2LD4A

Solution structure of the n-terminal domain of human anamorsin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
b'MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anamorsin
molecule tags Apoptosis
source organism Homo sapiens
publication title Anamorsin Is a [2Fe-2S] Cluster-Containing Substrate of the Mia40-Dependent Mitochondrial Protein Trapping Machinery.
pubmed doi rcsb
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ld4A00
2VDWA 3CKKA 3H2BA 3T7RA 4PCAA 4CTJA 3O7WA 5EEGA 2G72A 3A7EA 1JSXA 10MHA 4BLVA 2PX5A 1M6EX 3C6MA 4P58A 3UJCA 3NDIA 4P7GA 1P1BA 3M6VA 4C04A 4LWPA 3NW9A 4P7JA 4QVKA 1X1DA 2OYRA 3ORHA 3G2OA 4OBWA 5E9QA 2P41A 2PKWA 2ZZMA 4YUWA 1NW7A 1TW2A 2AN3A 2B2CA 2GPYA 1XTPA 1X19A 5LQUA 1SQGA 3E05A 3EVFA 2CMGA 4KIGA 2I62A 2F8LA 2O57A 5GIOE 3LCVB 5F2OA 3NDJA 1NW8A 3KR2A 3FUUA 2IH4A 3HCFA 1IM8A 3TOSA 3KPJA 3TPZA 4OBXA 4DF3A 3SX0A 3HA7A 4BLUA 1XCJA 1KXZA 4DCMA 3SSMA 1L1EA 4E2XA 3C3PA 2QRVA 4RVGA 3SSOA 3TFWA 4E2ZA 3GDHA 3MTIA 1XJ5A 4RV9A 1RI3A 3MTEA 4QVGA 3UJ6A 3A4TA 2FHPA 2I6GA 2Y1WA 3B5IA 3EVEA 1RI4A 3EGIA 2XVAA 3GRVA 1N7JA 3R24A 4O29A 3T7SA 4EKIA 3JWHA 2E5WA 3MCZA 3HCBA 3QOXA 5E1BA 5G02A 3S68A 2P8JA 1KYZA 1L3IA 4NECA 1WXXA 4X41A 3BWBA 5EOVA 4IKPA 1DUSA 3M33A 2XYRA 4RVDA 2R3SA 3EVZA 3MAGA 5CCXA 3SM3A 5JR3A 2O07A 5CM2Z 1R8XA 3UFBA 3P2IA 4ER0A 4OQDA 1I9GA 5DX1A 2P35A 2P7IA 3VC2A 4BP1A 2ZZNA 2ZFUA 1EIZA 3KPUA 1BC5A 3PX3A 1FP2A 2NP7A 4R6WA 2H1RA 2AOUA 2AS0A 4PYJA 5K09A 2CMHA 1G55A 5KS2A 2ADMA 4ER6A 4K6MA 1I4WA 1VQ1A 3HEMA 3IHTA 4M37A 5FTWA 5KQRA 4RTPA 3G7UA 3GRYA 3HM2A 3MERA 4WVLA 5E9JA 4E70A 2IBTA 3GCZA 5CD1A 2GA9A 4E2WA 3GWZA 2PXXA 1JG4A 1ZHFA 3M6UA 5LR6A 2C7RA 1YFJA 3REOA 3BUSA 3GXOA 3LBYA 1QYRA 4GOLD 4R8RA 4WXHA 1KPGA 2Z6QA 3TM4A 4MHTA 5E9WA 2HNKA 1I1NA 3ELWA 3FRHA 4HC4A 5K0NA 4PCLA 2IGTA 5B1SA 3T0IA 2OB1A 3TR6A 3G5TA 2OPBA 5DRYA 1FP1D 4DCGA 1EJ6A 4AX8A 4DKJA 4HH4A 5DRTA 1WG8A 2AOUB 3GJYA 3KR9A 4QTUB 3CJQA 2AN5A 3HCCA 1WY7A 2UYCA 5HOQA 4PONA 3Q7EA 5MHTA 3CGGA 2PX4A 4HRAA 5EMKA 4E30A 4E31A 1G38A 5C1IA 2OKCA 5CUQA 1VP9A 4X60A 3UJ9A 4ER3A 2C7PA 4EKGA 4GBED 5P8WA 1IXKA 1ORIA 2R6ZA 4C07A 1QAQA 2GH1A 4YUYA 1X1BA 3BWYA 1D2CA 3EGEA 5GWXA 1NW5A 3CJTA 2XYVA 3LECA 5EVJA 3FTCA 2AOWA 3KQPA 2AZTA 3ME5A 4U7PB 1YUBA 5EIFA 4GOMD 5K0LA 1SVUA 2BZGA 3A7DA 3NWEA 5HILA 5GIPE 3M6XA 1RJEA 3HNRA 1KP9A 4Y30A 1PRYA 4E33A 1G8SA 4F85A 2QE6A 2P3LA 5EQJB 3UJBA 4B17A 3F4KA 2VS1A 3THRA 4RTRA 2KW5A 2WA2A 5LQKA 1YF3A 3WSTA 4RTSA 1FBNA 3K6RA 4FGZA 3P2KA 3PX2A 1MHTA 1KPIA 1ZKDA 5ICCA 4UOEA 1R8YA 1MJFA 2PT9A 2PWPA 2PV0A 2WK1A 2FPOA 1YFLA 4HG2A 5KYGA 3BGVA 3PTAA 2HMYB 3CVOA 3HCEA 3E7PA 4GF5A 3OU7A 3VSEA 5DXAA 2PGXA 3LDUA 1NKVA 2P1DA 2EFJA 1BHJA 3GO4A 1L3CA 2NXJA 4PYNA 2QYOA 4IV8A 3X0DA 2YTZA 2BR3A 4KIFA 5CVUA 1RI5A 4F84A 2C7QA 3GIWA 2IH2A 1XDUA 3EGVA 1VE3A 2HTEA 4CXMA 5HIMA 5M5BA 1DL5A 4GEKA 2FYTA 3HVJA 2CL5A 3TRKA 2DPMA 2V74B 4CKCA 4HTFA 3OFKA 5EKXA 4CTKA 1KR5A 3LL7A 3KQOA 1NW6A 2PY6A 4LECA 4BP3A 3PFGA 1Z3CA 1QAOA 3LPMA 4DA4A 1XDSA 1V39A 2PT6A 5FCDA 3G88A 3KPWA 3LGAA 4PYMA 1VBFA 5DSXA 3ER9A 2C7OA 4PYIA 5KVAA 2B9EA 3QV2A 1QZZA 2YXLA 2BH2A 2HR1A 5E1MA 3GRRA 4QQNA 5E1DA 3I5UA 4R8SA 4KDCA 3KHKA 4FR0A 2NXNA 3THSA 3ELYA 4BLWA 5HZMA 1JSZA 4EVIA 3L8DA 2GB4A 3JWGA 5DTRA 5EC8A 3UWPA 3OFJA 3PS9A 3PVCA 1F38A 1F3LA 3DMHA 1WZNA 1RI1A 3AXSA 5FULA 8MHTA 3AWIA 1KIAA 3ER8A 2UYHA 3I9FA 2YXEA 3UA4A 3M70A 5E1OA 3SR4A 2O0LA 2YXDA 4YV1A 2IFTA 3EVAA 5K0CA 5EHIA 5CCBA 4RTOA 4PYQA 4ISCA 3Q87B 3UJ8A 1DCTA 5K8VA 4MWZA 2BM8A 4R05A 4C08A 2PBFA 2ZWVA 4PIPA 3P8ZA 2NXEA 2PJDA 5FWAA 1SUIA 3JWJA 1NBIA 3P97A 1O9HA 2EJUA 3KR0A 4AUKA 3EVCA 3FZGA 2NP6A 3EEYA 4DM3A 4PYLA 2G71A 1KPHA 2PSSA 3R9XB 1VLMA 1ZG3A 4MIKA 3ERCA 1L9KA 3FUTA 2ONYA 3P71T 3KR1A 5HIIA 1JG1A 4QPPA 1TW3A 1UIRA 2ONZA 3ID6C 1YB2A 4M7RA 3BWCA 3SVZA 3P9KA 5F2NA 4FT4A 5FA5A 3TKAA 3EEOA 3HTXA 2XYQA 5E2AA 5BW5A 2K4MA 4RVHA 4JXJA 3SSNA 5FADA 3OU2A 3HP7A 1T43A 4GC9A 4KVZA 3KQTA 4DZRA 2OY0A 4OQEA 3G8BA 5JUWA 3FRIA 2AOVA 3R3HA 2V7EA 4DQ0A 4FZVA 4A6EA 2VDUE 2UZ4A 2PX2A 3G5LA 3FPEA 1KHHA 3OU6A 3C3YA 4YV0A 5BP7A 4MQ4A 2P7HA 2IH5A 5FQOA 3KKZA 3FUXA 3OE4A 2ZTHA 2ERCA 2N47A 3LKZA 5K0EA 3A26A 3AXTA 3RIEA 4MTLA 2G1PA 1SQFA 3G2MA 4GOOD 3FPFA 2IDJA 2ZZKA 3HA3A 1SUSA 4V0RA 3TMAA 2AOXA 1NV9A 1N7IA 3OCJA 2VDVE 4L7VA 5DTQA 3UJDA 5HFJA 2PXCA 3LDFA 4POOA 2HWKA 2AOTA 1R74A 3O31A 3PT9A 5DM2A 3B3JA 4HGZA 3IV6A 2WA1A 1P39A 3P9IA 3VC1A 1IY9A 3UJAA 3O4FA 4FSXA 2OB2A 2OBFA 2AVDA 3A27A 3B3GA 2YVLA 5HEKA 3FYDA 2B25A 2B78A 1M6YA 1Q0SA 4XUDA 4GOND 2YX1A 1QAMA 1QANA 1R18A 2OO3A 5GINE 2FK8A 1XVAA 3NVMB 5EHGA 4KW7A 2ZULA 5K0GA 1KYWA 5CVEA 4YMHA 3I53A 3GRZA 5KQSA 1SG9A 3KPVA 4KDRA 2XBMA 1ZQ9A 2H11A 3QOWA 5FA8A 1FJXA 2P40A 3V97A 5DM0A 2ZIGA 4PWYA 1NV8A 4X63A 2PXAA 2JH8A 2Q41A 4DMGA 5EMLA 1R00A 1JTFA 5LQNA 4EQZA 3RW9A 2IPXA 4PGGA 4EK9A 3EVBA 3HCDA 5FHQA 3SMQA 2JHAA 3EMBA 2JHCA 1INLA 3FYCA 4RWZA 1HMYA 5ICEA 7MHTA 3G8AA 2AOTB 2ORED 3CJRA 3KU1A 3MQ2A 4FP9A 3DXYA 3E8SA 2G70A 5U4XA 4IV0A 3KQQA 5DXJA 3CBGA 3GGDA 4M38A 3G2QA 5DTMA 5EMMA 3FTFA 3DXXA 3TKYA 2ZW9A 3ELDA 5EG5A 4YMGA 2QRVB 4GUAA 3DP7A 1ZGJA 1Q0TA 3OZRA 3KQWA 4FT2A 5CVJA 4C4AA 4HGYA 2Z6UA 5K05A 3BGDA 5CIYA 3ELUA 3DMGA 4FS8A 4FSDA 3FTDA 4YV2A 3NMUF 2CKDA 2A14A 2JH9A 2JHPA 1UFKA 2GS9A 3OPNA 1BOOA 3NWBA 3V8VA 5LQAA 4EMSA 1P1CA 3MB5A 4RTJA 3DLIA 4RVFA 2JG3A 4RTLA 4E32A 4E2YA 1VPTA 5T64A 2IIPA 1EAMA 2ESRA 4RX1A 3EPPA 1WXWA 1AF7A 2ZBRA 5DLYA 5GP1A 5IKMA 4HSGA 2VP3A 2ZVJA 5H02A 3LBFA 4AZTA 3FPGA 1XXLA 4BY9E 3HCAA 5DWQA 1N2XA 2GLUA 2EJTA 2ZIEA 1JQDA 3LCCA 2GAFA 4RYLA 4ER5A 2ZLBA 1NT2A 4XUCA 5DPMA 3E23A 3DULA 3LCUA 5GOZA 4QPNA 4CKEA 3PFHA 3U81A 3UZUA 5DM4A 3KQVA 4C05A 2ZCJA 4PYKA 3LX6A 3OE5A 5EEHA 4PYOA 3I58A 4RSRA 5ICGA 3EVGA 5IH3A 1JTEA 4OX9Y 3GRUA 3M6WA 1JG3A 1R6AA 4R6XA 3TQSA 3UA3A 3C6KA 3IYLW 5EMJA 3UJ7A 5T67A 2YUIA 2AN4A 3RODA 3FUVA 2DULA 2H00A 3HA5A 5C9ZA 4AZVA 1O54A 2B3TA 1AQIA 5BW4A 3FTEA 3R6TA 3DOUA 4RTQA 3EVDA 4X1OA 4Z2YA 5EKUA 4GQBA 2PLWA 1RI2A 5ERGB 1ORHA 3DMFA 4PINA 5DM1A 4AZSA 5K01A 1ZGAA 3IEIA 1PJZA 4LWOA 4U7TB 1X1AA 4KRGA 3PB3A 3CC8A 2BR4A 2I7CA 3BXOA 4X61A 5E2BA 5BXYA 4RTNA 1TPYA 4C06A 3OZTA 1XDZA 4PGHA 2O05A 3G89A 4F86A 2LD4A 2Y1XA 1EQAA 2BM9A 2ZBQA 4AZWA 1JG2A 3GNLA 3LKDA 4OA8A 1L3BA 3SGLA 4XUEA 1BKYA 2JJQA 2QY6A 3C0KA 3M4XA 5E8JA 1EJ0A 4ATNA 3P2EA 1JR4A 1NW3A 4QDJA 3P9NA 4RTMA 4HTFB 4CKBA 2PX8A 2NNWB 3BKXA 4P7KA 2YR0A 4ZTBA 2OXTA 5K03A 3DUWA 5EZQA 3HVKA 3KQSA 3MCTA 3KQYA 5D1HA 1JQEA 1FPQA 5D1NA 3MGGA 5FQNA 2AR0A 5HIJA 4RTKA 2IP2A 5E8RA 2ZSUA 3CCFA 2OZVA 3VYWA 3FPHA 2VZ9A 1AV6A 5K0FA 3DH0A 2EG5A 5F2KA 1EG2A 3OZSA 1X1CA 3PLAE 1OR8A 4A6DA 3R0QA 2CWWA 2NXCA 2P3QA 3LSTA 5DX0A 3AJDA 3D2LA 1P91A 4KWCA 5ICFA 5GM1A 5T6BA 4G56A 4YUXA 2I9KA 1RJFA 2PVCA 1U2ZA 5DX8A 3TM5A 1VP3A 5HIKA 1VL5A 5GM2A 2G8NA 4PNEA 1AQJA 1G60A 1NBHA 5LQJA 1B42A 3BGIA 1D2GA 2PWYA 3B89A 3TLJA 4C03A 2IBSA 5C0OE 5K0JA 3A25A 5LQCA 1JQ3A 5DT2A 5K0BA 5LQRA 1WS6A 3KPYA 1G6Q1 4XCXA 3FPJA 1Y8CA 5EGSA 3I64A 3EMDA 3B7PA 3BKWA 2FRXA 1H1DA 4LG1A 2UYQA 1NE2A 1RJDA 4PIMA 5EPEA 2Z6AA 2NYUA 1D2HA 1O9GA 1VIDA 3BWMA 1RJGA 3DLCA 3FUWA 1M0EA 1UWVA 1YZHA 2EX4A 3MHTA 2FK7A 2HV9A 2AVNA 4CWAA 2ZWAA 5FUBA 2YQZA 2IDKA 3DTNA 4YUZA 3B3FA 3GU3A 4YUVA 3BT7A 2O06A 3HVIA 3HVHA 4M36A 3BZBA 3LHDA 3T7TA 2QM3A 3G2PA 3KQMA 3DR5A 4V0QA 5EIWA 3UBTA 3NTVA 1HNNA 4H0NA 3AY0A 4ER7A 4IWNA 1XCLA 3ANXA 3JWIA 3K0BA 3LDGA 5FHRA 5CVDA 4Y2HA 3P9CA 2UYOA 3DXZA 4QDKA 4QTTB 2ZBPA 2BR5A 2FCAA 5FWDA 3SXJA 2XVMA 4P7FA 4QQKA 5DSTA 2ZIFA 1G8AA 4GC5A 5CVVA 4OA5A 9MHTA 5LSAA 5EZSA 3NVKI 3NJRA 2P3OA 1YZ3A 1SKMA
chains in the Genus database with same CATH superfamily
2PG3A 1UBUS 1JV2B 1W35A 1XXHE 3O2SB 1EESA 2FQ1A 1EVKA 2X4LA 1NLYA 3PK0A 1LI4A 1AD2A 1KMIY 3NDIA 5HBRA 5A62A 3L18A 4P7JA 3GGOA 4L9RA 2E49A 4MA0A 4K2AA 1WABA 2PKWA 3E35A 2ICAA 4Z9XA 3KB1A 4I9UA 4OVKA 2GPYA 1YQGA 4MJ3A 4EECA 5AK0A 3UQYS 4WLOA 4BCDA 4DCTA 2J5QA 3OZFA 4YJ3A 1UBFA 4ZOEA 2OP1A 5HQJA 1U8XX 1IM8A 1YR7A 2FWIA 3M1IA 4FOOA 2CXTA 3C4QA 5D6OA 4AXBA 5MN5A 3WBFA 1Z0KA 3W4JA 3OCVA 4KL8S 1X70A 3DOCA 3OF3A 3E81A 3INYA 1QP8A 2A9PA 1ZMTA 2A9VA 4BUZA 3KE9A 4HWRA 1SVIA 5IHXA 2FDRA 1JIQA 4MGZR 3QVSA 5E9AA 2E48A 3A4TA 4U00A 3KLNA 1JDJA 1OFUA 3QOXA 5IABA 5CT6A 1TVEA 1DC7A 1KYZA 2IYWA 1XO1A 2VDOB 3F7NA 1P1FA 3N53A 1E69A 4B3JA 1G20A 1V4NA 2AXEA 4G5QA 4WK4B 3RBVA 4RVDA 4JEIA 4LFCB 2C5HA 3TNDA 3GMSA 2O07A 1O89A 2FWRA 3SC2B 3FA2A 2QMYA 2GZ3A 3G0GA 4I9FA 3V4PB 1RYFA 2FPPB 1RLUA 4MWOA 4P98A 1RVDA 2RGBA 5CFQA 3FNQA 1NJ5A 3TCXB 1IWBB 5CYOA 1EIZA 2NU8A 3KPUA 1YS9A 2WRZA 3BTUA 3PX3A 4R6WA 2H1RA 2PK3A 3JZFA 4O1MA 4RD3A 3ECAA 2B36A 2HFJA 4R0NA 4DRXA 4F1WA 2G9ZA 1NQ5A 4H3VA 3ANMA 3ZV6A 4KMSA 2CK3D 3TPCA 5AJZA 3RSHA 2BJHA 4X1YA 4FWIB 1Q84A 1KPGA 2GEFA 1KZ9A 3FXAA 1BIFA 1PJLA 1FP4B 1QGED 2GD6A 3ABQB 3NHRA 1P2VA 2EX0A 2F3PA 2LWIA 2YWGA 1P73A 3QPWA 4KLNA 5KKAA 2W0SA 4CUKA 4M8IA 3G5TA 4QYIA 2QGFA 2VH1A 2ZTMA 1W4RA 4BB6A 2CVHA 1OXMA 1I14A 2EKQA 3OH8A 2AOUB 3QVGB 1NYQA 4NH0A 1CQIA 2IYLD 3ONEA 2EW8A 4LRXA 1LTHR 4DREA 5HOQA 4D0RA 5MHTA 2B37A 4NAHA 3HRKA 2JGDB 3LQ2A 2CVOA 3HYNA 4R69A 3GG9A 4E30A 2VATA 5K6AC 3VAZA 5CUQA 4ZK2A 3G6KA 5JNRA 5AVRA 2KHZA 3B70A 3RT1A 2EU8A 3BA1A 4J0FA 3ZV5A 5SZJA 4PPGA 5JFOA 4O4IF 1M8JA 1JYFA 5L7TA 5TGZA 3PICA 4Q1FA 3X44A 1T8SA 5IAEA 1VYTA 4NICA 1KJ8A 1E2LA 4LXTA 2RMKA 4WK2B 2WHPB 2L0XA 1PR2A 4BVGA 2IEYA 3QF4A 1KP9A 2IS6A 3O4HA 4PBSA 3A05A 1YNSA 3G9ZA 1IQ0A 4WI1A 4P34A 3R0JA 5JPIA 4Y0VA 4GW3A 2VYNA 3PWSA 4PXSA 2B35A 3PX2A 1J2RA 5ICCA 4PZCA 2REBA 3W7AA 4IIEA 1Z0ZA 3RG8A 1V1MA 1YFLA 2PGIA 2ZB3A 4HRXA 2IF2A 4QRDA 4CCSA 4JYZA 4UDYX 5TT0A 5JCXA 4UE6A 1UXGA 5MGBA 3A4YA 4V2UA 2P9QA 2FXVA 4AXXA 4QT4A 3F73A 3I12A 1KETA 1NM5A 1U5CA 2EYQA 5E38A 4CMAA 1UBLS 3E7DA 3LLUA 1NG9A 1ISHA 1E1YA 1QYCA 1XCBA 3C3DA 2HTEA 2QE7D 3D7RA 4KK3A 4RLFA 4RZIA 1E9EA 2OQIA 1J8YF 1X74A 2YS6A 3AH8A 3OPVA 4WXYB 3UMJA 4UKDA 3S8YA 4H31A 1N34B 4MW0A 2YVKA 1O4VA 2QVYX 1KL7A 3K1AB 3OJFA 4HAWA 3NFYA 2J09A 4JB8A 1JJAA 3WV4A 3LTNC 4D2IA 4O4HA 2CK3A 2E4ZA 5DWVA 1OTXA 3O2QB 4EZEA 1RD4A 3BMQB 4QLOA 3SS9X 2Q2QA 2FF7A 2VDWB 1JU4A 4LDNA 2AEFA 2V7TA 4NMHA 4PHHA 3SBXA 3EQ9A 1Q5PA 4DMHA 2H3EA 2XE6A 2WM8A 4NV0A 3HBAA 1XZNA 4YCAA 2YXLA 3COWA 3RYHB 1T8WA 5ERXA 2G9RA 4P7BA 3IIJA 4DPMA 3W7BA 1P81A 1FZQA 1IHOA 2CD9A 2OM6A 2ZAYA 3VV3A 1U5BA 4U7WA 1N5LA 4WL0A 2W0MA 4V1CB 2VDPB 3MRXA 4EVIA 2J7PD 2BF4A 2G4LA 2REQB 1SCUA 1QIIA 4KXYA 4UBLA 4C4RA 3SQXA 1YQ9A 4WNYA 5CFMA 2IZ0A 4Z3KA 1FDIA 1MORA 4HBZA 3ER8A 3SDBA 1PG0A 1KS2A 2Q2WA 4FKBA 5PGMA 5UKDA 1W93A 4EY5A 1RSZA 3B53X 3EBLA 3G85A 3S27A 3S70A 2UUOA 5KNDH 3IAHA 2TMGA 4IUDS 4P3XA 5ELXA 5DHSA 4TWJA 4BPBA 1E0AA 4R05A 4XASA 1KC3A 1QK5A 4GT1A 1UT5A 1VMEA 2DBQA 2WHXA 3ZGXA 2O8EA 2HJWA 5JO9A 2H9YA 3GDWA 2H5JA 3G5AA 3VFDA 4DDWA 1EXNA 2HF7A 2JB9A 1Y6QA 2ZRNA 3PEYA 4EYOA 5LDHA 2PUCA 2WVHA 4ZPJA 2UXCB 1ZOOA 1FMLA 2PCJA 3C41J 3GVHA 4P0TA 5JJCA 1AGYA 2BLLA 3JQQA 5D3MB 3TDKA 1T5BA 2FSVC 4AKSA 3GLFA 4U5XA 4DR4B 2YHIB 3BMQA 1XHEA 3UKOA 4AT1A 4O1IA 4RK1A 1NVBA 2PSEA 3UXMA 3EJ6A 1PSDA 3LM8A 3EEOA 3ED1A 3P9KA 1QGDA 4FT4A 1ZMRA 4MPJA 3QKWA 5FA5A 4TQAA 1MTZA 1M8FA 3N59A 5CGZA 4RVHA 2XIQA 4OAQA 4KVZA 4R0MA 1VIVA 2OLEA 4RQUA 3LT2A 2PU5A 5JY6A 3ZY2A 3G8BA 3O2NA 3AKZA 4UTZA 5JUWA 3SQOA 4KAXA 2V7EA 1KO4A 4HQRA 1OUMA 4PZUA 3QVKA 4A0RA 3HYLA 4OJMX 4UM5A 2ZPUA 4HB2A 5EERA 4F3KA 2BKXA 3W79A 1O4WA 2EF1A 2RCNA 4JCOA 5LOVB 1RBZA 2O4UX 4IDBA 4RKQA 1IHXA 4C3OB 4XFJA 1WNTA 4DC1A 1AU9A 1C80A 1V1MB 2ZDGA 4GPBA 5H4GA 2O50A 2C9BA 1JA9A 2XOKA 2QUZA 3MS2A 2P2CA 4D82A 1AKYA 1J6UA 1P72A 2XMDA 3OSZA 4EPTA 1IOLA 3EOBI 4P4NA 5HK9A 1JU3A 1SQFA 2ANBA 4BQRA 1HDOA 3LYAA 4DV2B 1QVVA 4MGHA 5JZBA 4AY5A 4F3YA 3ZWOA 2VBFA 1ECLA 5CA0F 2FZGA 1P6QA 4XI9A 3TQHA 3H1TA 4IMIB 4MUEA 4URHA 1DV1A 3Q7QA 3P0RA 3ILVA 4XYEA 4Z9FA 3CWQA 1CDOA 1Z22A 1L5HB 1A9OA 3ZDFA 4BB5A 3A27A 4DT1B 1XN4A 3GN2A 4MDFA 3ETHA 4EABA 1V1JA 2IPOA 2VT2A 6PFKA 1QAMA 1TO6A 4Y9SA 2H8KA 3EIEA 4JQSA 5CAEB 4OM7A 4FDUA 5LBUA 3NWPA 5K0GA 1XK6A 3O3OB 4Z9YA 2YV3A 1J2YA 2IX9A 2NO5A 4YRPA 2VNIA 2OXFA 3GOHA 4PE5B 2E4AA 5CB4A 2DXIA 1FFYA 3HHEA 3QOWA 5HGXA 1E2PA 4J1SA 4YDRA 5B6JA 2QBYB 1MG5A 3AT1A 3QE0A 3RB8A 1OKKA 2NGRA 4DMGA 3NXKA 3MN1A 5AJYA 5DW3A 1R00A 1O94D 4A3SA 4QYIB 4N0DA 4BX2A 2J4DA 5LUAA 4ARSA 5AOVA 1YCHA 1FTNA 1SFRA 3LKVA 3LPNA 5JS1A 4DAEA 3F47A 3DAPA 2O19A 5K8IA 1KSFX 1DXHA 2P5YA 3H16A 4WADA 4MS4B 5DH9A 2P4SA 3WXMA 3FOZA 2CHFA 1I7SB 3IHLA 1D1TA 1Q1GA 3MQ2A 2VHVA 5GADl 1ZIYA 4MJLA 1IUOA 1ZUNA 2V1XA 2Q3MA 2X9QA 1M6WA 3AEZA 1AIPA 1CY7A 3ORQA 4FW8A 4TMFA 3FNBA 1FS4A 2WJYA 2XZPA 4G84A 3OEEA 5GONA 2J9FA 2EZUA 4BB9A 3F3MA 1ZRNA 3L2OB 4S2EA 4UHBA 3KCQA 2QZSA 3L8GA 4Q7JB 4W7IA 5AKJA 4AWAA 2PRKA 3U5TA 1GPAA 1YK1A 3HY4A 4JVMA 2Z2IA 5ALQA 5LQMA 2QLFA 3GAMA 3HVRA 2QTVB 2HSWA 5CIYA 3OM8A 1QMGA 4REMA 3L4EA 3FPKA 4X9XA 4OYLA 2PS3A 5ILQA 4LTMA 5HDQA 4IAOA 1X1SA 2AFIA 3WMEA 2EOAA 4LDRA 1QGAA 3R20A 5IC6A 2F4VB 3IP6A 4FFBA 1T9ZA 3I2FA 4YJGB 1ZI6A 1M2FA 2XTNA 2AI1A 2ZE7A 4KFCA 1HORA 2IYQA 3H75A 3DR3A 5JATA 2MSEB 5KJEA 5FPYA 1C7ZA 1GAWA 1N2JA 5TE9A 3VJLA 3TTVA 4JR1A 1XXLA 1HEYA 2A7XA 5LWQA 2BEJA 1AM4D 4R2LA 5DWQA 1MZPA 1EQ2A 2EJTA 3H13A 4JJ6A 4H0FA 2GAFA 4RYLA 3UB4A 4ZRNA 4GOXA 2RHLA 4JI4B 4Z0HO 3E23A 4CQJA 5FPPA 2WWGA 4Q47A 1GTJ1 1QIFA 4EHFA 1SC3A 1OAOA 1L6IA 4MOWA 3VBEA 3F0TA 4OG2A 4TMKA 3I58A 4LBYA 1YIOA 1CY2A 1Q7RA 2ORVA 2BCEA 3KWJA 2KM1A 2ZRHA 3P2OA 1S3FA 1I7NA 3CB4A 2DUWA 1DC4A 1GFWA 2GI4A 3L6DA 1SIUA 1VHTA 3BA6A 1PWHA 1UANA 2AN4A 4ZQBA 4ZGGA 1YC5A 4JXKA 5AUQA 5LIPA 1QQ7A 4YLYA 1O54A 4XJSA 4RY2A 3REQB 1CT9A 3Q88A 1GR1A 4K26A 5EPUA 3ZVMA 3SQNA 4RTQA 5EJ4A 3LA6A 3ZR4B 4ITUA 4ND3A 5JNWA 2Z04A 1U7UA 4B48A 1Y33E 2W2OA 1DC8A 3OPXA 2I71A 1GCIA 3RH0A 3FGOA 3PB3A 3CC8A 4EARA 1P77A 3S3TA 1GILA 1TE2A 1SPXA 2ZRKA 1WSDA 2Q0HA 4PGHA 1P18A 4F6RB 2A0KA 4LY3A 4ZU1X 4DSZA 3EGXA 3M5CA 4W8HA 2B5WA 1YUMA 3PPYA 3PUHA 4ZHSA 4MRAA 1KY2A 4ZI3A 1XEWX 3F8WA 5CDGA 1HX7A 3OPQA 1HFEL 3TXYA 3ZE6A 5A3RA 2CHGA 1XRMA 3FTPA 4HX5A 2DFPA 2QG6A 4Y98A 2PL9A 2B4KA 2QQ5A 3D43A 3K9WA 3QX9A 5G40A 5BQ3A 4RTMA 2QLNA 1P4SA 2K5UA 1E0SA 1C8LA 1YD7A 5L53A 5JCOC 2IXGA 1DTSA 1R5JA 3JQGA 1BU8A 4FVTA 5K03A 3LMKA 5D1HA 5ALUA 4RTKA 3I1YA 4EX7A 1JMKC 5IRCD 3KQLA 3O8QA 1EFVA 1NU6A 3ICCA 3I2KA 2VYVD 4MB0A 4YAWA 1ODLA 4UVGA 3UK0A 3H2YA 1GQQA 1EG2A 1DKNA 3A4IA 4RF5A 1W19A 3NXSA 2P11A 4EVQA 1V7ZA 1ZH6A 1M7GA 1PP4A 4YTEA 4COKA 3EF3A 5GM1A 4YT5A 2J85A 2CFSA 2DC1A 3X1JA 1PT6A 2B9VA 3TNLA 4ZV4A 3VU0A 4RYDA 3WK8A 1N2SA 2NPIA 4PNEA 4Q9IA 1LZKA 4AIIA 4NMWA 2H0AA 3RTDA 2PWYA 4FK8A 4NU6A 1ZUWA 3BS4A 1HDCA 1XPJA 2E4UA 2JAQA 3W9UA 3TLJA 2E7ZA 2RBGA 5A5DA 2PLRA 3ESBA 4BNFA 5JH7A 2IBSA 1P4RA 3LUCA 5H9VA 1Z8NA 1FVXA 1KI7A 1NX9A 1GDHA 2IBMA 4KKXB 5JHHB 2VHCA 3C8MA 3LP8A 5EZYA 4KGDA 4Q15A 3RS5A 3MBIA 5C7LO 1KBZA 3GLSA 3LDAA 3LHFA 3X1WA 2Y27A 2IS2A 1VIDA 2A9OA 3LSYA 4GGOA 4GMDA 3ZGZA 2WJAA 5EJAA 3C45A 3DOHA 4RWEA 4PZYA 2BMFA 3CRQA 1EXDA 3SC6A 4PICA 4YI3A 1RACA 2NQ8A 2VAPA 2D0IA 2VL7A 4D6YA 5AW4A 3CVYA 4GIBA 1BDIA 2CYBA 3HCNA 3ESYA 3FMIA 4EOGA 4IX9A 2HXYA 3N8HA 5CVTA 3HVIA 1C9YA 1Z82A 2YZKA 3VSAA 3K4HA 3IKLA 3LWBA 1SXJD 1PSZA 3VRHA 2PKRA 4BZWA 3JAKB 1Q0ZA 3IE2A 3GPIA 1N3BA 1RLTA 1SK8A 2PAAA 2XE7A 3CINA 1XZJA 3NTVA 4W99A 5H83A 1J8MF 3TS1A 3BXEA 2JLUA 4DLVA 3RJ5A 3MUFA 4EMUA 4GPTA 3PGKA 3PHLA 1VDMA 2ZI9A 4H7EA 2OBMA 2X1MA 1SN7A 5EHNA 5K2OA 4I8XA 4DWVA 2QMEA 2VDJA 3K71B 3UPUA 1OMOA 2ZIFA 1KJQA 2XWQA 1I5EA 2BL4A 5JVDB 3O26A 8GPBA 4WCFB 4TKUB 5CVVA 1PJ4A 5FWYB 3Q11A 1Z5PA 2XTZA 1G64A 3CNOA 4YGYA 1J8QA 4LXXA 1CR2A 1FSPA 1MU0A 4HQ6A 2QZZA 2COEA 4LKRA 3GL9A 1S1MA 3BX1A 3MJCA 5TPWB 3HXMA 5E4FA 1EWTA 2D2IA 3GNQA 2WLTA 4WFIA 4DLTA 2WIGA 4LWPA 4UEOA 3EHEA 4C3UA 3IE0A 1UODA 2XUIA 1RKQA 2GASA 2YRXA 1T3SA 4ZICA 1M6VB 1P9WA 2V97A 5K3DA 1ILEA 3STVA 2X15A 2QTTA 3H1FA 1X19A 3REFA 1TB4A 2PD4A 4ND8B 5HRUA 2XBLA 1PDVA 1QK4A 4F4FA 2O1SA 2BFCA 4GE0A 3Q5GA 4UHDA 2CC2A 4H1VA 3I42A 2QGNA 4MZDA 5KO2A 3SR0A 3V9PA 2GPAA 2P69A 3SX0A 1ZRSA 2W2QA 1MEEA 2QXTA 1JZSA 1WV1A 2NSLA 2JFZA 3GUVA 3UJ3X 3COJA 5IASA 4Y0NA 4EY7A 1T26A 1QYWA 1CF9A 3CN7A 2QUJA 4RV9A 2G5TA 3USZA 5FOUA 1GTMA 1VMAA 1HV8A 1CUAA 3EVEA 3EDOA 3R24A 4A8HA 4B76A 3UGQA 2A5YB 3H18A 4YPVA 5FLYA 1U7XA 4FMDF 4FYWA 4ZZIA 4UTNA 5T8KC 1M34A 3I1IA 1DBRA 3MYRA 4PGMA 1XDGA 4M1YA 4HUQA 1NVVQ 4MINA 2JEZA 4Q7EA 3G1WA 1R8XA 2WZQA 3LBIA 4A5OA 5EJ9A 3ZDCA 3EJWA 1NBWB 2YVQA 2OOSA 2ISQA 4JUFA 4RDXA 3QM1A 4FI3F 4JAVC 1DP4A 1BO6A 4L15A 2J48A 1GAEO 1ODKA 4EPWA 5MN6A 4LJLA 1E9CA 3CG4A 3D3KA 5C18A 4K6MA 5CYGA 1WZIA 2V5AA 3ZD9A 2J30A 2O0MA 1ULTA 1V5EA 2BI7A 3G7UA 3IQDB 2R6FA 3OLCX 4JMLA 2JLQA 621PA 4TRNA 1H22A 2ENWA 4UNSA 5TVKA 3TRHA 1OILA 5J43A 3EWSA 1DO0A 1LS1A 5FOSA 5LR6A 3BUSA 5BV8A 1QO0A 4N0EA 4GOLD 4J75A 3T5TA 2L82A 4JD5A 3ELWA 5K0NA 3CR7A 3COPA 4LMBA 2XNHA 1A7UA 3LS2A 4QUHA 2RGWA 5DHRA 3ACBA 1FP1D 3DCJA 2DKOA 2XECA 1ZD1A 4GHWA 2FUKA 1A3CA 1ZOLA 2F67A 1RBYA 1PS8A 2A9KA 2IYYA 2UYCA 4G0VA 1Z45A 3WK4A 4KR3A 3HNOA 1NBME 3PVZA 2G77B 4DSTA 2IV7A 1ECCA 5C1IA 3KM0A 2HGSA 5IM4F 3L04A 1ZC4A 1KGDA 2HJRA 4RL6A 3IOCA 5IVDA 1PCXA 3DXFA 4N12A 4GGMX 2GWHA 2HF9A 2R6ZA 2KMLA 1Z62A 2MYUA 3M6FA 4JJ8A 3AFIA 1XI2A 2WUDA 3I04A 1GPH1 1U1FA 2DGDA 3K94A 4TMXA 3TW6A 3VR5D 1L4UA 2RI6A 1XKTA 2L18A 1EWYA 1V2HE 2O6HA 1IQRA 4OJQA 3B1ZA 5BPHA 3IVGA 4EG6A 4U2FA 4K6HA 2NSYA 3SJ7A 4X62B 2BE9A 1ZVJA 3KE8A 3GP3A 1XQVA 2CUKA 1JU9A 1RQXA 1O94A 3PHGA 1MV8A 4IJVA 4QTXA 1Q74A 3PXGA 1ODIA 1QZUA 1TTPB 1VLZA 2P3LA 1MR3F 1PG2A 3O82A 4G4GA 4NAUA 4F92B 4RTRA 1E1MA 3X2SA 3TK1A 3R3ZA 5EIEA 1OQAA 4BRSA 1MHTA 4ZHQA 2BKEA 4C0KA 1P0IA 2CF6A 4NCNA 2K2WA 1E32A 1F6BA 1ID1A 3CVJA 4CMIB 3KB2A 3TWOA 2I7XA 2WJ3A 1QHXA 3VR3A 3DHVA 5KYGA 2GK6A 5L7YA 3LE8A 1NPTO 3TXXA 3JZIA 3RUAA 3B6ZA 3LDUA 1EEHA 1TM5E 4KE8A 2OQRA 4I5IA 4HGQA 2B0CA 5CG2A 4GXRA 1XJWA 1X92A 2J6HA 2N1MA 1W0JA 1ZCFA 3HKBB 3KLMX 4F4JA 1YR1A 2RAFA 5JZVA 4J0QA 2AL7A 2IZZA 5D86A 1P0FA 1JE0A 3QFRA 3RUFA 1R4ZA 3VHQA 5LDDC 3O90A 2NU6B 3JAWB 5DCYA 1VZ2A 5IUNC 2DUMA 3AETB 1NW6A 5DDIP 3BD9A 4GH5A 1FLDA 4TN5A 4I6EA 1I4EB 4X1KB 1SJ9A 2WU8A 3LOQA 3EIXA 5ALXA 1E1DA 3QSGA 4IIYA 1Q0UA 2HQOA 3ZLJA 2PUJA 1M73E 2QLMA 4IRUB 2E87A 4JOCA 4WASA 2GERA 2WDPA 4ZOCA 3DAFA 3R9KA 1KEPA 2C7OA 2BEWB 4B7UA 2IPAB 1Z25A 1MQSA 4MP8A 5FNVB 1ULZA 2Q2OA 4LBWA 1KDVA 5BSEA 2IHZA 3R5TA 1A4RA 1G5HA 3Q8XB 2OGUA 3QMVA 1OBCA 2AD1A 2G9QA 3TOCA 2FTKE 1WCV1 1XP8A 4IIJA 1YE5A 5HS4A 3NIFB 1YDMA 4F3CA 5KJ1A 4X84A 3ZGOA 4C89A 5LP6A 3I9FA 4BFYA 4BHTA 1CW2B 1VSVA 1XV5A 2PA0A 2ZXEA 2XQIA 2P5TB 1OC4A 3D2CA 4HB4A 5KWSA 2C95A 2X0JA 1NBMA 2MSWA 1N77A 1V7PC 3KT6A 5DNEA 2IGBA 4INAA 5IEBA 3CEJA 1CHNA 3ESDA 4O2RA 1EP1B 2EERA 1KMHB 4XQ0A 1T8TA 3NOOA 5G53C 2PJDA 3D8RA 4A8JA 4RW0A 3A0RB 1CUCA 2AXNA 1Y9DA 3H3XA 4Q4HA 1FUYB 1JA0A 3P97A 4PG4A 1IN1A 5AQEA 2H0QA 1N3YA 3JRXA 4OFWA 1GU0A 2XOEA 2YFQA 5JSYA 3C39A 3FHCB 1WU8A 1U28A 4BV9A 4MDEA 2JD2A 1KPHA 2L2QA 3BE4A 3CUKA 3NAGA 3I9NA 3PPXA 3C98A 3Q2KA 2O3TA 3ZS9A 4FM9A 3N0TA 2P4UA 4LSGA 3S2FA 4ZVKA 3ZJ4A 2C97A 4G5RA 3AO0B 2RDMA 3GFOA 1YB7A 1VCHA 1YVDA 1D7AA 2JATA 2J9ZB 3D2AA 2CL7X 3H4MA 3U4IA 4LZAA 3WK5A 1MKYA 4D4HA 3QG5A 1EINA 5EIXA 1ZJWA 2AZ4A 1TCUA 2WT8A 1SCBA 3KHSA 3OP1A 4XSVA 3UMMA 3OIWA 3WLQA 1BVHA 1Q57A 3FYUB 2COUA 3PFIA 1DFIA 3T3GA 1P80A 2VSQA 3BE5A 3OY2A 5EJEA 1MT0A 4A6EA 4M6WB 2PD3A 1M0TA 2W8BB 5I9BA 3OU6A 1UFRA 5F64A 3V42A 4C6TB 4J1QA 1EDOA 1J7JA 2UVDA 3Q3JB 3WGVA 3ZZTA 3X1ZA 5IWCA 3M5WA 4JI0B 5IF3A 3JALB 4BGUA 2C99A 3EC7A 4YJHA 1FXWF 3LKZA 4YJKA 3IQFA 3WICA 5DLPA 3F49S 1CEEA 2AYXA 3MTJA 3GEGA 3MBOA 3OQJA 4EY4A 1T9KA 2I4LA 2ZZKA 5EN4A 2AOXA 1Z07A 1JI0A 2ZB8A 3BL5A 2QAGC 3JASB 3HRIA 4TROA 3VNAA 3ZU5A 2WWIA 4KYIB 4TS9A 3UMSA 1E6UA 2CJPA 1MO3A 3TQOA 1ZNWA 4EB8A 1VHQA 4RORA 1NSYA 1PDOA 5JLJA 1A95A 3P94A 4H18A 2ZTSA 3I2HA 1CQXA 3RHTA 3HBNA 1QONA 2IE0A 1PV1A 2R1TB 1UBNA 1E0KA 4Y0AA 1PUIA 5AHOA 1QRDA 3UW3A 4A6XA 4EI7A 1JEYA 1X2EA 2JGEA 3OAAA 3QXHA 4D43A 3DBOB 1DBPA 1W5EA 1KYWA 4HVTA 4XFKA 3BQNB 3I53A 4XD7D 1QXSA 1SUBA 3KPVA 2AKAB 4S3MA 3R0VA 3TG2A 4ZV7A 3U9SA 4BNHA 3CZMA 4F12A 1TM3E 3JQ7A 3BORA 4IVRA 4BFVA 4LXIA 3VHXB 1EA5A 1XELA 1UT8A 3E3NA 4JU9A 4ZVOA 3WFIA 4AKEA 4DLSA 3EFBA 2HMUA 1SXPA 5H81A 5K6RA 3GJRA 3QY9A 1P7VA 4QUKA 2FN8A 4ROSA 5KSPA 3WWYA 4DWWA 5A03A 3KU1A 1BJTA 3OCYA 2XA9A 3G79A 2HIMA 3DAYA 2QU8A 3UK1A 4PVCA 1Y7LA 5ALLA 2JASA 1RNLA 3CZPA 2R4QA 2FPKA 2V58A 3AK4A 1RHQA 4MW2A 2C03A 4XKJA 2FLKA 3DXXA 5CJPA 5CH5A 1OE0A 3HUFA 5BVGA 5IYZF 4QXMA 1SK9A 4EYEA 4HGYA 2IEGA 4CKWA 1BOFA 2ZR8A 3TNFA 1YFKA 5KYYA 5A4DA 3EX7C 3PC8C 1R88A 4MW1A 4OMUA 3LQQA 3LCRA 3KAKA 1Z3IX 1O77A 4EG7A 5AW3A 3T38A 4INZA 4UARA 1OAAA 3N7AA 2HPZA 4V3BA 3WJ1A 2CUZA 1PW7A 4O1HA 4Y2YA 2AH5A 2FSVA 1T8UA 3DO6A 4FZ5A 1AQUA 1CU1A 2PQ0A 2I6TA 1GJRA 1RBMA 5EZYB 3FRJA 1C4XA 4JCCA 1IAVA 2V6FA 5I7SA 5L45A 5BV1A 1SWWA 4DC9A 4Z53A 1W0JD 4BY9E 3T41A 1RHMA 1ADFA 1DELA 4U6NA 5KDDA 2RH5A 1PVVA 4ER5A 4D0LB 1Q1BA 3QE2A 3ANTA 1GITA 2PFKA 3LCUA 4QPNA 3H5NA 4TTIA 1NSTA 4CEIB 3CUTA 2CVFA 2C2KA 1M0WA 2PUVA 4H7DA 4XPIB 4AJEA 5AM3A 5JVDA 4IQ8A 5FEUA 3CLRD 1WU7A 2V7GA 3PF9A 3A1VA 4UD2A 2CLDX 2PUEA 1PT7A 4ZQGA 3OJCA 4QNMA 2Z2YA 4JGBA 2C5AA 3G8YA 4XYMA 5FOXA 1E18A 3C3KA 3P4XA 3EXIB 5DK6A 3HZZA 5J4YA 3SKVA 1ITZA 4K9MA 4QRHA 4FGWA 5TGDA 1C0PA 2Q3EA 3VKGA 2JRCA 3SZLA 1RVV1 3GJSA 3LPDA 3P0IA 4MSUA 4DEVA 3FTQA 3KUXA 4RPKA 1I80A 1W34A 4B6EA 1XRRA 3CZ4A 5HJEA 2ZQZA 2Q5IA 3LBHA 1VLQA 5FA6A 1NAIA 2HIGA 4I1PA 4M99A 3DMFA 3ZBPA 3N86A 1LRKA 1EU1A 4MX8A 3GBPA 4FR2A 1X1AA 1M74A 2I7CA 4X61A 1TPYA 1XDWA 4OTZA 4X54A 3V7UA 4CLRB 5I45A 1FW6A 5G0TA 1EK0A 4TZ6A 1ZD3A 2JBHA 1NYRA 1Z8DA 3NWOA 4WZZA 1JG2A 1QC5A 3C4JA 3RF7A 2VDNB 1L3BA 2P30A 4A9AA 4EAQA 4CEHB 4L5AA 4OU5A 2H08A 5G41A 2TECE 3H87A 1VI6A 2XUDA 3B1KA 1NXWA 4TRJA 1Z33A 2RH4A 4YVFA 5EIAA 5AXDA 1L7EA 2WIDA 3MM4A 4OOEA 2MINB 3WYDA 2WUEA 4CMJA 1L5FA 2CXUA 1B2LA 2BDEA 2HHJA 1V11B 3DTVA 3UCEA 3PC7A 1OFVA 4C0XA 5K8UA 4Y6SA 3BB1A 2NZ2A 5A3VA 5HIJA 3VR1A 3G8CA 4QT0A 1KH3A 2QZ9A 1X1RA 3E4DA 4IOMA 4E1AA 3E0QA 2FUG1 4HZIA 4FEAA 1TQ6A 1RHJA 4X0EA 2G40A 3IDSA 4P84A 5CA1B 4FB4A 2HZ7A 3H65A 3IQIX 3DL7A 1OAOC 4KRXA 1SXJE 5T6BA 1DXYA 4O5AA 4GLBA 2BE7A 1XTSA 3KKMA 3NCTA 1VGRA 1U2ZA 3EZ9A 3LCMA 3C5CA 5DBFA 1SVKA 2QTBA 2YQ5A 2QHXA 2B8JA 5GM2A 1E4VA 4FBGA 2OPHA 3RFFA 2X6TA 4L72A 2FPXA 1SC9A 2PS1A 3JSAA 2GESA 4MVCA 4XIYA 1T4CA 5JDCC 3S2GA 1OX4A 2C5LA 3WISA 4HFJA 4LGVA 5SY6A 3D31A 1WUYA 2FGJA 2ZRGA 2Z30A 4XCXA 1QHHA 4M1WA 2FWAA 2OM2A 1SBIA 1RWMA 3QMWA 4IHJF 4ANFA 4RLHA 5BN3B 1CUYA 1RJDA 2FZVA 4RD1A 1G98A 4HQ0A 1D2HA 2QRUA 1T0HB 1RJGA 1REQA 2QPAA 3GT3A 3TL2A 2KJQA 1FPMA 4FCVA 1N7GA 1YVEI 2O2IA 3JPYA 1PR9A 1QRAA 2QYSA 2ZWAA 4FFPA 1F1BA 3EXHB 1QFYA 5M34A 1KAQA 1AHNA 1NRIA 2QP3A 3OQ1A 4NE7A 4MI3A 1TAHA 4XVUA 1II9A 5HM8A 5IYZA 2XUJA 3OFND 4FWTA 2DU8A 2NZVG 3G2PA 4B2PA 4OQMA 5JU6A 4V0QA 1DAOA 2O2XA 4XVRA 4HLUC 2QL5A 4DLLA 2J9FB 3LDGA 1EBFA 3DMNA 5K0ZA 4QXRA 1EMDA 4MQ6A 5D3KA 2DKFA 2ZBVA 2GKGA 1YONA 3Q3HA 7ABPA 4PZAA 4X94A 2JNWA 3FLMA 5FYQA 5IUKC 2C9MA 3NJRA 1JSCA 5I01A 5HFNA 3MGBA 1KRHA 4I4TB 3H2BA 3QEJA 3TJRA 4BKUA 3CVXA 4YRQA 1UOOA 4HYTA 3F3SA 2PX5A 2XZOA 1QFXA 3DDWA 1J90A 3R5XA 1BVRA 2IOHA 5H9WA 4QVKA 4PX5A 2ZDQA 4L8LA 3WLPA 4BNDA 4EKNB 4O33A 3RFTA 2HF8A 1XPUA 1IXZA 1NJ8A 1V95A 5MF6A 2YIVX 3DOIA 1A77A 2AK3A 4JXXA 1DCMA 2BKLA 2YASA 3PKJA 3SIPA 1E5VA 3NEAA 2PJZA 1KARA 4L28A 1UKZA 4UEWA 5HIAA 1DDGA 3HJTA 5GIOE 2PX3A 4JITA 3PQ6A 4G3XA 2JEYA 1LTKA 1ZM9A 1NW8A 4BO2A 3KR2A 2O2HA 2WILA 2IH4A 2HBRA 4QG7A 3NEPX 4H1UA 3ZIAD 2RHGB 3LQRA 5GGXA 3COYA 4A73A 3DD1A 4BFUA 4F1KA 2BBWA 2CV2A 2XNJA 3WY9A 1HOTA 2PAFA 3C3WA 1P8JA 3LC7O 3LUJA 4K9QA 5CCEA 5J40A 1RRVA 3AP1A 3ZHUA 3KTOA 4PSKA 3RREA 5JD3A 2FHPA 2VJNA 1SEPA 3WYBA 3NH9A 3P9ZA 4AF7A 3AM4A 3LG2A 1PEDA 4P3NA 3ZLUA 2P8JA 2X2PA 3C6BA 1GPMA 3OQMA 4FC7A 5M04A 1P45A 3T1OA 4KRFA 1E6EA 2CJWB 1HL3A 5BSRA 1OLXA 1OT5A 1PGNA 1KDZA 1SULA 4EMTA 2R3SA 2XB8A 3HCOA 4Q9DA 2BSQA 2HNAA 4E0BA 3NUQA 1H2YA 1WUKS 2NT4A 5EUBA 4FYXA 4QU8A 4ER0A 3I05A 2VJLA 3WLKX 4HADA 2AC2A 1DZ3A 1GGFA 1FDOA 2JGIA 3EZ7A 1TKRA 2Q27A 3AF2A 2PJRA 1ZN9A 2OHGA 3LVRE 1T1IA 2HH9A 1OBVA 2XRMA 2B4TO 5IH7A 3I5XA 1V5IA 1MAUA 2QS9A 2ZP1A 2HREA 3CW9A 4C1BA 2VT6A 4G86A 5AW6A 1XF1A 2GA9A 3QPBA 3R41A 3U80A 3A70A 3M6UA 2CLCX 1SU4A 4IINA 4R3UC 1CDDA 3HFSA 4MHTA 4R8RA 4BN4A 2ZS8A 5TF0A 5LN1A 2Q9AA 2Q3JA 4BNJA 4RPLA 3T7CA 1CSEE 4MYDA 1EFDN 1UEXC 4CCAA 1UMKA 1Y81A 4UQOA 4AY4A 1MOPA 1WMSA 3QKRB 2JFXA 1M0SA 4AX8A 4WY5A 4HNGA 1L7MA 1XDBA 2SICE 4YP1A 3CJQA 3VNRA 2YCBA 3G0BA 4NS1A 1RAHA 2OORA 3LFHA 2HDWA 5EWMB 2BKUA 4LWZA 1P74A 5ALFA 1PD1A 1N9GB 3Q7SA 3GIDA 5EMKA 1PQWA 5LLSA 3GJ7A 1E4YA 4KR2A 4ER3A 3WLAA 4BBJA 1KWKA 4EKGA 1YZYA 4N7JA 4GSYA 4M1KA 2XXBA 2IYUA 1ETHA 2VJYA 1LX6A 3C16C 4TV9B 2V8BA 3URKA 3WYGA 2B8TA 3I62A 3H19A 5F4ZA 1NW5A 1U6KA 4IGIA 3VPDA 2ZEJA 4BUJA 1APBA 2H65A 3LYLA 4O4IA 5JYCA 3L6RA 3KP1A 2NO1A 4X8HA 3S5JA 4B8ZA 2BZGA 4I5GA 1XTQA 3QI2A 4EY8A 5JS6A 2XMGA 2ET6A 1KK0A 5IARA 1N6IA 4DE5A 3FDIA 5JWOA 5LMUB 3DBRA 3M5DA 3NG1A 4I99A 4MKFA 3S8MA 2P2NA 5KOYA 4FN5A 2E6KA 2KW5A 3WSTA 1Q92A 3ZE2B 4DR7B 2VDQB 4LF7B 3K6RA 3SK0A 2XE4A 3ULKA 3F5SA 2QD2A 4W5RA 1CZRA 1KEZA 1Z08A 2XCLA 4IVQA 2VRCA 2V6GA 4JHLA 4DWOA 1N5MA 1WUTA 3COVA 3OOSA 2XAUA 1TQ2A 3AILA 3H9CA 4WJLA 3EDRA 4QYSA 2P1DA 2QUIA 1HGXA 3OSUA 1IJBA 1WSBA 2NXJA 4QJ4A 4ZYYA 5DCWA 1FFGA 5EE1A 4F5EA 2FQQA 1HYEA 1JEDA 2QAJA 3K4PA 5AVSA 2W6QA 3VMMA 1FQKA 1L4FA 2EXXA 2EIHA 3QJGA 5IKEA 1GG5A 1DQNA 1SHZA 1IQPA 2WJIA 2IK8A 1K0FA 4H3KB 4XIFA 1U7OA 5FPKA 3T5AA 3OFKA 3BREA 4UAGA 4JVOA 4OOFA 3KQOA 1PX0A 3U62A 1X3LA 1Z0IA 3I37X 1CY0A 3GH1A 2JLZA 2VUHB 2F8MA 2VWPA 5AKZA 4G2NA 4D98A 5FUVA 2QN6A 2WAAA 2PT6A 5FCDA 3KJQA 5DSXA 1GQRA 1W6UA 5C4GB 1VBFA 2EAUA 1ADYA 2R97A 4CG3A 4G65A 4B2LA 4Q21A 2ODWA 1LPOA 3O1HB 2VI5A 4ZQEA 4LZJA 3NM6B 5AVQA 2V7QD 4MP6A 1T2FA 1ZIDA 4QPZA 4TM7A 3IPCA 4EW3A 1PFGA 4I4TF 3TQFA 2WYWA 3IP8A 1M1YB 2DUUA 3G2JA 4QBHA 1KI6A 4WDRA 2OC4A 4ZYUA 4KPEC 1B6RA 1C3JA 3RS7A 3GX1A 1RRGA 1O5TA 1ZCJA 2WG1A 5EZ5A 2F55A 4H35A 3UY4A 3OM9A 1JPVA 3EXEB 2RG7A 3H6KA 3N0RA 3K8ZA 2PUAA 2QQEA 2WD7A 5I8ZA 1MCZA 3EXAA 2RI1A 3UBMA 3L84A 3LHKA 3UAGA 1EJBA 2IE8A 5CCBA 2JLSA 2C20A 1C1DB 3IPAA 2J6IA 1IK6A 1RM5A 4C20A 1IEVA 4PAQA 5KTKA 1Y6RA 3VO8A 3IDZA 1MT3A 4JT2A 1ANKA 4NBUA 2OAGA 5BYKA 1X1EA 4M1TA 4OHRA 5A1TA 2LDXA 2VTEA 4OMFG 4AJHA 1B6GA 5K8LA 1DRWA 5KQPA 4QARA 3TVTA 4AUKA 5EHZA 1XYGA 4US0R 1YJ5A 1YA8A 1SHTX 3TZBA 1U8AA 2PM8A 3OZCA 1IG3A 2AFVA 1K4YA 3AJ9A 2QDXA 2YVAA 3AGQA 5ICSA 1I7PA 2XADA 1RW4A 3HI4A 3W5HA 4EJSC 5KTOA 1M33A 3WGGA 4NMXB 1UM8A 3DBIA 3W7VA 1N6LA 1UBRS 1RPNA 1RWPA 4F3NA 5F1OA 4Q16A 3KQTA 1R3DA 3N2ZB 5ITWA 2FEXA 3EWNA 4KQ2A 1LV7A 2OXEA 4CI9A 3TX6A 3T5MA 4RHFA 1RLJA 3RI3A 3SEAA 2PX2A 1WDMA 1QFSA 2QAGB 4OP3A 4LJYA 5DCUA 2PNFA 5FBZA 1BE6A 2YDYA 3O3MB 1BEZA 1VKJA 3AM5A 1B0ZA 4UBMA 4ZHQF 5JJ5A 3RTBA 4XOUA 2WYIA 1LFDB 2A3NA 3DE6X 2HA6A 3PXXA 3T7KA 4AKTA 2QGZA 3G2MA 2ZAGA 1YA4A 3D6FA 2FPSA 1OGIA 3GDFA 1E6WA 5T8KA 3AFGA 1NA5A 2ID4A 3COZA 4U8GA 4CM6A 3KKPA 2XOKD 2CXRA 1GZ4A 3C43A 1Y1SA 5KYTA 3ESZA 4HHEA 1WA5A 2R6HA 2ZRDA 3FSGA 1CS0A 1NRWA 1YTLA 2WIBA 4FSXA 5HEKA 4OHYA 1FIUA 1GKKA 3E5MA 4KXVA 3AU9A 4ZCQA 1QPZA 3IBTA 5L3QB 4RC9A 5AVKA 3URMA 2BCGY 5JD5A 1RM4A 4WCVA 5B3JC 1EBBA 5ERYA 1C14A 4TZKA 2OR3A 3ANYB 5FTMA 3ZNNA 2F64A 1JDUA 1KQOA 1XYVA 2HWUA 4JLWA 2VBCA 4LBVA 4NARA 5F5NA 3TW8A 4YMHA 1CY8A 3GV0A 2PWAA 3EXHA 2ZJ7A 2H11A 4YH1A 3WL4A 2QMOA 4U02A 3WLOA 3CZAA 2WNHA 1O0SA 2PGJA 3B9RA 1G0OA 1NR7A 5ESRA 4WBNF 2GUWA 2UVPA 4ITRC 5L3QA 1Z7YA 3IAS1 4PGGA 1ZJ6A 2YDXA 1IONA 2QE7A 3GGPA 3BSYA 1CS0B 4B84A 3P1JA 2BH9A 2JH3A 2XKBA 3GMTA 3ETLA 1MXFA 1R7RA 3TMYA 1WHSB 4JR0A 3SYMA 1IFXA 4RDIA 2AJCA 1EUYA 1I51A 2VOEA 1BFKA 4MA5A 2VP2A 3C2QA 4F3TA 3OQHA 1OX4B 1YA6A 5CB8A 3VR5A 2I33A 3UMYA 2HLHA 5HOEA 3IKJA 2BHNA 5GY7A 3QNUA 3E6AA 1RXCA 4F5ZA 4HPWA 4Z49A 5A5GA 1YRBA 2BM1A 3MT9A 4GM1A 4NEGA 4XRGA 3DMGA 5ARCA 1YOVA 1YBFA 1U0LA 1PEAA 2C1XA 1BDBA 2FWBA 2IA5A 2QJFA 2Y1DA 3LP5A 1H1LA 3NALA 3PQ3A 1M34E 1W88A 3OPNA 2I65A 3Q8KA 4BNXA 2C96A 1Z16A 2Q5QA 5CT8A 2PKYX 1ISJA 3KJZA 1U0HC 4XTCS 4RO0A 4IICA 4D25A 3HYRA 1XVUA 2EQ5A 4ETNA 1F06A 3KUUA 3JRWA 4KQWA 1M72A 3C1OA 1YMUA 2CLOB 3QTLA 4IW3B 4MVJF 1XZLA 5TX7A 3O7MA 1J4AA 3A4LA 3EPJA 2ZLBA 1KOJA 1TUIA 1WKCA 1H0KA 3NYRA 4O4LF 1XU9A 3DC2A 4RMHA 1AKTA 1XEXA 5FR2A 1R6DA 2AMYA 2B98A 3IV7A 3OLZA 1RYMA 4IKOA 3W8FA 2VA9A 4Q24A 5A06A 5JQGB 5BO5A 3EEFA 4C4PA 4IDDA 4Q18A 4DLRA 5ICGA 2R48A 4WJZA 5DEIA 3EXFB 5IH3A 4OH1A 3V8QA 3ZNQA 4HDRA 5EJ6A 5I7FA 4GL2A 1XDDA 3TW4A 3WWDA 1K4KA 3W3AH 1TJ5A 2IYAA 3LHIA 2E4YA 2OCLA 4UC0A 3RT9A 4BJ1A 1L5KA 4KHPB 4LMAA 2WD7B 3H5WA 4JC5A 3DOUA 2FPLA 1T3ZA 2M6RA 2WUVA 4J1TC 4MQBA 5ALTA 3KDPA 5J2UA 1OF1A 1W47A 1YR8A 5AKIA 2Q1SA 3N2LA 4QOHA 1ORHA 3ZDYB 4YFYA 3CRRA 2LVBA 1FTWA 1B14A 1YVUA 3HO1A 5IXSA 5E2BA 1WBDA 4X20A 1ADGA 1SB9A 4F04A 3PC8A 1YR9A 1IHUA 4GM4A 5EXXA 4CEIA 2DHCA 1OPXA 4OHCA 1YAJA 3PF8A 4TYYA 5IPFA 3SGLA 3DBLA 3LLSA 4BMVA 4XUEA 1J0DA 1W2GA 5FDFA 5BWNA 3GLGB 1H6DA 2I55A 2OWDA 2HC9A 4FS3A 4ZTZB 4QPDA 3KT3A 4HLNA 4BNZA 2A2ZA 4C0QC 2XMPA 4I36A 2FB9A 1L4YA 4TLAA 1S2OA 1WB6A 4KIJA 4LC9A 3H8VA 2X58A 3KLBA 3NTLA 1ABFA 4P7KA 4Z9AA 3V7WA 3DFZA 4C4YA 1S7GA 2O2GA 2W2MA 3DZKA 2I4MA 2EC5A 3IRUA 4TWRA 3SZ3A 3TD9A 1WDTA 2H7VA 3BERA 4CG2A 1X1CA 1CEXA 1Z47A 3I0ZA 4A6DA 2DUJA 4MLPA 5IHPA 3DVAB 4EPYA 4FHEA 3CF2A 2X0KA 3A1TA 1H93A 3IVXA 3KOUA 3W6PA 4LA4A 3AUFA 2NVOA 3BIOA 3FJOA 4ZVUA 5IBPA 3DA8A 4HEA6 4QLBA 5TB5A 2Y66A 4DV6B 3DDNA 3WB9A 5C53B 2GVZC 3ZQ4A 3L8EA 2V5UA 3UAYA 3KB6A 2O5VA 3AC0A 4DJ5X 3JR7A 1C9MA 3KAPA 4GMXA 1AMUA 2HYIC 2FDXA 1QGYA 3DB2A 1IUPA 3EGCA 2C2XA 1YC2A 3E3LA 4G0XA 4PCVA 3STYA 4DA0A 4V0MA 5K3FB 1N2EA 1DADA 4LN1A 1T2UA 1TIBA 4B81A 2C88A 3MS4A 1EVJA 1Y8CA 4KLRA 3EG9B 4MUAA 4DRZA 4HVLA 3QENA 3B7PA 3THXB 2Q6VA 2UZ1A 1XXHB 1Z2NX 4PRZA 3WB1A 1EWRA 3LD9A 3S2UA 4DNFA 5FFNA 1Y82A 3GNSA 1C3VA 4LQ4A 5JY1A 2Z6AA 3DLCA 5FP0A 3FUWA 1MC1A 4M4SA 5KTTA 1NUTA 2ATEA 3F98A 1JQ5A 2IYTA 1RHKA 4PXYA 5TC4A 1HK7A 4XYLA 3SJZA 3B48A 1RWWA 4YUVA 4EMBA 3CF4A 2E5FA 4ND6A 4W1QA 3KYBA 2DR0A 3D8TA 4RZUA 5FIUA 4DUYB 4H0CA 4X3CA 1UZAA 3RHZA 3VSCA 2F62A 3DR5A 3KQMA 5EWMA 1JEYB 1Q1QA 3B6EA 4OB8A 4H7HA 2ZBDA 2WYHA 2RAPA 4HEQA 4D41A 2W6MA 4D4GA 3OT4A 4RF4A 3FOBA 2ZUSA 2XVMA 3E9RA 4QEDA 4BRWA 4HXFB 2PA3A 5F7XA 1Q3HA 2EJCA 4G8CA 1SGWA 3MGCA 1JFTA 5CXXA 2IEIA 8ADHA 4Y2QA 4JLOA 3PEUA 4ALIA 5H82A 4TPKA 1V48A 2Q6OA 4K05A 2G72A 5DXFA 1I7QB 3D6HA 4EHJA 4QHYA 1KYQA 2HSJA 2K2QB 4EG8A 3HU1A 3UJCA 5DBIA 2I1WA 1TKCA 2I5PO 3DDSA 5CW2A 3C1AA 4MS3A 2OYRA 4ZRMA 5E9QA 3HL0A 2P41A 3IUSA 4MVWA 3MCVA 1TW2A 4MCHA 5BW6B 3DS8A 4WKBA 1QVRA 3ZD6A 4D8UA 1D6SA 2O8VA 2HM7A 4RV4A 4P2GA 3G2LA 3QFTA 3DLHA 4FKZA 9LDBA 1DLJA 3RYCA 4FHDA 3DV2A 3FYUA 1U2RA 1W4LA 2FPGA 3CEMA 2UV8A 3IA2A 4QXPA 5F1PA 1LLQA 1Q1ZA 1AQNA 2FH5B 3KX2A 1GAQA 2PZGA 2AUTA 3TOSA 2DSNA 5I9LA 2ZR0A 3ASVA 1DG3A 4H9GA 4OUDA 3WGHA 1FDVA 1OWNA 1XCJA 1L1EA 2HYDA 4LJ5A 2GN8A 3B7WA 3SSOA 4F2DA 2Z6VA 1U1DA 5EJFA 2OOKA 3M89A 4NOMA 4W1SA 2JKZA 2GUGA 4L4XA 2NTYC 4X92A 3NV9A 2FP3A 1XZHA 2QRMA 4IGFA 3RSSA 2I7VA 3B5IA 2XB4A 2R6CA 3M4ZA 1IZ8A 1WB5A 1KSHA 3IO5A 4NC9A 1UFOA 2ZIWB 1IN6A 1U8CB 4BFLA 2W6OA 2VJOA 4DLBA 2W2XA 1I5OA 3PC2A 5KWVA 3KAQA 1L8AA 3M33A 2GETA 3HYSA 4HX2A 1VI2A 2P68A 4ZOBA 4ID9A 2Z9BA 1TJNA 2FUCA 1TEZA 5KSWB 1XROA 1QTIA 3ET5A 3JQEA 4OGGA 2WMDA 4QDTA 3WGIA 2XKJE 4BP1A 2ZFUA 2YQ4A 2MYNA 1C3OB 2Y0EA 2R84A 4CCWA 3OX1A 1B0UA 4WZAE 2Q5FA 4GQIA 3UUEA 2NT3A 3WNVA 3DEFA 4P4SA 5K09A 2C7BA 3LNTA 1OCEA 3A3NA 3IHTA 4J4BA 4NBWA 5EUQB 1BH6A 4TSKA 1GPNA 1UK9A 4FHFA 1W44A 3ACCA 1JI3A 4JWKA 3CS3A 5E3JA 1E9FA 1R0WA 3W6UA 4ENPA 5L95A 2C2MA 1BVUA 1ZK4A 4HWKA 4NJOA 1A5TA 4HNUA 3VSBA 1GNSA 1M7BA 1RC1A 1K86A 2LV8A 3SF0A 3UAVA 4HXGA 4EGFA 1OXTA 4M3NA 3CF6R 4NZPA 4BAUA 4ZPXA 5CX1A 1T6XA 3HVUA 4EGAA 2PR2A 1I0ZA 4FDVA 2C98A 5CDHA 3VH1A 2C04A 1ORRA 3IJEB 5LZ4A 4S04A 3E70C 2PXHA 3Q12A 2IHTA 3BFPA 4HAXA 1J0CA 1KAHA 4LZZA 4B47A 1AE1A 5CT5A 5LCXA 2C00A 3DMTA 4DILA 3CCCA 5DE3A 4DIBA 3CNEA 4GMFA 1MV5A 1CUDA 4J7UA 1ZR2A 3C1TA 1K7SN 2V4ZA 1OIWA 3DBVO 4GXTA 5KX5B 3VZDA 5KSZA 2JLRA 1IXKA 1ORIA 3CLKA 3H9JA 3A2LA 3JX9A 3MSXA 4DV5B 4D4JA 1ULAA 3PITA 1D2CA 4HQNA 2ZU6A 2PZJA 1I0IA 1F2VA 2W93A 3OPYI 1L5NA 2BIFA 5BWMA 3FOCA 3R44A 1LBTA 1DFGA 5EIFA 2QTWB 4I14A 2DM6A 1E8DA 3VR2D 2BONA 2P1RA 4ZYXA 5IX8A 1GZUA 3BJEA 3M6XA 1Z2CA 1YR6A 4OKNA 4PLYA 3M3PA 1FS5A 3HO6A 1WMFA 1U9IA 3BXZA 2VS1A 3EMKA 1P5HA 3CPSA 3HXPA 1TT7A 3IKMB 4MQLA 3S1AB 1XZMA 3ZV3A 2O0KA 3DFMA 2EZ4A 2J59A 2R1ZA 3S99A 3D54D 2XH8A 3N2NA 1XVTA 1QIMA 3OOEA 3K5HA 1NXSA 3A6FA 5DNWA 3SX4A 5LP1A 3ONWA 5DXAA 5JSFA 2EFJA 3D7LA 4MUGA 2FPGB 4PLVA 3S7TA 4L8FA 3W5JA 1BXRA 2HUNA 3KJEA 3E0XA 3RVBA 1MO2A 3ETNA 3SJCA 1FTSA 5CLFA 3EIHA 1HTWA 2LIPA 1EFHA 1XD8A 2IYRA 1FS6A 3NJ4A 5DT9A 2ZE6A 3TNJA 1ZOIA 4MS3B 3RVSA 4HTFA 4M86A 3DOOA 3ZHSA 5CX4A 1OWOA 2CY0A 3CRNA 1VJ0A 1J8DA 2ACWA 3ZCXA 4A0GA 4BX0A 4HS4A 5B1EA 2FWNA 1DAMA 1UXJA 4BMNA 2O59A 1FMFA 1FU7A 5T41A 4H6VA 4UULA 1QP7A 2F3SA 2FLVA 1XDSA 1ABEA 1XZEA 1LU9A 4OQYA 4Q12A 3BYZA 3QBJA 4FJ1A 3J7TA 1M1UA 3IIKA 4HYQA 1H94A 2OQ2A 4HP8A 4ZAGA 3OQOA 4D26A 2Q7OE 1G1AA 4K1XA 3WWOA 2DY0A 3ZWYA 4DKXA 5I9SA 3UG7A 1TJ3A 5AW9A 3JVUA 4P82A 4K6GA 3JWPA 2NZUG 4FR0A 4FINA 4OGKA 3OVMA 3IPXA 1JSZA 4HEJA 5LQDA 1OHHD 1UJNA 1JLRA 2YIMA 2Z43A 1F6DA 3AYXB 4HNSA 3CLHA 3LIIA 1Q14A 4R68A 4UAVA 3ZCQA 2CDNA 3K5IA 1C8VB 1HY3A 1JWBB 1ZDMA 2GMWA 4RD6A 3VPFA 3UANA 3V34A 3GYBA 1GPYA 2W4QA 2WJ4A 1AB6A 1DQPA 3M70A 3VGJA 1P1HA 3A1SA 4GDMA 1T2DA 3DJYA 4DLWA 1VPLA 4LCBA 2H63A 4J3FA 1TQ8A 1YOBA 2GN6A 4Y2SA 1VIYA 1TF5A 5CFZA 3EXIA 2NWQA 4GNKA 2ZPTX 4AK9A 1SRRA 1O0CA 1YL5A 3SYRA 4IIHA 5IJZA 4K81B 4P3OA 2JVJA 2GZHA 2UZ1B 2Z09A 4Q3DA 4R2HA 4ZI5A 3GFRA 3UBTA 1O9HA 3OEED 5HGJA 5D3QA 3FYSA 4EIWA 4NONA 3NHMA 4QOIA 4ZZ3A 1NN1A 1GGNA 2ATIA 4ENSA 1X9IA 4MIKA 1FQWA 1FNMA 3F67A 3FM9A 2RGAA 3MA0A 5HIIA 3WJ7A 1SXHA 4L85A 4DLUA 2O3SA 2E4VA 4C4XA 3RKUA 2VCEA 3O4RA 2DVMA 3VH2A 5B1HA 2PS0A 2ZPAA 2DZDA 3ML1A 4MR8A 2AFIE 2JJ1D 4TV8A 1ULHA 4B6PA 1DDOA 4DJTA 2HJVA 3NHZA 4DQ0A 2P6RA 2J0SA 1RKUA 4RLQA 2Y6VA 1JIVA 2FLWA 1T29A 3ACDA 3AF5A 5ITVA 3ZV7A 4YV0A 3E22B 2J7KA 3MMNA 5D87A 1EVLA 3U7JA 2IUFA 1PZMA 5KYYB 1AXGA 4BBPA 1GGVA 1QDLB 1XMJA 3OE4A 4BO4A 3PI6A 3ROGA 4AKHA 2ERCA 1RJ9A 2HHAA 1SA0B 1PLLA 1Y4ZA 2K7FA 4Z3OA 3ZWPA 1VE5A 5KCMA 5EE9A 1WQ1R 3RJZA 4MJXA 3LZCA 4K9PA 2JFHA 4KXWA 3ODPA 3H5RA 2DETA 2GEDA 3LDHA 4GZ3A 2ZB7A 3LZDA 2G5GX 2HWKA 1QFMA 2MJLA 3NASA 1F51E 5EQFA 1UAGA 5FNVF 2XQFA 1QV7A 5FRDA 2EP5A 4GKJB 2DQ4A 3NC0C 5E3HA 1Q7CA 2O3RA 3ZDEA 4G37A 3ZBQA 1DWOA 2C61A 1B3BA 2EJBA 1YJQA 4ZVMA 2JLVA 4M60A 4YQFA 2W2PA 3HI6A 1RC8A 1JDNA 2XY4A 2ZULA 4QQ8A 4UMDA 5ARDA 2TSYB 2XMBA 4I9HA 4P4GA 4N6GA 3PPWA 1T24A 3IP5A 4UPEA 3O03A 3T0FA 5L4SA 1RWKA 2ZJ8A 1ZXBA 2KYRA 3BIWA 4GPEA 1FX0A 3F3YA 5LQNA 3QELA 3K0EA 1N9KA 4CV0A 3CUEF 2O2DA 4IPTA 4WN3A 5ER6A 3FYCA 1N5DA 1M2JA 1USIA 2QLJA 5J23A 2PJUA 2P91A 1KIFA 5C80A 3JASA 2VQFB 1N8TA 4RSMA 1IEWA 3RC1A 3I6YA 3DE4X 3IIMA 3FTFA 3TTTA 2BI8A 1DBSA 1OVGA 1QG0A 1ZS9A 3ELDA 3FFXA 3OZRA 2PTHA 5CVJA 3ESCA 4BLQA 3V46A 3W5CA 4BV8A 4Z1OA 1DOAA 1N1GA 3GI1A 4FB5A 2R4UA 2WI8A 1DINA 5LFAA 5EA2A 3ILXA 4KYUA 1AA9A 3K92A 5ES4B 2GZAA 3A1CA 3A4VA 4LRYA 1NURA 1QRSA 1E63A 1A98A 1SCAA 4M6WA 1IM5A 2ZDHA 4EHLA 1G59A 3V33A 3NM5A 4RVFA 2EP8A 1LLDA 3P27A 1TMKA 3CRMA 2D0DA 4LKOA 1OLSA 3BK1A 3QITA 5LL6P 1BGVA 5A9SA 1GZVA 3EPPA 3OFNA 2G8LA 5KCZA 1NI5A 1O96A 3FPGA 1USGA 2O48X 5FI3A 2YXNA 3R5JA 4QBGB 4EFKA 1E3DA 2XI4A 4EDFA 1TVKB 1L2TA 4E5UA 3MGKA 3NBQA 3G9UA 4RMJA 4ZVSA 1KKUA 1E7WA 2BZ1A 4NENA 5FOQA 3GOQA 3LQ4A 1EVIA 3BJIC 3GCXA 2DBRA 3K9GA 3FJ1A 3H97A 1T9AA 3FLAA 1U9YA 4IDEA 1HNWB 3S8EA 2QVXX 3AL3A 1I7LA 4EYKA 4OY3A 1LNQA 1FFCA 3KXDA 3MWGA 4HDQB 3OIGA 2I3DA 5K8CA 3NJ8A 4MAFA 5I4KA 5I5EA 3U3MA 1UC5B 4Z4QA 2OMKA 2GM4A 2R4TA 1S96A 2R65A 3PNLA 3QBTA 3L1VA 3WOHA 3W5IA 3AESA 2OSBA 1H2WA 3E2PA 4DTCA 4QFBA 1CX9B 3ZH2A 4X1OA 2G82A 4MQ5A 2EW1A 1S0UA 2PWBA 1Y5NA 3NT4A 1PJSA 1Q15A 1PVOA 1DXQA 4S0ZA 5FTLA 1X7WA 1II0A 4M54A 1V7CA 3FHLA 4P22A 2EJWA 4W9NA 3CF0A 2FETA 3DZJA 1DPGA 1NTOA 1KJWA 1NDUA 1NJGA 3JZMA 4FYJA 5CX1B 4YMUA 1JT9A 1MGOA 2O4CA 4W8OA 2BM9A 4QUDA 1ADCA 1L7PA 2XKAA 4ZOLF 3QBDA 4O8ZA 3TLGB 2G6TA 3FCCA 3GFFA 2X1LA 5BNZA 3GRPA 4CLEA 2CYCA 5B53A 4ZZ0A 1G9TA 1EIWA 4PVDA 2I2CA 2WBLC 2PVSA 4E03A 2OK7A 4CKBA 2VK4A 4CN8A 2NNWB 2C5GA 1H2ZA 1Z7WA 2WJVA 2YR0A 4D92A 4YRNA 3L82B 4OHOA 5A6SB 4R2WA 5B4VA 2BOVA 1KJ9A 4R5MA 3GFGA 4YPFA 4C6RA 4EHIA 4YAUA 2QI9F 2H54A 2VNJA 3WLHA 2WT9A 4I1IA 3UMFA 2QVZX 4IEFB 1UEIA 4PC6A 4CM1A 3K70C 3KSMA 3D64A 4GSKA 4F9TA 1XN1A 1TTQB 4MTCA 4YUXA 2NAFA 4ZTUB 2R8RA 2WE8A 1K7YA 1M6NA 2ZR7A 3B1JA 4TKVB 5KSYA 2I9KA 1T6BY 5KC9A 4HH3C 3ZY4A 2G8NA 3MJDA 4N8DA 1TU0A 1MIOB 3QUTA 4Y6LA 4ZODA 5CCDA 1F8FA 1F4VA 3ILHA 4FGJA 3B89A 4LK2A 3VQTA 2JVIA 3V1YA 3A25A 5FH9A 3FOFC 4N3AA 4PLPA 3SCZA 1KHTA 2UVQA 4C5AA 4YNBA 1SKYB 1YS1X 2WF9A 3BKWA 2GZDA 4FYYA 3EFHA 1NFRA 1COZA 4KIUA 3ZLBA 2WFAA 3GR6A 3NH6A 2A1TR 1ISFA 2QRGA 5EPEA 1H4SA 1SQSA 3UB2A 1LBSA 1CF2O 2GPWA 1UWVA 4R98A 4RZQA 2XMZA 2QG4A 1L8OA 2Q7XA 1IQUA 4J2TA 5ALRA 5JAPA 5D00A 2Y2UA 3I28A 4BMYA 3LQ1A 5HRAA 1J99A 4B3GA 4KQJA 4TXMA 5CDFA 5IK2D 3LHDA 4FEGA 1DJLA 1VL0A 2GCOB 2EKZA 2EL7A 2IOFA 3SEZA 3PQDA 3FCEA 3WMRA 1KFEB 1WPXA 2GEVA 2G5CA 1QHNA 3BMOB 4TUYF 1UFVA 1HFKA 4Q4CA 1NU8A 4Q3LA 3DDCA 4CDMA 3TLZA 2YYSA 1TCCA 5C32A 3GFTA 2JFPA 1IXSB 2IUSA 1NR1A 2ZJ0A 2BMEA 5CIWA 4RIHA 4WESB 2DFDA 3MELA 3SIXA 3R76A 1X13A 3CLSD 3I9V6 2ODBA 4ZZ2A 4E5MA 3ABSB 3N0VA 4YRCA 1KWGA 4E6EA 1BX1A 3UH0A 2VZ8A 2HWXA 4ADSG 5JJLA 3BRWD 3D5EA 1IZZA 4GD3Q 5GQSA 4CTJA 1CRPA 5AXAA 2IUEA 4MEAA 3CUSA 1E7RA 3C5WP 4BLVA 1AO3A 3EISA 3TSOA 4C04A 1MVLA 2BFEB 4F96A 3F7OA 4A15A 1X1DA 3GD7A 3HB4X 2I6UA 4K9DA 4OBWA 4DGSA 3HKDB 3IXMA 4KPUB 4KODA 1JS1X 1Z68A 2PQMA 2BHTA 4RHUA 3WFZA 5LOVA 4G1FA 2OC9A 3NT5A 1CUSA 2IW1A 1JB9A 2ORIA 1P17A 2HA5A 3HEAA 3L7KA 3PYLA 4O0MA 2JGAA 5LXTF 5LIRA 4MVJP 3U40A 3ZI4A 3IJPA 1R0YA 4NCIA 1ZISA 4B1FA 1B8PA 3ZX5A 2O0JA 4WBNB 3O74A 1Q83A 1YRYE 3OLQA 1OZHA 2AMVA 3PFBA 5E6SB 4N3CA 4NEQA 4ASUA 4NCKA 2I4RA 3DV0A 5JLAA 3L0SA 1ZFNA 1HA3A 1RCUA 3C6QA 1DAKA 4QYWA 4DR1B 4I6GA 4UW9A 4JQYA 4QL3A 4UVIA 4QVIA 3I4LA 3RF6A 1BWRA 3DHYA 3P2MA 4E2XA 2QRVA 2AYZA 2WSSD 3PPVA 3UGJA 3HB5X 1LNZA 3VVLA 2M6KA 4MR9B 4DV1B 5I9MA 1UBEA 4C7MA 5JZOA 4HNVA 1I4OA 4EKIA 5JSHA 1CEQA 4F91B 4JROA 1Z7EA 1B7GO 5JCZA 5LWHA 3VZPA 3PUWA 2Q9BA 4GX2A 3SC4A 3GEPA 3U2QA 3IXLA 1V96A 1L3IA 1U6IA 3BDIA 2WT4A 4V0SA 3FNIA 4X97A 4CL8A 2FDCA 5E6SA 3TQTA 2QMZA 3K0KA 3QRWA 4FIZA 4KNVA 4PW0A 2XYRA 3VUEA 2YWEA 2YOHA 5K4HA 3MLAA 4NU8X 1XAHA 2HRCA 4LOJA 3PEWA 3D7SA 3HPQA 1SB8A 3N07A 4KQCA 5HZHA 4OKSA 4C2TA 1MOZA 5JMTA 3HKDA 3KLPX 4YQEA 1NBAA 1RPAA 2ZRMA 3CWZA 1CZNA 1QP0A 1YR3A 4B80A 2ZRAA 2WTEA 1NW4A 3OTWA 4R7GA 1T9GS 5EFOA 5I4CA 5EWLA 2AR9A 1BMFA 2PZBA 1WXFA 3DW3X 1IN7A 4M55A 1PKXA 4LW8A 3NDBB 7REQB 2P2SA 2CFIA 4Y2UA 3VZRA 5A02A 3ZYCA 1DAEA 1YFJA 3PE4A 2J3EA 4OM8A 4E51A 1L4MA 3MMZA 5EZYF 3TM4A 4EP1A 1TZ2A 4BFTA 1T1JA 3UPDA 2EEPA 3DZBA 4G5GA 1YV9A 5B1SA 3PG5A 1A69A 1AB5A 1II8B 1C1YA 2QRNA 3NX4A 4YQZA 3VU8A 4RZ2A 3BMOA 4H4DA 2W2LA 3MXTA 1UM9A 3EVNA 4O4HB 4CEJB 1E66A 2H0RA 2VTBA 2DLNA 3AW8A 1RZRD 2J3DA 4H6PA 5GOTA 3AFHA 1Q21A 5TQVA 1V4BA 4HEA1 3PFCA 3IHKA 2B4QA 2YWDA 4YP6A 4Q3BA 5J2UB 3A4NA 1ZGBA 4K9OA 3PRJA 3VYRB 4PLTA 1JIJA 2C9OA 2EBFX 3LF2A 3OO0A 1M8PA 3GJ8A 4MS1B 4GBED 3EFOA 4HWTA 1BD4A 2EG9A 1OZ0A 1I2CA 4K46A 4OJKA 4XYBA 1NOKA 1X1BA 3A9SA 3WK6A 2VLBA 3RS8A 3OJ0A 4KSCA 3QLVC 2XAAA 1RAIA 1JFLA 1TF7A 2QSJA 2VYQA 3OD5A 4LE2A 1VE9A 1I24A 5DLDA 4DG5A 5KTYA 1YS6A 4YRAA 2NQ2C 5BUSA 1RPJA 4NZNA 1C0IA 1WLYA 1EFTA 1YDGA 4ZJPA 3W3AD 3K9HA 3D81A 3OOYA 3UJBA 3WGJA 3VKHA 4L4RA 4GR5A 1KZYC 3EA4A 4O2BA 4RTSA 3ICOA 3LXMA 4FGZA 1ML3A 1H9BA 2XSZD 1DIOB 4JIGA 4UOEA 2PT9A 4KLZA 5KVQA 1T15A 2GFQA 5IAOA 2OYSA 2WYVA 1C3LA 3BHIA 1S9HA 3QKIA 5GV8A 3T1QA 2QM7A 3RK4A 3E7PA 4HNTA 1VE1A 4FYKA 4TLLB 4K6OA 4MQMA 4YQYA 3X0DA 2QQGA 2QVLA 2BFAA 2QM0A 1TO1E 1CYEA 5DGCA 2HWYA 1JHXA 2QSYA 2RAUA 3BCUA 3OJXA 4F84A 1J24A 16PKA 4Y6QA 1H1LB 3JQBA 1YBAA 1XDUA 3EGVA 4P35A 421PA 3CM0A 3TLMA 2GAOA 3PYMA 3OKFA 4HWGA 3T6KA 3KBBA 1UC4B 1GUDA 1PEKE 2JAXA 4RD4A 3ZVLA 2DKNA 2CXPA 1D8AA 3U7RA 4GKAA 1ODTC 1UK7A 3TRJA 2ZTLA 4GE3A 1OV6A 2FA9A 2O3QA 4X6YA 1MB9A 5IJ9A 4KMMA 4JUAA 2VYFA 3DAGA 2QLBA 4IEEA 1GU7A 1LX7A 1XD9A 3G88A 1T4DA 1CIJA 4FW9A 4LHVA 1VCMA 1P2FA 1KQFA 5KVAA 4L51A 3M2TA 3QV2A 5LC1A 2F59A 3GJXC 3QY0A 3EEBA 4NI5A 3K9QO 3UOWA 4MJ7A 3QYPA 4Y2TA 1WWKA 3PRHA 4MUJA 5ALMA 4RL4A 1TA4A 1GUAA 2ZKIA 5IBQA 3U31A 5JCPA 4EJ0A 3VUFA 1LLUA 3BGWA 3ZH9B 4ERXA 3O4JA 2Z08A 1UBMS 3OFJA 3PVCA 2R7KA 4G9GA 4QYTA 1PN3A 1XEWY 1WKVA 3EIWA 1WXEA 4YALA 2WPNA 4JC0A 1EGAA 1EVQA