4I08A

Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
243
Chain Sequence
b'SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
molecule tags Oxidoreductase
source organism Vibrio cholerae o1
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
total genus 88
structure length 243
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i08A00
3TZKA 3AUAA 4GSLA 1RYEA 5JW6A 1YL5A 2E49A 1ONNA 1OC2A 2B4TO 1OOEA 3EYWA 2Y99A 2QRJA 3NTOA 3PHJA 5IZCC 4ALMA 1XHLA 3QIVA 3MJVA 2PGDA 3HADA 4OXNA 4MKXA 2X5JO 1EVJA 2Q2QA 5F1PA 3E03A 1SEPA 1SNYA 1Z73A 2PKRA 4HFRA 3GUYA 5KVSA 4BMSA 4DPMA 5CPFA 5GZ1A 3DBLB 1JN0A 3ST7A 2ZB8A 2HO5A 2JFFA 5DP2A 3RBZA 4YRBA 3GZ4A 3QP9A 3ZN2A 5JFOA 4JXKA 2VT3A 4NJOA 2AA3A 4NDNE 3WB9A 4II3A 2AE1A 2C2XA 2X9NA 3DAGA 3OH8A 1ML3A 2FWMX 4AICA 1ZMTA 1H93A 4ONEA 4S3MA 5JO0A 1E77A 3WFJA 1DC3A 1W6UA 4R68A 4RF2A 1DIGA 4YJHB 2FZEA 4NI5A 3ABIA 5KJCA 2VYVD 1PJ3A 2I3AA 4E5PA 1O9BA 1BHSA 1BXKA 2EW8A 2ZTVA 4TWRA 3QVWA 3E1KA 4GKVA 1ZJYA 1XG5A 3OFSA 3VTZA 4D41A 1GZ6A 4AJ4A 3E48A 3VPGA 4YAKA 4NNJA 2I65A 4GLLA 4BL5A 3PTZA 3FBGA 4R4JA 4A0SA 1GV1A 4J7UA 3WXBA 1G0NA 5FI5A 2LDBA 3RD5A 1SPXA 3D3WB 3FR7A 3GVPA 2A4KA 2XAAA 2Y05A 4R16A 2YFQA 5B4TA 2YHUA 4MP3A 4EUFA 5MDHA 2WD7B 5IDWA 2EP7A 4LMPA 2IEDA 4GBJA 1H9BA 1LDBA 3A9WA 1JAYA 1K6JA 3JQFA 2IYPA 3GG2A 3JQ7A 4RPHA 5EIOA 3ZWYA 4PG7A 3CZRA 2GRAA 3GZNA 5JYEA 1QLHA 4IDDA 4M1QA 3WICA 5KOIA 3W1VA 2YY7A 2ZATA 3OECA 2EJVA 3JD0A 4EJ6A 2CVQA 1R6DA 4IQGA 3GDFA 3H7AA 2PD3A 1SC6A 2QW8A 3DMTC 4XQ9A 3FCOA 3SVTA 1DXYA 2NM0A 1E6WA 2NVWA 1E7RA 1YBAA 5ER6A 5DBIA 4K28A 4IS3A 1LSOA 4D3DA 3RFXA 4CUJA 3AM4A 2ZYGA 3F46A 4IDAA 4IY1A 2DKNA 1NWHA 2YW9A 4GVLA 1FMCA 1G6KA 4PLGA 1WAMA 4HX5A 1EVZA 4J6FA 1XDWA 2Y67A 4TROA 1ZO8A 4M49A 2QRLA 3QJ5A 3I52A 3KV3O 1WDKA 1NAIA 1MV8A 5A3VA 4RVGA 4IIUA 3FPCA 5AVOA 1BSVA 3HG7A 4YAGA 1DHRA 3EHEA 5T6BA 4AL4A 3H9QA 2NQTA 2X6TA 4YXFA 4XYGA 4BKOA 2NUAA 4CM7A 3U09A 4ZQBA 3L6OO 5LCXA 1B0AA 4H16A 1I0ZA 1XR3A 4EI2A 2G76A 1ZK2A 4FFOA 1NBOA 5BSHA 2RHCA 1LC0A 1WWKA 1B3RA 2J8ZA 1U4OA 3Q6IA 1HE2A 2OP0A 5BNTA 4OMUA 3W4KA 3IDSA 3HN7A 2NU9A 2DFVA 1DOHA 1MFPA 3RJ5A 3PYLA 1FK8A 4M86A 3EVNA 4BUCA 1Q0QA 3VZSA 4J1NA 1H6CA 5ITVA 3KEQA 3OIDA 3WJAA 1P9LA 2WEKA 5IXSA 3VHRA 3C24A 3WSWA 1EUCA 1MGOA 3ZWPA 3D3EA 4R1NA 2FPPA 1P33A 3K31A 4OIMA 2VHVA 3WTBA 5I7FA 1QYCA 4RLSA 2P5YA 1R0LA 5LC1A 1H6BA 3GVIA 4B8ZA 2EERA 1LJ8A 1U3UA 2F00A 3DL2A 2W2LA 1MB4A 3AUUA 2D59A 4BV9A 3BAZA 4CMAA 1DFGA 1LRJA 5G0UA 3GK3A 4JROA 1V35A 1NX6A 3DMYA 1E1KA 4CMIB 5FF9A 3KBOA 1T1SA 4DMMA 2BGMA 3D4NA 3HFGA 3RFVA 4MPDA 1F12A 1DIHA 1PS9A 5U4QA 5C7OO 3IJPA 1ISFA 1AUPA 3AM5A 2R6JA 2VHXA 2Q50A 1MC4A 3GDOA 4GL4A 3JCZA 2WSBA 3N58A 1K3TA 3NJ4A 4A03A 4RQUA 2ZJ1A 3D0OA 3QWFA 1LU9A 3GDGA 3GVXA 4J90A 1QG6A 2DBVO 1JVBA 4XGKA 4FIZA 1T2EA 3MJ4A 2JFHA 4Q3BA 4U0KA 2I76A 1GFSA 4I5EA 4QO7A 3VDRA 1YH3A 1KVSA 4JBIA 4CL8A 4BV8A 3VPSA 4ESOA 2IXAA 4Q3AA 1MXFA 3OA0A 4HKTA 1E3WB 1LDYA 4YTEA 2VYND 1O95A 4BO3A 4RPGA 3ZWOA 1UR5A 4BMNA 2BGLA 1PJLA 1ZFNA 3AY3A 1PZHA 4F46A 4PLZA 4JJIA 4R5MA 4I5FA 5DN9A 5L4SA 3WGHA 3JQGA 4O5OA 3F5SA 1I3KA 4D45A 1O6ZA 4RZIA 5EPOA 1HDRA 1M67A 4WGGA 5AXBA 3WTCA 1BGVA 1A4IA 4DYDA 3GT0A 4XGNA 2EWMA 1N2SA 3ZCXA 4ZRMA 4WLEA 3DBVO 1XU7A 4E33A 5DCUA 4HXYA 3CTMA 4CMEC 1DIAA 4HFJA 3RBVA 2P91A 1B2LA 2GR9A 2HJSA 4N5NA 1P77A 3WYBA 2QIOA 4W6ZA 1PR9A 4HADA 2UV8A 2P9CA 3PFWO 3WNVA 4A2CA 2VWPA 5JC8A 1VJ0A 4NZ9A 2AXQA 3VZRA 3BMCA 1P0FA 1SOWA 3RUDA 3STHA 3L77A 4XGIA 3B1JA 2CSUA 3F1LA 2OL4A 3KYDB 4UULA 2GCGA 3E5MA 4XJTA 1V6AA 4XJSA 3COSA 1A71A 2VQ3A 5JDIA 3V1UA 1YRLA 3QSGA 4Z0TA 5K6AC 5L40A 2YV1A 4Q3DA 4EEZA 1BDMA 1BG6A 4DYVA 4E5YA 2CDBA 2W2KA 2EHDA 2GYYA 1AHHA 3SJ7A 3QV1A 1U4SA 2Y0EA 3BMQB 4D46A 4DREA 4ZQGA 3PLNA 3RIHA 1E6EA 2VZ0A 5LDHA 1U2GA 1M75A 3ROMA 3FTNA 1U8FO 3MJTA 4J4TA 1HYHA 1WVGA 1DC5A 2YV3A 3GRKA 3O9ZA 1I01A 3ZWXA 4E13A 1LLDA 1X14A 4OKNA 3TDKA 3QLJA 1WMBA 3GGGA 1EEHA 4XX0A 4LW8A 2VZ9A 2XOXA 2H9IA 2BHLA 1VJTA 1EFKA 2X0IA 1EUZA 2P4HX 1E3LA 4GMGA 4HWKA 5A3JA 3U5TA 4TVOA 2GLXA 4OQZA 4IS2A 2Y0DA 4TQGA 3AWDA 4FFPA 1C1DA 5IXYA 5DCYA 1U2DA 1D1SA 2YJZA 5CDSA 4FGSA 2UUPA 3S1LA 3NT2A 4WECA 2G17A 3I9LA 4BIIA 1ADGA 3VAZA 2NLOA 1AN9A 3NDJA 3QWHA 1BXZA 2ZYAA 3B20A 1VL0A 1I3LA 2HMSA 3CUKA 2E37A 1PTJA 3K9QO 4W82A 1C3VA 2FN7A 2O2YA 3MJSA 4YT5A 3S2FA 4XYLA 2E6UX 1TT7A 4OH1A 2DBZA 4B79A 2NU7A 3PJEA 3WIEA 1X15A 3E9MA 1OC4A 3RVDA 4PG8A 2HK8A 3DZJA 4IQ0A 3I23A 2PZMA 5I9NA 4AVYA 2LDXA 1MG0A 3JQ9C 2BKAA 2YQ5A 3TL3A 2XPCA 3AOEC 2B4RO 2FMUA 3PZBA 4NK4A 1LRLA 4LSWA 1JKIA 3WYEA 4J43A 3BTVA 3EMKA 5L45A 5J23A 2D8AA 2DFDA 1HDZA 1J5PA 3BHJA 3ZHXA 4L4RA 3C1OA 2PFGA 3RBXA 1Q2XA 4PG5A 4WLOA 2C5EA 3UOGA 3INTA 3OA2A 5DZSA 4O6VA 4R9RA 3AU9A 2GZ1A 1GEEA 3BZUA 4HV4A 4O59O 3KLPX 4PCVA 1ISJA 4XWYA 4F6LA 3GN2A 2Y68A 1A7AA 2YUTA 3IS3A 3CKYA 1YB4A 3PWSA 2NQ8A 4YT2A 2OGUA 2C07A 1DSSG 3G1UA 5KKCA 1UAYA 4FR5A 3U4IA 3M2PA 1NPDA 1ADBA 4K26A 3DOCA 1NVTA 2Q1UA 3C7CB 3GMDA 1P1IA 2VHYA 1WMAA 1D1TA 5ILGA 4CODB 5GMOA 1LDNA 4GGPA 2GN9A 3AJRA 3PQDA 5DULA 2HMVA 2IZ0A 1LLUA 1O0SA 2HK9A 2AW5A 2HKIA 3H9GA 4XYEA 4E5KA 2BRUA 3GZNB 2BFPA 4M87A 1PGNA 4GWGA 1IHXA 3SEFA 5A9SA 5KJFA 3UVEA 3PDJA 4J4BA 1NYTA 5I9LA 1U7TA 4E6PA 2QRKA 1T2AA 1HTBA 2H6EA 1PJBA 1J6UA 2PKQO 4KTVE 1E5QA 4IDFA 5JDCC 5CFZA 1PZEA 3UW3A 3V1YA 2VWHA 1EVYA 4CV2A 1VKNA 3D4OA 3TRIA 2VUUA 4YR9A 2CDAA 4CPDA 3VVCA 3FF4A 5TJ9A 1U5AA 1AHIA 4PFJA 1DRWA 3WGZA 2XXBA 1LNQA 2C20A 3C7DB 1QORA 3H3FA 3X2FA 1IE3A 1W8DA 1I24A 4FN4A 4UUNA 3DDNA 5JMPA 3UCFA 5U9CA 1YBVA 3I3OA 4I5DA 4C4OA 1KVUA 4NBUA 4DIFA 2W4QA 2GPTA 4BNGA 1S6YA 3NGXA 3I1JA 3JYPA 2AG8A 3QQPA 2EG9A 3L07A 4IGFA 1BMDA 3MWDB 4W7IA 9LDBA 3N7UA 2X22A 3ROPA 4XRGA 2Y1EA 1NWCA 4GQAA 3RC9A 4ND3A 3LC1O 5JY6A 3FNGA 4Y8VA 2GN4A 2Q49A 5I8ZA 4OXKA 4Y6PA 3GN1A 4B4UA 1FDVA 3HB4X 2GDZA 3GNSA 2GUGA 4QX6A 1XKQA 1VRWA 1MC5A 3R6DA 3O8QA 1P74A 3JQBC 3RASA 1WW8A 1GCOA 5G4KA 4J1TA 1XELA 1LLCA 5B1YA 4RVDA 1QYVA 2JKVA 2PZKA 3ETGA 3KYCA 4II2A 1LC3A 4CQLA 3I83A 5G4LA 1V3TA 4D7AA 2O23A 4MOWA 3M1LA 1R4MB 5T8KC 3JSAA 2P5UA 4IIVA 4GVXA 4CJXA 2VTDA 3P5SA 4TKLA 1RM3A 4E21A 1SB8A 5G0WA 3VKUA 1E6UA 3GGPA 2BI8A 3PLRA 4J4HA 5F5NA 3AU8A 1EBFA 1I30A 2GSDA 4BNIA 2Q45A 2CVZA 2ZCUA 4CMJA 5BSFA 1OBFO 1VLLA 1T2FA 1RM0A 3NRCA 2HMTA 3LQFA 1Y9AA 1Y5MA 1Z7EA 1NXQA 3FTPA 1Q7CA 1N7GA 3HJAA 1KEWA 2CNBA 2UVDA 3DFUA 2VN8A 5B4VA 3BHMA 3PVZA 1UP4A 4E2YA 2ZB7A 4RDHA 5JO9A 1C0KA 5DF1A 2DBQA 6LDHA 4UVDA 1IZ0A 1ZUD1 3KEOA 3PGJA 2EW2A 4KZPA 3VDQA 5CDTA 3B70A 1YJQA 2FSSA 1HE3A 3ZW9A 1IZ9A 1N8KA 2CMDA 4N7RA 5KIAA 1LDEA 2G5CA 2EP5A 4Z9YA 3LT1A 5L95A 3DXFA 2B36A 1N9GA 3DZGA 3D64A 1Z7BA 3WX0A 1BW9A 2X0NA 3IC5A 2J3KA 3OEWA 1NFFA 1RM5A 4U7WA 3MOIA 1VL6A 4WOJA 2BD0A 1VKOA 5CG2A 4E2ZA 5BR7A 2XXJA 1LXCA 3HDJA 1B8PA 1EE9A 4IXWA 2JD1A 5JAZA 1PS0A 2O3QA 1PGPA 2R2GA 4IGEA 5A06A 3WOHA 1AXGA 4BNKA 1NQTA 2HRBA 2NVUA 4WPGA 1ZZEA 2DPGA 4BO0A 1W0CA 5JYDA 4DGSA 1XSEA 5JCXA 4ALKA 1E3SA 1DFIA 1XA0A 3D5QA 3INRA 4CLOA 4B7CA 4TZKA 2AEMA 3OEYA 3S55A 4YPOA 3JQGB 1CDOA 1DHTA 3JD4A 1K0UA 2X9VA 3K2BA 3JYNA 2AQ8A 3DZFA 4AJJA 3GPIA 1NASA 4KP7A 1YONA 1A72A 1ENYA 3AOGA 4ILKA 3QW2A 4R3WA 2W98A 3AI1A 4NFYA 1I8TA 3PYXA 2PH5A 1BW9B 2ZKLA 1RPNA 1QRRA 3C7AA 3RC1A 3WG9A 1H2HA 4Q3CA 4J2HA 2PD4A 5KJ6A 2Y66A 3PJFA 4FBGA 5JBIA 3TZQA 1KY4A 1YQDA 1ULSA 4JBHA 4P8RA 5A02A 2ZTMA 5CPBA 3RUAA 1PWXA 4WE3A 1WPQA 3AM3A 5TQVA 4Z9FA 3SLKA 2OOSA 2C54A 4YJDA 2OO5A 3ZDFA 1H9AA 3WLFA 1EUDA 4U6QA 2WM3A 1AXEA 1ORRA 5IZCA 2Y1FA 1A7KA 2ZJ0A 1L1FA 4D0RA 1FXSA 2Q1SA 4FQ8A 2V6MA 1B8UA 3IIEA 2NACA 1X13A 5CAEA 3INGA 2UDPA 2P4QA 2JHGA 1PQWA 1Q7GA 1HRDA 3H2SA 3H3JA 4ALNA 2HMWA 1UZLA 4P4GA 3ZNPA 5JCJA 1K2WA 1Y8QB 2B37A 4OJNA 1U5CA 4PLCA 1D7OA 4YJFB 1EDOA 5B37A 5A5FA 2ZB4A 4WLNA 2AMFA 3OQ1A 4UVGA 2PA3A 1A27A 3AUTA 3ZWAA 4BNNA 1BWSA 1GUZA 1PWZA 3PQFA 4YEDA 3JQEA 5AXCA 3ZW8A 4AJ1A 3PFFA 3HDYA 1E3WA 1K5HA 2WYVA 4JN6B 3JQAD 3H5NA 5AXDA 4XDZA 4YRAA 3JQAB 4J9VA 2GGSA 3RKRA 3L0DA 2PLAA 2NU6A 1IPEA 1IUKA 2BELA 1YXMA 1EK6A 3C3XA 3IOYA 4BMVA 1JLLA 3ICCA 1EVIA 4FC6A 3WMXA 3W4IA 4HFNA 4YAEA 4CMHA 5KVQA 1E7YA 2CD9A 4JX8A 5EJ2A 1NFQA 3MWEB 5FYDA 1E5LA 4FOSA 4D79A 1LTHR 1OI7A 5A05A 1OAAA 1UZMA 2HLPA 4JLWA 2UAGA 5F1KA 2O4UX 2Y1CA 3V8BA 4UREA 5DNAA 3VH2A 4B3IA 3OJEA 3EAGA 3ZWCA 2FZWA 8LDHA 4EYEA 1D8AA 2CFCA 5GY7A 3ICPA 4KUHA 3BXXA 3L9WA 2NVBA 3H2ZA 5A9SB 4MIEA 4KUEA 4BNJA 1YWGO 1Q0HA 2HQ1A 3K92A 4XR4A 1ADFA 4D42A 4QFDA 1NFRA 3PK0A 4WCFB 1E92A 3GOHA 1ULUA 4JGBA 1JKFA 4XIYA 4YYZA 1U3WA 2IZ1A 1M66A 4ZQHA 3JYOA 3ASVA 3P2OA 1DRUA 7ADHA 1L7DA 5CG1A 4PRKA 3Q1LA 5F21A 2PWZA 5DCWA 5DBFA 4AJ2A 5TT0A 4AJLA 1D4FA 3PHLA 3RUCA 3UCEA 4NU5A 2RH4A 3SX2A 1GQ2A 2IZZA 3GEMA 1QSGA 4UUPA 2NU8A 1GZ4A 1OMOA 1ZK0A 4CV0A 3MCVA 3SBOA 4R9SA 1TT5B 4FFLA 4L76A 4EW6A 1DJQA 2RAFA 3H9EO 4MP8A 1JA9A 1YBMA 1QV6A 1UAGA 1ZIDA 2ET6A 2NNLD 3L4BC 4WNIA 1I10A 3G1TA 3WQRA 1ZSYA 3NT4A 2QYSA 5FEUA 4XD2A 1KVQA 2DTDA 3G79A 3B1KA 5F5LA 3HDHA 4WUVA 3PYMA 4E5MA 2NVUB 2D5AA 4MVJM 1PJCA 1PX0A 4KTTE 4OXYA 5ENVA 4FC7A 4OOFA 5BNIA 4LISA 4RCVA 3HUDA 1VI2A 3MZ0A 2ZIZA 3KXDA 1LEHA 4CMIA 3L4SO 1K6IA 3TNLA 5THKA 3T7EA 1DBVO 4GX2A 4ZQEA 1UXHA 3RUIA 4IJKA 2E4AA 2GN6A 4E2WA 3RI3A 4PG6A 4DIOA 2E48A 2VOEA 5ADHA 3ANLA 3UKOA 1YO6A 2Q2VA 3BTSA 3JD2A 1PJSA 4BNLA 4CLRA 3QHAA 3G3EA 3OHSX 1GCUA 2PGJA 4HNHA 5KJEA 5HA5A 2O48X 5T8KA 2PTGA 1FDTA 3A14A 5HTOA 3VC7A 1E0DA 2WTBA 5IDXA 4E0BA 4MVJG 4NFHA 1Y6JA 4NBRA 1TVEA 4RPLA 4AJKA 3A06A 5COAA 1ISIA 1Y8RB 3UHAA 3V5NA 1ZSNA 4YJHA 2QQ5A 3JQ7B 2H63A 3KSUA 1E7SA 1V3VA 3GG9A 4JBGA 3HHPA 2DUUA 4FJ0A 3IAHA 1T4BA 2GASA 4CM9D 4CLXA 4RVSA 1R4NB 1T2CA 4L75A 2Q4EA 4RDIA 4IJUA 3ZHBA 3BHIA 3DONA 4JIGA 4NG5A 3ETDA 1R4MA 3M6IA 4PIVA 3ZV4A 3EUWA 5I7EA 3KZVA 4CQMA 3O38A 3S2EA 5IF3A 4R5HA 1T2DA 3DBLA 2NTJA 2HK7A 4QTZA 3SC4A 3BA1A 3ZV3A 4WKGA 3JV7A 5L4LA 1C0PA 4DBZA 3G0OA 1C1XA 2C2YA 3CXRA 3GLQA 3ZV6A 3WYCA 4XA8A 3HDQA 1XGKA 1NHGA 1N5DA 4XKJA 2AEFA 3OJOA 4LSMA 3RCBA 3JD3A 1C1DB 3GHHA 4YT4A 2O2SA 3F1KA 5FFFA 3KSDO 4C7KA 4MVJF 1UDAA 4FDAA 4Z3KA 1RKXA 4PVCA 2I66A 2FR0A 3S2GA 2Y0CA 1EDZA 2V65A 2V6FA 3FNEA 4M54A 3NAQA 4WASA 4TRNA 3PHIA 1QYWA 4YVFA 5CP8A 2IEBA 1PR3A 3DBRB 2J5KA 1VJ1A 3Q0EA 4DUPA 1GR0A 3QA9A 4WCFC 5TSDA 2ZYDA 4DBVO 4O1MA 1RM4A 1V9LA 3TOXA 4MO2A 2EKLA 1NAHA 3CH6A 1CJCA 2NTNA 4BNZA 3C1TA 1NNUA 4KDEA 3DBRA 1NR1A 4D3SA 1NPTO 2VNSA 2YV2A 4CLEA 1O94A 3OQBA 1LX6A 1IPFA 2DLDA 1UXJA 3E6AA 1LDGA 4LMRA 4FGWA 4CM4B 2GERA 4WLVA 3TQHA 2I67A 2PY6A 1ADCA 2IRWA 3Q9NA 2FOIA 1DO8A 3GC6A 1WZIA 1PZGA 5TC4A 4Y98A 4AJHA 2XF8A 1HL3A 3O26A 4MVJH 2A35A 2Q3EA 4Y6RA 3CZMA 4QSMA 2FPIA 3E18A 1R16A 3H5RA 4B3JA 4LCEA 2JAPA 4B8WA 1X7HA 1HDYA 4NPCA 3WWZA 4AJNA 4CLOB 3UF0A 1ENOA 4BO7A 3U0BA 3ZU4A 1F17A 4PLVA 1ZKMA 1HDOA 2BI7A 4FFNA 4YRDA 4BNUA 4XQEA 4OSPA 1NVMB 5COQA 2AE2A 2OBNA 3WDSA 1UUFA 4L9RA 2VWGA 3AI3A 5JS6A 4J7XA 1GL3A 1VSUA 4DTIA 3I4FA 2VRCD 2VHWA 2PV7A 2X58A 1MXHA 4UEKA 1MFZA 2C0CA 3OETA 4RORA 1YL6A 5GZ6A 2I3GA 4HBGA 3DC2A 5DOVA 3F3SA 4J0FA 4JK3A 3B1FA 1P1RA 3WJ7A 5A03A 1ISGA 4XEHA 1GUFA 5G0VA 3DTTA 4E31A 3W6UA 1YDEA 5TRTA 1HT0A 1ZXBA 4B7XA 3PJGA 1CF2O 3KHUA 5HRUA 1KS9A 1NM5A 3I9OA 4LRSB 3GEDA 4CMKA 3VPFA 2OP1A 2G0TA 3DHEA 3WLEA 1ZNQO 3BTUA 1UDCA 2ZQZA 3K5PA 3NKLA 3UAGA 1PIWA 5EERA 4ND2A 3DHNA 4BOYA 3ZU2A 3W6ZA 1HSZA 1V0JA 2X0JA 1YGYA 1YOVB 3PZRA 3K73O 4P4NA 2DAPA 3CEAA 1IY8A 2HJRA 4BQPA 4IBOA 3FNFA 4E30A 1KVRA 2O4CA 2W90A 4FS3A 2DT5A 5ER9A 2CZCA 4XR9A 4L74A 3JQ8B 4ROSA 2RCYA 5H83A 5TS3A 3LT4A 4WOKA 4EGFA 5L4NA 2VNAA 4RL6A 3E9NA 4TRJA 3TZHA 4ALJA 3VPHA 1TI7A 4H7PA 4YQZA 1KERA 1EZ4A 2QX7A 4DQUA 1JAXA 2Z5LA 5EL0A 1EE2A 1DJNA 3DMTA 4YA6A 5TGDA 3S8MA 4YT8A 1WLYA 3JD1A 4ALIA 4BO5A 4YACA 1P44A 3MTGA 4R01A 3W8FA 4FFMA 4BNTA 1MX3A 1TA4A 4PRLA 2Q4BA 1PJTA 3KSZO 4J9UE 4OKIA 4ZICA 4HFMA 4RZHA 2GN8A 1P31A 1A4UA 3T4XA 1PQPA 1HZJA 4MIYA 1Y5RA 4NMHA 1OZAA 4DC1A 1A5ZA 4ND1A 4Y9DA 3W4JA 2BGKA 4OOEA 4N18A 1DLJA 3FRJA 3ULKA 4QFCA 1V8BA 3ADPA 5T5QA 3LYLA 1BXGB 4R54A 4ALLA 4WK6A 1M2WA 4NHEA 3G17A 1ZK3A 2HAEA 4J1QA 1EQUA 2YQ4A 3FWNA 3TJRA 2NV6A 2EF1A 1QYDA 3EW7A 5T67A 4CMEA 4IPTA 1QV7A 1ZK4A 1TB4A 1VC2A 4JNKA 4DL9A 1X1TA 3M2TA 2PNFA 2OXIA 5ICMA 4ND5A 3PQEA 1X0XA 4RGBA 1F8GA 4ZD6A 2GO1A 4U6SA 4XDYA 5JCJD 2RH8A 1IYZA 1O5IA 4P38A 1BVUA 3TFOA 4BGEA 1NR7A 4MIOA 2YDYA 2J5RA 3D3WA 4G81A 4ZJUA 4CR8A 5HS6A 3QVOA 4NBTA 3VTFA 3HWRA 3NJ8A 4EZBA 4A27A 1G1AA 4MP6A 1Y9EA 1U9JA 3L9XA 4DPKA 2DC1A 3I9KA 3IKVA 5THQA 3QWAA 4UEJA 2Q1TA 4OO3A 4IINA 2FR1A 3ZNQA 1HXHA 1Q0LA 4R69A 4GX1A 2J6IA 5JDIC 5KJ1A 4B4VA 2C59A 2TMDA 4B4WA 3KM0A 6ADHA 4N5LA 2BMAA 1Y7TA 5CEFA 1NTOA 4RVHA 1JWAB 1YL7A 4F6CA 3L6EA 2X7HA 3E82A 5AOVA 5CDYA 1YS4A 3V2UA 2EV9A 4IJVA 3GF4A 4NFSA 1WNTA 3V2HA 1C0IA 4YJGA 2WD8A 4Q3NA 1LRKA 2WD7A 2ZTLA 4PN3A 1QR6A 1R12A 1VPDA 1ZJZA 1TEHA 5ES3A 4D0SA 1EK5A 3NT5A 4U0JA 3OM9A 4M8SA 1PJ4A 4N5MA 4DVJA 4EUEA 8ADHA 4IMPA 4BO6A 5L9AA 4DXHA 2D3TA 3FI9A 4RPKA 5JDCA 4EJMA 1HYGA 3PI7A 3K8ZA 2B0JA 3EK2A 1XYGA 1KOLA 4BKRA 3EGOA 2DTEA 3MJCA 1LSSA 3IJRA 4MVJD 1SAYA 4TZTA 3EVTA 1KYQA 2B4QA 5C7IO 4RV9A 1EMDA 3GFGA 1KEPA 4LN1A 5IN4A 3QE3A 5C37A 1UXIA 4UUOA 3TOZA 5JNLA 1LDMA 5L51A 4UVIA 3TN7A 1QYXA 5HS4A 5BT9A 1IL0A 4FJ2A 3KLMX 4JP2A 1P1JA 2QYTA 2CF5A 1K89A 3CE6A 3DQPA 2OFPA 3MOGA 1VSVA 4L0QA 3RAJA 4C7JA 4J3FA 4E32A 4D3FA 2IE0A 3OP4A 4BGIA 3PRJA 4GI2A 3GHYA 4PLYA 4P4LA 4RO0A 3U4DA 3RFTA 2Q99A 1JDJA 1P1FA 4BKPA 3GRPA 3PP8A 4FB5A 1R37A 1XU9A 4KUGA 4MKZA 2R00C 4LK3A 4J7CA 1ENZA 1LI4A 4E4YA 3DOOA 2SCUA 5T64A 1QMGA 4MVJP 1GYRA 1GYPA 1QP8A 4JQCA 1LSUA 1HETA 1UXKA 4QXMA 4BB5A 2IODA 1DEHA 4L4XA 1UP7A 1ZW1A 1MG5A 3KYCB 2NTVA 4HNGA 4PZDA 3WWYA 4J2OA 4IUYA 3OICA 3TZ6A 3WNQA 4BKQA 1N1EA 3FR8A 5G4KB 1KC3A 3ENKA 4I08A 1GY8A 4BNVA 2BH9A 1AE1A 2EIHA 3KB6A 2JFGA 3AOEA 3I9MA 1XEAA 3WR5A 1VM6A 1YB5A 5H81A 1T1RA 4R1SA 3UICA 5KNLA 1CQJA 1P3DA 1L7EA 1GAEO 1E7MA 1IHYA 3C1AA 4FJ1A 1E1MA 1O8CA 3R3SA 2J3JA 1HLDA 2OORA 3CPSA 4FD3A 4OL9A 2Y1GA 2RIRA 1P1KA 4A73A 3KRTA 1SO8A 1CEQA 1DC4A 3D5TA 2VOJA 1XQ6A 1M76A 3NUGA 4AJIA 5H82A 4JJFA 1SEVA 2C7VA 1W73A 4J1SA 1CWUA 4PLPA 2NSDA 2GD1O 4Z3DA 4OYRA 3T7CA 4PGFA 3IL2A 3JQFC 2D0IA 3ZV5A 3U4CA 3LC7O 1ZCJA 2P9GA 5EQFA 3O4RA 3ETEA 3WGIA 9LDTA 1G0OA 4A26A 4LVCA 5U1PA 2P9EA 4IDGA 4CLHA 4BO1A 1XLTA 4E12A 4A7PA 3HN2A 3HB5X 4YDRA 1Y1PA 4CUZA 1E1NA 3ADOA 3WFIA 2Z95A 1GYQA 3ONEA 4W4TA 5IDYA 1DAPA 4BGUA 1JTVA 1YKFA 5JAQA 2PZLA 2B5VA 3TL2A 4CR7A 5KCZA 4OQYA 4PLTA 4PLWA 3GY0A 4PZEA 5TNXA 5KWEA 3NV9A 3KVOA 3AY7A 5COBA 4B3HA 4NH4A 3DZKA 4A10A 3K2EA 3RROA 2B5WA 3ON5A 3NDRA 4IQ8A 2Q1WA 1GD1O 2ILTA 4R1UA 4O63O 3L4BA 1NQ5A 1RJWA 4YQYA 3T4EA 4INAA 3IKTA 4P22A 3CIFA 3ORFA 4RVUA 4UVHA 3I9JA 4LRTB 1E3IA 2W8ZA 3RWBA 5TJHA 2A92A 3PPIA 4E2XA 3GMSA 1PSDA 2QZ9A 4FOOA 1N92A 2PKQP 1YE3A 3NTQA 1NP3A 1IULA 1JWBB 3GEGA 4DRYA 1R66A 4NIMA 3VH1A 3ZZNA 2HDHA 1UH5A 3LVFO 2PGLA 1T24A 2AEJA 1ZXLA 2DU8A 1ZEJA 4Z0HO 1GU7A 4DLLA 3NEPX 4RF4A 4OGWA 2AQIA 1H2BA 4RVFA 3JYQA 4XQCA 1GDHA 2W2KB 1U8XX 3F5QA 3SXPA 3OF2A 2J3HA 5C7LO 5TIIA 4NJMA 3SC6A 4CLRB 1PJQA 1GQYA 4PVDA 2BLLA 3PWZA 3KOUA 1IB6A 3PWKA 1E7QA 1N1GA 4GLOA 1HLPA 3KYDA 2P68A 2J5QA 3KUXA 1ENPA 1NPYA 5B4UA 3TPCA 2ZCVA 4W9NC 1T26A 1H6DA 1ZSVA 1GPJA 3VKVA 2B69A 2POQX 3FNHA 3TSCA 2GNAA 5CDGA 5BSEA 5A9TA 4DLBA 2CVOA 4EEXA 1YDWA 1CQIA 2NWQA 3WQSB 4BB6A 3WS7A 3VOSA 3U62A 2JCXA 2C29D 4IDEA 1K6XA 3BMQA 2FSVA 4S1VA 1HDGO 4OHUA 4E3ZA 5K6AA 1N7HA 2D1YA 3FWZA 4GX5A 2OBYA 3LZ6A 4RQTA 1JW9B 4E5NA 4IZHA 4KQXA 1H0KA 4GWKA 2O3JA 1ISHA 2HRZA 3IQDB 3JQBA 3K6JA 5A4DA 1TT5A 5DP1A 3DFZA 1E1LA 3F9IA 1YQGA 5LDGA 3PGXA 3DOJA 5I9MA 2AHRA 2WE8A 3X2EA 4GKBA 4MJLA 2JCVA 3MEQA 4NR0A 4BNMA 1PL6A 4ND4A 4AFNA 2YHIA 5EMHA 4F45A 1KC1A 1P0CA 2FHSA 1Z75A 3NGLA 4FCCA 4AJPA 3GQVA 1E7WA 2IXBA 2VZ8A 4G65A 1ZVMA 1N9GB 3JQ6A 1B8VA 1RYDA 1WP4A 4W9NA 1SMKA 2Z1MA 1FDUA 3CMCO 5TX7A 3VZPA 3KYBA 3ROKA 4CLDA 3KO8A 4ZVVA 1LQUA 2V6GA 4BO9A 1JKJA 2VWQA 4UUMA 3H8VA 5EINA 4HUJA 4BO4A 4DMLA 4DPLA 2X4GA 3Q2KA 2UUOA 4HP8A 2O3TA 4D44A 2HMUA 1R0SA 4Y6SA 4CM4A 4CQMB 3GAZA 4FPXA 5DDIP 2DTXA 4WLUA 4L4SA 4QT0A 1HDCA 3AFNA 4IDBA 3F6YA 1XQ1A 3OIFA 3BMCB 2FY8A 1KETA 1O89A 2PH3A 1QLJA 1R4NA 3DWFA 3GFBA 2A9FA 3JQ9A 1HZZA 1C14A 1HF3A 4O0LA 1M6HA 3M1AA 5K9ZA 1H6AA 2VHZA 3WBBA 4BO8A 2QZZA 4U5QA 4B4OA 4I9NA 2OZPA 1BVRA 3ZNOA 3EZLA 3DHYA 2GZ2A 3DAPA 3FHLA 4L8VA 4MVJI 4XIJA 4XYMA 4BS9A 3DO5A 4R3NA 3DZHA 3EY4A 1F06A 3D4PA 2O7QA 1X0VA 1PGJA 2B35A 4Y67A 3GUCA 5TLSA 5EQDA 3P2YA 4CMGA 4CQMD 3RC7A 3OSUA 1YVEI 2X9GA 1CYDA 3OJLA 3Q2IA 5L7TA 4ZGWA 3O8QB 1CETA 3JQAA 1E3JA 1EFLA 5IN5A 1JVSA 3BYZA 3A28A 2X86A 4PG4A 1DLIA 1LLQA 1UZNA 1B26A 1ZK1A 3WQQA 4PLFA 4CMCA 4J49A 4ZN6A 3WGGA 1VL8A 3TFQA 4ZU3A 1I5RA 2CDCA 4YJFA 1Q1NA 2E82A 5JE8A 2CY0A 4LVUA 3W8DA 4DWVA 5JXWA 3TF5A 5ILOA 4JP3A 3RSHA 5A1TA 4UAGA 1P1HA 3LLSA 1J0XO 3MJEA 4UEOA 4FSHA 1I2CA 2P2SA 4FW8A 4XYBA 2W2LD 4QEDA 5ICSA 1HWYA 3LDHA 1WDMA 4ZQFA 5L53A 3HQ4O 2QG4A 3ENNA 4AG3A 1KBZA 5BSGA 2DVMA 4EITA 2O3SA 3DBHA 4G5HA 3FPLA 4UVEA 5KVVA 1MLDA 2Y1DA 2O7SA 3PDUA 1ISMA 1T4DA 3EDMA 4ZHSA 4U8GA 3PHHA 3P7MA 5DBGA 1U3VA 3UCXA 3WSVA 3DAFA 2VYNA 5CEEA 2G1UA 1X7DA 4MVJA 5CDUA 2VCYA 1TLTA 1ID1A 4OM8A 5TT1A 2YZ7A 4ZA2A 4BNFA 4GX0A 4I8XA 4I9HA 2I9PA 3QVXA 3KTDA 4PZCA 1B14A 4I5GA 5IDQA 1LA2A 1KY5A 1HKUA 4R41A 4MINA 1C0LA 3E5RA 3GA0A 2BF7A 3IMFA 3UH1A 1VE9A 4LCJA 2ZTUA 3D7LA 3K96A 4N54A 4XRRA 3U49A 4A5OA 4K6FA 2GZ3A 3AUSA 3DBHB 2FP4A 3DEYX 3WGOA 3SLGA 4DC0A 1IOLA 2H5LA 2IDZA 2VRCA 3E8XA 1MP0A 1MUUA 2CUKA 2X23A 5F3RA 1HE5A 3W8EA 1Y81A 3V2GA 5FWNA 1B15A 2YDXA 4YAJA 4LGVA 3R3JA 4AJOA 4RLHA 3OJ0A 3CINA 1F14A 2B83A 2D2IA 1PGQA 3GH3A 3R0IA 2OUIA 4CQLB 4J0EA 2VTEA 2V7PA 1V3UA 2TMGA 1H94A 4Z0PA 1PQUA 4KMSA 4IJWA 4IDCA 2JD0A 3ZH2A 4EJ0A 2H1SA 3DTYA 4ITUA 4X54A 4DQXA 1BXGA 2OHXA 1UP6A 1PS8A 2DQ4A 4W7HA 1OFGA 4NQZA 1ONPA 4WLFA 1DC6A 2FR8A 3VZQA 5B12A 4IM7A 3H9UA 5JLAA 1U3TA 5IAAA 2ZQYA 1DFHA 3DB2A 1KIFA 3A1NA 3UUWA 1ZH8A 4CV3A 1XWFA 2C82A 4XB1A 4YCAA 3B6ZA 5ENDA 1PJ2A 1R15A 3R1IA 4XZ3A 5G0SA 4DLAA 1A9YA 4KOAA 5L7WA 3OMLA 4I1IA 1XIVA 1Z6ZA 3U4HA 3IP1A 2QHXA 4QUKA 4BNWA 5IFLA 3WGQA 1DIRA 1X7GA 1ZEMA 5I7SA 2DBRA 3PIDA 1DPGA 1Y8RA 1A9ZA 3E9QA 4WNCA 3RC2A 3NYWA 1UDBA 1KVTA 4IZIA 4KQWA 2PZJA 3VH3A 3I9NA 2ZK7A 3ZWNA 2DM6A 1E3EA 5F1OA 4D43A 4CM3A 4YWJA 4RPJA 1PU2A 4M55A 3FBTA 1UXGA 3QWIA 3RJ9A 3LK7A 1B3BA 3S2IA 1M6WA 3SJUA 3U3XA 3VH4A 4KDFA 4BNYA 3WBFA 1GV0A 4CMBA 4QO8A 4K6CA 1PEDA 2WMDA 4R51A 4YB8A 4CM6A 1F8FA 3BTOA 2C7GA 1LUAA 2VUSA 2GF2A 2D5CA 1X1EA 4XQGA 4DA9A 4J91A 2F1KA 4B7UA 1S7CA 1WDLA 2JL1A 3OBBA 4AJEA 4CM5A 1ARZA 3GPDG 1JQBA 3LSYA 1Z82A 1DDOA 2JHFA 3ZWWA 4BVAA 2BFAA 1NQAO 3DZIA 3F4BA 2WE7A 3PXXA 3AI2A 5L7YA 3RQSA 3QVSA 2X1HA 2HSDA 1RWBA 3RU9A 3PHGA 5JSFA 3ANMA 4YJGB 2I99A 1U7HA 2PK3A 3LC2O 4GMFA 5JAIA 4J16A 2EJWA 4WEOA 2I6TA 1T25A 5I7VA 3K30A 4CM8A 2A94A 2NADA 1DB3A 3BIOA 3GR6A 4K9DA 1KEUA 1U1IA 5GZ3A 1NHWA 2FRDA 1PL7A 2Y1OA 4URFA 4EUHA 4OSOA 5A9RA 1MA0A 1LBEA 1WZEA 4IMRA 2Q2WA 5C5IA 2IYOA 3ZHZA 4F3YA 1LQTA 3JQDA 5FI3A 1FJHA 5JY1A 5KTKA 4BO2A 2HUNA 4CR6A 2Q46A 3ZU3A 1CIVA 1GUYA 1LSJA 1QXSA 2O50A 4NK5A 5DT9A 2HCTA 4DQVA 1YJ8A 1I36A 2O3RA 1DIBA 2OMEA 3JQ8A 3UXYA 4EBFA 2EGGA 5G2OA 3GVHA 1B16A 3ZWVA 5K0ZA 5EN4A 4GAEA 5T57A 5HBRA 5ITWA 5L3ZA 2WDZA 3UFXA 3WGTA 5A04A 5KVCA 4BQRA 3GNQA 1NVGA 1CRWG 2DPHA 3A4VA 1QKIA 1HYEA 1XCBA 3OIGA 3BMOB 1HE4A 3QWBA 4YBZA 1ZBQA 3GNTA 3PEFA 1EBUA 2YFHA 3FD8A 4H15A 3Q3CA 2FPGA 4RJTA 3C8MA 1U28A 4BGVA 1JU9A 3U9LA 2BFOA 3HZZA 5CEJA 1EQ2A 2VRBA 4BKUA 4WCFA 3AFMA 1B7GO 3F47A 2HU2A 2O3UA 3TWOA 3KETA 4QQRA 3RUFA 3NX4A 2Z1NA 2DUWA 4TKMA 3LF1A 2WWRA 1SZJG 3OQ6A 3LF2A 4NBVA 3O03A 3QY9A 3I4CA 4Q39A 1DAOA 3LLVA 4KWIA 4CUKA 5AXAA 3RUEA 3BMNB 3GVCA 3PIIA 1PL8A 3DZBA 4KWHA 2VYVA 1AGNA 1PGOA 5CHEA 1YOVA 2X8LA 4Q3EA 2EKQA 5AQ1A 1Y8QA 2D4AA 3G49A 4ID9A 3JTMA 4MVJE 1CERA 1I2ZA 4MDHA 2VT2A 1R0KA 2X5OA 3D1LA 3ONDA 3ZU5A 4CM1A 4JJGA 4HY3A 4R1TA 3WGYA 3ZHYA 4YAIA 3RUHA 1PZFA 1Q7BA 1GQQA 3OJFA 1Z45A 1HSOA 2EEZA 5IG2A 1J49A 3L6DA 3NTRA 3GGOA 3H6KA 3P19A 4WEQA 1I32A 1I3MA 4BHTA 4CL3A 4Q9NA 3VPXA 4W99A 3IP3A 2YHIB 4DIBA 4PLHA 5HWSA 3HSKA 3LU1A 4NU6A 1TXGA 1ZMOA 1BTOA 1SBYA 3TZCA 1FDSA 3DR3A 2PD6A 3ROQA 3LT0A 2CF6A 2EXXA 1GZ3A 2VUTA 4L73A 5JC1A 4G2NA 2JD2A 4Z6KA 5IJZA 2WYUA 1GTMA 3Q11A 3CMMA 2X0RA 3H65A 4CV1A 2YYYA 3QVTA 4OAQA 3FN4A 1F0YA 3ASUA 3H4VA 4NJMB 2WJPA 5TF4A 4BNHA 3I6QA 5A5EA 7MDHA 5JAMA 4MKRA 4TVBA 3ZNNA 5HM8A 3N74A 3I6IA 3AW9A 5G0TA 5JPIA 5DOZA 2Y93A 1FF9A 4GH5A 3WIDA 5MGBA 1HDXA 3BMOA 4WCDA 2R00A 5JMWA 3H5AA 1KEVA 4TRRA 2JJYA 1W4ZA 3VVBA 2AG5A 3Q9UA 1J4AA 4TRMA 2ZB3A 1GADO 3V1TC 3FSRA 4M89A 4FFRA 4RF3A 3ITDA 4GGOA 1D3AA 3HNPA 3C85A 4EDFA 1P45A 3ZI0A 3ONFA 1C1XB 3IUPA 5I8WA 4TMFA 1BDBA 3EZYA 3JYLA 2G82A 1I33A 4JCOA 2RHRA 2EGHA 2EKPA 2JCYA 4TSKA 4Z9XA 2C5AA 2AQKA 1DRVA 1HEUA 1YB1A 1Z74A 3NDIA 4RF5A 3IUSA 4CM9A 1WXDA 2JAHA 1NQOA 4XB2A 3AK4A 3ZGYA 2AQHA 3F4LA 3CSDA 5EESA 2WYWA 1H5QA 1ONOA 2J3IA 4GPD1 3ZWMA 3ITKA 1SCUA 2RBEA 1SOVA 2PR2A 2UYYA 2V6BA 3WMWA 1I3NA 4CM8B 1YQXA 4K1LA 3ZWBA 3BMNA 1GEGA 5BQFA 3JQCA 3GAFA 2BFMA 2I5PO 4I9UA 4NBWA 3RU7A 1I2BA 4GSKA 4BNXA 1GPDG 3HE3A 3UN1A 2X5KO 1SB9A 4ZRNA 3QRWA 3MTJA 3PJDA 5IZ4A 4IXTA 3EC7A 3ANNA 4QECA 1BRMA 1FDWA 4XCVA 3UGKA 3I5MA 3LT2A 4WJZA 5C3MA 5BNFA 3RKUA 3HFSA 4H3VA 5AYVA 5KKAA 3H9JA 3AY6A 1UJMA
chains in the Genus database with same CATH superfamily
3TZKA 3E9YA 3LM8A 3ONVA 3Q7SA 1CUSA 1YL5A 3LP5A 3QNUA 3NEJA 1I1NA 4PN7A 2JGKA 2QRJA 5BYKA 3PHJA 2IPMA 1JMKC 4TUYA 3H1PA 2ZBVA 2FN3A 3NONA 3MJVA 3MWFA 3QIVA 1QUFA 2CVPA 2PGDA 4I4LA 1WB6A 2FRXA 3HXKA 4U7GA 4E46A 3IRUA 1EVJA 3LDUA 4RHUA 4YAWA 2UXDB 1SEPA 1NYLA 2XQVA 4JYBA 5A71A 3AVQA 2PKRA 1JG7A 3GUYA 2P11A 4WZBE 5TARA 2FW7A 4DPMA 2D6FA 4GT1A 2XYVA 4XUDA 2ZB8A 5FPYA 2HO5A 2CLCX 1AM4D 3HU2A 3PRKE 4OHOA 5AH0A 4JQZA 3QP9A 3RBZA 4G1FA 3ONNA 3TMAA 3BK7A 4WBSA 4Y2JA 4L5YA 3ZGLA 4NJOA 3N2EA 3N8HA 4LKRA 3PPVA 4NDNE 1ZIPA 2C2XA 1A3CA 4NZOA 1O0CA 2FFAA 2BRUC 2V97A 3EFEA 2A33A 5IC4A 2FE4A 2YUIA 5LP6B 2OGWA 2FWMX 3OCCA 3WMGA 5AUPB 5FWDA 2C99A 4R7GA 3DEIA 5JO0A 2PU5A 1KYZA 2ZE5A 3GRAA 1QS0A 5K3CA 2F90A 2E4UA 2IDKA 2YMMA 2FZEA 2GFQA 3ABIA 3V4PB 4DFDA 3LKZA 3HL4A 3FZEA 5KJCA 2Y0PA 2P3LA 3LQKA 1YZFA 2A5FA 2OCKA 4DA4A 3FYCA 4IP0A 1ZJYA 3OFSA 1PYDA 5GQSA 2JGJA 1G2PA 2Q9UA 1TCBA 1O6FA 4OQXA 5CB6A 4G0MA 4E51A 3PTZA 2J3EA 3U39A 5HZMA 3OZSA 3K20A 1EP1B 3UNXA 2ZSHA 4QQNA 4X84A 3RVRA 4BJ3A 2HH9A 4A0SA 1GV1A 2AR0A 3LTNC 3EZNA 4HWSA 4I9GA 4HSEA 4UPEA 3ZKAA 3I09A 1CRLA 4CL0A 1SPXA 2FXVA 5CRIA 3CR7A 3D3WB 1DAFA 2BBTA 1Z2DA 2WSYB 2XAAA 5DGHA 3CG0A 4L1KA 1EE1A 5C46F 1NF3A 4QGAA 4MP3A 1MT0A 1GCGA 2ALJA 5IDWA 4G26A 4GR5A 3FGOA 2XMRA 3QKWA 4OCZA 4WVFA 3TOVA 5CBPB 2IEDA 3V4SA 1LD3A 2DB3A 1N5LA 2MMCA 1BVYF 1K6JA 2ID7A 1PD1A 2OHJA 4RPHA 2J0VA 1FA9A 3H2BA 5IM4A 3M1YA 4LJRA 4KQGA 4PW0A 4DLZA 2FLKA 1SR8A 3TVDA 3OECA 1Y5IA 2LWIA 2VYQA 2YBEA 1I1QB 3JD0A 3LC0A 4S2UA 3IA2A 3IUMA 4IQGA 5BUZA 3N53A 2BMVA 1NG1A 3VPDA 3SVTA 2NVWA 2BC9A 5ER6A 4YXWD 2DRIA 4LE1A 1G9SA 1GZ7A 2JJMA 3A11A 3TLXA 5F7ZA 2J7KA 4PYOA 3W77A 1ZR2A 2V0GA 2WKRA 4MXDA 1JI3A 3RV4A 2WJHA 3DMNA 2IBMA 2D1SA 2NZVG 1A0OA 2ASEA 4GVLA 4RH3A 4WXRA 1MB9A 4QOSA 4J6FA 2X8AA 1TUIA 1XDWA 1Y80A 3B60A 4O4LF 2ZQ5A 1ZO8A 4OK5A 4OMCA 3MFYA 4P53A 4M49A 4IYRA 3KKLA 2IUSA 3SNHA 1XEXA 3I52A 4Q93A 3RSOA 1VZ2A 1WDKA 1NAIA 2PCJA 2V8OA 5A3VA 1P2UA 2AHOA 4LKOA 3ZDZB 3R6GA 4BQSA 5H4HA 3T15A 3GEIA 3QLVC 3P2KA 4RVGA 4YRPA 4EPYA 4F4FA 2VTBA 1TFRA 4HNAB 1UQTA 3AC0A 3QXSA 1BSVA 4H6PA 4JI1B 2PTHA 2JJQA 4XEUA 1EFTA 3EHEA 4C87A 3T94A 1GZSA 4QEZA 5JT1A 3MGAA 2X6TA 2MIIA 2BHTA 4XYGA 3WRYA 4YXFA 3CX8A 5ESXA 1D2NA 1GA6A 3FI0A 4MUNA 5ALRA 4ZQBA 4YJ3A 3K70D 4LQ4A 2ZBEA 3PU6A 4RFLA 3VR5D 1I0ZA 1XR3A 4BDTA 2CXSA 4WA8A 1ZJ4A 4EI2A 5FNVF 3L4JA 2RJNA 2RBGA 3IODA 5E8RA 1COZA 1LC0A 3RT1A 1CUAA 2XDWA 1MGPA 4ESEA 2OP0A 3EGCA 2EJUA 5BW8A 2NXNA 1K98A 4MR8B 5K0CA 2P4EA 4I50F 5DK6A 1DOHA 3BMXA 4HVAA 1MFPA 1EIZA 3ZQ4A 3PYLA 3P71T 3CU5A 3A6FA 2WIBA 5ITVA 3ESDA 3KE9A 3RVJA 1FUIA 3OIDA 3HCFA 3ZU6A 1I1OA 5IXSA 3O31A 3WSWA 1E2DA 5JQGF 4IVNA 3UTDA 2EFEB 1N3YA 1QHNA 1W52X 1W34A 3GPBA 3IUNA 3NHJA 3L0IB 4D92A 2TYSB 4OHBA 2GCPA 1V8PA 7YASA 2WA1A 4N8DA 4HNRA 4QPCA 4A82A 3MXTA 1NATA 4QRDA 3UO8B 1A1SA 1H6BA 2HA6A 5LC1A 4WSOA 3BIXA 3DL2A 1U3UA 1SQSA 4OGLA 5C32A 4QT4A 3AZOA 2D59A 4BV9A 2PWYA 2P1ZA 3BAZA 3DWIA 4QU5A 3G9UA 4YK7A 5CLGA 2CV2A 2FWIA 2ZSAA 1W0JD 4KYVA 4RK0A 1E4VA 1CUEA 1E1KA 2E4VA 4EWLA 3QH4A 2OO7A 4XPIB 4ZU6X 1S1CA 3HFGA 3RFVA 1YC5A 4MPDA 4UBIA 1A4XA 4Q9HA 4HMPA 4FZ3A 1XMSA 2ZUFA 1NVVR 4MA5A 3RYCA 3U5ZB 1ISFA 4QC2A 3RU3A 3TR5A 2R6JA 1ZM7A 2VHXA 1GR1A 3V55A 3UWPA 4K9KA 3ZX4A 3G8AA 1D5CA 2XKAA 3OSZA 1M7GA 4RQUA 1G5PA 1J22A 4MEAA 1NOJA 1XQWA 2WZCA 3N5CA 3QWFA 4C2AA 1HYBA 2H2DA 4A2PA 1YRQA 4BUJA 4S0ZA 4YCSA 1QG6A 2DBVO 1JVBA 2MYNA 4RDCA 4XGKA 1YZTA 2ADFA 2XMGA 1T2EA 2GHQA 2JFHA 2ZUUA 1TKBA 4Q3BA 5AI5A 3ZXIA 1I6MA 1Q3HA 2N47A 1PO7A 1X6VA 1ZOOA 2HEIA 4QO7A 3A3KA 3CW9A 4JH0A 4MV8A 2FSGA 3TRDA 3VR6D 1MOZA 4TV9A 4J3NA 3KC2A 3R77A 4WGFA 2QX9A 2O1XA 2H07A 5CYFA 1MXFA 3U3MA 4PYMA 4YTEA 1LDYA 1L4MA 3OPNA 1OWMA 1YOBA 4JOBA 4Q7JB 4BO3A 1W36C 2WP8J 4MR7B 3VM6A 1QOQB 5CW1A 5BN4A 5DGCA 4YBRA 3ORHA 1PVOA 4NQRA 4OQPA 1VIYA 4BMNA 3AY3A 1ZFNA 3A1SA 1PZHA 1M5TA 4JC0A 4R5MA 4F46A 4WZBA 2X2EA 3GD5A 1WULS 1PLKA 1Y3AA 3JQGA 4LCBA 1WV1A 4EYQA 4R2IA 1RCFA 2J3LA 4F3KA 5E1BA 3LUGA 2KLBA 2WC1A 1HDRA 1XZEA 3O5AA 1ZA2A 1XEXB 5JI2E 1XVTA 2PVCA 3GT0A 1CFJA 4Q4DA 4XGNA 2H7CA 2OECA 2YN0A 3BC1A 5BSMA 4WLEA 3DBVO 3EQ9A 1XU7A 3T1OA 4MJ3A 4HXYA 3USES 3GRUA 5EIAA 1H4TA 1NJSA 2GI4A 1N8TA 3Q40A 3VJMA 4DMUB 5LLDA 1P77A 2R6AA 1KO7A 2ZRJA 1EEXB 2QIOA 5KYGA 1HUQA 5HUHA 4ETWA 2UV8A 4NU0A 1QV9A 2AYXA 2HY7A 4BEWA 1CUJA 3BD6A 3PFWO 1SPBS 2G9VA 3OFND 4A2CA 4HCJA 1YRAA 3RVSA 1D1QA 4Z7OB 4C7OA 4NZ9A 3VZRA 4CTJA 5BSUA 1V9SA 1MV5A 5CFPA 1SOWA 3G0CA 1M8KA 4K6MA 4BMYA 1FTWA 1LK7A 4C7BA 3OBIA 3QXXA 5FTKA 4Q3OA 2WT8A 4UULA 4BTEA 3E5MA 4XJTA 1V6AA 1IM5A 4XJSA 5JDIA 1CQIB 2VQ3A 3ZLTA 1K1EA 3V1UA 3AHCA 3D6HA 1MA3A 1YRLA 3C97A 5K6AC 1G59A 3RR2A 1XZIA 4P5DA 2Y1XA 1UJ6A 1POXA 1K7FB 3GP5A 1PR1A 4BNDA 2C9YA 4MYSA 5IAJA 4DEVA 4IUDS 3OZCA 1XC7A 4M8NE 5JVDB 4N82A 4C6RA 1AHHA 4CG1A 5I4KA 3VJRA 1L1RA 3QV1A 4GLFA 2BSQA 2B6NA 4DLUA 3EEBA 5DISB 1RE1A 2ZT7A 1Q95A 4JODA 5LDHA 2WZBA 1JR3E 3NBQA 4IL5A 2X4IA 3V8MA 4BCDA 4D4LA 4PBRA 1C7IA 4PGHA 4CF7A 2VH5R 3HO1A 4B44A 1HYHA 1WVGA 2B5OA 2X40A 2CXTA 1BHQ1 4RULA 3GRKA 1E94E 1U63A 1I01A 1O4WA 2JGDA 1LLDA 1TAHA 1X14A 3R6LA 2VIIA 1ZL2A 3EVZA 5DHUA 2QGZA 1MBZA 2XOXA 2H9IA 2BHLA 1UKZA 3Q85A 4C4AA 4DNQA 2C2OA 4INZA 5SZJA 1EUZA 2D1TA 1NLUA 2BGUA 5AT1A 5K8LA 3U5TA 4TVOA 1O6CA 1FDOA 2W0MA 4NV0A 4OQZA 3PE3A 1G7CA 3WK9A 5CA0A 3BDIA 1LPSA 5DCYA 1BMFD 1U2DA 4TLEA 3WWOA 5IH7A 1W4CA 2UUPA 4CEJB 2ZUTA 3NT2A 4XSVA 4BQFA 2G17A 3I9LA 2A7XA 4EW3A 3LRTA 2RGYA 2OAQ1 3OZXA 1Z47A 5F7XA 1AS3A 1V8DA 2WBLC 1ZJJA 1N78A 1ONSA 2E37A 1QM5A 1AURA 1PTJA 3K9QO 4YT5A 3MJSA 3CH7A 4XYLA 5JVDF 5J2TA 1E59A 3DE2X 2E6UX 3ZJVA 1Z4QA 3G0DA 4B79A 3R9WA 1ABEA 4Q37A 3KTFA 4JENA 3NEAA 1QAMA 4TMZA 1XLUA 3R7SA 4PIPA 3QMMA 3WIEA 3WBKA 2AOXA 3NVAA 4UTPA 2WG2A 2YXNA 3CLSD 2WJ4A 3PE6A 5IAGA 3WYDA 4QXOA 5I9NA 4IOMA 2YINC 2ZXFA 5DXFA 3C3PA 1KARA 3MWGA 2X77A 2OG1A 5E4JA 3TL3A 3ZY6A 4C4RA 5H9VA 4UNIA 4TSRA 1X70A 3BWMA 4NK4A 4QPZA 1NDUA 1WVIA 3COPA 3LVRE 4C3UA 4LSWA 1JKIA 3VHLB 5K01A 1JEYB 1TVKA 2D2XA 4J43A 3WE7A 1QU2A 1XCGB 4L15A 4IHKA 3ELDA 3SC2A 2LNDA 2D8AA 5ARBA 2DFDA 3EZ9A 1J5PA 2P6UA 3AW8A 1B93A 3N0XA 5E7MA 2XBMA 5U4XA 3ZHXA 3ZE6A 4L4RA 3RBXA 2Q1XA 1Q2XA 3BD8A 4PG5A 4WLOA 621PA 1HL7A 3UOGA 2RGWA 2YWEA 1SHLA 1A2OA 4OU4A 4FQ5A 1JR3A 521PA 1JZTA 2XV1A 2MYUA 1CKEA 1F9EA 2KSQA 1SRRA 1RZUA 3B7PA 3D6TB 4MS3A 2IOFA 3KLPX 4PCVA 4V3BA 4HAZA 3RRJA 4HV4A 4XWYA 3GN2A 1KSJA 2B6HA 3DE3X 1ECFA 3CO5A 5AW0A 4G85A 1R6XA 2C9CA 1YB4A 2NQ8A 3GFPA 4N7JA 5A9SA 3VXKA 1ZN9A 2JLBA 5KKCA 2IU0A 1U1DA 3V4OA 4FR5A 1GFWA 3EXG1 3M2PA 2PMFA 3IAS1 1Z6TA 2IIBA 2QYOA 3K05A 1OV4A 3GMDA 1P1IA 4S12A 3OZIA 1E8MA 4TZ0A 4JBNA 1H0SA 1LDNA 1CJKC 4UD6A 2GN9A 3SG0A 1NF9A 2VXBA 3HKBA 1WCYA 5DULA 1OFTA 2M98A 1DBRA 1TMYA 3A32A 3HRHA 3MINA 3WJ1A 4LF9B 2BRUA 1R5OA 2DJIA 2BFPA 4XCQA 4GWGA 1L4KA 2YV5A 3RT9A 4QUHA 3P9PA 2J9FB 2MSCB 3UG7A 4KC0A 3E3NA 2QQGA 5LBTA 2XTNA 2XSZA 4PZZA 4R9UC 3B8HA 2DHRA 2GVNA 5D3ZA 5FI0B 3ER8A 1TUBB 1OGIA 3KB8A 2JJ2A 3SF8A 4D2IA 2FEOA 1TU0A 2QRKA 5G3ZA 1D2CA 1HTBA 4X1OA 2C7OA 1DXQA 2N3ZA 4ZEMA 1PJBA 2AZMA 3RIGA 3ZZTA 4OLFA 5ALVA 3GPCA 2GQ0A 3A2NA 2BGTA 2ZUWA 3BUSA 3F74A 3IIKA 5DTEA 3VR6H 5CFZA 5IFKA 3E1SA 4CV2A 1EVYA 2KQUA 2DLNA 1CEXA 1VKNA 4HDNA 3L4KA 4JT4A 1JAIA 4C4PA 3O4JA 1E3MA 3T9DA 1XRQA 3QXGA 5CLHA 2I7TA 4PFJA 2Z98A 2C20A 1JZSA 3S7ZA 1QORA 3CISA 3H3FA 2PMBA 1IE3A 4IICA 4P3KA 3SZUA 4UUNA 3TQQA 3UCFA 2GZDA 5U9CA 1SKQA 2V3WA 4W5TA 2CBGA 3NNSA 1NZJA 1WBDA 3EDCA 3FUTA 2PA0A 4TVSA 3FTEA 3L0BA 1ZJ6A 4CTOA 2D4HA 2J0UB 2J0SA 2GPTA 2ZT8A 3L82B 1S6YA 3H2KA 3I1JA 2B8JA 2R11A 3JYPA 1I80A 5FQOA 2AG8A 2A1TS 3IESA 3P52A 5KC9A 2BI4A 2EG9A 2Z6VA 4W7IA 3S68A 2HWKA 1SG0A 3QLUC 5DKFA 5K3AA 9LDBA 2X22A 2AUTA 3HGTA 2QLFA 4EG7A 3OJCA 2Y1EA 3TVYA 4L3WA 4XRGA 4FWIB 4YV7A 5DV9A 3SMVA 5DSZA 4OFXA 1JGTA 3GLHA 4GBED 5K8TA 3ZPXA 1KZ4A 2D06A 4FHCA 1D1PA 5HQTA 1JLHA 4XTRA 1BDIA 1VCHA 1CUVA 3KHTA 3RC9A 3M4NA 2XHZA 3FWPA 4RZ2A 3PNBA 5J1SB 2BWJA 5JNTA 4Y6PA 4JLJA 4PZLA 3AYXB 1PT8A 4KE7A 4MB2A 2FEPA 2GUGA 3DUWA 4QX6A 5E1DA 5FOTA 1L5LA 2I62A 2ODEA 1VRWA 3X3HA 3WAJA 3O8QA 2JFYA 4OLJA 2LXNA 3P9KA 3K0EA 3FRIA 4S1WA 5C4GB 4NTZA 1DAIA 1E1YA 1MORA 3V7YA 1GCOA 1QIJA 1X80B 3F5MA 4A6EA 4UTZA 5EG5A 3CZCA 3L0ZA 4TYWA 3ZQUA 2HXGA 1T6ZA 3Q7TA 4CQLA 2VH2A 1BHO1 2O23A 4FMCB 1BCRA 3M1LA 4M22A 3JSAA 4EX6A 5AKYA 3K5HA 2RGAA 2FZLA 3H99A 3P5SA 3V42A 4CJXA 1YFJA 4HEHA 4K9QA 2ZJZA 2JNWA 3PLRA 2IYZA 3L6RA 3AU8A 1EBFA 4YX9A 1XZCA 4BNIA 2Q45A 2CVZA 5I3ZA 2HV9A 3O0DA 4CMJA 1RXIA 3NNNA 5BSFA 1VLLA 2PZ8A 2VUHB 4Y1FA 5KSYA 2A88A 2TRSB 5IVDA 2VBFA 3FVTA 2RGXA 3LQFA 3E7WA 1VPTA 3E35A 1TYAE 1Z7EA 2B7CA 3KJFA 3S28A 1Q7CA 3UY4A 1T8SA 4X24A 5B58T 2Q5LA 1CJBA 3HJAA 4DR1B 2RIPA 3MWEA 3WLOA 1UP4A 3HLKA 1QRUA 2Q6TA 5JO9A 4LY9A 1E6LA 4L8FA 5C8ZA 5P8WA 2DBQA 6LDHA 1DINA 3TNJA 2AS0A 1QPBA 1PG2A 1IZ0A 1QAOA 2Z2JA 3E7FA 4KNVA 5CIYA 4A2WA 4B6QA 4KZPA 1YASA 3VDQA 1YJQA 1I4WA 4WBNA 1N8KA 2VJPA 2PIAA 5FNVB 2EP5A 4Z9YA 1BA2A 3DXFA 4DMKA 1P9NA 4DDUA 1FTNA 1N9GA 1RXEA 2B36A 2FUKA 2IYRA 1PSZA 3KJIA 1Z7BA 4JBXA 4RIGA 5K8IA 3DJFA 1Y63A 2A9QA 4BNDB 1RM5A 2VI5A 3MOIA 4IKOA 4LSGA 3D7MA 2BD0A 5BSRA 4BFUA 1RXVA 3VGPA 1CUZA 5BR7A 4BLVA 1LXCA 3HDJA 1UPCA 4IXWA 2B7BA 2JD1A 5BPFA 2FWRA 4MLPA 4YR7A 1R6AA 1C30A 3WOHA 3WB0A 3SYTA 1NQTA 1IHUA 2PUJA 4JT2A 3B48A 4BCBA 4J0KA 4QOJA 5DLPA 1FFYA 3N0WA 4UUQA 2NVUA 2J87A 1ZZEA 5IT9A 1FRFS 3ONWA 2PZEA 4EJSA 1J0AA 3SBDA 5BURA 1JLLB 3OUZA 1NN5A 1W0CA 5AJYA 4DGSA 4F91B 2ZR0A 4LOIA 2WUFA 2P4UA 2G1AA 3T38A 4U2GA 3ZW7A 1UBEA 4AZVA 1E3SA 1WZCA 3HLYA 2DPLA 3TR0A 2ZS7A 2OZKA 1KY3A 3T5TA 1A9QA 1E1CB 1CQWA 1V7QA 3K09C 3E58A 3NKVA 4IW3B 2AEMA 1Z83A 4KPUB 4YRJA 4OUDB 4BATA 3KK0A 4BQIA 5I3CA 2JG3A 4QRIA 2P6MA 3I1YA 4H0CA 1P17A 4KQCA 1O95D 3ZCPA 3DZFA 4F2GA 2OMKA 3FMFA 3AR8A 3TEJA 4YRNA 2J85A 2JAWA 5C8XA 1G98A 1MRSA 4IJQA 4XM1A 5SYMA 3KX2A 4UMEA 1FBTA 2BEKA 2C94A 2E6KA 4DIEA 3PYXA 1C3JA 4QHTA 2ZKLA 4OYYA 1QRRA 3RC1A 3I5YA 3TRFA 4JP5A 3BXHA 1E0KA 2HNKA 3PJFA 1KJNA 5KNDH 1ECLA 4BFLA 1M2FA 2ZROA 4WXPA 1VBKA 2OBXA 4N48A 3M9XA 4C04A 3I2HA 2ZTMA 3GRZA 5LP6F 2GXQA 2ZWVA 2W4IA 1PWXA 2WWYA 1CRPA 1HT1E 1WPQA 3G13A 3H83A 1NBME 1E64A 1WXHA 1HBJA 3OZUA 3ID6C 4RSMA 3VKFA 2HBRA 2VDWB 3LBNA 2W5UA 2C54A 2C3PA 2OOSA 4LI3X 4BQOA 2YKGA 2VQ6A 1JLRA 1EUDA 2YFYA 1N34B 1AXEA 2QLLA 4JC8A 3EARA 5IZCA 4FCWA 1U81A 3FPGA 5ESRA 2GHIA 2AIRA 4LJLA 5DTIA 1L4EA 4XI9A 3U26A 5C3UA 1SKYB 3BWDD 4U3JB 2VTKA 2ZJ0A 3C3CA 1GG2A 1L1FA 1J5EB 1Y3FE 2PGIA 4WKBA 3P9CA 2V6MA 2B92A 2DWOA 2PG3A 5D01A 4CHTA 2NACA 4K46A 5BWLA 3AX6A 3LUDA 4YP1A 3AFIA 3GBPA 2BMFA 2JHGA 1RWPA 3N8GA 5IK2D 4BE7B 1TF5A 2QV7A 3B53X 1U8YA 2F4VB 3QVGA 5JD3A 4C0XA 3H3JA 3M5DA 2YXPX 4AG6A 1UZLA 5CVTA 1V4NA 2ORVA 1QVWA 3B38A 2G63A 4PLCA 4J29A 1X87A 5A5DA 1UBJS 5HF8A 5A5FA 3UENA 5FBLB 4WLNA 4EFLA 3MTEA 5JU6A 3E7PA 3TAUA 3RC8A 4WV3A 1OV6A 4UVGA 4I66A 3ROTA 1A27A 1H22A 5FBVB 1D2HA 1FNBA 3AUTA 1UPTA 3FYUB 3DVRX 3IAS6 5GJCA 5HDBB 2EJTA 3U3OA 3LWBA 1G8AA 3L7DA 1T4GA 5JSQA 4IG4A 3ZXYA 4AJ1A 2PJUA 3ZYCA 1YQWA 2Z3ZA 3QBTA 4Y9UA 3X44A 4DQKA 1X7WB 1OU4A 3F73A 2GPJA 5JECA 5FUYA 3OQOA 3JQAD 5JAOA 4YRAA 2HXYA 3S2YA 1JHMA 2DSNA 1V39A 2Y77A 1KEEA 2G40A 2H2FA 2WWHA 3H1GA 3NHLA 4JS0A 3RKRA 3UAXA 3MOSA 3L0DA 1OGYA 5BV2P 2BELA 5FRDA 1L5NA 4BV3A 2LBPA 4C88A 1EK6A 4M9UA 5FPPA 1ZRMA 1V3QE 6REQA 5LYJA 4BMVA 3UT0A 4LOHA 4YMTA 3VDXA 2EC5A 4CKWB 1D07A 2NAFA 1SUAA 3W4IA 3WMXA 3OPMA 2ABWA 4EKEA 4CMHA 5KVQA 2RHGB 3VPAA 2G83A 2IX9A 2SKDA 4KQ2A 2C4VA 1U0OC 4LOAA 3VU8A 5EJ2A 2IEZA 4RX1A 1SM4A 3D3JA 1E62A 1NFQA 1NUSA 2FMIA 5AW6A 3FLEA 4WH0A 4FOSA 3T3IA 5K7SA 3KOOA 4V0LA 1QC5B 5CNIA 2MT9A 4A91A 1UJCA 1OI7A 4OHYA 1E0AA 1MTZA 3R2JA 3DQQA 2QU8A 4MQUA 1ADYA 2ZJ5A 4JLWA 3RRZA 1DDIA 2UAGA 3D7RA 4JDPA 4RV4A 5F1KA 1YACA 3I3SR 5FYQA 2A8YA 3VR4H 2Q0SA 1R50A 4FU0A 2P5SA 4B3IA 3EAGA 5ERYA 2FZWA 4UM9D 4B43A 4F72A 3A6PC 2C9ZA 4LEIA 2BJVA 2P2DA 1N25A 2O5VA 2VHEA 4KGVA 4WNYA 5EZ5A 5AKEA 1QUEA 4DIDA 4ZYVA 1BGXT 3CJRA 1Z16A 5FOUA 2NVBA 4GYKA 4MIEA 4NZNA 4KOEC 3K92A 4ZAYA 5H16A 2HIAA 4HWGA 2HMYB 1HFWA 1GJRA 4RXMA 4JGBA 4O5AA 4XIYA 4MS4B 1K86A 1ZHFA 3H5OA 4F9TA 4YYZA 3I5XA 5HBGA 2HCJB 2P62A 2YWRA 4KXUA 1RQRA 4KK4A 4UHJA 4ZQHA 1UFRA 4UJ3A 2PGOA 4Z1MD 2O5CA 2CMKA 2GM9A 2VEDA 2WRZA 4LMAA 1J42A 2WFLB 2P3OA 4IEFB 1QP4A 2IBSA 2YYSA 3SR4A 5DCWA 4NDZA 1D2RA 5DBFA 5AW1A 4JOQA 4WZ6A 5EEHA 5TT0A 3UQYS 5EKDA 2MINA 1EESA 3RUCA 1TYEB 2R8EA 1P7YA 2QZSA 5BXQC 4Z1OA 2ISQA 5DGXA 3FOEC 1NXXA 1T0JB 2RH4A 1CZRA 2LRHA 1GQ2A 2IZZA 4I7EA 4ENWA 4UUPA 1ZRHA 2QJRA 2YIVX 1GZ4A 1OMOA 4DUGD 3PXEA 4EHDA 3ISJA 3MCVA 1AZLA 1NBEA 3FWHA 3PVSA 4EPVA 4FFLA 5CK4A 4Q9AA 4ATNA 1IHDA 2QZPA 3DE4X 4RFVA 2XOKD 4HMQA 4KYTA 4GPIB 3L4BC 1N75A 2RG1A 3WQRA 1ODJA 1KAOA 2F43A 4XD2A 3PNKA 4E1VA 3B1KA 3OCUA 4TWAA 2O8BB 2REBA 3QF4A 4UE2A 2JVJA 3VR2A 3AIOA 1ZUNA 4EEKA 1PX0A 1NBWB 1FSGA 3HCPA 4OL0A 1H1LB 1EM8B 2OFWA 2EL9A 2V54A 3NM5A 3OIWA 4RCVA 3HUDA 1GAWA 1CRZA 2IH5A 1E20A 1ND5A 3ILXA 2RK3A 4CMIA 5E7JA 2IZ7A 5THKA 3TNLA 4GX2A 3VO9A 3H97A 1TZJA 3TI7A 3ZE9A 3BWYA 3RG2A 1E66A 1V4VA 1NW3A 1XL1A 1CJVC 1ZNWA 3VTKA 1Z4OA 3IERA 1DJLA 4C05A 3UKOA 1WOMA 1YO6A 5KYXA 4JJZA 1N2OA 4RTNA 3OHSX 4MDYA 1GCUA 4G6ZA 4KIUA 3GOQA 4ESVA 3K70C 2ZRLA 5CU7A 1TW3A 2ATEA 5HA5A 5IM5A 5T8KA 4HBZA 4KXQA 3A14A 3MCWA 1O96B 1TNDA 1YSCA 2PO7A 2V7BA 3CUYA 3MC1A 3Q3IA 3T95A 3SFZA 5HQ3B 4V2IA 2H3EA 2G36A 1TVEA 1WSDA 2ZIXA 2VK1A 3PQ4A 5DWQA 4K81B 1DQRA 2ONKA 3F3KA 5BSWA 1RI2A 2HL6A 3OX1A 1B6GA 1LFAA 2HU5A 4NBKA 3EZXA 4YJHA 3ZGNA 4AMBA 2HNBA 3QF7A 2H63A 3LHSA 3KSUA 1Z6XA 3GG9A 4B5LA 4Z54A 4D96A 2IUEA 1QHHA 3MN1A 1UMDA 4MCAA 2W6ZA 5SZHB 3EXFA 2AV6A 4CM9D 5JD4A 2BN4A 3QNMA 1KR2A 3C3JA 3KJXA 4L0MA 3THWB 2Q4EA 1NX9A 4RDIA 5DNYB 2BCJQ 2D5BA 4G1BA 3HABA 3VU9A 4JIGA 1RXSA 3BK2A 3ETDA 3LW8A 4KPFC 4F04A 3M6IA 3HJFA 3KR0A 3UJDA 3WIUA 3O75A 1MEOA 4J2TA 3T41A 3O38A 5IF3A 5CVDA 3PGVA 1TMKA 3DBLA 3EEOA 1K9VF 3U7IA 4L5BA 3ZV3A 2H8GA 3JV7A 3LP6A 4G5XA 1C0PA 4DBZA 3G0OA 4MK4A 2C2YA 3BXOA 3GLQA 3ZCTA 3WYCA 2ZZMA 3C3WA 5A6SA 4ZJZA 1XGKA 1KQ3A 1NHGA 4I1OA 4AKEA 2E4WA 2C2KA 2F2TA 1JIVA 1G3RA 2AEFA 1MIHA 2XZPA 3EN0A 3ENWA 3O9VA 4FT4A 4WW0A 2UVPA 1J70A 1P4SA 3L1HA 2JGNA 5DHQA 4HGYA 4JXZA 1SHKA 1W8IA 5J5CA 4UAJA 3LPLA 4N6NA 3UOWA 5DRYA 3MS7A 421PA 3UZUA 3ZZ0A 3KJQA 1DEAA 4ZOLF 3CZ5A 2I66A 1SK9A 1TKAA 4TQ9A 2Z9CA 1W2HA 4MS3B 1UWVA 3CEHA 5E2AA 5CFQA 4AO8A 3CVJA 5K0BA 1JLKA 1SBQA 3L6UA 4P36A 2ZPUA 3FNEA 4DDTA 2WF8A 1DAGA 1NU8A 2YQZA 1QYWA 4WASA 4ZVNA 4DCUA 2C4WA 4GYWA 2IYYA 5J1TB 2IEBA 3PC8C 1S8AA 2J5KA 3HBAA 3IQEA 2Z2YA 4OHPA 4YFYA 2WJIA 4KEAA 2QDXA 2ZYDA 3SC2B 3CVXA 1U2PA 4O1MA 1RM4A 3VJLA 4X93A 3QUBA 4G0ZA 4K9MA 4Y30A 4F4JA 1B73A 4MO2A 1CY6A 4MI9A 3BZBA 4WADA 1RBZA 1E6MA 2Q8QA 2Z8YA 1II8A 4A8JC 5EMMA 4D3SA 1NR1A 1T6NA 1S2GA 2HRRA 5FO0A 3WC4A 2XB9A 3HMKA 4V0SA 4CLEA 3DM5A 3T7RA 1H4QA 3PS9A 2RHMA 3CS3A 2V1UA 2GJ4A 3GQBB 2WF5A 3E6AA 4H18A 3EUAA 3KZOA 4A6XA 4EF5A 4ETMA 4FGWA 5BPHA 1WU7A 2GERA 4UMVA 1O77A 4P08A 2IHYA 2XZDA 3GEPA 3OCXA 4TLCA 2IRWA 4PINA 1GZHB 1G4HA 4I50A 2PUWA 3AJ8A 5TC4A 1A77A 3B78A 2IKQA 3EWSA 5ALPA 4MRVA 1L7VC 3QKSA 2IV3A 4LGMA 3GFFA 1XRPA 2A35A 4G1MB 4BQEA 3N76A 4RA6B 2VDVE 3NOXA 5AUQA 1R16A 1X77A 1JDUA 4FYKA 3ZWDA 3NWPA 4B3JA 5FXMA 5DLEA 5A3SA 4HQOA 3GNLA 5IMBA 3UF0A 4B73A 4QNNA 3KJHA 5JBQA 4NONA 4KLAA 3RYIA 4GF5A 1F17A 3ENZA 4JKIA 5ALHA 5GOZA 2FPKA 5CLIA 1HDOA 2BI7A 2IPNA 4KQIA 1Y37A 4YRDA 4I4TA 4UDYX 5KYKA 2GBCA 2V74B 4OSPA 5COQA 3OPYA 4NEQA 5JD6A 1WCWA 2HDWA 4DQLA 4H4DA 4TTVA 2ZPAA 1V71A 2EBUA 4QJIA 5JS6A 1Z28A 3JASB 2N0SA 4J7XA 1XNQB 4NV1A 3I4FA 3MMXA 2ZEJA 1GN8A 3NP7A 4G4JA 1MFZA 3DMDA 4RVOA 1JDTA 1F51E 1FFGA 3HEMA 5AWFC 2OAEA 4I55F 4MWSA 3DC2A 4RENA 3F3SA 3KALA 1NW8A 1M6NA 1QOPB 2BFFA 2R6CA 3SE0A 1ZGJA 4WJLA 3R5HA 4OEHA 1DZ3A 3WB1A 1JSLA 5AW9A 3WJ7A 5FWAA 4AS1A 1ISGA 4OGGA 4IFIA 3V7UA 4CIXA 3AEUB 2ZYUX 3DTTA 3PDCA 3W6UA 1G41A 1M0SA 4EAAA 4KL8S 3U7FB 1NQXA 1UPUA 2NMVA 3PJGA 4RSRA 3F98A 4GU5A 4B87A 4EKYA 3KHUA 2GK4A 5HRUA 3LUCA 4LRSB 5T3YA 4CMKA 2ZGVA 3T4UA 1L7NA 5DJ5A 4P4SB 4D8TA 1LKZA 1ZNQO 1ZVJA 3ETJA 4JUFA 4X3CA 2OD9A 3P0EA 3V3KA 1PZNA 2QTFA 4UNQA 4YV1A 1NUUA 3FJYA 5K5EA 4BOYA 4B33A 3OFVA 4IIEA 4QJ3A 5CB8A 1MHTA 3DYVA 3ZU2A 2ZXEA 3IFSA 4O4JF 4N9WA 4D4IA 1II0A 2Y9MB 1HSZA 3W9BA 2XD9A 3HCCA 4E7PA 1BA3A 2PXHA 2ZUSA 3K73O 2DAPA 1RTKA 1DQPA 1IK4A 2WFAA 3CEAA 3GT7A 1TYCA 4JUCA 1P1BA 1KVRA 2W90A 1OZ0A 5F1YA 3HGMA 4FS3A 5ER9A 1ZG3A 2I55A 4XR9A 2FG6C 4ROSA 3S5JA 4O25A 3D31A 4KKVA 4WOKA 2VNAA 4RL6A 2UVQA 5JRZA 4TRJA 3OEHD 3TZHA 3VOBA 4ALJA 3ZD6A 5LFAA 3FPEA 3LBIA 1KAEA 3CPEA 3VUEA 4H7PA 5BQ3A 1KERA 4JYZA 3QHPA 4MWOA 3N0VA 3AJAA 3PI6A 3KHSA 4UCXA 1N0VC 5TGDA 3P0FA 3KDAA 1L4HA 2QZJA 4FFMA 1ZOIA 4P9NA 3OX4A 4V02A 4PFQA 1KQFA 1U9IA 2J9GA 1EXWA 2FWPA 3HXQA 3BH6A 3EBLA 1P31A 3T4XA 2OD7A 2RC6A 4O4JA 2AKEA 1PQPA 1NBIA 4PSVA 4G8JA 4NMHA 3N2GA 5E6UA 1A5ZA 4E07A 4EX7A 2BGKA 4MYTA 4JBWA 4V39A 2YZ2A 1HFEL 4N18A 3YASA 2VQFB 1WXGA 3PUZA 4V0ME 3TCNA 2FHPA 1ZM9A 5T4EA 3WGJA 4KZKA 1V8BA 5JJIA 4G3XA 1H8EA 1BXGB 2LKCA 2ZLBA 4GICA 2X3UA 4HB0A 4X0EA 4ALLA 4BJ6A 4NHEA 4ZAGA 1PLLA 1AOXA 2VSOA 3G17A 4UEWA 1YK1A 5BR4A 3C43A 4X45A 5DGDA 3Q3VA 1FX0B 4QGBA 1UMKA 2FZ5A 4G5YA 4HHEA 5ALLA 1EFVB 3ZG6A 3T06B 1XMOB 5JJKA 1D2AA 4Y0VA 3MLAA 4L2IB 3EOBI 1Y1RA 4RACA 1OXTA 5C8VA 1FNSA 2O6HA 3TGWA 4J0CA 3TTSA 4B5KA 2JH3A 1YFKA 3BCHA 3BRWA 5KREA 2HSEA 3NAGA 3ZY5A 3ADBA 2I2CA 2O6LA 3MJRA 1J25A 2QTBA 4MMXB 4C22A 3H6GA 8ABPA 5IP5A 4DCGA 1THZA 3A05A 4P84A 5DVZA 3VC3A 4MUJA 5BSVA 2PNFA 2V96A 5ICMA 2QMQA 4L28A 3SOZA 1ZI9A 1DBPA 1XI2A 2A5YB 2BFBB 3B7GA 1WMFA 1Y6QA 4RGBA 3AERB 4IR7A 3F3YA 4GQIA 5HKOA 4ZD6A 2NT4A 4B1FA 2WQZA 3GLTA 4U6SA 3W7VA 5HM6A 3DL4A 3RV3A 2R6DA 2H1OA 2RH8A 3AETB 3FPFA 3PX3A 4UM8B 1B42A 1TM3E 3H3XA 4G5GA 5EE9A 3KHKA 1VB5A 3FETA 3TIVA 3TFOA 1OAKA 1P73A 3QEKA 4HYQA 5B1HA 1DJPA 1DU4A 5T7BA 2YDYA 2C00A 4UM5A 1H2EA 4AC9A 2IOHA 3HWRA 1VIAA 4HWOA 4DG8A 5L6MB 3ECCA 5E6SB 2XXAB 4A27A 2PT9A 4UEQA 1YS2X 4KVZA 3DYIA 1GGEA 3A1WA 3QZUA 3UAZA 1WSAA 2PBLA 3I9KA 4TOIA 3TUIC 3GA5A 3QWAA 4LAFA 4UEJA 1P7PA 3HBLA 3WL6A 4C6SA 1L7PA 4OO3A 3AEQB 5BOSA 1Q0LA 3B9RA 5JDIC 3K0AB 3RVKA 1YBHA 3OTOB 1CZOA 1U0JA 2TMDA 1I4DD 3SSMA 2C4MA 1Q7RA 1Y7TA 3R5FA 4Q1AA 5DNCA 1DG1G 3R24A 1NI4B 3L6EA 2II6A 3E82A 3E3LA 4FTWA 2H92A 2XCQA 4KIWA 2QTGA 4UM7A 3AVTA 1XD2A 3PEYA 1DUVG 4JLVA 4OLHA 4DQ0A 5JSZA 1TQ4A 3PNSA 1WNTA 4NFSA 3LE8A 3V2HA 3QKTA 4YJGA 1Z29A 1CE8A 1YJ5A 3EOAI 3FDXA 5JAIA 3GLGA 4D0SA 2I6XA 3U44A 3JATA 5KNDD 1E2HA 2VYCA 3ZJ4A 4CKBA 5KDDA 5LA6B 2O2EA 2P6PA 1VTKA 1YAHA 3HXTA 3BEDA 4BZXA 3OPXA 4U0JA 3OM9A 3Q7RA 1PJ4A 5JXIA 4IMPA 3LWNA 2XOKA 3RJZA 1OH6A 1FP2A 5CFRA 1LPBB 4X5OA 4AQDA 4AIRA 1G55A 2WF9A 4YONB 2GN2A 2V7QD 3ITNA 1VPVA 4OLBA 2B82A 2JFNA 3K8ZA 1HPLA 1W96A 4YDSA 3GPLA 1MO4A 1GGVA 1KTIA 1TZKA 1CUGA 3EGOA 1A5TA 2C2GA 2DTEA 4LJSA 4LXYA 5JV5A 2RHJA 3NOQA 4MKIA 6YASA 1BX1A 4PHCA 1SAYA 3CGWA 5FJIA 4G2TA 4HGQA 1OD6A 2P67A 5EJ4A 1D03A 3LH5A 4ZDJA 4RV9A 5LWHA 1FJXA 5LOVA 4LN1A 4CF4A 4IIJA 4M0PA 2IGTA 3ACBA 5JH7A 1CUFA 1PTKA 1I4LD 1TM1E 2HWYA 4UUOA 3TOZA 5C8YF 5AFSA 2FZKA 2AXPA 4WTOA 1QYXA 1REQA 1QTRA 1EWTA 1P1JA 3CE6A 2F1IA 3DQPA 3M5WA 5A5VA 5B7QA 3RAJA 1VSVA 3ZJTA 1KK3A 5L3QB 5JEEA 1COWD 3WHLA 3OP4A 1A97A 3EDRA 4QTTB 3L43A 4C1NA 1CZUA 2FSUA 4BVGA 3ZUGA 2LP4Y 2A0WA 2XW6A 1C9JA 4OAPA 4BKPA 3PP8A