2LD4A

Solution structure of the n-terminal domain of human anamorsin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Anamorsin
publication title Anamorsin Is a [2Fe-2S] Cluster-Containing Substrate of the Mia40-Dependent Mitochondrial Protein Trapping Machinery.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ld4A00
2PT6A 5EOVA 3I64A 4YUYA 3BGVA 5KQRA 2YX1A 2AVDA 4HGZA 1XDZA 3OE4A 2ZBRA 2UYCA 4NECA 3MTIA 1WG8A 2AVNA 4EKGA 4PINA 3G88A 3GDHA 4GOLD 2ZTHA 3DP7A 4ATNA 4CKCA 1L3CA 1QYRA 2IBSA 2PBFA 3NWEA 3BZBA 3K6RA 2ZULA 3OCJA 3OU6A 2AN4A 2ZCJA 3HA5A 3I9FA 5MHTA 3DXZA 3LKZA 5HIKA 4PIPA 2Y1WA 1XJ5A 2B9EA 3CCFA 1NV8A 2BR5A 7MHTA 3ORHA 5K09A 4RTNA 5KQSA 2VDUE 2Z6UA 5DT2A 4Y30A 5ICFA 2P7IA 3KQSA 3UJCA 4QTUB 1G60A 3DUWA 2PWYA 1ZG3A 1FJXA 1TW3A 3FPEA 4XUCA 5DSXA 3TMAA 4KDRA 2QM3A 1P1CA 1R8XA 2PV0A 2ZBQA 3QOXA 3SX0A 1SUSA 5DXAA 3CBGA 2R3SA 3P97A 3SMQA 2JH9A 3KQMA 3R0QA 2EG5A 3PFGA 5DLYA 1JR4A 5EZQA 1NBIA 5EC8A 2ZIEA 3EVZA 4FSDA 2AOWA 3BWYA 2PT9A 4P7JA 5EMMA 3CJQA 2BH2A 3AY0A 3VC2A 3LSTA 1H1DA 2PXCA 1I1NA 1XCJA 3HVKA 3TPZA 2IH5A 3PB3A 4YUZA 4DQ0A 5EQJB 3THSA 4GQBA 3DMFA 1ZHFA 4PGHA 4DZRA 3P2KA 5K8VA 2BZGA 1RI4A 3LDFA 2ADMA 1D2CA 4RVHA 3CKKA 4X1OA 5EIFA 5EVJA 1Y8CA 1YZHA 4LWOA 4RTSA 1JTEA 2ZBPA 5FQNA 4AZTA 4Z2YA 4YUWA 5CIYA 3ERCA 1XCLA 3EEYA 3OPNA 4FT2A 2Z6QA 3NVKI 3R9XB 4V0QA 3I58A 2PSSA 4LWPA 3GO4A 5LQUA 4HTFB 4GUAA 2VZ9A 4RVFA 5DPMA 1DCTA 3KQWA 4PIMA 4RSRA 1EJ0A 3KPWA 2JG3A 1ORIA 3P9CA 5E8RA 3KR1A 4FS8A 2PXAA 1NW7A 1JQEA 2FK7A 3PX2A 2NP6A 3FRIA 2NXNA 3OU2A 4E2WA 3CJTA 2KW5A 4C06A 3KQVA 5DXJA 2YUIA 4IV8A 4BLWA 1M6EX 5D1HA 1NKVA 5FCDA 1JG1A 4KWCA 2AZTA 1O9HA 5GM2A 3HCEA 1KYZA 3NVMB 5EKXA 1JSXA 2C7PA 1NW3A 4LECA 4ER7A 4IKPA 4KIFA 3G7UA 5DTQA 3PTAA 5BP7A 1MHTA 2ESRA 3KR2A 1QAOA 4GF5A 4RTRA 5E9JA 1EJ6A 2P35A 3M6WA 2G1PA 3BT7A 3UJ6A 3ER8A 3GRZA 1PRYA 1P91A 3GNLA 4PYIA 5HILA 4X63A 4C07A 1PJZA 3LCUA 3VC1A 3DLCA 4DA4A 4HGYA 3ELUA 3HVHA 4PONA 4EMSA 5LQCA 2QYOA 1EG2A 1I9GA 4IV0A 3SSMA 4FGZA 5ICCA 1N7IA 1P39A 1RI5A 2ZWVA 3UZUA 1OR8A 3DOUA 3FPJA 3FYCA 4GC5A 4OQDA 5FA5A 4AUKA 5K0GA 4YV1A 3C3PA 3GJYA 4PYKA 3BGIA 1YZ3A 4ER5A 4G56A 3FTFA 5D1NA 3B3JA 1F38A 1UWVA 3H2BA 4XUEA 3EVEA 5GIPE 4DF3A 4PGGA 5CVVA 3G2PA 3EVFA 4DKJA 5DSTA 3EGEA 3I5UA 2FCAA 3DXXA 3TQSA 2CL5A 1L3BA 1BOOA 4BP1A 1JSZA 5JUWA 1RJDA 4JXJA 3GCZA 3MQ2A 2O07A 5DM0A 3LBFA 2OBFA 5FQOA 1IM8A 1KP9A 5EGSA 5FHQA 1RJFA 4GOND 1V39A 3OZTA 3M33A 2IFTA 5IKMA 3MCZA 4GOMD 5G02A 3G2MA 4C05A 2O0LA 1G38A 1G8AA 2GLUA 1RI3A 5H02A 5K0EA 2CMHA 2NP7A 3OZSA 4F86A 3EVAA 5K0NA 2BM9A 3HA7A 1QAQA 3MB5A 2O05A 2B25A 3FPGA 4PYQA 2IGTA 2XYQA 4MTLA 2PX5A 3E05A 2P1DA 2UYQA 1D2GA 3R6TA 1NBHA 5ERGB 4QPPA 3UJ7A 1SQGA 2R6ZA 4BP3A 1G8SA 5K0BA 3T0IA 2K4MA 1UIRA 2AOUB 3M6XA 1O54A 1XXLA 5E2BA 3LGAA 1U2ZA 2CWWA 4L7VA 4P7FA 3VSEA 5LQNA 2DULA 5DTMA 4E2ZA 5CCBA 4MQ4A 4OA5A 5FHRA 3TKYA 1FP2A 4QVGA 1X19A 1WXXA 5KYGA 3CGGA 3E23A 3UJ9A 2AR0A 1KPIA 2ORED 4AZSA 1JQDA 3F4KA 3B3FA 1L9KA 3Q7EA 3IYLW 3KQQA 5EZSA 4EQZA 5HIMA 5LQKA 3PLAE 2B2CA 5K0CA 8MHTA 2OB1A 4FP9A 5GOZA 2PXXA 5DTRA 3IHTA 1QANA 5K05A 4DCMA 1VP3A 1XDSA 3JWIA 4FR0A 4YMHA 5CVUA 2IH4A 3HVJA 3UJDA 4IWNA 2B78A 3DLIA 1T43A 5T6BA 5U4XA 2XVAA 1R74A 1X1CA 5CVEA 4E30A 1EIZA 2P3LA 5E2AA 4OX9Y 3R24A 4Y2HA 2ZZNA 2ZFUA 5K0LA 2EJTA 1Q0TA 4RX1A 3KQPA 3S68A 4YMGA 2QE6A 3GIWA 3HNRA 3P9KA 4XUDA 3ANXA 5DX0A 5LSAA 1G6Q1 5HIIA 4RTOA 4F84A 4RTKA 5T64A 3HVIA 2OKCA 2PY6A 3GU3A 2OXTA 1R00A 4DMGA 3C6MA 1DL5A 4ER6A 4QQNA 4E33A 3T7SA 10MHA 4ZTBA 2VP3A 2C7QA 1R8YA 1O9GA 1IXKA 2EX4A 1VLMA 1N2XA 2B3TA 3SSNA 3P2EA 3LHDA 5M5BA 3THRA 3D2LA 5CUQA 1YFLA 1HMYA 3TOSA 4XCXA 2V74B 2WA1A 4U7PB 5DM1A 4U7TB 3RW9A 4A6DA 1TW2A 1VBFA 3G5LA 5DX1A 9MHTA 3GXOA 4PYJA 2P40A 2ZWAA 3GRUA 2NNWB 3L8DA 3BKWA 1WXWA 3G8AA 4KW7A 5DWQA 5GP1A 3U81A 4RTJA 3UJBA 5ICGA 3BXOA 4EK9A 3FUTA 1NV9A 3NDJA 5EPEA 3LDUA 3E8SA 2FYTA 3EMBA 4C4AA 1YFJA 2P41A 5LQRA 5EG5A 3DTNA 2NYUA 1JQ3A 1SQFA 5E9WA 4CKBA 2O06A 4QDJA 2G71A 5C0OE 3M6UA 4GC9A 4KRGA 5FWDA 2YXLA 3HCCA 4C08A 3SM3A 1FBNA 3OU7A 4QVKA 1RI2A 4CWAA 3G8BA 2FHPA 2P8JA 3A27A 2PJDA 3O7WA 4O29A 1WY7A 3KPUA 4C03A 4CKEA 4MHTA 4GEKA 3M4XA 5E8JA 3EVDA 1RI1A 5LR6A 3DMGA 2GA9A 2QRVA 2P7HA 1YF3A 5FTWA 1YUBA 5E1BA 2N47A 3DXYA 2ZW9A 3GGDA 2AOTB 2YXDA 1XTPA 3KPJA 5DM2A 5EMJA 3WSTA 2A14A 3KU1A 3P2IA 2H11A 1Z3CA 2E5WA 3EVCA 5DRTA 5ICEA 3EGIA 3LBYA 3DH0A 3SVZA 3A7DA 1NW8A 1KYWA 3CJRA 4PYNA 4QQKA 5F2KA 2HMYB 5K01A 2UZ4A 1X1DA 4BLUA 2IP2A 4WVLA 5HIJA 3OE5A 3A25A 5F2OA 4OQEA 4RTPA 5LQJA 3K0BA 1KPHA 2PKWA 3BWMA 1ORHA 3GRYA 2ONYA 2ONZA 3Q87B 2G70A 3T7RA 2DPMA 3FUUA 2PX2A 4ISCA 3G89A 4GBED 5EHIA 1G55A 5C9ZA 1IY9A 3P9NA 2JJQA 5E1DA 4QPNA 2ZVJA 3KR9A 4YV0A 5BXYA 3EVGA 3UJAA 3HCDA 3RIEA 3CC8A 4M38A 3SR4A 4X41A 4V0RA 2EFJA 1ZQ9A 4QTTB 4RYLA 1KPGA 1ZKDA 4HSGA 4RWZA 1R6AA 1FPQA 1R18A 1X1AA 4X61A 1TPYA 3TRKA 4H0NA 4OBXA 5F2NA 3QOWA 5EMLA 5HFJA 4BLVA 3REOA 3NMUF 3NJRA 3M6VA 2AN3A 1NT2A 3JWGA 4KIGA 3DULA 2GPYA 4YUVA 3T7TA 3EMDA 4F85A 4RTMA 3O31A 3NW9A 4AZWA 5CVJA 4QDKA 3A7EA 3FZGA 1WS6A 3DMHA 3GWZA 5EMKA 3JWHA 2FPOA 1XDUA 5EHGA 2ZSUA 3LCCA 2ERCA 4HH4A 1JTFA 2GB4A 4DCGA 1BHJA 2FK8A 4RTLA 3HEMA 3R3HA 3ELDA 2JH8A 3AWIA 4CTJA 5GINE 3TKAA 1AQJA 4E2XA 4YUXA 2HTEA 4E31A 2HWKA 2H1RA 2PVCA 4A6EA 2OZVA 4R05A 2JHPA 4HTFA 2OO3A 4PWYA 3GRVA 1P1BA 2IPXA 3P8ZA 5GWXA 3TR6A 5BW4A 2HR1A 1BKYA 3C3YA 3EEOA 2HNKA 2PWPA 1RJGA 4E70A 4P7GA 3MHTA 5K03A 3HA3A 1F3LA 3FRHA 4M36A 5K0FA 5EKUA 2BR4A 3SXJA 4WXHA 1KIAA 3ID6C 4DM3A 3FPHA 4X60A 3PVCA 3FTCA 3BWCA 3TM4A 5C1IA 4OA8A 4M7RA 2NXJA 3ER9A 3GRRA 3AJDA 2JHAA 3PFHA 4B17A 2ZZMA 2OB2A 3QV2A 5B1SA 3RODA 3BKXA 1VP9A 2H00A 2VS1A 4BY9E 5GM1A 2Q41A 3BWBA 3KQTA 3UJ8A 2IBTA 5KS2A 2WK1A 2CMGA 2GAFA 2ZZKA 1VL5A 3ELYA 1KXZA 4R8SA 3UA3A 2I7CA 5K0JA 3KPYA 3FPFA 3KKZA 3G5TA 3MAGA 5LQAA 2EJUA 3C6KA 3EPPA 5JR3A 2C7OA 3TM5A 1I4WA 1JG3A 2ZLBA 4HG2A 1HNNA 2FRXA 3NDIA 2PX8A 5EEGA 3UFBA 1MJFA 2AOTA 3DR5A 3VYWA 4OBWA 4M37A 4CXMA 3HCAA 2PLWA 2QY6A 1SVUA 1X1BA 3PX3A 1VQ1A 3B89A 5EIWA 2P3QA 1M6YA 5HZMA 3LKDA 3M70A 1WZNA 4R6WA 2OYRA 2VDVE 3FUVA 3LDGA 3I53A 1FP1D 5FUBA 1AF7A 4EVIA 3A26A 1AQIA 2I62A 3G2QA 1VE3A 4KDCA 3MGGA 4PYLA 3P71T 4ER0A 5FA8A 3HP7A 3B7PA 4AZVA 2AN5A 2XYVA 3LX6A 2YXEA 2IDKA 5KVAA 3HTXA 4R6XA 2PGXA 2F8LA 2BR3A 3B5IA 3EGVA 3IEIA 3LCVB 3X0DA 4MIKA 4GOOD 4ER3A 3OFJA 4AX8A 5CCXA 1JG2A 4K6MA 1SKMA 2UYOA 3TLJA 2NXEA 5HEKA 3V97A 3UBTA 1Q0SA 1INLA 5FADA 3HCFA 3IV6A 3KQOA 1KR5A 2YVLA 3FUXA 2P3OA 1XVAA 1UFKA 3OFKA 5E9QA 5GIOE 3EVBA 4FT4A 3KQYA 5DM4A 5T67A 1NW5A 3KHKA 2G72A 5CM2Z 2OPBA 2IH2A 4PYMA 3FUWA 2PX4A 1SG9A 3SSOA 1QAMA 2IIPA 2BM8A 3FTEA 2ZIGA 1EQAA 3LECA 4LG1A 5DX8A 3UA4A 5P8WA 1L1EA 2AS0A 3FYDA 1RJEA 4E2YA 3AXTA 4RVDA 5BW5A 1N7JA 2HV9A 2JHCA 3SGLA 4PCLA 2AOUA 2YTZA 3JWJA 3O4FA 4KVZA 4PYOA 2NXCA 2AOVA 1L3IA 4PNEA 3E7PA 4YV2A 4MWZA 3KR0A 5E1MA 2YQZA 3NWBA 4PCAA 1YB2A 2I6GA 2XVMA 4C04A 1ZGJA 5FWAA 4HRAA 2V7EA 2OY0A 3G2OA 2Z6AA 4FSXA 3A4TA 3PS9A 2YR0A 4HC4A 4EKIA 1NE2A 3AXSA 4R8RA 4E32A 3KPVA 2WA2A 3FTDA 3BGDA 3ELWA 3MERA 3ME5A 3B3GA 3BUSA 3HM2A 3LL7A 3NTVA 1SUIA 2GH1A 1NW6A 4RV9A 1ZGAA 5FULA 3TFWA 5CD1A 3C0KA 1B42A 5HOQA 2AOXA 3PT9A 4FZVA 4RTQA 2C7RA 1D2HA 3LPMA 2O57A 4UOEA 2XYRA 2I9KA 2IDJA 2Y1XA 4P58A 5E1OA 2CKDA 1QZZA 3HCBA 2VDWA 3CVOA 3P9IA 5IH3A 2UYHA 3V8VA 2G8NA 5DRYA 5EEHA 4P7KA 1AV6A 1DUSA 1BC5A 3MCTA 4POOA 1M0EA 2LD4A 2XBMA 5CVDA 1EAMA 3OZRA 3UWPA 2GS9A 1KHHA 4CTKA 1JG4A 2QRVB 3MTEA 4RVGA 1VIDA 1VPTA 2ZIFA
chains in the Genus database with same CATH superfamily
1GZDA 2JIBA 3LUKA 3L7BA 3NBQA 4Y2PA 5IZCA 4BVKA 1ZVKA 3CIOA 5CEEA 5JXJA 1ZC3A 1USKA 1MJGA 3PEEA 4B7XA 1N5DA 3R7DA 4QQFA 3MRTA 1A4UA 1GJRA 1Y7LA 1E4VA 3OTQA 4K6GA 4M7OA 3D0OA 4R8LA 1VHJA 4G0MA 5AJWA 3I2KA 5SZJA 3SYTA 3TG8A 1XROA 2QL6A 3DEFA 4WOJA 1NBOA 2ZRKA 3MUOA 3LU1A 2R4QA 3NHFA 2QZ4A 3SQMA 4AKTA 5HZGA 1SKAA 5IT9A 2RHMA 5H8WA 2HYDA 2WUVA 1K5PA 4NDAA 1ZH4A 3PHJA 5K3SA 1J90A 4GSLA 3A6EA 4PG7A 1GG2A 4YCSA 1IOWA 4EZEA 1P6XA 3CYFA 2CL7X 2X8BA 4LF4B 3KOYA 3AVYA 1IEQA 1LLDA 4E2FA 3IBYA 5H80A 2VSQA 1VE9A 1EGMB 2D62A 3KQSA 4I50B 4QUIA 1G60A 5ICFA 3RYFA 3SJZA 5JFTA 5BYJA 1YB6A 3RI3A 9LDTA 1JI3A 4K9LA 4CMCA 3VYVA 1DEKA 2ODEA 3FHLA 2QM3A 3QOXA 3DWIA 1CRWG 1XTIA 3SX0A 1R3UA 3OP1A 1PWYE 4KR9A 1IMJA 4Z9FA 4OLAA 2HRZA 2PBZA 4C21A 1UAAA 2DWCA 3GYGA 1M73E 4RAOA 4WCFA 2CLMB 1M0TA 2E5FA 2CC2A 1MNQA 4I8DA 4V1CB 1EGVB 1N6RA 3T35A 1KI1A 4BBAA 3MHPA 5B1YA 5ELMA 3WRYC 2LDBA 4WZBA 3GROA 1ZK1A 1VCIA 4GVLA 4ZU1X 1HTTA 5SYNA 3S70A 4G07A 5CDSA 3VNSA 4S2EA 4BO8A 1Y0BA 1QPBA 2ID4A 2V98A 2ZKIA 4A73A 4G0WA 2OC9A 4MVJP 1UBKS 2VYND 4YMVA 1NN1A 1U5AA 3AIIA 2R1TB 2D1FA 3H19A 1G8FA 3OA2A 3PQ5A 3QPUA 1ZIYA 2F1OA 3IUSA 4U0JA 3DYBA 4V0ME 1E3QA 4X1OA 5C7LO 2ASEA 3IUJA 2E4WA 4YJ2F 5IUJC 4CV2A 3GUZA 5H9WA 2ZB4A 4CCSA 5F2EA 4C0QC 5EMHA 1PV2A 1KEWA 3DE4X 2HI0A 4DKXA 3C15C 2QSJA 3CNHA 1HYGA 2G9VA 4V0QA 1BNCA 4EF4A 1AKQA 2IIBA 4MV7A 1HPLA 2X9LA 4QHYA 4U39A 4GI1A 1OFHA 2FSUA 1CUDA 2HM7A 4R84A 4XOUA 2OQVA 5FUVA 3WISA 1E92A 3ZYZA 4AZ0B 2JG3A 1K75A 2ZIUB 3I6BA 2NXNA 4H1WA 2E87A 2R4UA 3G59A 4KOAA 5F3WB 1EX7A 5GJCA 1QGZA 3UKOA 1EZ4A 5EIBD 3RHFA 3P7MA 1Z5NA 3U26A 2ZUDA 1W88B 3NNNA 2LPMA 1E62A 2OFXA 1E1QD 4GE0A 4LECA 2Q2OA 3W3AH 5B58C 3MWFA 3KB8A 4RHFA 5DWVA 1CR6A 2ZVQX 3PENA 4MICA 4EFDA 5C53B 5E9JA 2OV4A 2O52A 2G1PA 4Z4CA 3OO0A 1IC6A 4FU0A 1FXWF 5J5AA 1QK5A 2ID8A 1ZJ6A 2OE2A 2QU8A 5EYPB 3T6KA 2XQKA 4PONA 3IUMA 1FTYA 1N6PA 1LDGA 1MB3A 3GT0A 3AJ9A 3VO8A 4I8IA 1C7RA 1H9AA 1O57A 4GPEA 2B4KA 2R6DA 3QXSA 1C50A 4HOYA 2IUEA 3LIIA 4R2IA 5G53C 1F2TA 3NOOA 3UZUA 3N76A 4YXWD 1SBCA 2PZAA 3CB4A 3OY7A 3LWNA 1LK0A 1E60A 3TG2A 1Z56C 3R4CA 1KK3A 4HT3B 1KIMA 1YMQA 3QRWA 1Z35A 5D1NA 4FXOA 4BNJA 4LYAA 1WF3A 1CY2A 3C39A 3BM5A 3ZY4A 2RIPA 1UZAA 4IGFA 1BXGB 3CLVA 3IPAA 4E5VA 5EXEA 4QDUA 5EKTA 3I5UA 5HBGA 1LTQA 2GO7A 2IZ5A 3QA3E 5BSWA 3U9SA 4FDUA 3R5SA 5B5SA 2X22A 5G1NA 4TT3A 4V1CI 1N2EA 1A4RA 3EIEA 4K6CA 3V1LA 3WHPA 4QPDA 4JFRA 4BN4A 1VGVA 1WMAA 1GNSA 1SKYE 1JHRA 1WUKS 1P80A 1WWKA 5K0EA 2GARA 2YCBA 1UMDA 1GDTA 2RGXA 3GD5A 1GUAA 2XQJA 3E0XA 4OMUA 4QAJA 4MVJA 3BAZA 4PYQA 3RVMA 2XYQA 4QASA 1JJIA 1I5OA 1YZLA 5IKPA 2GK6A 1CDZA 1DQNA 1V71A 2UYQA 4G81A 5DCWA 4AO6A 2OZPA 3WP0A 3RS0A 1N2GA 5HFAA 1WSAA 2WIBA 5F7ZA 3BE8A 5F9MA 1Q7BA 1SK9A 4BP3A 2RGEA 3QK7A 3AX6A 2A88A 4ZI7F 2AOUB 4CL8A 1ZRMA 2GEVA 2RCYA 4FOTA 3VSEA 3T1QA 3B6JA 4M8SA 1ZPDA 5FHRA 1ZU5A 4QVGA 4WY2A 3UWKA 4CHTA 3WMFA 1GYQA 2AZ4A 1L5VA 5J59A 1P7PA 2BGMA 3OJ0A 1L4EA 4ZPXA 1ZGBA 2DFLA 3PRKE 4DS3A 2C2OA 2EU8A 4DCNA 3IYLW 1DX6A 1ZX1A 6PFKA 1U7ZA 5CIQA 5GPBA 3QFRA 5E7JA 1JIIA 1L6RA 4RZ2A 4F9EA 4J43A 3FLMA 1V1JA 4YRCA 3IHTA 2VWGA 3P9SA 4DJTA 4IVNA 4GM4A 2NN3C 1VJ0A 1RKUA 4DHWA 3U09A 1XTVA 3GGJA 4GU5A 4D43A 1YR2A 1WSWA 2QF7A 2DHCA 3PA8A 2NUBA 4HDNA 4NNJA 3EAGA 4R0MA 3SVLA 3QEAZ 4KR7A 4WEOA 3GP8A 4AURA 4IQ0A 5KC9A 2H1SA 2Q5CA 1L5HA 5L8VA 2GYWA 4F06A 2BFCB 5LMNB 4HSEA 1QSGA 3TIIA 4LMRA 1JLRA 3RFTA 4CIBA 3ABRB 1BXRB 4LK2A 4BEWA 5LQKA 3HJTA 3C1OA 5EIHA 3HVIA 1GCIA 3GU3A 4R5HA 3GLRA 1V16A 3WTBA 4EMUA 1AXRA 3A9UA 1DL5A 1M2WA 2ORIA 1ZWLA 4Q7MB 4C14A 1HGXA 4JVMA 3RVLA 3CUWA 2BBOA 3P0FA 1TEVA 1TZKA 4F8YA 4BDTA 2BUCA 2HMUA 2Z0MA 1KQGA 1R8YA 2VDLB 2GM4A 3I6ZA 1HNWB 4KP7A 1Z4QA 1NBAA 1P7ZA 3OF5A 2YZGA 4HGOA 1T8RA 1E1CA 2B1JA 1C9NA 2RD2A 4J94A 2Y1LA 3W04A 4DZZA 3AM4A 2M98A 2HGSA 2D7JA 1QCYA 1U63A 4RD4A 4DNPA 5CP8A 3RF7A 5IKXA 2CV2A 1ZRNA 4NYIR 2DQZA 3E58A 4FQ8A 1UAGA 1YJAA 2HPHA 3BKWA 3Q10A 1Y9AA 3E27A 3NV7A 1Q0QA 1CF2O 2EZTA 3G1TA 1DRVA 2EX0A 1X74A 4M2LA 1RJ9A 2FYTA 4C5AA 3HB5X 1U9IA 1MGPA 3QPVA 5ESXA 3RFVA 2IS4A 4PG8A 1Y8ZA 1JU3A 1HLDA 3DZJA 3PRHA 1T9GS 3EIWA 3H3FA 3KQUA 2JFOA 3UGQA 4A1OA 3M49A 2WWXA 4IIEA 1SVLA 2B0JA 3K8YA 4DMMA 2BGKA 5ALJA 5KWIA 4KE8A 3A2MA 2PFKA 4CL3A 2YWEA 1PJCA 1ZUWA 4OAOA 3VR6A 3AYXB 3ZWVA 4ZCQA 4G5SA 2DXIA 4XYBA 3NTRA 4N40A 5AI5A 4ZQBA 3LE8A 4L7QA 2C1ZA 1GRNA 1AT1A 3D3JA 4J3NA 1UBMS 2JS7A 3BWXA 1GXSB 3K70C 3E18A 2F8SA 4N0EA 2G36A 1NGSA 1HUQA 4HFMA 4OUDA 1JHZA 1UJ5A 3VR1A 4B3FX 4NYMQ 3W2IA 2X14A 2RB5A 4NZOA 3WMGA 3A7DA 4GQIA 4Z2AA 4AY5A 3RARA 4ZN6A 2E85A 5C8DA 3BFJA 2VUUA 1X1DA 5FBRB 3GZJA 2VBIA 3HEBA 4LISA 5HJ5A 4QTXA 1N6HA 2WVHA 4MR9A 5JSZB 1G59A 1PJRA 4TV9A 1OXUA 4BMCA 4FYJA 2KX7A 2ZBEA 3KYIB 4UFPA 1X86B 1AGNA 4GX2A 4EJFA 3HCDA 1PZMA 2WWYA 1Y6JA 4XEUA 3SJCA 3OE7A 4XSVA 3WAKA 3THXA 3ROMA 4HSGA 3W9SA 1PR6A 1PFQA 3SF8A 4L76A 4DYVA 2A1TS 3GLUA 4PRYA 4LRUA 4X61A 4H0NA 4G67A 2BDTA 2W2OA 4C76A 1ENPA 4K9PA 3WGGA 2D4HA 4G9EA 3I39X 2QG4A 1IY1A 1J8QA 1O2DA 1E9DA 3TS1A 2HF9A 2XKAA 4MCIA 4OJMX 4H59A 4GL4A 4COKA 3FN4A 4H6XA 4G0UA 1I3MA 3OCWA 2CXXA 2R6AA 3DBLB 3ZHCA 4BJ1A 4G1FA 5EMKA 4QHTA 1RM5A 3JQFA 5T67A 3VR3D 4GUDA 5EHGA 4AKEA 4OHOA 4K6HA 1S5PA 1TO6A 4EW6A 4H16A 2E55A 4U7GA 1BHJA 5FLKA 2V3WA 3HEMA 3QPAA 5K3FB 4A8HA 1YC2A 1MKYA 4G24A 1I0LA 5IYZA 1E58A 1XKTA 3RS7A 1F51E 3G7SA 2GPTA 5ANRB 5F7XA 5DHRA 3W3ZB 1VL8A 3CZRA 1N6KA 3OQIB 3RJ5A 4Q3BA 1C14A 2GCEA 5CNIA 3VH2A 4DB2A 5AOAA 1EHCA 3N0RA 4ZYXA 1RLUA 1VDMA 1BKYA 1KOJA 2A3NA 1PT8A 2NOAA 2XEXA 3NQ41 4FOOA 4DWOA 2RB4A 4LSGA 3BJRA 3BMNB 4NZ9A 1X7WA 3ACBA 2ODWA 2P6PA 2C0CA 1RNLA 2VBGA 2ZRIA 3E7DA 3M81A 4PF1A 4RHEA 4YRBA 3QVUA 1P72A 1NL3A 2WJVA 3SS7X 5EGNA 2WWVD 2AFRA 1L4FA 4MRRA 3AV3A 1T5SA 4MRAA 2ZIXA 1V96A 4R9SA 2IYNA 3EGWA 1J97A 2JFQA 4AJOA 1NG9A 5IAGA 3ICWA 3I28A 2GEKA 4UAVA 3RAEC 4NJEA 3GARA 2X19A 1P1IA 3H1TA 4NENA 3TTYA 2RHCA 4ZYYA 3E70C 2G0NA 3E9EA 2O1XA 1TI7A 1UT5A 4RVSA 4ZCTA 4BNVA 2B1IA 4K05A 1L1RA 3U7EB 3ZXSA 4JLJA 3DL7A 4JITA 1O8CA 4R8VA 2Q1WA 5AIAA 3MT8A 3OI7A 3H17A 1JDPA 2IYEA 2APJA 3UMJA 4QUHA 4LHEA 5BOSB 3IT2A 2P1ZA 3U4IA 5ALMA 3VHRA 4O4IB 1BXKA 1SVUA 1VTKA 1X1BA 3JZAA 4NZYA 3SJBA 5HUJA 1JDZA 3RWBA 5C52B 4W5NA 1ACLA 1UC8A 1WZNA 2GNOA 3NV9A 4XGIA 1AV7A 1JBQA 3OLQA 3QNWA 4MW1A 2OYRA 4KQMA 5FRDA 1GRVA 3KKQA 2RONA 3FB1A 4K9DA 2FPUA 1CWUA 1QQTA 3G2QA 1FVXA 5FUYA 3HM9A 4OP3A 1FQWA 4PYLA 3WGYA 1NAHA 2HTFA 3UATA 3C3BA 2CVPA 2D1QA 3PTZA 4OVKA 5IT0A 1EVKA 4P54A 4WVFA 4J1TA 3ST7A 3GUVA 4A23A 1ZN8A 3ON5A 2P75A 5L7YA 4HNQA 2B82A 3B8HA 2YINC 4IIBA 4WSOA 1SXJA 2DH5A 5CCXA 2IHUA 1NAIA 2W2LD 2P6MA 2WSBA 3I62A 2FUKA 2W70A 3S1LA 5CYFA 3DKKA 3UBTA 1Q0SA 3O8LA 4D79A 4UMFA 4CKWB 1L8LA 2Y8EA 3O2QB 3OT5A 4LDQA 4XQ9A 1YDMA 4MEBA 1BDIA 5A0VA 4X62B 4DR4B 1DINA 4HN2A 3RR2A 3T3OA 4IEFB 5CW2A 2VQSA 1WKVA 2J32A 2BM8A 4OXQA 3PK0A 4JFAA 3D2AA 3AFNA 5F7OA 1O0BA 4YDHB 3W05A 4ARUA 1PVDA 3L8ZA 3H0CA 2IEZA 4MQLA 1IHXA 4K9NA 4TYPA 4UTPA 2X4DA 4NMWA 1BZYA 1D8AA 1K7CA 3FJOA 2JHCA 4G1UC 4H35A 4REQA 4L8YA 2J0UB 4BJ3A 3K1AA 5EINA 2P9JA 4QATA 1T3SA 2RBGA 3CLRD 1FW8A 1G4AE 3CNLA 2JGKA 4U2GA 1Z5WA 4UEWA 1LKZA 2ZQYA 3HXKA 1OASA 4OLHA 3FOAA 4HDRB 3I5XA 3B2EA 2XB2A 1P8AA 1ML4A 2OY0A 4RQUA 1YIOA 5JADA 1OI4A 4KRYA 3FZEA 3ZR4B 1Y9ZA 4KXYA 1QR2A 1GAWA 4DR3B 5L3RA 4C78A 2NPFA 1Y1KE 4N8SA 1CR4A 4RV9A 1X80A 3Q5EA 4JI3B 3AG5A 5CD1A 3VKFA 2Q9CA 1IK6A 4IRXA 3F9IA 4UQOA 4CIVA 4UOEA 4AB1A 4KHPB 4C0JA 1QZZA 1MB0A 3E61A 3PNLA 4UUAA 3QX3A 2XNDA 1E5QA 2FAXA 4QODA 2O19A 3CH5A 3W8DA 1GZVA 4MINA 5B64A 1T9AA 1QO9A 1T1SA 1JMVA 1WL8A 3L0DA 3QHAA 1FU8A 4CTKA 1P3DA 4IINA 4IJMA 4Z3DA 2Q0SA 4DBZA 2IA5A 2MYNA 1PV1A 4RBNA 3D3WA 3FSRA 3U7QA 4AJ1A 2BTEA 1I6MA 3LX8A 3ZIDA 1BMFD 4R3UC 1X7YB 4RFVA 4XGRA 4B43A 4IQ8A 4M1QA 4EVSA 1ZMOA 1YXMA 3LUGA 1MOSA 3AVTA 2UYCA 1V6CA 2HT6A 3HWWA 3VKUA 1WG8A 3GB9A 3IQWA 2DSTA 4BUJA 4RY8A 2Z4SA 4CKCA 2HA6A 3V55A 1L3CA 4GG1A 2I22A 3C16C 5KYYA 4LRSB 5C1PA 1G9SA 2FUEA 3H6KA 1IN6A 4RETA 3GEGA 4YREA 2VDJA 3UCFA 2CNBA 3OU6A 2Q2VA 4O8ZA 2WM9B 3C87A 2WB2A 1R8SA 1YDGA 2CHEA 1NR1A 1H6BA 2Y1WA 3QLEA 4MJLA 1IY8A 1JEJA 1ETUA 3KWMA 3RC9A 3TXAA 5KTRA 1XV5A 5K09A 3LY7A 3N5KA 4O1HA 5IK2A 2GYUA 1YIDA 3M2PA 1MO4A 4RTNA 3T7AA 2J4CA 5DT2A 3ZVRA 1YHZA 4KMOA 3JQAA 1SOAA 1YS1X 1F8YA 3RYHB 4BMOB 4TMZA 1BEZA 1FJXA 1ESEA 4H3HB 4XUCA 2PPVA 1Y6FA 5THXA 2ZUEA 2MOKA 4A7PA 3URMA 4E13A 3DBRA 3PQ8A 2I33A 5EP2A 3CBGA 2OWEA 1GPJA 1Z7GA 4MP6A 3SD7A 1WBDA 1AKNA 3BS4A 4MWDA 3RSOA 1KSJA 3HGMA 1GPYA 1UZMA 2AD1A 3AWDA 1GTMA 3PFGA 2ZUFA 4YYZA 3HKEA 3JQGA 3TW0A 2UZAA 1GTSA 4NAVA 1KR2A 5G41A 4HB3A 3DLAA 4N54A 4R2WA 4P7JA 3M3DA 3KSMA 4Y1EA 5I9SA 3X1XA 3AFHA 4AG5A 5F52A 3AO0B 1VC2A 3LSTA 1TQ4A 4ZIRA 1CUBA 5LP6B 1G3UA 2NIPA 3WA7A 4TM8A 1OE0A 5CDFA 1H2ZA 4TXHA 3HDHA 4HDMA 4KNWA 1PT7A 2GCOB 4QNNA 4MCAA 3E22A 3SG0A 1CRQA 2BCGY 1YZHA 2C5AA 4JSRA 721PA 4I4IA 3N2GB 2LGJA 4RTSA 2ZBPA 1H5NA 3GLTA 2WJ4A 2C42A 1GR0A 1RMQA 3D1LA 2CNOA 2ANBA 4HYEA 1P31A 4M0UA 5FYDA 2A1UA 3R9XB 2H4WA 3AUUA 4MVJH 1P3Y1 2I3BA 1O3YA 5AHRA 5M2QA 4GRDA 1YZNA 1YFZA 4GYJA 2YDYA 3NDBB 4PIMA 1J70A 4CETA 1JDVA 3O0DA 2Q5QA 1B6SA 1NVAA 1CRLA 4XD2A 3MINB 3K1ZA 2GM9A 2H8KA 3KZ1E 5EERA 3PZRA 3FPSA 2IYYA 2FN9A 2WJPA 5B55A 2SECE 2QN2A 5D1HA 3DO5A 4KWCA 3DFIA 2I6FA 1TM7E 5JSKA 2XNHA 5BUSA 2BUAA 3QJYA 3A1UA 3AF1A 4KIFA 4KQGA 5DTQA 3KWJA 1FJGB 2ESRA 1FFEA 1KJYA 1EUDA 1Z06A 4OQPA 3R3XA 4MAAA 3QYJA 2D2EA 4DSNA 2IOHA 3UJ6A 3G0IA 2XUDA 2DHDA 3MWEB 5HILA 3QELB 1H8HA 4X63A 4IILA 3FDZB 2JH3A 3P0RA 1SFRA 3DLCA 4HGQA 5FL7D 5ICMA 3LRXA 4RACA 4U9UA 4Z4HA 2NTVA 2Z8ZA 5A05A 3KZVA 5DBFA 1SURA 5IJZA 2PUHA 1TQ2A 1P62B 4B3BA 3KSBC 2FKAA 3R5HA 1EB8A 1O95D 1RI5A 2OENG 2P9YA 4V38A 1Z37A 2NM0A 3MLBA 2NW6A 4HYYA 4LX0A 4CF7A 1OWMA 2IBMA 2J5XA 3GWGA 5NULA 4COOA 4G2NA 4EG1A 2Z8XA 3EF0A 3C3PA 1I7PA 3VKHA 1S7CA 2GHIA 1XBTA 1XAGA 2VAVA 3CO5A 3A3YA 1Q7CA 2ZM5A 1X8KA 3OECA 4QBKA 3K71B 4DV4B 4J0DA 1UWVA 1TVMA 2OMKA 4JLUA 3X3HA 3CUYA 3PUYA 4L4UA 1R4MA 4PGGA 1WW3A 3NETA 1W36C 1HDGO 4NBTA 4FE4A 3WLJA 4ARAA 1H23A 4S12A 4EBBA 3DF9A 1CY1A 5DP2A 4UNRA 1U31A 1GDDA 1N0UA 2A9FA 2FPWA 2PS1A 4FN5A 3A04A 4D74A 4D57A 2P9TA 2EGHA 5IXYA 5G02A 3PLNA 3GNQA 4KBFA 4UQPA 3AUJB 3VNAA 2WG2A 3FGZA 4YJDA 4UAGA 3U7IA 3U17A 1M2VB 3UV3A 4FSHA 2K2WA 1BJTA 1GZ4A 1AK1A 5IF3A 4JMPA 2YKGA 4ARIA 3D6TB 4RD1A 4KR3A 3WLLA 1D2GA 5LD2B 1NUPA 1UBTS 3RFXA 2EL9A 4WUTA 3T0FA 3BH6A 3TPFA 5HZMA 4FYXA 1MQAA 3ONWA 4DLTA 2VQ6A 1WVIA 1XJ0A 5JBQA 1Z0IA 1KY4A 1O54A 1E9FA 4HRXA 4CUZA 1WXQA 4QPZA 3FNQA 3K2IA 3WLPA 1UQUA 2VPPA 4IH4A 5CCBA 4OHVA 5BN4B 3B6KA 1PFKA 1U8AA 1XMJA 3LQ1A 3OD5A 1O7JA 3OJOA 1DC3A 5IC5A 2CCGA 2C82A 5C3MA 4OM8A 1E0AA 4GPAA 3WR5A 1E7MA 4LYGA 2GEJA 3GOQA 3ZCPA 2HWUA 2H63A 3Q72A 1SB8A 3D6VA 2C3OA 4J3JA 1ZBDA 1QIKA 4TLLB 3P19A 3TB4A 2O8BB 1N6IA 2DUMA 2BGJA 5KHLB 1FFYA 3K9LA 1SMKA 5KWSA 2PE5A 4I1OA 4A8JA 4PO8A 2Z2ZA 1ECPA 1P5FA 2YVQA 2FY8A 3D2CA 1KAGA 4NH4A 5CFQA 5HWSA 2IH4A 5CM9C 1QONA 1JG7A 3TNLA 3TKLA 3AI2A 5I8ZA 3HU3A 4TZ0A 5JXGA 1GGFA 3AHJA 1P5RA 2XWPA 3T0GA 3D8HA 4FCWA 3VO9A 4AYTA 4E30A 1Y6RA 1ANKA 4AN1A 2GQ0A 5D3ZA 3A58B 3KEFA 1QHHB 2VNKA 3D6JA 4ND7A 4U9IS 5K0LA 4ALMA 1NMQA 1UKCA 3LPCA 2NU7A 4QOHA 2DP4E 3E7FA 1Q74A 4OBBA 5T8KA 2IXFA 2AZXA 2FZCA 3V6MA 3F8WA 4DHEA 4L73A 1KMQA 5FXMA 2YMPA 2FWJA 2X23A 3V5NA 5E4JA 3WRYA 2DPHA 3WIOA 4C87A 2V4MA 4ZKDA 1WXIA 3EXFB 3PQ3A 4RD0A 3ZNPA 4RJJA 5E6RB 1XQVA 3K94A 2BCJQ 2Q0QA 3T1TA 1E89A 1LCIA 4GVPA 3UYLA 1IBLB 2QS9A 5LNK6 3FOCA 2ZPTX 3G8DA 2R2GA 1HMYA 2GASA 5F64A 1ITZA 4ENVA 2YWFA 2JCVA 4G01B 4O5AA 3CPEA 1ZOPA 4QFCA 4FGKA 1W9MA 4HNUA 1PYGA 2A9KA 4YJ2A 2XW6A 4BWGA 3W34A 1J1IA 2AFHB 4Q1DA 3EEBA 2J6IA 5D3MB 4D92A 2EWMA 3BHJA 1K88A 4BMNA 3GH1A 3HP4A 2XWBF 4HGRA 4B4KA 2JLXA 2OCAA 3M1LA 4A2CA 3JQ9C 4Z0PA 3WLSA 2C99A 1BHSA 4M1ZA 1U7WA 3WLRA 3WVNA 1KSFX 4QRIA 3RHZA 4Z9YA 3COYA 1X2EA 5ER9A 2J7PD 5CLFA 4CEJB 3ETGA 4AJLA 1XJQA 4Z4IA 2CMKA 4ME6A 1QVZA 4YWJA 4O0LA 3Q8XB 1UJMA 4UUQA 4B75A 4TX1A 4D41A 5A62A 4RIIA 5LU9A 5CNJA 4XYMA 4F2WA 3IR5A 1PT6A 3ZWWA 1WTAA 2VVTA 5FTWA 1AVTA 2ZW9A 3RC1A 1DQSA 2L0XA 1K97A 1XQ1A 4HNVA 2ZJ4A 5F1PA 1DAFA 1Z6PA 4BFVA 1MDFA 3TQHA 1LBEA 3LG2A 4IYRA 1R6BX 4DNOA 1Z82A 1E1RD 1QHGA 1UWKA 3FNBA 4D6YA 4N7MA 4EB8A 2DQ4A 3EY9A 2I1LA 3DH0A 2PX0A 1TZ2A 4EI7A 1TF7A 4MUBA 3T94A 1OYYA 4ZYZA 5JCZA 1I0IA 1VYVA 1ORWA 2BYTA 1U1GA 1MV5A 4MVWA 4RC9A 1JGTA 5AUNB 2ZJZA 1YULA 1QGYA 3HDYA 4MGYR 1I9CA 4NY1A 1PS0A 4IFEA 1E0KA 4H7IA 1A7UA 4N3AA 5AJHA 1M6HA 3TQRA 2IWRA 4IZIA 2HDWA 1T24A 2O2ZA 2ZS7A 1TTTA 2PQMA 3EVGA 2NU8B 3VTZA 4O5OA 2QTMA 1KU0A 4QTTB 1YAHA 2WQZA 4RWZA 1R6AA 2FPLA 4ZMBA 3HCNA 2O8CB 2ZJYA 1KBQA 2YWDA 4IJ5A 2MYPA 4Z49A 4HAZA 4UNPA 2Y0DA 4N3CA 2ZITA 3Q0TA 4G9GA 3SHWA 1VJTA 4FIDA 3QEBZ 3REOA 2BDUA 2QPAA 3WNZA 3KTAA 3ZK9A 3DNMA 3DHVA 1UPAA 3H5WA 2GZDA 2NZXA 2WFLA 2GUWA 3F5DA 3P27A 4CMEC 3L7NA 1IN1A 3R1IA 3W1WA 1Y3FE 3UAYA 4PN3A 1D4ZA 1T13A 1FE8A 1YB7A 2VJMA 5J1TB 2Q2QA 3GWZA 1E4OA 4AVYA 2HMWA 4HGNA 2HN9A 3DGEC 3WMWA 2VP2A 2AUTA 1XYYA 5IEJA 4BE7B 2SKEA 2ERCA 2Z5FA 2OO5A 4PU0A 4ASUA 1DIOB 4EAAA 4YO8A 1DHTA 4EWLA 3SHVA 3ZDDA 3HN2A 2OGWA 5FYQA 3TEJA 2O8FB 4QQRA 2I4IA 1UPCA 3B85A 3FHCB 4EG0A 5CDHA 1KYYA 1PQWA 3KAKA 3MMXA 3PYMA 1OTXA 4GIBA 4QXQA 5FLYA 4QEZA 1LZLA 4W1QA 4RDXA 2I91A 4U7DA 4DJEC 1DEXA 2PH7A 4ZHSA 2YICA 1X39A 4CR8A 2XD4A 3RUIA 1NMEA 3WQQA 1R6TA 2PTHA 4E70A 4LBZA 4QT0A 3DL4A 3FNIA 3O4VA 2PT7A 4H08A 1UK7A 3UHPA 4BLTA 4CEHA 5CCEA 3M4NA 1YS4A 3ZHSA 2PUAA 4A6XA 3AB8A 1NRWA 2RK4A 2Q4RA 1P1HA 3ID6C 1PWEA 3O6VA 1CY0A 3TM4A 4MV0A 4LFAB 5IDVA 3V46A 3ER9A 3OZEA 2F9FA 3R2JA 2B37A 1XVVA 4BX8A 1GWNA 1U02A 4IIDA 3ITDA 4C3UA 2XNSA 2YWHA 4YJ3B 5CT4A 1N1EA 4MS3A 1VP9A 4CQLB 5J4HA 3GFOA 3SZ3A 3G23A 3NHWA 1AKUA 3RIYA 3RWMB 2JLZA 1LBTA 2F43B 4Q3EA 3GLFA 5KVSA 1JVBA 4BNGA 3QE0A 1DBPA 1EU1A 1JYFA 2D06A 1CBUA 1YOVA 3PFNA 3MWKA 1YRWA 4YH1A 5KSPA 2G80A 1KAOA 5J43A 2ACVA 3LZDA 2Z98A 4KI0A 5HS6A 3V1NA 5A9TA 3U4MA 2C0PA 3NDIA 1D4FA 3WE7A 3F5MA 1VHTA 2GD2A 3I9V1 4JU8A 3CKMA 5CXXA 4UNSA 3TI7A 3ITEA 1JJ7A 4M37A 2E4ZA 2ZWOA 3U37A 3G17A 5EIWA 4US2R 1VQ1A 3B89A 5EIBC 5KQLA 4J1SA 4MUAA 4YAIA 5KYXA 3M70A 3P96A 1HDZA 3SOZA 2G88A 3I53A 1E3TA 3OOYA 3FTNA 1S1CA 4RL4A 3BC1A 5FTJA 2IXDA 3MGGA 5CR9A 2NQ2C 4ENQA 5FA8A 5THKA 4O33A 4AZVA 1M8FA 3SC4A 1ENZA 1SUCA 2JLCA 3IKVA 4K28A 4TRMA 2E1PA 3H9QA 3IPRA 4V0NA 2UUAB 1JEQA 4L6AA 3X0DA 3AF6A 5A4IS 4UW9A 4QWMA 3M6IA 1U1EA 4IDGA 2OGSA 4FB5A 5HZHA 4F71A 5I48A 5KOHB 3RSZA 2F1RA 1NR7A 2I7TA 3F71A 4M6WA 5CLQA 3ZJ4A 5LZ5A 4B34A 4OB6A 2ZI5A 3K35A 2KYRA 2PAAA 1QRTA 5FWXA 3ZWDA 2ACWA 1R6XA 3OWXA 4Q7LA 5I5EA 2IYRA 1WX1A 4NESA 1UUFA 3AHGA 4G23A 1NVVR 3NKVA 1Q0HA 3QPCA 4NPHA 3N8DA 5E6SB 1KAHA 2IH2A 1ESDA 4LOLA 4CV1A 3FTEA 4UHEA 3HB4X 1EQAA 1UZUA 2PRZA 4JP2A 4DUGD 3FYDA 4JLVA 5FPSA 2VNSA 2PGLA 3LM8A 3TQTA 1ZIDA 4LI3X 2C3YA 3RVKA 1IE3A 1L1QA 4PLYA 1SHJA 2QMZA 4D96A 3FWYA 3MT7A 4MR7A 5H4HA 1L7OA 4MARA 2B36A 4M3NA 4QLOA 4V3BA 4WTOA 4Y6GB 4KQ2A 2A1TR 5CIWA 2W6JD 4C04A 2V7XA 3KJNA 1B7GO 3KJXA 5DNEA 4O4HB 3T4EA 4CM4B 4EI2A 1TK2A 4MVJE 3CUEF 4JP8A 1IOVA 2A35A 3F2VA 3G2OA 4S0ZA 3HNPA 4HC4A 3V8RA 4LQDA 3SIRA 4HLDA 1H8ED 1Z0KA 5F3RA 3PSHA 2R7AA 4J9VA 4QG3A 1CUFA 2H0RA 1NW6A 3EQ8A 2FOLA 1I94B 5A5VA 3CFYA 4FDMA 1V8DA 3TD2A 5LQDA 1YVRA 3EDRA 3N70A 4EOGA 5JANA 1JDJA 4QYTA 3WGTA 2ZJFA 2BKXA 4RKWA 1PAUA 2ZYVX 5IFKA 2VHYA 3UFXA 5C46F 1G4UR 3JCZA 2QLBA 1DBVO 2FMHA 3J80A 3BORA 4N48A 1JLKA 3G9QA 4UEKA 2D8MA 1LH0A 2GPAA 3FZNA 3L0PA 3FXAA 1XVIA 4B85A 4ND3A 2D5BA 3I9KA 3FHJA 2W6ZA 3EG5A 3EASA 3C3CA 4L5JA 3DC7A 5KTMA 3B2QA 3K92A 4DDHA 1Y6GA 4B31A 2AVDA 3RHTA 3AZQA 4DA7A 3EXHA 2VK1A 2WAYA 3UWOA 4BTVA 5BXQC 1OJLA 3EGXB 3GFGA 3KHSA 5FH9A 4NYIQ 5JXWA 1WLYA 4XGQA 4HPXB 1AHPA 3B1YA 2EEPA 2ZTHA 5IKOA 4AT1A 1E3MA 2HB6A 5I9LA 4J07A 4QO8A 1N4AA 1S89A 5BV7A 4YT4A 1C9JA 4W5HA 1V8FA 2ZULA 4Y2TA 1AJEA 1I7QB 1PDVA 1BG6A 1WDWB 3OKCA 4HS4A 3Q2IA 4PLZA 3UMMA 1F1BA 4F4DA 4QKQA 1XNHA 2WYUA 3K8ZA 5DBIA 2NYRA 3M4ZA 4L3VA 4BP9A 3A9TA 3PEUA 1OZGA 1QZXA 1N3BA 4U5XA 4CM7A 2CHFA 3STUA 1QCCA 4K87A 5J4KA 1CQPA 1U2TA 2DECA 1ACJA 1HT0A 1FP4A 4UHJA 1A9XA 3U0BA 5A4DA 1JSCA 3W5DA 1BW9B 1SUSA 1DAHA 3DKIA 2BKUA 1JR3D 3DTVB 2V5AA 5EZYF 3IIKA 2FZGA 4GKAA 4KFCA 2L18A 2YFHA 2MHCA 1TQ8A 2G3YA 3LT2A 1D0VA 1LLUA 2ACEA 5I7SA 1T1EA 3DQQA 1DWOA 3HQ4O 2JJYA 4LZPA 2ZYDA 2WICA 3LWZA 3NATA 1BS1A 2WM8A 2AFIA 3U4CA 4XQ0A 3ZLUA 1KFEB 1OXKB 3ZKAA 3U9LA 4OOFA 1JJBA 2D1TA 1M75A 4TN1A 1L5LA 3ZU2A 4B44A 3BCUA 1WMDA 2RK6A 3UMSA 3MYYA 2OC4A 4DQVA 3GCXA 1QX3A 5CFOA 1SQSA 3QU5A 1B1CA 4RFSB 3CKKA 2UYGA 2C2BA 2JLRA 2A9RA 1FXUA 2D2VA 5JFGA 1ZD9A 2IELA 3IEKA 3HRHA 1P1FA 3MJVA 2P2SA 5CB4F 4K26A 5G0TA 3T5BA 1TD9A 1Z6ZA 3OPNA 2NVWA 1J22A 2WZQA 3WWYA 1AQNA 1SA0B 2JFNA 2WOOA 1TVKA 3H9UA 2AYXA 2I1QA 2VZ9A 3QLTA 5ECWA 1BD4A 4BLQA 3ONDA 2PH1A 5BYBA 1MH9A 3AB3A 3HV2A 1BFUA 4CQMA 2EWVA 4BNIA 1JQEA 2UZ0A 2NP6A 3C7KA 3JATB 2VAXA 2DLNA 3NHKA 4UU1A 5ABPA 3NNSA 4C06A 2GKGA 1BEEA 4YASA 4Z1MA 2CXHA 2OHHA 4IV8A 2WKWA 3GN1A 5T6MA 3WGLA 2QK4A 5CBPA 4QDXA 3OURA 2PQ6A 1HEIA 2QGNA 1S2DA 2RGAA 4MAFA 1IATA 4RK6A 3NP9A 2HRRA 5BP7A 3T54A 3C3EA 3IQEA 1PJ8A 1CJVC 3EGDB 1OY1A 3DNPA 1W5AA 5TMEA 3RS5A 2ZATA 2W2KB 3ZW7A 4DSZA 1A96A 3BXEA 4MUKA 3FI9A 1P91A 3GNLA 2QN8A 2A5YB 4PYIA 5ALGA 4CM1A 3D0QA 2OLKA 3OD1A 2IEIA 5K0ZA 3QFTA 5C8ZA 1ADFA 3H5OA 3M9LA 3AEKB 1U3VA 2QYOA 4IV0A 2VTBA 3MTQA 4ZEXA 3R0IA 1G1AA 3W6UA 2Q5LA 5EJ6A 1N7IA 5DLEA 4P93A 3ZLBA 5ARDA 1OVMA 4BLSA 4XKJA 2R5WA 3DCYA 2PKXA 3WK9A 3HADA 2WMDA 1TTQB 1EVEA 3G0CA 3NU1A 5HS4A 4ER5A 1ZCZA 4KQ1A 4QWWA 2V1UA 4A1FA 3B3JA 5DN6A 2HMAA 2Z3ZA 3INNA 4ZAVA 3A0RB 1Z22A 2CXOA 5HP4A 2C4UA 4M0EA 3B1VA 2GVZC 2FCAA 1ZMXA 4PC2A 1XB2A 2WI8A 1XAHA 3ROZA 2O1EA 4BP1A 2C4TA 1G291 1RBQA 1JDBC 5JMOA 5K3CA 5DM0A 1N78A 2O07A 3IE1A 5BVHA 3A6ZA 4N76A 2IZ7A 2O5VA 2Q8QA 5G40A 3H8VA 4BNDA 1WOMA 5AJYA 1GM5A 1KTVA 3DV2A 4FKMA 4EHDA 2WTUA 3M33A 1L7QA 3QVLA 2P2NA 2Q8PA 5HUHA 1G8AA 4NZZA 5AKZA 3KOWA 4BVEA 3IXQA 4IW3B 3JYHA 4ZC8A 4WI1A 3HSYA 3RHSA 3ZD9A 4C0WA 4FNMA 5H9VA 1TJ4A 2R48A 4Z0HO 4BFUA 3VR5D 5BSUA 4MITA 4D80A 1OBOA 4BQSA 3BEDA 5JJKA 2EFGA 2WHEA 3IMEA 4OKNA 2IXAA 4JB2A 1GKIA 4X20A 1ZJZA 5EY5B 2J5BA 4Y2XA 3V8BA 1KDPA 3OPQA 5KDLA 3ZBPA 4ZXFA 4QOEA 2CWWA 1LSUA 2W6OA 4OA5A 2G67A 3CNBA 1WXXA 4JLPA 1NATA 1QK3A 4TL7A 4QGBA 4Y3UA 1ESNA 3H4IA 1XMQB 4B4WA 1VSQA 3F4KA 3MWDA 3KQQA 4UVEA 2FSVC 3E3OA 3PLAE 3T61A 1HURA 1YE8A 5K0CA 1N1DA 3OSZA 4UXIA 1FFCA 4YY3B 3O3MB 3MBIA 5DTRA 5EMNA 1TAUA 4UHDA 3CN7A 4Q3CA 4YMHA 1Z18A 3KJIA 2MSLA 3JY6A 3LVBA 4NEQA 1DDOA 3NT4A 3RT7A 1NC1A 3WJ7A 5TQ0A 2QDKA 1PDWA 2Z9BA 2X8AA 3U39A 3WIDA 5FPQA 3W06A 4HNTA 5EJAA 1UJ6A 1U28A 3EFEA 2R5FA 4KYUA 1TC2A 2BFOA 4M0LA 4BCDA 4OQZA 3TDNA 1NLMA 2GOYA 2W2VA 2Q1XA 1IONA 4K6OA 2EJTA 4MPDA 3WYCA 4TUYB 4LCBA 1OH7A 4TYQA 2FZ4A 4X6UA 2CXPA 4ZMRA 2FWIA 2R8BA 2D1RA 1KEEA 4C4OA 1HE8B 4ALIA 1A50B 1GOTA 4S35A 2O8EA 2GEDA 3PDCA 2IQIA 2KHZA 2X0DA 1UKVY 1O6CA 2PY6A 2OG2A 2OXTA 1YJQA 1Z8FA 1I1HA 1XCGB 4K6FA 3U19A 1R9NA 4Z0TA 3AL0C 1DDGA 3HEAA 3P2OA 1SKYB 1GRCA 2HPVA 3DQZA 4XOIA 3SYNA 1FQJA 1SXJE 1IXKA 1YB4A 3FX2A 3LBNA 2VF8A 3ZLJA 4BFXA 1VKJA 1BKSB 1U7HA 4NE7A 3TMYA 2QTTA 3E5MA 1TVCA 3LOUA 2PD4A 2OT3B 4P81A 4YMIA 4BE9A 2SNIE 4U7PB 4EHFA 1L7VC 4MGKR 4MVCA 4Q24A 1W48A 1TE2A 4YN3A 4IRUB 2VAPA 5SY6A 4CF4A 3L3BA 3NIGB 2DB3A 2FPPA 1NASA 1CS0B 2C88A 3MWLA 4TS1A 5H3CA 2JPDA 2IUSA 4WOBA 4PEVA 3TXYA 3VC3A 2GTHA 4NHEA 4HLQB 4CNBA 5C4MA 2MR6A 1U90A 2WU1A 4AF8A 1E2DA 1IPEA 3PFKA 4US0R 2TMDA 5DW3A 1VLHA 2BELA 1B1AA 2NYUA 1C7ZA 1IZ0A 1D3AA 3JVUA 1EVQA 1K7SN 1H4VB 2IXBA 2Y93A 2WHXA 2XOXA 2QAJA 3F78A 4QVKA 1RI2A 4C03A 1NSTA 2HMVA 1XRRA 1TA9A 3R5KA 3KPUA 5ALUA 5DHAA 1EE9A 1IB0A 4REMA 1P2BA 5JFOA 1BEUB 1HYBA 2QRVA 4RL6A 5AOCA 3CW8X 3NRJA 2VXOA 2VP5A 1SD2A 1XTPA 4Q3KA 5FTKA 3RBAA 1BU8A 1QV6A 4Y6OA 1ICEA 4IHJF 1GPAA 1QIFA 3RAJA 3QOYA 4QYIA 4LK3A 4X54A 4KREA 3M1YA 4OB8A 1J2YA 4TS3A 1T3LA 4E4RA 2LKDA 3IEXA 4CYMA 2IHBA 4WUVA 4DY6A 2ISSD 2WJJA 3E0QA 1C3OA 2HMSA 5EE5B 2CHQA 3LUBA 4LBWA 4KQXA 4OHXA 1RWBA 3W7VA 4HDOB 3ZHRA 1BGVA 1NOKA 3HU5A 4J7AA 4DRXB 4M21A 4RKQA 2BFFA 2QAIA 1E9CA 2XGMA 3L0IB 4MS4A 1AMNA 2B8NA 5HDBB 1L4UA 2YHAA 4KNYA 3DEJA 2G70A 1Z36A 4TLEA 3RUFA 2PX2A 3IXLA 5KWVA 1E64A 2GBIA 3L8HA 5EZ6B 3ZDAA 1IY9A 4KLAA 1JB9A 1J9ZA 1ZEMA 2CFRA 4I6EA 3O2NA 1DKLA 2JBAB 4WKGA 3A31A 4QM7A 4M38A 4LJKA 2PL5A 3OAAA 3FDIA 5AOBA 1W4AA 2QTBA 1KO1A 2NVOA 1EWKA 4EB6B 5A5EA 2ZR0A 3VISA 4IJQA 1T3GA 1I14A 4Q1CA 3WWPA 1LFDB 5F2NA 3GJ7A 5MF6A 2IX3A 2QQ0A 2FPRA 4PHFA 3PI7A 1AGPA 1G6OA 4JKYA 3TNDA 1QQAA 4EY7A 4IKEA 3ZDZB 4XM2A 1NT2A 3QUSA 1YZKA 3CR8A 4DIFA 1K66A 3THYA 3MAAC 3NW9A 1YZVA 2VHWA 2RAUA 4KSYA 5CXSA 4EABA 4K6KA 1IM2A 4NEHB 1PS9A 3D9QX 3ZHVA 3JQCA 5T4BA 1R27A 5KQGA 2PUGA 1OGIA 4B9AA 4NSNA 5DGXA 4XGNA 3MSCA 4UVDA 2XCRB 3NCHA 3FNRA 3RYIB 4H7HA 3LT0A 3AYZB 4EZIA 4TMTA 4V02A 5JVDB 2O3QA 1GCGA 2CJWA 3H5VA 2QT1A 4GI5A 1RRFA 2CZCA 2XHEA 2ZU6A 3BSSA 3D02A 3N8KA 3RUPA 2PUVA 4PX9A 1MAHA 1K3UB 3DAGA 4U6SA 2LDXA 4JT8A 1ND5A 5T57A 3L1UA 4YP7A 2OV2A 2J08A 2Y4NA 1Z73A 4BKQA 1BO6A 3L1IA 1Y34E 3HGTA 5GAJA 4FDTA 2Z6VA 3E3NA 4M36A 3G0OA 1L8XA 1NQVA 2VTKA 2YIJA 2ORYA 3P2JA 4PSDA 5KU7A 2FB9A 3NHZA 1QORA 5DTEA 1Z5VA 2ZRLA 4WXHA 3GFRA 3PC6A 2QRKA 3WYDA 3B1JA 1CUAA 4J7UA 1AHNA 2EAUA 3L4BA 4M8LA 4NLLA 1C0IA 5AI0A 1FDWA 2REQB 1GQOA 5B1SA 3RODA 4HUTA 2HBYA 3CZCA 4BY9E 2VSFA 4GMKA 1RW4A 2GK7A 4X90A 3Q98A 3LLUA 4UUBA 1PD0A 2FFJA 2WK1A 2CMGA 1DO0A 2FLKA 2WU0A 4N5NA 5DMHA 1CULC 4R1OA 1JH9A 4EBFA 3IX7A 3SZUA 3TR5A 5CA0F 1DBIA 1U8YA 3L8FA 3IDSA 3JTMA 5DMXA 3MAGA 4J75A 4B2YA 3H18A 2BHRA 3TM5A 2YW9A 2OILA 2XMDA 1Q44A 3RFUA 1EBBA 2QVBA 4W5JA 2LVBA 4LS3A 5LN1A 1J5XA 1JZQA 1T9CA 1ZXLA 3BJZA 2GN1A 4FTWA 5E3HA 5JXHA 1NIJA 1JDSA 2QMHA 3PX3A 2CVZA 2QBYB 4CG1A 1Z4OA 3QP9A 3GA5A 2OHJA 2VZEA 1YK1A 4R6WA 3HN6A 2EZ4A 4JJEA 4TQAA 4ZI7B 2RAPA 2RARA 2WHPA 4OQFA 4TM7A 4KDCA 1WRBA 3P71T 4IS2A 1MG5A 3NOVA 1TCUA 4GZ6A 1SXIA 4ZOQI 4B3HA 1QCZA 3E8XA 3PIIA 4QOSA 5BN1A 4GX5A 1Q0LA 1PNQA 1TKBA 1WF6A 1Z2AA 4OREX 4OI4A 2DR0A 2W4IA 1UP6A 3IURA 3RKUA 3NOXA 2HU2A 1ISGA 2EJWA 3JD3A 4MIKA 4P86A 5G4KB 1T35A 3B1WA 3MWGA 3VR4A 1X6VA 2Z04A 1XL0A 1JAHA 1LTHR 2BONA 1FDTA 1E5VA 2X6TA 5JAIA 1EFDN 2KPOA 3SR0A 1N1MA 1INLA 5CB8A 2QM8A 1SK8A 1O95C 3WGQA 3M5DA 2R8YA 1QWOA 3QMWA 2FEXA 5E9QA 4MV9A 3KQYA 4P36A 3ZS8A 1E6EA 3HH8A 5LLTA 1QG0A 2C9ZA 1VB3A 1CYEA 2AHOA 4MP3A 1UKZA 5B4TA 3P20A 1NN3A 4M8NE 5GMOA 3HFSA 3JARB 3UGTA 2JHFA 4UPEA 2J0SA 4IDEA 3OJXA 3RO7A 1N2SA 4PFSA 5DULA 1N7JA 4HVAA 1UXGA 5IBRA 1O08A 2YTZA 2ZT5A 4NFLA 1DUIA 5L7TA 4UXJA 4GSKA 1L4NA 1ZO8A 3K32A 4MWZA 3ZQKA 4AN4A 1E6UA 4P4SA 1DX4A 2GN4A 1ZD1A 4FFMA 2I6GA 4UE3S 5F51A 4C6TB 4ON9A 3MYRA 2YJ5A 5HMMA 5AI8A 4CMEA 1XJWA 2O2DA 1HE4A 2A94A 3M5CA 2K7ZA 3NVAA 3LTNC 2SKDA 1OPXA 2QN6A 3LQFA 2H92A 1I1QB 2AZMA 4GRIA 5FJJA 4EJMA 1Y8RB 1PG2A 3ELWA 4HAUA 3HBJA 1ZISA 3LL7A 4P53A 1F0PA 3WKBA 3U60B 3NTVA 3A10A 4E5YA 1FYEA 3AEQB 1SGWA 2R751 4MV3A 2X41A 1XPJA 2WWWA 4GDMA 3O9ZA 4FC7A 4L50A 4PR0A 3VJKA 4RTQA 3FETA 2I9KA 4QPCA 1PGNA 3STYA 2D4AA 1BQ4A 3RRYA 4ND8A 3IDOA 1XA0A 5IBPA 4GI3A 1QP8A 3B12A 4CCAA 3OQHA 4CM8B 4YAGA 2UYHA 1WXHA 3ESCA 2H59A 2O0JA 1DEHA 4ZARA 3V3TA 2A4KA 3HVRA 5KNCA 4YCNA 2DF8A 2PLAA 1RVDA 2CMFA 2W6CX 2ECOA 3HL4A 4QGHA 3W2TA 4E5PA 5LM3A 1A2BA 2CLHB 1DKQA 4X92A 5A04A 1VPTA 4L8WB 3R8FA 4HUJA 4QTYA 3H1GA 4DA6A 4OYYA 1NQUA 3Q4GA 1DCMA 4KKVA 4RD6A 2B4RO 1T5DX 1BGWA 3D7LA 4OHBA 3KEGA 3OOHA 3E9RA 3PNYA 4IQGA 4JOCA 2QR5A 3PLRA 2BFDA 4NECA 4UBJA 3F6SA 2O0KA 5JO9A 1AGYA 4DAOA 3MOGA 2H4XA 4E22A 4EH1A 4ZI5A 2Y1KA 5M7EA 3TF5A 4LDRA 1OT3A 4DR2B 1XDWA 2FF5A 3NWEA 3EX7C 1QTRA 1VRCA 4ZXPA 4LYYA 1IHUA 4IDPA 4AXBA 2F1KA 3H2GA 4ZEWA 3HA5A 4IXWA 4R8KA 5FLEX 3HABA 4C3ZA 3RYCB 2BGWA 5CHEA 3ZW8A 5IVHA 1WW8A 4PBRA 1GUYA 5BUCA 1G7TA 1NV8A 4FEEA 7MHTA 3JVVA 4H1HA 2F8MA 3SE0A 1KJ8A 2JZNA 1YQWA 1T2CA 2NNLD 2RBKA 1J8VA 2VPYA 4PTLA 2OPHA 1XE3A 5CDTA 5CDYA 1KQOA 5ENZA 1EWQA 4QLAA 2R4TA 4F5ZA 1W6UA 1R8XA 2PV0A 4P4GA 2IT1A 5IJ9A 1TM1E 2VYQA 1U0LA 4CTNA 1XNQB 5DXAA 4YMLA 2PUJA 2ICAA 4XDHA 5DYIA 2QLTA 3EBOA 1UINA 4OG2A 2R8XA 2RJ3A 2RH9B 1P4JA 2XSZD 3C8MA 1G9XA 1PFYA 4BZWA 1FLDA 4IUBS 2NO7A 1NBIA 3GIDA 4KWHA 4WN9A 4BAUA 3E48A 3COVA 2HQOA 3UB3A 1UBUS 2WSYB 3AY6A 1T1IA 3IC5A 2VI5A 4IIJA 4U7JA 4XX0B 2O7SA 1QF9A 2XRYA 4G5QA 2BHTA 5CMLA 1KH3A 1SKQA 1I3CA 3OICA 3RDPA 4DZRA 3QEMA 1RQNA 2OZKA 4IWYA 4PAQA 1G8PA 3ENZA 4G65A 5BMVF 1A8IA 2E48A 1C7IA 3A1CA 3FWZA 5ARBA 3CVUA 3K9CA 3G85A 5KJFA 2H0AA 5FO1A 4WNYA 4AG3A 4J0EA 4NHOA 3S1AA 1BMDA 1OBVA 1PUXA 2Y1EA 3WMRA 3JQ7B 1M6VB 2UZ1B 4LE1A 4LJYA 4LWPA 3ECSA 4YACA 5T41A 1KJNA 3H5NA 2X3FA 3N8IA 2OCLA 3B1ZA 1NQXA 2YJGA 2IOFA 2YASA 4KN8A 5I6DA 1NW7A 2Q5FA 3IDZA 4ID9A 4QVIA 4FZ3A 1OZHA 3S8MA 5TVGA 1DOAA 3CR3C 2WJIA 3UGJA 1WVGA 1GGVA 2FZWA 2G4CA 3H86A 2HCFA 3UAGA 4CRWB 1ZAKA 2TSYB 4JX9A 4UHHA 1EX9A 1NNI1 3FCXA 1AKYA 3CF4G 3V4OA 2OQIA 1RADA 2DLDA 2DBVO 1FXSA 4W9NA 3WYBA 4LQLA 2JC3A 4MVJG 1U3DA 5FBHA 2Q0XA 1OWPA 3K2BA 4PLVA 4EJSC 1PWZA 3RT1A 3ILYA 4RA6B 4UD6A 3W6ZA 3THOA 2L19A 1IJKA 3DUFB 4M1TA 5JRDS 4PCVA 1WZ2A 1C81A 1ZSYA 1A69A 1HDCA 1O97D 4JQZA 1PJZA 1V2HE 2XDQA 3VC7A 3AP2A 4DCUA 4E88A 1QDUA 4B3TB 5D86A 3E53A 4FZJA 4RQTA 4YA6A 4Y6SA 3X1KA 1X1RA 1KEVA 5HM8A 2RGWA 5EFZA 1ZMBA 4OXRA 3S44A 1T0UA 2CEKA 1N5RA 1QVVA 2CEAA 2X8JA 3KOXA 2ZUTA 3RSGA 4H9GA 2ZS8A 2ZYRA 3BYZA 2O2EA 2B30A 1SWWA 2XZLA 1XQ9A 4R7GA 2O8VA 1CDDA 3Q12A 3QEOA 4MAMA 1Q1ZA 2BAGA 2IV3A 3R7WA 2WJHA 5BYKA 5JRZA 3A14A 2QSYA 3GD7A 3HYNA 2VUIB 4ENTA 2Z4RA 3AIMA 4E1BA 4DB4A 3QKUA 3FH0A 4HEHA 4NS1A 4RESA 1GTG1 3KXLA 5CFMA 4MQEA 5JD4A 5DSTA 4X93A 3K16A 2VWPA 3UY4A 3UPUA 4PQRA 5F5XA 1W85A 1WCIA 4V2UA 3LBFA 4C01A 1B8VA 1PFUA 1FS4A 3K0FB 2O3JA 4EATA 3JD1A 4RZ3A 4D0SA 4KWEA 2QM0A 1KI6A 5E4FA 1J5EB 2FPKA 3NH6A 5JARA 1SCNE 1IWPB 1YBVA 4NBSA 1YOBA 1J7KA 2FOXA 5KSWB 4BS9A 1Z2NX 3Q5GA 1KZ9A 3L5KA 4JOQA 1C0PA 2Y68A 3OZSA 1WM1A 4IL5A 3AUFA 4W5WA 4CTMA 3MT0A 4LHVA 1N5JA 4S0XA 3SBDA 6LDHA 2I7DA 3EZFA 1WXEA 1NUUA 4QA9A 3SY8A 5JAMA 4FE3A 4JEMA 3OEED 4OL0A 3VJLA 1N0VC 2CBZA 5EWJA 3R6TA 3OQOA 4K2AA 4L28A 4JJZA 4R40A 4IMJB 3WO0A 3LC2O 3SZLA 3DR3A 4H7FA 2OXRA 1X70A 3VGJA 1GNRA 5ALDA 5LQNA 2P4QA 2GZ1A 4NJMB 5CGZA 4YRFA 5K8CA 4PXYA 4DSAA 3ILXA 2PR2A 4JJ8A 4OSEA 1CZUA 3ND6A 2Y67A 3SX2A 1EDBA 2INGX 4H18A 1V8ZA 4N1AA 3WNCA 4A8PA 4WK0B 1L9KA 3ESDA 4LJLA 1R9JA 4JWKA 1E2NA 3O82A 4BGDA 4LJRA 2VSYA 1QFJA 4WZAB 1NMYA 2Z09A 5A7FA 3CCCA 3RFFA 2VP0A 4FMDF 4Q4HB 3JWIA 3RVOA 2A2ZA 3VFDA 4TSFA 3ZZNA 1NVVQ 5GQSA 4KCGA 1VKNA 4BYMA 1VPEA 4MPRA 4NATA 1W47A 2E9SA 1T43A 3HK2A 5HVNA 4QHSA 4KQEA 2J6HA 2J0EA 3PZBA 1BE8A 3L93A 3MNFA 5A9RA 3PQ7A 4EYSA 1LWOA 2PUWA 1K5GA 2I6UA 4JIGA 2CVHA 3VU9B 3A4IA 3G79A 5KYWA 1B2LA 1H1LB 5AM1A 3VR5H 1S01A 5A03A 4U5QA 3DJYA 3H9GA 2ZTSA 1EDZA 3SC2B 4LZAA 1U9ZA 4C4XA 4AQYB 1VG8A 2PA3A 5A5DA 2CVOA 1VHQA 3PNOA 1DRWA 3PQ2A 1QQ6A 4DMGA 1AM4D 5EHZA 3OIUA 2O59A 1VG9B 2QTVA 4QUGA 4ER6A 4C0XA 5IG2A 1WPQA 5KPDA 3ETCA 3TEMA 1FMTA 1Z0FA 3I2JA 3LP5A 3PHCA 4E5SA 5JQWA 2GFHA 2QRGA 3CUTA 1MU0A 3F8TA 2B3TA 1O4VA 2JEYA 3ORFA 4XVHA 5FLXA 3H4TA 3LHDA 4PRKA 4AM8A 4MIOA 4B3IA 2WD7A 3KV3O 4X44A 2OK8A 2Z56A 4TL8A 2QVGA 4J3FA 4XEHA 5AUQA 4A6DA 3THWA 1TW2A 2ZEJA 1ULBA 3BIJA 1V45E 1RQPA 5DX1A 4X84A 1S9DA 3IQZA 4PYJA 1UJNA 3L8DA 4UARA 1E2QA 3U81A 3UNXA 3MPUA 5CX4A 3U6BA 1AO3A 1C0KA 1KBOA 3OWHA 5IN4A 1U7DA 5EUMA 3D59A 3MW8A 4ESHA 1WU7A 1V47A 2IHZA 3DNFA 4CE6A 2WJ3A 5CA1B 1YFJA 5HUQA 5G3YA 5TQ2A 4NOLA 2X7XA 4YRIA 1R5NA 3C7CB 4R1QA 2HD4A 4KRGA 1XXHE 3ZIUA 2N1MA 3N2YA 4MS1A 1ZSNA 5KNDH 3GLIA 4CWAA 4XCQA 2C2HA 3U7RA 4PN7A 3WLHA 1Z62A 4CKEA 1MQ9A 2RI1A 2ZSKA 5G0VA 5IU6A 4D0NA 2ATVA 5I7AA 4OXXA 3RABA 1RI1A 2I03A 3BMCA 2W2NA 4I19A 1OIVA 4KXQA 3EOAI 3TVDA 4KU4A 4NMHA 1EIWA 1NP7A 3A4NA 3PDIA 2XADA 2XLCA 2WPDD 4O1MA 1R9GA 1UDCA 3P9QA 2EP8A 4GXNA 3HY4A 4BNMA 4H27A 3H9JA 4JK3A 4TLAA 3FZYA 4PNPA 3ABQB 1KFBB 4U3JB 1UODA 1G1MA 1UBNA 4NOMA 2AJTA 3B82A 4IXNA 4J4TA 1DXYA 3IQFA 3ZZ1A 1B23P 3IRVA 1JAXA 1PR2A 3NONA 5JJ5A 3O8QA 5F2KA 1FQOA 3SU8A 5HJ7A 2IRWA 3NBUA 5TJ9A 2CFOA 4WVLA 3UG6A 2O3RA 1G2OA 4LZZA 4ZCRA 3D54D 4RPHA 3GRCA 1DU4A 1QH1A 3QF7A 2HKIA 4IWXA 1S2GA 2NV2B 2ONYA 4P3OA 5A06A 3F3YA 1R0XA 1GPDG 1IHOA 3PJRA 1Q11A 3C2QA 5JWHA 2QW8A 3LVRE 3W5VA 1R7RA 5GONB 3UJAA 4F5EA 3KT0A 4I3FA 5KREA 4X41A 3U48A 3NHJA 3A1WA 2F6RA 4RYLA 1J00A 3ISJA 1Q2UA 1ZP6A 2IZ1A 2YOGA 3HBLA 1DHRA 4DQDA 4E5KA 1VE6A 1CQIB 3EEFA 4EGSA 5AIBA 3QHPA 2ECQA 3AHEA 1HOXA 3L49A 4ZYUA 2ZRJA 2JDIA 2CJPA 1SJ9A 2D0PB 1HA3A 2VJDA 1E5XA 2HY7A 3AESA 3LXMA 3A1TA 3QUBA 2PNJA 1ST2A 1QLHA 1UL1X 1YI8A 1PGPA 1W75A 1XEAA 2NADA 3CWZA 2PWAA 2GPYA 3PDJA 5JDCC 5KOYA 4BC1A 2XPCA 4JEIA 5IAOA 5A5GA 3GCDA 4WFQA 2CJYA 1KFKB 3E2MA 3O8CA 1CF9A 1QRRA 2OCPA 1C1XA 3VR4H 4BWVA 4CMIB 3ZHBA 2CHGA 1AB6A 2VXYA 4L5CA 4Y18A 3FVWA 2MU1A 3DA8A 1P0CA 2GB4A 3KZKA 5G1PA 3SXUB 2F1JA 3W6NA 4MDEA 2BM1A 4TZTA 4XDZA 2ZRPA 3SEFA 3ELDA 2CL0X 3EUWA 4KQFA 4AP5A 1TEZA 4O4LB 5ILOA 3VYSB 2IOYA 1G5QA 1Q1AA 2HTEA 3Q9UA 4RENA 3ZWBA 2OHVA 5KNBA 2H1RA 3CLTD 3U3OA 4B3RB 5EQDA 3OQMA 4E1AA 3E3AA 2AFIE 3TSAA 5J3JA 3ZQ6A 4ABTA 4P82A 1NJSA 1ZNWA 2R8PA 5KB3A 2HF7A 3TINA 4OI0A 3CPSA 3GVXA 3MRXA 4RU1A 1TVEA 3IFSA 2EQ5A 3QH4A 4LMBA 1T9HA 3S7TA 3G9ZA 2QP3A 3AEXA 3O0TA 4G89A 3UMVA 3V4VB 1SHZA 4AD8A 5K5EA 3W8RA 5LNK1 2D2IA 3S7ZA 1TK9A 2GSDA 4DLPA 4DYHA 4C2TA 4JGBA 1L1FA 4GNRA 4MQUA 5HK8A 2EFHB 1IOLA 5ECDA 3ZJYA 3DVLA 5MN4A 1I7SB 1BA3A 1D1PA 2W0SA 4IQ4A 4PSAA 4F5DA 3HBFA 1E2PA 2D74A 5B1EA 4JI4B 1CU1A 4D3XA 4E5UA 1JEDA 3VAZA 1C1DA 1W87A 3HR4A 3JVDA 1EK2A 4D8WA 5JZVA 1KXZA 3B48A 1Q5PA 1J24A 2IQ5A 1VMKA 2Y1OA 2FG7C 4JP3A 2CDNA 1R0WA 4P92A 3ROFA 4FFOA 3HSKA 3CQ9A 3MRSA 4MKZA 4XUGB 3G5TA 5DCLA 2OTCA 2X77A 4TTPA 5G0SA 5DI3B 1XEWX 4M46A 4RUKA 4YJGA 2YJZA 4R8MA 1LNSA 1UBSB 2XQFA 4RY2A 5A7GA 3UFBA 1G21A 1T5LA 3WX0A 4CFZA 1LDEA 4OBWA 5TQJA 5F76A 5KNCH 2BMVA 2HK7A 1QC5A 1RP7A 2NXWA 1ULTA 3TE7A 1FNDA 3N28A 4Q47A 3A3OA 4XTRA 3GW8A 3LGXA 5EL0A 1ZM9A 3GJXC 3IA2A 1P0QA 1PL6A 1MO6A 1NI4A 1WZIA 2YNMD 4HVLA 4YCLA 2CK3D 4EFNA 1CJBA 2PUDA 3F5QA 3KALA 3C3MA 3MWJA 5FNVA 2AN5A 4JBYA 4U2EA 5C81A 1IVNA 1EFRD 4ZU3A 2ZYHA 2OD7A 2HW8A 4ER3A 2CLIB 5DW0A 3EOZA 3NXSA 4EZBA 5FL3A 3ZJ5A 3AF0A 4TYMA 4F4CA 3QM1A 3ZWAA 1SKMA 1C80A 3N7AA 3GRFA 2QD2A 3LHFA 3MTGA 2RFLA 2WSSD 4N65A 3L92A 2OYSA 3ZXXA 4CIXA 1IN8A 5HQJA 4FT4A 1OH6A 5BR4A 4Q05A 1E2UA 2GRAA 4ZVKA 2OPBA 3GFPA 3PUVA 5JNTA 3FVVA 3W5CA 2J30A 2I66A 2GVNA 4MUEA 1ZN9A 3LECA 2RIRA 3OOWA 4AX4A 3F3MA 1VPWA 3I9JA 2BD0A 4BNYA 4FJ2A 2QRNA 3SP1A 3W78A 4EW3A 4MGEA 4D9BA 2A59A 4OIFA 4XD7D 2B8TA 4HFRA 1JP7A 2QEQA 4G5YA 4KPGA 3ESQA 1WKBA 2C5HA 2PT5A 1UC4B 5ERYA 3PXGA 1K89A 3ZWMA 4Z1OA 4IHJA 1FNSA 1Z2OX 2WNSA 3GBVA 3MJTA 3WGIA 2QRUA 2WJAA 4KO4S 3I8SA 1RE0A 3GEHA 3RJ9A 3G7NA 3TZCA 4PFJA 4MMXB 4E11A 1OPRA 2V4UA 3PD1A 5IWCA 4Q4JA 2I2WA 2X0IA 3BBLA 3BB4A 3HKCB 3PDUA 4C43A 1KEKA 4HF7A 3WIVA 2JLVA 4PLPA 3EULA 1LVGA 1E3WB 1SN7A 1PFGA 5TDHA 1H2WA 4GT1A 2WWGA 4G1MB 5J1SB 2YRWA 2AMVA 5JI2E 2IEYA 1JR3E 1W4BA 2YIDA 3DOOA 4BQIA 1OC2A 1PJ4A 5IFLA 1Z25A 4DXHA 2FI1A 2WAAA 3WGUA 2E37A 1FSFA 5DRYA 4BCBA 3PX7A 3ZD8A 4ZRDA 2Q3MA 2ZAMA 3RBXA 5F21A 1YGPA 1E79D 3IAAA 1NUHA 2YW2A 3UAZA 2LD4A 1TM5E 3ORQA 4F9FA 1QPZA 2EKQA 3OZRA 3BXXA 4INAA 3F47A 1KHHA 3Q3EA 2AB0A 3R3VA 1Y5NA 4LYDA 1QX4A 2WAXA 1T1RA 1IWOA 2ZIFA 1F2TB 1LZKA 1KC3A 3OO1A 3Q3VA 3ZE9A 1PZXA 2ZWPA 3F98A 2HLHA 5E6UA 3SPXA 5CEFA 1KY5A 1SC4A 4MTCA 1T4CA 4EKGA 2P6RA 3OFND 3INYA 3SFVA 5AKLA 1WUTA 1FMFA 1YU9A 1EJ2A 1OT5A 1AUPA 1CV2A 1D0IA 1Z83A 3UV6A 4DCTA 4GMFA 5KEIA 4AY6A 3M6LA 3BZBA 3CR7A 3FKSD 4J91A 3JQ6A 2BN4A 3UT6A 3DHWC 1EK1A 3LLMA 1N7GA 3VZCA 4XWWA 5MHTA 4CCYB 3LCRA 2XX3A 1V1MB 3G9XA 1XEXA 2FSSA 4HR7A 2MSEB 3N6RA 5ADUS 2Q27A 1GV0A 3IMGA 4HGPA 3QLUC 3QI2A 2BL4A 1OKKA 1RCTE 3ASYA 4JB3A 2EGGA 4LFBB 1EEHA 5DYTA 1T4DA 4TYWA 2VFAA 1W5FA 1KKMA 4MHOA 1RAGA 2ZUWA 2P68A 3TMAA 2JFHA 2DZDA 4DLWA 4PGAA 3P5SA 2V54A 5K99A 5K3OA 4LF8B 1ZN2A 1QDLB 4FC6A 2RGGA 4ZOCA 4LGYA 2CE7A 2CFSA 3KQMA 2H16A 3R0QA 4HXEB 2WDZA 3DO8A 2X0FA 3VZRA 2V3CC 2J1LA 3EZXA 4JEHA 5B2ZA 2X9QA 5A4AA 1YCFA 4DEYA 2NTNA 4JN6B 3LZCA 3ADCA 4NK5A 3MTJA 3Q8WA 1GITA 3AVPA 3ER6A 3EXEA 5JAZA 2PXCA 4C7KA 4FFSA 2BJWA 1UT8A 3QF4B 5H0IA 5IJ0B 4L5YA 1MX3A 5FNZA 2OCYC 5IXSA 3R3UA 1BCRA 1L5SA 3HXTA 4JYBA 4D0LB 2PRSA 3E9QA 1AQLA 3C1UA 5C1OA 5KOIA 3TJZA 1UBCA 4GECA 5CA0A 1UXOA 4AZTA 4IIYA 1UM9B 3OOJA 3IB6A 3G13A 3RGWS 2HA5A 5KWEA 3PC4A 3V4ZA 3FOZA 3KSDO 1KNQA 1HORA 1MC8A 3B36A 3FMIA 3AZOA 4JC5A 3PGVA 5P21A 1K3FA 3UT5B 1UMBB 5EIOA 5KHAA 2VT2A 2OFFA 4D1YA 4Q02A 4PVDA 5AVZA 4MKGA 4ZO6A 2QU7A 2RHRA 3SK0A 3ZE0B 2E4AA 1U7XA 1V7CA 1VPLA 2FLVA 5DXJA 4BZXA 4ZQCB 2C00A 4LOHA 1KDZA 1D04A 1IULA 2D59A 2FZLA 4N5LA 4MK4A 1V8PA 3K0AB 4I4CA 4GX0A 5IJXA 3BGWA 3DHEA 5REQA 3SHFA 1R4ZA 1DIGA 3OKFA 4KV7A 3HJHA 1Q20A 4U7WA 2XY4A 3DZKA 3BJEA 5KX5A 3B6IA 4HZUB 5DHPA 2G08A 3PTAA 1MHTA 2ZETA 4AS2A 4JIMA 4OF4A 2JK1A 5KTOA 3HKBA 2C4MA 2WG1A 1TX4B 2ZRBA 3SVTA 4QICA 4TRJA 4RIFA 2GAIA 3T4XA 1YMUA 3V7FA 3VOAA 4D3SA 2P67A 1TJYA 2CNLA 1GEEA 2D5AA 3AKYA 1QYDA 4EUEA 2W6PA 1JBEA 1ADBA 1RQ2A 4LW8A 3OTHA 3FWHA 1LQTA 1T8YA 2WUDA 3ZDBA 3WQRA 4E3WA 1T0HB 1WMSA 4XAQA