 3FPHA 4WY5A 3VKVA 4D8XA 1SUIA 5ALYA 4JUIA 1I94B 2JFXA 1ZBQA 3AVQA 4GH5A 4MW1A 4OI0A 2AOVA 5C3UA 4LMPA 1QF6A 4O2AB 2ZI3A 1N8TA 1X3LA 3ISVA 3QEAZ 5AHXA 3AVVA 4BEBA 4RO0A 3GVHA 1JIQA 1R4AA 1Y4SA 1DINA 1U3DA 1DEOA 4IH9A 4M7PA 1HM5A 3VPHA 2HU2A 4YDSA 4PFJA 4DIDA 4WZZA 5J4VA 2EYQA 5KO2A 3H2JA 5ES4B 2B82A 4UCWA 5EIBC 2FJ0A 4QUEA 3TQQA 3R8XA 2PZLA 2NWQA 5FTJA 2I65A 4PGGA 4JL6A 1E6CA 5K01A 1L3IA 1PDWA 5TVGA 3T5GA 1E1NA 1KEPA 1DAPA 3DKRA 2UZ4A 2CDBA 4IDGA 3ZEIA 1UWVA 3RK4A 5F51A 5L3SA 1E3TA 1YCFA 2BWJA 2JKVA 2XWSA 3AOEA 1XYGA 4BP8A 1A8IA 2E89A 4YMSA 5CLFA 1FVXA 2NSDA 3RUDA 1XHEA 3EQ9A 1OTXA 4GOMD 1Z29A 2OBMA 3HMKA 1PG2A 2CFCA 3K96A 3KE9A 1NQ5A 3KUCA 3PI7A 3RB8A 4Z1OA 1VL1A 4JXXA 1RM5A 1KSJA 3SJZA 2E49A 4LXGA 4HEHA 3MG9A 5MN5A 5IVPA 4US1R 1KQOA 2Y1KA 2YHUA 3BFKA 5BWLA 1EHYA 1MLDA 2ZYHA 5B6PA 5HKKA 1ZPDA 2PANA 3C43A 4KXWA 4DA8A 3PC6A 1UEIA 1ZUD1 4FDTA 2IUUA 1ZW6A 3WK5A 1L8LA 3MW8A 2H08A 1RRKA 3F7OA 2JVKA 3PHLA 5UKDA 4LY3A 1SQFA 4WFKA 1MV5A 1YJCA 2HU5A 2W8ZA 3GZNA 1C1HA 3L3BA 1Q1ZA 4INPA 4YP5A 1KQGA 1I0IA 4KPFC 2P9ZA 3L77A 3ZHRA 3HXLA 1AKQA 4TMXA 3OF3A 1FFXA 4HYYA 4D26A 3RYIB 3HE3A 4KO4S 5CT4A 1JQBA 6LDHA 1BIFA 1W8IA 3QE9Y 2P3LA 5ERXA 1E58A 2JLBA 3BICA 3HKDA 4EMBA 2ZI9A 3B9QA 3C45A 1T3TA 3IVAA 5F4ZA 2C5EA 1UMKA 2JFYA 4X20B 3WQRA 3AR4A 4YJGB 2FHSA 1ST2A 1H1LB 3Q1LA 4FOLA 1Z0SA 5HKLA 5JS6A 1GA4A 1MVNA 4XCQA 3JARA 2QMYA 1E66A 1D2GA 4RACA 2F62A 4E08A 3KZOA 4NF2A 3AOGA 2IGBA 1EDDA 2FF5A 3E2PA 5DYTA 5DGHA 2N46A 3MYRA 3FWHA 1DJLA 1P4JA 4NJOA 1KY2A 1QLWA 1SKYE 3ZV4A 3TECE 2OA0A 5KTTA 3SXJA 2J8ZA 2Q6OA 4U8GA 721PA 1ZVKA 3QF4B 3RT1A 4LF4B 4LXUA 4UTPA 1P2UA 1PYGA 3AM3A 1JLRA 2ZTUA 1JZQA 2HZBA 2O8BA 1UPCA 4KXVA 4YRFA 4DMKA 3TTUA 4B4WA 3UB4A 5IFKA 2CDAA 4A2PA 3M7IA 5JS7A 1JA9A 2E4VA 4LDAA 1ATZA 1YQWA 3OQJA 1KI1A 5DTQA 3TI7A 1LQUA 3V33A 5C1OA 2PLAA 2ZUVA 4GNKA 2JAXA 1ZUNB 1W7AA 4DMHA 1WAMA 5SYAA 4J8PA 4MTLA 1QUFA 3EW7A 5D5HA 1D1SA 1RKVA 4Z0NA 3WNBA 2O7QA 2COEA 3BK7A 3I4FA 5AI9A 4YMGA 3TAXA 4L1KA 4A26A 4UM9B 3UMYA 8LDHA 3A3YA 2PEZA 3LRTA 2OMKA 4AS2A 5AW7A 2H52A 1NW4A 3U4DA 4WZAE 5AVVA 5TQJA 3TSOA 4EUEA 2H7XA 1U28A 4F4IA 2JI7A 2CK3A 4QBGB 2XUJA 2IUYA 5IG2A 3CRZA 3L7AA 3N0XA 1JAXA 3LXUX 2RONA 1VCMA 3G1UA 3SHFA 1VM6A 3A6FA 2ZS9A 3AILA 3JD4A 3RM3A 2ERCA 4FYWA 3ACBA 4QODA 3INGA 4FOTA 1AQIA 3ZD6A 4P36A 3OCJA 4I4CA 4FT4A 1UR5A 4YR7A 3OOEA 1T2NA 1VPTA 2P9HA 1AQNA 2PS3A 2XSZD 3RQIA 4PC7A 3RYHB 3CZAA 4QQKA 3LXRA 1TU0A 1EMDA 3BTVA 1YBMA 1EEHA 1GHTA 3QV2A 3F47A 5K3SA 4PSCA 2UZ1B 2F9MA 3JASB 3M6FA 2PSEA 1F0NA 4KGXA 5HUJA 2NXNA 3R3ZA 5FPYA 1S3GA 5B12A 4X61A 4O4HF 1QFYA 5JWHA 3NGLA 5DPMA 5LLSA 3GYGA 4PWYA 2B1RA 3B1WA 3F71A 1XLWA 4QGBA 5EE9A 3SNKA 4Z0TA 4OQDA 4TWIA 5AVYA 3K35A 4ZZ2A 4ZYVA 3MEQA 1P0QA 2QGFA 4J43A 1XRRA 5ARDA 2ZBUA 4OBBA 3PEFA 2JHGA 3D8BA 2ZJ7A 1B41A 2OOKA 5HTKA 2F9FA 3ANYB 3IESA 1J0AA 4PNHA 1NR5A 3FMGA 3I6YA 3HK2A 1QGUA 1DCKA 4MLCA 3UH1A 2GCGA 5B7GA 4ZDJA 1M6NA 1T0HB 1II0A 1XVLA 3W2HA 4WEOA 3CINA 4U7PB 3TE6A 5EJ6A 2K4MA 2V97A 3FLAA 4RD4A 4J0HA 3TLYA 2Z6UA 3QKTA 2R5WA 2FLKA 3UHFA 1NU8A 2JGDA 1X7WB 3CUTA 5HFNA 3W5VA 1PSWA 4DBLC 2AHRA 1H2ZA 4YBRA 4EJFA 1ULZA 3HYNA 1GZ7A 1SGWA 3SOZA 4XRRA 3V46A 1FMJA 1P29A 4LK3A 4JBXA 4AP5A 5GIOE 3S81A 4IUCS 1EQUA 3KKOA 4RF3A 1LC3A 2O3JA 5LM3A 4D42A 4LTMA 5CA0B 3LX5A 3OCCA 4IHJB 5IF9A 2ZDQA 1SIUA 2HA6A 1QHFA 1I7LA 2ZR8A 3N2KB 2CXHA 2PUJA 3PHGA 1U6IA 1TAGA 4M7WA 5CK5A 1YJAA 1ECJA 3IB3A 4MARA 3T9FA 3U4QB 2VYNA 3DHWC 4XRGA 1IDOA 4WOPA 1Y6JA 2J6CA 2K2WA 2JJMA 4RF5A 4ZYLA 5FLKA 4RVCA 1QIDA 2A88A 3ZBPA 1XKTA 1RJGA 4E21A 1AGYA 1JR3D 1M83A 2H59A 4WFJA 2AR9A 4QJ4A 1FU8A 1LDBA 3KYDB 3A26A 2XH8A 4HNAB 4Q7KA 4QTXA 5FXMA 1R4NA 3RHTA 2KS6A 4RLHA 4G36A 2ZIZA 1SCUB 1Z0JA 4E14A 1BE1A 1XXHB 3NHPA 1ZZGA 1UADA 1Z68A 1O9HA 1ENOA 1N2OA 1T0IA 1KO8A 2BCEA 1QRDA 1RP1A 2GNAA 2ATVA 1HT2E 2P6PA 3DAYA 3PQDA 4BO8A 3IELA 4K6MA 1LFAA 2VPIA 3PFCA 3BQ9A 3RO7A 2XMDA 3HB1A 5CJPA 2CJWA 4R9RA 1OF1A 3REQA 5KQSA 2J1LA 2AGVA 1RQGA 3EXHC 1AS3A 4JR0A 4Q05A 5JR3A 1JFVA 3FMFA 5AM1A 2Q2OA 3TQOA 4N49A 1M7BA 2GBFA 5KQGA 5KDOA 1MRNA 2JPDA 1YOBA 1NMZA 4WBXC 4DLBA 3DMFA 4Z0PA 3WV4A 5I4KA 3GIDA 1O8CA 2Y1FA 3I6BA 1E63A 1DPGA 4G5OA 5CA0F 4OA5A 3GDWA 5D01A 5L9AA 3DTVA 3LI2A 4N3GA 5JEDA 1E0JA 2Q1YA 4NABA 3IO3A 4CLOA 1LPNA 2H1IA 2H85A 4XGRA 1I7NA 4KG7A 2J0UB 3QVXA 2Y6UA 4L5AA 1NUUA 2Q29A 4P3PA 4DRXB 1NW5A 1QHYA 4PR3A 4TSFA 4MP3A 4MRNA 4RH0A 3HSYA 2ZOSA 5FLYA 1YFLA 3S70A 3QTTA 3B1XA 4RHEA 3I5AA 4TTPA 3M4XA 1SB8A 2IZ7A 4ZRMA 3OG9A 4QU5A 1F6DA 2W93A 1TK2A 3BOSA 3C3YA 2JK0A 3HU5A 1OVMA 4PO8A 1V7PC 2WP8J 4NX2A 3H5NA 4X45A 1E4EA 1ECBA 1Q1GA 4F06A 4FOPA 1G21A 3A8TA 4JSYA 3L05A 1EWQA 2BUAA 4G86A 1QO0A 2V7QD 3KSRA 2X4GA 2VK1A 3NHKA 2DKNA 2L82A 3ICWA 3AV0B 3FE2A 3HR7A 2ZRIA 2YFYA 2BBWA 2X9GA 3B60A 1H9BA 4TRMA 1AUPA 1APBA 5ELLA 4F85A 1OYWA 5BR1A 4C3ZA 2YQ5A 2ZBEA 2GM4A 5IU6A 3D7MA 2PYZA 2XSZA 3EOAI 2QL6A 3OD1A 5CMLA 2HD4A 3EVCA 3QWHA 1ELOA 2JS7A 5G1NA 4C9BA 2VJDA 1KWGA 3MWFA 4PVCA 4QYSA 5CIWA 1E1CB 4R2IA 4W5TA 3JRWA 5J5VA 2I8AA 2YVQA 4JI7B 1ORHA 2X9NA 3V9AA 3A9TA 4KFSA 4AZWA 2ECQA 5KAMA 3HP4A 1E0DA 1TUEA 3A04A 5FB3A 3D3EA 3DE1X 2I2DA 3ZD7A 3LHKA 3CB4A 4BNVA 3BPSA 3DLPX 2VXOA 2AOWA 2QY6A 1ONSA 4A5OA 4C3VA 5K0GA 1JWLA 5EFOA 3BSSA 3NM6B 3DC7A 1A8HA 4Y9SA 3PXBA 5GJWC 3N0VA 4MEBA 2JRCA 1E99A 5TRTA 1HNNA 1JPUA 4EFKA 4QULA 2E37A 4M1QA 2YOFA 3OURA 3AYXB 3G0IA 2BFPA 1GZUA 2OP0A 2RJNA 2XMSA 3JQGB 1FX0B 1J5EB 2QJFA 2NU9A 4PLVA 4HB0A 5A03A 5I7OA 4LECA 3RYCA 5KOHA 5AI5A 4Q1CA 3PX2A 1YZTA 3G9UA 4FN5A 5ER9A 4B80A 1JDUA 1KNXA 1MO2A 1XFAA 3EZFA 4QL3A 1FDIA 3GCGA 2C5FA 3LT1A 1EDEA 4HAIA 4P4NA 4JWTA 1Y5RA 1XSEA 4H27A 4LHWA 1Z2OX 4H3HB 4YAJA 4DADA 1YDGA 2RHGB 3CUEF 3WLKX 2FI1A 1WCV1 3HZOA 2ZM6B 1FNMA 1R0WA 1TIKA 2Q5FA 2BEJA 4TTVA 5DCLA 2ACEA 4OXRA 5L6LB 1QE3A 1XPOA 2P1RA 3NP9A 1JRLA 1YDFA 3MM4A 4O4LF 5LC1A 4BYGA 3VUEA 1KPIA 3AEUB 3HB7A 2QRQA 5EPEA 3CO0S 1JJAA 3WYDA 3NO4A 4ED9A 2PUEA 3LAWA 3GT7A 2ECKA 3ZDZB 3L1JA 3WQBA 3X1JA 4DLSA 1LTKA 1A9OA 1O6CA 3TRHA 1YHNA 3WXMA 2BEUA 2ODBA 3AFIA 1COZA 3KE8A 1LX7A 3QIAA 4BDSA 5FA6A 3D4IA 3K1YA 3PEEA 3R3UA 3TG8A 4RSHA 1U2QA 1II9A 1SMKA 3OM0A 4O4HA 1SBCA 3ADOA 3HMQA 1MPXA 2HU8A 4TXHA 5EFZA 3RS2A 4DIOA 5LIPA 3U7GA 5JC8A 3B3AA 1YBFA 3DBLA 4PRLA 2WKQA 2PD6A 4QOSA 4J1TA 1TVMA 4CMHA 5F12A 1PJ4A 4K6KA 4RESA 1QFMA 1HKHA 2JHCA 5KYUA 1Z0UA 1N1EA 3TCKA 2MR6A 5K3AA 4BRWA 3GB9A 5ALSA 5DGIA 2CJXA 3FRIA 3NYRA 3U31A 3ZE6A 2Y0EA 2VL7A 1QH8A 3TIFA 2AUMA 3V4SA 1Z7GA 2GCOA 4ARIA 2RGBA 4HMOA 3C97A 4U2CA 3TTSA 1NAIA 3CLTC 4IZHA 3WYEA 1UZNA 4D56A 4DA0A 5KYUB 2YZGA 2XADA 3AP2A 4NJEB 1E2HA 3VPBA 5K0TA 2W6QA 2B98A 5JADA 1YVRA 3F1KA 1PZFA 5TB5A 5F9MA 4WOJA 3SMQA 2ETVA 5EC8A 2ZATA 3TAHA 3S1SA 5EINA 4PTZA 4R7GA 4EA6A 1DUIA 1RFGE 4GWKA 4MVJP 2X4DA 4XVCA 2AEEA 3B12A 2ZTHA 3LKBA 3TRFA 2I6GA 3UUWA 3GX1A 4GSLA 4F5YA 2ZSAA 2HQBA 3EH2A 4N8DA 4WZBA 1DAEA 5JD6A 3B6ZA 2C8VA 3QYFA 4JU9A 4OSOA 1Y0BA 5CVUA 1MCZA 3IERA 4QPCA 4JJIA 2C2KA 2RBGA 1AZWA 2A8YA 3DM5A 3F3YA 3AEUA 4BNLA 1VPVA 1NQWA 3ZWAA 4HQRA 3HA7A 3KOMA 4OHFA 1BDHA 1EFPA 4IMJB 1ZD4A 3HCRA 3Q11A 1R6UA 1W25A 2ZRMA 5LZ7A 1U0SY 1T9CA 5AJYA 2AFIE 2FX2A 3BXFA 1AKYA 2EJWA 1FXSA 4A6DA 2Q3CA 2AOTB 1HRDA 1IPFA 2R9VA 3FY4A 3BWEA 3OSUA 1Z5WA 3G2KA 3HZHA 3BZBA 1PS0A 3ZH2A 1ZH2A 3IOCA 4QYMA 1KL7A 3Q40A 4TROA 1PT9A 1WVIA 2IFTA 2JFOA 3B78A 4XLZA 3KTAB 3RVPA 4IJMA 4HDKA 4IF6A 2BV3A 4RADA 1K7XB 1FRVA 4BX3A 1QO0D 2V7QA 2A2ZA 1PR1A 1G8FA 3A1SA 4KXLA 1RC1A 4LWOA 1FX0A 3KOYA 5A3SA 4RDCA 1DRJA 3X1XA 2PR7A 3KHUA 1QNLA 2PRYA 1N7GA 4L3VA 4DNQA 4OKIA 5CM2Z 5CAEB 1G0OA 4YPFA 3Q7SA 4J16A 3RG8A 3S40A 5IAOA 4KAXA 4P0PB 1SO8A 3D2CA 1CUBA 5ECGC 3MCAA 4BEJA 3K15A 3MTIA 4BLRA 4E2YA 3CKMA 4RZHA 4WOBA 4CLRB 4MQUA 3T7EA 3ORFA 2RGGA 1XAGA 3AEQA 5HE9A 4D43A 1Q7EA 4QECA 1Q44A 4WT7A 4ENQA 1BO6A 3JZIA 1T0PA 2QNIA 3FOWA 3LW7A 1Y3CE 3H9BA 1DEAA 4D9MA 4LMAA 2HADA 1WCIB 3S28A 3ABOB 1M2WA 2HHLA 3V7NA 1G5QA 2YWRA 3L0OA 3OEED 2R5NA 4N18A 3MMPA 4BWFB 2IU6A 4JC5A 4PQRA 1S01A 4FBGA 1GTG1 1USUA 2ZJ6A 3K2IA 3LOPA 3UOAB 3WL6A 4C2AA 4TTQA 4I1RA 4F4FA 3I6MA 4D45A 2WG2A 3LPDA 4KE7A 4P0TA 3Q9UA 5HOQA 2F3PA 4O1IA 2EKZA 4UHEA 3N05A 5AVTA 3S5UA 3AJRA 5LP6B 3EXEA 4PYRA 4JNKA 4TZKA 4XI9A 1P81A 2QRJA 4H60A 1HL7A 2XWPA 1D6NA 4RKRA 2Y1XA 1F06A 1EM6A 1WXQA 3TZCA 3O8QA 4MWDA 5KAPA 2QY9A 4RTQA 4MWZA 2IF2A 1A69A 2QRVB 3CMCO 3ORHA 1OTHA 4YLEA 4LZZA 2FLVA 3TIGA 5DLPA 4D0SA 2C1XA 2ZE6A 3R9XB 2WKWA 4KRGA 4WK0B 1C50A 5A9SA 1TUGA 3GJSA 5ICFA 2G77B 3L0IB 1TJNA 2PKQO 3ITKA 1TKBA 1KF0A 3QPDA 1TI7A 2OBXA 3PDWA 4CQLB 2R1ZA 1PJTA 1LEHA 4IXWA 4M9CA 1DC3A 1KRXA 1TF5A 5CNIA 1M2VA 1LDGA 5ALDA 3UCFA 4FB5A 4RNCA 1RE1A 1U9IC 2ARKA 2VPQA 4PWZA 5DN9A 2IX3A 3GRPA 3U6KA 2B99A 3SEFA 2MHCA 3TGPA 5FWDA 1W59A 3HJTA 3DKIA 5B7PA 1ZJZA 3P7MA 4EQZA 3O8RA 3VA7A 3GPBA 2AN3A 3KK0A 5G4KB 1S3FA 2CLMB 1JHVA 4NCNA 3AJEA 3U17A 2IBSA 3LSTA 1U0JA 4FFPA 2GBCA 3MS2A 3R0QA 2WFAA 5K3DA 1N25A 1NP6A 2XMGA 1NN0A 3FPFA 4M6WA 4HRAA 4D5GA 5JRJA 2ON6A 4IGAA 1Z56C 5KNDA 2EV9A 2PX8A 4Y6GB 4ENSA 3A05A 2BFEB 2JIDA 5KHOC 1OIXA 2X1HA 2O23A 3PV0A 3QHPA 4JC8A 5A9RA 4KN8A 2OD9A 2H1HA 1PR4A 5B1DA 2ZZNA 3AOEC 1CUAA 1ZGJA 2GX6A 4RKEA 1VBFA 2V6GA 4AWXA 4BO6A 1T2EA 5H9VA 4LXIA 5BURA 2HRDA 2I3AA 2IH2A 1Z26A 2VLIA 3DBVO 2MYNA 1JGTA 4QBTA 1CY7A 2CNLA 3GBSA 3DNFA 4IIUA 3K0SA 4NXMB 1FTQA 2IPAB 5IK2A 5EG5A 1WEKA 2C7BA 4FW9A 3SS9X 1G8KA 2EFCB 5EJ5A 2FEPA 1L1RA 4FSXA 5AUQA 3VHQA 2O0LA 1TK3A 2GCNA 5SY9A 3T3IA 5MN4A 3KT8A 2O8DA 1CVIA 4CKYA 3PEWA 1G8MA 2J9ZB 2AR0A 2NVOA 3IPLA 1MO6A 3R3VA 1XDDA 3OT1A 4BKPA 3O6VA 4YAGA 1BXGB 5KPDA 3TXYA 5CLQA 3OT5A 4MI3A 1P7CA 4GKVA 4OKSA 1TMGE 4IJUA 1B6SA 2IIBA 4XGKA 4UDNA 1AKTA 2C5AA 2IYLD 4WADA 2VJQA 3QLUC 3OJWA 5G4KA 4YWJA 2PNJA 4CCAA 2I2AA 3OQIA 1ZKMA 4RWZA 2WR8A 2ZI6A 2F2TA 5A05A 2K7ZA 4RDIA 2QZ4A 3VDQA 4BQQA 2RD2A 3GLVA 4AXXA 1U9JA 1EVZA 3I3OA 3A9VA 3QKUA 4YAOA 1V43A 1E7QA 1L3CA 3HJGA 1T8WA 4MS3A 1Q7RA 1ZOPA 4HNTA 4UNRA 2QL7A 3KETA 1YHZA 1FC0A 1JTVA 1PFUA 4IDBA 4II2A 3FPLA 3GQBB 3I39X 3WKCA 4V0RA 3A9UA 3RF7A 2B4QA 4YUYA 4IVQA 3EXG1 3KBBA 3KNZA 3CLRC 4M0UA 2K7FA 5F3DA 1U0HC 1BCRB 1PR5A 3FWYA 4RJ2A 2HM7A 4HXYA 1VKNA 4HEA1 1T5OA 2DHQA 4XOUA 4YS6A 1P75A 1M6EX 3LPLA 1JB1A 4JS0A 2GSWA 5K6AC 5K8VA 3C5VA 3BBPA 3LDAA 2L69A 4G5FA 4M0PA 4ALMA 2BGLA 4TZ6A 3JWGA 5DHPA 3ZVNA 2ZIXA 2WWXA 3V6MA 3V4VB 3VPXA 2PBFA 3WBJA 4GOND 5EP4A 3L46A 4ND8B 4RA9B 3WOHA 4AKEA 4C06A 1O94C 4FNMA 3ZLUA 1Q84A 2RHJA 4REQA 2E6UX 4AN1A 1QFXA 5H9WA 2I2FA 2PUCA 5GGYA 4UE6A 1YZQA 2ZXFA 4G5RA 4UCQA 5FCDA 3NNSA 2EL9A 2ZVPX 2I33A 1W0KD 1P9LA 4HWKA 2GVDC 2HT6A 3PK0A 4EITA 3EF0A 1DJPA 3GC6A 5CXSA 3K0FA 3U4CA 1M34B 4NE7A 5B2ZA 3LDFA 1CFZA 4QYXA 5HOEA 4CDGA 1X7WA 5DXJA 5BOSA 4UBIA 1L5SA 5LU8A 1VMIA 5F9HA 2BW0A 3U1BA 2QV7A 2A1UB 5CBPB 3M49A 2GEKA 3RGWS 3UUGA 3CR7A 2WWFA 3EFHA 3GLHA 3WS7A 4C0WA 5AIBA 1EXVA 4O2BF 1IG3A 1N3BA 2JAWA 4XDYA 1VYHA 4HZUA 2BCJQ 4CKZA 3OCZA 4YWHA 4EY4A 3QEJA 3WGNA 1R15A 4INOA 1E8MA 4GDFA 1Q91A 2FQWA 2XV1A 4IJWA 5TJHA 3U4MA 3H1EA 1WQ1R 3TDMA 4I66A 1V2GA 1QQ5A 4CM6A 3UFXB 4HB4A 4GRAA 3LJKA 3DH0A 5EMHA 1F2TB 4DPKA 4TWBA 3MTGA 1DG1G 1GO2A 4D0RA 3GLFA 1UDXA 3X1YA 5GM2A 1NSFA 2IYZA 1T6YA 4ZCPA 4AZVA 1HT0A 1ZXBA 5EESA 5C8YF 2D7JA 1RLOA 1M72A 2VH5R 3T1HB 2F17A 2ZXUA 2DWQA 3AM4A 4A8JA 4F71A 2MDTA 1VG0B 3CZMA 1TTQB 4B33A 1SXQA 3Q7PA 3SYTA 4IOJA 2IW3A 1CV2A 1NXPA 1F2UB 1M34E 4UFNA 5DFAA 1U1EA 2OVFA 2BE9A 4DQUA 5HQ3B 3QEMB 3R6GA 5JG7A 3J81A 1YQDA 3KQVA 2Z6VA 2VNHA 3WNVA 3BWYA 4MP8A 3DAHA 1I13A 1ZXLA 2PU7A 3I8XA 4G2TA 4HBZA 4F11A 1ZW1A 4QQRA 2AW3A 4YA6A 3H4IA 5U4XA 3RRBA 3WLEA 3PEUA 5CB8A 4LDJA 2QZZA 3C7KA 3DXZA 3WHLA 2B35A 1EVYA 1T4BA 5TEWA 3MERA 2FPPB 4IH4A 4OYHA 5ITVA 1W46A 1SCQA 3EGDB 1OXUA 3FD8A 4GPTA 3MYYA 4WNAB 3EG9A 4Z9BA 4XB1A 4AG6A 3HY6A 1VA4A 4F72A 1BNCA 4KLNA 2G1JA 3RSZA 3QLUA 1GZDA 3OLZA 2OCBA 2IA5A 4CHGA 1J9ZA 1WXIA 2ZWPA 4FXOA 5K45A 4OBWA 4HQOA 2C57A 1OFUX 4ZQIA 1G59A 2PUDA 4C7OA 2FPXA 2EKDA 2E4AA 4G63A 2PRJA 3TIVA 3VR6A 1GU1A 1A1SA 1TD9A 1U1FA 4KDEA 2F4NA 1LY1A 2P6MA 5IW8A 3RTCA 1KK1A 1NRIA 3ML1A 3RSGA 2GBLA 2YOGA 4F3CA 3RWOA 4QXRA 1H3FA 3AHCA 3C5HA 3MJDA 4JBIA 4R3WA 2E18A 1QH8B 1OX6A 3W06A 3W2IA 2I4OA 4JUBA 2C4VA 2W2VA 3DW3X 1I5EA 1W6RA 2DWOA 2QRMA 2VUHB 3U4IA 4URVR 4B7AA 4YPVA 3ZJTA 3EEFA 3PNSA 1UP4A 3EGVA 2BTQA 3K1ZA 4KQFA 4QBHA 4DBVO 5BN4A 1P7WA 2FPUA 4BRSA 1DL5A 1PE0A 4X63A 3FHLA 4E3ZA 2ZB8A 3QJ5A 4ND8A 3Q3HA 5L3RA 4JH0A 4IO0A 5LXTF 1ITZA 4JLAA 3WICA 3D5EA 4PE5B 1DELA 3DLIA 3V4PB 1R4ZA 4BPBA 5LOVA 4H2DA 4ZEVA 4FTWA 1Y1QA 3I2JA 2QTCA 1KARA 3PQ4A 1S2IA 3TBKA 1JPNA 2XCSB 4REMA 4MQ5A 3M6VA 2VPZA 3WK7A 4H77A 2QTHA 3CRNA 3CLKA 1USWA 3PT9A 2AQIA 4YJGA 3BE8A 4AIRA 1FSGA 1JHDA 1N1GA 1YNSA 1Z88A 2MWMA 4PX9A 3WJ1A 4DLZA 3RAFC 1URPA 3VI3B 1Q17A 4YRAA 3B5JA 3K9CA 3ZJUA 1JALA 5KJFA 3LO5A 4V24A 3W79A 1KZYC 3AIMA 1S1CA 5DNEA 3WV5A 5BT8A 4BU1A 5BV8A 2W6NA 3GRKA 3GA5A 1OI2A 1SY7A 3K73O 5DWQA 4ZHSA 2KJQA 2C5SA 4A3SA 3CF4A 3M4JA 1YRYE 4GW3A 4DLVA 3U1VA 3BTOA 2AJ8A 3U56A 3PJFA 3K16A 2FNAA 3BIWA 3PJDA 1N2XA 2O1EA 4JP5A 1VKZA 4KBYA 2QQ5A 1WU8A 2I7XA 1X19A 4BNIA 5E2AA 3T5BA 2WTXA 3HABA 3FUWA 3QVLA 1JSXA 1FUUA 1OXVA 4NIMA 2QUZA 2WZCA 4GYYA 1EFUA 3M82A 3QI2A 4Q1FA 1U1IA 1VKRA 2J3LA 2C3PA 3AI3A 1K68A 1WR8A 3G2LA 3H2BA 2JGNA 4X97A 2WI8A 1HORA 5CDFA 3VU1A 3UATA 1W9HA 4D4HA 3HCWA 1ZYUA 2MTBA 4K0RA 2JD2A 3DUFA 3KTOA 2GPWA 4M22A 2Z2KA 3GEHA 4MVJM 3W0LB 1HMPA 4NSNA 5TT1A 3RUEA 4PCUA 1DUSA 1WHSA 4AMUA 3MLEA 2RHHA 2XT6A 3I09A 5ILGA 4P3XA 3E3AA 2CSXA 1C8BA 4WWHA 3EEIA 4H1VA 1A76A 2EJCA 2ZUSA 5EJFA 4PGMA 4I4IA 5I3ZA 1H66A 2R48A 3KJXA 1T26A 4R1UA 4DDHA 5BMOA 3OQPA 5AVQA 1KPGA 3KQQA 3B13B 4IVNA 4BNFA 1TZBA 3GJXC 1SBZA 3M6IA 4AY4A 1S2LA 5LPNA 1L5LA 4JASB 3X2SA 2V7GA 2Z6AA 1SVLA 1GTL1 2II6A 3I9JA 5JD4A 2GM3A 1W88A 1VDZA 2XWJI 3FLMA 2FAXA 2XMPA 2XNHA 3ZX4A 3RS5A 1XZHA 4YRZA 1ESCA 2HF7A 3NEPX 4TKVB 3L1VA 2AF4C 2GZ3A 2PGNA 4QFMA 2NU7A 3GHHA 3ASVA 1OV4A 2AJTA 2HIHA 4Q9JA 3OEWA 1XMSA 4N12A 3HCEA 3M9XA 1XTJA 4MUNA 4AMYA 1G2OA 2AXEA 4LX0A 3O3NB 5A3JA 1NJGA 3TEMA 5B64A 1QFZA 3W2EA 1NW8A 4FINA 2VKTA 4JFRA 1JBEA 2HCRA 3R3WA 1QAOA 1XTZA 1JDPA 4HGRA 1E1MA 1EQ2A 4GU5A 4DSAA 3HNPA 3UG6A 5DU2A 1RI2A 3A6DA 4J6EA 3HGQA 2NTJA 4JT4A 3VJMA 1MAWA 2UDPA 2QLBA 4EY5A 3WGZA 2IIPA 1Z07A 3JQ8A 3DVLA 5P21A 5DOVA 1YQGA 1FYVA 4LKOA 4CG2A 4OFWA 1AE1A 3OT4A 4FWIB 4NZYA 2DSTA 2MYUA 4MUXA 4OCZA 5KMGA 1T9KA 5B6JA 1MJ5A 4F96A 4P4SA 3PDUA 1DHRA 3EUAA 2HTEA 3EGEA 3QU4A 4KAJA 1Q12A 4HDSA 1R5JA 5EJMA 1XF1A 2DPYA 3Q98A 2Q5OA 4KMOA 1CUGA 3IDAA 2ZWOA 3EFOA 2X8JA 1ZJYA 1K4YA 4X8HA 1C3LA 1STOA 4KX3A 3D8NA 4CTJA 1PV1A 2FX5A 2FFAA 2ORED 4A92A 1ORVA 1YTLA 3BVPA 2IT1A 2X1LA 4B3TB 4G56A 5BW5A 4W9RA 5HUQA 5KYXA 2G72A 1KR2A 4MR7A 1ZIYA 1VJ0A 3IBFA 3U1TA 3SIWA 4CG3A 2YUIA 3CVOA 2HHCA 2OVBA 2Q9BA 3HUDA 3ESQA 3L7IA 4G01B 4UPDA 2FR0A 1VPDA 3UBTA 2FSIA 2P5TB 3A9RA 1ZVMA 2LDXA 3AUYA 4WKNA 3W8FA 5A4FS 1S96A 1P1RA 4CUJA 4R0VA 3KWLA 2VHXA 3PCTA 5AHRA 4MMXB 2QUAA 4X95A 4EJSA 1VLQA 3TJZA 1Q1NA 4V03A 4UOEA 1AVTA 5C1IA 3DE6X 4ABTA 4V0SA 1VIMA 3DHVA 2JL1A 1YK1A 1S9HA 2R2AA 2QSYA 3CBGA 4HC4A 2ZG6A 3SIXA 2MSDB 4L8GA 5E3HA 1WNFA 5FOVA 2PUBA 1TYBE 3HRHA 4DLNA 4OYYA 3VC2A 1G5PA 2H29A 5INTA 1XQVA 1WHSB 2YR0A 3EZ2A 2Y66A 3CZ9A 3LBYA 3EUWA 4HEJA 2X2EA 4EHDA 3VO2A 4PPYA 3AEKA 1I7DA 3LRXA 3V1NA 3ZQ6A 3NBYC 5KDDA 1YFJA 2PLWA 1YJBA 3H65A 1KOLA 2ADOA 5EWJA 2CDCA 3W8NA 4CBVA 1E2LA 1TB4A 2P9BA 3HCOA 4TTRA 4J75A 4WK6A 4DJJA 4TYNA 4JBYA 1WB6A 5GMOA 1L4FA 2QL5A 4WXRA 4RMJA 4HEQA 1CYEA 2FG6C 4B79A 1TMOA 3HWRA 5DGCA 221PA 5I51A 4I2VA 5IN5A 2BKXA 2HDWA 4FNOA 4FT2A 2W6IA 4CR6A 2BN4A 3MWLA 1FFEA 2JCVA 1ACJA 1RMTA 2KBFA 5TSDA 4BV8A 4F84A 3F4KA 5I7SA 2Q6LA 3O2NA 5LMNB 4WH0A 1KMHA 3D4PA 4CGZA 1LDNA 3SZGA 2FZEA 3U9TA 2HSGA 4PZUA 2PZMA 3F5FA 4UNQA 3ONVA 4YV0A 6NULA 4W5NA 1NQAO 2C1EA 4U9HS 1EFRD 5KVCA 2JF0A 1N6PA 4BMSA 1K98A 5JJIA 1F8FA 3KZNA 3I0MA 4HKTA 1V7ZA 5DCUA 3DQZA 3WISA 4HGNA 2JLYA 2NNLD 3M1AA 1MB4A 1MZVA 4EEZA 3IS3A 1OX5A 2HJVA 2KWIA 2XQIA 2GAIA 1F3LA 4ZKDA 5FUYA 2ZYWX 1KS9A 3SIPA 4DM4A 5BWOA 3VQTA 4K9DA 4NFSA 5M3BA 5EJ4A 1VGQA 3ZG6A 4CW7A 9LDTA 2PKWA 4FGWA 2WAYA 1SCUA 2VF7A 4JBLA 3BCUA 4PLZA 3R7FA 4DUGA 4YUWA 4P1ZA 4PCLA 4C0AC 2OK8A 3JQGA 2IY8A 4J0CA 5E9AA 5FBHA 5JVDB 1IZ9A 1P1FA 2NU6B 4K9RA 2G88A 2VNJA 3BRSA 3KYCB 1PT8A 2WDZA 4H15A 1NJ2A 4PG5A 1ZZEA 2JVJA 4QKQA 4INJA 2VJMA 2CJWB 2BKVA 3M1IA 3AB3A 3P9SA 1NG1A 3MOIA 3IUSA 3ROXA 3H16A 1LNQA 1O5IA 2F1JA 3L7NA 3T5MA 2WJVA 1E0SA 4MICA 3CE9A 4Q47A 3R9KA 3ESCA 5CLJA 5BNTA 1JMVA 4O4IB 2GVNA 2V8OA 4NBVA 1GPAA 3EEQA 4XEHA 4GOKA 3CXUA 3ENZA 2PT6A 3IKMB 1EWVA 2KI5A 4I1OA 4TOIA 5A3VA 4H6XA 4RTLA 5JBQA 5KVAA 4FMPA 4BNZA 4NNOA 1IQ0A 4P4UA 1GPBA 4MQEB 4DUZB 3G9TA 1MZPA 4B71A 3P0RA 1X7ZB 5HUHA 1N8SA 1U8ZA 4XTCS 4M0KA 3T3NA 3LLUA 1DBRA 1IN6A 2QP3A 1QIJA 2G83A 3WB2A 3DR3A 1E9DA 4X3OA 2FQ1A 1L7EA 2QQGA 5F64A 4ESOA 4YLYA 1ML3A 4FE4A 4P9NA 5BWMA 1ZRNA 2Q4EA 1V3UA 2O0MA 3PUIA 3VJKA 2BY4A 1CDOA 4DNPA 5LD2C 1NLYA 2BI8A 4QBKA 4B31A 5AKYA 1S89A 1YS2X 4RPGA 4KMRA 3V2IA 3WRVA 4ZQFA 4UBNA 2O20A 4IEFB 1QCDA 5BQ5A 2VYFA 1A1VA 1E9BA 3SSOA 3BCHA 3H8SA 1U4SA 5G53C 2FQYA 2NAFA 4EVIA 3CC8A 4C7MA 2GDZA 3COPA 3QEBZ 4YAIA 2HIAA 4CR7A 2WDPA 5H7XA 3Q15C 3SFTA 4C76A 3G59A 3P96A 1EYZA 2Y1DA 1BEZA 3LWDA 4CM9D 4JOCA 2QBYB 3RTBA 4CKBB 3THOA 2IOHA 1DBPA 2FFRA 3DMTC 4EAQA 3EA5A 1RC0A 1MC5A 1TGYA 3AETA 1J00A 4YJHB 4PHHA 4AG3A 4RQUA 4RIHA 4Q9LA 3GMTA 3T3OA 4Y6RA 5JSFA 4M55A 1ZD2P 2J9RA 4BKUA 4ES6A 5JU6A 3SHWA 3BGSA 4V0NA 4XLLA 5CFLA 1O6ZA 3UMJA 3U44B 3U0VA 4ECAA 4KR6A 1CB7A 2GTIA 4WOKA 4RSGA 3F4BA 1OE0A 4GECA 5AW4A 4RGYA 2H1LA 3O3CA 1FCJA 1WKVA 4WFIA 3TQHA 1OGJA 5A3RA 3IAS1 1H3EA 3FTNA 2Q9AA 1T2AA 1Y80A 1Y9AA 2QD3A 1JKMA 2PRSA 2XLBA 3EAGA 1PJQA 3M6LA 3RIYA 2EF0A 1HKUA 3AY6A 3G7NA 1CZKA 2A33A 2ZUBA 4M49A 3TS1A 4H7JA 1B4DA 1MD9A 3M83A 4X6YA 3OIVA 1KI6A 2H1FA 4XD2A 1JKXA 4B6RA 5LR6A 2Q46A 3WAJA 2NSHA 3C70A 4JELA 4TV9B 1BHQ1 1P2BA 2PTGA 3OAAA 3LXXA 5LBIA 1WZ2A 1XZ8A 2V8BA 2AZTA 3N87A 3PHIA 4E5NA 2CZQA 1HFKA 3KELA 1D7AA 1MIHA 3L4BA 2P67A 3PNKA 2YJ5A 2DBZA 4NMMA 5SZHB 4EG1A 5K6TA 1H4QA 2N9UA 3ZGZA 2PUVA 2GCOB 2FSFA 1U1CA 2JKZA 1YNOA 3MCZA 1N6LA 2P2LA 1PJRA 2OHIA 2OY0A 1SA0B 4FUQA 4C0QC 1NZFA 2YRWA 4ZYXA 1T43A 1LBSA 1NRJB 1T9AA 2W7TA 3B2NA 2XY4A 4MRMA 3SY8A 3IP8A 4FKMA 1QXSA 5KC9A 1F6WA 4RV4A 2WT4A 3LGSA 2GFQA 2PT7A 4GPIB 4MULA 2IEZA 4V0QA 2C88A 4KREA 1FMCA 1YJ5A 4ESVA 1ISHA 3FI9A 3BRCA 4JGBA 3WBKA 3OTIA 4OFZA 2ZRFA 4OJYA 4BNHA 2RGRA 4E51A