4I08A

Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
243
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1
total genus 88
structure length 243
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i08A00
2DAPA 1V3VA 1M2WA 2O3RA 3OA0A 4R1SA 1K6JA 1A27A 3HHPA 4BV8A 2NSDA 4GX1A 3UCXA 3MJ4A 2FZWA 5COQA 4DUPA 4GBJA 3GAZA 4NFHA 1PL8A 1LDNA 1QRRA 4FS3A 3ZWXA 4XRRA 4QX6A 4BNMA 4II2A 3WDSA 4IQ0A 5DOVA 4EZBA 1DXYA 3QVTA 3G0OA 2AQ8A 4B4UA 3L6DA 4J2OA 4IXTA 4MOWA 3HB5X 1ONOA 3AOEA 3GRPA 5KVQA 2I3GA 3TZ6A 4RF4A 1RYEA 1WW8A 2YFHA 4DVJA 1BRMA 2GRAA 1DFIA 4NPCA 4U5QA 2B0JA 1F06A 3GNQA 2E4AA 3ULKA 4HV4A 3KLMX 4DLAA 4DMLA 1ZMOA 2QX7A 3FNEA 1N8KA 1DAOA 3UH1A 1T2FA 4CMCA 4PZEA 1U5AA 2AG5A 2D2IA 1P1KA 2VHZA 3FTPA 2ZTLA 3PIDA 4BNTA 2X4GA 4KZPA 2VHYA 4ZD6A 4WJZA 5THQA 5A9SB 4R9RA 2RH8A 2QZZA 1DRVA 3CMMA 3OQBA 4JROA 1E7SA 1JKJA 2G0TA 2GERA 4PLTA 4DYVA 1WDKA 4PLVA 4E2ZA 3S2EA 4G65A 1Y7TA 3K30A 2C2XA 1HDRA 3EDMA 1AHHA 2AW5A 2IODA 4CR7A 3GEDA 1KERA 3UXYA 3PHJA 1YH3A 2BELA 1T1RA 1K0UA 2YHIA 3WX0A 5IXYA 2FMUA 4B3IA 2E49A 4E3ZA 2A35A 2NVBA 4LVUA 5BR7A 5DCUA 3E18A 3ENKA 4FBGA 1DSSG 4KDEA 2X5KO 4YB8A 5JSFA 1X15A 3RFTA 1FF9A 4BQRA 4I5DA 3WGHA 4ZJUA 2FWMX 4IQGA 3GN1A 3RJ9A 5KWEA 3JYQA 1N1EA 2HK9A 5HBRA 2FOIA 1VL6A 2P9CA 2EKPA 3AOEC 3LLSA 2YY7A 1EE2A 5L3ZA 1U8FO 1CETA 1C0IA 1UZNA 3Q0EA 1P44A 1SPXA 1JKIA 5EMHA 2VOJA 4OOFA 3H5RA 4PLZA 4YAKA 5B4UA 2X86A 3C1AA 3PFWO 4I9HA 3RUAA 2B36A 5A9TA 4AJNA 3GOHA 3A06A 4CMAA 4RVHA 4ITUA 3NKLA 4R16A 3WNQA 4GWKA 4LMPA 4LMRA 2ZYGA 4J0FA 3G1TA 4OXYA 3LLVA 3NYWA 4AJ2A 3Q3CA 5B4TA 4M89A 1QP8A 2O50A 3U9LA 3MTGA 3WIDA 3WQQA 1MG0A 1C1XA 4B4VA 4OL9A 3D5TA 1X13A 3EZLA 1RYDA 3BTSA 5JYEA 2X22A 1I3MA 3ON5A 1FMCA 4YJGA 4B3JA 4KQXA 3I9OA 3IS3A 3U49A 3F3SA 2GSDA 2JKVA 2E6UX 4NBRA 5KJ6A 5L4SA 4ZQEA 4Q3NA 2DU8A 4JQCA 1W0CA 4IJWA 4D7AA 3ITKA 4OSPA 3M2TA 1PJ2A 2GYYA 5TT1A 4Y98A 2RBEA 1GAEO 1T26A 2RH4A 2UUOA 3RD5A 4FFLA 2ZYAA 2NNLD 4MDHA 3BMCA 3RAJA 1PL6A 2IE0A 4Q39A 2DTDA 3Q2KA 3L6EA 2J3HA 5ER9A 4AL4A 1TA4A 1QYCA 4DREA 1CRWG 3VPGA 3DZIA 2X9GA 5JC8A 3ORFA 3E9MA 1H2HA 4J1TA 3H9QA 3DOCA 3OIDA 5T5QA 2OUIA 2G76A 2CFCA 2CSUA 1NPDA 4H3VA 3BMQA 3ZNPA 3E82A 3M1AA 5COBA 2ZTMA 4PLFA 5JMPA 5H82A 1DAPA 4GX2A 1NHGA 3ANMA 3QV1A 3DHNA 3KYBA 4CM6A 4CV2A 4CL8A 4D46A 1ZK2A 4XQ9A 5KJFA 1PIWA 3JQBA 5CPBA 3PJGA 1RKXA 2VHXA 2B4QA 4CL3A 4PN3A 8LDHA 4D41A 2Q2VA 1ZVMA 3QRWA 4KTVE 4BGIA 1ZNQO 1NHWA 3FF4A 4L9RA 4RV9A 2ZJ1A 3GC6A 1EMDA 3X2EA 4CQLB 4GGOA 4INAA 2DBRA 2WSBA 3VH2A 1UDAA 3GNSA 2YUTA 3GRKA 5JPIA 4HKTA 5TSDA 4XIYA 4XGKA 4Z0PA 3I6IA 2WJPA 1R37A 2P5UA 3LQFA 5IN5A 1AHIA 1X7GA 3ZZNA 1CERA 3WB9A 4AJLA 3I9LA 2GZ1A 1PQPA 1KEWA 2FN7A 1A72A 3OECA 3W6ZA 3IMFA 5C3MA 1J4AA 2WYVA 1DJNA 4CMGA 4QTZA 1D3AA 3CEAA 2EHDA 3ENNA 3OJ0A 2EV9A 1HF3A 3SBOA 3VDQA 5EQDA 1YOVA 2WMDA 1ZSNA 2ZB8A 3FRJA 2QYTA 5A3JA 3QIVA 4OMUA 3ANLA 1ML3A 3AU8A 3PTZA 4MVJD 2Q46A 4WGGA 2FRDA 3TZQA 2VYND 1YQDA 4LCJA 4NFYA 1PGOA 1P77A 4ZN6A 4BO3A 3JYOA 1OOEA 3BMCB 2CVQA 1SOVA 2OMEA 4BB5A 2Y0EA 3QVXA 2RHRA 4MVJG 4KDFA 3JQBC 4ZGWA 4DQVA 4TMFA 1B16A 1GADO 1P0CA 2YHUA 4DIBA 1PZGA 3N58A 4XCVA 3BMQB 4PG6A 3WOHA 3DZFA 5TS3A 4BNNA 2I99A 1F17A 1U5CA 2JFFA 4OSOA 4MVJE 4R01A 4JP3A 5DT9A 1JWBB 1AE1A 3KM0A 5C7IO 1RM5A 2X58A 1RM4A 1GCUA 1ZSYA 1YONA 3KSZO 1NVTA 2ZB7A 3A9WA 1T4BA 4R1TA 3OBBA 4RQTA 1IZ0A 5C7LO 3QQPA 3WSWA 2DPGA 2WYWA 4YXFA 4EEXA 2Q2QA 5JS6A 4UVEA 1EQ2A 5L51A 3OF2A 4XDYA 3PP8A 1YVEI 3ASUA 3I6QA 3KO8A 4L8VA 2HRBA 4BKRA 3RKRA 5AXDA 3L07A 4GVLA 4OH1A 4J4HA 4BNHA 1IHYA 3UAGA 3CH6A 9LDTA 3F1KA 1GFSA 4FR5A 1IYZA 5LDGA 4WK6A 4LVCA 1QR6A 7MDHA 2GASA 5L4LA 1RM3A 1ID1A 3ZU5A 1HE4A 3E48A 4F46A 3JYLA 2CZCA 3JQ8A 3JQCA 5JO9A 3C7DB 2O2SA 5FI5A 1YOVB 2HK7A 4I08A 1E92A 3P2OA 3H5AA 2A94A 1RWBA 2NQTA 1V35A 2PR2A 3PFFA 4NBWA 3HB4X 3QWFA 2PWZA 2V6GA 4A10A 1HDGO 1VRWA 1R4NA 1UXKA 1IULA 4WCDA 3TDKA 1LU9A 3IQDB 1ISJA 1QKIA 5G4KA 3HN2A 3ONDA 1OC2A 3PYXA 1J49A 4QT0A 3ST7A 2C29D 2D8AA 4ZICA 1Y5RA 2Q1WA 4NG5A 1TVEA 2B83A 5HA5A 4DGSA 3NRCA 3FTNA 3GPIA 3KEOA 3LC2O 2UV8A 2PD6A 3H5NA 3ZWAA 4NJMA 1BDMA 4NIMA 3STHA 2NTVA 1WLYA 3CE6A 3H9EO 5A3VA 4CR8A 1NFQA 2O4UX 4YQYA 3GT0A 3ZW9A 4BO2A 2QHXA 3ZU3A 5CDGA 1WPQA 1C3VA 4ESOA 4S1VA 4GL4A 1HDYA 2BI7A 1UXHA 4FJ0A 4YRAA 4CM5A 2Y1FA 3IJRA 1V8BA 1PR9A 3LYLA 1H9BA 2PK3A 1GEEA 1X0XA 4R9SA 4A7PA 1X7DA 2FPGA 1XA0A 4URFA 4CLDA 3ZWNA 2YQ5A 1RJWA 3PJEA 4AJKA 3MJCA 3NGLA 4QO8A 4IJKA 3RIHA 1HYEA 3GUYA 1E7YA 3DC2A 1WXDA 2W2LD 4Q3CA 4PCVA 5ICMA 1H93A 1V9LA 4AJ1A 3Q6IA 2ZK7A 1XU9A 5I9NA 1PGJA 3RUEA 2ZJ0A 1EZ4A 4E2WA 3JQ8B 5DF1A 4EYEA 1KVQA 3C85A 2X0JA 3ROKA 3PWKA 3BTVA 1K3TA 1B3RA 2I6TA 2Y1EA 1VPDA 3ZN2A 1KC3A 1SC6A 1VL0A 1HTBA 2EKQA 3E8XA 1R4NB 3FBGA 3ZDFA 1U9JA 5JCXA 2VZ0A 3S2FA 2JJYA 4U6QA 1H6AA 3ZW8A 4MVJP 3L0DA 4L74A 3W8EA 3PHLA 4JP2A 2WE8A 1B3BA 2OBNA 1OFGA 3FWZA 3DEYX 4JK3A 1E3JA 1H6CA 4BMNA 2JAHA 4GKBA 3MJSA 1GUFA 2DQ4A 3OSUA 1N9GA 1X14A 1R0KA 1EUCA 2EF1A 3I1JA 2D59A 3LK7A 3QY9A 2GN9A 3WGYA 5CP8A 4MVJA 3NTOA 1UDBA 1WVGA 4NJMB 4RPGA 1I32A 2VYNA 4XD2A 4PLHA 3U4IA 3GVXA 4LSWA 3ZU2A 2GPTA 3OIGA 1MP0A 3VTFA 1OAAA 2C5AA 2XOXA 1XDWA 2EP5A 2X0RA 3C7AA 4BO5A 3DAGA 3EGOA 3INGA 4MIYA 4YRDA 5KTKA 3H65A 3ZU4A 1X1TA 2P4QA 4J0EA 3UF0A 3WGTA 2G1UA 1IHXA 2B5WA 3DMYA 2Q3EA 1BG6A 4CJXA 5HM8A 1F8GA 1P9LA 4EGFA 1DFGA 1PGNA 4BO0A 3H6KA 4PRLA 3AW9A 5CG2A 3D4OA 4D0SA 4PRKA 4N5MA 5IXSA 4DBVO 5DP1A 3HFGA 2OO5A 3D4NA 3L6OO 3HDQA 1BXGB 2PA3A 2Q45A 1NQOA 2D3TA 1AUPA 3WG9A 4WECA 3ABIA 2OORA 3TL2A 3QSGA 5BNTA 1EFLA 1WAMA 3O38A 4QFDA 3BYZA 3K96A 1HXHA 4CLRA 1OMOA 1Q0LA 2FY8A 1LTHR 4RF2A 4WLNA 2WTBA 3ZWPA 3WXBA 4CLXA 1VJ0A 2ZATA 3JQFA 4IDFA 5CDUA 5GMOA 3H3JA 3OQ1A 2AEFA 2BFOA 4HFMA 3FR7A 1FDSA 1T2EA 1QG6A 1E6WA 1K2WA 2JL1A 1DIGA 1K5HA 5I7VA 3U4CA 1D8AA 4BHTA 3T4XA 1KEPA 1BTOA 3V2GA 3KETA 1U2GA 2VZ9A 1YDWA 3GDOA 4MVJH 1U2DA 1N9GB 4R5MA 4CLHA 1TI7A 2HMWA 3H2SA 4D3FA 1F8FA 2Y67A 2F1KA 1PJ4A 3IP1A 4BNYA 2NM0A 2VT2A 4FC7A 5A05A 5CDYA 4N5LA 1I30A 1VSUA 1BDBA 3GHYA 1PJSA 3WGQA 2HO5A 3LF1A 5CPFA 4Z9XA 3WMXA 3WNVA 2I9PA 2NU6A 4NDNE 3PI7A 3R1IA 4NR0A 3KXDA 1DBVO 2J6IA 3BMOA 2I5PO 4YBZA 4WOKA 1I8TA 2Y1GA 3A4VA 3AUSA 3K8ZA 4ZRMA 2JHFA 1UH5A 3HUDA 4IXWA 4UVGA 2H9IA 3QP9A 4E12A 3AOGA 4R68A 3RROA 3PJFA 2IXAA 2FPIA 5JAIA 4YAIA 4TROA 3GZNB 2JCVA 1MFPA 1SMKA 2HU2A 3JTMA 3VPSA 1MFZA 1M66A 5T57A 4ZVVA 1GQ2A 3T7CA 1LDMA 1K89A 1BHSA 1KOLA 3F4LA 4MIOA 4CLOB 4WNCA 3JQFC 3MJVA 4D79A 1QORA 4LSMA 1NAIA 3A28A 2PD4A 2ZQYA 2C5EA 4DMMA 4XGNA 1ZKMA 4E2YA 4CLRB 2WD7A 1MV8A 4OXNA 2HSDA 4J43A 4GH5A 3SX2A 4DQUA 3KTDA 3G79A 4RPHA 1C0KA 1U3VA 4NK4A 1KVTA 3LSYA 5BSHA 1O6ZA 4WPGA 3OFSA 3I9KA 2UVDA 2W2LA 2YDXA 1AXEA 1R0LA 4P8RA 3UN1A 3BIOA 4WLUA 4GKVA 1EE9A 3ETGA 2X0IA 2DVMA 4ND1A 5HTOA 4AJJA 1OZAA 4GVXA 3C7CB 4EUHA 3GK3A 3W8FA 2XAAA 2NTNA 4HNHA 3VZPA 4KP7A 3S2IA 2NV6A 1DC3A 2X9NA 5DCWA 3WGGA 2Q49A 1DC5A 1V0JA 3IIEA 3ONEA 2W98A 1GU7A 1E5LA 1MXFA 1U1IA 5FYDA 3IDSA 2Q4EA 1Z73A 1EDOA 2JD1A 3K92A 4F6LA 3AFNA 4BKOA 3RUDA 1XQ1A 3VDRA 2EEZA 3QA9A 3RUIA 2UDPA 4AG3A 4JBHA 4HX5A 3BMOB 3LT0A 3K9QO 3FPLA 3ZGYA 4R54A 2ZB3A 1NX6A 2BGMA 3GEGA 2ZTUA 4Z9YA 3PXXA 3UHAA 3AUTA 2OGUA 4FJ1A 3CZRA 1A4IA 2CY0A 2PZKA 1NYTA 4OKNA 5I9MA 4Z3DA 2GD1O 1Y8RA 2YV2A 3JQEA 2EIHA 3RFXA 4FD3A 1I3NA 4XJTA 3LT4A 2VT3A 4O59O 1ONNA 2BH9A 3JCZA 4OHUA 1GPJA 3H3FA 1GUYA 4TKMA 1V3UA 2FR1A 1ENZA 1MX3A 3HQ4O 5EIOA 4DXHA 1ARZA 1HL3A 4X54A 1HE5A 1SAYA 1DIRA 3PHIA 2TMDA 1FDTA 1R4MA 3DTTA 4GPD1 4WLVA 2WD7B 4OJNA 1V6AA 1ZSVA 4BNXA 3FWNA 3V1YA 1P3DA 3TOZA 5BQFA 2CDAA 2IZ1A 5H83A 3AU9A 1NQ5A 2NADA 3Q11A 3NV9A 4ONEA 1FXSA 4E6PA 5KKCA 1FJHA 2Y0DA 5L95A 5KNLA 4NU5A 3ZWOA 3VH1A 3PQFA 3V1UA 2XXBA 3SXPA 5IZ4A 1A7AA 1Y9EA 2Y1DA 4TRJA 5BT9A 1ZUD1 1HDZA 3P2YA 3PK0A 1VJ1A 3ZWYA 2SCUA 3GVPA 4KUHA 5CFZA 3TFOA 2X1HA 4LCEA 1KEVA 4CM7A 3OMLA 1JW9B 1UDCA 1DC6A 4RDHA 5IDXA 3U5TA 2OXIA 3F5QA 1Y5MA 1EUDA 3JYPA 4YAEA 1QLJA 3EK2A 4MO2A 5FFFA 1A4UA 4XA8A 3DWFA 3LU1A 4MP6A 4R1NA 1MLDA 1E7MA 1YKFA 3QVSA 4RLSA 2EERA 1E1MA 4M87A 1YS4A 2A9FA 2O48X 3GZ4A 3QWHA 1HKUA 3UCEA 2PV7A 1LJ8A 2PY6A 3WICA 5L7YA 5TJHA 5CDSA 5DP2A 4B8ZA 4B8WA 1B0AA 1Z45A 1J0XO 1EK6A 2PGJA 1EEHA 2NQ8A 2PTGA 4LGVA 3KRTA 2D5CA 4MVJM 4IM7A 1Z7BA 3GHHA 2IZZA 3VVCA 2HMSA 4O6VA 2V7PA 4FW8A 1Y8RB 4JX8A 3UGKA 3JD1A 1DHRA 4NMHA 3ZWVA 4CM4A 2GUGA 3ZHYA 5I8WA 5FEUA 2DTXA 5F1OA 3F1LA 3FNFA 4CUZA 1SNYA 2X6TA 2AQIA 1EDZA 1YWGO 3R3JA 3CXRA 3D5QA 3Q9UA 1OI7A 3WR5A 5G0TA 3I83A 1H5QA 4NJOA 3ZCXA 4CQLA 3G49A 1B15A 3WWYA 5A4DA 2BFAA 3OJEA 3TNLA 3WGOA 4JLWA 2AMFA 1R4MB 3LF2A 3TZHA 2VRCD 3WJ7A 3MTJA 4D0RA 1HSZA 2XF8A 1GL3A 3HSKA 3PYMA 4IBOA 1LX6A 2A92A 4IGEA 3DO5A 3WBFA 2X5JO 3RASA 3KSUA 1GYRA 3BMNA 4LK3A 3WQRA 4GMFA 5TF4A 3RVDA 5KOIA 1E5QA 4FGWA 1I33A 3GGPA 4N54A 2LDXA 1E3IA 5B4VA 3U0BA 3KEQA 1BVUA 3FNHA 1KC1A 4YWJA 4GX5A 1ADCA 5CEJA 1GQQA 4XRGA 4AJEA 4BO7A 4JBIA 5G2OA 3WLFA 2EGHA 1LLCA 1PS8A 5L40A 3KYCB 1UR5A 5JY1A 4FFPA 5B12A 5GZ1A 5LDHA 1B8PA 3WGIA 4P4GA 4CV3A 1VKOA 3E6AA 3DHYA 5G0WA 3AUAA 4ZQGA 1JWAB 4DIFA 4B7CA 3INRA 5F21A 4W82A 4DIOA 5CHEA 1LBEA 3DOJA 4MKZA 4C7KA 4DTIA 4AFNA 2C0CA 2C2YA 3QHAA 1D1TA 1DDOA 2EXXA 3WFIA 3H7AA 4ILKA 1LLUA 5CEFA 4A5OA 5EL0A 4MINA 3I4CA 3K2EA 5COAA 3PWSA 1IE3A 4JIGA 4WNIA 1NR7A 1U4OA 3CKYA 5L53A 3WWZA 3JD2A 2VWHA 2WDZA 1O8CA 3RFVA 1YQXA 2PLAA 4Y6PA 1IOLA 3BZUA 4UEJA 2P91A 3RCBA 2JAPA 1I3KA 4CM4B 1UXGA 1R16A 1NM5A 3MWDB 5GY7A 1ADGA 4UULA 2PNFA 1NNUA 3ADOA 2VNAA 3AI2A 1KS9A 4QFCA 1EUZA 3JSAA 4XB2A 3L9WA 4ID9A 2BMAA 4MP8A 3NT2A 4Y9DA 4E5MA 2FSVA 1YO6A 1T2DA 1CQJA 2P68A 3DMTA 3GQVA 3ADPA 3LVFO 3VC7A 2PGDA 3UW3A 4WASA 3TOXA 3TQHA 4DRYA 2TMGA 5J23A 4QEDA 1N1GA 4K28A 3BMNB 1FDUA 2WWRA 3EY4A 1TLTA 3MJEA 2J3IA 4WLOA 4B4OA 3NTRA 3PLNA 4UUMA 2YW9A 3TWOA 3E5RA 3GR6A 1YL6A 2VOEA 4AVYA 5TT0A 2Z1MA 3OA2A 1DLIA 1GY8A 2CF6A 3ONFA 3FD8A 2J3KA 4B7XA 1O95A 2QRLA 3KYDB 3TZCA 1ZCJA 1E6UA 3I9JA 2QYSA 4CMKA 2AG8A 2DFDA 5CAEA 4NBTA 4LN1A 2OFPA 5IAAA 1BMDA 3EMKA 4GQAA 2QQ5A 4RL6A 2CMDA 2LDBA 3VAZA 1HWYA 4CMEA 3WS7A 2BD0A 1LDBA 3G1UA 4R3WA 2AE1A 4J9VA 3R3SA 3MOGA 3VPXA 3WTCA 1T24A 2PD3A 1JKFA 1KETA 1F14A 1IB6A 2VTEA 1B7GO 3DZHA 3W4JA 1SO8A 4BKQA 3DFUA 1GQYA 1PX0A 4QSMA 2Y99A 1K6XA 4HBGA 1U7HA 3B6ZA 1EQUA 1NPTO 3GGOA 4J2HA 1JAXA 2EJVA 3MJTA 3E03A 3AI3A 4CMIA 4E13A 3RC7A 4G5HA 2I65A 2H5LA 2OP1A 3FCOA 3JQAD 1Y1PA 1VJTA 4IZHA 2IXBA 2VQ3A 1MA0A 5IJZA 5JY6A 3KUXA 1NBOA 3A14A 4Q3AA 1HE3A 4HFRA 5JLAA 1GZ3A 1LRKA 4KMSA 3C8MA 3DFZA 2GN8A 2HK8A 4BOYA 4YT4A 1PTJA 1VE9A 1CEQA 3GGGA 4J1NA 5IDQA 4J7CA 3FSRA 1ZK0A 3HNPA 4A2CA 2NVUA 2J5RA 1PEDA 3OEWA 2BGKA 3F6YA 3GH3A 2DFVA 1H6DA 2CUKA 2Q2WA 3ROMA 1NPYA 2OZPA 2O23A 4RJTA 2I67A 4ZQBA 4JNKA 1WZIA 2E37A 2P5YA 3IOYA 5TGDA 3GF4A 3OJLA 1DIBA 3NEPX 1QYVA 4CMEC 1HETA 1DIHA 1P0FA 4BO6A 1JVBA 5ENVA 4CMHA 4B3HA 2VCYA 2HUNA 5ICSA 2VRCA 2X8LA 3WTBA 3S2GA 2CD9A 4PLPA 1A71A 1JA9A 4IDDA 5U4QA 3AUUA 1H9AA 1Q0QA 1E77A 3EUWA 2GR9A 4O0LA 1ENYA 4U6SA 3MOIA 1AN9A 5A5FA 1SZJG 5GZ6A 1XQ6A 5HS6A 3KHUA 5B37A 3BHIA 3U62A 1I0ZA 2DUUA 4C7JA 2NTJA 3AK4A 3TL3A 3B20A 1NXQA 2EGGA 2GF2A 3NX4A 3PZBA 4CODB 1G0NA 3UFXA 5I9LA 1KVRA 2PFGA 4M8SA 2OL4A 4R51A 5EESA 3SC6A 2IRWA 1R66A 1SEPA 2D1YA 3KB6A 2F00A 1LLQA 1YQGA 4GGPA 1DFHA 4DBZA 4CMIB 3D7LA 1PU2A 4E4YA 5C37A 1PJCA 1HRDA 3HZZA 4ZRNA 4Z0TA 4AJIA 4D3SA 1R0SA 3C24A 1A9ZA 1E0DA 4OAQA 3T4EA 5JE8A 2R2GA 4KQWA 3GDFA 4TZTA 4XEHA 1L1FA 3PGXA 4PG5A 4XJSA 4J4TA 4Q3DA 4E33A 2NVUB 5T64A 3W6UA 4MPDA 1QYWA 2NWQA 4BGVA 1RPNA 1JTVA 1P45A 2G5CA 4GWGA 3PGJA 4IDGA 4BNVA 1BXGA 1TT5A 1IPEA 1KY4A 2JD0A 1S6YA 3F5SA 1JVSA 2B37A 4NFSA 5K9ZA 1SB9A 1YDEA 4XR9A 4XYBA 8ADHA 2I3AA 1FK8A 2BRUA 2VUTA 3NDIA 5ILOA 3KOUA 3N74A 4BUCA 2QIOA 5KVSA 5JCJD 4MKRA 2HAEA 3T7EA 3EW7A 1DIAA 3PYLA 2JD2A 3ETDA 3AJRA 4YT5A 2PKQO 3RKUA 2X0NA 1H94A 4H15A 3GAFA 1UXJA 1I3LA 4D45A 4DQXA 1YB1A 1O0SA 2QG4A 4EI2A 4YAGA 1VKNA 3FHLA 3ZV5A 1IPFA 4BQPA 1ZK3A 4CMJA 4K6CA 4XQEA 1PZHA 4ND2A 5TC4A 3O03A 4YA6A 4GI2A 4C4OA 2P9GA 3AM3A 1H6BA 4YJHA 4JN6B 3VH3A 4BKPA 4JGBA 3PQDA 1DEHA 4RF5A 4YCAA 1O89A 2Q1TA 3CZMA 3KVOA 1DC4A 1YBVA 1XHLA 3RBXA 3CUKA 4FB5A 4R5HA 4IDAA 4UEOA 1PL7A 1ONPA 4RVGA 4WUVA 1L7EA 3NDJA 2Q50A 1C0LA 3P5SA 3C1TA 3WYBA 2DUWA 1YL5A 2Z1NA 4L0QA 4Z3KA 2QZ9A 2FPPA 1HSOA 3GG2A 1G1AA 3KBOA 4WLEA 4U8GA 2P2SA 4WE3A 2Q4BA 2E82A 2OBYA 4IIVA 1HYHA 3O8QA 4Y8VA 1Z6ZA 2QW8A 2B5VA 1T2CA 4P4LA 3GZNA 3D4PA 1HLDA 3DB2A 1PZFA 3K31A 4QXMA 3VKVA 5DDIP 4ALMA 6LDHA 3JQAA 5KIAA 3TPCA 4E5PA 2CDBA 1HDXA 4CLOA 4XWYA 1TT5B 3V1TC 1IUKA 4ZQFA 1NFRA 3ZWBA 4GX0A 1E1KA 1T25A 1ZJYA 2W90A 2YJZA 4XYMA 1E1NA 1R15A 3OJOA 5EPOA 3RC9A 3RQSA 4IMRA 4M54A 5F5LA 3C1OA 4RF3A 5JNLA 5EERA 1WDMA 5A04A 2G82A 3GDGA 1ISFA 4PG7A 4G2NA 4IJVA 4DC1A 3NJ8A 2FSSA 1NQTA 3ZV6A 2NLOA 3GUCA 3DTYA 3VKUA 4XQGA 2V6FA 4YT8A 2VNSA 4F3YA 4YJHB 1EK5A 4I5GA 3UVEA 4FN4A 4TZKA 1MB4A 3PJDA 2Q1UA 4XX0A 3WMWA 1ZZEA 4FSHA 3AWDA 1QMGA 2H63A 1KBZA 1EBFA 4E21A 3JQDA 2QRKA 3W4IA 3IL2A 1GEGA 4YJFA 3IKVA 1PSDA 3GMSA 4BNJA 4P38A 5F1PA 1FDWA 2DBQA 5T67A 1DOHA 3BHJA 4OGWA 5F3RA 4F45A 1A7KA 1CWUA 5LC1A 2J5QA 3NGXA 1K6IA 2IEBA 4TVOA 4AJPA 5JO0A 5MGBA 1PJ3A 2B4RO 4DL9A 1LRLA 2IEDA 2WD8A 5DOZA 4YEDA 1XWFA 1P33A 3O8QB 5ER6A 1R12A 2HJSA 3TF5A 4QQRA 4DPKA 2IYPA 2YQ4A 1GR0A 4P22A 3SLGA 1P1JA 4ZA2A 1OC4A 1GD1O 1KY5A 5JBIA 4BMSA 3JQAB 3H9JA 3DQPA 3B1FA 5ITVA 6ADHA 2WYUA 1U4SA 1UXIA 5DULA 2O3TA 3DDNA 4FDAA 2ZCVA 1HZZA 4CQMB 1F0YA 4GAEA 3O26A 4Q3BA 3PEFA 1GZ6A 2AXQA 4RO0A 1I2BA 4J4BA 1MC4A 1XU7A 2AQKA 3DHEA 1LDYA 2XXJA 3L4SO 1ZBQA 2Q99A 4FGSA 1XR3A 3MCVA 4BV9A 5F5NA 3W1VA 2R00A 2IYOA 4IDEA 1SCUA 4J91A 1LC3A 4FFMA 4EEZA 3RUFA 3I52A 4NBVA 5KJEA 3ZNQA 4K6FA 4RDIA 1R6DA 2I76A 4TRRA 4XKJA 3QWAA 4WLFA 4I9NA 1P74A 4I1IA 3SJ7A 1IZ9A 1C1DA 4XGIA 3AY6A 2HJRA 1NASA 1Z74A 5EQFA 2J5KA 5F1KA 2AA3A 5I7SA 3TJRA 5JCJA 5DZSA 5BSGA 5AXCA 2Y05A 3ZHZA 4OKIA 1MG5A 4OQZA 2J3JA 4W6ZA 4HP8A 3VOSA 4WKGA 1NVGA 3OIFA 5JMWA 3F47A 3U09A 2Y93A 3DAFA 3L9XA 3NUGA 4GSKA 4YJFB 5JC1A 5AXBA 3V2UA 3MWEB 2R6JA 3NAQA 3ROQA 5IF3A 1M75A 1UUFA 4LISA 5JFOA 4J6FA 4J49A 4PVCA 1JDJA 3I9NA 1B2LA 3PWZA 5HWSA 4ALKA 3OQ6A 1DO8A 3GNTA 1M67A 1M6WA 2W8ZA 1XLTA 3WYEA 4EITA 1H0KA 3CSDA 1F12A 3FBTA 4TKLA 5GZ3A 5DBIA 1I2ZA 4XDZA 2VZ8A 1MXHA 1JU9A 2VWPA 4PG8A 1WZEA 5A06A 4JCOA 2P9EA 3NT4A 3PVZA 4K26A 1XYGA 2VWGA 4N18A 4OO3A 2G17A 3D0OA 3EZYA 4M86A 1N92A 1U8XX 3DBLA 1O5IA 1PGPA 4CV1A 2R00C 1XCBA 4RGBA 3CTMA 4R3NA 4TVBA 3U4HA 5IDWA 4PLYA 5K6AA 3RC2A 2AHRA 1PQWA 3SLKA 4D43A 1E1LA 2Y1OA 4E5YA 2DPHA 1GZ4A 1B8VA 4KWHA 2VYVD 3I23A 4PIVA 5JAQA 3AM4A 1ADBA 3JD4A 4BGEA 1P1FA 3SEFA 1ZJZA 2X7HA 3WGZA 3QE3A 3VH4A 4GMGA 1LSOA 1N2SA 4GSLA 5AVOA 1QV6A 3Q1LA 1ZMTA 5TQVA 4IDBA 3GA0A 4QECA 4WEOA 4I5FA 3UOGA 2HMTA 4Y6RA 4CM8A 1WDLA 5IZCA 1C1DB 1LRJA 1YBAA 1LLDA 4JJFA 1JAYA 4BKUA 3KYCA 5IFLA 2O3JA 5BNIA 1E3WA 2RCYA 4DWVA 3DOOA 4HY3A 1W8DA 4RVFA 3L4BA 4FOOA 4YACA 1W6UA 3BTUA 1LSUA 1U28A 5L7TA 1TT7A 1EVZA 2DLDA 4EW6A 3E9QA 2ZYDA 4AJHA 2GNAA 3I9MA 1ENPA 1CJCA 3E1KA 4Z6KA 4CR6A 4D3DA 1ULSA 3BTOA 1P31A 3RUCA 1EBUA 2Y1CA 4YVFA 1ZFNA 1B26A 3WQSB 1UAYA 2WM3A 1PJBA 4KUGA 3RC1A 4DLBA 2HLPA 4JJIA 4O1MA 2VUUA 1DJQA 4NZ9A 4Z0HO 1M6HA 5K6AC 2B4TO 2EW2A 4U0JA 1YGYA 3RSHA 5U9CA 4H7PA 1WMAA 4MIEA 4PZCA 4LRTB 2DM6A 3ASVA 4B4WA 3JD0A 3DBLB 1QSGA 1UP7A 4CM1A 1Q7CA 4UUPA 1BVRA 3VZSA 1CQIA 1LNQA 2W4QA 3GFBA 2EKLA 2A4KA 4HWKA 2JFGA 3E5MA 1BGVA 4RZHA 2FP4A 3GVIA 3NTQA 4UUNA 4N7RA 1Y8QA 4BO1A 1NWHA 1O9BA 2OOSA 1U3WA 2VN8A 5IZCC 3EAGA 4CM3A 3D1LA 2JHGA 2PZMA 1PJQA 1SEVA 3TN7A 4IPTA 3E9NA 4M55A 1ZXBA 1HT0A 3TZKA 1LA2A 3L4BC 4NHEA 1CIVA 2C07A 5EJ2A 5TNXA 4J1QA 5A5EA 4FIZA 2HMUA 1J6UA 4E31A 1ZXLA 4CM8B 2I66A 4L4RA 3BA1A 3KYDA 5CG1A 4D44A 3K6JA 4QO7A 4YT2A 1E3WB 4TWRA 3RWBA 1MC5A 5BSFA 1UP6A 3DXFA 4II3A 4K1LA 4ALJA 4J7UA 3GVCA 3GN2A 1LSJA 1FDVA 1UAGA 4DPLA 3ZWCA 4L76A 5G0SA 4A27A 4QUKA 2EJWA 3RUHA 2VHVA 1ORRA 2W2KA 1PZEA 2PZJA 3KV3O 4NBUA 3S8MA 1GDHA 1B14A 5G0VA 3PDUA 3H2ZA 3VVBA 4HFJA 3QLJA 3OICA 3LZ6A 5IN4A 3IUSA 3N7UA 4AICA 2O7SA 4L4SA 3FR8A 1HE2A 2V65A 3JQ6A 1M76A 4A26A 1A5ZA 4YRBA 4F6CA 1EFKA 3NJ4A 3QWIA 3VPFA 5HS4A 4L4XA 3JYNA 1DHTA 2YHIB 3WLEA 4ALLA 1DRUA 1G6KA 5DN9A 4J7XA 4CLEA 2NUAA 3I5MA 4YTEA 1EVYA 1YBMA 2BGLA 5JW6A 3ZI0A 4R41A 1QYXA 4NQZA 3VZQA 2D5AA 4W9NA 2PKRA 4IINA 4EBFA 4TSKA 2FR0A 5KJ1A 1U7TA 1HDOA 3FNGA 4RPKA 3U4DA 4BIIA 4BO9A 1ADFA 3D3EA 1E7QA 4XYLA 5JAMA 3KLPX 2Y0CA 3WSVA 4EDFA 1Y8QB 2Y68A 2CF5A 4M1QA 5TIIA 1Y9AA 3PHHA 2RHCA 5T6BA 4J90A 3RBZA 1WP4A 2AEMA 3ETEA 2FR8A 3U3XA 2BFPA 5AYVA 3WBBA 5FWNA 4JJGA 4UUOA 4DLLA 4A03A 1UP4A 3RU7A 4LW8A 4OM8A 1TEHA 2H1SA 1YJQA 3ITDA 3QVWA 2C82A 1YE3A 1BXZA 2C59A 5LCXA 1PJTA 4BMVA 4FFRA 5L9AA 2VYVA 1N7HA 1GCOA 2H6EA 3HADA 3K73O 3NT5A 1Q7BA 3QW2A 2GN6A 3DAPA 3UKOA 2VUSA 5JDCA 1S7CA 2DC1A 2EP7A 4E30A 1GV0A 5AOVA 1CF2O 1UJMA 3QVOA 2CDCA 2CNBA 2BI8A 4FOSA 1VI2A 2BKAA 1ZIDA 1C1XB 3HDJA 3QJ5A 4RVUA 1CYDA 4OQYA 2ILTA 4Y6SA 3EC7A 3GPDG 3P19A 3FPCA 1WWKA 4RLHA 4U7WA 4YJGB 2W2KB 4PLGA 2FHSA 5B1YA 3W8DA 1RM0A 3V8BA 4D42A 4Q9NA 4UAGA 1PWZA 1JQBA 3HDHA 4IS2A 5I8ZA 3WIEA 4W9NC 2X9VA 3M2PA 5KVVA 2AQHA 1NWCA 4BB6A 3PZRA 2AE2A 4E5NA 3ZH2A 3I3OA 4J9UE 2NACA 4IZIA 1Z75A 3DMTC 1B8UA 3OETA 2Y66A 5DNAA 3CIFA 3GFGA 4CM9D 4CQMD 3JQGA 1E3SA 2ZIZA 4YDRA 4E5KA 4GLLA 3V2HA 1EVIA 3AFMA 3EVTA 2UUPA 4RQUA 5L4NA 1E3LA 1L7DA 2HCTA 1PR3A 3I4FA 3R0IA 5BSEA 4CUJA 4MKXA 4TQGA 3TFQA 4J3FA 4YJDA 1BW9A 3JQ9A 3K2BA 4R4JA 3HE3A 3UCFA 3ICPA 1LEHA 1EVJA 1T4DA 3GLQA 3PPIA 3X2FA 1D1SA 2VHWA 2VTDA 5K0ZA 5JDCC 1NQAO 3BXXA 1CDOA 5IG2A 1G0OA 1P1HA 3Q2IA 2RAFA 5BNFA 4BNZA 3DZBA 1YRLA 4AJ4A 4BNGA 4BNFA 3M1LA 1Z7EA 4BNWA 4OIMA 1N5DA 3IUPA 1PGQA 2DT5A 1BWSA 1U3TA 4LRSB 3D64A 3AY7A 1LC0A 3DONA 4WCFA 1ZEMA 2ZQZA 1Q1NA 3QWBA 3UICA 3ZHXA 4Y67A 4AJOA 5I7EA 3COSA 1LXCA 3DBVO 2X5OA 1NR1A 3RU9A 4B7UA 2J8ZA 3LT2A 2Q1SA 3AY3A 2RIRA 4FPXA 3DZJA 2Z95A 3INTA 4R1UA 3GEMA 2ZKLA 4RVDA 3VTZA 1DLJA 1DPGA 1Z82A 4KOAA 1MUUA 1DB3A 5ES3A 3IP3A 4J16A 5FF9A 1XSEA 2VWQA 7ADHA 5JDIA 4HUJA 5T8KA 3PLRA 2C20A 4RPLA 2HDHA 2PH5A 2CVOA 4HADA 1BXKA 1PQUA 3IAHA 4ND3A 3VZRA 4BNKA 3JQ7A 4IUYA 4B79A 1KEUA 1TB4A 2EG9A 5JXWA 3JQ9C 1NP3A 4KTTE 3F9IA 4E32A 4PVDA 3PHGA 3JQGB 5KVCA 1J5PA 3HN7A 2ZTVA 1TXGA 1X1EA 4IMPA 4ZHSA 3OP4A 3BHMA 3K5PA 2UAGA 1HYGA 4NU6A 1HZJA 5KKAA 4ALNA 2ET6A 1BW9B 1UZMA 4IQ8A 5DCYA 4EUEA 9LDBA 5H81A 1Q2XA 2GLXA 3DZGA 3ZNOA 1NFFA 4J1SA 3G17A 1I5RA 1PJLA 4HFNA 4WCFC 4I5EA 3JV7A 3KZVA 2DBZA 2OHXA 4KWIA 4IDCA 2NU7A 1ULUA 2CVZA 4YYZA 2X23A 3MZ0A 1SBYA 1WMBA 4EJ0A 2VRBA 4EJ6A 5ADHA 2GZ3A 1VC2A 1VLLA 2POQX 4N5NA 1QXSA 2V6MA 4NI5A 2GCGA 2BF7A 3VPHA 5JDIC 3DBRA 1KYQA 4CV0A 4XQCA 5T8KC 3UUWA 4WCFB 1E7RA 2P4HX 2WE7A 3W4KA 3B70A 2NU8A 2IDZA 4U0KA 1LUAA 1GTMA 1WNTA 4TRMA 4E0BA 5A9RA 3B1KA 4RPJA 1JLLA 4UVHA 3H9GA 1E7WA 1KIFA 2O3SA 1IL0A 1ISHA 3F4BA 4IY1A 3C3XA 1AXGA 3O9ZA 4Q3EA 1GUZA 1XG5A 2O7QA 4DA9A 4W7IA 4OYRA 5AXAA 2O3UA 3H8VA 3ZNNA 5TX7A 4XR4A 1KVSA 2QRJA 2NU9A 3JQ7B 1PWXA 1YXMA 2DTEA 5DBGA 3WYCA 3ANNA 2C54A 3OH8A 1YJ8A 5G4KB 1Y6JA 4DC0A 4NNJA 1MGOA 3D3WA 3LT1A 1YB5A 1D7OA 3DZKA 1P1IA 4MP3A 4FCCA 4KUEA 4PG4A 1YB4A 4G81A 3OJFA 4WOJA 2C7VA 2DBVO 3DR3A 5DBFA 4MVJI 2BHLA 3R6DA 4BS9A 4BO4A 3PIIA 3JD3A 1NTOA 2XPCA 4DYDA 4CUKA 4EJMA 3BAZA 2HRZA 4CM9A 4CQMA 5C5IA 2BLLA 4A0SA 1LQUA 1E6EA 1I24A 2GGSA 1A9YA 3GVHA 4A73A 1E3EA 1UZLA 1NAHA 3AI1A 4M49A 1HDCA 3NDRA 1ZO8A 3H4VA 4JXKA 5MDHA 4ZU3A 3ZHBA 1I10A 2JFHA 1ZEJA 3S55A 2HMVA 2HQ1A 2PH3A 3RI3A 3LC7O 3AM5A 4FJ2A 1XIVA 1T2AA 3CPSA 3DBRB 5KJCA 3SVTA 1W4ZA 3FN4A 1ZK4A 2YV1A 5CEEA 1SOWA 2YFQA 1LQTA 1VL8A 2ZB4A 4UVDA 3G3EA 1ISMA 2JCYA 4XYEA 1BSVA 1NVMB 2PGLA 3O4RA 4XZ3A 4BO8A 4FFOA 3PDJA 5JYDA 5G4LA 4YAJA 1VSVA 1HLPA 3PRJA 3DBHA 3B1JA 5JAZA 4UVIA 4L73A 2IZ0A 1GYPA 1GPDG 1PS9A 4HXYA 1QLHA 3ZV4A 4HNGA 5CDTA 5TRTA 2B69A 4K9DA 4W99A 5KCZA 5FI3A 4OXKA 4FC6A 1N7GA 4BNUA 2EWMA 4W4TA 3IC5A 1W73A 3CMCO 5THKA 3ZV3A 1YL7A 4R69A 1X0VA 2YDYA 4PGFA 1P1RA 1JN0A 4RVSA 4FFNA 3HG7A 4UEKA 1LDGA 4S3MA 3RBVA 1PS0A 3LC1O 4RCVA 3DL2A 2O2YA 5A03A 3D3WB 5IDYA 1I2CA 2DKNA 4Z9FA 1H2BA 1I36A 2YYYA 2O3QA 3GMDA 5A02A 3TRIA 5I7FA 1U3UA 4P4NA 3ICCA 4XYGA 3ZWWA 3S1LA 5G0UA 2V6BA 1AGNA 3MEQA 4IS3A 4H16A 2OP0A 4OOEA 4CMBA 1I01A 3SJUA 3V5NA 5ENDA 4O63O 3LDHA 1SB8A 3L77A 3ROPA 4PZDA 1DRWA 2E48A 3ZWMA 2GDZA 1ZK1A 4WEQA 2HKIA 5AQ1A 1VM6A 4L75A 4PLCA 3IKTA 1IY8A 3Q9NA 4UREA 3WJAA 3WFJA 4IJUA 4BNIA 5TLSA 4YQZA 2GZ2A 1ISIA 1LDEA 4YPOA 1HEUA 1Q7GA 1Q0HA 3OEYA 1C14A 3GY0A 4EUFA 2O4CA 1T1SA 3GG9A 4IIUA 1V3TA 1Y81A 1X7HA 3SC4A 2AEJA 4DPMA 4I8XA 2B35A 5A1TA 1XKQA 4I9UA 3OM9A 4ND4A 1GV1A 5EN4A 3CINA 1XEAA 1OBFO 4RORA 4E2XA 5EINA 4BL5A 3DBHB 4XB1A 2YV3A 2YZ7A 5C7OO 2UYYA 4XIJA 2FZEA 1O94A 3EYWA 5A9SA 4BGUA 3RJ5A 3VHRA 2ZCUA 2PKQP 3HWRA 1C0PA 5ILGA 2D0IA 2GO1A 3HDYA 3KSDO 2NVWA 4PFJA 4PLWA 3EVNA 5HRUA 5L45A 2GN4A 4RZIA 3IJPA 1QYDA 4GLOA 1GYQA 4TRNA 1D4FA 5TJ9A 5L7WA 1XELA 1LI4A 3HFSA 4IGFA 2C7GA 2WEKA 3FI9A 3OHSX 4ALIA 4ZQHA 1XGKA 3HJAA 2BFMA 4BNLA 4ROSA 1QV7A 1LSSA 3PQEA 2EW8A 5ITWA 4CPDA 4YR9A 3H9UA 2PZLA 4W7HA 4BVAA 4MVJF 4FQ8A 2JCXA 4NH4A 3M6IA 3P7MA 3EHEA 4MJLA 4O5OA 1KVUA 3TSCA 4JBGA 4NK5A 1ZH8A 2Z5LA 3A1NA 3F46A 2D4AA 1ZW1A 5U1PA 1ISGA 1ENOA 4ND5A
chains in the Genus database with same CATH superfamily
2HCRA 3FKQA 1V3VA 1H8HA 1V95A 2I6UA 3FVVA 2FEOA 3H4IA 1UJ4A 3OA0A 4C1BA 5LWQA 1NU6A 3TIVA 3UCXA 3MJ4A 1J1UA 3IO5A 2AOVA 2F3UA 4GBJA 3GAZA 4NFHA 1PUIA 1PL8A 4P80A 2YJ4A 4RJLA 3TLBA 4BNMA 1M3SA 3AVXA 4IXNA 5DOVA 1ORIA 2CLSA 4TT3D 1DXYA 5FPTA 3ESYA 4I4TF 5C0OE 2B1QA 3BXHA 3ENZA 2WJ3A 2I62A 4AI6A 4UTZA 3SXUA 2AQ8A 4C43A 5AW0A 2ZAMA 5DPMA 1D2EA 4R1PA 3T0GA 1JDUA 1EWVA 3N2GA 2ZS9A 4ESVA 1Y7PA 1ONOA 2V55B 3GRPA 4PX2A 5IC6A 5AD1A 3TZ6A 4RF4A 3L05A 4NPCA 2BZ1A 5DLEA 5FBVB 4U5QA 2B0JA 1YR9A 4XM2A 1XAIA 2E4AA 3E3AA 3QXHA 1IJFA 3O1IC 3KLMX 3MWJA 5K6TA 4DLAA 3OWOA 1EH5A 2GPYA 2QX7A 3GT3A 3SSAA 3UH1A 5JHGB 1GQSA 1T3GA 1H0RA 2EAUA 3FMGA 4CMCA 3FTPA 1HFEL 1Z0FA 3PIDA 1XA4A 1FSZA 1TYBE 3MJHA 4ZD6A 4MDEA 5THQA 2C4NA 3WO0A 2IF2A 1FVOA 1UPTA 2ZSDA 3HB1A 3I01A 4ID3A 3CMMA 4QQ8A 4JROA 3T9AA 4BFTA 5KTRA 1KEKA 1W29A 1NJ1A 3BG5A 3G2OA 1JE0A 1WDKA 2R11A 2OECA 1BFDA 3Q7TA 1Y7TA 5EXXA 4OHXA 1I7SB 1JFLA 2C2XA 1HDRA 3PNVA 4NC9A 4U3JA 4UU1A 1INLA 1GKYA 1AHHA 4K9RA 2AW5A 2IODA 2DMRA 5DIZA 1PVDA 1K6EA 1F5NA 2IYRA 3EFOB 4PSVA 2XHEA 3ZVNA 1K0UA 1YZVA 5IXYA 1W85A 2FMUA 3KDPA 4AS3A 3NP9A 4NDAA 4V3CA 4IUBS 3ZPXA 1JPNA 4LE2A 2HF7A 4IO1A 4LVUA 4EGJA 4EY4A 4M6WB 3GLHE 5JZSA 5JXJA 2IVZA 2MT9A 4R71A 5I45A 4KDEA 4KLCA 3QHPA 1D9XA 4DCMA 3DVLA 5JSFA 2HU7A 2IOHA 1FIUA 3N0TA 3RFTA 2ZAGA 3QEOA 4ZJUA 3Q8LA 1H4SA 3FFXA 1I2AA 3ZC3A 1RI1A 1VMDA 4LOKA 5KWEA 3JYQA 1EP1B 3ESXA 1LQ2A 4TPKA 3LL4A 1SIBE 3HCPA 1VL6A 3U44B 2P9CA 1UOPA 2M9MA 4DB4A 1UJ2A 3AOEC 1Z36A 5KAPA 2WJJA 1CY7A 4IG9A 2V03A 1GRCA 3QOXA 1UZNA 3ZJUA 1P80A 2A5LA 2OHVA 4DDKA 5EMHA 2HEGA 4TWBA 2Y1WA 4OOFA 2A9OA 3H5RA 1CW2B 4ZAVA 1XK7A 1V9SA 2XRMA 3R3YA 4YAKA 3EC2A 3TO5A 3C1AA 2K4MA 4CIVA 3PFWO 4I9HA 2DUMA 2JIZD 4YPFA 2R7AA 5A9TA 4QPDA 4AJNA 3K9NA 1QGUB 1K88A 4AWXA 4JNCA 3NKLA 4R16A 5E4TA 4O4LF 3WNQA 5JYCA 5MN4A 4LMPA 1SVSA 5E6RB 4DCGA 3O8LA 3OQVA 5BY2A 1Z15A 3CGWA 4IDOA 5HCNA 1SURA 1HPLA 3RAFC 3NYWA 4AJ2A 2NT3A 4M89A 5EKSA 3OHPA 2O50A 5EMLA 1VCHA 1C8KA 1XQXA 1E2KA 2I80A 5TQ0B 3PVSA 2N42A 3EW9A 3ROTA 5K45A 1WIWA 5A0VA 1MG0A 1C1XA 1PRYA 5JYBA 4JBWA 1YMQA 3QMVA 4K87A 2HIGA 2ORIA 1Q6YA 2UYOA 3D5TA 4OL9A 1X13A 3EZLA 1RYDA 4WDQA 3OFVA 1I3MA 4RBNA 2GZSA 3HCFA 4YLEA 1SOAA 1EP3B 1RXSA 3JZIA 1QCZA 1U2TA 4KQXA 1TZCA 3OC0A 2FSFA 1XL1A 1WUTA 3EVDA 3F49S 1FZQA 3VR4D 4BEWA 4H2DA 5KJ6A 3MS4A 1LGYA 4UD6A 4Q3NA 3B6KA 4MQEA 1W0CA 1WW2A 2R25B 3CSUA 3DSRA 3GXBA 4IJWA 4OSPA 4CDGA 4D7AA 2YZ2A 5TT1A 1RTTA 1W1UA 4QPCA 3HO6A 3KAKA 2RH4A 4HXFB 4W9RA 5DFAA 5AFSA 1IM8A 2AN4A 2NNLD 1G41A 1HQCA 4B6EA 4DV7B 121PA 5EMNA 3RAJA 3BMCA 2VJDA 1L8OA 2DBYA 1N9KA 2J3HA 4KC0A 5B64A 4QDUA 3LIPA 2ZSJA 4DREA 3L49A 3TI7A 1UK9A 4IV5A 4G86A 1ULHA 2O20A 3DZIA 1SJ9A 4LV5B 2IHTA 1OLSA 3L8MA 3Q41A 1RP7A 3E9MA 4MMXB 4URYR 4UPDA 5DKFA 1DAIA 4EG3A 3UPTA 4J1TA 1BMFD 1IATA 3FPBA 3HMQA 4Z4EA 1SCBA 3E70C 2BBWA 2WIAA 2H7XA 1T9ZA 3E82A 3EXFA 4LQ4A 1Q50A 2QR5A 1E2PA 4GD3Q 3IT3A 5KC9A 1X92A 3QV1A 1DKPA 3DHNA 3IBYA 3N5KA 4CM6A 2BR4A 4TS3A 1KFEB 4CV2A 1FFCA 1OIVA 2WYIA 4J0QA 1IBKB 3TMKA 2P77A 4TTSA 1RAIA 2A9PA 1RXCA 3CEPB 3PJGA 4PSUA 4Q7LA 3ETJA 2P2CA 4G6ZA 3TVDA 2HV8A 4DJTA 3OZGA 3I04M 1NI4A 4FHCA 4CL3A 4YDQA 5JNWA 1TCUA 2IA5A 3HB9A 1OLXA 1QYIA 1PFKA 1U2QA 4C76A 1UWCA 2C61A 1GAJA 2XVYA 4L9RA 2ZJ1A 5E6SA 5A5GA 3BRWD 3GC6A 4JL5A 5ANRB 5BURA 1AKTA 2MSDB 3X2EA 2QORA 4GGOA 1OGIA 2DQYA 2FUG6 1UDAA 4EA6A 3BXEA 1I7LA 2F1HA 2ZT6A 2QTHA 5IYZB 1E79D 2OV2A 2FAXA 3HBMA 5JPIA 2JK0A 4HKTA 5J43A 3AVQA 3HKCA 2PRJA 3L84A 4EKEA 4Z0PA 2WJPA 4GMDA 2P5UA 5JCOA 3CRZA 1M1YE 4NEHB 4TT3A 1CULC 1XXLA 1CERA 3I9LA 2GZ1A 3V4PB 1KEWA 1IPHA 2VA8A 2IH2A 2VHEA 4V1CA 3NW9A 3IMFA 5K99A 1P73A 3K09C 5GV8A 2BE9A 3PX2A 1DJNA 4B2YA 3H83A 3HJGA 4L57A 1ZJ4A 4O8ZA 2EZ8A 1ZNYA 2EHDA 1P2FA 3BK2A 1N57A 1HYBA 2P3LA 3ENNA 3OJ0A 4GI3A 4OCZA 4BC1A 4OJQA 3HR4A 3A05A 1ODIA 1ODLA 3I1IA 1ZSNA 2ZB8A 3FRJA 4QUAA 4OP1A 5A3JA 2QQFA 3KQUA 3QIVA 2NSHA 4OMUA 1GQOA 1NQVA 2FUNB 4GT1A 1ZJ6A 1DMSA 1AUXA 4PX5A 5ERYA 5FIUA 4MVJD 5JOQA 1ZUNB 4X84A 3ODGA 5A6VA 4JP8A 3PV0A 2GLTA 4EA7A 4YAWA 1ECJA 4QDKA 1N8SA 5CH3A 4G5XA 2XMRA 2R6R1 2CVQA 1SOVA 4PHHA 3TEFA 4CZ2A 3AINA 5A1JA 1PTKA 3LPNA 3VMFA 4BB5A 4WNAB 1N36B 5H4HA 1UPCA 1YC2A 2Y1LA 1DAEA 3F6SA 4RHCA 1W88A 2VT6A 2CCJA 1WBDA 3W5SA 4DQVA 3OIVA 4X64B 2R60A 5I4IA 4DIBA 5E7JA 2WTUA 1GPH1 3LWBA 4B6JA 3AJAA 2V7UA 1ZIOA 3DZFA 3E3LA 3FH0A 3QVVA 3VDNB 4PSKA 3WOHA 3H4MA 5HJ7A 3D8BA 1Z6TA 2ATVA 2JFFA 1CUDA 2FN3A 1ICIA 4OSOA 2X3UA 4TV9A 3NHZA 5FA8A 4F9GA 3TECE 3AJ9A 1P7VA 3AVVA 2RBKA 3F90A 1ZOIA 1C1HA 3BQMB 3DXYA 3KM0A 1T3ZA 3STVA 1GCUA 2N0SA 4OUKX 1PFVA 1G8HA 2ZB7A 3ZOKA 4GMKA 1XT6A 1GT91 4R1TA 1XQ9A 1C9DB 2JANA 4AXBA 4AK9A 1GPNA 2C3UA 3QQPA 3OQOA 3FUXA 5GGXA 4YXFA 4HSEA 4MYUA 5TB5A 5KQLA 4NG4A 4M1KA 3RUPA 3OPQA 4IHAA 1D2NA 1WKCA 1YVEI 3ASUA 3KO8A 4KE9A 4Q48A 2IXTA 3R3VA 3RT1A 4GMHA 1U8YA 3RKRA 3LK6A 3U3OA 2GXAA 3BFVA 2A84A 1NYLA 4E22A 2QN8A 4FFDA 5GJCA 3CKKA 1TMYA 3UAGA 4EWLA 3IT0A 5JJBA 1CY8A 1GFSA 2FEMA 2MYUA 5LDGA 4AZ0B 4XVUA 4HR7A 4DA6A 3BL8A 3WNDA 1WKBA 4G84A 4P3NA 1E58A 2JIZA 2A1TS 2RIPA 3K53A 4JVMA 4YUXA 4MRVA 5WRFA 2XTMA 3ZU5A 3U61B 4FGKA 2CZCA 3JQCA 1I6LA 5JO9A 4C4YA 2Q3DA 2EDAA 3C7DB 4BVEA 1YOVB 4I08A 4E03A 2C7RA 2G5PA 4KAAA 1OH6A 4JODA 3HA5A 1V35A 2PR2A 4B44A 1ES9A 1H66A 1M8JA 1WXXA 3HB4X 4QT4A 4IUDS 1UWLA 1XJWA 2QZSA 2VXYA 1GNQA 3E84A 2V6GA 1X80A 4TLDA 3VC1A 3LXRA 5FOWA 1M54A 1R4NA 3QLVA 2WIGA 1IULA 1RPAA 3I8SA 1EWYA 2J87A 2GESA 1EX1A 2FRXA 1YD7A 4NV3A 1KDTA 2IBTA 3ONWA 5G4KA 3BWDD 4UCXA 4YBRA 3ELYA 3OX1A 3VR4A 2WJGA 4Y6GB 2XJ4A 4ZICA 3PFGA 2W4MA 3GFPA 5B2ZA 1JFVA 4AYXA 4U9IS 4DGSA 2VP5A 3GELA 3KZCA 2P7HA 3GPIA 4JMPA 5BSTA 3ZWAA 1OH7A 2PD6A 3I39X 3R41A 4NJMA 1DWQA 4DKXA 1XRLA 3TG2A 5H9VA 1EXDA 5IMBA 4Q4JA 3OEHD 3STHA 2NTVA 2Y76A 4FMDF 1QB7A 4GO1A 2LPMA 4LUCA 2O0JA 3T95A 1W7AA 2X0DA 2FK7A 5A3VA 4CR8A 5KYXA 3E0XA 2O4UX 2I4RA 3OZSA 3VNVA 3ZW9A 1KR5A 4E4TA 4NENB 1AKQA 1Q6ZA 1FDIA 1TU0A 1JUDA 2GN1A 3ETHA 4FFWA 4L0MA 3SR3A 1WPQA 2YS6A 3U6BA 3U60B 1J00A 2E3JA 2BMJA 1Z4LA 1QO7A 1ESDA 2YFYA 3Q0TA 1HDYA 2BI7A 4GL4A 4NQRA 1T4CB 4S1VA 4MQ6A 5EPEA 5AVTA 1UXHA 4KIJA 4HQFA 5AP9A 4IIJF 1RZRD 3UV6A 4DR3B 2ECQA 4TMKA 2WIKA 5GQSA 1BMFA 4CM5A 4YRAA 4EGQA 3IJRA 3KZOA 1H9BA 5H3HA 2XUQA 3ICVA 1X0XA 2KX7A 1P5ZB 4R9SA 4RJIA 1C7ZA 4DV2B 3NLLA 3ND7A 4FUTA 1ZDMA 3OUZA 4WZBA 2HR1A 4WNYA 3K16A 4KWEA 4IHJA 1DG3A 2KQUA 2XX3A 4AJKA 3SJAA 3GT4A 1UMDA 4X24A 3GH1A 4IJKA 5B3LA 1MT3A 4F56A 4QYMA 2ODBA 1JBKA 1WXDA 4Q3CA 3FROA 4BVFA 1B0UA 3BAFA 1MB0A 4LDNA 5ICMA 1H93A 2LGJA 4I1OA 1EK0A 1R5NA 4MV8A 1PGJA 2HA5A 3RV4A 3OKAA 3LOUA 3BRWA 3M4JA 3TR0A 3NORA 4E2WA 5EZ6B 1AZTA 3VTKA 2IX9A 3C85A 4L16A 4EQ6A 3ROKA 3T1YB 4R8VA 5LU9A 2HF8A 4ZCPA 1BH6A 1P2GA 2YZKA 2OGZA 4KR9A 1E79A 4IOJA 1ZY2A 2I6TA 2BKVA 4KFRA 2FZ4A 1QYRA 4RAOA 1XTQA 1VPDA 3KQTA 1KC3A 2GKOA 1Z4QA 1G5QA 4ISBA 1XUOA 3AFOA 2CEKA 5FOUA 1APBA 4YUAA 3FBGA 2GO7A 1U9JA 5BV1A 4R7ZA 2V1UA 3GUZA 3S2FA 3VR4H 2CJWB 3WHLA 4DJ5X 4EHDA 5AI6A 1WB6A 1MT0A 5C5DA 4KI7A 1OFGA 2VTKA 1H6CA 3PIRA 1NKSA 2G1AA 2K5UA 4GKBA 4DSNA 3CZ9A 4ESEA 1GUFA 3WL8A 4I3GA 4Y9RA 3PXCX 5H1YA 3R44A 3BWYA 3NIWA 3ME5A 2EF1A 3I1JA 1T0JB 1V9CA 3F67A 4TYMA 4INJA 1OZGA 2D00A 1OBCA 2QB5A 3JARB 4MVJA 4RZXA 5CP8A 3VNQA 4HDNB 4RPGA 4A0GA 4Z53A 2ZWAA 1I32A 3IQZA 3QXCA 4XD2A 3DL7A 1M2HA 2XIQA 1IHPA 4RQBA 4RVOA 1MENA 1FU4A 1HQDA 4F8JA 3I32A 3SKVA 1OAAA 2XOXA 4ZXPA 3KELA 1PT7A 1XEWY 2I2DA 1J2EA 1WPXA 3OI7A 1NXTA 2C5HA 4YREA 3UPDA 4E15A 1SU6A 4BVLA 4MW9A 3SR4A 2P11A 3IRUA 3NV7A 4N8DA 3ZLBA 4I1RA 3ZU4A 2QLNA 3AFHA 2H4XA 3ROFA 1QIFA 4J0EA 2TRSB 2Y4NA 1MB2A 2ZVPX 3QG1A 4UHDA 1NBEA 4J76A 4JVLA 521PA 4RK5A 4UC0A 3BQ9A 2WWWA 2JA1A 1V16A 2Z2XA 4EGFA 2PS3A 1WPGA 4B3BA 1NNI1 3I1YA 1NVVR 3DMRA 4MICA 5CIYA 4QJ3A 3ZLJA 1NY5A 2Q3HA 3OCYA 1YE8A 3QUCA 4KBGA 4DBVO 5DP1A 2CJPA 2OQIA 4TYWA 3D4NA 3L6OO 4KR2A 1PW5A 1T36A 3BEDA 4IXMA 2IOFK 5DGXA 3LKZA 1CFZA 2JA2A 2I29A 1KEZA 4OGLA 3V4RA 1TQDA 4DZZA 4YLYA 4F4JA 4ZIRB 1EK2A 1D0IA 1C3OA 1WAMA 3CUSA 3LLCA 2P2NA 4QFDA 2H2FA 4CLRA 1Y6RA 3UTDA 1Q0LA 2WBLC 3OZTA 1KDZA 2XZLA 3COJA 4RF2A 4TXMA 1AK9A 4LZNA 2Q6LA 3ZWPA 1BWPA 2ZATA 1FP6A 1G7RA 1KWGA 4DG8A 2A5JA 3RIMA 4Q01A 1CQPA 3TLYA 3U39A 2LNDA 5JWOA 2FW0A 1JIJA 2JFVA 5BN5A 3UOAB 4DMCA 2AEFA 5B3JC 2BFOA 1P2DA 2CBXA 2X0FA 1TCAA 1U3FA 5DSZA 5TARA 1YQUA 2FN4A 2JL1A 2OSBA 3VSBA 4GFDA 1XZLA 2RGYA 2ZBVA 3WGMA 4JA2A 4BHTA 2V0NA 2IDMA 3T4XA 2V0GA 1BTOA 4CFZA 3LDAA 4G09A 3KKKA 1TKRA 5JMOA 2QAGB 2XUAA 1ZGHA 3O3NB 2C00A 4FOLA 1FQKA 4K2HA 4MVJH 3KPVA 3NUZA 1YULA 1U2DA 3C48A 4PTYA 2A1IA 3AEXA 1Y8AA 3KFLA 4R5MA 3UJAA 3IMEA 2Y67A 3ZS9A 4YRFA 1CY0A 2JI6A 4HTFA 1CVLA 1D4ZA 1SULA 2HGSA 2VT2A 3AEZA 1QGOA 3FPSA 4QHTA 3JQPA 4QE3A 3EF0A 4AY5A 3Q88A 1BDBA 1HDIA 2OBXA 3OQIA 3N0XA 3OPMA 1GKIA 3ESZA 1EUQA 4ENTA 3ORSA 5DHSA 3WNVA 2NU6A 3O8DA 5HUQA 5L3QB 4CXMA 3QQ5A 1OY1A 2R8PA 4NR0A 2I2AA 2VP2A 1N2CB 3RLIA 4QLBA 2O7RA 3BMOA 3JAMA 1C7RA 5FBQB 1DV2A 3A4VA 4YAUA 3O7WA 3K8ZA 2GK4A 4BZPA 1FNMA 1NSYA 2JHFA 3P32A 3PD1A 1VTKA 2JZCA 3AR3A 3H1PA 5FO0A 1UBFA 4MJXA 2OORC 4E12A 4R68A 2ZB2A 1V8ZA 4D3ZA 1VYTA 3PDIA 3FTQA 3OEHA 3S2ZA 1OXKB 2FPIA 3N2LA 3NHPA 3GZNB 2JCVA 1Z63A 2VFAA 3ECSA 5AM1A 1M66A 3W1EA 3T1TA 1TGYA 3VYTB 3OWHA 5H0IA 4F5ZA 1U3GA 1YZTA 3VC3A 1PNVA 5BW5A 4MIOA 4D74A 4QARA 3LVBA 3NI2A 2LBPA 1KDYA 1GDTA 4YRMA 1QH1A 2Q6TA 2O57A 1NXXA 3CY6A 4CI0B 4LSMA 5SYAA 1E9DA 3E5HA 5E1OA 1RZRA 4OHFA 4RS3A 2XGGA 4HN4B 4DKJA 2J3MA 1WD5A 2K87A 4DMMA 1GG8A 2WIJA 1MV8A 4OXNA 4GR4A 3OZEA 5JBQA 5HF9A 1HFJA 2QL5A 3DD1A 1O3YA 4GH5A 4LXUA 5KTOA 1RZ3A 1NURA 4RJ2A 5EVCA 1U3DA 1U3VA 3M3HA 2ZSIA 2AMLA 2IPAB 1KVTA 1SG6A 3ESRA 2O6HA 2C31A 1ECGA 3QPDA 3O8RA 5JPDA 1O6ZA 3AUXA 3QVMA 4V2UA 4WPGA 4FK8A 4QWWA 4X6YA 4ZVTA 4H7EA 4AKTA 3KQVA 2I2WA 2RK4A 4F3CA 3TLMA 3L04A 1Z4MA 1NP6A 1QLWA 3OJWA 1L1RA 4XSVA 5FPKA 3BIOA 1N1DA 1YCDA 2UYQA 3O1HB 2YJNA 4GKVA 4MVYA 4LC9A 3U7EB 1CS4C 3CNLA 3PCTA 3UWSA 1E4EB 4ZO8A 5HTOA 5EZSA 1RAHA 1L5HB 4GVXA 1MKYA 5K3SA 1LBSA 1RPTA 1A77A 3WRXA 1EDEA 3OCCA 2XAAA 3H18A 4OLJA 4O4IB 1J5XA 3I28A 2NV6A 5DCWA 3OUUA 1QFSA 1GA1A 3IIEA 2EJCA 3UKJA 2ZIVB 1SCJA 1MXFA 1U1IA 3GLFE 4DTCA 3EDRA 1RKBA 2IZ5A 2EW1A 3QYPA 2XGMA 3UQYS 2I2FA 4LY3A 2GAAA 4JXJA 3RUDA 3ZJYA 4BKOA 2UYHA 3DVQX 3QA9A 4WXPA 4YC7A 5EMMA 2O8EB 3RUIA 2R1VB 5C8YA 2ASVA 3IUYA 4TWJA 3RF6A 2J9YB 5BSKA 3MXTA 5CVCA 4LF4B 3LT0A 2MSCB 4AUMA 1ZPDA 4U2BA 5BNZA 2SBTA 1ZM7A 3ZGYA 4OI0A 2WD9A 1NX6A 3WYNA 3S99A 4AUEA 1BQ3A 3KZ1E 2LCQA 3U44A 3PXXA 3GRUA 5DM60 3IV9A 4FJ1A 2IOFA 4OKNA 2FE4A 4KH0A 2YV2A 1PQYA 1E9VA 4FD3A 4NU0A 5G53C 5IEBA 3JALB 3OZVA 2OOKA 1AZWA 5KPDA 3W5AA 1JMVA 3GXOA 4OHUA 5E0KB 2VYFA 5MHTA 1GUYA 3WLKX 2PWYA 1MX3A 4OATA 1HL3A 3FCYA 1HE5A 1ISSA 4QREA 2J0EA 3HUUA 4L6IA 1DIRA 3QTTA 4FONA 5CB4F 3K2IA 3VR6D 3FVTA 3N8KA 5JAUA 1EM8B 1XEFA 1RLUA 2VQSA 3FXAA 1O87A 1QTNA 2VBFA 3NTXA 3C3DA 3PFIA 2I1LA 4GRIA 4R2IA 1AJEA 4CCYA 4TLMB 3GPCA 2HIHA 1Z38A 5EJ7A 1NQ5A 1DJOA 5KKCA 2XB2A 3I92A 2Y0DA 2X5NA 4KJZA 1CY2A 5JFTA 3ZWOA 1KZ7B 2P9YA 1K8XB 1SN7A 3EYAA 3NALA 4JEIA 3VH1A 3TQCA 1Z4KA 3CR3C 2GPSA 4H1VA 3SXPA 1EFPB 1KI4A 4A8PA 1Y9EA 1VPVA 2O2XA 4TRJA 1JQDA 4X6UA 5JZBA 1ZUD1 4FXOA 1RLTA 2R7LA 2QGFA 3ZWYA 3FHJA 3WLJA 1U63A 3PQ8A 4RY0A 4TYYA 4LCEA 1EX9A 3IULA 3OMLA 2B21A 1KFJB 2OV4A 3W9YA 3PD7A 3DCJA 3F5QA 4LXQA 3JYPA 1EGVB 2QRVA 3HM2A 3KLNA 3LGSA 3DHWC 4JBYA 3I0ZA 2WTAA 4H6VA 3EK2A 1CY6A 1G5TA 3DWFA 3MWKA 4FYWA 5F73A 5AUQA 5JSKA 1E7MA 1JL3A 1II0A 3GB9A 3W04A 4MR9A 1WBBA 2EERA 3CF2A 2A9FA 2O48X 1A8SA 2WIDA 3QWHA 4XQ0A 5H59A 2PV7A 1JEJA 1AGPA 3L40A 1FUKA 4FDMA 4AMGA 2VJAA 2WF6A 5L7YA 1MZVA 2Q3JA 5CDSA 2G1PA 5DP2A 4PC3A 5HP4A 1XVAA 3DYBA 1N0IA 1DKUA 3EVGA 1J0XO 1EEHA 2O1SA 4GOXA 4I1YA 2PTGA 2IVFA 3KRTA 5LQMA 2KMLA 1REQB 3REGA 4EELA 3U37A 1TU3A 4CW7A 4ABTA 2RGCA 4JENA 2OM6A 4QU9A 2PQ6A 1Y8RB 3CRNA 1Z35A 3BH7A 3WO1A 5IWCA 2P75A 3JD1A 4S1WA 5LWHA 1DHRA 1C50A 2GUGA 1T5BA 5FEUA 1IXZA 1OBHA 3MWDA 2XUDA 3F7TA 1RNLA 2BKEA 1CJUC 1S3SA 4QWMA 1LBTA 1M8KA 2OWDA 4FT2A 1N2JA 3CIOA 1F2TB 4YN3A 1IN5A 2V1XA 1H5QA 4NJOA 2H17A 1J07A 4TTQA 4JQZA 3G49A 5HIIA 2I7CA 3UNXA 1MR3F 2BFAA 3OJEA 3K1YA 2QUBA 4BTVA 4KXFB 3TZHA 4TXLA 5EJMA 2VRCD 1QMPA 4D0RA 2BONA 3PYMA 3OM1A 4FP9A 4HDKB 2NZ2A 5IJ0B 1V11B 4PWYA 5J2UF 3RASA 3NIGB 1D2RA 4DY6A 4LK3A 2Q4OA 5KDDA 3HJNA 2I7TA 2HD4A 4WINA 2B8NA 1WKVA 5KOIA 1YHZA 4U2EA 2OLKA 2QXUA 3WADA 3ZQKA 4N54A 3ZE7A 1VMIA 3FTDA 1E3IA 1L5NA 4HT3B 1RWVA 2PJDA 4YWJA 2QZ4A 5ALNA 3TFWA 2R68A 5CEJA 3KKOA 2WM8A 4LDQA 3V00A 1GILA 1PAUA 1GG2A 3ISJA 3ZG6A 1E94E 1YQQA 3KYCB 3IB3A 2HBRA 2CL5A 4FFPA 4ZMBA 5B12A 4C6HA 5JY1A 4R1MA 5KX5F 4BMCA 5CTAA 4CV3A 5LDHA 3EZ9A 4WJKB 1ZUNA 3RVOA 1FVXA 1X7WB 1SUBA 1YE5A 2CMFA 2RGEA 3DHYA 1O4WA 5CLQA 2ZRGA 3O0DA 4DIFA 4YI3A 4EFLA 1NUHA 3EPRA 3R7SA 2QRHA 5BUSA 1Q57A 3EIOA 4WERA 4C7KA 1GGVA 2F1RA 3FRHA 4JFAA 1Y1TA 5AW7A 2Z2YA 2OCKA 2C0CA 1QWSA 3AB8A 1G2IA 4GZ5A 2DFNA 3G2MA 4MA4A 4CIYA 3H7AA 1LLUA 4YP1A 3RW9A 2LIPA 5LZ9A 2OGSA 4MV0A 1V96A 2YXEA 3E22A 3K2EA 3MF4A 4IVQA 3FZEA 4B82A 1IE3A 4CFYA 3LG2A 4WNIA 5DRTA 3AHIA 3P52A 4A91A 3WHIA 2PPVA 3CKYA 1G6HA 1RWQA 3EOAI 3JWJA 4QUIA 5L53A 1V8FA 1GIAA 1BA2A 2IV7A 3C3CA 1TUBA 2W93A 1IOLA 2PRZA 4RZUA 2DQZA 4PNPA 4FHZA 1EZZA 4ZOEA 3DAOA 3BD9A 2GN2A 3OO0A 1UXGA 1R16A 3IV7A 1NZDA 2IS1A 2YVAA 4D8WA 3MUEA 1ADGA 3NHLA 3IVMA 1OFUX 3QEBZ 2RGRA 4KXVA 2P3QA 4XB2A 1EUZA 5AVWA 1CIPA 3L9WA 1KGSA 2W5UA 1OX4B 1KQFA 1RACA 1NJSA 2FSVA 3DFIA 5REQA 4N47A 2C5BA 4N0QA 4EJSC 2F90A 4P98A 4YCBA 1GN8A 3ADPA 3LVFO 4Q3KA 2LKCA 4BVBA 4YXWD 4GQIA 2W8BB 2P2YA 2XGOA 5LD2C 1WB5A 2WMOB 3ZKAA 2AT1A 3ENVA 4LJ7A 3OM8A 3BMNB 3AUJB 1FDUA 3PUHA 4I1VA 3EY4A 3TLZA 4AZ0A 4B6RA 1MX1A 2V4UA 1CDZA 2F67A 2H18A 3NTRA 3A2LA 4UUMA 6YASA 5LA6F 1KI2A 2RAUA 3RE1A 2IHKA 1GXSA 3EB9A 3GZJA 1E2DA 5TT0A 4BLRA 1GY8A 2XA1A 1X1DA 2CF6A 4MCHA 3ROGA 3ZE0B 3FD8A 2H5IA 4B7XA 5KOHA 3VR6A 4O8CA 3KYDB 3GNLA 4WX2B 3HV2A 4OXIA 4KITB 3B5EA 4U5XA 3KZXA 3RSOA 4B74A 3D8HA 2JEYA 4NBTA 3BFKA 2O52A 2OFPA 3ZR4B 2GNPA 4BJ5A 2I6FA 1I2DA 5K8VA 4XX1A 1BD3A 4RL6A 1Z07A 2CNOA 3DCNA 2P90A 3QBEA 3BXOA 4U7GA 3VAZA 5KTPA 4CMEA 1TQ8A 2CHEA 3G1UA 2AE1A 3K4PA 4BJHB 3TKYA 3WLAA 2FFRA 3BDAA 3EDOA 3WTCA 3LUCA 4KQ1A 3WY9A 3T1VA 2OXTA 1F14A 1OGYA 1ZU4A 2A0FA 2CWDA 4QODA 1B7GO 4X6XA 3EGCA 1KDVA 1SO8A 3AEUA 2VZLA 4R7GA 3ZBTA 3EUEA 3OZRA 4HX2A 4M37A 3GP5A 5BNWA 1PX0A 2JFUA 1KY2A 3DOHA 1Q20A 1IM2A 4BMYA 3OOYA 4D80A 1NM5C 4FU0A 4TTPA 3X1JA 2TYSB 1ZITA 1PJRA 2VJPA 1EGHA 1T9KA 3GGOA 3G7NA 2QP9X 4PO3X 1Y9JA 2GKSA 2G07A 3FSJX 4CF4A 4CMIA 4YY3B 2I9KA 5I48A 4A3SA 4NCIA 1CV2A 2OP1A 4NENA 1TEZA 4CT5A 5JY6A 2IXBA 4IILA 5IT5A 1NBOA 1XRMA 2OILA 2Q28A 4WN9A 3WWDA 3BGWA 2Y3IA 4R2XA 1D6MA 1IDN1 1U3CA 1YDMA 3DFZA 3F96A 3PEEA 4FTWA 4JXZA 2GN8A 4G63A 2BGIA 4YT4A 1Q44A 3GGGA 3ESDA 2EFJA 4J7CA 2WAYA 1ZK0A 3HNPA 4QTUB 3TNFA 5K7SA 2XCIA 3JRXA 3L5KA 1JFTA 4C05A 4EF5A 3ROZA 3GH3A 2AFIA 3VKWA 4XARA 2YVUA 4MYHA 1CNFA 5J58A 1HORA 5LKRA 2WK1A 2B6HA 2VH1A 5BW6B 1KHTA 1NBHA 2CUKA 3EZNA 2DEUA 1RYZA 3T3HA 4UNRA 1NPYA 4JUBA 2HO4A 1L5LA 1PT9A 5CXXA 4CWAA 4RJTA 1DQPA 4TM7A 1SXJD 4BAUA 1EU1A 2FSIA 4JEHA 1I1OA 1E2MA 1DIBA 3NYQA 3VR6H 3RM3A 4MGEA 4A15A 1T5OA 3ID6C 1AHNA 1A8UA 4R9VA 1HETA 3HCAA 1NE2A 1FA9A 3QXXA 1S96A 1Q1AA 2VSNA 5ENVA 5EIXA 2QR3A 4CMHA 3ZI7A 4DDTA 5KHLB 4AP6A 3AHEA 2VRCA 2X8LA 4AQYB 1ZRHA 2G70A 1ZGCA 1H9AA 3U3JA 3A11A 3EUWA 3F2VA 4KR3A 3MSCA 3O91A 4HMPA 5IANA 4L3WA 4JJ4A 4LC1A 1S9DA 4U6SA 3INNA 1SZJG 4OBXA 1XQ6A 4JYPA 3SVZA 2R0QC 3QA3E 2QMQA 1F2UA 1UOQA 3IELA 4GYKA 4KGXA 2JHCA 3RT7A 2PUWA 1ORTA 4UOQA 4COOA 4FKBA 1L7PA 2NTJA 1SRRA 2JIMA 3JTEA 1DTWA 1O08A 3B20A 3COZA 5LLTA 1OAOA 4NABA 1G0NA 2O7NA 5I9LA 4IIDA 5IJWA 2ECPA 5K1ZA 3SXJA 2VSFA 2D1YA 3DLIA 3KB6A 4ZMSA 1UPFA 4HDNA 3B2QA 3G5MA 4GGPA 3HGMA 5JS1A 1HQKA 1PTJC 4Y1FA 1QV9A 2VJYA 3V1MA 5M3BA 2QWXA 1F1BA 4JT4A 2YWCA 1IUPA 3CN9A 4D3SA 4F11A 1FRZA 1Q3TA 3SZRA 1RJGA 3NIDB 4UCQA 2WUVA 3GMTA 5FJJA 4B83A 4LE0A 4UNPA 1L5WA 3AIKA 5B53A 2C97A 2ODNA 4C0JA 5DISB 4KQWA 1WZ2A 2V9CA 2PJUA 3NHJA 3CLHA 2QBYA 1KMQA 4XEHA 4F93B 4AY4A 1WG8A 5TE9A 4BXOB 3PGXA 1RW4A 1XROA 2Q5QA 3C4JA 4J4TA 4ZJZA 2JAOA 1UK6A 2WJZB 3LUHA 1FY2A 1QYWA 3GCZA 4JGGA 1JTVA 1NF2A 1PG5A 3ZD8A 4CG0A 1FSFA 1P45A 3I3SR 2J0UB 4O2RA 4EB6B 4IDGA 3SZMA 2F59A 3M34A 3AQIA 3ED5A 4MDFA 1S3IA 3U9SA 2VKTA 1VJ5A 2G28A 3C4VA 3X1MA 2D62A 3L7YA 4FYVA 1EDBA 1SB9A 5BSVA 3CSSA 2OGTA 1U8TA 5L8VA 3UGTA 3HYLA 3DG9A 4Y2RA 5ILOA 4KVZA 1F7VA 1ACJA 1DWUA 4UCFA 1U1FA 2YQZA 1QCYA 2GAJA 4FHEA 1KP3A 1H5NA 1HEYA 3DAHA 4ZRDA 1K27A 1P2SA 1VI5A 1YJCA 4FWIB 1H94A 2BM8A 4MW6A 1MN6A 3TVTA 4QKQA 5AKIA 2Q07A 1J1ZA 4KHZA 1UXJA 5FL7D 3BUSA 1E5VA 4YXWA 4W5QA 3H1BA 1HUQA 1E2QA 4HLUA 4Y2XA 4JLJA 5ICFA 3D8NA 3LWNA 4XIIA 1TJNA 2BKLA 3O4IA 2OBLA 4F3NA 3UA3A 4YA6A 1HEIA 3DMFA 2XB6A 1XXHB 2Q5JA 3QUAA 2BFNA 4M7OA 2E18A 4RCYA 4V0SA 4BC0A 4J0IA 3VH3A 1ZRMA 3PQDA 4JGBA 4ZKEA 4DT1A 2IPLA 3JW8A 1DEHA 1S8NA 2PXXA 2RKBA 2H48A 1O89A 4UHCA 3UFXB 5G41A 1U6IA 1OWPA 4BMPB 3KVOA 1C30B 1DC4A 1LB1B 1Q12A 1YBVA 2CLFB 2GBCA 1MIHA 3GEPA 4LE1A 4UM5A 4BRZA 1EXWA 3U7RA 6ABPA 4YLGA 2OKGA 1A8QA 3L3BA 4RY2A 3M4ZA 2BR5A 1V48A 1XTTA 4RXTA 2YXBA 2YXLA 1IJKA 1UBLS 4REMA 4UEOA 3UENA 4BFVA 4EVSA 2AC2A 3HDGA 3LE8A 1C0LA 3NDJA 5HE9A 5H3LA 1L9KA 1YR2A 2B1IA 2DUWA 3MXOA 2IUSA 1GGNA 1ILEA 4L0QA 1FUEA 3CJRA 3OQPA 3PT5A 1HK7A 2X0EA 5KTSA 1FRNA 5E9QA 4OK6A 4BN0A 1G1AA 2GAOA 2JLSA 3IAEA 3FPKA 2MSNA 4MCIA 5AKYA 1ZVQA 2VXOA 2Y2UA 2E82A 3OM0A 1EVKA 2QLFA 5CJ2A 5TMDA 5AKZA 5HGXA 1DWOA 4LNUA 4JI3B 5LMCA 1Z6ZA 2BRUC 1RFLA 2QW8A 4MS3A 2C3OA 3NEYA 4LZWA 3GZNA 3CLSD 2QMYA 3D4PA 3AETA 2PQMA 4P4LA 5F64A 2ZRIA 1PZFA 1Y4SA 1U1DA 2XNKA 1H65A 2YNMD 1TM2A 3U3ZA 3VKVA 4CHTA 6LDHA 3L8GA 4PBRA 4W1RA 4OUDA 5CB4A 1HDXA 1M5RA 2IH5A 3V1TC 1TT5B 1M7HA 1VCNA 2RARA 1IUKA 4ZQFA 3CH4B 4B3XA 4CEJA 4Q05A 3ZX5A 5HOEA 1TUGA 2JJMA 4YHHB 3GCWA 4JDPA 3GLVA 3CVOA 4IRXA 1FFAA 3CC8A 3TD2A 3HU5A 1Q7RA 4DWWA 3OJOA 3RC9A 3OX2A 4GQBA 4IMRA 3K0AB 5SY9A 1JI0A 3KJFA 3NFRA 2XNSA 4WA8A 3RVKA 4H4CA 1Y98A 2QZJA 3K9FC 2V7VA 2FFHA 1ISFA 2JI8A 1MJHA 1PV1A 3ZTTA 1R0WA 1SXJA 2CC2A 2ZYHA 1OXTA 3K9LA 1NQTA 3ZV6A 4CYMA 1SUWA 1RI4A 2DWQA 4C0AC 3OD1A 4KRGA 4Z2YA 1UOEA 2AB0A 1OX6A 4IFTA 5ARCA 3KTFA 4IHQA 1FBTA 4KR0A 4RC9A 4HQLA 1JLLB 2B1JA 3O7MA 4I5GA 4XEUA 5E0OA 1YCHA 2W6PA 3A1UA 3FCSB 3QI2A 4TZKA 5CNIA 4B6FA 4D8YA 5KMGB 2ZIFA 3FTFA 5E6UB 3EJWA 3WMWA 3P2KA 3DBOB 1ZZEA 1Q19A 1EBFA 1YDHA 3BGIA 2DFLA 2UKDA 2QRKA 3NAMA 3J81k 4HAIA 1YTLA 3W4IA 3NRBA 3EPLA 1GEGA 1UM9B 4M88A 3GT7A 4PSAA 1QPZA 5A4MS 4RDXA 1YJ5A 2DHRA 3KQHA 3B7PA 3SICE 4OXQA 4P3YA 4IVRA 5F1PA 5CX1B 4A0FA 2VJMB 4HO1X 3THYB 3AERA 1CEXA 2R1VA 1EGMB 3BHJA 1E3TA 4LBWA 1BX0A 1KDPA 1A7KA 3K1JA 4OP2A 1I14A 1A4XA 1JZQA 1CWUA 2EKBA 2H3EA 1XTSA 2HDOA 2J5QA 5LC1A 2C2MA 3MJRA 4X65B 2EIXA 3NETA 1RBYA 4ZKDA 1CZOA 2P9FA 1QJCA 2F3QA 2PUVA 1CT9A 2IEBA 4AIRA 4E70A 1IEXA 1TIPA 1YRHA 4KYUA 1NKTA 4AJPA 3PKZA 1ESEA 1U2RA 4DL9A 1H85A 2WD8A 3CX4A 5EZYF 4YEDA 5ER6A 3TF5A 2OC4A 1KZ9A 4I4TB 1OBOA 4MUAA 5TPZD 2JGLA 1P1JA 3DE1X 4ZA2A 1OC4A 4XCQA 2DHQA 2EKZA 4HDQB 3MMPA 1SM4A 3JQAB 2JRLA 4QUBA 2OQVA 4BMSA 1Z7YA 4EFDA 1GRRA 1HDEA 3FGOA 1NRWA 3PUKA 3DDNA 1VA4A 2CMHA 3MYRA 1I6WA 1F0YA 2QMEA 3NXSA 5I5EA 4GAEA 3T5BA 3PEFA 2BEWA 3QH4A 4EENA 3R3HA 4JZYA 2I7DA 1I2BA 3GLIB 1N5IA 1MC4A 4OJMX 4S0XA 5BPFA 5AW1A 9MHTA 1W2HA