2KPOA

Solution nmr structure of de novo designed rossmann 2x2 fold protein, northeast structural genomics consortium target or16
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
110
structure length
110
Chain Sequence
b'MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEGGSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rossmann 2x2 fold protein
molecule tags De novo protein
source organism Artificial gene
publication title Solution NMR structure of denovo designed rossmann 2x2 fold protein, Northeast Structural Genomics Consortium target OR16
rcsb
total genus 38
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2kpoA00
2N3ZA 2MR5A 2LCIA 2LNDA 2LVBA 2N75A 2MR6A 2LV8A 2LR0A 2L82A 2KPOA 5GAJA 2LTAA 4J29A 2L69A 2LRHA
chains in the Genus database with same CATH superfamily
3GLIB 1YULA 1KI6B 1YB1A 1CZNA 3EGWA 1SUWA 4J1NA 3D6MA 1F2VA 1Z0ZA 4GMGA 3RRXA 1V96A 1U65A 4NYMR 4WL0A 3WLKX 4BKQA 3DPIA 1EVJA 4BNYA 4LV5B 1FQJA 2FN9A 4HFMA 3O8OA 3WX0A 3B5IA 1X1EA 1USKA 1X1SA 3PUVA 4PC2A 2NU9B 5GTDA 1QIKA 1JE0A 1OVMA 1B6TA 5F1KA 1OB5A 1W0KD 4NEHB 1NUSA 3THYB 2MDTA 2C5EA 3EXIB 3FB4A 5AD1A 1L6IA 1ELOA 3LKDA 3AUSA 5DHAA 4Z49A 3KJXA 3RFVA 1K8XB 2GAJA 2Z4TA 1MBZA 4IDNA 4M8KA 3N86A 3NRBA 2I8CA 3S0JA 5C1DA 1TRKA 3PC7A 4EHIA 1M74A 4F3KA 1NFQA 3HC7A 1H2FA 4QUKA 5DBHX 2IWHA 4F7DA 4ZEVA 2JJ1A 2YJ4A 1HETA 4OP2A 2XCOA 3TZLA 4CG3A 4FE7A 1C9KA 2OHGA 3KFVA 2BWJA 4EYQA 3G5AA 5HF5A 4XWWA 1VA5A 1LW7A 2MYUA 5H3CA 5T6MA 4BLWA 3O3OB 1AA9A 1P3Y1 3H6HA 2WLTA 3BZWA 3SLRA 5KU7A 2IYQA 3ZXIA 4ANFA 1M6WA 4REQA 4OUDA 1SCDA 3OJEA 4HNSA 5G0SA 2J31A 4DN6A 2W2KB 3SE0A 3D3WB 4ARIA 4YYEA 5BUSA 2O5RA 3C3CA 5AW9A 1CEXA 3G88A 4BUJA 4CV1A 4QDKA 2PM8A 5E6RB 3GLHB 5A4DA 1WUTA 4DLUA 4IF6A 2XHEA 3F1LA 4OUKX 1LVUA 1DG1G 4PLYA 1FBNA 1QG4A 2ERCA 3THXB 3OZ7A 4KAAA 2V6GA 1E4EB 3LECA 1YR9A 3QXGA 3LG2A 1A4IA 1N5JA 3W6ZA 5KTPA 1XNHA 1Y1LA 2W2MA 1ESEA 3E4CA 2NVUA 2V74B 3H4MA 1SIUA 3GU3A 3JWHA 3N8NA 2WJJA 3ETNA 4XIYA 4QYTA 5GOZA 4YCCA 1L6RA 3S5JA 1MJHA 3M5DA 1QCDA 1CULC 1G16A 3OD5A 1Q92A 2WW8A 2Q1XA 1BA3A 2I71A 3KQPA 2IV7A 2YJTD 4FOOA 1YL7A 1YO6A 1OBHA 3ILSA 4HUQA 2WV7A 2HT6A 2V65A 3PXUA 4E5DA 5L53A 4WKCA 3SE7A 3OIDA 1SN7A 5T8KC 3VI3B 4HVLA 4OLBA 4KQJA 5CW1A 3GHHA 1N25A 1MA3A 5CLJA 2O6LA 3LPDA 4DLRA 4ZTZB 1T5LA 4URHA 2OBMA 2PAFA 3LBYA 3UOGA 3MMZA 2NXNA 4BMSA 3IQDB 1UM9B 1Y3BE 2JJQA 4LYGA 1DCTA 4HP8A 2NZJA 2A3RA 3FKQA 3NBYC 4XGQA 5AOCA 1VE5A 3EDMA 5IWCA 4OQNA 3ZZUA 3OPVA 3G2IA 3H3XA 5KVSA 3C6MA 1XLUA 1NDUA 3OIYA 4CCYB 1B1CA 3R8XA 4E15A 5A5EA 2TMYA 2AF3C 2I7CA 3QWFA 3KOZA 5TJ9A 1BFKA 4M1EA 5M29A 2XUKA 3O2NA 3IV9A 5ICMA 1U1IA 1VFPA 2VJYA 3PPYA 2AFHB 3HCAA 1ES9A 5HKBA 3F67A 3LHIA 1CUFA 1X1AA 3JQBC 5ED4A 3BD7A 3BHMA 4MH0R 4QBGB 3ET5A 3FTNA 4Q9HA 4MMYB 3FWZA 5DBFA 5H3HA 1T5OA 2JLAA 5IK2A 2IHNA 2X22A 1ODLA 3DKVA 3LBNA 1LCIA 4PFKA 4C87A 4FYHA 4O59O 3KK0A 1E1QA 2ZB2A 3IVGA 1YIDA 4BCDA 1T25A 1QQ7A 2FEPA 3IMGA 3KKMA 3MILA 1QP0A 4TMVA 1PZHA 4HQLA 3KB2A 1YH3A 2ADMA 5KTRA 2IL1A 3PIRA 1C3OA 5T4FA 4MXDA 4DOMA 3IE0A 2CUKA 5LMCA 3GLFB 1OH7A 1F51E 3BJEA 2NNWB 1SWWA 3L4EA 4AD8A 4NZMA 1NLUA 2G9UA 3EODA 2ZUBA 4YRPA 4P93A 4W1PA 1T5TA 2D3WA 1UMCB 2CW5A 2XOXA 5A7FA 1DAKA 1E20A 3LRTA 2QNIA 1XQXA 1LSSA 1WW3A 2ODAA 4FMCF 5EJFA 1GPH1 5FHQA 4BAUA 1IBMB 2Z1NA 1H65A 1L5RA 4EZEA 5I3ZA 4QUGA 5JO0A 1NSYA 3DH0A 2RARA 4G07A 1W85B 3MGGA 3Q7EA 5JSHA 5KJ6A 1RCFA 1GTG1 5HEKA 3BL8A 1X6VA 1G8FA 2HK6A 3AR4A 2UYQA 3TG2A 2JHFA 3RRYA 2IDZA 3OKAA 3PFNA 3TCXB 5JNSA 4D3FA 1Z35A 1G8MA 2O05A 3H1BA 3HSYA 1IG0A 4KX5A 1F8XA 3G82C 4HYQA 3LZDA 4Q1EA 1DEKA 1WCV1 2CNBA 2P4EA 5I7VA 2FI1A 4QJ3A 2QGZA 2C2YA 2GNOA 2GXSA 2JIMA 3IJEB 4B3CA 1DAPA 1XTTA 2V4ZA 1GPJA 3B2EA 3WJ7A 4TUYF 3WC4A 4TWAA 3AF2A 4W7IA 5KAMA 2NUTB 5LOVF 1GTL1 1GCUA 2X7HA 2VTDA 4BB5A 2HWKA 3BA1A 4UNPA 5DOZA 2XADA 1UKVY 1T2FA 4PBSA 3AK4A 1JG7A 1DWQA 1LC0A 4ZVSA 3GNTA 4RY9A 1FPMA 3CRQA 3UANA 1M67A 1V5IA 3L4JA 1YCHA 2VZEA 3NASA 3P9IA 2D5BA 3I5UA 9GPBA 1BCRB 4NCBA 5H5JA 3F47A 4GYYA 3TL3A 1K2VN 3T3OA 1Y3DE 1I1NA 2PZMA 2DY1A 4S12A 5EVJA 3DUFA 3ZNQA 2I2FA 3QXCA 1XYGA 4U4AA 1NP7A 3V48A 4PPNA 2Q41A 1HKHA 4N6NA 1N57A 3EEOA 3DMFA 3O4VA 1K6EA 4OUDB 1Z0SA 2YJ5A 1L4NA 4RVHA 1QCCA 1XZLA 2HIGA 3FDZB 2IELA 3FVWA 5I4BA 4XASA 4GGOA 2QMEA 3L6DA 4JFRA 5IC4A 1E7WA 4CM1A 3SSOA 4S04A 2NO5A 1PL8A 2I4MA 1ZAKA 1ONOA 2VNAA 2YINC 4ZXFA 2L69A 2OD2A 2ZIFA 2E4VA 3ASZA 3MJTA 4OY3A 4OHZA 5BORA 3HYRA 2H2HA 1V7QA 2MJLA 5AJWA 1N7GA 4LX8A 3UFXB 1Y7LA 2FX2A 4RK1A 3ZCXA 3VDNB 2A5DA 4R1TA 4ASUA 1KORA 1JHRA 1POWA 3MT7A 1P9NA 2GM5A 5GZ3A 4HB3A 2VJLA 1N5DA 2ZB7A 3CCFA 2G40A 1NQ5A 2H31A 3IERA 3IPRA 3JWJA 4JITA 1GLGA 1IY8A 4CT4B 1CHNA 2GAOA 2QSYA 3CN9A 3SMVA 3ZWQA 3T1VA 3ZC3A 3PDIB 1KSGA 1VCMA 3H16A 2GBFA 2CFOA 1O6BA 3RK1A 3O3NB 2PH7A 1V4BA 2C97A 5IDYA 1OILA 5C7LO 5C3UA 2Q9UA 2W6MA 1HYGA 5DULA 1SOAA 4R98A 2LGJA 1QYCA 1I3MA 1XZQA 1M0TA 4G25A 4PFJA 2VPZA 1QBKC 4X0EA 1SEVA 2NU6A 2QB5A 5I9MA 3RTEA 4BDSA 4BIMA 1L1QA 1WXGA 4J1SA 4WY2A 1KQ3A 1LQTA 2HTFA 4HN2A 4XVCA 4ZMBA 5AKEA 3W2HA 2PKEA 4NBNA 1QE5A 4F3CA 3CX8A 4K6FA 1A9ZA 3PE6A 1RHJA 1ZD8A 4ZO8A 5KCMA 3VNAA 4URZR 2FK8A 4DF3A 2Q50A 3OHSX 4QECA 3EZNA 5GV7A 4XGKA 1KL7A 1UBLS 2XGGA 3LKVA 3OM8A 3SIWA 4U3JB 2GJ4A 3BJIC 3LRPA 3QFRA 2DHEA 2FQ1A 1II9A 1PFVA 4Q1AA 2VC2B 1R4MB 4ONEA 1VE3A 1KYZA 1SIWA 2RHTA 3ON5A 1WY5A 3SIRA 2HA6A 3AJ8A 1VBFA 3EXHC 3MXTA 3CGWA 4X6XA 2OWDA 2CXQA 2OC9A 1I5RA 1AJEA 3EFHA 2H1IA 3G85A 2H4XA 3GGSA 3QUTA 4Y6GB 4H4EA 3AVWA 4INJA 4X71A 2V0GA 2J0UB 4M8NE 1F0NA 3TJMA 3PQEA 4V03A 5JWRA 3NHBA 3ONDA 4UEJA 3A1SA 4I19A 2R1ZA 2F1HA 2QJOA 3FZGA 4WW0A 4MV7A 1J9ZA 1RPJA 4ARZB 4F71A 5D87A 3NDBB 2G5PA 2YY6A 4DG9A 1ZK1A 1G38A 2FKNA 2Z6AA 1C4XA 1FPQA 5HIJA 2OK8A 3QLEA 3UMBA 5KVAA 3GY0A 1CHDA 3M83A 5K0NA 2H29A 1ABEA 2HJWA 2P3OA 3R20A 4E2ZA 4GXRA 3NEJA 2QW8A 1JI0A 2WF8A 2KBFA 5I9SA 4Q39A 5U4QA 1KARA 1P8JA 1U1DA 3OTIA 3HL4A 4ZYXA 1TYZA 3DEJA 4B2IA 1OZHA 3VZPA 1R27A 1OYVA 3HBAA 5DM70 2XOEA 3IMCA 3KPWA 2D8MA 1W7AA 4QRIA 1DX6A 5H7XA 1IDN1 5JAQA 1J2EA 4Z0PA 2WYOA 3TAXA 4I50B 1XWIA 4YCMA 5DCWA 2BMJA 1F2DA 4AMUA 1UEJA 4N9WA 2V6MA 2BJVA 5LXTB 2RMKA 2FSVC 5HE8A 2FMFA 4PPQA 4XIJA 4JI3B 3ZJ4A 3F71A 3ONEA 4NU8X 1QOZA 3M89A 3LU1A 1TX4B 1WF6A 2FDCA 4CQMD 1W44A 1RRGA 2Z8YA 3IIKA 5J2UA 1F4VA 1CIJA 2Q9BA 4GXTA 2WT9A 3EEBA 2IOFA 1P9OA 1IOWA 3L7CA 4CMBA 2Q3MA 1FJXA 4N7JA 2HJHA 3IRUA 2WUVA 5JJCA 4CEIB 2B4QA 5FR1A 1BKYA 2MOKA 4BV9A 1R3DA 4PYIA 3RT1A 1YRYE 2ZRLA 4N40A 5TGTA 2VRCD 2J9GA 2P78A 3DWGA 3E5RA 1N0WA 3KHTA 4DV4B 4BNJA 4IH9A 2J46A 1XXHA 3SM9A 3AF6A 1VPWA 1YBVA 2ISSD 1CETA 4RZHA 3FYUB 3PVZA 1CY0A 2LXNA 3P2OA 3UGKA 4BQRA 5K7SA 2XQJA 4MVXA 3EUEA 3WYNA 2FDRA 2REQA 4PO9A 5ES4B 1FRFS 4FYIA 4EATA 2QXTA 3WNQA 2PS0A 2R62A 4D5EA 2I4NA 3HY4A 3NYIA 5F23A 4L8LA 2AW5A 2BIFA 2P69A 2NV2B 3GD7A 4F5EA 1B8OA 3FWKA 4DV5B 4XOUA 4BNLA 2HCFA 1NNI1 2VNHA 4U5QA 2IYXA 4E33A 1CZHA 3DE4X 1U0BB 1N92A 1ZCFA 4NARA 1NXXA 4LQLA 1ZJYA 1H2HA 3HDTA 1XU9A 4RM2A 1J1UA 1D7OA 3DFKA 2V5AA 3B38A 4DLWA 5KYYB 2PH1A 1CDZA 3FHOA 3H9UA 2XNHA 2EU8A 4FFLA 5I8ZA 4D8WA 3HXLA 1NQXA 3JQ9C 3LX5A 4I4TB 2YZKA 1CNEA 1DXHA 4TM8A 5EZYA 3PC4A 2AC7A 5JBNA 3FJ1A 3I30X 2J48A 3W8RA 1V3TA 4PAOA 1U4SA 2A4KA 3PTLA 1QX3A 2PL1A 1COWA 2GO1A 3DBIA 4HQRA 2HMVA 1ESDA 4WSOA 3UHAA 1Q0PA 2O3SA 1G3RA 4PN7A 1S3FA 5HOEA 1I4WA 3UC9A 4MITA 3RU3A 3OZDA 3ZTTA 4IYRA 4EFDA 1HE4A 4PZZA 4E46A 4NK4A 4KO3S 5C4GB 4FBLA 1Q0SA 2G3YA 3GCGA 3HLTA 4GX1A 4X54A 2IV2X 3RVMA 1QDLB 4BP9A 4EAQA 4ZHQB 1RU3A 4MUFA 1DBRA 3QEAZ 1JDTA 2IPNA 2P2LA 3GT0A 3OZWA 4D56A 2SHKA 2AYYA 1C2TA 1N3LA 4EO4A 1S1MA 1XJ0A 2BGJA 2H2FA 2MSDB 4BYMA 5GOTA 5GWXA 4NL4H 2YV2A 1BE0A 1BROA 1E3TA 1JYEA 1UT8A 3O90A 3OLCX 3DVLA 2NU8A 1FSSA 2CMGA 5CUQA 2F8LA 1YFJA 4EFKA 1BYUA 2QRZA 1EDOA 1IB0A 4X7BA 2GZAA 3IP1A 4HLCA 3UB4A 5EIAA 1S4MA 5AKLA 4ZVQA 4OQEA 3H84A 5J2UB 1EX7A 4RPGA 2XKBA 2RGAA 3DG9A 4N8EA 1HC7A 3N39C 1T1RA 2XUFA 3L1VA 1M1NA 2PD6A 3F1KA 4YXWA 5C5DA 3STXA 5IHXA 5ADUS 1YE5A 1JR3D 2YJGA 5JDIA 1SCJA 1U1FA 2D7JA 3GJRA 3TM4A 3AFHA 1FDRA 3BMQA 1BRMA 4XPIA 1KH1A 4LDNA 3M4NA 5IUJC 3RFFA 2XVAA 3HKEB 2VDJA 1JA0A 3IALA 3IPLA 5E6SB 4ESHA 4JP2A 1M6VA 5FORA 1PEYA 2CJFA 3Q88A 4TXLA 3WGHA 3BHIA 3CLTC 4GU5A 2Y27A 1P2DA 1ZUD1 3AUTA 3DE3X 1XQYA 3TGPA 3CW8X 3NTRA 3BIWA 3CTPA 1MR3F 3PE3A 1UXGA 2R96A 5ECWA 2NX2A 2IGTA 3RS3A 5JXWA 5KQPA 1R10A 2J9YB 5IKXA 2ACWA 1AE1A 4OO3A 2EBHX 4QJ4A 2QQ5A 2G4CA 3V1NA 1VBKA 2AF4C 4DAEA 2HU5A 3M6UA 1VXRA 3CF4A 4GQBA 2X9VA 2OFWA 5EMLA 4B6RA 3C8HA 3MMPA 2XZDA 4M0FA 2AJTA 3QOXA 4DKXA 5K8CA 4YC7A 1E2HA 1DKQA 2O7VA 5THQA 3B12A 1G55A 1Z82A 4MCAA 4ZPXA 3IPXA 1O5TA 1YQTA 4BLUA 2HSZA 4EA7A 2BFDA 3NKFA 3BL6A 4A92A 2JHPA 1OW3B 3ZXXA 5AUPB 5A5GA 1D9ZA 3IH5A 2V5VA 3H1FA 2Y9MB 2B61A 5JCOC 1O0SA 1OLUB 2C2OA 1CUJA 1P7VA 2EYQA 2DT8A 4YAIA 1P5JA 2AOTA 3MJCA 3AV0B 4PCVA 2BFNA 4WOBA 3ZHSA 3EXAA 2C84A 1SXJC 2JIZA 5AJXA 3UWOA 2DH6A 3P5BA 3Q11A 3GUCA 3THWB 2WA2A 3MLAA 4GKVA 4IW3B 5F3RA 2WP0A 4DR6B 3C8DA 2FN7A 4J29A 4WK2B 4EPTA 4YBRA 4DR3B 2JIBA 1E9DA 5HM8A 5FBLB 5I47A 5JMPA 5ALDA 1QGAA 3CLUC 3EIXA 1Q0UA 1DXQA 3H0KA 4I50A 1PQUA 5J4LA 3PXGA 2F64A 2QN6A 3CGGA 1HYBA 5J5CA 1T9GR 1A2KC 2PMCA 3HDHA 4TTPA 4XUEA 1DV1A 3BWMA 2VF5X 3EA4A 1I5EA 3VC7A 2PNFA 1ZVKA 3FVTA 3NOOA 2PQ2A 1B2LA 3AY6A 3K9GA 5BYBA 1T1GA 2QW0X 5CVTA 3BFXA 1NBMA 4UVDA 1EG7A 2EIHA 2QZZA 3T7TA 4OJTA 4MEJA 2YWDA 4C78A 4JASB 4QQ8A 2HXSA 5BSGA 1DQRA 4K03A 2YYYA 5DEOA 4TQ9A 2EBWA 3GCWA 2BI4A 3HLKA 3QBDA 1ZNZA 2DPHA 3L7OA 1VCNA 2YXEA 3U49A 1VI6A 2XRZA 3WRVA 5BWBA 2YUIA 1F1JA 3T35A 1B73A 3Q3CA 1XD2B 3HWRA 3OZCA 1NQTA 4D9IA 4GYJA 2GJ8A 2O7NA 3C3XA 3JAMA 1R6AA 2VAMA 2HNKA 2ZB3A 1P1IA 2C61A 1U8ZA 3FYUA 3Q3HA 1J70A 1GN9A 5E0KB 1X7XB 2W2LA 3NWJA 4MRPA 3W2EA 2NPFA 4B44A 3ZX4A 1II0A 1M2FA 2MSEB 2FPGB 3GWGA 1G9XA 3HFSA 4IZIA 4YAOA 4TT3D 5AJHA 5ECYA 1BCSA 3STYA 4D9BA 3BL5A 1HDRA 4DSUA 4C2AA 1O96B 2P30A 4HRXA 2MMCA 1TPZA 4NKRA 4K8OA 4RANA 4Y9UA 3UGQA 1E96A 4EEKA 3Q3JB 1ADFA 1AQLA 1V8DA 4YWJA 5IAJA 4CM8B 4F5WA 1KYYA 4HNVA 5C8YF 1HA3A 3DSRA 1JHOA 2GK4A 1OYWA 1Y80A 2AGVA 3OIGA 3H4IA 3O82A 1XEXB 3ITDA 1PTJC 1HZZC 3GJSA 3HUUA 2H92A 4ZDWA 4J3FA 3ZKWA 4BNHA 5JH7F 5KOJB 3KQNA 3QTBA 1AUVA 4BDTA 2Y1OA 1FNBA 4K0RA 1PLLA 5IBCA 1DL5A 4YR7A 1DFHA 4V0MA 4OQYA 4PZAA 4NICA 1TZ2A 3K6RA 2C0QA 3OZIA 4Q3EA 5FUWA 3URKA 2PWZA 4FFBA 4PANA 4OXYA 3RS5A 2JFQA 4CGYA 1YJBA 2QP3A 2G67A 2OQIA 3PFHA 4YP1A 1BS2A 3GW8A 3IV7A 4KXLA 4XR4A 2FLKA 4M88A 4WLEA 2BISA 5ES3A 4JJ4A 4ARSA 3OZAA 2YHIA 4MS3A 3C6ZA 4KK3A 2J41A 1G64A 1ZH6A 3C3AA 1RACA 3L0ZA 5F7JA 4WVLA 1Y8AA 2Q2WA 1XRNA 1OXUA 1KK0A 1QKIA 3HH8A 5JAOA 3GNLA 2ORVA 3C3MA 2F9MA 3K09A 4HAVA 2CK3D 3LTNC 3NJRA 3ZHTA 1SHJA 4NNPA 2OGSA 3NHPA 3B5EA 4KO8A 2B21A 5IM5A 1ZXBA 1K92A 4BO6A 3ZJTA 2A78A 2HYDA 2W6QA 2DHRA 3F6BX 5JATA 2C7OA 1P1HA 4DQKA 1ZVQA 2JBAB 3CNOA 1P7CA 5JXHA 4EABA 4Z7OB 4P7GA 1BDBA 3PEUA 4DV1B 1LKZA 2B20A 3MSXA 3NWPA 2I4TA 4OL0A 5T57A 1YHYA 3NBMA 4F3YA 1WHSB 2ERYA 4EB6A 1JAIA 5B3JA 3T1OA 3VTKA 3VISA 2C4KA 1EX1A 1IPHA 4GOND 7REQA 1M1UA 3SQNA 2C1XA 4BO5A 1DOZA 4IKEA 3B51X 2FZCA 4IHKA 3L4KA 4XH9B 4WKGA 4GGMX 4BZWA 1T5SA 5E1OA 4R01A 2J0SA 2PRJA 4G6ZA 1O89A 1T0BA 3HNOA 1QHNA 5B2ZA 3DVRX 2PUAA 3GJQA 1XC7A 2YZGA 3DT9A 3P0IA 4GOKA 4QNMA 3RVDA 4HFRA 1XAIA 2IH2A 4IO1A 3WKAA 4BN5A 1EZ4A 3TSCA 2PUEA 1F4PA 1JLKA 2LPMA 3K0AA 4PE5B 4WK0B 3SXUB 1EUYA 1YK1A 4US1R 4I9FA 3RF6A 3GDWA 1R5JA 2BMVA 3HGMA 1IIBA 4N0QA 4NOMA 4YO7A 2KQUA 3PG5A 2GJKA 5AKZA 5TRTA 4A03A 1SZJG 4BX0A 2GCEA 3DUFB 4LI3X 4MGHA 2HX1A 1UP7A 4KE8A 5K0TA 4QE3A 3SYRA 5AXAA 1AGRA 3WGLA 3FJYA 2E55A 4M2LA 1R8QA 4FUTA 4Z9BA 1NG9A 2F90A 4J7AA 4DPLA 2CWWA 3D4NA 3E53A 2Y93A 2H1RA 4LXIA 3VU8A 2I2WA 1LRKA 1MJGM 1K8QA 4HGOA 3SQOA 3QFCA 4OHKA 3TW4A 3ZBPA 3BMCB 1NVFA 3B70A 4KLRA 1WEKA 3I5MA 1KZ7B 3NWBA 1LPBB 1YZ3A 2GYYA 3P45A 3JQFC 2ZJBA 1CNMA 3CRMA 3IURA 4CEHB 2IVZA 2ODPA 1NIJA 2Y1WA 1NQWA 4F12A 1QGUB 3T9FA 4MIEA 2NXJA 2Q6IA 4NBLA 3BTSA 3TPFA 1PSZA 4RS4A 1KAOA 3B1XA 1EWRA 3OM1A 3WL3A 4YHHB 3CZCA 1MB0A 1QIDA 1X1BA 4L57A 4N1AA 2OESA 1XDBA 3E22B 3F5DA 1ZRNA 2IYSA 4M0CA 4QPDA 4BVKA 4ES6A 1CS0A 1LVGA 2EBFX 2O2JA 2VH1A 1OLSA 2XBUA 2ZIZA 5D7BA 3U40A 4DCUA 1IUKA 2ZZNA 5CX1B 3QU5A 3OU7A 2D1SA 1W47A 1TNDA 4RSGA 3WZMA 2PBLA 1N6IA 1ZY2A 2UXBB 2XGSA 3ANMA 2CL0X 1U9IA 2XBLA 3LT4A 1PGNA 4G0NA 3ME5A 1DKNA 1JBKA 1ZEMA 2X3YA 4D97A 4P0QB 5LQDA 1JPNA 3PC2A 3PPWA 4RA6A 5CFLA 3GFRA 3H04A 4JJ6A 4EY3A 5CAEA 1KQPA 2VLBA 3Q10A 3HJAA 1C7QA 2F43A 4YA6A 3ETLA 3IR5A 3OURA 3TBHA 3H99A 3R6LA 5AKYA 2G0AA 4N5DA 2ECQA 4PYQA 4H3HB 5J47A 5DTEA 3VOBA 4CDRA 5T5QA 1Y5IA 2PQ0A 1O94A 2P9EA 1EA5A 1QRAA 4BL5A 3L0OA 3UWPA 3C5WP 2PX4A 1X3LA 2G0NA 4NTZA 4A4DA 2B4KA 4U3JA 2J09A 3M6VA 3S2FA 1EVYA 1ADCA 1OF1A 4NLLA 3V7FA 5AFSA 1Z18A 2E37A 4FVTA 1YC2A 5ALWA 1XXLA 4KWEA 4LZLA 2UZ1B 4IHJA 3JZIA 4DNFA 5BR4A 2BUAA 1E2EA 3ASUA 4XM1A 2RI0A 1CUEA 3GGOA 3R5FA 2ZUTA 2ZLBA 3HO6A 3VV2A 2R1TA 4BFSA 2Z43A 2GA9A 3R2JA 4E7PA 2JGIA 5IULC 1VCIA 3CJRA 4B43A 2RGGA 1YDEA 5J59A 3L8EA 1P5ZB 1GD1O 2QV0A 4X65B 1WZUA 3CVXA 1K66A 4YJ2B 2XXJA 4M1KA 5B3AA 3OJLA 1XMSA 5H59A 3VOAA 3PGJA 3JX9A 3KOXA 1R2QA 1DBSA 1JPJA 1NVBA 3CSSA 3OZTA 4LPSA 4Q19A 5AI6A 1I1QB 5CHYA 1GTMA 3EAQA 4MB0A 1H2AS 2QNBA 2FWBA 1TD1A 2C95A 1OY1A 2O9JA 2CDRA 4BQEA 4PO3X 4BQQA 2VQFB 4LNAA 3FIJA 1IHXA 3KYBA 1JHYA 2CEAA 2WV9A 1J2YA 1XROA 2J3KA 1BFUA 2IF2A 3X1WA 2MWMA 4C4RA 1D5CA 3DHVA 5TT1A 5EIEA 4YAJA 3SQXA 4EKYA 2PTGA 5BSVA 4QOGA 3ZW8A 1M9NA 1MOZA 2ETVA 3IOCA 4AMYA 5J9FA 4ZI7B 1EFKA 3L04A 4OG2A 1ZN8A 3LGSA 2VTBB 3B8EA 2DFDA 4YJ3F 4YMWA 4R0NA 4RV4A 4G5XA 1Q20A 4HAXA 4OYYA 2QRVA 2J8ZA 4UNQA 1I6MA 4F92B 1RJGA 3GGJA 2J3QA 3M49A 3GCZA 1AMNA 4L50A 3EFOA 1C0KA 3AEZA 2D4HA 2A3NA 2EX0A 4RMIA 4GAEA 4YRJA 1ZOOA 5BQ3A 1ECGA 4TXMA 1OSNA 3BK1A 1JFVA 2JDIA 4JYPA 3KQOA 3U09A 1EYZA 4EBBA 1DIAA 1EM8A 1AIPA 2PIDA 3W8NA 1ZN7A 1YR6A 3U3KA 2Y92A 1WHTA 1O8CA 4NJEB 4EUFA 4G1UC 4BAZA 4JNCA 3H17A 4NCIA 1GG2A 1YVUA 1UPBA 5K1ZA 3IMKA 4NABA 1VL6A 2BVNA 1TMYA 5EJAA 1K8YB 1LQUA 2H1HA 2OPBA 3EIWA 3H5AA 3EGEA 1KJJA 2OV8A 3OLXA 1SBCA 1NBWB 3G9ZA 4GI3A 4L22A 4UJ3A 5G3ZA 4J3NA 3WAKA 3UMJA 4L8YA 5KOYA 3JW8A 4ZAZA 3PNOA 4ND1A 3U16A 4JCOA 4MUIA 2D0OB 1G7TA 2EG9A 5JXJA 1GGKA 5K8TA 2W6OA 2CKDA 4IDQA 4M0KA 4YJFA 5FJJA 1NN0A 1CKEA 1DEXA 4B33A 1X8KA 3BSYA 3NQ41 1D07A 3QVVA 1FLVA 2QZSA 4X91A 1SXJE 4OSEA 4HDNB 3H2BA 4ZQHA 1T0JB 3C3YA 3L93A 3PC6A 4AVYA 1FDWA 1LNZA 2FQYA 3PSHA 5DRYA 4FWBA 3IBSA 5F64A 1C14A 1TJNA 2ZBDA 5H68A 3DCIA 4L76A 3GJZA 3F74A 3D3NA 1Y0BA 4BXOA 1HYQA 5JCPA 5B1SA 1JGTA 4CQMA 4UM9D 1KMIY 2A0WA 1U11A 3OWHA 4QDXA 2AB0A 3F3SA 4WFKA 4ZO6A 2BN4A 3UQZA 2GEVA 4FJ0A 5E0OA 1FTQA 2OVBA 3QBEA 3CO5A 3V4VB 2JG3A 5ECDA 1MX5A 4BJ5A 3P2MA 4CEJA 3FFXA 2DLCX 3SNHA 1JW9B 2GEKA 2ONCA 2QL9A 4LCJA 3ZLBA 3B2NA 3IQIX 1JMYA 1ZK3A 4XSHA 5COBA 2VLIA 2O8VA 4Q02A 4EEXA 3AY7A 3DFMA 3L0IB 3JZMA 4FIZA 1RR6A 4GYKA 4IKOA 4LWOA 5E1MA 1GEGA 3W5VA 1D6JA 3EIQA 5CRIA 3VNBA 1EJBA 4D8TA 1VIYA 2D0DA 4F86A 3GYGA 1HTWA 2E85A 2VSNA 4QELA 5CM8B 5J23A 3OZSA 2XGMA 3W4IA 4EG0A 2HQBA 4F1WA 4C2TA 1WHSA 4ZJZA 5DX8A 3M6LA 5JSYA 3V9PA 4FIDA 5FPYA 4WIAA 2HSJA 4E14A 4RDXA 4YCBA 1K88A 2XODA 1OOEA 2JCVA 4YJ3B 1RZRD 3MTBA 3P0FA 1YJCA 3FOBA 3MSCA 5B7GA 4HLUA 3R41A 3WS7A 5JD3A 2IHYA 4M6WA 5EKUA 4ZYLA 3K94A 1E66A 1GT91 3IB6A 3UUFA 4DCCA 3Q4GA 1IMJA 1QONA 2VQSA 2XDQB 3DTNA 2XTZA 3LC7O 4LHYA 1P5RA 1JAXA 2RAVA 3OPYA 4OQQA 1XTKA 3STVA 1XD2A 4B8YA 4MV1A 1XKTA 1W85A 5JUWA 3BMQB 4XPIB 5E95A 3TECE 3UAXA 1HKUA 5L4NA 1N2CE 2OQVA 4DMRA 3QFHA 4LSGA 1TM5E 1YQ9A 1HH4A 2E5FA 3A25A 4RZQA 3LUAA 3TEJA 3R8FA 1T0UA 2G9ZA 5HRCA 2XWPA 5J2TB 4LAFA 2ODEA 4RZIA 2XUDA 4XTCS 2ZUEA 3NT5A 3WICA 2P3SA 1DUIA 1ARZA 3GHYA 5BN4B 1XZEA 5HZGA 4DEXA 2I4OA 4EW3A 1MW9X 4ZIRB 1JQ5A 1RQ2A 2BMWA 1GRQA 3QE9Y 2WHYA 4NE9A 5JMWA 1QP4A 2D1FA 1OFGA 1SY7A 4E6PA 3UO8B 4DBVO 2GEBA 2DECA 1AUOA 1OBVA 1DAIA 3A9SA 2QJRA 4MI1A 1YJ8A 2VK4A 3CZ9A 1D3AA 1OXSC 1SH7A 1JHUA 4KTTE 4BN0A 4YAGA 2UU9B 2PRKA 4LRTB 2Z2XA 2YKGA 4RTNA 3B53X 4DM7A 1ZVVA 2DWUA 3TW8B 1G20E 1GAJA 2GPJA 1VBNA 1U9JA 2JDID 4WD3A 1SHKA 2QJWA 4EUNA 4QZVA 1W46A 4D25A 2ZYRA 4OFZA 3WISA 3WLRA 3IIMA 4DMCA 1W5EA 4JI5B 1NYQA 3ESQA 3UXMA 4QG3A 9ABPA 1XD9A 1XA4A 3E8XA 3CJTA 4FN4A 2ZBVA 2ZIUB 4FFVA 3Q7QA 4PQEA 4A5SA 5CH5A 1Z6PA 2RGXA 2SCUB 3N2KA 3TNJA 5JAUA 3ECCA 1HX7A 3RS9A 2QS9A 1E9VA 4RPLA 4GI7A 4J0QA 4CKBB 1E1LA 2QWXA 1E6UA 2POQX 2JLZA 1NXOA 5B1EA 5KEIA 1GZ3A 2E4WA 5EUMA 2XE8A 4ENSA 1TYDE 1UXIA 1YI1A 1Z8NA 2CFSA 4JL5A 2YNMA 2Q1UA 2JAOA 2ZRGA 4KI7A 3QU4A 3W5CA 1BC5A 3L6BA 1MJFA 2CBXA 1NW9B 5ITZB 2Z83A 4IQ8A 1N5RA 1P4SA 2HQOA 2W0MA 3LCJA 4DA8A 1C7IA 4LGMA 5FTJA 1G4AE 3CB2A 3LGAA 4O2AA 4PHFA 3KCQA 4KLZA 2O1WA 2H2GA 1P5HA 2C7RA 1J20A 1E9FA 1XSEA 5DPMA 2X2PA 3KKLA 4U9UA 3P0EA 3QVMA 5DX0A 1NX6A 2JS7A 3LUPA 2O7RA 2XD4A 4HDOB 4JVOA 5D1HA 4BC0A 4MUYA 4IIJB 4KITB 3KSZO 1T9AA 4CQLB 4QPCA 3SICE 2H5LA 2ZBRA 4LE1A 5HRUA 4PSVA 3GRUA 4UAJA 4X20B 1MAHA 1SJ9A 1MIOB 3HCDA 2P9ZA 3KT6A 3JZAA 4JA0A 3GRZA 4GWKA 1BVRA 3H9GA 1P77A 3E82A 4ZQIA 5LIRA 1LU9A 3ZPXA 1RXEA 1KNQA 1NFRA 4HWKA 4PYLA 3WHPA 4F1KA 2GH1A 2J1LA 2LWIA 5CBPA 1R64A 2C4VA 4E5YA 3VKUA 4C4XA 3ZH9B 3F73A 3WLLA 3JQ8A 1VA4A 1BE6A 4I3GA 3SXUA 2EKPA 3CZ4A 2FWIA 4B3IA 4BVHA 3KQTA 3ZHVA 2VDRB 4B2PA 4X1IA 1Z12A 3KQSA 4K87A 1VKRA 2C54A 4F45A 1P3DA 3PITA 4LGCA 3ROQA 1CUIA 3PGMA 4YJKA 1GZ4A 4ZI7A 5B3KA 5EZSA 5KNBA 3I3OA 3KUDA 3UMCA 4BUZA 4RO0A 3HJTA 3KJNA 4ISCA 1FNCA 4P86A 3C3PA 2R5WA 5IT0A 1QH1A 3O4FA 3T94A 1Y1QA 4K9RA 3B6IA 4NCAA 3DTVA 3NAMA 4HH1A 4LYAA 3FMVA 4O1HA 3UMGA 1JSCA 2XOKD 3X2FA 2DC1A 2VNJA 3Q98A 2QN9A 2CLSA 4QUEA 3T5CA 2ZYGA 1IE3A 1YZNA 2BFEA 4BNXA 5F7XA 3ZVMA 1W59A 4ALJA 1MPXA 2VHEA 1IZYA 1L7XA 2IP2A 1ESZA 3N0RA 2XX3A 5J58A 1G7SA 2OOSA 1YB4A 3K16A 4RVUA 3GMTA 3ZWPA 1G6KA 2EHJA 1O3YA 4P33A 3KJGA 4P3XA 1AHNA 5C1IA 2VF8A 1KTVA 4XRGA 2R8XA 1DJOA 5J43A 1QR6A 4MV0A 3IESA 2XD9A 1VHQA 2XVMA 2IHBA 3FUUA 3ISVA 4NJEA 1R0WA 1H0HA 3S1AB 5KYTA 4O4LB 3T52A 2XNSA 2OMKA 1SBNE 4ZOLB 3BSFA 2Q6TA 2ZIGA 2AD5A 3DMYA 5BT9A 2QLTA 3BX1A 3HRKA 3TDNA 1TK3A 1XDSA 2EBUA 2GCOB 4FXPA 4TV8B 4F2HA 2HQRA 2C31A 1VE6A 1V9LA 3QUAA 3KOUA 4JLAA 5NLLA 3EYAA 3T5BA 3EGVA 2JKYA 2WDZA 3PI6A 3PNYA 4QXRA 4DDMA 1V35A 5CPBA 1OB2A 5EVCA 5FOXA 2BE7A 4LVCA 5EJ9A 2NVOA 2WEKA 3NHJA 4B2YA 1VLJA 1R00A 5HDQA 2ILVA 2M6SA 4D3XA 4B34A 3I2GA 1QGDA 3G8BA 3GJ5A 5CDFE 4OKNA 3REOA 4AECA 1PEKE 4OKIA 5A2GA 3K4HA 1E0DA 4LIPD 4C0QC 3FPAA 1Z6ZA 2FZGA 4P53A 2XUIA 4B85A 3OU6A 5E4TA 3GJ3A 3T7DA 1CBUA 4AJJA 4KR7A 3BFKA 4E1AA 4RFSB 4CM3A 5LL6P 1T5IA 1W5AA 2PTHA 4MKZA 1U2RA 2OM6A 1IN6A 2ZIEA 2ZZKA 3N2ZB 2CJWB 3FPJA 1Z4IA 2R2AA 3ADDA 3A1CA 1NUUA 3WO0A 2X0RA 3WBBA 2F4VB 3RVJA 1JJFA 1P3JA 2CDNA 2Y99A 3ZXYA 4FFPA 3LPMA 1X9IA 2OQRA 1U90A 2PBZA 4LZNA 4WESB 2WWXA 1WXWA 8LDHA 3E1KA 3I2FA 2RK3A 2GVNA 1F20A 4PPGA 4CI9A 4KKXB 1XMQB 2RJNA 4NNJA 2YZ2A 1XIVA 1Z36A 3AF0A 5LD2C 1Y3FE 4WBXC 2WJPA 2DM6A 3B9PA 3BUSA 3FUWA 3IAM1 5B37A 4FLMA 4BNKA 4Y2PA 1SBTA 4EYGA 3N8GA 3LUKA 1JYFA 1O4WA 1KEKA 4RETA 1SCQA 3HR8A 3RHFA 2IYNA 4LHZA 4WOJA 3L7NA 1B0AA 2Z08A 3QU2A 1TRHA 1K5HA 3GIDA 4WJZA 2VSYA 4QXOA 4W1QA 1FJHA 1WPGA 1M5RA 1RI3A 2XUHA 3QPCA 1B74A 1LPNA 1Q1GA 1J39A 3KZCA 1WULS 3PNSA 4IDGA 4C9BA 2I29A 3SAJA 3RIXA 4ME6A 3CS3A 1JXOA 1Z4JA 4XEHA 1DDIA 1UWKA 4CT5A 5EA2A 3WK9A 4OK6A 3PHGA 5TQ0A 3PENA 4C7JA 2O8EB 1R6BX 4JUAA 3DXXA 1XP5A 2BHNA 4MYDA 4NR0A 1IUNA 5EQTA 5FI5A 1T0IA 4OI1A 3RUFA 2Z3VA 4A0RA 5GINE 1E0KA 3E7FA 4YJGB 1O08A 3OJ0A 1B16A 1EVKA 3D7LA 3TZ6A 2I3DA 3B6MA 3O73A 3GNQA 5F33A 1VI5A 1V5GA 3HRIA 4CTNA 2QTGA 4X7MA 4DJTA 1NIPA 3LUGA 3O5AA 3WYEA 2EG5A 2XB4A 5I7RA 2F00A 1YCDA 3LOUA 1J6UA 1NBAA 5G0VA 2NO7A 2BZGA 5DDIP 5IVDA 5TY0A 1QZ3A 3HKBA 4UTZA 1R37A 3NALA 4FU0A 1K89A 2W6IA 2WF9A 4KR6A 2OR3A 4KPUA 2X8JB 3AF3A 3OCCA 1G1MA 3GJ7A 1FFHA 2OBXA 5EPEA 1ZJ5A 3DT8A 3MLEA 4F21A 2DQYA 4C4AA 3DBRA 2HC9A 2ZBPA 4JEMA 4UARA 1BQEA 4NQRA 2QAIA 1WZNA 2DTDA 5P21A 1BHQ1 1AV7A 4MS4A 3GT7A 4UHBA 4BQIA 4EJSA 4PVDA 1QH1B 3B6ZA 4D3SA 3S40A 4UTOA 1SXJD 1GZSA 3D7KA 1T1SA 2YVLA 3L6UA 1E5QA 2ZJZA 2FPWA 3LS2A 4TMFA 4ZOEA 4EO7A 1J23A 1DJPA 4UAVA 3UJ8A 1U6KA 2R5FA 4JB2A 3FYTA 1UXOA 1A1VA 1U3VA 4FCTA 3WYFA 1VTKA 2YBDA 3GVHA 4PTLA 4DNXA 3ETJA 3AM4A 2J3HA 3RB8A 3NJ8A 4L5BA 3OO0A 3NBUA 4MIKA 1GHTA 1D0SA 2O2HA 1X7WA 1A96A 4BPRA 2QR2A 2VJBA 3GP8A 5HZHA 2HREA 2RJOA 4LVNA 5D3KA 3L5KA 1ZI8A 2OHJA 4EGSA 2X8WA 1S2NA 3PNQA 1AK9A 1NR5A 3ILVA 3PR3A 2CNOA 2M1XA 4YMSA 1I7SB 3CNBA 2X0KA 1DGQA 2D1RA 2FSUA 4LJAA 5KVVA 2Y1CA 3JXEA 1EBBA 2JGRA 4BWGA 2CXTA 4O0MA 2IH4A 2VXCA 3TRHA 4NC9A 1VDMA 2GQ0A 1ISRA 3AOEC 2FWNA 2BFDB 4UMVA 4D9EA 3QE4A 4NYIQ 3DMGA 3RYHB 1LPOA 2OENG 3KSRA 3AMVA 3A9CA 3L02A 1UC5B 1R6VA 3N6VA 3PJFA 3AVUA 2ZJ8A 2E0IA 3IIEA 5BV2P 3HP1A 1SKMA 5BVGA 1QO7A 2DFVA 1L5OA 3F2VA 1PHRA 3KJEA 3MJFA 4QGHA 4CV0A 4YYZA 4XW2A 3IQZA 4BN4A 3A9UA 1RRVA 4PXSA 3EMDA 4YS6A 1YS2X 2QG9A 3FX2A 2G71A 5LMUB 5KYXA 1F8UA 1Q7GA 1IM2A 1ZIPA 4Y7DA 3KKKA 1Z5UA 3DTTA 3GUUA 3EEIA 2WD8A 3LHSA 2GEJA 3CVYA 3NIGB 3QBTA 4DLAA 2ADFA 1ZK4A 1TIBA 1MABB 2WG2A 1PAUA 1GTJ1 1J22A 2B99A 2I7XA 5P8WA 2QHXA 3SFZA 2V9CA 2QQGA 1DO8A 3OETA 1L4YA 1E0AA 2QDKA 5L6MB 2I0FA 4HATA 2FUG1 3EVFA 4II2A 3C5VA 5EE1A 1VPDA 1KJNA 4D4HA 1X7YA 2OAGA 5TIIA 4OCZA 1PR2A 1WAMA 2QPAA 2DR0A 4LDRA 1G7CA 3BN3A 2FZKA 2J5QA 1VRCA 3ODGA 1GARA 3VXKA 5CDYA 3JQGB 1C0PA 3DOJA 2PSEA 4EHLA 3NX4A 1ZA2A 3U26A 1OE0A 1YVEI 4HWOA 2ZIXB 3MW8A 2X1LA 1M2OA 2VAPA 1XO1A 2XYVA 1TVMA 5CIYA 3OCWA 2G6TA 3ICVA 5DXAA 2OOKA 2FW0A 2BUCA 1D2EA 1Q14A 1Y98A 1RNLA 3O8QA 3AI1A 1ZU4A 4HDRB 1JZTA 5CA0B 4WKBA 3GEHA 1RI5A 1YVRA 3N7AA 5CLGA 4B6GA 2PS9A 3PP8A 1FSGA 4FZJA 3KEFA 1XA0A 4GNKA 4CW7A 2DCMA 4EJ0A 1EP1B 1L5WA 5K2OA 2BW0A 2PGAA 4RHXA 4D2IA 4IJUA 1RRCA 1OHHD 5EXPA 3WQSB 2ZYDA 3M6WA 2OZVA 5TMDA 1RFLA 5E2AA 2B6NA 2FLWA 3IYLW 1P31A 2X1VA 4FOPA 4G2TA 3IULA 4GR9A 2QKYA 3W77A 1WBJB 1I9GA 3MZ0A 3OPMA 1IZ9A 2HFKA 1VJTA 1B1AA 2MSKA 3AU9A 3PPIA 4G9GA 4GEGA 3A3KA 3ZTYA 3KLNA 1N2GA 2FSFA 2IXGA 3G0IA 4HJXA 4UCXA 5C5CA 2I34A 1SUFA 4ED9A 3IE1A 1ACLA 2A0XA 4H1UA 2M32A 3E8MA 3S3TA 2W6JD 3DC7A 3IEXA 4XFKA 3NDPA 2NUAB 2ZSDA 1XTJA 2FFBA 2JBWA 4CMKA 3RBAA 2JFYA 4B3FX 5A4FS 1KMCA 4L5IA 5A5FA 3FSRA 4KVZA 3ICQB 2G7MC 1J06A 1DHTA 3AB7A 2B92A 3DKIA 5BN5B 3NJ4A 4ID3A 5IKOA 2LCQA 1NN1A 3W8EA 3F4BA 3TS1A 1VLHA 1TEHA 4G4GA 1E8MA 1LI5A 2G1AA 2AG0A 3EQ6A 2PGIA 4D0SA 3D5QA 2HMTA 4F84A 3QVJA 2SKDA 4YJ3A 2ZTLA 5BWCA 1UL1X 2OCAA 4HS4A 4O2AB 4OH7A 1ZN2A 2ES4A 4ACBA 4BNVA 5C1OA 1KETA 3AGQA 3DNMA 3BKXA 3OEWA 2G04A 1Z2AA 4OI0A 3BGSA 1WOMA 3PS9A 4YRDA 1RIIA 2AJCA 4GHWA 2Z04A 4XDZA 4ZMSA 1WCWA 1EE2A 2P6MA 3DKPA 3NHWA 1OA0A 1C9EA 3O0TA 4RULA 5DWVA 5IZCA 2XKJE 5DNEA 4HO1X 1F48A 1GKKA 3I58A 4OAPA 4EJSB 4J6FA 1FA9A 2Q45A 3E9RA 1RWMA 1XNGA 3J7AC 4YLGA 2O2GA 1VYTA 2PYDA 1PYOA 1K5DA 3WRYA 4ETNA 1BA2A 4OB6A 4Y1RA 4D42A 1DQYA 1Y8ZA 3EAGA 1CUGA 1LI7A 2QZJA 4RH0A 3QEBZ 1ZMTA 3VHRA 2AJLI 4LDPA 4BP8A 2CMHA 4PFQA 4R54A 4O3MA 1NMEA 3WLIA 1D5WA 3K0AB 3EQ9A 1I30A 3F3MA 4JH0A 3I8OA 2ARKA 1PD1A 2G8LA 1Y6ZA 2ZS8A 3U4MA 1AO3A 2K2WA 1QLWA 1FFAA 3SC6A 4LV6A 4YDHB 3MM4A 4YMIA 1TGYA 1JA9A 1FW6A 1DG9A 1NTRA 2HRQA 2JGAA 1IUPA 2YV1A 2D13A 1VSBA 2DBVO 2ZANA 3G2HA 3U3RA 3RW9A 3SF0A 2FX5A 1KMNA 2P7IA 3MWEA 1R9NA 3AY0A 4KU4A 1J2RA 3DB1A 4OU4A 5F9MA 4IOMA 4P4GA 1N36B 3ZGNA 1L8LA 2D1TA 4GOMD 5GAJA 4JUCA 1M0SA 3H2YA 4DQVA 2PZBA 4QWMA 5I8WA 4OOEA 3N2EA 2OBFA 5CIWA 3DDHA 5JNVA 5CVUA 1F8YA 4ZCLA 1Z56C 1RKUA 4A1FA 3VZBA 1Z6AA 1XALA 2O20A 1M76A 2VOEA 1X7WB 3CWZA 1HDOA 2NYVA 3CX4A 1YA8A 4MLZA 4YFVA 1ODCA 1RWWA 1U0OC 2OHFA 3JD4A 3BKWA 4L72A 3VR0A 5BMVF 1SCBA 1E5XA 2IOHA 3I6QA 3ONFA 4D9KA 4G24A 1OU4A 3VR3A 4KIUA 4Q0MA 4L9AA 4D8UA 3IDQA 1AC5A 2G0TA 2VCHA 3DVAA 2FMHA 4PICA 4B4KA 5ARBA 1XKXA 2AH5A 3OG9A 1SK8A 3QHAA 5K8JB 2E4AA 3HP4A 2ZETA 2WG0A 3FVVA 3HV2A 1CZRA 4G85A 1SU4A 3T3MB 2FCRA 4BKPA 1WVMA 1T8PA 2AG1A 4I7EA 3OFND 4D92A 4NOLA 4U6NA 1J07A 1QZUA 4C21A 4OPMA 3GEMA 4RORA 2CLLB 4FGWA 4NHEA 1KVTA 3ONWA 5FX2A 1DO2A 2HL6A 4IHJF 5DK4A 1KP2A 3DXYA 4AS3A 3PLAE 1Z37A 2IBSA 4JOQA 3I28A 1VPEA 5KDOA 4JZKA 3AFIA 1G5QA 2GF9A 2Q4RA 4J7UA 1G6OA 2NXWA 3LF2A 5C8YB 1L7VC 1V5EA 4K1LA 2JFBA 5KQLA 1W4ZA 2YZMA 4ALLA 5IBQA 5JSZB 1Z73A 2R8RA 3PXAA 4L5CA 5KCZA 1Y1RA 3IODA 1IYZA 4W5HA 3GA7A 1Q12A 4L28A 4B6JA 3L7DA 1MO6A 1FX0A 4NF2A 3ABQB 4L8GA 4RUKA 2P1RA 1OA1A 3D2BA 3IPCA 3OM0A 3ZU3A 3GGPA 4H59A 1RD4A 2ENWA 2GOYA 2RSLA 1XZBA 3O2JA 5DU2A 1R8SA 1W4CA 1Z17A 1EAMA 1MB3A 1ODJA 2A9KA 2G09A 2BBOA 3AP1A 2A67A 3BIOA 1Z75A 3C1OA 3IS3A 3FFAA 3KEGA 4OQLA 4QHSA 1HMPA 2CFTA 3ZHRA 4Z2YA 2M6KA 4XYMA 1IAVA 1MEOA 3DYIA 4WK6A 5DHTA 4RLQA 3IJPA 4DRYA 3K92A 4FB4A 3U4AA 1MC1A 4HV4A 4QOJA 2D8AA 5IXJA 4RY8A 4YMUA 1W36C 3LY7A 3PJRA 2PA0A 5MN6A 2IIPA 2QK4A 3HYLA 2DQ4A 3NI2A 5JMOA 3TTTA 3FKJA 3GQBA 3V8NA 3L8FA 2ZRMA 4Q9JA 1B2RA 4O2BF 4K0KB 1IJKA 1GR1A 3R5JA 5ENDA 5E8RA 5C5EA 3PKJA 2PL3A 4ZI7F 1B0ZA 1PF7E 1BQ4A 3E3LA 2B2NA 1XVVA 5CLHA 4PAMA 4F8YA 4CHTA 4CEHA 1NTOA 3LK6A 2PA3A 3HCOA 1IN4A 3OD1A 2JIOA 3BMNB 3DTVB 3JQDA 3CZMA 3OA0A 3FUXA 4MROA 2FEOA 4Q9NA 2H2DA 5AKHA 5G0UA 3A31A 2OBBA 4DUYB 1ZMOA 4CIWA 3R7WA 3G2PA 1PUIA 2PYZA 5LZ8A 1Y8CA 4JBLA 3JPYA 4BMNA 4JU9A 2JLRA 5BXQC 2EDCA 1ZEJA 4Q03A 3H2GA 2GM3A 4R8MA 2VCYA 4LJKA 2O8DA 2P2NA 4UZSA 4YR9A 5C52B 4XCVA 2HA4A 4XGIA 1KI4A 3ET4A 4AN1A 1DHRA 3M1YA 4PIMA 5LQNA 5DNWA 3AOGA 3LMKA 5GONF 2D4AA 1N3IA 3W1VA 1U2TA 4ILKA 3KJIA 4PR3A 3S29A 1M2HA 3EYWA 4JBXA 4RCVA 4TS4A 2IT1A 3I9MA 2GHTA 3FUTA 3SJAA 5KTMA 4YXFA 3FA2A 2QDXA 4XB2A 4I9HA 4COOA 4YUYA 2WJGA 2DHDA 3RJ5A 5HDBB 4PGFA 5C8VA 4LBZA 1MAVA 4QBIA 4JI1B 2G36A 2H48A 3I01A 1OC2A 2WZBA 3Q0IA 3QXHA 1YBFA 3FHLA 3ZZTA 1VHDA 3FPFA 3RU9A 1I4OA 2WSSD 5KYWB 2FRXA 1LF0A 2AG8A 2AN4A 3EA5A 3O47A 4JXJA 2ZI3A 1WUIS 4G63A 4DUGA 5ICCA 2RIRA 2EERA 5JCXA 2BFFA 1Z45A 5GGXA 5M2QA 3K71B 5I7WA 1GT6A 1IDOA 4ZVKA 4E70A 4BY9E 1CZKA 2RHOA 2WABA 2WTMA 3GWZA 4HDNA 4YRFA 4JVNA 2Z8ZA 1H3FA 1XZFA 3OH8A 4AWXA 4YAUA 5FWDA 3U6BA 3NVMB 3LHKA 4MS4B 1L1FA 3M9LA 5JZMA 2ZG6A 3IMFA 4EGQA 3IFSA 1KI9A 2N42A 2VJMA 2GSDA 2QJTA 2A30A 4JDUA 1GOTA 3RUDA 1ILEA 4ETMA 5IVPA 2FG7C 3FZQA 3VPFA 3BFPA 4BJ1A 1N6LA 4NFYA 3UJPA 4TQAA 1UBJS 3TLAA 3FCSB 1VSQA 1H3NA 4Q7LA 1RJ9A 2BPOA 5KTKA 3IJRA 2ZBQA 3DF9A 4AJHA 1U8UA 3QVUA 4O4LF 4PEVA 2NO9A 2BE9A 3T9CA 4EW1A 1M8KA 3LVBA 3L7JA 1HXHA 3LCVB 3VTZA 4MI9A 3W4KA 4X41A 3PL1A 3KXPA 4EWLA 3O83A 5B6JA 1AN9A 2BFCA 4AP9A 4KGVA 5JJLA 1AQIA 1RJWA 2JGLA 3CEPB 4IFBA 4ZV7A 4X90A 3PQ8A 4JD5A 3QH4A 5C1BA 2NADA 3CEHA 3I2YX 1FMCA 1DFGA 3L06A 3QVGA 4JBGA 4M9CA 3WRWA 5KOJA 1EIZA 1YR3A 3QYAA 1RYDA 3BCHA 1A8HA 1Z6GA 5GGYA 3VO8A 2EL9A 2YW2A 2GAAA 4PC6A 2XUAA 3H2IA 4MKGA 4S2EA 1WUKS 2CXRA 3L8HA 4GLFA 1N6HA 2EYUA 1DE0A 2FWAA 3JTMA 4HCJA 2LDBA 3ZDCA 1V8OA 2Z57A 1R1DA 5TPZA 4OVKA 1C0IA 3L1KA 1CEEA 4MICA 1J8VA 4X61A 1YOBA 3JV7A 3VU9A 3EX7C 2VDOB 3A3NA 4D99A 3TSWA 2XMPA 1O9HA 2D0IA 4ZEMA 1W4RA 3QKUA 2CF5A 5CLFA 4PRKA 1RXWA 5FHRA 1N4DA 5GM1A 1V11A 1RJDA 2XE7A 4BV8A 4E51A 2VPWA 1KOLA 4IRUB 1PJ8A 3ZU4A 4LQ4A 3WNDA 2FUKA 5FXMA 2IYFA 1FEZA 2P67A 2Y6UA 2QVCA 2GLXA 1D04A 3CX6A 1BQ3A 5BQPA 5KNDH 2IPAB 3G6WA 4YTEA 3TRIA 1VSUA 2C83A 4CKWB 1LJUA 1WZEA 2J3DA 2BSAA 4Z4FA 1ISMA 1ZUNB 1A5BB 2VH5R 1Z5NA 5J5VA 3UK7A 3FHTA 4LJ9A 5I48A 2YL2A 5E2BA 1NAHA 1WKVA 2A0UA 3OSZA 1QG2A 3GJ0A 5DNDA 4YRZA 4IVPA 3RKUA 1G5FA 4DUZB 4G01B 4JVSB 2CV0A 1WETA 4R7TA 6ABPA 4UUOA 5I01A 2Z2IA 2Z8YM 2WJ3A 3W34A 1I2DA 3F98A 3WNZA 4BMPB 2AFRA 4KDCA 4P35A 3TX2A 1E69A 3WB2A 4AULA 4KAJA 1O6FA 1DC7A 1PZGA 2XF2A 4FI3C 4L7QA 5FIUA 4CFSA 5K8UA 2XDQA 1VZ2A 2UDPA 1QDUA 3V4OA 1RHKA 5AVZA 4G0OA 4EG5A 3NDJA 2O5VA 2EX1A 3OX1A 5IEJA 4H7EA 3BFVA 4NECA 1IVYA 1FP7A 1M8PA 1S4QA 2O0MA 3L4BC 4KH0A 4KWCA 3SKVA 5LU8A 1CFZA 1R0ZA 1KDVA 3FMPB 4WJKB 4TS3A 1YV9A 2B1JA 4EKDA 3NC4A 1KH3A 4JT2A 4KXVA 4HDSA 4WHMA 2CVPA 1COZA 4N41A 5IUNC 1T9GS 3LM8A 3NW9A 1A9SA 1WMBA 4QVIA 4IDCA 5DB4A 3RIHA 1ACMA 1G60A 1H9CA 3PQ3A 4R2KA 4FFDA 5DHPA 2ACVA 2P1DA 3L41A 4N0DA 4LY6A 4M38A 1M75A 2Z1MA 1KI2A 1US8A 4GR5A 5DBEX 4JQSA 4F5ZA 2QYTA 3H5IA 2JBHA 5FV4A 1M66A 3ML1A 4J0HA 3SF8A 4MW7A 1YWGO 1NY5A 1UKYA 2R7LA 2RJ3A 2XYRA 4FNOA 4QAQA 4W6QA 1RSZA 1WMAA 3OJWA 1OT3A 1E3QA 1J9GA 4CRWB 4A36A 2GYUA 3HXTA 2IXDA 3ZJ5A 5BQFA 3WIDA 5GJBA 1KDRA 5EHQA 1GPNA 1DTSA 4RY0A 2VATA 4X7PA 4G5YA 4U9HS 1CCWA 5B5SA 2O2CA 1FQOA 2RKOA 3JVEA 5C5IA 1Y82A 4YI5A 4MVJH 1MQSA 1JSXA 3LPAA 2VWGA 3AETB 4N0PA 4BUCA 3EMVA 1TVKA 3DZFA 3ZLVA 4BIIA 3SJ7A 1QAMA 1ICIA 1Z8DA 2HADA 2CBGA 3GBPA 1H2BA 4MINA 3DZDA 1Y3CE 2JLXA 2IBTA 4WCFA 4ZANA 4GEKA 3OPYB 2NO6A 4D57A 3R0JA 3DW3X 1PQWA 4KACA 2XXBA 5KWEA 2QW1A 5HQJA 4XD2A 4RPJA 4AZ3A 3VDXA 4QYXA 1P80A 2ZQZA 1GSOA 3EEQA 5B12A 3KIPA 4RHCA 1Z0JA 1SUCA 4RC9A 5KOIA 1OFUX 5D5PA 3ORRA 2FGKA 2BL4A 2HDOA 4BP3A 4KLAA 5F77A 4N5MA 5EIBC 3RKSA 3VPSA 4B3BA 2RC5A 3Q7IA 4IZOA 4UTPA 4MP3A 5TSDA 6GPBA 3CMCO 3HVHA 1XQ6A 4JEIA 3PWKA 2WWFA 3NRJA 4DLXA 5A04A 1S2LA 1IRIA 4ZTUB 2DKOA 3MAAC 4CN8A 4FEGA 1ULHA 4KWTA 3U9TA 2V54A 1Y7IA 4NDZA 4A8HA 2FPMA 3OLWA 4QULA 3DF7A 2GI4A 3C1TA 1FDUA 4GLOA 3H8VA 1CD5A 3GUZA 2VK2A 3MF4A 4X20A 3TQHA 1KAMA 1U7ZA 1TU3A 3O8QB 4AO7A 1GTZA 2O50A 3IEKA 1NY6A 4FGUA 4ZVVA 4D8VA 1NVTA 3M4JA 3TJRA 4BO9A 1D4AA 4AZSA 3ZV3A 5M7EA 1CSEE 1RXYA 2D2IA 5K0EA 1R74A 2I6FA 3U7FB 2HSWA 1L0BA 3ILHA 3OCZA 4QUHA 2KE5A 1H2ZA 3FUVA 5F2KA 4CLOB 2WWWA 5B2EA 4XSGA 1P0MA 1U5AA 4OHMA 3I9JA 4Q4HB 1DT5A 2FMTA 1XEAA 4K8RB 3ZY2A 1Q0ZA 4PS1A 2J3LA 4K1XA 1BKSB 2Q2VA 4TTVA 2F3UA 2VAWA 4V1CA 3NBZC 3U7QA 1N2EA 2XNKA 4D41A 2C2BA 4Q3CA 5T7BA 1MAUA 1ZI9A 3AUXA 5BQOA 4WXMA 2XB6A 4RZ2A 1SUAA 1KVRA 4P7BA 2W2PA 4JQCA 5JLAA 4TOIA 4C4PA 2DQZA 5IAEA 5AJTA 4PZYA 2YCBA 1I2CA 1CU1A 3V7YA 1NMZA 1UKZA 1E7YA 2NXEA 3F0TA 4KGZA 2WPDD 2WFMA 3OWXA 5FTNA 1VE9A 3LQKA 2KW5A 2FWRA 4EMBA 1QO0D 2VHJA 2NO0A 1GV0A 5KYWA 1ZUNA 1ABBA 1L7RA 3K30A 3TNLA 1RC1A 3WBFA 4MGZR 4J0JA 3HUDA 4X95A 3C6KA 4M3NA 4BLRA 2XDAA 5EP3A 4K26A 3HA5A 3GO4A 5JO9A 1ECCA 5LP1A 1FSPA 3L40A 1ZM3A 4LZPA 1SOVA 2KWIA 4UMFA 1GQQA 3ICOA 3AEUA 4F91B 4MARA 3NIFB 4ZMRA 3H05A 3LDAA 3EH2A 3TRJA 1OYOA 2H52A 5LP6A 1K7YA 1YZVA 5LA6B 4KQGA 3KL4A 1JQLB 4HAYA 4FK8A 1PBNA 3PYXA 1Q6YA 1UKCA 1XMVA 2Q3CA 1AB5A 3PNMA 4HEJA 4Z4CA 2J59A 1JWAB 1TQDA 4F4FA 1VHTA 1DEOA 1V45E 4HXYA 5DO9A 2H9AA 5H83A 1G5TA 3KT0A 4AKSA 4AJNA 1JQAA 2RGNA 3IAUA 4TMYA 4Y98A 4DANA 2YNMD 4PNEA 4FPXA 2HPHA 1G20A 1E1NA 2RGNC 2W6ID 2WYHA 2XLCA 3IKLA 1QE0A 1YUMA 3QLUC 3R0VA 5G02A 4KQ6A 1H42A 3HJFA 4K2HA 4F4JA 4JT4A 4DILA 3GLVA 3CUEF 1PQPA 1S96A 2OFOA 1GR0A 5DGTA 5JVDB 4EX7A 2HR1A 1OX6A 3MGKA 4LXTA 2J6CA 3Q6IA 3WBKA 1U5BB 4EQZA 5JI2E 1DJNA 5KREA 3FSGD 3TCNA 3U4HA 2CUZA 4N5HX 3TSYA 1RLUA 2UZ4A 1R9MA 3L1HA 2AMFA 3BQMB 4RVSA 1XVLA 2YH2A 2COKA 4XWKA 4AC9A 2QRUA 3IAS6 1XCGB 3EN0A 2P41A 2XZLA 1FYDA 2IE0A 4K3UA 3O8NA 1FF9A 5K0SA 5AI0A 1CF9A 3VZQA 2N1MA 1ZR2A 4R9RA 3BTOA 4ECAA 2PBFA 4RK5A 3X1ZA 2WQ7A 4F9TA 1Q1ZA 4NXNB 1QGED 2VZ9A 3K6KA 3TIXB 3P2KA 4BWFB 1T13A 1BEEA 4BKRA 3VR4D 5B7PA 4OEHA 5LDDC 2C9OA 5KX5F 1G5IA 1DAMA 1VL2A 3OEEA 4ZCTA 2GILA 4LN1A 5L3VA 5BSWA 3NG1A 3L6RA 4ROSA 4PGGA 2XTMA 4ESOA 4UPVA 4C05A 2JJMA 3VHXB 1C1XB 1JF8A 3BGVA 3ROZA 5CNMA 3IKJA 5CP8A 4YUXA 1LGYA 2IW1A 2C58A 3B1JA 1RLIA 3BGWA 3O6VA 4P4UA 1U1EA 4CDGA 4PWYA 1VJDA 4PLHA 3NEPX 3O84A 1GLNA 3KUKA 1Q74A 1UANA 3I53A 3GCXA 4C0LA 3COYA 3PL5A 4V1CI 2ZROA 1E9BA 1L7NA 3NVDA 2FP4B 1QOQB 4PYOA 1F3OA 4K9PA 1D8TA 2AI1A 3T5TA 3V55A 1HV8A 1XQWA 2JAHA 2P9YA 1NPDA 5WRFA 2O6HA 3ZNOA 4A3SA 1WF3A 1CC1S 1OT5A 1U4OA 3W9YA 4BHTA 3QVWA 3FW1A 3TFQA 1DBIA 3ELBA 3HBLA 4OIFA 4PZ9A 4YFYA 2QD3A 3TR5A 3TM5A 1ZH8A 1JHZA 5CK4A 2QAGC 2UUCB 3I37X 1JDJA 1QK3A 3ILYA 2YIVX 4Z0NA 5DTJA 1J2TA 2VUIB 1USVA 4QODA 4EQ6B 4TRNA 4IQ0A 2DUWA 4IFIA 3TDKA 3BMXA 1RBYA 2MIIA 1T36A 4HZGA 5DBGA 2AVNA 3STWA 2RAUA 3LDUA 5FI1B 4MWTA 3VKFA 2VSQA 3ZBQA 4N76A 1U3WA 1MEEA 4Q37A 1MNAA 1V7ZA 1J5PA 1IHDA 2VHZA 1KVUA 1QWOA 1KR5A 3A0UA 3GJYA 4OHYA 4TGLA 3H0CA 2NZUG 3MOIA 3S28A 4OBBA 1EPUA 4GLBA 5FP0A 3W1EA 3NFRA 3G2MA 3DZBA 4U6QA 1SKYB 3WK5A 3TMKA 1G3MA 1C8VB 4OSPA 5A5VA 4HOYA 2CXPA 2PZEA 4N12A 3SSNA 3LIPA 5FBVB 3F6YA 3R7AA 4B79A 1JAZA 5G1NA 3HPQA 3RC3A 1ZGCA 5A3JA 4UU1A 2ZWIA 4FYYA 4LZOA 1PWEA 1TE2A 1IY2A 3I2JA 3PI7A 5CURA 2YC2C 1RBMA 3BMNA 4E3WA 3OE1A 3P9CA 2IZOA 2YFYA 2IITA 4IVRA 1CVRA 2ECKA 5EYPA 4Q3NA 1ZITA 1H85A 4L78A 3LT2A 1NVWQ 1AHIA 3LA8A 5AKJA 4LHEA 2DAPA 2EJVA 4ZZ2A 3H4VA 1L5HA 5T67A 1TUBB 2OECA 1GA1A 4FEYA 4MI3A 3OBBA 5JZ9A 1P19A 4ZV9A 5JPCA 3E15A 4R3UC 3R5HA 3VVCA 3D4BA 3GPIA 3W3AA 2YS6A 3Q1KA 4QJ5A 4TYPA 1K4YA 4TS9A 4FOTA 2WTNA 3LQ4A 2IEIA 4WBNA 3V8MA 4HPXB 3IT1A 4UD6A 1UZAA 5JAPA 4I4IA 2F1RA 2ZI4A 3L1IA 3FN4A 2PQ6A 1NQVA 3D2CA 1JQ3A 5JADA 5JI3E 1J49A 4Q4CA 4GD3Q 3UAYA 3D1VA 3OEHD 4M37A 2H08A 5CW2A 4JR1A 5G1OA 5LA6A 2C3PA 2DR3A 2W8BA 2WYIA 2ZRPA 3L7KA 3OKPA 4QUAA 1FS4A 5DTQA 4DVJA 1YF3A 1T4CA 1GTRA 2BBSA 3DCJA 1W34A 5I7SA 4KQIA 5A3SA 3P0HA 2NSLA 4MPTA 3CBGA 4GI2A 4FLFA 2BDUA 3EZ7A 4UBKA 3W5HA 2FW8A 3RAGA 5BPHA 4X62B 1L8XA 4IXTA 4R41A 1UDBA 3Q0EA 4HYEA 1ISIA 2G83A 4E03A 1PTKA 3ITEA 4HGQA 1P18A 1HT2E 2RBKA 1H0RA 5J2TA 4YLEA 1IQPA 5K6TA 1R5NA 1AXRA 2PMEA 4M60A 2GTPA 2QG4A 3JQ6A 5F3WB 4IIGA 3QF4A 3QUCA 4NENB 3UGTA 1OC4A 1T35A 4HZUB 5CR9A 1WSWA 8GPBA 2CCGA 3LRXA 1E4VA 3ZCVA 3HY6A 4DCMA 5DTMA 4RMNA 2D1YA 3RU7A 1GG5A 3CX7A 1DARA 4NE7A 3L3BA 2GEUA 3EQZA 1G41A 3RWMB 3A1WA 4JY7A 3EVNA 2ZSBA 5FA6A 4C7MA 4TN5A 3HWSA 4QXPA 1RQXA 2J9FB 3S5UA 5BV7A 5JHHB 5DISB 2J85A 2JFWA 2ZUVA 5IF9A 3AONB 4X1OA 3I8SA 2EEPA 4IFTA 4NAHA 2RGWA 1P17A 1XRLA 3TVTA 4ER7A 4ZQGA 2IRWA 5FB3A 4JYBA 1SG0A 3WL6A 1X9HA 2VJCA 4E5SA 4EYOA 4ATNA 2XSZA 3UCEA 1U28C 2XVZA 2GN2A 1M2KA 1VYHA 2PZ8A 2B25A 5F78A 5FBKA 2NP7A 3IP9A 1KZYC 3D6NB 4F4IA 3R75A 3VU1A 5IEBA 5FFMA 1P9RA 2PV7A 1THZA 3C14C 3P1JA 3WIUA 4B0PA 3A28A 3FIUA 1JHMA 2OCIA 5DSZA 2WWVD 4KHZA 3V4FA 4CLRA 1XMOB 3DHNA 1KO5A 2BH2A 4I1UA 4EB8A 3ACDA 1LXCA 3T3GA 4A73A 3VQTA 3WYGA 1U02A 2HRDA 4RTQA 3GLHA 4UD2A 4W5RA 1Z4NA 3F9IA 1QS0B 4Q21A 3PGVA 3DLHA 4TKLA 1VP3A 3TBKA 5AHXA 3W6NA 3ZWXA 4GVLA 1L8AA 3JWEA 3OMLA 4EUKA 3SHTA 2BEVA 3QTLA 2UYGA 4Q3AA 1UPXA 1OKKD 2JD2A 3QHPA 3PB3A 1QIIA 5DN6D 2VDQB 3I23A 5BNFA 3PQ6A 4YV0A 1VMDA 3S2YA 3ZDFA 1E98A 5H8WA 1QFXA 1CY2A 3PYMA 4ASUD 3T7KA 4B6SA 4RY2A 2Q5IA 4TTJA 4QU9A 5LWQA 3I6IA 3WRXC 3HY3A 4JA2A 3GZJA 4NHOA 3H8WA 1R5BA 5H81A 3PA8A 3T0GA 3G1WA 4HTFA 2PT5A 1OXVA 2JLWA 1D8AA 3TX6A 2WM2A 1WE2A 4EPXA 4F93B 5IAGA 4M1MA 1RP1A 3HEBA 1ATIA 2I3AA 3OPQA 1YS9A 4NAUA 4RHUA 1PSWA 1LPSA 3RABA 5AQ1A 1DEHA 1M7HA 1IBLB 3FXAA 4JP5A 1AKUA 5KYGA 1QRTA 1FQKA 5AW0A 1UDRA 3AJRA 3CNNA 1XDUA 4BLOA 1H2EA 4LG1A 4Y7CA 4RIIA 1J00A 4KMSA 5TV2A 1GUBA 4L0DA 4AQDA 5HCIA 4YT8A 1JFRA 1UJMA 1FYFA 4EI7A 1AUQA 2VRNA 4LNHA 3OLYA 3PEYA 5DT2A 4GMXA 2HCTA 2ZIWB 1I36A 1SQ5A 1PR4A 3V80A 2Q8NA 4O4IB 1BXZA 3AI7A 4JLNA 1HBJA 3WIBA 1HL3A 4FOSA 4IJWA 2NUPA 4IILA 1FTGA 2BZ0A 3R7SA 4RXMA 1Q77A 3SLGA 1CW2B 3ZE6A 5KQGA 6AT1A 2QBYB 2XXAA 2JVKA 4IXDA 4L3VA 3NOVA 2VZLA 1FFDA 2Q4EA 3FWYA 1FRQA 1BGWA 2QD1A 3AZPA 2DG2A 3F6SA 3O1HB 4GQIA 4Q4DA 4QO8A 2VHYA 4ZALA 3D59A 2ONJA 4F6RA 3O21A 3H9QA 1FNNA 3V8PA 3GT3A 3KU4A 3HZRA 5CM9C 4P84A 3GRFA 1OLSB 5JYEA 1C3OB 2GEDA 3HU1A 3SC2B 5HKKD 2O3TA 2QTWB 1NJFA 1O2DA 1SQFA 4LSWA 2GJSA 4CMIB 1Q1AA 2XZOA 1YIOA 1XCLA 4Z99A 3V2HA 2PUFA 1V25A 4HLNA 2Y9PB 4DWWA 3E03A 4ZAGA 2OHVA 2YR0A 4F5YA 4CMJA 2X9QA 2FX3A 2XMCA 1MJNA 3SBEA 3SR0A 1XN1A 2BLLA 2Q3DA 3TZQA 3WOVA 1AO0A 3EA0A 1EI9A 4I1YA 1WJGA 3T95A 4WA8A 2Q8QA 1CQJA 3OQHA 4L16A 1E3WB 4TT8A 4GW3A 4NMXB 4B9AA 4IIBA 1EQ2A 1EVQA 4OLFA 2NT3A 2FN4A 3OZRA 4RGYA 1K75A 5JQGB 3N5KA 4WZ6A 2VPQA 3VBCA 5K9ZA 4M7RA 1U7PA 2B7CA 2H18A 5JH7A 5CDTA 2W6CX 2H06A 3LX8A 4Q47A 3HKBB 4RMHA 2PNJA 4D9CA 4YCSA 4KRXA 3TF5A 4MIOA 1GNSA 3QI7A 4IXMA 1TJ4A 1PX2A 1L5QA 3DUWA 1Y5NA 1U28A 3B7WA 1Q17A 1TK9A 3PCXA 2IHTA 2JAUA 4DCPA 1KR2A 2VP9A 3TIGA 5BVHA 3RVKA 3LTEA 5L3SB 4UNNA 2H5IA 4BBZA 1NUAA 3KEQA 4JQYA 2WVJA 1XCBA 3GGCA 2CEKA 5CCEA 2IX3A 8MHTA 2ZUWA 3ESBA 5ELXA 3FETA 5DP1A 3UN1A 5IJ0A 3FG9A 4H60A 4MV8A 1UEXC 2VF7A 1DRJA 3JRXA 3OX2A 4PRYA 1I1OA 4JLJA 4OX9Y 3T1HB 4DPMA 3QKRB 2NQTA 1U2QA 4ZVNA 4DC0A 2ZJFA 3GJ8A 1W94A 3WFJA 4C0WA 3DVQX 3DXFA 5A9SB 5CB4F 3ELWA 1OTHA 1QYDA 2JA1A 9MHTA 1PU2A 1QDEA 4OHUA 2JARA 4JJFA 4LI0A 1NZDA 4JX9A 4P7KA 5BQ5A 4RQUA 1DU4A 3PQ5A 3ZHXA 2IEAA 1UDWA 1O54A 2UXCB 3KHKA 4EUHA 5AVWA 3QVTA 4KX3A 2GCIA 3VR3D 3G2NA 3K32A 5FUBA 3LFHA 3IOYA 2GAIA 2JH8A 2NUPB 1L3CA 5AICA 3TSOA 4JSYA 5ALSA 3G5MA 4COKA 2TRSB 4II3A 1DTWB 5EZ6B 3M7IA 1T3HA 4JGGA 1NBEA 4BGEA 4C2UA 4UUMA 2B7LA 4L6AA 4M21A 2EL7A 1QGOA 2PT9A 2BRUA 2C88A 1YRAA 2IP1A 4NBTA 2EKLA 1OTYA 1QPZA 3AKEA 4BCCA 1QIMA 1Z13A 3PDHA 1XK6A 4UE6A 3UPTA 1DFIA 1WW8A 4XB1A 4FSDA 3N6RA 1WPXA 5DXFA 4MUAA 1XE3A 4UUBA 3IOMA 1QWSA 3ER9A 4QYIA 2LV8A 2X5JO 5JALA 1P1FA 4RV9A 1U94A 1OI7A 4WA7A 3ZGZA 3CNLA 3P2JA 1A27A 3CB4A 2PSJA 2Y1FA 3NFYA 4KQWA 4RM3A 4GDFA 4Z51A 4K9KA 4GIBA 3H7IA 5AVVA 1YZQA 2CVOA 4D6XA 3FTQA 3SJZA 3TNFA 1HE1C 3MUFA 3V42A 5CYPA 1H4SA 7MHTA 4EKEA 2CHQA 4IVQA 4KRFA 4LJLA 2VR1A 2E6KA 3COSA 1Y6RA 3JWGA 1Q1BA 4QWWA 2B9EA 2J7KA 1VKOA 2PEZA 4LBVA 5I9TA 4A6DA 4E07A 1VLZA 1E58A 3UQYS 3QEJA 5FOSA 4ZCSA 3E70C 1WZ2A 8ATCA 3FPGA 1UAGA 2XNDD 2HBZA 2OKGA 2C8LA 4HPWA 2I5PO 4RWZA 4BVFA 3GLIA 5ALJA 1O03A 2FKAA 3O2SB 4DR7B 5JSUA 2Y3IA 4YIKA 3NETA 5LQJA 2IA5A 3RHTA 2R8PA 2C5LA 5BRJA 3ZV6A 4O2BB 4C7OB 1E61A 1VC2A 2V9ZA 3D5EA 1ST2A 4F2DA 3IL2A 3KD2A 2WNHA 3FZEA 1W0KA 3EASA 4RX1A 1LRLA 3CE6A 2PWPA 3O8BA 3C7CB 4YJDA 4ARCA 4R40A 2QSJA 4QNRA 4BEJA 4IIEA 1PWXA 3RAPR 3OPYI 3ZE8A 4DJJA 2WSBA 2ZDGA 4TYQA 3RRBA 4EA9A 3V3TA 2V7QD 2QF7A 4JUDX 3PPXA 4IX9A 4KMMA 5FRDA 1A0OA 1M54A 4HNHA 3RK4A 5L51A 3C3BA 1TCVA 4YUZA 2XIJA 1EFUA 1NDHA 3BOSA 5EOVA 5T3UA 5HKOA 3QU9A 4I5GA 3GLIE 2Q7XA 5EZQA 2B7BA 4IP0A 1VYUA 2PR2A 3E0QA 3G23A 1E1CA 4NY1A 3CO0S 5TPZD 4EJSC 3CEJA 1TU0A 6CHYA 2QG6A 1NXPA 1ZGHA 2R751 1G6HA 3ANYB 5LBIA 5EJ4A 1TD9A 5GIOE 5FCDA 3K2IA 4J94A 1UOQA 1ODIA 3B3GA 4X1KA 5JDCA 2WF5A 3NHKA 4CR7A 1X86B 4LC0A 2Y1EA 1CX9B 2EVWX 2P62A 1RYYA 4AB1A 3PFWO 1P0FA 3FTDA 3S55A 4IL5A 5KMGA 2CZCA 3S2SA 5K8LA 1NHGA 1S2IA 2BR4A 3C3KA 3QMMA 4MGKR 3HCNA 2LKCA 5JCJD 2O7SA 1MOPA 2OZEA 3NBQA 3WB1A 5AIBA 4RVDA 2POCA 5ALMA 4ZT2A 2OBNA 2C2MA 4Z1MD 5HCUA 1S8AA 3GBVA 5J4HA 1XLVA 3LPLA 4KFSA 5JNWA 1HR0B 1ZUWA 2X0NA 3FCYA 1Q44A 1TMKA 1IXKA 1AX9A 1TLLA 3ADOA 3LFUA 2J0QA 1WMSA 3U5TA 1B7GO 2FUEA 3ZYCA 4RQTA 1Z6XA 4JWTA 1MIOA 2D7DA 4WJLA 3DBLA 4ID9A 4HRYA 4Z3DA 3UT6A 2ODTX 3DGFC 4RK0A 2HLNA 4QVKA 1UQRA 3T8YA 3R3UA 4KGXA 4R1MA 1D2CA 2NIPA 5CJ2A 3ZQ4A 2LTAA 4ZCMA 5HW0A 2P4SA 2TMGA 5JS6A 1PJCA 2PDAA 3SWWA 2WKQA 2AOXA 4CLDA 4BJHB 2J3JA 5IRCD 4QTUB 4F60A 2JAQA 5C32A 5IJ9B 1Y37A 2PGXA 3I83A 2UZ3A 2ZQYA 4FFNA 3OT5A 4PG4A 4RK6A 4D6PA 1E1MA 4XCQA 4RJ2A 3EUAA 5DHUA 4PXYA 3R76A 2COEA 3Q7SA 1BWSA 4UZFA 1XMJA 5JRJA 2GDJA 5AYVA 5L3SA 1NMSA 2P77A 3PE4A 4P2GA 1A4UA 3D6UA 3EZLA 2P79A 4Q15A 1I6LA 2AN5A 4PG5A 4ZAVA 4IGKA 1E77A 4BLSA 4WQMA 1X3SA 4XFJA 1CT9A 3EXEA 2UV8A 4WFQA 5EKSA 1RMTA 3QKIA 3BORA 4IXWA 1GUAA 3GRRA 5DN9A 2CLEB 2R11A 3F4LA 1EWYA 2GT1A 3KQVA 3MJVA 3R7DA 4R83A 2W2OA 2I33A 3QW2A 3ZE9A 3DHYA 3EY4A 3WK4A 4FC7A 2C29D 4LDAA 4UTVA 2C5FA 3GLFA 2ORIA 3SD7A 4KR0A 1GPKA 5LZ9A 4PW0A 1IXYA 2P0YA 2X2FA 1X80B 4X45A 4GH5A 3K0CA 3H13A 4B3TB 3HABA 3UF0A 4H6XA 4HVCA 3TXXA 1E2GA 1OPXA 4PCUA 4W82A 5BQXA 1T1JA 2CD7A 3UHPA 1ZFNA 4MVJD 5K4HA 1RI2A 3TYXA 4LRYA 3ZIAA 1HZJA 1WKCA 1I3LA 1XWWA 2RGUA 4JMPA 1J2UA 4P5PA 1AKMA 1TKCA 2OAQ1 4MW1A 3VMMA 1ZXLA 4D4GA 1PNRA 1A2BA 1IK4A 4L7VA 4ENRA 4DSOA 4PCLA 1E99A 3I9LA 3BRCA 1Q3KA 2H16A 1ZM7A 1LA2A 3E6AA 1E2LA 5HM6A 4NFSA 1AUXA 2NZVG 4F7WA 2PN1A 4HDSB 3KE8A 1RKXA 5EMMA 4WXHA 4HWTA 3VH2A 1VM6A 4EHFA 1JALA 1Q7TA 3PHBE 3SOZA 1FTNA 1QHIA 1HM5A 1UC4B 3BICA 3HV0A 4MLCA 5GJCA 3BMOA 1AH2A 1SIOA 2D5IA 4DAOA 3ST7A 5ALNA 4CF5A 4E13A 5I4IA 1ECBA 4REMA 4DQLA 3EWSA 1USUA 2HNAA 1X14A 2FEAA 3OF5A 4CTJA 3RM3A 4LE2A 2YFHA 1BWPA 4R71A 3A9WA 1E3JA 4KN8A 5CJPA 4MW0A 3LI2A 1JI3A 1PO7A 2NNLD 4M86A 4NI5A 4AYTA 1FJGB 3KHUA 2PHZA 1W0JD 2XE4A 2GBIA 5DBOA 2YHBA 3TWOA 1T2CA 2VL7A 4ABYA 2PQMA 3D3JA 3KAQA 3VC3A 3NANA 1Q2UA 4DIBA 1WR8A 1NN5A 2XF8A 3HJBA 2DP4E 5LQSA 4C22A 4RTKA 1HEUA 1T8RA 2VDMB 1JTFA 2YV5A 3E2PA 4ARZA 4EEZA 3A0RB 3FTEA 1T6YA 5ELLA 3VAAA 1G291 2FW6A 2Z4RA 1TKAA 3VPDA 3WGYA 3E2IA 1NLZA 3KYDB 4B3JA 4X6LA 1DZIA 3UV7A 3H3JA 1T43A 2VP3A 2D1QA 1LTKA 3KL2A 4CIBA 3HM2A 1O87A 1T8WA 3RYCB 1XEXA 3QU7A 4Q4JA 4AUNA 4MVJA 3L84A 2FR8A 3D1LA 4FX2A 4UTNA 4AY6A 3HCCA 3P7MA 4ARUA 4KQ9A 4EYKA 3G02A 2OGTA 1Y6QA 4UVEA 1NVAA 3REQA 1E7RA 2XGJA 2Y0EA 4CU5A 3NTLA 5FA5A 2RHBA 1RAAA 3C4VA 3RS7A 2ZB4A 3HU3A 5KPDA 4B3XA 5KDLA 2HRRA 1EUZA 2BMEA 4CQMB 4Z4EA 2HTEA 5BURA 3CZRA 3WGMA 2W42A 5JCOA 1XHFA 3RTBA 4BU0A 3FCXA 4A8JA 3AIOA 2BEUA 2JFZA 1GWNA 5SICE 2A9RA 1RLTA 1WXFA 5H1YA 4QGFA 2N47A 4WEOA 3DMPA 1WABA 1KY2A 1M83A 2IYAA 2W93A 2BI8A 1BRTA 1ZCJA 4DQXA 4CEJB 5A0VA 4KO1S 4FKMA 1QTNA 2I66A 2H0AA 3EF1A 3RSSA 2VA9A 2NVBA 3LCMA 3EY9A 4AKEA 3WKDA 5TVKA 4C14A 3STHA 4AYXA 1JDPA 4DHEA 1AKRA 3T5AA 1H0KA 2V7BA 5DYWA 1DPFA 1GADO 3AUFA 5ERYA 5F73A 3UZUA 5KMGB 4NEGA 3HJNA 3RUIA 2P2DA 4U2KA 2QUJA 5DV9A 5HKLA