2LD4A

Solution structure of the n-terminal domain of human anamorsin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anamorsin
publication title Anamorsin Is a [2Fe-2S] Cluster-Containing Substrate of the Mia40-Dependent Mitochondrial Protein Trapping Machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ld4A00
1QAQA 3LDGA 1KIAA 1YUBA 4PYIA 4M38A 5EEHA 3GRRA 5KYGA 5DM1A 5KQRA 2NP6A 3OE5A 4DF3A 1XDUA 3SSOA 5EVJA 5DM2A 2YXDA 2F8LA 5C9ZA 1KYWA 4LWOA 3MQ2A 4GOOD 2NNWB 1NBHA 3NDIA 2ZFUA 3EEYA 2I7CA 3HCDA 5FA5A 3DMGA 1PRYA 2B78A 3LCVB 2P41A 5KQSA 2I9KA 4A6EA 1VP9A 1L9KA 2BZGA 3TQSA 5BP7A 3EVZA 1D2CA 5E2AA 5IH3A 2VZ9A 1AQJA 3E23A 2PXAA 3D2LA 3DMFA 1Q0SA 3O4FA 5D1NA 5FQNA 2C7RA 5CVDA 1UIRA 3MTIA 1YFJA 1ORHA 2G8NA 3E8SA 5LQRA 1P39A 5HFJA 4DQ0A 4PYKA 2OYRA 2GA9A 3SSMA 2ZZNA 3JWHA 3IYLW 1UWVA 3DUWA 2OPBA 1WXXA 3THSA 3OU6A 4RTPA 4GC9A 1P91A 1KXZA 1QANA 4GOMD 5FADA 4JXJA 5G02A 3UBTA 3UZUA 5FCDA 5DLYA 3FYDA 3A7DA 3V97A 3ID6C 3LDUA 1FPQA 3MCTA 3DLCA 1RI4A 2IFTA 1XVAA 1G55A 3G5TA 3KPWA 5EIFA 1NW7A 4AZVA 3FPFA 2UYOA 5ERGB 1QAOA 1NE2A 3GIWA 3LDFA 3PVCA 4WXHA 5E8RA 4Z2YA 2QM3A 3SXJA 5K0GA 2E5WA 2AN3A 3M6WA 2ZCJA 4RV9A 4EKGA 2PVCA 3AWIA 3LL7A 5LSAA 3SR4A 2ZBRA 3SX0A 3EVBA 1R8XA 5DTRA 3NWBA 2VP3A 2ZBPA 4GBED 5T64A 3PFHA 1NT2A 2QYOA 3B7PA 3A26A 4QQKA 4AZTA 3KQOA 1QZZA 3UJBA 4QPNA 5E1DA 2YX1A 3KQSA 4F85A 1XCJA 3BWYA 3OCJA 4ISCA 9MHTA 1RJDA 3HCCA 4MWZA 2PX4A 3AXTA 3G5LA 3GDHA 4LG1A 3EEOA 2JHCA 2XYRA 4R05A 4PIMA 4KDRA 4RTKA 4RSRA 4XUCA 3PLAE 4CWAA 3PTAA 2GPYA 5DRTA 3I5UA 4YMGA 3X0DA 3KR0A 2XYVA 4DCGA 4EK9A 1WZNA 3HVHA 1EJ0A 5ICEA 2ZIGA 3P2KA 1EG2A 1Q0TA 3EMBA 3TFWA 1L1EA 3LECA 2Z6UA 3DOUA 4AUKA 3OZTA 4MIKA 3FTDA 4QTTB 5FQOA 2PT6A 1JG2A 2QRVA 5LQJA 5DX8A 2UYHA 2UZ4A 4R6XA 3LX6A 3R9XB 3SSNA 5EHGA 1FP2A 3P9IA 5EZSA 2BM8A 5EOVA 4KIFA 4PGHA 5E8JA 3FUVA 3KQMA 4FZVA 2P3QA 4QTUB 4K6MA 1G8SA 1RI1A 5DTMA 5C1IA 2PBFA 4A6DA 5K01A 5LQAA 2IBTA 1JTFA 3GGDA 3GNLA 4ER3A 3EVDA 4PWYA 5K0CA 5CUQA 2IH5A 5FWAA 1NV8A 5ICFA 1SG9A 2G70A 4BLVA 3AJDA 5GP1A 3OFJA 2QE6A 3AY0A 5ICGA 1F38A 1VQ1A 1AQIA 4PYOA 5EPEA 2HNKA 4FGZA 3V8VA 4E31A 1RI3A 3MCZA 5EMMA 4ER0A 3KPYA 4OBWA 3CVOA 3MERA 2FHPA 3C6MA 3HEMA 3M6XA 4QVKA 2OB1A 2HTEA 2Q41A 2IH2A 2ONZA 3DLIA 5DT2A 5FHQA 1NBIA 2GLUA 2VDVE 5DWQA 4BP1A 3IEIA 3BGIA 2XVMA 2CL5A 3EPPA 2I62A 3OFKA 5CVEA 2AR0A 3GRZA 1IM8A 5EMKA 5BW4A 4RTRA 3G8BA 3HA3A 2ZIEA 2PX5A 3C3YA 3ME5A 4RTSA 1FJXA 1QAMA 3CGGA 4R8RA 5DXAA 3TKAA 1RI2A 3S68A 4AX8A 5HOQA 5DSTA 2XYQA 4ER5A 3PFGA 2C7OA 1XDSA 4PYMA 2ZZKA 4E2ZA 2PY6A 3FUUA 4RWZA 2ZWVA 3Q87B 1M0EA 2NXJA 2QRVB 3Q7EA 5EKXA 4MTLA 4FT2A 4RYLA 4IKPA 2ESRA 1ZGJA 1ZG3A 3E05A 1ZHFA 2N47A 1G8AA 2KW5A 4KDCA 2VDUE 2NXEA 3MGGA 4GEKA 3SMQA 1WY7A 1YFLA 4IV8A 1N7JA 5CVUA 3SGLA 4RVHA 3UJDA 3BZBA 3R0QA 1TW3A 4QPPA 4C08A 4MQ4A 2LD4A 3UJ7A 2PXXA 1X1DA 3TRKA 5CM2Z 2Z6QA 3P9KA 3RIEA 3KQTA 2P7IA 2PX8A 3A7EA 5FULA 4AZSA 2GAFA 3B89A 3FRHA 4E70A 2Z6AA 1X1AA 1XXLA 2ZSUA 1KYZA 5B1SA 3WSTA 4EKIA 3KQPA 2ZTHA 1EAMA 2CKDA 3HNRA 5ICCA 3I64A 3CJTA 5DX0A 4OQEA 3DXYA 4RTQA 5CVVA 3B3GA 3OZRA 1BHJA 4KWCA 3MAGA 4O29A 4YUYA 3KR9A 4CTJA 3CJQA 4IV0A 2ORED 5DRYA 3RW9A 4LWPA 3GRYA 3HVKA 2NP7A 2ZBQA 1KPHA 1MHTA 5DM0A 3OPNA 1KHHA 4QQNA 3NMUF 3DXZA 4YV0A 1PJZA 2O0LA 1RJGA 5EEGA 2HMYB 5EMLA 2WA1A 2FYTA 4M36A 2AN5A 4LECA 2YVLA 3DP7A 4P58A 1P1CA 5LQNA 4X41A 1YF3A 4MHTA 2BR5A 2XBMA 2YR0A 3G8AA 1L3CA 3HCFA 3BGVA 1WS6A 2P8JA 2YTZA 5DM4A 8MHTA 3NJRA 3TPZA 3LHDA 1X19A 3GJYA 3LKZA 1KR5A 1XDZA 4R6WA 5EMJA 3UJCA 4E2YA 1OR8A 1L3IA 3PX3A 2V74B 5KVAA 3C3PA 3C6KA 1O9HA 3CJRA 3QOWA 4C07A 2WK1A 1DUSA 5C0OE 3NVMB 4DM3A 5K0EA 4YV2A 4F86A 5KS2A 2AOUB 3G2MA 3P97A 3NDJA 3QOXA 5EHIA 2ZLBA 5LQUA 1JQ3A 2O57A 2JH9A 2OBFA 4M37A 4QDKA 3GCZA 2UYQA 2B25A 3PT9A 2AOTA 2ZULA 2OKCA 3O31A 4FSXA 4H0NA 2H11A 1JG4A 3HCBA 4RVGA 4U7TB 5GM2A 4PCLA 2OXTA 4EMSA 1R6AA 4YUWA 3CBGA 3UJAA 4RTMA 2B3TA 4HG2A 2ADMA 3LKDA 2IIPA 1YZ3A 1VLMA 2DULA 2I6GA 2P35A 4PCAA 5CVJA 4RTLA 5CD1A 4YUXA 2AOVA 4OX9Y 3A4TA 4E32A 2UYCA 3KQWA 3BWCA 4E2WA 2O07A 3HTXA 5HIIA 2OO3A 3K0BA 4P7GA 5U4XA 1FBNA 4RTOA 3M4XA 3LCUA 5HILA 3L8DA 4DKJA 1XJ5A 2B9EA 2FCAA 5MHTA 4V0QA 2YUIA 5DX1A 4UOEA 1U2ZA 5GM1A 3KPVA 4RVFA 3KPUA 3P8ZA 1DL5A 3P9CA 1VE3A 3R3HA 2Y1WA 2P3OA 4Y2HA 3DXXA 4RVDA 3EVGA 5EG5A 4HH4A 5T67A 3T7TA 4R8SA 2EJUA 3SVZA 1R74A 1SQGA 1VL5A 4C05A 1BKYA 3FYCA 1XTPA 3GWZA 2P3LA 3T0IA 3FTFA 5E1BA 7MHTA 1IY9A 2CMHA 5E9QA 5FHRA 3TKYA 4YV1A 3RODA 5JR3A 5M5BA 3ER9A 3JWJA 3LBFA 2JHPA 3EVEA 3B5IA 5CCXA 3TR6A 5GOZA 2H00A 1NW3A 2PV0A 1H1DA 2AOTB 4HGYA 3G2QA 1ZGAA 3O7WA 4PONA 2HR1A 1AF7A 1L3BA 2CMGA 3P9NA 5GWXA 1Z3CA 1VPTA 3LBYA 4YUVA 3ERCA 5FTWA 2H1RA 5EZQA 3P71T 3BUSA 4KVZA 4E33A 4RX1A 3OU7A 2NXNA 1BC5A 3M6VA 4QVGA 5F2KA 3K6RA 3PS9A 2C7PA 4B17A 1O9GA 4ER6A 5HZMA 2JJQA 5P8WA 1EJ6A 3QV2A 4OQDA 4QDJA 4PYJA 1NW6A 1M6EX 2PWPA 5LQKA 3DMHA 2IPXA 1RJEA 3EGIA 4P7KA 3UA3A 1SKMA 3OU2A 1QYRA 4CKEA 4YMHA 2HV9A 2NXCA 3M6UA 5FWDA 3BWMA 3KR2A 3FUWA 2B2CA 2PWYA 3EGEA 2P40A 2EFJA 3NTVA 2O06A 5HIKA 4PGGA 5F2OA 2PT9A 2ERCA 3FPEA 1DCTA 3BKWA 2AOUA 2YXLA 1HMYA 3SM3A 3VYWA 4ZTBA 2IP2A 5EQJB 1M6YA 1NKVA 2G71A 2Y1XA 4WVLA 4PYQA 2ZVJA 3AXSA 3P2IA 4P7JA 3KQYA 2AOXA 1JSZA 3I9FA 1KPGA 1X1CA 3HCAA 1VIDA 3DULA 1R8YA 3FTEA 4V0RA 3FPJA 4HRAA 3JWIA 4ATNA 1JQDA 1BOOA 1Y8CA 1SUSA 3BXOA 3HM2A 4BY9E 2ZZMA 5LR6A 3CCFA 3DTNA 2AVDA 4C03A 2IGTA 1D2HA 3IHTA 3ORHA 3LCCA 3U81A 3BWBA 4E30A 3THRA 2IDJA 1IXKA 2AOWA 2OY0A 10MHA 3OZSA 2K4MA 3T7RA 2IBSA 4DA4A 2A14A 3CKKA 4E2XA 5K8VA 4P7FA 1ZKDA 2V7EA 4KRGA 5FA8A 4HSGA 2O05A 4BLUA 5T6BA 2BM9A 4GOND 4XUEA 5EKUA 1I4WA 5HIJA 3BGDA 5DXJA 5LQCA 3FPGA 3FZGA 4C06A 2GS9A 3OE4A 3UA4A 1TW2A 4HC4A 1MJFA 5F2NA 5HEKA 4C04A 4U7PB 3DR5A 3KR1A 4AZWA 2ZIFA 1O54A 3ELWA 3KQVA 3LSTA 3MTEA 3VSEA 4C4AA 4PNEA 1INLA 3BT7A 4F84A 3NVKI 1ORIA 3TM4A 1G6Q1 2HWKA 4CKCA 4BLWA 1RJFA 2BR4A 3M33A 1YZHA 1F3LA 5EIWA 2FK7A 2GB4A 3EVAA 5E2BA 4M7RA 5K09A 1I1NA 3HVJA 4X63A 1D2GA 3HVIA 4DMGA 2AS0A 3UWPA 5GIPE 2C7QA 2WA2A 3H2BA 5DTQA 1P1BA 2DPMA 5K0LA 3G7UA 4HTFA 5DPMA 1TPYA 2ZWAA 4EVIA 4PYNA 1JR4A 1R18A 2EX4A 2ZW9A 3GXOA 2AZTA 4OA5A 1G38A 1AV6A 3TLJA 1JSXA 4KW7A 5K0FA 4YUZA 4RTNA 3FUTA 3B3FA 4L7VA 4PYLA 1I9GA 2JHAA 5IKMA 1NW5A 4POOA 4NECA 4OA8A 3TM5A 2VS1A 4GF5A 5CIYA 1SVUA 4DZRA 4RTJA 2FRXA 2PLWA 4FS8A 1EQAA 4OBXA 4GC5A 3NW9A 2EG5A 4GQBA 5E1MA 3PB3A 3CC8A 2YQZA 4FR0A 4X60A 4ER7A 3I53A 5EC8A 1JQEA 5FUBA 2QY6A 4X1OA 5D1HA 3T7SA 5BW5A 2BH2A 3M70A 2IH4A 4PIPA 1R00A 2GH1A 4DCMA 2R6ZA 3G89A 2BR3A 2NYUA 3EMDA 1T43A 2FK8A 3HA5A 4G56A 3FRIA 1JTEA 3VC2A 3ER8A 3GRUA 4CXMA 3DH0A 1G60A 1WXWA 3P2EA 3LPMA 3VC1A 2OB2A 2PSSA 2JG3A 2CWWA 3KPJA 3A27A 5K0JA 3TMAA 1JG3A 5K0NA 3R6TA 3EVFA 3G2OA 5K0BA 3MHTA 3LGAA 5E9JA 2AN4A 2PKWA 3F4KA 2P1DA 3PX2A 5BXYA 2PX2A 1SQFA 4PINA 2AVNA 4HTFB 1XCLA 1VBFA 2YXEA 1EIZA 1JG1A 4KIGA 1X1BA 2OZVA 1FP1D 1N7IA 3IV6A 3HA7A 3I58A 3KHKA 3HCEA 3KQQA 5E1OA 3REOA 4EQZA 4FT4A 3A25A 3GRVA 1ZQ9A 3ELDA 2IDKA 4IWNA 5DSXA 5EGSA 1VP3A 2FPOA 2G72A 3R24A 1NW8A 4HGZA 4CTKA 3B3JA 4GUAA 1HNNA 3GU3A 3EVCA 2EJTA 3UJ6A 2XVAA 4X61A 3KKZA 1SUIA 4FSDA 3G2PA 3UFBA 1V39A 3EGVA 3UJ9A 3G88A 2G1PA 3NWEA 2R3SA 4BP3A 1NV9A 1UFKA 3ELUA 5K05A 4CKBA 5GIOE 4XCXA 2PJDA 1B42A 3GO4A 5H02A 1KP9A 3HP7A 5GINE 5E9WA 4Y30A 4GOLD 3BKXA 3FUXA 2P7HA 2VDWA 2JH8A 3FTCA 3E7PA 1RI5A 2PXCA 4XUDA 1WG8A 2PGXA 5HIMA 5JUWA 3ELYA 2ONYA 5CCBA 3UJ8A 5K03A 3C0KA 1YB2A 3JWGA 3TOSA 3FPHA 4FP9A 1KPIA 3ANXA 3MB5A 1N2XA 3KU1A
chains in the Genus database with same CATH superfamily
1DINA 4OGKA 4W8OA 3IODA 4PYIA 1BXGA 4XTCS 1EI9A 1Z0AA 4LXGA 4C6HA 5JS7A 5D7NA 1ZR2A 1E89A 1KQGA 2XOKA 4I6JA 3BK1A 4MQMA 3ADKA 1SC4A 4D46A 3Q9LA 3QOFA 1NBHA 2XB4A 1LPAB 1K4KA 2FFRA 2ID9A 3M4NA 3TQCA 5JJCA 5F4ZA 4Q02A 2O6LA 1SKYE 2YUTA 5EJIA 2QQFA 4FE4A 1WV1A 2OG2A 3W90A 5LQDA 2XSZD 4X97A 3K09A 3MTIA 3ZE2B 5GTDA 4BNFA 4NBRA 4FOTA 3QP9A 4CVNA 1E1KA 1PNVA 721PA 3H5VA 1GRNA 3NHJA 4LHXA 2BMFA 3BXZA 1FC0A 5GZ6A 1OZ0A 4FEEA 4PCVA 4QC2A 2EF0A 2F3SA 1E94E 1H1LB 1W4CA 2VYFA 4NR0A 3S1SA 3ZJUA 3T3PB 5B55A 2I4LA 3KWMA 3ZNPA 4DDTA 4C7OB 5BN1A 3AKDA 3MCTA 4KSBA 1T3GA 3GJ3A 1V0JA 1DC5A 1OLXB 1JR3E 1U80A 3FPFA 1DX6A 3F2VA 4FWTA 2VDWB 3MJVA 3KVVA 5CXUA 3COSA 4HH1A 1JBEA 3L1UA 1XAJA 4EKGA 3S8YA 1JYFA 1D6MA 5DP1A 5G0TA 3FYTA 4Q9JA 4TYNA 3K92A 3QVVA 4J2TA 2P9TA 4O2AB 4ECAA 2D7JA 5ITVA 3F67A 1AUQA 1U9YA 1U8UA 2QG6A 3ZW9A 4B9AA 2UUBB 1Z4KA 4MRAA 1V11B 4NENB 4G8JA 3TLEA 2VK4A 3FTNA 3V6LA 4JGBA 1ATZA 2IY8A 3M34A 1FLAA 1E64A 1PWXA 4OIFA 3DJYA 1B41A 3VZDA 1XELA 2O5EA 3KWLA 5DLPA 3W3AA 3CRRA 3AI7A 5JSUA 2XYRA 3TIIA 2WSYB 3C70A 1UBRS 4ZOLA 1VBKA 2JGKA 2QD2A 3DYIA 4XI9A 4CWAA 1NUAA 3MAJA 3I5UA 1NL3A 3G6KA 4BFUA 3WO0A 3HVHA 3N2YA 3AF5A 4JR2A 2DUNA 2H18A 4KXYA 3ZCVA 2QW8A 3PFCA 3AUUA 2EFEB 4C78A 1F0KA 2E4YA 3PRKE 2H85A 5ALFA 1U8CB 4DLYA 1H5NA 5KWEA 1VKJA 3U7FB 2R8RA 1ZU5A 2P9BA 2A5JA 3KJQA 3R3WA 4H3SA 3V00A 4FW8A 3KZCA 6Q21A 5LQJA 3AUTA 4X0EA 4B6QA 4KRXA 3H17A 1Y6QA 4NVRA 4UU7A 1VHJA 1LBIA 1YRLA 2YQ5A 1UPTA 4ZQEA 5MN6A 5FFMA 1F3OA 4W4TA 1I6KA 4Z1OA 5LM3A 5C1IA 3AJAA 4KMOA 5DHPA 3Q10A 3VAZA 2VCEA 4EWLA 2IZ5A 1JB9A 3CLTC 3EVDA 1WXGA 1K3UB 5CT5A 1NV8A 3AKEA 1BWPA 5EJ2A 1ZK2A 1I14A 3IV7A 1W5BA 2QUAA 3AY0A 1VQ1A 5CB4B 4NE9A 4FGZA 4Z9YA 1KSFX 1CNFA 1NJFA 1NVDA 2RHJA 4V2UA 4UMVA 2JBWA 2KBEA 2Q3HA 4I1IA 2K6GA 4WA7A 4D7AA 1Z4JA 4OB6A 3TF5A 3DCYA 2O19A 3CRZA 2O3JA 3MOIA 3S55A 1EFRA 4C0LA 2GFHA 3DLIA 3UJPA 3KOZA 3N86A 4GRDA 4IF6A 4OH1A 4W8HA 3I2JA 3PPYA 2O5VA 5KYUB 3AOGA 2IY9A 1K89A 2QNRA 4OX9B 2AR0A 5EMKA 3UCXA 3A2MA 1MGPA 1PL7A 1QPGA 5B7NA 1TYCA 2DETA 2R9VA 4TKLA 4LYHA 2WU1A 3DE5X 3MILA 2IHBA 5A2QA 1K97A 1MOSA 2P9FA 1QIHA 4CDMA 4WCVA 2NO6A 5F33A 1CXZA 2G67A 1LEHA 3CUEF 4DQXA 2CLCX 4U7HA 4JLNA 3ZLUA 2Z1NA 4JJZA 3V4PB 1C3JA 3RUPA 1GPMA 1LCIA 3GH1A 3OZVA 2O8NA 3PA6A 4K0KB 3MGGA 2ACWA 3M1LA 3C39A 3FTQA 3FN4A 4JJAA 3HUDA 3ICQB 1CUJA 1ZXBA 2OAEA 4WAUA 4H0FA 3DZBA 4BNUA 3D6FA 3P4XA 4C08A 2GN9A 2IVZA 1CYEA 1TECE 1AVTA 2ENWA 3DE4X 4F6RB 4WXMA 1RMQA 1TA9A 3WDSA 1MV5A 3N8DA 4ETMA 2Y0BA 2Y3IA 2IY7A 4KEAA 4HEQA 4YAIA 3MMXA 4LJ4A 1BX1A 3PXCX 3SYKA 2FGKA 5KTNA 1U0GA 3RIEA 3MNFA 5JWOA 4YT8A 5D00A 4FYXA 4X94A 3HCWA 4ZVVA 1WDWB 5FR1A 5JEDA 4UEQA 1SAYA 1JHPA 2RHTA 3HCOA 3NV9A 4B3RB 1XXLA 2B34A 1SURA 1QPBA 2O5CA 4CGZA 2HWWA 3INNA 3KOOA 2B94A 3E35A 5IUNC 4WCFA 3EX7C 4Q6BA 3W5VA 2PUWA 2VQ6A 3IESA 3EGWA 3X3HA 3O0DA 1CWUA 2BZ1A 4JB0A 5DDIP 1EGHA 1A4RA 1Z5PA 3IE2A 4J0QA 1VIYA 4F12A 1YA6A 1P2VA 5G53C 3G9UA 3R7SA 1Z13A 4BMDA 1ZRNA 3OPNA 2JLSA 5BUSA 5ALZA 3NO4A 2AF3C 1B93A 1GL9B 2ZDGA 3A05A 2GZSA 3ICOA 3DXZA 3ILSA 4MQFB 4REMA 3ACDA 3BRWA 2WV7A 2WJ6A 2YHIA 5CH5A 3P2JA 4UMFA 3TBKA 4YRSA 4CEHB 4FHFA 3UUFA 4DCSA 2PRSA 2H4XA 1CQZA 1X7XA 1FP6A 3B1XA 2YR0A 4I9UA 3G8AA 5BNWA 4KO3S 3KETA 1SUEA 1T6XA 2ZRJA 4KV9A 5ESXA 1XDZA 3X2FA 3L8GA 3DEFA 2GERA 2HLDD 1WOMA 2YZ2A 2H1OA 3E9YA 1A3CA 1SD2A 3TL6A 1CQIB 1MO3A 1W59A 3Q3JB 5C0OE 2FG6C 3GP5A 4CDRA 3AFIA 5HVNA 1NONA 4YQZA 1BMTA 4FGUA 1JQ3A 4KIJA 1YB6A 3D6AA 1YZFA 3IDAA 3F3KA 2JKVA 1RKBA 4UULA 1NQVA 4N8EA 2CT8A 1HL7A 5LIRA 1DJNA 4I4LA 3QNMA 1NBEA 2IW3A 4P6VF 2VWQA 3L05A 4L78A 1T6ZA 1H3FA 1PBTA 1QIMA 2BFWA 4WLVA 1R8QA 1A9SA 4FGJA 2I67A 1WCV1 5DV9A 2AMVA 4C14A 2RH4A 3L7CA 4BFCA 2FX2A 4K7JA 5ESWA 3UKDA 3RVSA 1M1NB 4Z9XA 2X0NA 2GBFA 3C24A 2WNSA 3HSKA 4ABYA 3TSAA 2B83A 2PH5A 3LWZA 5LB2A 5EYPB 5LU9A 4CKXA 4CEJA 2ZTVA 1O5TA 3FZQA 4DZTA 3ZHBA 1N6LA 1UEXC 2FPSA 4LXTA 2IRWA 5HILA 4X00A 1MABA 4OKSA 4WCFC 1IPFA 1TEHA 4HEHA 4ZVSA 3OZXA 4LC0A 4U7GA 1PJQA 1SA0B 2GJSA 4G26A 1VLZA 3ZHOA 3ZEIA 2XD4A 1L4HA 3KPUA 3GLIB 3BREA 4G5HA 5FPHA 1W36C 2F6RA 4GGMX 4XEUA 4O59O 2XPCA 4MB6A 3LQ4A 5A9TA 4DC1A 4EOGA 2FETA 4YRQA 5C51B 4J07A 1TF7A 5CFRA 2R8BA 2ZAMA 4FGSA 1G6OA 4LTDA 3AT1A 4UUAA 3O8OA 2GEDA 4ZXFA 4DSUA 3VNVA 2AR7A 1XTPA 5CIWA 4L07A 5CJPA 5E2IA 5FEUA 3E1SA 3SQMA 1PS8A 1SBQA 2XITA 3ER9A 2ZBGA 3PJGA 1ZCBA 3G0IA 4ISBA 3H2HA 4L15A 4ZQBA 3RSZA 1I33A 1X80A 2JHPA 3QVJA 1Z74A 1O87A 3I09A 3V4SA 3G0GA 4Z8YA 1UZMA 1X1SA 2M9MA 4DXHA 1GSOA 4B76A 4UE2A 2BHNA 4O2BA 1M67A 1KY2A 3K0FB 4I3GA 1E1QD 4IIYA 1MQSA 1RM3A 3B1JA 3CCBA 1OIXA 2D5CA 4HGOA 3RVKA 4CLHA 4UKDA 1Z3CA 1V8OA 2HBRA 4N47A 3OQOA 3NWJA 4EG8A 1E61A 3PUJA 5EWLB 3DTVD 2PYDA 2YW2A 2B21A 3PCTA 3FROA 2QMHA 1XTBA 2FQ1A 3O4JA 3PS9A 4B17A 2APJA 5KWIA 3ET5A 1I2ZA 5FLYA 1UCFA 3FNBA 4MUYA 5TMBA 1YBAA 2PWPA 1NTOA 1E1DA 1WKVA 1ZNWA 3ZX4A 3P4YA 4MHTA 3FYUC 4TV9B 1W0JA 4P4TA 3ROZA 4ND5A 2ADOA 2ZIAA 3BD6A 1M1XB 2XGMA 3AP1A 3AEKB 3TXAA 3T61A 3A9CA 4LSZA 1WP4A 2B2CA 2JPDA 3KXIA 1POXA 2ZRNA 3IQGX 4RVOA 4IIEA 5JD6A 1JW9B 3B82A 3KOMA 4CT4B 3SZMA 4BQIA 2EBHX 1NKVA 4EGAA 1NZJA 2Y1XA 3PGMA 1J8MF 1ZKMA 2J3EA 2FDRA 2Q2NA 2QLFA 3DR3A 3KP1A 5H81A 1PWZA 2RDMA 3MRXA 1Z6GA 2AOXA 4D4JA 3DAOA 3HHEA 3SYLA 1Y7IA 2CNWA 3G2HA 4CEIA 3SHVA 2HRQA 1QOQB 1Q0PA 1DAOA 3DS8A 1JQDA 1DXQA 3JTEA 5J4HA 1EH5A 7REQA 2HU2A 2FFQA 3SHQA 1BX0A 4C03A 1FDOA 1XRLA 3GFFA 2ACVA 2QTWB 5LZ5A 1U9IA 1T9KA 3RFFA 5HQJA 1V7ZA 1ENZA 3VKFA 3TOCA 4GP9A 4HPWA 2HOQA 3N7UA 3SJZA 1QR6A 3V1TC 1KQFA 1DFIA 2H4HA 3NT5A 3MAAC 5DHUA 1FQWA 3DKVA 4MA5A 4R1QA 4RETA 3NPMA 3VR3A 1J6UA 1JE1A 4MH0R 4KDFA 1H0RA 4XIYA 4J1TC 5EIHA 2O0JA 2GS9A 5CM9C 5BN4A 3JAMA 1OSNA 3OE4A 2ONJA 3OIFA 5L40A 1SCUB 4YJ3B 1M8KA 2OYCA 4GDFA 1RKQA 4J0EA 3GZJA 4AY4A 4TLLB 3AUFA 2BGNA 4LJYA 1JHDA 1ECPA 4NBWA 3H5WA 1XB2A 4IDDA 1GUYA 2F8MA 4JJ8A 3RGGA 2LP4Y 3W34A 2HPZA 3VZQA 3RRBA 3C8HA 1G6HA 3EZ9A 4Y2JA 3SS7X 3UWKA 3PQEA 3EN0A 4AS2A 1QE0A 3QLJA 2GXAA 1MJNA 4CKZA 1I24A 3O4IA 1TM2A 4J76A 3UWPA 2OGSA 5JPDA 3EQ8A 3UJ3X 3H11B 1T8TA 4JFAA 3G2IA 4CTMA 3IAM6 1JXMA 3I01M 3T7JA 4KPYA 2XMDA 1JJFA 4G0YA 1JQKA 3EXFA 4HDKA 1FCJA 2F17A 2Z83A 4TYPA 2VF2A 3TQFA 4Q12A 4WADA 4EITA 5FBKA 2JJ1A 4ALMA 1J8QA 4EG0A 1E62A 1XJ0A 1EP3B 2VS1A 1SVUA 3BG5A 1YDGA 1PW7A 4CM4B 2IS1A 2BEWA 5HBGA 1UMCA 3NW9A 1P4JA 1YI8A 4B3SB 4LSWA 1ODLA 3F8WA 2LV8A 5E3HA 4I36A 1Z7YA 4WJLA 3H83A 5B1EA 3KKPA 1SZJG 2O7SA 1CE8A 3Q7RA 3DE7X 1EQ2A 2R6ZA 1ZCZA 1POWA 3SDBA 1YSCA 2PN1A 1J0DA 1MEJA 3CTMA 4RBNA 3UMVA 3A0UA 5IU6A 1AUXA 3H5TA 2HU5A 4IO1A 2COEA 4INZA 1IUOA 3F6CA 4A4DA 3FOWA 4BKOA 1YU9A 1G4UR 3N0VA 1OXXK 4MVJM 2PSSA 4DQLA 1L5WA 1QX3A 2F7SA 3V7YA 3J7AC 2R68A 1MX1A 3CZ9A 5FOTA 1DV2A 1ZGGA 4MGKR 3QQPA 1XOIA 1U8ZA 2X0RA 3L8CA 3LPLA 1LSJA 1TCBA 2WKRA 4WK2B 1JPNA 1YULA 3EE6A 3QPUA 4UFOA 5KAPA 3BQMB 3U9LA 2YMPA 4JQOA 4HZGA 3S1AB 2DERA 3GZNB 1L7OA 3NHYA 1PEYA 2WM2A 3QBDA 2I2DA 2X77A 1YCFA 4OQXA 3QPWA 1CJTC 2OZVA 4YRJA 2QRNA 1N7IA 2WF7A 1H2EA 1JHZA 1JA0A 2AK3A 5FFNA 3WAJA 1F4VA 2A7QA 3Q3CA 4HX9A 1JSLA 4Q21A 1Q20A 2C9MA 3N9IA 3R44A 1PDOA 2QMYA 3D4NA 3M83A 1L5HA 3RC1A 1DV1A 4ABTA 2HXGA 1Q15A 5E6RB 1I30A 1VMAA 1M10A 2XOKD 1RRPA 4LQ4A 1E4YA 1X7ZB 1NVAA 1XYYA 2HWXA 2Q3JA 1EE1A 2QDXA 4NYMQ 6CHYA 3H9UA 1UPAA 1V8ZA 2AEFA 3ZLBA 4CQMB 5KDDA 3G88A 4NPAA 1KP2A 1WD5A 2G1PA 3A9SA 3JD2A 1DTWB 5HJEA 2QTHA 3D43A 3JCZA 1C30A 4FK8A 1UJBA 4LRXA 1OI7A 2I6TA 4U5QA 4YRFA 1TCAA 4C30A 3QX8A 2R2AA 1YQXA 3HPRA 4RGVA 5H02A 1U3DA 3OPYI 4RQAA 3UC9A 1U28A 4P81A 5BV1A 2VUUA 5CEEA 1K2WA 3E7PA 3ILVA 2VJNA 4LYYA 3TTYA 4TV8A 3P96A 1WW8A 4N7RA 1ODTC 4D6PA 1SCBA 2FW6A 2D2IA 2PX0A 2WLSA 3EDOA 1SU6A 1FDIA 1J0EA 2WKPA 4QOGA 5CX4A 4L95C 5I47A 1P9NA 2BGJA 3SP1A 4PHTA 2QSYA 4PQFA 3OE5A 2GXUA 2XYHA 3UQYS 4GX0A 3C41J 1RW4A 2OHVA 3PPIA 1WABA 2B8TA 1JMVA 1GN8A 2ZKIA 1DHRA 3K2QA 5HM8A 2NSDA 2EW8A 1JZQA 3K9HA 3WZLA 4DVGA 4Z7QB 2PGNA 3LW8A 3OFVA 4BBPA 1EX6A 4L3OA 2HY7A 1EK2A 1MX5A 4MV8A 3D2LA 4PXAA 3O4FA 5C8VA 1CVLA 1E2PA 1E1MA 1P5ZB 3KXPA 3NVAA 4QD3A 2D4AA 2D00A 5C5IA 3WL7A 1GLVA 3IAM1 2GAJA 4PX9A 1VJCA 4M0UA 4WZAB 2Z8ZA 4CFYA 1TM7E 4XARA 3W3AD 3KUDA 4U9IS 1BH2A 2DUUA 3PUYA 1XWFA 1Z6YA 4M60A 1EFHA 1A8IA 3R8FA 2WZCA 5FO1A 2HQOA 1UBLS 1CR0A 4BZPA 2VF8A 1CR1A 1GPDG 4IJMA 4GZ6A 4CM8A 3A7DA 1UAAA 4M22A 1AKEA 1V16B 1ZO8A 1TO1E 5AK3A 1SUAA 2OQRA 3EBLA 3NUGA 4IFBA 1RC8A 2HSZA 4K46A 4WHMA 1TIKA 2J6CA 3PVCA 5LBTA 5I4BA 4GGPA 3IPYA 5K0GA 5KJFA 2D6FA 4RQUA 1HYQA 4EGQA 1TCCA 2Q1TA 4OK6A 1TLLA 1O7JA 1NVVQ 4RK4A 2Y6VA 4W7SA 3S27A 3SKXA 3QX3A 3E7DA 3JX9A 1ZUWA 3P52A 4LDAA 1DKRA 3N2GB 1R0RE 1F7UA 3WHIA 1F5SA 1L5SA 2JASA 4S0ZA 8OHMA 4A82A 5LD2B 1QORA 3KL2A 3R23A 3TSYA 1GTMA 2PKYX 4ZEOA 4LTNA 4QASA 1U28C 3M81A 1FSFA 2IOFA 2OECA 3LRXA 1J9ZA 2KLBA 4LG1A 2YWRA 4MB2A 4EY4A 1G64A 1B0ZA 3WISA 5JXJA 1PYOA 5AOCA 4FYMA 2X0FA 5K8LA 1W29A 3PTAA 1LXCA 2OHHA 3I05A 4OPMA 3ZOZA 4RF4A 3DW3X 4EK9A 1TJ3A 3IAEA 4EDHA 4AQYB 4F56A 3FHTA 1F2UA 1TEXA 1QG4A 3FTPA 4ID9A 2NU8A 1Z73A 3NTOA 2ZSIA 1BE6A 2BP7B 4BQRA 3LNCA 3RFXA 1NXOA 2F67A 4KPUA 2X4GA 3P32A 2QYTA 5E7QA 1YRQA 3TLGB 4AWAA 3MVEA 4EUEA 4U2GA 3TNDA 1RD4A 4QQ8A 4C22A 4E3ZA 3N59A 3VR4A 4QO7A 1OFGA 3JQBC 4D8YA 4EG4A 5EZSA 2BM8A 4R51A 4AB1A 1Q1ZA 2I4TA 1H69A 4YIKA 4DSAA 3RAGA 1NUPA 4QFCA 5LLTA 4QTUB 3FCXA 5LQAA 1P60A 4TL7A 3UOAB 1LY1A 4ALLA 2FW0A 2NO1A 3RU7A 1MZVA 6ADHA 3VVBA 1A4UA 2QX8A 2P1RA 2JIOA 2V5UA 1RWQA 4BFZA 1S1MA 3KFVA 3UT0A 3UIEA 5LWHA 4R8MA 3ANSA 3LVRE 5TGTA 5ECYA 1HDXA 2AYZA 2Z5LA 1QH8A 1NKTA 4LOJA 3L0PA 3MERA 1A76A 1B0AA 2Q3BA 3DONA 4JNKA 1URPA 3TWOA 4QUKA 4Q9IA 2XLCA 4HVCA 1FRQA 1T9BA 5DWQA 1YVUA 2VAPA 2L17A 3IEXA 4D9KA 1ZIYA 4RVSA 5JY1A 1T9AA 2WIDA 1JMYA 2EGHA 3A1EA 5BW4A 2FSVA 3FNQA 1KRWA 2PWAA 2ZIEA 4B3DA 4QHSA 3KKKA 1I7SB 3E4DA 4IILA 1BHQ1 2H16A 2PRYA 4DLKA 5HOQA 4Z7JA 5U9CA 3AM1A 5F73A 4HS9A 5AVOA 3OLCX 1J97A 2N9UA 3FCCA 1KHTA 1FP7A 4LWQA 3UB3A 1XDSA 4OV6B 1RYFA 3EW7A 1ZSNA 4OAPA 2FMTA 2BM1A 3EEIA 4L16A 1G5QA 1KA9H 4MTLA 3WO1A 2GJ8A 2R96A 4L0DA 6NULA 1R1DA 1O94C 3CNBA 2C20A 3B6MA 3RS8A 3P0EA 3STTA 4MS3B 1RMYA 1N9KA 1FUYB 1W4AA 4JOSA 3AR7A 2I87A 5AOAA 3ZCUA 1W8DA 5E6UA 4BO0A 4C7MA 1T2EA 5KQPA 1H8HA 3I42A 3BDIA 3BRWD 1DG9A 3VBEA 1X8LA 1ZONA 2FZEA 3GZ4A 4DEVA 5IH7A 1NJ8A 1BTOA 3IKJA 4UDNA 3E9RA 4MK4A 1LVUA 2YICA 2GPNA 4JJ4A 5CB6A 4Z3DA 1TT7A 1G8YA 4HWKA 5KPJA 2V54A 1WQ3A 3PQ2A 1Z2NX 2Q4TA 4K9LA 1ILWA 4U02A 3NBQA 4II7A 3STHA 3U6BA 3BULA 1JT9A 2QXUA 2Q21A 1E63A 2P5YA 1F2TB 3AILA 3W6OA 4EECA 4TVSA 3DKKA 2ZRPA 1XU7A 3IULA 1BHJA 2FLVA 1TLFA 1J00A 3NB0A 4YQYA 3UT6A 1MO2A 2GRUA 3A31A 1AZWA 5GAJA 3CG0A 3ZQJA 4EHBA 4UBMA 2I6SA 4M8LA 5CJJA 3RW9A 4R1SA 2F55A 1JSCA 2INGX 2J5BA 3GRYA 3KSMA 3VDMA 2YASA 1G3MA 4MQEB 5DEOA 3VNQA 5EN4A 1QK4A 1ZISA 5IF3A 1OH6A 1K6MA 1X7HA 4Y2TA 5IANA 1DRUA 1GQOA 1W30A 3UCEA 2CJYA 1EWYA 4KX5A 5BV0A 5IBQA 3KBBA 2WA1A 2YOFA 4MA4A 4RE6A 1YF3A 2WD7A 4PG8A 4GLBA 1NJSA 2IPMA 7MDHA 5FBLB 1L3CA 3ENKA 2FSVC 5K5EA 5DM4A 2GQ0A 5KX5F 2ZJYA 4JP1A 4L5IA 4MWCA 2HFKA 4L72A 2Y9PB 2K2WA 5JEEA 5ALJA 2DM6A 3BF8A 3VH1A 4XYEA 1TVKB 2BFBA 2V6JA 1IBLB 3GPCA 5HE9A 1BROA 3DO8A 3KE8A 3G7SA 4HTAA 1S3FA 4BLSA 4CV0A 1DT5A 1XTKA 1E5VA 4XJXA 3R3YA 4C4XA 1U65A 2ZT7A 3P2MA 5IKEA 1J99A 2IYNA 3O4VA 2JH9A 5JISA 2IXDA 3T1HB 3RHTA 2NU6B 4LDRA 4OFZA 2G4CA 3FHOA 3HRIA 4GLOA 3T3GA 2FZLA 4QGBA 3DZ8A 3TDKA 5LDHA 2JGEA 1B2RA 1QGED 1S2MA 3AR6A 2OQVA 3ZZTA 2JA2A 3OD1A 4JGIA 3CSSA 2V3WA 1AGNA 1LTQA 3Q7TA 3DJFA 2XD9A 3PTZA 3L4KA 1ZGHA 1CZOA 1O3YA 1UPCA 5KSZA 4M1TA 5LXTB 1FLVA 3A37A 5H16A 4XWOA 1HM5A 4Y6LA 3QMMA 4EELA 4HVLA 2W2OA 4N9WA 1RM4A 2OEPA 1J06A 3PHJA 4HHEA 2X0DA 1OFUA 2VHCA 1BVHA 1N9ZA 2D8MA 4B3MB 3AZPA 2XQJA 2G0TA 5JSYA 2PUGA 4NCXA 1UBNA 1EK1A 2PRIA 4E1VA 3FPCA 3LA6A 2B5OA 2IOQA 4HJXA 1EGQA 3CR7A 2JH3A 4B6JA 2EJUA 1UP6A 4O1MA 2WYIA 4ZVOA 4P2BA 3K9CA 4Q3DA 5CLQA 1W0JD 1A9TA 1JHUA 4PS1A 2CMHA 3H84A 1MKYA 3KVOA 2J48A 4BFWA 2FZ4A 4BCDA 1W1WA 2I2AA 2NM0A 3D7LA 3M5CA 4UVEA 3A1UA 1JDTA 3EZ2A 5CCXA 1WV0A 2WI8A 3NORA 4MA0A 5IARA 1CSEE 4OQ4A 4RIFA 3WGYA 3HEAA 2AMFA 4ED9A 1LPMA 3K0KA 4DR5B 1I80A 1VHTA 1O95D 2X3FA 1PT5A 3H04A 4WKPA 1LJLA 4WOBA 3RVNA 4DJFC 4PPQA 4RGYA 1PR1A 1HQCA 1ZUHA 2CHEA 3NEJA 5I4CA 4WOKA 3WK7A 3N7AA 4LNHA 3NM4A 3WGVA 3UHOA 2CNWD 3PSHA 3VSAA 5B36A 4DXAA 3O2SB 1Z7BA 1ZMBA 2JFHA 1QO0A 2OHXA 4YAFA 4IZOA 4LF7B 4KBFA 3NAGA 4QUGA 2JJQA 4ZO9A 4PZ0A 1AUOA 4NYJQ 4P5EA 3H2JA 4J1QA 1AM4D 4EEZA 1ADBA 1E66A 1UKYA 2NVOA 1P2FA 1JVBA 2P6MA 2R97A 3HBAA 2X9LA 3SYNA 3TIXB 2GPAA 4HATA 5I7EA 3U39A 4IRUB 1F20A 3OOWA 1M8FA 1PJ8A 3BORA 3BYZA 1DKPA 4DM7A 2NGRA 1U90A 3DT9A 4GZ5A 4FZ3A 1WDKA 1FW8A 1R2QA 1YR8A 1PK7A 5L9AA 4CM3A 1KNQA 5A9SA 4NWIA 2WNHA 3D81A 2WJ3A 4MDYA 2P1ZA 1YQWA 5IASA 1NY5A 3K9BA 4E5NA 2WILA 2VJAA 3QXXA 1NG9A 1GQSA 2FJUA 3ZWQA 3LQRA 1JEQA 3CN9A 3ZN2A 2YNMA 2NZVG 2IF2A 3IOYA 4ZYYA 2R7MA 3HCAA 5DU2A 2OHOA 4RMGA 3OHSX 4HGRA 5LP6C 2V7UA 1G20E 1EXVA 4OOFA 2J32A 1C9KA 2HQSA 2WIJA 4BTLA 1Y8CA 2H1SA 2DF8A 3DF7A 1NHGA 2ZWPA 3DEJA 3LUKA 3EDCA 1GU0A 3LC1O 3NKVA 4Q7LA 3RFCA 2VP9A 2HMAA 5JG7A 4C0WA 1ZOLA 2PMFA 2FXIA 1ST2A 4TOIA 1M2VA 2G63A 3VJRA 4BNGA 1YZLA 4NAUA 3OZSA 5TQ2A 2K4MA 2C96A 1PUXA 3GDGA 2ZM6B 3LX5A 4PN7A 3IAUA 2DY1A 1UPXA 1HSOA 3QEOA 5EKUA 5KCMA 4AU1A 2BDUA 2EHDA 4UXHA 1UJMA 4ZZ3A 4XM0A 1D07A 2JJ1D 2OV4A 3C48A 1FDTA 4O4HB 4OB8A 1Y8QA 4K6FA 1MJFA 4TLDA 1FK8A 5GONA 3K5WA 5A4IS 4UQLA 2GZ2A 4PAWA 3DMPA 2Q6KA 1QDUA 5HCUA 2VWHA 1VG9B 1OXMA 5IJ0A 3WGUA 3CONA 1XQ6A 3TL2A 1E0SA 2IV2X 1QRDA 4H4CA 3W05A 1Z36A 3SF0A 1RC1A 2WNIA 2VT7A 3K6JA 4DSNA 2B1RA 4ZCTA 1FJGB 3CXUA 1YKFA 3QLVA 4ACBA 1X39A 4FB5A 3MJSA 1WXHA 2ZYRA 3KYCB 2WAXA 3QMVA 4X63A 4R69A 4Z4FA 5I8PA 3E9ZA 3PICA 3KT8A 2OXFA 4LJ8A 1I94B 1TK9A 2J5KA 2ZSAA 4FFWA 1TA0A 3AIIA 4N54A 4A6PA 2UV8A 4AX4A 3RDPA 2JAHA 1FS4A 5DHRA 4OL9A 3PXDA 2AZTA 3O26A 3K70C 2QX4A 2E5LB 4X8LA 3VOSA 4YUZA 1L5MA 3WK5A 5BRAA 3OUUA 1IHOA 1F06A 4U39A 3FVWA 5AJZA 4Y6SA 4ZC8A 1FTSA 1LDBA 1H2FA 3L8YA 3ND8A 4AC9A 2POCA 1COWD 4MW2A 1ISFA 1EP2B 2RB4A 2YVAA 4M76B 1IB6A 4LXQA 1EFTA 1VE1A 2GCIA 1UBFA 2NU7A 2VK2A 2D0DA 4B3BA 2YNMC 3I45A 4EO4A 1MOPA 4P4UA 3IX7A 2QMEA 4GQBA 3K2EA 3U56A 1BG6A 4FR0A 1YRHA 2J3MA 4KMRA 4X7RA 4QBHA 4KWIA 3JWEA 5EC8A 1MA0A 4MWSA 2Q1XA 4KQIA 2A1TR 1HEIA 4W7HA 5GQSA 1R88A 2X0KA 4JT2A 1VTKA 5D5PA 3WYGA 1D4OA 5KX5B 3ER8A 4GSKA 4R3NA 5ULLA 4CIVA 4MRNA 3MD0A 4ZT5A 5IAJA 4B8WA 2CV0A 1NRWA 1SGWA 4JBXA 5C7OO 4UC0A 1GTG1 1UT6A 1GPKA 1MB9A 1UDCA 3GRKA 5I9MA 1XMPA 3JRWA 5K0BA 5CFPA 4ZPXA 3S1LA 3L46A 1IJKA 1KMHA 3CHYA 2AUMA 3ETEA 3G1UA 4RO0A 5IK2A 3UEOA 5BXYA 2JFZA 4R1TA 5T3YA 3IEMA 1QRSA 1W4ZA 5SZHB 3GLGB 4HN2A 2HHJA 1FP1D 4WJZA 1QCZA 4Q82A 3B9PA 1UT5A 4FMDF 5DYYA 3GRVA 4N41A 2VKQA 5CAEA 1X7YB 3M6IA 4D3DA 2G72A 4HGZA 2XDQA 4DQVA 3T5TA 3EVCA 4TRRA 2NTEA 3PRHA 3I1JA 3EC2A 1H0SA 4OQFA 2Q4DA 3MUNA 5JFTA 1M76A 3PRJA 3UFBA 1FTQA 1WKBA 5IVIA 4RFVA 1KVRA 2PSHA 3L6DA 4YH1A 1ZOOA 2DSTA 3L8EA 3QUCA 5J59A 4BNJA 5DJ5A 1IZ0A 4FYJA 4YACA 2OENG 4M86A 1V1JA 4HEA1 3PJDA 4XDYA 1G16A 1DXYA 3D8HA 3I4LA 1SXIA 1EBBA 1OYYA 5AHWA 1X0VA 2I3BA 3A6JA 3EIHA 3CO5A 3HY6A 3D31A 3IPAA 3MHPA 4BWFB 5HJ2A 2ZBFA 5JZMA 1ZDMA 4V0ME 1Y5LA 4EM6A 2F1IA 2VJMB 3U40A 3J81A 2O8EB 4FP9A 4WOPA 3WMWA 2IYZA 3COPA 5E9QA 2WAOA 1T15A 2UZIR 1QAQA 4LJ5A 3ZWVA 1TUBB 2YFQA 4URWR 1PFYA 3EA5A 4CF6A 4QUDA 4KNVA 3GEMA 4FNOA 1LWNA 1SNYA 2OAP1 2FOLA 5C9ZA 2WB4A 2NNWB 2OVBA 2R1VA 4CLRA 2X8JA 1YUMA 4HB3A 4D4HA 4XOIA 5AVWA 3IBGA 3LCVB 4RIGA 3WQRA 4OSEA 1ODJA 4PLZA 3EMKA 3J7TA 4CIDA 1NDHA 3IXMA 3U17A 3VPFA 4ESHA 4KLZA 1ABBA 2H9YA 2C7RA 3PJRA 3N8IA 1K98A 3T41A 2QV7A 3RVJA 1J8DA 1TKRA 5HFJA 4AWBA 5CNIA 3PD7A 3FOAA 4QECA 5FL7A 4EYQA 2GEJA 4RTPA 1K9VF 1YHZA 1YQDA 4MS4B 2C4MA 2X5OA 1PVDA 3R9XA 2XAAA 2HYDA 3PT5A 4QVIA 1FNMA 4GM0A 2IUUA 2O23A 3IVMA 2JVJA 1VIMA 1JQ5A 4FD3A 3T4UA 3WFZA 4NFHA 4Y2SA 5ADUS 4R2MA 4BMCA 1NQ5A 2ZCJA 1R7RA 5ITZB 3RS7A 1EJBA 5KQMA 3ZJVA 2JAPA 3EFOB 2BFOA 4L8LA 1CZUA 1NI4B 2FR8A 3GCWA 3ZWWA 3D4IA 4M4SA 3VR4D 4DJTA 5J4KA 1QZZA 1QOPB 2KS6A 2ZI3A 1OLSA 4YREA 3ZPXA 3BWYA 3L07A 3QKTA 3IMFA 4JUDX 5LMCA 2BI4A 2E87A 4JXZA 1M2FA 2QYHA 1Q6YA 4KH0A 1E20A 4YI5A 2A4KA 1N2SA 3HDQA 3MB8A 4Q66C 1UMDA 2FUNB 2RHGB 5FUQA 3HO1A 3RSQA 1EFUA 1EWTA 4UTZA 3IAS1 3SZLA 1QZUA 1JU9A 4DCGA 1XEXB 3CM0A 2EFGA 1CB0A 4KK3A 2J67A 1XBTA 1Z8NA 4DLXA 4QJ4A 1O8CA 3A14A 4OHKA 1NP7A 2X13A 1VPLA 3C5WP 1PWHA 2F3UA 3B12A 2GAIA 3SI7A 1AGYA 2RKWA 3A4NA 4RDXA 2C00A 2VSYA 5HF9A 1WU7A 3CZCA 4A9AA 2CDAA 1XNHA 1TC2A 1N5DA 3C1OA 1LNSA 4K6KA 1TZMA 3DZCA 1V5GA 5E4JA 2OCDA 5LWQA 4MRVA 1CY1A 1BW9A 1JPVA 1QGUA 1Y3IA 4U6SA 4GW3A 4FDVA 1G8SA 3UW1A 3KQNA 1YT5A 4XSGA 2CSXA 2QZ9A 3C1UA 4ADSG 3KLNA 2DPGA 3NBKA 2XVYA 5SZKB 1R0CA 1ZS9A 2RK3A 4CR7A 5FXMA 1RLIA 2FSFA 2F1KA 4KYIB 1E5DA 1ZI8A 2G9NA 4BY9E 1SELA 3U4CA 4YIHA 1FFEA 1QH0A 2VT3A 4RU1A 2HT1A 4EVQA 4YRZA 5L4NA 1Y82A 1DKOA 5DBEX 1QRUA 2GUWA 4PC7A 5LL6P 1O6FA 1W94A 1H8HD 1LRLA 2I7DA 4XPIA 2CLOB 1GNTA 3H2GA 5FHQA 3SJ7A 5KU1A 2NOAA 3CTPA 3I9V6 3RO7A 1GNRA 2QIOA 1OZGA 5HFAA 4DYHA 1G63A 5KYWA 5JI2E 4CM9A 3L77A 1J2TA 5LYJF 1VMKA 3WLQA 4DDWA 1NXWA 2V7TA 2QUHA 3GEEA 5IPFA 5JV5A 4PO8A 3NV7A 1C5KA 5CHEA 4FLMA 5K3OA 3S68A 4C6TB 2FLKA 1JJVA 1H4SA 3OOYA 3EDMA 2MSCB 2A67A 1I7DA 4E2ZA 2IUSA 1CC1S 3UANA 1KSGA 4ERXA 1OFHA 1IBMB 4ZHQA 5TT0A 3Q9UA 4FT2A 3ND6A 4ZJZA 1SVLA 2BEUA 4A5SA 2Q2VA 2FUCA 4KDEA 3R7DA 2HO5A 2TMYA 4GL4A 5ER6A 1WY7A 4FJ1A 3U4QB 1KO1A 4O6VA 3G1TA 5AW1A 3SDZA 5CP8A 2HSEA 1IULA 1NA5A 2QE7A 3N58A 2NYAA 1T25A 4XIJA 5D84A 2BBWA 4C88A 2ODQA 1ULHA 3DMYA 3ZQ4A 1ZMRA 4W5QA 3I34X 4IQ4A 1N2JA 2DLDA 2YCLA 1LLUA 1R6BX 3QFSA 3GFGA 1SKYB 2ODPA 2E6UX 4E70A 3NDPA 4ZDWA 1WO8A 4XZ3A 3I4FA 4RLFA 4JI5B 2FRVA 1FFHA 2Z6AA 4XLZA 1B3RA 4J9UE 4QSMA 1HSZA 3BWXA 2DX7A 1X74A 1Z5VA 4BQOA 2WTXA 1J2RA 1DQYA 1C2TA 4G23A 4S3MA 3KAPA 5T4FA 3U7EB 3ZS8A 4O4IF 3UT5A 4YCSA 2Z57A 3GFPA 1F4LA 2FLWA 4AF6A 4ZTZB 3QKWA 3CJQA 4GDMA 1UZNA 5JNTA 3JQAA 3LP8A 3Q7SA 4MYCA 4RZHA 1VL0A 1NX9A 1F17A 2D2VA 4MMYB 5LZ7A 1H5UA 1NBOA 1NPTO 3AVPA 2QT0A 3S5JA 5CA1B 2OLKA 2JFNA 4QBTA 1ISJA 4RF2A 1OU4A 1GITA 1OQAA 3WBBA 1RJGA 1ZAKA 1MAUA 3KLMX 4U2FA 1P0MA 1A4XA 4GEGA 4M36A 1E2JA 3IH5A 4LECA 4YI3A 5EMLA 5JDCA 1IBKB 4QM7A 3W8DA 4BFLA 3PL5A 2XBMA 1EX9A 5EJEA 3Q0IA 2GOYA 4IHKA 4G37A 5D3QA 1ZN2A 2NZJA 1EB9A 2FPIB 4JEMA 1CS4C 1QTRA 1ZIDA 4F5YA 1IWPB 4OQLA 3RHFA 1OR8A 2IYYA 4ZYTA 1F9AA 3TOXA 2YJGA 2X22A 3UUGA 3HWRA 5T5QA 3BDAA 2IV3A 3HP1A 1EFPB 2QSZA 4MWEA 3BE6A 5GJWC 1G8JA 3A06A 5FPPA 4YV2A 2H5IA 3P97A 4G2NA 1NWHA 2DKFA 3VHXB 1V5FA 1A71A 5FBQB 1VCOA 2ST1A 3MPOA 3X43A 1GR1A 2O57A 2HZ7A 4WOCA 4I4CA 3WGKA 3QRWA 5CB8A 1QZXA 5IEBA 3WWOA 3DTVB 3O3OB 3B51X 1L5RA 3QEMA 1UDAA 2B36A 3G2NA 4JVNA 4WZ6A 4P2GA 3D7RA 4HDAA 1ZWKA 3QWFA 1YA8A 1XROA 3T8YA 5K8TA 1ULUA 4TXHA 4CQLB 1VLMA 3SF8B 3CNHA 3WIDA 2AMYA 1MT0A 3W4IA 3EAQA 1XF1A 1F4PA 4M7OA 5I4IA 2VDQB 4OX9Y 1DQPA 1ULBA 3SBXA 1FFXA 1LVHA 3BWCA 4R7ZA 1XMXA 5I9TA 1GPNA 4LJ6A 4JEIA 4H1HA 4Y0NA 1XQ1A 5CMLA 4YP7A 5HIIA 4W5TA 2HU7A 1FBNA 3VNUA 1A7UA 2DFKB 5AHOA 3S44A 2ZSJA 4JLSA 2O48X 5KKCA 3EXAA 4I1YA 3LT2A 4DW8A 1W75A 3D0KA 5EKDA 6REQB 1NMXA 1UBEA 4M0CA 1KAHA 3P9XA 1DG1G 2OGWA 2QRHA 4FYWA 3USCS 1CZKA 2ECOA 3M7IA 1TJNA 3VXKA 5TQVA 2RIRA 3KJNA 4BMPB 3OMLA 4Q0MA 1RXWA 1Q22A 5G3YA 3T4XA 1XZCA 4BAGA 1RWXA 4Y1GA 4KN5A 7GPBA 2VDRB 2GI4A 3HLTA 2P3LA 5IYZB 1K68A 4HGPA 1KQ3A 2JIMA 4I4TF 3ZCPA 1F6DA 2ZJ0A 4X24A 2HIMA 4LXUA 3K70D 3AHEA 3WLKX 1Y6GA 4NKRA 1SY7A 4UNIA 4DBLE 1B16A 1GTL1 4XSVA 2RE8A 4Z4GA 2P75A 1Y3AA 3HBLA 3I04M 1XT6A 1JVSA 4J0DA 1VPTA 3CW9A 3ETDA 4AKEA 2DSNA 4OVKA 5FTWA 3GPLA 3AJ9A 3FW1A 3B20A 3HJHA 2V96A 4GXQA 5F7JA 4YLYA 3KT3A 4BFYA 5A3VA 1G5TA 5BQXA 3MJFA 4AJ1A 3G8YA 5BURA 1MZPA 4QVGA 4UTVA 1N5RA 3IUSA 4C7KA 4UZEA 4IIUA 4LHVA 4XASA 2JFQA 1G3IA 1GPJA 2BJHA 4RAQA 2R8OA 2R4TA 4OQDA 2QMQA 4WV3A 2IPXA 2HDHA 1YAHA 2FF7A 1XZBA 1TNDA 3UA3A 3R5TA 3AF4A 3H9CA 1GL3A 3OU2A 5DYWA 5JSFA 1KTIA 2XNKA 4P3OA 4EEXA 3SC6A 3IELA 3TB6A 4L0CA 2PWYA 1OX4A 3LRTA 1U2SA 4LDNA 4TTIA 4CMBA 3QG5A 3HR8A 3Q0EA 3DDWA 1H2HA 2AQIA 2IOFK 3WJ1A 1ZNQO 3VPGA 3KTDA 1JFSA 3TQOA 1V45E 1OGJA 2PMKA 5AM2A 1GCGA 5C8YB 5AIAA 1JSZA 2YWCA 3MBKA 4PW0A 3O4GA 1V7CA 5I7VA 3BBLA 4C2TA 1HG1A 4ZK2A 2WZQA 5CTAA 2J5RA 3QVOA 3F3YA 4F9EA 1PKEA 3A1WA 2FSGA 2A9PA 4U3JA 4BN5A 3FTEA 1UXGA 3PC2A 3ZCSA 5IUKC 4JUBA 4KQWA 4E5KA 3RABA 3OSUA 4AJ2A 4M1KA 1ZRHA 1Z45A 1P4HA 1JHQA 1BJRE 2VSQA 3FF4A 3K35A 4TTAA 1HFJA 5DZSA 5HTKA 4C2UA 4NZYA 1EDDA 5AJTA 3TI7A 4OMDA 4WN9B 1IVSA 5IVKA 1Y33E 1QC5B 1TAQA 3BMNB 4Z0TA 3C85A 4D6XA 3K96A 5K8VA 2O50A 2O4CA 3HV0A 3ONVA 3LT5A 3PEFA 5IDXA 1OWNA 5LJIA 2I2FA 4FD2A 4HLCA 3L7KA 3OCVA 2GD2A 2MR6A 2O2EA 3FMGA 3P0FA 4KAFA 4KLRA 4OSOA 4L7QA 4WLOA 1LPBB 3JARA 4PHFA 1MIOB 4R2KA 3INRA 5LQCA 2PX3A 4MYDA 2CJPA 1GPWB 3OEYA 4HY3A 3SHOA 1U0RA 3E8MA 1A1SA 4ZK6A 2J9FA 3LSTA 4L02A 1JH8A 2GRJA 2PAFA 1ZJ6A 2C0PA 2ZJ5A 5IAGA 5BWBA 3H8WA 4BVGA 4G84A 4WUTA 4UTXA 2Q4EA 1EK6A 5J3JA 3NTUA 4ZCLA 4FS3A 4BO8A 1L7VC 3ROGA 4HZUA 4QFMA 3OKFA 4OAOA 3WDKA 1EMDA 4JUAA 3O75A 1VSTA 3L5KA 2W2LD 5KNBD 5DTQA 4MLCA 3D8NA 3C4QA 3HM9A 1Q3KA 3LPCA 1KNXA 4CMCA 4PZDA 4LZOA 5GY7A 1R9GA 5HA5A 2YXPX 4OQPA 2QL9A 1U3TA 4AMBA 1RU3A 2VBFA 3LLCA 1FFSA 1YJ8A 2VDKB 3PIRA 1M2KA 4O4IB 3TQHA 4FDAA 3EGXB 3WGHA 2RCNA 5F3WB 2EEZA 4BB0A 1OXTA 2YYZA 3LAWA 4OUDB 2JIZA 2Q6OA 2W43A 2IHTA 3IUEA 4KYVA 5ALEA 5BNIA 2A78A 5ALYA 3ZH2A 5IK2D 3FG9A 3NONA 2NVBA 5DXFA 3C14C 1MVNA 3H1GA 3G6WA 1GV0A 4L6IA 2QYSA 2YHBA 2WD9A 4F9GA 3DSRA 1O57A 1V96A 3GVHA 3PQFA 5AW7A 1V1MB 1PQ4A 1PW5A 5I8ZA 5D1HA 3NZEA 3U3OA 3UF0A 1H05A 1R00A 4GXNA 4EARA 3E0QA 1H8EA 3G89A 3NYQA 4LXIA 1I6LA 3N8GA 3EA0A 4PO9A 3UJNA 2G9ZA 1KF0A 3IVRA 5DI9A 3VC2A 3PUZA 1YJ5A 5IMBA 2PS9A 4FM9A 3SXUB 4R81A 1RHKA 1T9CA 2P5SA 4HDSB 1G66A 3AQ4A 3HO8A 3PK0A 4L6AA 3ROPA 3UFXA 5CYGA 2FQQA 3RFTA 4B40A 2PUAA 2HIHA 2PO7A 3BFPA 1OLUA 3R0IA 4KRYA 4EDFA 4IVNA 4J16A 4PC1A 3MHTA 4I99A 3M9XA 3D0OA 2W4IA 3I9NA 4PINA 4Y9UA 1FZTA 2CHGA 2C4HA 4RVNA 2VN8A 2YXEA 4L50A 2HV8A 1T5TA 2CGEA 3JYLA 1ONPA 3V1MA 5K0FA 1KI3A 2FPPB 1SHUX 3RS5A 1GZSA 2X1LA 3WJ7A 4KODA 2NZYA 4UM8B 1ZNXA 4GG1A 4AO7A 3K4HA 1Y1SA 4RK7A 2R6GA 2ZYWX 3UKJA 4D8VA 4U6QA 2XT6A 3D8UA 5JO9A 1BWRA 1GD1O 3CEHA 5KINB 5JRJA 3BB1A 4DZZA 3GQVA 1CKEA 1EWVA 3IB3A 1KDTA 4OEHA 4ZOLB 1T1RA 3K4QA 1Z82A 1CDOA 1N33B 4UUBA 4F1KA 2WUGA 4KXNA 3TR5A 2FP4B 2X19A 1T4CB 1M1UA 4PAOA 3GLTA 1QHGA 1KK1A 4EPVA 3DD1A 2TRSB 3EGDB 4KIWA 2A57A 2VPWA 4UEJA 5LNK1 4C87A 3FSEA 1NPYA 3KV3O 2HUPA 4KCGA 5E38A 1N0WA 3BKXA 3FM9A 1BGWA 4Q16A 2DMRA 2IE8A 4RPGA 4ARBA 1CV2A 4L4ZA 4TLCA 1QGAA 4R1MA 1Y5IA 3GEIA 2FRDC 3ELYA 3F7TA 2I3ZA 5FL7D 3AERA 4UFPA 2K2QB 5HF6A 3E9MA 4RHYA 1GU7A 1RRGA 3O1JC 3NH9A 3TOSA 1V47A 1SVSA 3FPHA 2C57A 3RTAA 3FNFA 4YRAA 1T29A 2V7BA 4I4TB 2GTPA 3UTCA 4DAEA 1L2TA 4FFOA 1Q83A 1ZRMA 3GRRA 2YL2A 3CT4A 2NAFA 4TVKA 2A33A 2XF8A 5TQJA 5BSVA 2F8LA 1IG3A 2GHIA 3DTYA 3KCQA 4N01A 4U00A 4BNWA 2XYPA 3IJ5A 3MQ2A 4MUGA 5D01A 2B0JA 3I6IA 4K9RA 4LMRA 5EUCA 1B2LA 2I7CA 4DDHA 2C2KA 3DMGA 2QM8A 2VNKA 4QRIA 1BQ4A 2L82A 3BHNA 3OJFA 4I8DA 4RHUA 5KC8A 1QRTA 2IEYA 3M82A 3V3TA 4B3HA 3IAHA 1AN9A 3H7AA 3FR7A 3Q7IA 2F9FA 3FXAA 4AIIA 3IBTA 3HU1A 2Z3ZA 3FOBA 4J16C 3R74A 1C3XA 4CDNA 4DVJA 4AG3A 1YIOA 1VYVA 2L42A 3AESB 4B6FA 1Y1TA 1P3JA 3TO5A 1GGFA 5BQ3A 1WXXA 2PKCA 4MRMB 5JY6A 4GC9A 3ONWA 5TMPA 4US2R 2P2GA 1RYNA 4YJHB 4XFDA 3L18A 4JN6B 1GG8A 8GPBA 1GTRA 4HWPA 4CLOB 5FX2A 2LKCA 1VG1A 2A9RA 2YV4A 2FX3A 4MWGA 5LYYA 2SKDA 4PVCA 1PS9A 1G55A 2MJLA 4TTVA 2GASA 4UU8A 4D0RA 2F62A 3EIEA 1DAGA 2ZUSA 3B78A 3BMOA 3LSYA 3S2IA 5FIUA 1P9LA 5H8WA 5I3ZA 1QB8A 3SX0A 5F35A 4MHSA 4QPJC 4CUJA 2EG9A 4YY3B 1R8XA 3RS3A 3P2OA 1G7CA 5G1NA 2NO7A 2CMDA 4U2CA 2GN8A 1ZICA 1CFJA 2Y66A 4Y2QA 3OPMA 9GPBA 4KR0A 2J45A 4FPXA 5BT9A 2WIGA 3H8SA 5BSGA 3ODPA 3ES9A 5B58C 3ZXXA 1ZU4A 2X8AA 3E3NA 1M0SA 2GN4A 1NMSA 2JHCA 3AINA 4URHA 1CUHA 3PEWA 3DVAB 1P7CA 2J9GA 3V8EA 4ZYXA 3M5DA 3QK7A 2DQSA 4JV5B 2AC7A 3ZCXA 1J09A 1W49A 2BCGY 2OO5A 1NX6A 3FF1A 4ZGGA 5TEWA 2IITA 3VNRA 5JMOA 1GPBA 3HJAA 4URYR 1RQGA 2WG0A 3DC7A 2CFTA 5BPFA 2XE8A 3A70A 2H59A 3RVOA 4OI0A 5ECDA 3OIYA 2JGDA 1TEZA 1E32A 2H0AA 2PZMA 2R5WA 3GMDA 3MT7A 4KVGA 3OG9A 4N03A 4CM9D 1Q0HA 4CV1A 3HH8A 3GAFA 3WA7A 1R16A 3P9IA 4DRXA 2Y1DA 3TLCA 1US8B 3OO0A 4RSGA 3RSFA 4HWRA 3LRPA 5CX1A 3DZIA 1NYQA 4WASA 1OBHA 2BEVB 2J5QA 2WPDA 2H0QA 1X7XB 1JTFA 3BB4A 4K1XA 2E4UA 5FWAA 1XLWA 4XCVA 4XIFA 1XZQA 1K63A 4GPTA 5KOHA 3KSAC 1Y9AA 3KLOA 1UKCA 1V6AA 4AL4A 1IN1A 3FPBA 2FSHA 2B4AA 4BZXA 3I9OA 2Q5CA 2WU8A 1R4MA 3DOCA 4FNAA 4Z0PA 2FHPA 1MA3A 4NY1A 3EQ6A 3M6XA 3ENWA 3N5KA 4KXLA 4QVKA 1WPXA 3RV3A 4OHFA 2QE7D 1XDBA 3ZI4A 3L82B 2PHZA 3LC7O 3R7NA 3PC6A 4E22A 4BN4A 4WW0A 1UADA 5DH9A 5FPKA 3E22A 4MICA 3R0XA 1RIIA 4ZD6A 3BWEA 3E5HA 4B7AA 4QULA 5I8WA 5JCJD 3KKLA 1NAIA 2PMEA 1SUFA 3L8MA 3UMCA 3L6UA 9LDTA 2WHEA 2PX5A 4RTSA 1R0ZA 3A58B 4BVLA 4PBSA 5DHSA 5HMMA 4CM7A 1T2AA 3QPBA 1SULA 3TKAA 5AH0A 5EKTA 1W0KD 2J0UB 1E1CA 3D3EA 4S2UA 4DIOA 4F0JA 1I3CA 2RGEA 4CCWA 2O8DA 2FMKA 4XB6B 1CIVA 2WAMA 3PGJA 4WLFA 4BFVA 5JROA 2PY6A 4JI0B 2ZWVA 5BO5A 4FKBA 5JNVA 3NIWA 3DXFA 1TPZA 3H87A 4PANA 2WU3A 3LZ6A 1OXSC 3Q7EA 4I66A 4BU1A 5G1OA 5I9NA 5DNYB 2YWHA 1ZG3A 3JQAD 1HYGA 2KW5A 4CEJB 4DCCA 4K2HA 2OO5C 1N0HA 1SQ0A 5TY0A 2XH8A 5LB4A 3OQ1A 1ZIPA 1XTZA 1C7EA 3DOJA 3P0IA 1ZJ4A 1IBSA 4COKA 4B6EA 5C5CA 3U4IA 2XZLA 1BCSA 4QYSA 2GJAA 1JLHA 2XZOA 3CB4A 4G89A 3TUIC 1XKTA 4MYUA 3U2QA 4DNQA 4EJ2A 1B8PA 5C4MA 4KQXA 3RJZA 1OCEA 1J23A 2JLWA 3EAGA 2W6JA 1U0LA 1M5TA 1Z75A 1XF9A 2V6MA 2ZROA 3FE2A 4JT8A 4QGGA 1MEOA 2BZ0A 4MR9A 4V24A 2RHHA 3AKZA 1PFGA 4JJFA 4GBGA 3Q1LA 1JEYB 2I03A 2Y1CA 3BMQB 3K31A 4RTQA 1HDRA 2NQ8A 2XB8A 2Q6VA 2O1EA 1QUFA 4NQRA 1U11A 3LQ2A 3GLHE 3NQ41 2ZG6A 1FFBA 4ZQCB 4CMAA 3O9VA 2PKRA 3OTWA 1L4YA 4DMHA 4QJ3A 4D9GA 4MKZA 3Q11A 4KXQA 1H6BA 3V2UA 3R75A 1DBQA 2QZ4A 1KOFA 4RLSA 3RS2A 2PLFA 4WNIA 3KJIA 1A82A 3EJWA 2GCPA 3ROKA 4H7PA 4UAGA 3H6KA 2I4MA 4MV9A 5JAZA 4IMIB 1E98A 3RIXA 3VTAA 4YP9A 3ZH9B 1KGSA 4QATA 1ZR4A 1YK1A 3DTTA 4YALA 2GCOB 1FUIA 1E2IA 5LCXA 1B8NA 2BCEA 2BMDA 3GVPA 3O1LA 1A1VA 4ZQIA 1G2IA 4G1BA 1X15A 4U5XA 1L3IA 1UKAA 4D8TA 4Z53A 2OGTA 1NATA 4IJUA 3KAJA 1FQJA 1L1QA 4TTPA 4L5AA 1JIXA 3ILXA 2C95A 4EYGA 2P0YA 1LJ8A 2DTDA 1WUJS 5EJGA 5B1DA 3ZK9A 4W5OA 3GG2A 5HZKA 1KY4A 3A3NA 1K7SN 2OBFA 3KEMA 1EBFA 4G24A 3SX2A 3WLJA 4DV3B 4L9RA 2VZEA 2C97A 3VSCA 3TRJA 2ADMA 3H18A 5DB4A 3WGGA 3HGQA 4HXGA 2PGIA 3SJAA 1T8RA 4AT1A 1WY5A 2PGJA 4D79A 4XIIA 3V33A 3QVTA 4PSDA 1MORA 4DLSA 1EVLA 1F0PA 3LI2A 4DB2A 1OWMA 4DRZA 1N5KA 3IE0A 2ZRDA 2V8OA 3FDZA 3PWKA 3T06B 4OLAA 2W6ZA 2JGIA 1L1RA 2XCOA 1VI6A 3GFRA 3LCUA 3D54D 3ONDA 4NS1A 1RWBA 3OJOA 4EHLA 1EFAA 1RKUA 5SZIA 1WVMA 1R0YA 5A6VA 5MHTA 1QDEA 3HL0A 3HLYA 4QOJA 3C5VA 3RJ5A 2ZCVA 3PYXA 3P8ZA 1YR3A 4FC6A 3ZY5A 1VE3A 2JC3A 5EG5A 3THXA 4MDHA 4JYPA 1G0OA 5L3SA 3HACA 2P5TB 3W6NA 1LU9A 1RKVA 2BF4A 3IKVA 2X8LA 4MUIA 3FYCA 1JQAA 4ND8A 3T5DA 2CUNA 2Y77A 3B85A 2OUIA 3KEQA 4FKMA 4OOEA 4TL9A 5L53A 5BVHB 2GK6A 3GNSA 4MV1A 5FORA 3JWJA 3RYIB 5I7HA 3IHLA 2XWPA 4UBJA 2HIGA 2B61A 2I33A 5EUMA 5JJLA 5G4KA 1UDWA 1LBQA 3E3OA 4B47A 1XZLA 1W5EA 4LPSA 1FVXA 4MX8A 2ID4A 1T10A 3P2YA 2NVUB 2AOTB 3ZV4A 3G2QA 3GFQA 4U2EA 2PIAA 3AY7A 4D4LA 2G1UA 2FQXA 1ZESA 3BD7A 3CPSA 1HT0A 2D5BA 4I55B 4RXMA 5E6SA 1WE2A 1VHLA 1OX6A 1TKBA 1EGMB 4EW1A 4YONB 3PGXA 2W48A 4FYVA 2ZRFA 4ZYUA 3DHEA 2I78A 2YYYA 3USZA 1C0LA 1C1XA 2IZOA 4WZBA 4GQAA 4RHCA 2P0AA 5B2ZA 2C7PA 2J46A 3CUTA 2ADFA 2O7VA 3BAFA 4FFPA 1VFNA 4NU6A 2VK8A 5F5LA 4B45A 4ER6A 1CQJB 1L7PA 1H22A 4QWWA 3I28A 4HLNA 2ZJBA 3DMHA 3SN6A 5JRDS 3RC9A 3WLMA 1A5SB 1G19A 2O2GA 3TE6A 1P0CA 4RNDB 4XR9A 3QU2A 2NXCA 4MZXA 4RDIA 4RPLA 4FOSA 5EWJA 3I30X 2C8JA 1JS1X 2P40A 4R1NA 5K20A 2Z2ZA 4XFKA 1E4EB 2J8ZA 3IOBA 4E5MA 1ZIOA 1HMYA 4G0QA 621PA 3N07A 2F4VB 3EF1A 1E3JA 4NFYA 5D5HA 2IP2A 2NTNA 4XGQA 1W85A 3WWYA 5CA0F 4WVLA 4M1QA 2ZVJA 1RLOA 2DC1A 1EP9A 2X0IA 1Y9DA 3I2FA 2X42A 4LBYA 5IJXA 3U7QA 3FFWA 1B00A 1BVRA 4J91A 1WXFA 3S2ZA 3HKCA 1HFWA 4LA4A 1Y4UA 2E1PA 3H7IA 2CXUA 2FW1A 4TKVB 3QJGA 5DBHX 3KWFA 4A0GA 3QENA 16PKA 1T3ZA 2M1ZA 4QDOA 4EEKA 1J8VA 4OK3A 5C2JB 1RXCA 3LCCA 2VHYA 2C3PA 1IUPA 3UOGA 4ZHSA 3DOEA 3X1YA 5HJ5A 3THRA 4Q4HB 5LFAA 1KFJB 1OREA 4WQMA 2GKSA 2GBGA 3E9NA 3KLBA 4HDMA 5H3LA 4BO6A 5I7FA 1VL6A 3HY3A 4E2XA 4LRQA 4FC7A 3LQKA 4NV3A 1UIMA 4OH7A 3FDJA 5EXSA 2Q6TA 1RWMA 3I72A 4M9QA 4PZYA 1JR6A 2FWMX 1GFZA 2P69A 4GWGA 5U4QA 1Y8RA 2WFLA 4KMSA 2NNLD 3FZGA 3QUSA 2CLIB 4GMGA 1W19A 4PO1A 3P9PA 5DI3A 2F4NA 3SOPA 2JIZD 1JMKC 4PZLA 4CKEB 3MMNA 3CNEA 3E58A 4J94A 2OOKA 4Z9AA 3A10A 1Z0DA 3ELWA 4Q00A 5HPYB 2UXDB 2ZYAA 2ZQ5A 4AWXA 1I8TA 3MWGA 5A0FA 4XKJA 3MWJA 1VSBA 3P9YA 1N5JA 3ZHCA 5IMSA 5EIWA 1Z6XA 4HDCA 1NHWA 1TM5E 3TN7A 2Y0EA 1ESCA 3ESBA 3JYHA 3DMDA 3NC0C 3AGPA 4RM3A 4AN4A 3RADC 1Y5RA 1CLUA 2AS0A 3MLBA 3LWNA 2VDPB 3TOZA 1ZXXA 4AZ0A 4A03A 2ORVA 4IIFA 5DULA 1RM5A 4UBLA 2G82A 1N1MA 2QRKA 1VE5A 2QG4A 4DG9A 1SIWA 4Q39A 3VOTA 4X62B 1FYEA 1CX9B 3ORYA 4DADA 1RHQA 1N5IA 4GE0A 5HR5A 4MWDA 2DWUA 2IBMA 3BL6A 2Q3FA 1I9GA 1ZOIA 4UQOA 1DADA 1VJGA 1CIPA 2EAUA 3SQLA 4KHPB 2GPWA 1T13A 3TM5A 2P4SA 4AKHA 3ZKWB 2FRXA 3RTEA 3VPDA 1W93A 3NOXA 5AXCA 3MIIA 5KHOC 2V4UA 5JIBA 3X1WA 1JHAA 4X60A 4Z9BA 1U8AA 3DQZA 4RZIA 5CFOA 3AHFA 5TT1A 2OBBA 1S1CA 5AM0A 4JC0A 3GEDA 1YI0A 2ZK7A 4EB8A 5K8CA 1WB9A 5GPBA 4KR7A 5AJHA 1PF7E 3U4GA 1RFLA 2WT8A 3H16A 3D1LA 3LPNA 4LK2A 5C8DA 2H2DA 2IHNA 3KSZO 3EMDA 1XP5A 2W2KA 3VOBA 4YMLA 5GJCA 3FRIA 2QL7A 3C7AA 3O3MB 2DBQA 4HYYA 4QYIB 4R98A 3U49A 3R3JA 4QT4A 2OBYA 3P0JA 3TMAA 1KQOA 3OY2A 2CDRA 3U3RA 2O2IA 3O7MA 1TVEA 1ADYA 2K7ZA 3EYWA 4HH0A 4BAZA 4QELA 1XZEA 1ZEJA 4LGVA 2XEDA 2HPHA 3NEPX 2EP7A 2JGLA 1KAQA 4CV2A 4RZSA 2PX2A 4WN3A 4C2BA 2AVNA 1H2BA 2DU8A 2H5LA 4OLHA 3CLSD 1XR3A 3TLYA 3WP0A 2VH5R 4PC3A 2AB0A 3V48A 2PG3A 2QNBA 1UKVY 1E1LA 1KAMA 2Z3VA 5ERYA 2UZ3A 1DLIA 4FYYA 4RJKA 4WUVA 4AO6A 1JZSA 2C2HA 1Z2EA 2AHOA 2ODWA 1BMFD 2EARA 4MP3A 5BR1A 1O0BA 4CTKA 1GCUA 5I9LA 4J49A 1NW8A 4LFCB 4KE9A 5AM5A 4D8XA 2B0CA 4J7AA 1LNQA 3IUPA 4Q93A 2GILA 3UJ6A 1GGEA 4W9RA 1XZKA 3LD9A 3UXYA 1K06A 5CG1A 3SIXA 2B4YA 1TZCA 3B1YA 1FDRA 1H1LA 4IG9A 1D5WA 2C94A 1PG5A 2UKDA 3A1SA 3CW2A 3QFCA 2CYCA 1UFKA 2MSNA 3KEOA 4NMXB 4PRLA 4U2DA 1YMUA 4BJ6A 2N3ZA 1RCTE 1KP9A 1LQ2A 4KPUB 2ZWIA 1XD2B 2VDWA 2LW7A 4KUHA 4BO3A 2XZPA 1A7JA 3AP2A 3CQ9A 3OEHD 3WZ2A 3R41A 4BE4A 3QE4A 1YB2A 4NE7A 1PTKA 4BUJA 1G20B 1G7SA 3VVCA 1IHXA 1I01A 5EXTA 5AXAA 3AEZA 1T3HA 2XGOA 3CH4B 3NHPA 1KDVA 3BB3A 3I76A 1V11A 5ARCA 1QFMA 3WK6A 5EVJA 2R1TA 2YIMA 3WWDA 1WLYA 2CC2A 2Q62A 2ZE8A 2FWNA 3NBYC 5IAKA 3WICA 1RXSA 2ZFUA 3ANYB 2JCGA 4RDHA 5AKZA 1ANKA 1XA4A 3EIXA 2BDEA 2ZWOA 3EK2A 3AQIA 5AVKA 4X65B 3GUZA 4MGZR 4M7WA 5GV7A 2JI9A 4HXFB 4GP7A 1AQJA 3E23A 4I08A 4CQJA 5BY2A 3CCCA 2Z2YA 4RZQA 2OGUA 4WKCA 5K0TA 1ORHA 3RREA 2G4LA 2O8VA 2KSQA 2W2QA 2B82A 4JL6A 3I01A 3OZWA 4KOAA 4CG0A 4LX8A 4NE2A 1CQXA 3SSMA 3JPWA 4I1PA 4GKJB 1YQ9A 2JARA 2AKAB 2FN7A 3GQBB 4V2IA 3TSOA 1ZZEA 3PPXA 2XTZA 5DW0A 1RE1A 1KXZA 2XY4A 2FE1A 2XECA 1KGDA 3RVLA 3UBTA 4H6WA 5HBRA 2DWOA 2B5WA 3LL4A 1NNUA 1TM1E 1SUCA 3NOOA 4JEHA 4PNHA 5AVTA 1ZWLA 2XZTA 4UU0A 3G5TA 3M5WA 1WSBA 3CRMA 3HI4A 3VYRB 2XCSB 2FI1A 2VNJA 3B5EA 2GYUA 4LDPA 2J33A 3JWPA 5COBA 1LDMA 1YGYA 1JKXA 1KC3A 2AE1A 5BQ5A 4Z2YA 4A73A 2PR2A 4D4IA 3DAYA 4PZUA 2F2TA 3AWIA 3LL7A 4HP8A 3W8RA 2ZBRA 4X1YA 1K08A 1VJ0A 1F7VA 4JLJA 1ZM2A 2B4QA 4GZLA 1P2BA 1IZ7A 4KP7A 5CB4A 2GMWA 2VNHA 2QYOA 2XUAA 3OP4A 4XTRA 3IVXA 4IQGA 3JQRA 3RTDA 4R9RA 4BNYA 1UKBA 1UC4B 2H51A 1KI7A 1QB7A 2N75A 3KZVA 4WWHA 1NQAO 3GRAA 4DGSA 4MVJA 1RJDA 1NP6A 3EY4A 4MGEA 3EXEB 2WPDD 2Z5GA 4MWZA 3G5LA 4MR7B 2FZCA 2H7XA 2X0JA 1P9WA 4RANA 3CUYA 5ALNA 5KYUA 2PFSA 1L4BA 1W88B 2Y0CA 4IFEA 3R8CA 5C7YA 2XA1A 5KIAA 5ISMA 1M34E 4PEVA 4D9HA 1E1RD 1C2YA 5CLLA 1QIDA 2JF0A 4NBTA 3ZWAA 1DDGA 4ZVLA 2IHKA 4MKFA 3LPAA 3N0TA 2W4QA 2EGGA 2BGRA 4XQCA 1XALA 5LUAA 3DOUA 5AM4A 2F3TA 1KI1A 2I54A 4MIKA 2PT6A 1JG2A 1K75A 1T9GR 2V7WA 4IICA 3ISVA 2QI9F 2UUCB 1OFTA 4QSHA 1P6UA 2CNDA 1Z8HA 4QEDA 4TPKA 4Z7NB 2PSFA 2PYZA 3S70A 2PZEA 3GRPA 5AXBA 1A8SA 2VG8A 3ND5A 4KIFA 4WXRA 4R7GA 1MOZA 3FX2A 2C9BA 3HKDB 2E9SA 2CXOA 3BEOA 4B4UA 4G0MA 2HJVA 2IYLD 2QQ5A 3VNSA 1UOPA 2O3RA 3ZVRA 4B74A 4DM4A 1G7RA 3PNMA 3V2HA 1WSWA 2WD7B 4BMXA 3H42B 4EY6A 3M3HA 5DFAA 4F60A 2IZ0A 2G70A 1EHIA 2X40A 1QQBA 4MW1A 4KLAA 2QE6A 4NH4A 5AVYA 3V8VA 2R8EA 3DLHA 1QPZA 2GF2A 4EI2A 1KZ6A 3RUCA 3KPYA 3Q2OA 1Z15A 5FRDA 3TECE 2PLAA 3FPLA 4EX7A 3PUVA 2WMOB 2XW6A 4JBHA 4YCBA 5DT2A 2SECE 3TRHA 4A1OA 3VPSA 4DA7A 3CY6A 2Q1SA 1REQB 4RKRA 3T4EA 3TZEA 3GW8A 2VRBA 1U3CA 3PX7A 1RRVA 2XRFA 3G1WA 2WTMA 4ZVKA 3C3AA 3NHLA 5KDLA 3SSAA 4BVFA 2ICAA 1GGVA 4Q1DA 3GJ4A 4XWKA 2W6JD 4WIAA 4ERNA 2KM1A 3PNSA 4KFSA 3CGGA 4R8RA 3DAHA 3RG2A 4DV5B 1DQZA 4YP0A 2XMPA 2PA3A 1ZUD1 4PZ9A 4K9KA 3LUJA 3VPXA 1XTRA 2ZU6A 5CR9A 4FSHA 3X1JA 4EGSA 4V1CB 3FUUA 2YJ3A 4UOZA 2IPNA 4KUEA 4L1KA 3GLKA 4OSPA 2Y99A 4CEHA 3IXQA 5AI8A 2REBA 2R87A 2V45A 3KLPX 4FWIB 3AJEA 1U0JA 2Z2KA 5F12A 3I8OA 4AECA 1N7JA 3D0QA 3WTBA 1PQPA 1YU6A 4J03A 3R0QA 5C18A 1T5SA 4QPPA 3VHLB 1Z4MA 5B64A 4MUJA 4I5IA 1GPUA 2CL7X 3IUBA 3KD3A 3MJDA 3OZDA 3ICPA 2PTHA 1DJPA 4RPKA 1JGTA