2KPOA

Solution nmr structure of de novo designed rossmann 2x2 fold protein, northeast structural genomics consortium target or16
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
110
structure length
110
Chain Sequence
MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEGGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords rossmann 2x2 fold protein
publication title Solution NMR structure of denovo designed rossmann 2x2 fold protein, Northeast Structural Genomics Consortium target OR16
rcsb
source organism Artificial gene
total genus 38
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2kpoA00
2L82A 2LR0A 2LVBA 2N75A 5GAJA 2LRHA 2MR5A 2L69A 2LNDA 2LTAA 2LCIA 2LV8A 2N3ZA 2KPOA 4J29A 2MR6A
chains in the Genus database with same CATH superfamily
2GAJA 4JAVC 4CEHB 5AP9A 1KDOA 2XNCA 5LQJA 5AJVB 2BEWB 2IY8A 3FMOB 3Q10A 4LNHA 1H22A 2FWPA 1YBHA 4HUJA 2GCIA 4FVTA 5AI5A 3EVGA 5KQRA 4II3A 4RGQA 3BD6A 4D80A 4IMPA 3EMKA 1IONA 1R0BA 3VHQA 3KB2A 5KB3A 3KO8A 1WPQA 2FEOA 3NW9A 4P5PA 1GU0A 4P5DA 4FSXA 1CUGA 1IUPA 2JFXA 4FNOA 1U1EA 1IBCA 4MP6A 4TRNA 5AUPB 3VR6D 2OC4A 4Q03A 3W2TA 1NXOA 2H08A 2HF9A 4BLUA 1J70A 3EASA 5B2EA 3ZWCA 5B6JA 3FVVA 2EW2A 1TAQA 2OILA 3NDBB 1AF7A 2OCAA 3S2FA 2P2LA 2I1QA 2FQYA 2R5FA 5IAAA 3S1AA 3FPAA 1JECA 1L2TA 5HPYB 2IHTA 4BEBA 2BV3A 2NV2B 2QTAA 3TW8A 2GEUA 2IYRA 4BWVA 4G26A 2VAMA 1WUIS 1KNQA 2HF8A 3CSSA 3D2CA 3RNLA 3LDUA 3ODGA 4D9KA 4QTUB 2ACKA 3ZVKA 5J4HA 1P7PA 1C7IA 5DK6A 3USZA 4F86A 4BBJA 1H5NA 3IPLA 1UF9A 1WMSA 3D6JA 4HLUA 1DJPA 2J3IA 4CM1A 2EWWA 3T4EA 1N92A 4K26A 3JZDA 5H3HA 2OMKA 4O8CA 4DDVA 3SSMA 2GXQA 3S70A 1T36A 2LE0A 4FFSA 5HF5A 1XRMA 1FSSA 5J9FA 3AF4A 4PVDA 1E4VA 3SMVA 2B3TA 3EWNA 3KNZA 4D9CA 3E9MA 4DGSA 3FSEA 3AO0B 5JJKA 3KQUA 3K1JA 2O57A 2XOEA 4G41A 3V34A 1AD2A 3ZOKA 5HNKA 1JIKA 1UADA 3UH1A 1VHJA 3C6ZA 2X0NA 3E81A 3WK6A 2IH2A 2CNKA 4FWIB 2LWIA 4NAHA 2F3RA 5FYDA 3CXUA 3PNBA 5HF9A 1DJQA 1EP2B 1KWKA 3WK8A 3UK7A 1D6JA 3NT2A 1SU8A 2AGVA 2HRQA 2OD2A 3DMHA 3JRXA 2CXTA 1M66A 3ACCA 2Z4RA 4LRQA 2GHQA 2JJ2D 3EULA 3DOEA 4QUIA 3KR0A 5FTWA 4B6PA 9ATCA 3JAMA 1WQ4A 4O3FA 3GWZA 2QUKA 4WN3A 4Q3EA 2QYSA 3U80A 4A26A 2XGGA 4QYSA 1AQNA 1NW9B 1VSTA 1RPNA 1V0JA 2V3WA 3IB3A 4EGFA 3FM9A 1VE6A 3UW1A 3IAHA 1ZIOA 4Q4LA 5I45A 3IJRA 3Q0EA 2GLUA 4RLHA 4YQYA 5B58C 1XMIA 5L6MB 2FN3A 3KYJB 2NTYC 4PYIA 1LRLA 4AP9A 2P91A 1DUVG 1G5QA 1PQYA 3P4UA 4G8JA 4P33A 3DLTA 3LA6A 5ALWA 5E38A 5J5VA 4HEA6 4K1XA 1BGXT 4UUBA 5DNDA 4B17A 4FX5A 4HEJA 4HEHA 1JPVA 3HU5A 3UWPA 2XIQA 1M75A 2GKSA 1X70A 4JK3A 4OBEA 4H0CA 1I7SB 2V6GA 4BXOA 1KFJB 4B3IA 3TRKA 4IX1A 2IHKA 4B2YA 4NEQA 4PQEA 2VJBA 1E6LA 1HG1A 1II9A 3COPA 4TZTA 4YRKA 1JIQA 1Z0DA 5D5HA 3E6AA 4HGRA 1GA4A 1TI7A 3OLWA 4R0NA 2CNOA 1W5SA 3L43A 1ONSA 4WAUA 1J0XO 5L3SA 2OK7A 4YIKA 1U0RA 2JIDA 2O2GA 4FILA 3R76A 2ZB4A 3FNFA 3H4IA 4K6FA 3VU9B 4AZVA 4J29A 3Q0TA 1CQIA 1QRAA 1T2UA 2XE6A 4GBMA 5IXYA 1KO7A 1W87A 2XUDA 4F3YA 4J43A 2W43A 3PFNA 2UKDA 4IH4A 1W30A 5A9SA 4QZVA 5LMZA 2NVWA 1DIHA 2RJ3A 2P9BA 1PDVA 1S2IA 2QX9A 5AO9A 4CU2A 3UJ6A 4ALJA 2CV0A 2EEPA 4DHWA 2KJQA 2IGBA 1GNQA 4IGEA 4GX2A 1B76A 1YRHA 4YRZA 2XLCA 5I4BA 4PN7A 2VWGA 3NETA 2RK4A 3IC5A 2XA1A 4GI3A 4BUCA 4UW9A 5JNLA 1KQFA 2QROA 5LZ8A 1T9DA 1YZQA 3IAS6 3LYHA 1QTRA 3PV0A 4RABA 5I5GA 3CF0A 3K4PA 1X7HA 1AK2A 2NOAA 3DGEC 1G42A 3OX1A 4MLCA 2RE8A 2CLDX 2VJOA 3B89A 4X85A 2PUGA 4N41A 5I7AA 3RRYA 3WB9A 2J7KA 5FL7A 2QPLA 3D8UA 1NXSA 4K9OA 5AUNB 1IN1A 3ORRA 4GUAA 4BX0A 2C95A 5FUVA 2PX3A 1RI4A 1NY6A 1LPNA 3KXKA 4KO3S 5LSAA 3QKUA 1U3FA 2XAAA 4Y2SA 1MUUA 4DQDA 1URPA 2ZS9A 4CODB 621PA 1PJRA 4INAA 3TG2A 1IQUA 4KLZA 3MWLA 5CT4A 1X8KA 1QE5A 1E1YA 3R44A 4DDKA 4EKGA 2FSIA 4P3KA 5AVJA 4QBKA 1JLRA 4XJSA 5FNVF 4EFMA 2QX8A 1E3DA 3L4SO 4BZWA 4DLYA 4LSZA 3SP1A 4LRTB 2EF1A 4TS4A 4U39A 5ALVA 5EJ8A 1Z7WA 3OG9A 2XCTB 3CKYA 1USWA 4DCTA 3FF1A 4Q1BA 1VKNA 4ARZA 1XHEA 2R48A 2LCQA 1FFXB 1H65A 4EHJA 3U7HB 2X2EA 4ZOQI 1DBSA 1KYYA 4K5QA 1V4NA 3CX3A 3I9V6 2XB2A 4C0SA 4KNYA 2CLCX 4CLRB 3BK2A 3X44A 3PVZA 3FYUB 4NHOA 5BURA 2ZUVA 1JR2A 1PZEA 2BGKA 2QPTA 4WOJA 5THQA 3WLSA 4BRWA 5K0NA 3QJ5A 2PQMA 1LBSA 1UJBA 5L7TA 1NULA 5FRDA 4B1FA 2ZREA 3EISA 4FHCA 3CIFA 2E5FA 4NQZA 4KQ9A 4RVOA 1R6TA 1CB0A 1J97A 4D79A 1DBPA 3KB1A 3NYQA 4TWIA 3NATA 3VH2A 1DE0A 4LNUA 4EHDA 2EYQA 1RXIA 3A14A 4G9EA 3SKVA 4K3VA 3V8RA 4F12A 2OGWA 4YO8A 2FUKA 4GEKA 5P21A 1PR0A 3ILVA 4YHBA 4TYNA 1FA9A 3GJRA 1JFRA 5K8LA 1NLFA 4I5EA 1IBKB 4TYPA 1WL8A 2GGSA 2G36A 3IE1A 2EQ5A 4CIYA 3PUHA 3REOA 1F1BA 1A9XA 3JQ6A 1NC3A 3D6VA 4FQ5A 1Z0SA 5B36A 2XF2A 2VPWA 2CL6X 2VATA 4LMAA 4WCFB 4C9BA 4MYRA 5TXGA 2XHEA 3T1QA 3FVRA 5KJ1A 2H16A 4M1KA 3IMEA 5AI6A 1PN3A 3NRCA 3S2YA 4F3KA 4HUQA 4QOEA 3MS7A 3CVOA 5FPHA 3RU9A 1VI2A 3FZYA 1OZFA 2IU4A 1NG1A 4RF4A 2XVMA 3HRIA 5EJ7A 2XW6A 2QRQA 1U2PA 3E58A 4QGGA 4H27A 1E7WA 2G08A 4G8CA 3ZWXA 4AN0A 4JQZA 2AJCA 3VZDA 2JFFA 1GAWA 1T9HA 3W6ZA 1CZNA 3UC9A 1HZZC 3KVYA 3L8CA 4MEAA 4EJSC 2J9FB 2QTLA 1GADO 1SHZA 1XAGA 5IEBA 3PJEA 4Q7EA 2NO9A 2I8LA 2VXYA 1G5HA 1LQ2A 1PL6A 1W75A 2LKCA 3Q12A 2PZKA 3GHHA 3IQXA 3P9QA 4IWYA 3U1VA 1ZZGA 5IK2D 3BMQA 4R9RA 4ZA2A 2BD0A 1O0BA 1ZX1A 1QYCA 2Y71A 4EHBA 3LVQE 4W5HA 3COZA 1LDNA 4LC1A 3UGKA 3ZPXA 2ZIVB 4F56A 3LJKA 4TLDA 2IXTA 1VLQA 3R23A 3FLMA 4JENA 4L7QA 4J16C 3MIIA 3ZUGA 4RD6A 4PG4A 3P52A 4IVPA 4X3OA 1EX9A 2PAFA 3G17A 5CXXA 3W4IA 4DCUA 1ZI6A 1UOQA 3CZRA 4GBED 4EQ6A 5AOAA 3SX4A 4MW6A 2ILVA 2R4QA 4B48A 3RSCA 3UB2A 4COOA 1OFIA 2QDXA 4YRTA 3PGKA 1NXQA 1ZUNB 1D1PA 3TIFA 1QC5A 2BGUA 4Z4EA 1OT3A 1SJ9A 3KRTA 3AY7A 5AVZA 3PFFA 2IYFA 3N8DA 2YWFA 5CJ2A 4FB5A 2C5AA 5BSEA 4JGBA 3ZW9A 1JEOA 2J3HA 1RZUA 3JX9A 1M67A 1YMUA 1E0DA 5HIJA 5JPIA 5J3JA 4ZMRA 4Z4HA 2WSYB 1Y6FA 1FJHA 3JVIA 3GPBA 1P62B 4MW5A 2WP0A 3FOWA 3ENZA 3MCZA 1HFEL 2C9YA 1HUQA 1NKTA 2EARA 2LKDA 3DBLA 4OL9A 4P34A 4NMMA 5IAGA 3CFYA 4OATA 3VHLB 4ZU3A 1L1EA 4TT3D 2FRXA 2ZU0C 4GLBA 5KNCH 4LDJA 5HUQA 3I5UA 4IM7A 5HDBB 3QA9A 5A04A 1JEEA 5JH7B 4FWBA 5FTJA 4W9RA 4Y18A 3HO1A 2JBAA 4FNAA 3ADCA 4F60A 1C8LA 1GNRA 4DR2B 1ZGJA 3MT8A 4TS1A 1YOVA 3W4KA 4LIPD 4Z1MA 2H52A 2CWDA 3CUEF 3IEVA 3ETDA 3B1YA 1BMFD 2JAQA 4BCBA 4DJJA 2OORC 4CKYA 4QXQA 1YVEI 4TT8A 3KALA 2ZDGA 2Y6VA 3ESDA 4BCCA 2Q4DA 5TT0A 1JIJA 1DIRA 2VTVA 1GIAA 2HIMA 3GDOA 3UVEA 2JGRA 3PGXA 4XPIB 3W9YA 1YR3A 3MCVA 1QRRA 4MWOA 1PFWA 4TV9F 4OD0A 3UV6A 4FS3A 4U00A 3OBBA 2LIVA 4B4DA 1T2AA 1IM5A 1BTOA 3ONNA 4EJ6A 4EKDA 1BFKA 1YZVA 2H00A 6Q21A 3HC7A 4W7HA 1U4SA 4D26A 3WO1A 4O33A 1TQ2A 3U4HA 4BRUA 4JUIA 3D43A 2E87A 2AFIE 3SICE 4AAYA 4D8UA 2R7MA 3I6ZA 4LHEA 1G7CA 3AL0C 2OAGA 3GBVA 3RUPA 4FE7A 2EKLA 3JATA 1Y9JA 3L7YA 1JTFA 2Q5IA 2XXBA 4FN5A 4GSYA 4C29A 3AR9A 5DT9A 3A6KA 3INGA 8ATCA 3W8RA 3ZGNA 4JP1A 3VUEA 2VYND 4F4IA 1ENOA 5HQ3B 2NVOA 1D8AA 2EDCA 2O9JA 3E82A 3NQ41 4PLTA 2IUYA 3C3YA 2VBIA 2IIBA 2DTXA 2PBZA 4JVNA 1T9AA 4QDKA 3RABA 5C4IA 1RLIA 5D87A 1JL3A 2ZJOA 4MP8A 4AN1A 1R4AA 3WGUA 1IOLA 3EXIA 4MQMA 1G55A 3AHFA 3ISJA 3O47A 4ZT4A 1S7GA 1J24A 3S7TA 3HBNA 2FF5A 5K45A 1KYWA 4MKXA 2ZZKA 2WVHA 3FD8A 2DY0A 2J09A 1GV0A 3PGLA 4F1JA 1M0EA 1XQ9A 4ZOLB 4ZCTA 3GVXA 3HNPA 1RQRA 2VEDA 3BGWA 3U3RA 3QELA 4HTAA 3WTBA 3W78A 3VH3A 3KKMA 3ROEA 3WGLA 5CFPA 7REQA 2CW5A 1O94C 1UFOA 1F4LA 3OX4A 6AT1A 5C8DA 4NY1A 2RGYA 3MSCA 1WCWA 3VPGA 2QRGA 1F6WA 1QO9A 2ZI5A 3UUEA 3R7BA 1TZMA 2GD0A 2HN9A 3FHTA 1QPGA 1F1JA 1N5JA 3VKVA 1TC2A 1H9CA 5C1IA 1WULS 4CL0A 4CHTA 2JHGA 3WYBA 1FS5A 2N3ZA 5JQGF 3S5JA 3JYHA 2P9ZA 1AGXA 2QR3A 3QENA 1PKEA 1T1RA 2UYOA 2ZE7A 2ZYTX 3ASZA 3QX7A 4IIBA 1HM5A 4PNPA 4L02A 1DKNA 4Q01A 1ATIA 1F2TA 2JAOA 3CQ9A 4Z0TA 3R9WA 3UENA 3BCUA 2FEPA 3OE1A 4DLTA 3EOBI 4LQLA 3U13A 1SVNA 1H9AA 3ELBA 2Z3VA 3W3AH 1UBFA 5CEFA 1GARA 5DM4A 4X62B 1EWQA 3LC0A 2OCKA 1GKUB 2FFQA 2PRYA 3WL7A 4DSOA 4US2R 1WXWA 3E48A 5GIPE 5BUCA 5LCXA 5BUZA 3CNBA 4RTOA 3QEMB 1YJAA 4KBYA 5JOQA 1WXXA 1ADFA 4RH0A 2VXBA 1A9PA 4BNTA 2P2DA 3TNLA 3WSTA 3WKEA 3L05A 3A2KA 3E3OA 4PIVA 1A71A 3I30X 4CIAA 3M6FA 2HLNA 1GNSA 1VYHA 2GK4A 2ZJ1A 5B57C 3UC5A 3L0DA 4C5AA 3E03A 4PPFA 1M2KA 2NM0A 4NH0A 5KNDA 4X65B 5AUOB 2IPOA 1NW5A 3DOIA 1C9KA 4JYCA 3ZWWA 1E2LA 1CU1A 1JILA 4BFLA 4MO9A 4DIUA 3AFMA 2NPIA 3NHYA 2O4UX 1PFKA 3DULA 2COEA 2XUIA 4MS3A 4TMXA 3GX1A 2ONKA 4BTVA 2XNKA 2PD6A 3B36A 1NVMB 1O03A 1FU7A 1L1FA 4LCEA 3WA6A 1WLSA 3ZGVA 3KD2A 1RTKA 2G3YA 2QVLA 7AT1A 1UMCB 4IUCS 5JU6A 1QU3A 4EI2A 2DZDA 4ZV4A 1LSOA 3H3JA 1M76A 3WK4A 1DRWA 2GLXA 2VSNA 2R84A 4YH1A 3UJ8A 4CM6A 3V4RA 3P2YA 2MSKA 3TQQA 3CLVA 2A7XA 2VPZA 2V55B 2VCEA 2ZE6A 3IFSA 4BHTA 4B3MB 5JNSA 4ZRNA 1Z5PA 2ZZNA 2QZ4A 4KPUA 1E9SA 1MJNA 1SCUA 1HQYE 1NDQA 2AC4A 2V7BA 3OZWA 3L0IB 1S2LA 5JTTA 2CXSA 4HZUB 1SVKA 2IYXA 4YPOA 5BYKA 3OUZA 3PXBA 3HDGA 4Y6GB 2CD7A 2Q5OA 3UXYA 1V1MA 2VDWB 3BQMB 2XWPA 2OQIA 2V4ZA 2YCBA 3C98A 2QG6A 3Q7RA 3TPCA 4PTLA 3COVA 2XE8A 1Z4OA 2WFLB 3KUXA 1Y5NA 1OYYA 3G89A 4I14A 3ZV3A 2GYUA 3ME5A 1IBLB 1QCZA 1H8HD 4EHIA 4RTLA 2ODNA 1DELA 1SD2A 1U9ZA 2HEGA 3N6VA 1Z4IA 5HP4A 1D4FA 1PAUA 4P86A 1L4MA 4MUHA 1P2GA 3CV3A 1Q7RA 3IQFA 5E6RA 3BZUA 5TNXA 3SK0A 5J5AA 2XXAB 3HKDB 2BCGY 1Q44A 3H9CA 4AYXA 1XF9A 2PUCA 2GEJA 1R2QA 3PTZA 5FPQA 5KTYA 2AXNA 4RZUA 1Y9DA 1U0EA 2V6BA 2WYVA 1IPHA 5AHOA 4I4LA 1JR3D 3IAEA 3JQ7A 3C3PA 2WWTA 3UWDA 5HGXA 3BXOA 4LZLA 4RKWA 1BXRB 1VG9B 2BLLA 4HY3A 3ZBPA 1YB2A 6CHYA 1PJLA 2PRZA 1ARZA 3P2OA 4NBSA 4Y2VA 2H4WA 4F3NA 4KDEA 1S4MA 2A14A 3E8XA 4KAXA 2GBGA 1D5CA 1BHO1 1VPVA 4R2KA 4BO6A 4Z7JA 1A8SA 2DQ4A 2W37A 2YY5A 2XYGA 3HY3A 4UM9D 3JQEA 3TSOA 3EPJA 3DDCA 1T9ZA 2V6IA 2JFQA 1PWEA 1PZGA 3EW7A 4L27A 2O3QA 2RAPA 4NDAA 1XMVA 4TTSA 2P4UA 3BMOB 2ZYSA 4QNRA 3DMTC 2IV7A 2ZVPX 1QHHB 2EJVA 3IUSA 2PNJA 1I32A 1KI9A 2V45A 3HKBB 3IPYA 3VBCA 4B47A 4LOKA 1Z63A 4POOA 1X80B 2VDOB 4NV3A 3ANXA 4BGIA 1CVRA 5GADl 1W36C 4KXWA 5C32A 2QHXA 2QNIA 3C3DA 5IEJA 3FTNA 2J07A 1ZL0A 1XROA 2ADMA 1C8VB 3SX2A 3HYSA 1VCOA 1HE1C 3G2PA 4FW9A 1D0SA 4IDCA 4NR0A 4L5JA 3I73A 3SYKA 4DDHA 1USGA 4KN9S 5LOVF 3UAGA 1PR1A 4Q82A 1YQUA 4JI4B 3WYFA 3PJFA 2R4UA 5C46F 1DKPA 5LZ9A 1YBMA 2QMOA 4O08A 4BX3A 4YPFA 3JD3A 2BEVA 5JADA 4CR6A 4HTFB 4X8OA 2IYWA 5EHNA 3EXEB 4RVCA 4YLYA 1RPZA 1FNMA 4C7OA 4BFWA 2H17A 3DVSX 4DMLA 1CHNA 5EUBA 3VR1A 3KBBA 3RYHA 1A7AA 1BWSA 4O2AF 1XL1A 4NABA 4QBHA 4P0QB 2VNIA 3R24A 3OAAD 3UJCA 4UHHA 3MILA 4ZEXA 1J4AA 2FB9A 2PQ0A 1WVMA 2C78A 1RRVA 4H6WA 4DOMA 2J0VA 3S4YA 2QE7D 2HWYA 1UEJA 4ZTBA 4I5FA 1V2HE 1M5UA 2XCUA 3OQIA 4TLMB 3O75A 3T5MA 2A0FA 3H7IA 5C8ZA 1P7VA 2C04A 3UMSA 3VDQA 5CCXA 3IKMB 1F7UA 2PANA 2GEDA 4R1SA 5CR9A 2XUAA 1JR6A 5LA6A 1NVKA 3I01M 4DCMA 4US1R 1OBCA 5ER9A 1OGIA 1CQZA 1I3MA 2I4TA 3LD9A 4K05A 3DKIA 2NVBA 3M4ZA 4EL0A 4YXFA 2OYSA 4HAWA 2WTXA 3K9QO 3W2GA 1LRJA 3B1WA 1YQTA 3PDWA 3LA8A 1G8MA 1UK9A 1XHLA 3C5CA 3H11B 4MINA 3DUFB 5AXBA 4M76B 1W93A 5CA0F 2RHJA 1PSZA 3ZTTA 2IHBA 3UB4A 2POQX 3PUYA 3L9WA 1QMGA 4M98A 2PR2A 4QARA 2BE7A 2CLOB 4W1SA 3VGJA 1RSZA 1XJCA 2AFIA 1LV7A 4R2IA 1JBEA 3SZUA 1A9SA 2JFOA 5ECYA 1LW6E 5BN5A 4PEVA 5K0GA 4NNOA 5HW0A 2YTZA 3OLXA 1EFVA 1WCIB 2HF7A 3AF6A 3DXFA 1Z82A 2ZYUX 2IYTA 1A77A 1ODJA 1NNUA 1RPTA 3BL8A 3NBKA 2RAVA 5CT5A 2PKQO 2ONJA 3ZWMA 2HNBA 4LJAA 2GPWA 4YUVA 1FDVA 1RJWA 1W1WA 2RB4A 4C1BA 3QVVA 5ELMA 3C7CB 4W6QA 3WRYA 3PEEA 3T7AA 3VFDA 3D3WB 3GVCA 4U02A 3G0BA 3VYUB 3ZCVA 4JITA 3NX4A 4TXLA 4BNGA 1EPUA 5IARA 5JFOA 4BFSA 2EBWA 4ZVNA 3OZFA 5JI3E 3LQ1A 2YWJA 5MHTA 4OIFA 3IOBA 1CJTC 3K5HA 3TXAA 3UO8B 4P7GA 2XGSA 4V3BA 2DB3A 5J1TB 1VBNA 2PX8A 2V54A 3LDGA 4GOND 5KSOA 3RV3A 4FR2A 3H04A 3L77A 2YXEA 4U8GA 3T3NA 3CE9A 3AB7A 4MO2A 2E4VA 3Q8WA 2H65A 1QYIA 3CCCA 3DXZA 2XNJA 3BDAA 2WWXA 3MRVA 1E1NA 3K9FC 1UOOA 3MSXA 2IZZA 1OI7A 2JLSA 3LUAA 1GL7A 1MJGA 3G85A 4XUGB 4IVRA 4BMNA 1IHUA 1RIIA 13PKA 2HQ1A 3PR3A 2E3JA 4EHAA 2DFPA 4L08A 2EKDA 2ZIXA 2QRZA 5CCBA 3PE4A 5K5EA 2LNDA 4D8YA 2VH1A 5DLQC 2EV9A 4OKIA 3FTEA 3U5ZB 1KIMA 4HAYA 1Z2AA 1D2EA 4LK2A 4MCHA 4TMFA 4R5MA 2BGMA 4I1YA 1ADJA 1NW3A 2D8MA 5G4KB 1K0UA 1TT5A 3GZNA 1E1MA 3M5CA 4LRYA 4PXYA 4UU8A 1UEIA 2NXCA 2OG2A 3JY6A 3P9PA 2A88A 4PNZA 1EDBA 4AJJA 2C0CA 1HNXB 4R1MA 5CAEB 2RGCA 1RXWA 1I9GA 1QAQA 1KU6A 3GOHA 3IQZA 4L9AA 4BPRA 4LBWA 1ORHA 2AN4A 1CSEE 3DHNA 2PGNA 5CEJA 3DT8A 3H9BA 4CL8A 1E7MA 1N5KA 4WEOA 4YX9A 5JYCA 1Y3CE 3KSZO 4L5IA 1HZJA 4PBRA 5GONF 3SVZA 3OURA 5F1KA 5K3CA 2I6XA 1CEXA 1EU1A 1QHEA 2SNIE 3A1VA 4D8VA 2HCTA 1PIWA 4XWWA 3QX9A 3KQTA 1JS1X 3P71T 4AKIA 2YWXA 4YV0A 1KEZA 4PAWA 4TKVA 2UUPA 3COYA 1C9DB 1JTVA 4RV9A 3KVOA 4NAVA 5JMWA 3ZQUA 4MQFB 2WVJA 1KE2A 1OYOA 3LPAA 3MPOA 2CUKA 2W00A 4YCLA 3WK7A 4ZC8A 1P9RA 4MGIR 4L9SA 4LXIA 4LC9A 4J0GA 1L5HB 1DQZA 3QVUA 4JA0A 4NQRA 1E8DA 4AC9A 1H4SA 1V3TA 1PR3A 2W2KA 2X6TA 3DDZX 3SEAA 2QZ9A 4YBRA 4JL6A 2Q4OA 2NZJA 3AFGA 5COAA 3T94A 2HF2A 5FXMA 1HK7A 1Z8DA 2QM3A 3G6KA 3I5MA 4IXDA 3MRXA 4X6XA 3REQB 3NDJA 3SQMA 3T4XA 1XJ5A 3H65A 5EIWA 1QF7A 1SZDA 4IGKA 1PL0A 1X3LA 5A1TA 2C99A 3HUFA 1JFLA 4OVKA 3OQ6A 3DLIA 4BU1A 3RF7A 1BCRB 3Q8KA 1U0GA 4OGLA 2X6QA 3IB6A 4BMCA 5I9SA 4ZO9A 3PQ5A 4A27A 5IT4A 1YCGA 4UVDA 5JXWA 2FUG6 3VPXA 2IZ7A 3NTQA 4Q9DA 3QVKA 1W35A 5B4VA 4BJ6A 1TJPB 2V9ZA 1RRGA 2OO5C 3BIFA 3CZMA 1Q7CA 3OPNA 1MEOA 2HJHA 2PCLA 3DFKA 3IVRA 5CPBA 3ZEIA 1EJ0A 1D07A 5FLKA 3MJTA 5EMMA 3KJQA 4HAXA 4A0GA 5KDOA 4HB0A 5KYKA 2WHYA 3Q1KA 4LFAB 1QS0A 1J49A 4K6HA 2YH2A 4OQDA 1YB1A 1TPZA 2ET6A 4UJ5A 1TQDA 4YTEA 4AJLA 4BAGA 2NSDA 2ZR9A 3JWHA 3L93A 3QPBA 2PE5A 3EPLA 4YS6A 3IHTA 1WB9A 1NUSA 1ESEA 3GZJA 4EJ0A 1DAEA 3CO0S 3K0BA 3RLIA 1KZ4A 5FLYA 5JZSA 5K4GA 3WLQA 3WRXC 5TARA 5AYVA 1CUYA 2IHVA 3QEAZ 1JLSA 2OFWA 2X4LA 3R3XA 2V6MA 3HVUA 3N7TA 2FPSA 1N8SA 4G0NA 1PQPA 4MVJI 4W9MC 4OA8A 5EC8A 5EPOA 3AR8A 5CDUA 1ZMOA 3VOSA 3DCYA 1L9KA 4MYSA 5AHWA 1D6SA 1PZXA 2C4HA 4IRXA 5FWXA 5EJGA 3A58B 2AJDA 4WV3A 2PQ6A 1JHZA 1IWOA 2RHRA 5EHGA 1HDRA 2VTBA 1Y1RA 3FOAA 3UHAA 3IAFA 1RQLA 2DPYA 2VHYA 4AMYA 3HJUA 2RAUA 1U2ZA 2ATIA 1GKLA 3EG5A 4K3UA 4EG0A 3PJDA 1CC1S 1J42A 3OE7A 3SQDA 5EZYA 2QTHA 3VOAA 2B1GA 1YDHA 4IICA 4D3YA 1SVOA 4DG8A 4NCBA 5EKXA 5HTKA 2EJBA 3ETHA 1UZAA 1WW2A 3WYGA 2X8JA 3FGZA 1W4ZA 2OZLB 1Y9ZA 4UC0A 1U2DC 4CGYA 1QYWA 2BEUB 4RC9A 3ZJTA 4MTCA 4LZOA 3SCZA 3R9XA 1TJYA 2VRWA 3U62A 2P5SA 1BQ4A 1J8QA 3NYIA 2QSJA 4KN5A 4AN4A 4BVLA 3N9IA 1N2OA 1QGUB 2D7CA 3F2VA 4BP1A 1DDGA 3RFXA 3DEAA 4IGFA 2FFHA 4NG5A 1D03A 3A27A 3AW9A 3L4BA 3V5NA 3W5SA 4RS3A 1ST3A 1SK9A 4QUEA 4URWR 5UKDA 4D8WA 2HWXA 5C37A 2RHLA 5T4FA 3MB8A 5JAZA 2E4ZA 4XUEA 1UK8A 3AEUA 4Q3OA 3F6PA 3QWHA 4NRDA 5ARCA 3NTOA 1N6KA 3AEKB 5LYJA 3ELYA 2RGWA 1JNXX 1ZK4A 4NMWA 3BN3A 3TBHA 2G6TA 4CMKA 2V1UA 4QXOA 1M1ZA 5BW6B 1B14A 4LF7B 5FO1A 1ACJA 4A73A 3NOXA 4IY1A 3KJNA 3OZGA 5DXJA 1JGTA 3RHZA 4KWEA 2CDAA 3SF8B 1CULC 3CEAA 1B4DA 3ZY2A 1OWNA 2RAFA 4D98A 2BPOA 3J7TA 1K5GA 5LXTB 4EL5A 5KYUB 3UKDA 2I2DA 3I8XA 2C2ZA 3BSSA 1ZJWA 1ZICA 3U7EB 4NZOA 4IO0A 4D56A 5HR5A 1L8AA 16PKA 5L3ZA 5LU8A 3TQOA 1RE1A 4WVFA 821PA 3PEUA 2M1XA 4GZ3A 4TUYB 3WFIA 3STXA 1U9CA 1F14A 4FLEA 2WG2A 4LYAA 2PV7A 4XGNA 2OC9A 3T52A 5HQJA 2BFBB 4I6EA 1J8MF 4I5DA 2FVYA 2PWZA 5ESDA 1YHYA 1HE3A 3LZDA 2VTKA 2VIIA 4JC8A 1OU4A 1GUYA 1YR6A 3EVDA 4BBAA 4YJ2A 5BQFA 3KQKA 4P53A 5KVSA 3BSYA 4E5UA 5T57A 3BMNB 1XZAA 3F90A 4OB8A 3C7DB 3T1TA 4EM6A 3JAKB 3EMDA 4QASA 4UCFA 2QRVA 4JKIA 5BYJA 4MAAA 4PBSA 3ROXA 1YAJA 2BFCB 1A5TA 1QDLB 3UF0A 3H3XA 2C7QA 2C82A 2Y2UA 3BKXA 5FEUA 2WSBA 2HSGA 3GIWA 3STTA 5JLJA 3EVCA 3AUFA 5COBA 3ADKA 2QJOA 1J8VA 1G63A 1K6MA 4H2DA 2QIPA 2PXCA 4KFTA 5BV2P 1CKEA 2C92A 1T25A 3CUTA 3FPSA 4LEIA 4XGQA 1GPYA 3JSXA 1F5SA 2JD1A 2QP4A 4BNVA 5E7MA 4ZFNA 2HPHA 4BBZA 1Z5ZA 1ONBA 4HKTA 4JR0A 1Z0JA 3H2JA 1AUOA 1I2AA 4KGXA 2EX4A 2VJKA 1QQTA 1P73A 3EQ7A 4ZICA 2J0QA 1VI5A 1RZ3A 4WFIA 4WGFA 1E5TA 4EG4A 1G3IA 2FZGA 2RI6A 4G5SA 3VYRB 5HKOA 3RSOA 5FUXA 3Q87B 1JDSA 2EW1A 3W8NA 1SUIA 2YV3A 4LY9A 4W5JA 3G3EA 3I6IA 3HDQA 4KSBA 4MWBA 2PDAA 4P5EA 3WLNA 4JXXA 5HF8A 4ZO8A 3L7NA 2EU8A 3R0VA 4YMLA 1M7BA 1NKSA 2UDPA 2MR6A 2AEFA 2FMUA 4DWOA 5BXQC 3OCUA 4HAUA 5AT1A 3UT5B 4PZLA 3ITNA 1FS4A 3AKYA 3GH3A 4OBBA 3U17A 5EINA 1YL7A 4C0KA 4F97A 4I55A 3F46A 4XD7A 4RVDA 3A9VA 5IVIA 3H0KA 3AHHA 1NW7A 2NO0A 2VYNA 2J46A 3RRNA 3W2FA 2O23A 3IYLW 5DP1A 5HG0A 2B1JA 4TROA 3T9DA 2F1IA 3NCTA 2Y1GA 3L8GA 3LWBA 3DKPA 4E14A 5IYZA 3LX5A 4CT5A 3G1WA 4ZODA 1NP3A 4TPKA 3UKJA 3ZXXA 4DSNA 1V5FA 3O92A 1KRHA 1ZIXA 4MJXA 4AJEA 3RNOA 2JLQA 4YC7A 3LC2O 4HB2A 2YHIB 1LI7A 5CHEA 2P2GA 5KPJA 4BKUA 2N42A 4HQRA 4LOLA 4YRSA 3KSAC 3A1SA 3HCAA 2AOXA 4LGVA 3KPYA 1RHRA 2WKRA 3BGSA 4XX0A 4F8JA 2HLDA 1RXYA 3IO5A 5AW5A 2XGOA 3GFVA 2P9YA 2ZJ3A 1KFEB 4YP7A 2JIZD 3WNBA 3ZGXA 4YRFA 3SJBA 1LK0A 3LX6A 3N59A 1Y3FE 3SYRA 2WZQA 4UASA 3SC4A 3LT1A 2PKXA 1Q7BA 2XF8A 1L5QA 3TZBA 3TX6A 1DJLA 1T1SA 4BKPA 3G2OA 5AJWA 1ZRHA 1EAYA 2OBYA 4PNEA 4EA9A 1G2QA 1R6AA 3UAWA 1K6JA 1NJSA 2B98A 3EAQA 1HLGA 1NY5A 3OJLA 4ALKA 3RWOA 4EJSB 5JRZA 5E6UA 3MJVA 4AM8A 2FEWB 1NRWA 3PD7A 3ZI0A 1THGA 2CF6A 4H3VA 4OHOA 2YWEA 3AIOA 5G0TA 1YVUA 2GXUA 4B6EA 2WHXA 4RTRA 1U7DA 1Y1SA 3BH0A 4G4GA 3H0CA 1OH8A 2D4HA 2AR7A 2PKEA 3W0LB 3BBPA 4NJMA 3LY8A 3W6UA 4O1HA 5EMJA 1V1RA 4II7A 1DCMA 2VQ6A 1OJ7A 1J07A 2C9CA 4JMLA 1LNZA 3QTLA 3PHGA 4FOPA 3GFGA 4W63A 4YCCA 2Q49A 1EDEA 1XZBA 5JE8A 4Z0HO 5TGDA 1CF4A 2Z4TA 3KTAB 3PE6A 2L19A 1UJ2A 1LTKA 2X23A 5CFZA 1UBJS 2R8XA 4EJMA 3JARA 3L4JA 3N0XA 2C5EA 2HM7A 2PTGA 3M1LA 1GPMA 1O4WA 4QT4A 3TUIC 1XVIA 4JB3A 1G8GA 5THXA 2VRBA 5EXDA 3RIEA 3S0JA 2X4GA 3WBFA 2GN4A 3H97A 3NUGA 4CMAA 5ICCA 2C5HA 1U7PA 3AC0A 3GGDA 5FQNA 2K5UA 5CMLA 2JHCA 3TKAA 2A9FA 1CT9A 2PD3A 2X19A 3BHJA 3PC3A 3R75A 1ITZA 1YQQA 1JN0A 1HKUA 1T6NA 3FN4A 4ZT6A 1JDJA 2DECA 3B3GA 3DFFA 5ALSA 3L7KA 3H13A 3P27A 4DTIA 5T8KA 2IIVA 2WI8A 5EE0A 1D4AA 1I2BA 1PX2A 1RT9A 2HA5A 1QKIA 2OQ2A 3ED1A 2FJUA 2WSSD 3NWOA 3GWGA 1WSDA 3Q0IA 4G8BA 1GGMA 5E1DA 5H68A 1ECGA 1MIOA 2GCPA 1UBLS 2BH9A 3D2LA 3DSRA 3FJ1A 5EWLB 3WWDA 5F7OA 2CLIB 3EAGA 4RJJA 2DE0X 4JLOA 5E7JA 3JD1A 4OMUA 2WHEA 3AP2A 4OOFA 2FW8A 1NX6A 1XYVA 2BP7A 4ZYYA 2OSVA 2M6LA 4CQMD 1B0UA 1EGVB 5JS8A 4C43A 1NX9A 2D1QA 3SHQA 1EZ4A 3CE6A 4IDDA 4RTNA 1B93A 3QKRB 4PHTA 4MWCA 3U7GA 1XD9A 1E6CA 1GGHA 2ZRIA 4MV4A 1DINA 4B6RA 4RL4A 2WIBA 1U4NA 2EWVA 3UMJA 3HJCA 3FLBA 4FGZA 4BFZA 1SG6A 3RANA 2HPAA 3O8BA 3PR2B 2ZCVA 4PAOA 4XE5A 2CY0A 4QVIA 1IRIA 1FSFA 1C9MA 1QDUA 1AZWA 1NJ8A 2PLFA 4BN0A 2GM4A 2V9PA 1B00A 1JR3A 5A3VA 3U3OA 5A4FS 5C1PA 2QD2A 3PNSA 3UEOA 2VR1A 2G88A 4DGQA 1L5LA 1BXGA 2AFHB 2OV1A 3V7FA 4B3DA 1CQJA 1Y1LA 1NN3A 2I6FA 3R7NA 3MM4A 2FDCA 1DQYA 2WWIA 3EVAA 3LLVA 4J1SA 5EE5B 2YBEA 3AGPA 2TMGA 1XCGB 2PFGA 3V1KA 5F2KA 2QPAA 2Z1MA 3GMSA 4H1TA 4CKEA 1J1ZA 4FZ5A 2MWMA 1GTL1 2VHXA 5FA6A 3THYA 3NM4A 4BDSA 1E5QA 5JZ9A 2Q6KA 3EUAA 1PT7A 1PTKA 4ZPJA 1LQTA 4IQ8A 2BMEA 3K9CA 1EJBA 1Q50A 3HFRA 3PRKE 4KK3A 2WT4A 4RL6A 4W8HA 4BN5A 4C0JA 4K0KB 3KOMA 1CV2A 3M6MD 3OM1A 5TEVA 5C51B 1T8RA 2XT0A 2FV8A 1C80A 1P5FA 1ZYUA 2WJYA 3C39A 2X2FA 2BGLA 5ICEA 1H2RS 1RMTA 4NOLA 5D5PA 1WZIA 3IAM1 1XZKA 1JQ5A 1IZ0A 1ZK1A 3V4FA 3HV0A 3O90A 2PS1A 3O1LA 3K5IA 4WOBA 3LT0A 1P9NA 3PTAA 2XQGA 1XTBA 2ZRQA 2F8MA 4MYDA 5IKEA 5KMGA 4HZIA 5DOZA 1ISFA 1QG6A 4YJHB 3WS7A 3NRJA 1TVKB 1HQDA 3KLBA 4IQGA 1R9GA 3A26A 2GOYA 4WDQA 3VZQA 4DV3B 1HQKA 3JZAA 4PRYA 3JQ9C 1QHSA 4MS1B 2ECQA 4GI7A 2X3UA 3F78A 1DAFA 2J5QA 5AHKA 2GCOB 3MOGA 5H80A 4OIMA 5I8ZA 5CFMA 3TZHA 4CJXA 3O8LA 1O6ZA 4DFDA 1HOXA 3ANTA 4NYMR 4DABA 5K20A 5FOVA 3O7MA 3KJZA 4U2FA 1P0QA 4C4RA 3OICA 1B41A 2GERA 3OETA 2I4IA 3PUIA 5JDCA 2FEMA 3VU8A 1QG2A 1GZHB 1GZ5A 4DA9A 3T3PB 5J43A 1NNEA 4KQMA 4Z2YA 3Q8XB 3TZLA 1M2FA 1R6DA 1W44A 4TVBA 4X41A 5BN1A 1UXGA 2YC2C 1CY4A 2WE7A 3ELUA 1YMQA 4LRWA 5JAQA 1AO3A 1TUGA 4YI3A 1CZLA 2F9FA 2NU8B 2ZTMA 4O4JA 1WUJS 4V1CB 2A78A 1Z6AA 4ND2A 2UAGA 2BFAA 3DHEA 4I9FA 4E32A 3WLLA 2KWIA 4D4JA 5EXTA 5JH7F 1IY2A 1NAHA 1TUBB 1VRCA 2G1KA 2Y1WA 2L82A 4OB6A 1Z2NX 2Q3DA 4JOCA 1N32B 1WU7A 5KVQA 2B2XA 3JVEA 1SD5A 4X7MA 2P8SA 2E4XA 2CKDA 1G6OA 3V1YA 3AOEC 3EDCA 3K35A 1RKQA 5GZ3A 2HJVA 4FD2A 4CM5A 2CHQA 4KXQA 2HT6A 3ZCTA 1Y1PA 2JH8A 4EB6B 1SVLA 1XUOA 2VVTA 1BKYA 3NEPX 4M7OA 5L7YA 2Y93A 2ZRCA 3D4OA 5F52A 1QQBA 5I4CA 2M2IA 3ICOA 8ADHA 1OXKB 1PFQA 4UCWA 5I7WA 2Q1YA 3V33A 2MSCB 2R6CA 3ZLUA 3LSYA 2C96A 3KVNA 3WYCA 1KSFX 4KJXA 4MWDA 1Q57A 5L7WA 2F17A 1D3AA 1R5OA 1KKMA 1XTIA 4ZVLA 1J8FA 5KTMA 3TTXA 2OM2A 2ZTUA 2QTWB 1Y9EA 4E13A 4MSUA 1K8XB 1EXVA 2GZ1A 4LJLA 4LSGA 3VR3A 3RVDA 1O6BA 3ETLA 3OKPA 2BGRA 2WSMA 4LXQA 3VDMA 5FQOA 3JQ8B 4S1WA 1NPYA 1A5ZA 4MGEA 4BFXA 2HYDA 5FAKA 1R0RE 1MZVA 1KO1A 3LX4A 3RROA 2ACWA 4EHNA 4CNQA 4KQWA 3D8RA 2Z8YA 3CEPB 4EAQA 3NFRA 2VPTA 2V0CA 2C2WA 3NAGA 3A9TA 3SQNA 5IRCD 3R1IA 4HDAA 3RAEC 4MVJF 1FSGA 3HI6A 4IINA 1CY0A 1AS2A 3HVHA 4UZEA 1QYRA 4N49A 4N0DA 3S44A 3K15A 1H85A 3PHCA 4MW0A 2BFMA 5JSKA 4G0UA 1RJEA 5FNZA 3AR3A 3QVOA 3NIFB 4AJKA 3ICQB 4PHFA 1NIJA 1KTVA 2FDXA 2CF5A 1YONA 3OC6A 3OOEA 4ZOLF 5GJCA 4XYLA 1Q15A 2DHEA 4G63A 4OUDA 4ZN6A 2WT8A 3LQQA 1VPTA 4PZDA 4RK7A 1DRVA 2Y4OA 1M6HA 1H69A 2AN3A 4FYVA 3LH5A 1RKUA 2I4NA 4L76A 4MWSA 4MYTA 4UAJA 3K2EA 4BECA 3WL5A 1T2VA 1YZLA 2C84A 1T5SA 1VJ5A 3ZGLA 1FTWA 2ZYRA 4RF3A 1NUAA 4F96A 2NGRA 5L3QA 5DBFA 4U1RA 1DUIA 1E2QA 2VPYA 4WRRA 1G5TA 3OJXA 3DZDA 5H8WA 2PG3A 3CCBA 3HUDA 1N5DA 1CW2B 5TF0A 2FETA 3H9EO 4K9PA 2X7HA 4ZV7A 5A5DA 3DR5A 3PC2A 4LWZA 4KFSA 4L07A 1SBTA 2EHDA 1P5RA 2ZBFA 4PYOA 5FTKA 1TCAA 4YAIA 1BCSA 4PQFA 1JPUA 5D3MA 4HNTA 4DLLA 2WDZA 1ETHA 1W36B 2ZUTA 4ZC1A 3AFIA 2Z5VA 3C0KA 4XM2A 1UM9B 5TLSA 3VR5A 4RTMA 2I9KA 5D5QA 5L4SA 1RNLA 4I8IA 2EZUA 4EKEA 5HKAA 2QR5A 3P9RA 4FYIA 3AJRA 2XVAA 3JZMA 2FX2A 4MI9A 4GXQA 1K5PA 5EE9A 5TVGA 1G291 2DKFA 4FW8A 3ZCUA 3L7BA 1Y8RB 2OCIA 3J80A 4AWXA 2ZRLA 4F3TA 4DMFA 3C7TA 7MHTA 3QLJA 2XRFA 2F4VB 2ROQA 1WMFA 2IOFA 2O50A 1B74A 1DZIA 3EMVA 4CGZA 3U4AA 2BDTA 5D3KA 3V4LA 3NTVA 2QVGA 2J4DA 3H9GA 4JN6B 1K7EB 1T9CA 5FUQA 3M6VA 2XPCA 4D9NA 5E0OA 3VVMA 2QLLA 1PWZA 3ETJA 5JEDA 1P33A 1R66A 5JJCA 2F1HA 3AWDA 4LHYA 4XTCS 5E4FA 1D0VA 3ER8A 3KQWA 3DC2A 3QIVA 1V96A 4BMZA 1C0IA 1RYMA 3ZD7A 3RKUA 4JI6B 2AI1A 1VL8A 3T54A 4MH0R 3OZSA 4C30A 2X5JO 2G71A 1Y80A 4QT0A 4X1YA 4RF5A 3CGGA 3GELA 4PE5B 5FUWA 2RCYA 2VDJA 2BYTA 1ZH0A 1Z4MA 2R751 2E55A 4HVTA 4KWHA 3CRW1 1UQRA 2HX1A 3H2BA 2X7JA 2XOKD 3I5YA 1SGWA 1FDOA 1ZD5A 2FFBA 3DUWA 5F4BA 1MLDA 1VMIA 1RHQA 1EGAA 1SC3A 4GAEA 2DEUA 2V97A 3VPBA 2C7RA 4HNHA 1P4SA 1XTUA 2QL7A 1S3GA 4CKXA 3EFOB 2G1PA 3FW1A 3L79A 1CNMA 3ASVA 5JJLA 1FSPA 2BZ0A 5EIXA 3NBMA 2GPTA 3U4CA 3QMWA 1U8AA 4EUEA 3E9RA 1NJ6A 1YASA 4N8SA 1Z6GA 3HUTA 1D2CA 1NL3A 1KJNA 3E3MA 4DLBA 1TEHA 2ZYWX 4KAJA 1K4YA 4CEIB 3NH9A 3GEBA 1I7LA 2QUJA 4X8HA 1POXA 3NEJA 5A5FA 2FI1A 2G9RA 1EWYA 4PYQA 2F9MA 1H9BA 4JD5A 1LDEA 3S68A 5TJHA 3VR2A 1EWVA 2BONA 3WQBA 1RR6A 4WBNB 2VZ0A 4XCVA 1KAMA 3DD1A 4ALNA 2AX3A 1RMQA 1T4MA 3D4IA 2M1ZA 4NZ9A 1DBRA 4WZAE 2JGDB 2OLJA 1UMDB 6ABPA 4CDGA 2RHBA 5JS1A 1PT6A 1RP1A 3IODA 2P6PA 4G0XA 4YR9A 3I62A 2WY2D 1VL2A 3TLKA 4DMMA 1O58A 3WV4A 3EZXA 4M8LA 3IVGA 3ILYA 2I6GA 1MEJA 4R1UA 5FNVA 1G19A 3QPAA 2JLBA 3V4PB 1VE5A 2FCAA 2ZJYA 5DNWA 1CJMA 1J7KA 3NWJA 3EZLA 1Z5UA 1UM8A 2C5SA 3T4UA 4WERA 4W5TA 1FJXA 3R9KA 2FSVC 4GOXA 1DRUA 1HTBA 2IHNA 3C4VA 1UFVA 2O8CB 2PUHA 5C35A 3GARA 4GZ5A 1IH8A 4X24A 1SCJA 4JVSB 5BT8A 5CH8A 3O4VA 1BN6A 4XA8A 3PFHA 4EP1A 3RHTA 3ZNPA 2FNAA 2QZZA 4AO8A 2RGAA 2GLTA 1GA6A 4I2NA 4EECA 3PD1A 1E99A 4L8LA 3FHJA 1RJGA 3RRMA 2F1RA 1RQPA 3NBFA 3TX2A 4BZQA 4GW3A 2J08A 2JVJA 2P4HX 4QBGB 4WE3A 4QPNA 2NP7A 1Q91A 2BUAA 5YASA 4FGUA 5GOZA 4RMGA 1XTVA 1NQ5A 4EZEA 1EEXB 2R00C 4TQ9A 2ZIGA 3KZMA 4G5XA 2WFMA 1O0SA 5K0LA 3RF6A 3PIDA 1QP8A 3VO9A 4JOQA 9MHTA 4I19A 1X1DA 1OH5A 2FSGA 3X3HA 2Q4RA 1W0KD 5THKA 1N6PA 1NE7A 1UKVY 4JODA 3CRNA 4QECA 4QPCA 4RIGA 1R4ZA 5KOHA 3T35A 4EENA 1OX4B 1QZZA 4QGBA 1NNSA 4U2GA 4XDYA 2FW7A 4E11A 1NQXA 2QT9A 2XUZA 1RWOA 4CIVA 3HA2A 1T10A 4A0SA 5I48A 3D0RA 4WXMA 3DEIA 2PU5A 2R8ZA 1BX3A 2XV1A 1K3UB 2REBA 4IHJF 4V0LA 4XM0A 1TZBA 3LNTA 2PXAA 1M2GA 3PQ2A 4PGHA 5TQ2A 3U1TA 3ICEA 5KYYA 2CXHA 4UE6A 1B42A 3D4PA 1IBRA 4FYWA 2YV4A 2NX2A 5TC4A 4FWTA 1E4OA 3HCPA 4BKRA 4E3ZA 2A5GA 1DX6A 1BS2A 2OBFA 4TZKA 1UBKS 5AD1A 2Y6UA 2MINA 4EF6A 5BO5A 3B6IA 4YN3A 2F90A 1STOA 4GC9A 2OPBA 1NVAA 2JFHA 4OHFA 5ALNA 2AC2A 3KYCB 1MABA 1QIHA 5KQGA 1GRNA 1MC8A 1VXOA 2C3OA 3MCUA 4S1OA 1H93A 1N75A 2HWWA 2WNIA 1Q2XA 3CT4A 3Q7TA 4FGLA 1ECLA 3EG9A 1KY2A 4R71A 4JL8A 4JLSA 2BBTA 3BYZA 3JAWB 3O4HA 4YRGA 1C4KA 4MLPA 4AU1A 1U04A 4RKYA 1XNGA 2JANA 4JY7A 4MKFA 1KZGB 1HWYA 1KQ3A 1M2VA 2VWHA 3TG8A 1HA3A 2B34A 2I2FA 3MQ2A 4XGRA 3W9BA 3ZWVA 2XDYA 3Q3VA 1XP8A 2GH1A 4ZDIA 5IASA 1DQNA 4EPVA 5JV5A 1AQ6A 2WRZA 1KQGA 2DOKA 4W9NC 1SVUA 5BSHA 1FX0B 4S0XA 2PZFA 3A25A 4UMFA 5JFTA 3WGKA 3OFNA 1LJLA 1EVYA 1QH1A 2R5NA 4Y67A 2UXCB 4F0JA 5SYNA 5CLFA 5J2TB 3COJA 4XARA 1RWQA 3T9BA 3WJAA 5HIKA 2C5FA 4GH5A 4JZKA 5E2AA 3AG5A 3QLUC 4WXEA 1TJ3A 2DH5A 3VV3A 1SHJA 1UL1X 4DJ5X 4RK1A 5IAEA 2YYYA 1W49A 4C0WA 2IHUA 2GJAA 1ZVMA 2RIRA 3D1LA 3FF4A 4PCVA 1LPMA 2OHVA 3GLFE 4TOIA 1Y1KE 3W2IA 4LJ7A 3LY9A 1P9OA 1GG2A 2CNLA 1D1TA 2FG6C 3BERA 1O6GA 4Q6WA 4GZ6A 2Q2VA 3OIWA 1DQPA 5EJ2A 2P67A 2P4QA 1X14A 3GZ4A 3H1PA 1OB2A 2Q27A 1MPTA 1JB9A 1PI3A 1NXWA 3DOFA 5FBWB 1FP1D 1WPXA 3H8WA 4LCJA 1JHYA 1P1CA 4LMRA 1KDYA 1D8TA 2Q1SA 3ZDAA 2GD1O 1N9ZA 4JT8A 5JFGA 2BHSA 4LWOA 4M3NA 4C3UA 1T8WA 2FRDA 1B3RA 1C9NA 3T5BA 2WT9A 3GJSA 3AGQA 1Z17A 4BS9A 4HS9A 1JMYA 1HDXA 1RWKA 2RH9B 3MCAA 2L42A 5BPHA 2VSXA 5FWYB 3LQKA 4ACAA 3FDXA 5KSWB 4YJ3F 4C07A 1VE3A 1NVUQ 2IODA 3RB8A 4Q7JB 3ZTYA 1YJ8A 1WM1A 2XQIA 3U3MA 1KJJA 2ZRBA 1PJBA 3O4RA 1NJ1A 5HUJA 3LTNC 1Y6RA 4BO1A 3DL0A 1USKA 1BYUA 3LFHA 2ZT5A 2LVBA 4GRAA 3OQVA 2QNRA 1N33B 1E61A 2JIZA 1N9GB 3FMPB 3FJYA 4E08A 1I8TA 1AKQA 2WHPA 2ZJAA 5BQ5A 2G1JA 3K0CA 1AG9A 1WHSB 1XCLA 4E1AA 2IOYA 4HQLA 4N3AA 3WJ7A 5HXAA 4BGUA 2VDUE 4QODA 1XK7A 3JQFA 1KDVA 2JLUA 4V0QA 5DLYA 1HDGO 1UBEA 5K8UA 2HQSA 2XTNA 4OQPA 4TTJA 4OXIA 4A10A 3FWKA 4AS3A 4BJ5A 5CDTA 5I4IA 1LI4A 1PKXA 2W98A 2ZP1A 5DYIA 4DNOA 3OEYA 1CRQA 5EKUA 2O3UA 3E5RA 1EG2A 2FEKA 3OECA 2RH8A 2RGUA 3S29A 3T5TA 4EEKA 4PFJA 1EM8B 4X63A 5DYNA 1R50A 4K6KA 4E5VA 1WXFA 1QM5A 4QTXA 4R7GA 4KBGA 1BE8A 5AH0A 1LJ8A 1J20A 1QAOA 4YALA 2M6KA 3MBIA 4EARA 2GFHA 4V1CI 2FUCA 1ZU5A 3C6XA 1X1CA 3QKSB 1VCNA 1GZ6A 3MF4A 1RLJA 3SS9X 2P3OA 3AVQA 3WL8A 5DHFA 2AR9A 1U5BA 1Y34E 4DZRA 3FWHA 3MTQA 2CV1A 3MJ4A 6GPBA 3QBTA 1IU9A 1EKXA 1UPAA 4N12A 2W42A 2J3KA 5ABPA 1DCTA 1QRSA 3RTEA 1YZYA 1YFKA 4FEEA 1BW9A 2VZLA 3JQGB 3NHUA 3TD9A 4D4MA 4XIJA 3ASYA 2DT5A 1C8BA 1OAOA 1O3YA 3CISA 2BT4A 1UBRS 2XDQB 2R11A 1P0MA 3OOJA 3AVYA 1DUSA 5JQGA 1T8YA 4XH9B 4QFCA 4FDMA 1SA0B 4ZAWA 3PC8A 4YWJA 2XZTA 2C58A 5BXYA 3E18A 2B4AA 4U3JA 5IKXA 4DW8A 1R5NA 2DP4E 3BS4A 2D0IA 3PL5A 1B1CA 2BMVA 1GFSA 3RYFB 2WYIA 2J8ZA 5MF6A 2XNHA 1XN4A 3IPCA 2FPWA 3WISA 2PJDA 3ZBQA 4CQJA 1B2LA 2IPXA 1TKRA 3CZ5A 1SK8A 2IEAA 2CNDA 2LDBA 3OU7A 5LDGA 4A6DA 5BORA 1KEPA 2Z08A 1X92A 3V2HA 3Q6MA 3IEKA 4INJA 5GOTA 4N0QA 1GT6A 2HHCA 5KUTA 4LF9B 1NBIA 1RRFA 2QTVA 2Z8ZA 3OZCA 3CYFA 2PGDA 1P5JA 4WZAA 1H8EA 2R7KA 4CWAA 1PGPA 1TK9A 1Q12A 3V3KA 5M7EA 3AVVA 2OG1A 1B2RA 2YYSA 1G2IA 2WSSA 2ZTSA 1O97D 4AX4A 1EVKA 4I46A 5JZBA 5CFLA 1PYDA 3GD7A 1BD4A 1PGOA 1E96A 3RC1A 3JASB 1ZN9A 4Z7OB 3GO4A 5JG7A 1THTA 4QRHA 2HBZA 2FZ4A 4JASB 5K0EA 4AJ2A 3WQRA 2R1TB 5DT2A 1X38A 2FQQA 2V7XA 2NSJA 1XK6A 1H2FA 4K6MA 1PUJA 3UOGA 3KT6A 3OTOB 2DUJA 3WADA 2AWOA 1MNAA 2ZSAA 3QOWA 3FCXA 2QBYA 2J9XB 3DCIA 4MITA 5KC8A 1W34A 1H0RA 2ID7A 3ETEA 1A9RA 3L7MA 2EZ8A 1ULUA 3O93A 4G36A 4XSVA 4BNKA 4Q9KA 3OLZA 4ETMA 3TLAA 1ZVQA 1AS3A 1L1QA 4L4YA 1J25A 2IXGA 2QI9C 1U1GA 4M1WA 4A82A 2H1HA 1CX9B 5AKKA 2WNSA 3L0OA 5HJ5A 4J1QA 3R7AA 1PGJA 2QX6A 1E4EB 2REOA 4KB5A 3A9WA 2VJPA 4MGZR 1JYSA 2YASA 1FNNA 2H57A 3AR6A 3RSGA 1KVTA 4X71A 3KHSA 2F55A 1NYLA 2OZEA 1JAYA 2PIDA 2QX4A 2YS6A 4UVHA 3KTOA 2Y1KA 3D6TB 5G53C 1HXHA 4HDMA 1EE9A 2ZROA 3SD7A 3H6GA 4DY6A 4F5YA 2X86A 3GCXA 2HMVA 1NUUA 4V24A 2NZYA 3N3BC 3VNVA 1V9LA 1EP1B 3GPCA 3FLEA 1EQAA 2AE2A 3ER9A 1B7GO 1FQWA 4GX5A 4PYJA 1E92A 1WDKA 3TINA 1ODLA 2GT1A 2HWKA 3HWSA 4PCLA 4ZANA 2PVCA 1HGXA 3AVPA 4TRJA 5IP5A 3HWRA 1X94A 2E21A 3W8EA 4BN4A 1QB8A 4C2AA 5LXTF 1REQB 1N2BA 3DL2A 4OI2A 4BATA 1ZD8A 2W2QA 1W52X 4GMFA 1Y4ZA 2W9XA 3M6WA 3ROZA 5C8YB 4BQPA 1QP4A 1MB3A 4BMPB 1UODA 4YCMA 1VG1A 1JQ3A 1SY7A 5TMDA 1N6RA 2OKCA 4ZKDA 2IBTA 4TUYF 4UZSA 1I4OA 1O8CA 4IOLA 2XTZA 5L53A 3IDOA 3WNCA 1LNSA 2OKGA 3JQAA 1ZA1A 4UFPA 4JLMA 3DAFA 3ABQB 4J0FA 3OU2A 4R31A 2IXEA 4YDHB 1ADGA 1ICIA 2PZBA 3O8OA 4PTZA 2R66A 5DNCA 4RORA 4B79A 1XZFA 1WSBA 4GUDA 4KUEA 4TRMA 1EXMA 3NBAA 5G40A 3UWSA 5K3OA 5BOSB 2CDCA 4BNFA 3L1KA 1N3IA 4MP3A 3OJOA 4M1YA 4OH1A 2JAXA 3G8DA 3EJWA 4QGHA 3RS4A 4E31A 2KBFA 1FW8A 3C14C 3DPIA 3ETCA 4QDJA 4UNNA 4BUZA 2H9YA 4RKFA 2XA2A 1XEAA 2XUFA 1XNJA 3IDAA 1MO6A 1J99A 4ZP1A 3C8DA 3VKWA 3VRHA 2WV9A 1GP2A 3FOCA 3RUIA 3VISA 4EOGA 4Z53A 2H48A 3RVRA 4CDMA 3OFJA 1NIPA 3Q7EA 5K2MA 3TKYA 4KAAA 2IE0A 1QIDA 1KA9H 4AVYA 4EHHA 3TE6A 1VKJA 1MMFB 2J3EA 1ZNWA 3INNA 4J91A 1U02A 4K03A 1JU4A 1ZJ6A 2IUFA 1DOHA 3BF7A 1VZ2A 3CTPA 4AROA 4JHXA 3FPJA 1DS6A 5HBRA 3GLFA 1T3HA 1FVXA 1RD4A 4E15A 2WYOA 4BVAA 1TRHA 4B43A 2BW0A 3WYNA 3DXYA 3A70A 4O2AA 3RGWS 2AJLI 4ASUD 2AKYA 4HBGA 5E95A 2VNHA 3T7RA 9GPBA 3K6SB 4HFRA 2IUSA 2DBRA 1Z0FA 3NT4A 3CNQS 3WXMA 3H99A 1W7AA 4TL6A 3OWXA 5SZIA 1WXEA 5LN1A 3GT3A 3IBFA 3FDFA 1SELA 1U0HC 1RJ9A 4JUAA 2YMMA 1L3CA 3L92A 5LVAA 4A8TA 4GMXA 5GZ1A 4QVGA 4XYMA 5H4GA 4BU0A 4UU0A 2BM0A 3BWMA 4FK8A 3B3AA 4DHEA 3I09A 3TLMA 3SXUA 5K3SA 3AERA 5AXDA 4U5XA 2SKEA 4DPMA 2EG5A 4AYTA 5KYXB 2HA6A 2OOKA 1CFZA 4H08A 1HT3A 1TU3A 3KJGA 4CM9D 5IM4A 3K0SA 4UAGA 5LQMA 2ZSKA 2X0JA 3BCHA 4NOJA 5DO9A 1MKYA 1T4CA 3IPRA 5CA0A 4XXHA 3PF8A 3ENWA 1D1QA 4HNGA 4I50B 4KO4S 1E66A 4K8OA 1NZDA 2RHOA 2C4TA 2NUTA 4RK4A 2QU8A 1GKKA 1YCFA 2ZE5A 4NCXA 5EQTA 1NE2A 3NHKA 3BXPA 4NEGA 4EAAA 2ZQZA 4QEZA 4ZO4A 4YMGA 1R9MA 1JQEA 2PS0A 3G2KA 5EMNA 1UJ4A 5E9AA 2O2ZA 3NWPA 1H05A 1Z29A 4ZYWA 4EGAA 2Q1XA 5CGQB 1I9CA 4OHYA 1K97A 3I28A 4P93A 4AY4A 1UKBA 2XITA 1OZGA 2K7ZA 1QJCA 3PQEA 2HHLA 2PV0A 1WBJB 1R4NA 4BX2A 3GXOA 1XLVA 3HGQA 4MV9A 5E9JA 4IIJB 1C1XA 4B3HA 3JALB 2PN1A 3GAAA 3K6JA 1WD7A 5F76A 4FKBA 3GG2A 1PJAA 3KQPA 3QFCA 1GL9B 1E2HA 2XKJE 3BICA 3DV2A 1WAMA 4RAQA 4D9IA 1MX5A 4F4DA 2GTPA 1XRJA 2FSPA 2I3GA 2WUVA 3JZFA 1BMTA 2IKQA 3DBHA 2LXNA 1NVXQ 3OLYA 1CIPA 2OO3A 1R18A 3OZAA 1BDJA 4FDAA 4L75A 4ND5A 3V4OA 4EX6A 4EATA 4G5OA 3OO1A 1GNVA 3ECCA 1PT9A 1C7ZA 3ANLA 4RA6B 3PX2A 2YDXA 4MVJD 1PVDA 4ECAA 1QO0D 5CBPB 2VK2A 2NYAA 3OH8A 3LC1O 3WGGA 1FUEA 4WLFA 1DT3A 4P3XA 4ZDJA 3KD3A 2AN9A 1T8SA 1C0EA 1DKMA 1V95A 2O1XA 3FR7A 3H05A 3HBJA 4KLNA 4X0EA 3PHBE 1WP4A 2A9VA 1U5CA 2O0KA 2A5JA 1RXEA 3CF4A 1SD1A 5AHXA 2GDJA 5LQAA 3DE5X 3QKWA 1NXPA 1LLUA 1T0HB 2ZSIA 1OMOA 2QV0A 4AY3A 1QQ6A 1QFSA 2OL4A 4IOKA 4NBRA 5CX4A 4HWSA 3VO2A 1XWWA 3EFHA 1DWUA 5TR9A 3G1UA 4HWKA 4MA5A 5JAHA 2C59A 4EZIA 2W11A 2HDHA 2R1VA 3T3IA 4M0MA 4BQSA 2EIHA 1XQYA 4BJ1A 5J59A 1BWPA 4IDNA 3QSGA 4LRXA 4MV6A 2G5PA 4D46A 3LVBA 2IYEA 3TQSA 4BX8A 1Z7GA 3KP1A 4P4LA 4EJ2A 2FDRA 4ED9A 3RYIA 2NQ8A 1CDOA 2ZFUA 5A4KA 1TM2A 4PLYA 3A1FA 1E98A 1ZO8A 2ERYA 1FP2A 2I4MA 3UA4A 4FP9A 4J9VA 1PUIA 4EHKA 1UAAA 3WDMA 3QLVA 4YPVA 4TLAA 2DPXA 3RJ5A 5DW0A 1YXMA 1AB6A 1ZHHA 1HV8A 2WLSA 1SOMA 3N87A 4ZPXA 1UZMA 3GFPA 3KG2A 4ZVOA 3EDRA 3NKFA 3ZYZA 4CYMA 4P4SB 3GLSA 3LF2A 4ETWA 3D8HA 1MJHA 1QYXA 4O02B 4PIMA 3AFHA 3M6AA 4Z4CA 1EFRD 1JFFB 2DQSA 2ZAIA 1ZINA 3PQ8A 2I1LA 3QQ5A 5BR7A 4FR5A 5LUBA 3ROGA 3QWBA 2WJGA 4LAFA 3MHTA 1ZD9A 1NVVQ 1PE0A 2VA9A 4GWKA 3WIDA 2X13A 2TMKA 1BHQ1 2J0UA 2UV8A 4EW3A 3RHFA 3TLCA 1L4YA 2C9DA 2B6NA 5DDIP 5FBKA 3WBKA 2YJNA 5J2UF 4IS2A 3A3PA 4ISBA 2VJCA 1KEEB 3V80A 4BB6A 1MAUA 3PLRA 5BQ3A 5KCZA 3F3SA 4O1MA 2G5CA 1AZLA 4C21A 4GQBA 5F35A 5EHZA 4GPBA 3HXMA 5KO2A 4AS1A 1KETA 4OYHA 4UHFA 2VFAA 4BE4A 3FKSD 2CNWD 3KOYA 4G5YA 4H3SA 4MR8B 4Y6SA 5AKJA 4AG6A 3KLMX 3W1WA 4LPKA 4IDHA 1M83A 3EF3A 3OF2A 3PX3A 4HFNA 4NYJR 4FINA 2BDEA 3ND6A 1SHLA 1JVSA 4P4UA 3FAZA 4X5OA 3R5HA 3M4YA 3EC2A 1GXSA 1T4BA 3LL4A 4BVBA 5CDHA 5F7XA 4PLHA 1ENYA 5H9VA 4O2BB 5BMVF 3UJBA 1E60A 3U6KA 1RDFA 4XUDA 3WK9A 1NI5A 4JLUA 2H92A 1CY7A 2Q28A 1G1AA 3ZG6A 4N47A 4BC0A 5F5XA 3I9FA 3RTGA 4CN8A 3L6RA 1KO8A 1YRYE 1T5OA 1I01A 3ILHA 1JWLA 3ILXA 1I4LD 2XMGA 3URMA 4A8JA 2NO4A 1QKJA 2ZB7A 3D0QA 1N8KA 3STHA 4HOYA 5IVDA 3GRUA 4QM7A 3KU4A 2WIGA 1A9TA 1QP0A 3BH6A 5DV9A 3E7WA 3LSTA 1KEWA 3KXDA 3T0IA 3UHPA 5IT0A 2VBCA 1WDMA 2BL4A 1E3WB 1WBBA 1D2GA 1Z6XA 1QCYA 2J5XA 2XMPA 4KYIB 3HJFA 3HY4A 4D44A 3BRWA 5JZVA 1XZPA 2FXIA 3I04A 4JJKA 4MW4A 4DT1B 5BVHA 5K0BA 4J07A 4BP9A 4MRAA 5B3KA 4M7WA 2JI8A 4M9SA 3ZY3A 1Z6TA 4KJZA 1A97A 4MB6A 1H4TA 3LVFO 4P7KA 4KH0A 1JEAA 3EVEA 1YCDA 2GKGA 4KN8A 4LA4A 3A3YA 4PXSA 4EY6A 1UDWA 1MIHA 4D7AA 3EEBA 1QHIA 2DLNA 3CLUD 3DE0X 5A9RA 1ZY2A 2P90A 3PFCA 1E9DA 1YSCA 4LW8A 4QQ8A 2WJ6A 1NSFA 4AX8A 4CMJA 1FFYA 2YX1A 2ZTHA 4J7CA 1OFVA 1IMJA 3GQVA 4J90A 3SDZA 3TEFA 3NHSA 1W0KA 1FFCA 3WFZA 1DPFA 4QIHA 3O9ZA 4NYIR 4FFLA 4QDOA 1VKOA 5HKKA 1MC5A 4V2IA 5KJCA 1ULSA 1VL6A 2EZ9A 3AL3A 1NF3A 2JGNA 3SPXA 3ZK8A 4HRYA 1QQAA 2ACEA 2R6HA 4NENA 1NVFA 1LWNA 4NLLA 4EABA 2XTMA 2IOQA 2WMNB 2IY7A 2H1VA 1MN6A 2XMBA 2IPAB 3ER6A 1EUCB 3T3EA 1SZCA 1FLAA 4D9JA 3LT5A 2XMQA 4CMIB 4D3XA 1WZEA 3OC0A 3W5BA 1EVEA 4W4TA 3ZHVA 4BQEA 1G8PA 4RKEA 4CR8A 1MORA 4L6CA 4MUXA 1VB3A 1MFZA 3WNQA 4DRXA 2IS6A 1Z28A 3LCUA 2CLSA 2A1TS 4BLVA 1L6IA 2PM8A 3HPQA 1VP3A 4RGYA 2BFOA 4OF4A 1VBMA 4PLCA 4WJLA 2HTFA 3NC4A 1A8HA 1XA0A 3QF4A 1A72A 1N1MA 1Z0UA 4JQSA 3D6HA 1E89A 5CVDA 2P0AA 4BQNA 4ROTA 3HB5X 4IMRA 3TQTA 4ATNA 4AMUA 1QV6A 2EJTA 3JV7A 5JXIA 2IZ6A 4Q19A 2O1SA 1TD1A 3PC7A 2GF0A 2ECOA 1YRQA 1A2BA 3LF1A 2HA7A 2GNOA 3AR7A 2WF6A 1IL0A 3M0EA 2QVZX 1A8QA 4P7BA 5HFNA 3SQOA 4NDZA 4M6WB 2Y8EA 4B6GA 2Q0QA 3IXLA 2TMDA 4OB7A 2BEWA 4IFEA 2YIJA 1RZRA 3LQRA 1CETA 4QFDA 3L8DA 3UT0A 5AVWA 3ZLJA 1A9YA 3MUNA 1FPMA 2VJMB 5FFNA 1QKKA 1TYAE 3HSKA 1Z4QA 2GK7A 2PRKA 3KYDB 1IXYA 4JEUA 1JHMA 4H77A 4KQIA 1DU4A 3QFSA 1FYVA 1MG5A 1ZQ9A 2ZANA 2Y0DA 3BWCA 4HG2A 3CLRC 1WKBA 2VUUA 2FFAA 1F8GA 2B7BA 1FPQA 2X41A 4ERNA 1JA9A 2R6ZA 5D6NA 3FCYA 3G9QA 3T8YA 4IIYA 4QUGA 2CFSA 4V0OA 3HVIA 3G0DA 2C42A 2HRBA 4D9FA 1E2MA 1VMEA 1C3JA 1UT5A 1XELA 4NHEA 3NPAA 4Y0NA 3T7TA 4D0RA 3DLHA 3TEJA 4JFAA 4HNVA 1BX1A 4D43A 3P26A 4CLOB 2ZATA 1QZ3A 1E2IA 1FFHA 2PBRA 2O2XA 1AJEA 1WW8A 3OT1B 4IF6A 3B51X 3LWNA 1U63A 3F2IA 5C7IO 4NBLA 4MRMB 1B0PA 2Q5FA 2XEXA 2ZLBA 4D6YA 3TOVA 2Q3BA 3FTFA 3CLHA 1KHHA 3HYRA 2NV6A 1PTJC 3SIPA 4Q7KA 2D7DA 4Q39A 2OV3A 1NVWQ 5AJXA 2CJYA 5FBRB 2IL1A 3ZWYA 2VHWA 5BVGB 1AK9A 1X42A 2QKYA 4NL4H 4D99A 4LXGA 3TNYA 4HH1A 5D7BA 1YI0A 1N5MA 1DKQA 4ZO7A 4E33A 2CE7A 4HT3B 1ZGBA 4JC4A 5FDFA 1E1KA 1ZXLA 2R3SA 2HBYA 2CMHA 3GBPA 3H4TA 3NHWA 4FFMA 1O9HA 4PPNA 1KI6B 2PVPA 4RZHA 2IV2X 5K99A 1S1CA 2YWRA 5HE9A 2I99A 2GR9A 2RHGB 3GRPA 2R6R1 2GJKA 4CUJA 4EGJA 3PCTA 4U7JA 5TPWB 6NULA 5LUAA 3INRA 5C5EA 2HUPA 1QZXA 2ZAMA 4ENPA 3QBJA 8OHMA 1CR0A 1X9GA 2ENUA 3AQIA 4QJ3A 1X1TA 1ZWKA 5FL3A 3VC2A 3CM0A 4UQPA 4ZYXA 5F23A 4G65A 4UNQA 4WKGA 3ND9A 2TRSB 5FWDA 1L4KA 2EFJA 2IYAA 3N2NA 3Q41A 4OOEA 5T3YA 5CFOA 5HZHA 2C83A 1N6OA 1IATA 5DWVA 5JWOA 1I4EB 3AT1A 3V2GA 1Z68A 2HZ7A 1M2EA 1PFGA 3ZDQA 2OPHA 2G8NA 1PK9A 1U90A 1YL5A 3AILA 2D2EA 3R5TA 1CRLA 4PF1A 3JQBA 2NU9B 3O6VA 3RT9A 3THWA 2GRUA 1SKYB 1YVDA 2DSTA 2BN4A 2JLRA 5GP1A 4U2KA 4BNNA 1I3CA 4Q5IA 2X8LA 3K53A 1YIOA 1NJFA 4X6YA 5TS3A 5EN4A 3WSWA 2WIAA 3IQIX 2CK3D 4B7UA 3G1TA 4LJSA 3IUYA 3HNOA 3H9JA 4PO8A 4ZDWA 5HHTA 2CLEB 1U9IA 3JR3A 1Q21A 5CIQA 3RFTA 2ZVJA 3GV0A 1HORA 3CU5A 4DREA 4N7BA 3T15A 4QJ4A 3PFBA 4WX2B 4GPEA 4EITA 1BGWA 1LNQA 2E9SA 2JFVA 2W83A 4EUHA 4PSDA 2YZGA 3CLTC 4CXMA 1U1IA 2HDWA 2W71A 2X58A 1N2GA 3FSRA 1CUVA 4JIMA 2GTIA 4QICA 2AXQA 2VHCA 3I1IA 4JQOA 4OJMX 2ZAOA 4Z5XA 3E8SA 3G88A 1TGVA 3INYA 2W6QA 4L73A 4QWWA 1BD3A 1VM6A 3R3UA 3RODA 3LY7A 5JAPA 1NVEA 1LW7A 2H4FA 4IG4A 4M0PA 4YMWA 4LZNA 1G0NA 1K86A 5ALDA 1XD2B 4C78A 4EFDA 2CZGA 3IP5A 4GX1A 2XUOA 1VGRA 3WWYA 4EHLA 5KQSA 3BE5A 3D9QX 3IOMA 1FXUA 4TTRA 2BSXA 2J6BA 5AW4A 5I7SA 4NH4A 2DQZA 2J87A 3AEYA 3HB1A 1RFLA 4DDUA 4CI0B 2QTRA 1Z26A 1CUIA 2F3UA 1XD8A 4IJWA 1RYHA 1CNFA 2G7MC 4J0QA 3KSMA 1PBTA 1XF1A 4AULA 3OF3A 5CLJA 1IC6A 1K8RA 4JP3A 1KYQA 1I30A 5K3FB 2ORED 3L4KA 2QTZA 3TMAA 1MP0A 5HWSA 1X1QA 2GNPA 4XI9A 2DX7A 2XWSA 4EO4A 1H6CA 1Y3BE 2G07A 2H63A 2YBDA 4JELA 1VDZA 2DUUA 2G04A 4NCJA 1AIPA 4AJHA 2DPGA 2QN3A 4H7PA 2O59A 3NANA 4YHHB 4DUPA 3H18A 1FUUA 4TTIA 1GILA 2ZS8A 4RNCA 3EZNA 4JUFA 4HEA1 1IQRA 1OKKA 3PQ7A 1PZFA 3KUUA 3I4LA 2GK6A 4W1PA 1AUVA 1YC2A 2GJ8A 5AXCA 2O54A 2UUBB 1TM3E 2IKSA 4MQ6A 3SFVA 2HBRA 1Z38A 2C8VA 3PHIA 4WSOA 4AKHA 1XJWA 4C01A 2OZVA 3I12A 2QVYX 4A91A 1L7EA 4UU1A 5AW1A 1RBZA 2OBBA 3W05A 4YQZA 5EI5A 1N36B 2C3MA 2EP5A 1FFXA 3D6FA 5F21A 1NNLA 5KTOA 3TSZA 3JTEA 3D7LA 3LPNA 1TC1A 3VNBA 1AKVA 5B2ZA 1YF3A 4EEZA 2YN4A 4CLRA 1YUBA 4D45A 1CRZA 1DADA 1E2EA 3IL2A 3MOSA 3ZE6A 4W7SA 3LECA 3A4LA 1XIVA 3HDJA 3ZVNA 3C3BA 3AF2A 4PSCA 2C9OA 2NZXA 4PYRA 2RK3A 2C4MA 3NTUA 2ANBA 1N2SA 2HSJA 1KY5A 2ODBA 4PZZA 5JPDA 3LUCA 3H9QA 4KYVA 2APJA 2ZWIA 4HLDA 4N82A 2VK8A 1TCVA 1LZLA 5CVJA 3D1VA 4OGWA 4YCDA 1NOIA 4MVXA 1GUBA 1VRWA 1XYGA 3D7NA 3NFYA 1F8FA 3V1NA 2PHZA 1F2VA 5BWOA 3S8YA 3VPCA 2VUIB 3F73A 1XPUA 1EUDB 1JBKA 1QLHA 1WDWB 3URKA 5FHRA 2YCLA 1HETA 4U2EA 2JKZA 4YGXB 1XFDA 4IIDA 4NULA 1G8SA 1HE2A 3IAS1 4Z0PA 3VV2A 3ZWAA 4AUKA 1G20B 2WP8J 5E7IA 4W5RA 4BRSA 2VCHA 5AK3A 3BRSA 1XTJA 5FBHA 4REQB 4YAFA 3L07A 3UV3A 1AURA 1OFUX 3ABIA 3EVZA 4KFRA 1V25A 3TZEA 2EYUA 1L5YA 3ESBA 2W6PA 3DVQX 4Z1OA 4B33A 1R8SA 2HTEA 1ODKA 4Y2PA 1OLSB 4B80A 2R8BA 5E4TA 3IUJA 2XUGA 1VJ1A 2D0PB 2ECKA 2HUNA 2YFYA 4RIIA 4F9TA 1B0AA 1FYXA 1YVRA 1IZ9A 3UMMA 2J9FA 3D2AA 2B9VA 1NLMA 4KMOA 3M3DA 3SYNA 3GFSA 2FWBA 4C2BA 1WQ1R 1KOLA 3DW3X 2QT1A 4LOIA 2BFDB 4XFKA 4Y2JA 2R44A 4UXHA 1BS9A 5CHYA 4E70A 4F4UA 1PV2A 1M1YE 1U3VA 3SZOA 3K71B 2BZSA 1XO1A 4RIFA 3BC1A 3PNOA 4BVJA 3EZ2A 2Q1WA 3I9V1 2X5KO 2F64A 1CCWA 1ZW6A 1B1AA 4KUHA 1NZFA 1K7CA 2X1MA 1LB1B 4M0KA 4JJ7A 2NYUA 5G02A 3W34A 3SVTA 4W5QA 1XRRA 5F33A 3DF9A 1X1SA 4H7EA 5DHQA 2WU1A 5EFOA 4QNMA 4P8RA 1I6LA 4C4ZA 5JD5A 2JS7A 1E0KA 3GI1A 4LV5B 1LKZA 4G5RA 5GMOA 5J2TF 1OIWA 2C31A 1G7SA 1Q3KA 3VR4A 1ZUNA 4Z54A 2PUJA 1CR4A 4CCSA 1K8YB 2K87A 4KE7A 5E7QA 2WJWA 1KI4A 3KXIA 2OWEA 5GQSA 4GNKA 3EZYA 3EGIA 1QRTA 5E1OA 4UNRA 1JJIA 1UXJA 5FV7A 1G9SA 3LUDA 4IH1A 4Q9NA 4RXMA 2ODEA 3IXMA 3BMCB 4Y7CA 4CM8B 2O5CA 4ZHQB 3GN1A 2B7CA 5AJHA 5EL0A 1XZNA 3HADA 4DLPA 1U94A 2HMUA 2Z5LA 1SEVA 4Y2UA 2NP6A 1TLFA 3TF5A 1EHCA 3AR2A 3PEYA 2FK8A 1FDUA 3NBZC 4GSLA 5BNWA 1TQ6A 3F5SA 3NV9A 1E5LA 4F2HA 2PGLA 3RS0A 5AFSA 1TA4A 5JH7A 4FDLA 3ANYB 4TTTS 3TSCA 1N7IA 2GUGA 4JSTA 2HIAA 2JJMA 4QLAA 3B6MA 3U48A 3EVBA 5K3BA 4JWKA 1I94B 1WETA 1MH1A 3LM8A 1Q1NA 1KH1A 2EQAA 3W5DA 1QU2A 4O25A 4I3GA 4QOHA 5AVYA 2ZM5A 2EFDB 3O91A 4WY5A 3GJ8A 3AHGA 3FSJX 4KG7A 3BHNA 2G17A 1SC1A 2XYVA 4TMTA 5SV2A 4GWGA 5IHPA 1EE1A 1BQEA 1MQSA 2HWUA 3R0ZA 3SOZA 1J0CA 2BEJA 2XWJI 3AH8A 4KSYA 4XPIA 2JNWA 3P7MA 3PDJA 2Y0CA 2I2CA 2MSNA 1T9GR 2ODQA 1O95C 3LX8A 4BMDA 2BUCA 3L06A 4NFLA 2YUTA 5JNUA 5AW7A 4GDMA 4WZ6A 2QLBA 1ZD1A 1X7DA 4PZEA 1SKUA 2PA3A 2Q50A 2V0NA 4JVLA 4ZEOA 4FI3C 2JF0A 1TW2A 3L8FA 5C34B 3TM5A 1GQQA 4ZYUA 3LOPA 1PNOA 4EI7A 4J1TA 1OD6A 3OX2A 3Q5DA 3SLKA 2C4NA 2W0SA 3DDHA 3K92A 3TLZA 4M4SA 5ALOA 5F5LA 2E48A 4YV1A 1SXJC 2C3PA 1QVVA 2YVLA 5DIFA 3JWGA 3KPVA 4ZRDA 1ILEA 1VC2A 2R62A 2CEAA 4KXMA 1JA1A 2HMAA 1K89A 3ABZA 3GT7A 1OTXA 3PC4A 2BGJA 2HJ9A 4M9ZA 1NGSA 2G06A 3ACDA 5PGMA 4AMVA 5KYNA 4IHAA 4YV7A 2PWPA 1V43A 2QAGC 4ZZ2A 4LRSB 4MVJA 4BO5A 4DXDA 4PICA 1QO0A 3SXPA 2VCYA 3G0CA 3MELA 5AKIA 3WLEA 2ZXUA 3HB4X 3TDMA 2Z6UA 1LFAA 3FWYA 1CERA 2W4QA 4ARVA 1ADBA 4CKWB 2BF7A 1MA3A 3GEPA 2C54A 1VYVA 3H0EA 1Z37A 3KLPX 4CMEA 4I0WB 5KS2A 4GXNA 4G97A 4ZOLA 3BJZA 4RD0A 3FUWA 2X8AA 3PUXA 3GXBA 5JSYA 2PZLA 2G83A 3G8CA 4G85A 2G40A 3I9MA 3SHFA 3GLIB 4QUDA 2YV5A 1Q1QA 4Q3DA 1BGVA 1UXKA 2BMDA 2G25A 4TYQA 5A5GA 1N7JA 4OA5A 5ILGA 3SF0A 3CVUA 2X1HA 2QXTA 3CR8A 3Q3GE 4OK5A 1E9RA 3TD6A 4M86A 2Z56A 4DV5B 4LYFA 4Y9SA 3OZEA 1RFGE 4M9XA 3TSYA 1N25A 1IHPA 4RA9B 5EUCA 4B09A 1NBHA 4B3SB 3BIXA 3U31A 1H2ZA 4KRXA 5F1OA 5KNBA 3Q15C 3I52A 5JROA 4AECA 3V6LA 2OBNA 1NONA 1JRLA 1SZPA 5DCLA 1BDBA 2JJQA 1IJKA 2J7PD 3NGLA 1UKAA 4JIGA 2QGZA 4X92A 4IV0A 4KXVA 3EW9A 3WL4A 1LK5A 1QR2A 2VDQB 4FYJA 1AV6A 1GEEA 1HYHA 3RUFA 5ALKA 2E4YA 3CZCA 4IGAA 2JHFA 3RTAA 2YXLA 3TW0A 4ZDKA 1V11B 4YXWD 4GGPA 4LTMA 1XTTA 4Q48A 5BW8A 1FNBA 2JARA 3SYMA 4KPYA 3QEMA 3FYHA 2ISSD 3O8QB 5IF3A 1ESMA 1JHPA 3E23A 121PA 2X9VA 4RTKA 2V98A 1IN4A 5KWJA 2WTAA 3K9LA 4F5EA 3ZDRA 1L7BA 1QG4A 1MXHA 2Y1XA 2YFKA 1XDWA 4MQ5A 3IJ5A 1JG1A 4AJNA 3QNUA 4KR6A 1JWAB 4YUYA 2HSZA 4X90A 1Y33E 3N86A 4B7XA 2BGWA 4RW0A 3L4BC 3UJNA 1CVLA 2O0HA 3V7NA 5K4HA 3O73A 2CHUA 5EYPA 4XEHA 5EIHA 1NP6A 1KZ7B 4EKNB 4Z8YA 4TWBA 3TJZA 2B4KA 3PEFA 1ZL2A 2PJZA 721PA 1JSZA 4I7EA 1JKFA 2VZEA 3W8DA 4BYGA 1IZZA 1U28A 3P2EA 2CHVA 1YT5A 1UH5A 1I2MA 4RQTA 1UMCA 4WZBE 4BAUA 4BXOB 4MDFA 1OILA 3M3PA 1KEKA 2FOLA 3TRHA 2GBLC 4L50A 3GCZA 2C20A 5DI3B 3R0XA 1P31A 3OZXA 3ZJ4A 2ECPA 5JY1A 4NZMA 5CW1A 4TLLB 1ND6A 4LMPA 3DV0B 4P2GA 4RJKA