1T2NA

Structure of a thermostable triple mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKAPPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVYSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Structural basis of selection and thermostability of laboratory evolved Bacillus subtilis lipase.
pubmed doi rcsb
total genus 68
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2004-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t2nA00
3IUMA 3EQ9A 3BDVA 4BYMA 2B4KA 2PBLA 3H2IA 3C6ZA 2Z5GA 5AO9A 3STXA 4E11A 4YX9A 1YR2A 2XUHA 4QWMA 1FFBA 1DT5A 1MX1A 3OURA 4Y7DA 5FRDA 2XUKA 2WSLA 2HRRA 2XUJA 1XQWA 3SK0A 1W75A 4Q82A 4BB0A 1W6RA 4LXGA 4OB6A 1AZWA 4OD0A 3I2GA 2Z3WA 5ALHA 4JUIA 4GLBA 3SC2A 4Q05A 4FFVA 4KRXA 4J03A 1CUHA 5ALKA 1LBSA 5DYTA 3DEAA 4HXGA 5HCUA 2WU3A 1XLWA 5H3HA 1WB6A 2AJDA 5JADA 4QDTA 1LPNA 2BKLA 1DQZA 4AZ0A 4G8CA 1B6GA 1DX6A 1F8UA 1TCAA 5AKLA 4U2GA 5CBKA 3VDXA 3ZLVA 5AIAA 1H2ZA 4WY5A 3TRDA 3ZLTA 3NUZA 4AO7A 1XZKA 4H7KA 4FMPA 3CCCA 4FFWA 2HU7A 1CUBA 2GYWA 4GDMA 4K6HA 4J0JA 4KR0A 2PX6A 2H7XA 2XQFA 3R3UA 1P0QA 1EA5A 2WUDA 2QUBA 5AKZA 5DWDA 1EDDA 3R3ZA 2C58A 1E8MA 2GBFA 2X8BA 1JFRA 2CJPA 4P93A 2R8BA 3G8YA 4OB8A 3QMVA 2RIPA 4P08A 1XQXA 4BVKA 2HA2A 2CBGA 2HA6A 5CT9A 3ILSA 2V97A 2XMQA 4IH1A 4BBZA 1JKMA 4W1QA 1GGVA 4H7DA 2WM2A 3AILA 2ECFA 3IUNA 3WKCA 2WUFA 1ZJ5A 4G4GA 4C4YA 1CPYA 3H2GA 2I03A 5AM5A 3IBTA 4KE8A 1USWA 1EH5A 1F0PA 4UBIA 4AX4A 3H04A 4FNGA 3WIOA 1Q0RA 5KBYA 1VA5A 2GYVA 1BE0A 3H0CA 1ZD2P 4QZVA 2PUJA 5AI9A 2OQIA 2VT7A 4FLEA 1BRTA 1SCQA 5AM0A 3I2FA 2ZYSA 2PKYX 3RARA 3BF8A 1L7AA 1YAHA 3E0XA 3WWPA 4UHHA 3WK6A 2XLBA 1ZJ4A 1E3QA 3IUQA 5ALPA 4BZZA 1WPRA 2QTBA 1RP1A 1K5PA 3MUNA 2GZSA 4I19A 2ZYHA 1JMYA 3B3QA 4CG3A 1LPOA 3EF3A 5HK9A 3BE8A 2IX9A 5AK3A 2VAXA 3HJUA 3FYUC 3V1LA 4FTWA 3O0DA 1BROA 2H7YA 1QOZA 5CTAA 2B20A 5D6OA 2RGUA 3HZOA 4OU4A 4Y2RA 4Y2TA 5JAHA 4CG1A 5CH3A 1XRMA 3F96A 3I28A 4BAZA 1NU6A 1RYYA 4W63A 3DD5A 2C0PA 3HLKA 4FWBA 3R0VA 1H2XA 3A2LA 4ETWA 5CXXA 2OGZA 4KE9A 2VQ6A 1XQYA 5CH8A 5AM4A 1YB6A 2PSJA 4O08A 1QFSA 1P0IA 2PSEA 2WIKA 1UK6A 5A7GA 4KRYA 5HF8A 2XUIA 4BVJA 2WJ3A 4EY7A 4X3CA 4XX1A 1MU0A 1DT3A 5ALYA 4AZ3A 1DTEA 3B12A 2XDWA 4FLFA 1YB7A 1CV2A 1MO2A 1R3DA 3F8SA 3G0IA 5CT4A 2Y2UA 4QA9A 5DTIA 4X85A 4BAGA 1LBTA 4BZWA 4G9EA 2WHRA 1XZFA 4Y9SA 5ALIA 1VJ5A 5AKJA 2QRUA 2DSNA 2GYUA 5HZGA 2EDAA 2VA9A 1YS1X 4EUSA 3ED1A 3FYUB 1XRRA 1YCDA 4QDXA 4Q3LA 3ICVA 5FKJA 5JD5A 3R41A 1QLWA 2WJ4A 2E3JA 4C6HA 4WFKA 1CLEA 2XMZA 3ICWA 4M0MA 4X97A 2ACEA 4ARBA 4F60A 2XUDA 3G9TA 1XZIA 4DNFA 5AKKA 4QLOA 1ODCA 2HFJA 2GBCA 3H18A 4P92A 2VJDA 4DYHA 3G0CA 3WKDA 1A7UA 1U8EA 4BCBA 1OXMA 2QM0A 1UOOA 5FV4A 3E1GA 3X3HA 1FSSA 2ZYRA 4J0DA 4IH4A 3QPAA 1UT6A 3RKSA 5AHXA 4L0CA 1YSCA 1ZGBA 3A6ZA 4BAUA 4C01A 4CFSA 4S0XA 3MUOA 2BAGA 2OGSA 1UZAA 3W04A 3FVRA 2QOEA 2O7VA 4DMKA 1ZOIA 5KREA 1YA4A 5LZ5A 2AJLI 4WCVA 1K6EA 3KDAA 3AZQA 3E4DA 2I3DA 4J3JA 4X00A 4YPVA 3D7RA 1XZEA 1AUOA 1CUGA 1XZHA 4UFPA 4UHDA 5AKIA 3PUHA 2VAVA 5SYNA 2BCEA 1UKAA 1IMJA 4BC1A 1KEZA 3H19A 2WHPA 4WFIA 1G5FA 4LYEA 1EVEA 3WWDA 2XMCA 3BIWA 4EY8A 3T52A 2Z8XA 1MNAA 1O6FA 1NU8A 2XUOA 3UUFA 3DYIA 2B9VA 5BWCA 4TPKA 5JAPA 1N1MA 3DS8A 4FHZA 5AI8A 3BDIA 1XZJA 2RHWA 4MEBA 5ALLA 5ALOA 5CT5A 3R40A 2J4FA 5DNUA 5ALMA 4F5ZA 1UXOA 3QPCA 4IH9A 1R9NA 3CXUA 1VXOA 3SX4A 5D3ZA 1LZLA 5YASA 1SCKA 3C70A 1EK1A 1CFJA 4X6XA 2OG1A 1VZ2A 4FBLA 5C8ZA 3LIIA 2JGIA 3VXKA 3VJLA 5LZ9A 1W52X 5AKYA 4WDRA 2OGTA 5ALEA 1DX4A 4B81A 1QJ4A 2OCGA 4BE4A 3C6BA 4IO0A 1EVQA 1XZGA 1R88A 4PSDA 1W4LA 1XRNA 2BJHA 3STWA 4OB7A 1GXSA 4OYYA 2WIDA 5K3DA 2ZSIA 1BN7A 5T4FA 4HXFB 1CUEA 4NVRA 3H1BA 3NGMA 5F4ZA 5ALDA 1CUWA 1LPMA 1MX9A 4DMFA 4MQLA 4DNQA 3PDCA 5AK4A 2ZJFA 4KE7A 1BEEA 2YASA 1L7QA 2C5FA 3AIKA 4W1PA 1TQHA 4HXEB 2VATA 3WA6A 1T4MA 3R3WA 3I6ZA 1UWCA 3STVA 2WHQA 4BP9A 4B83A 5LZ7A 1THGA 1BCRA 2OLEA 3DYVA 1R1DA 5AKXA 1E5TA 1U4NA 1CUYA 2J4CA 3W2TA 3CN7A 4KAAA 4DGQA 3FCYA 3F67A 1QIEA 1GKKA 2WHPB 4EBBA 4UPDA 2BFNA 3WWOA 5LYYA 1TK3A 4DSAA 3G7NA 2AJ8A 3FYUA 1DQYA 2DHDA 5T4EA 2PSHA 2H9YA 3P2MA 2ZYIA 4G5XA 2HRQA 4CIAA 3FLAA 4Y2QA 4MWSA 5AI6A 4I4CA 5AKHA 4LIPD 3HC7A 3HXKA 1ODTC 1WHTA 1UFOA 3FOBA 4BCCA 1N8SA 1B41A 4TGLA 5AI4A 1J07A 2Y2VA 3HRHA 1VZ3A 1O6GA 2WFLA 2PL5A 2BUAA 3ZI7A 5A7HA 3TJMA 2Y6VA 3IA2A 3EQ8A 3OC0A 3WL6A 1JU4A 4UFOA 4GI1A 5AOCA 3O95A 4OCZA 1CVLA 3WK5A 4BVLA 2BGRA 5BV7A 1XKLA 4GW3A 2XQGA 4UUQA 4YK7A 5AOAA 2QUAA 5ALUA 2D5LA 3EBLA 4AMYA 4UBMA 4AQDA 4A16A 5HKAA 2WIGA 5JD6A 4L72A 2X76A 3O9VA 5AICA 1FFAA 1W76A 5LZ4A 3C6YA 3PF8A 1S8OA 5A6VA 1CQWA 2WJ6A 3HI4A 5D3KA 1XZBA 2BGNA 4HRYA 3H1AA 4KAFA 1M33A 5EHQA 4B80A 1CUJA 3I2IA 1HL7A 7YASA 4UHCA 1EHYA 3I2JA 4ITVA 4JNCA 4ZI5A 5DLPA 1ZD4A 1QIHA 1R4ZA 3FWHA 3DKRA 5E2IA 2PSDA 2ZVDA 3W05A 1VLQA 1GZ7A 4GXNA 3C8HA 2QMQA 3ESDA 2OCIA 3PI6A 3G0BA 3LP5A 4DNOA 4H77A 2QKYA 2G5PA 4DIUA 2HA0A 1KU6A 4H7FA 4WJLA 5FPQA 4HS9A 1IUNA 1UKBA 2B61A 3FYTA 2HA5A 2QVBA 2HDWA 1CEXA 3FSGD 4X90A 5LP1A 2JGKA 3O4GA 3FSGA 2QJRA 5A71A 1LGYA 5LKRA 1UK7A 4BP8A 4QWWA 5AI0A 5C8VA 1EDBA 3WZLA 1GPKA 3UMJA 1A88A 4UBNA 3G9ZA 2UZ0A 3FLEA 3NOXA 3FNBA 1TCBA 5HKBA 1SCIA 2J3DA 3QH4A 3C87A 3C6XA 1EDEA 4DM7A 5EFZA 1TAHA 4H7IA 5CH5A 2JF0A 5HK8A 4X6YA 5ALJA 1AX9A 4EB0A 1WB4A 2HADA 1IZ8A 4RNCA 1Q83A 3R3VA 5AM2A 4J0IA 2O2HA 4FLMA 1THTA 2I78A 4H7EA 1MPXA 5AP9A 1EI9A 3O4JA 4Y2SA 4N5HX 3F9CA 1QGED 2OPHA 4UHFA 1JJFA 4C87A 2CB9A 3V9AA 3STYA 4G4IA 1ZICA 2XT0A 2PU5A 3QMWA 5KWIA 3CCBA 4ZWNA 2DFPA 1A8UA 2C7BA 2AJBA 2H1IA 3D3NA 1ZI8A 2EEPA 1LPBB 3QITA 4FDMA 4KYVA 5JASA 2FJPA 5EI5A 5HQ3A 4NZZA 4B9EA 4N8SA 2HA7A 4X71A 3E3AA 1MT3A 2PVSA 3L1JA 4F21A 1TKRA 3IUJA 2V96A 5A2GA 1YA8A 5BWBA 1QFMA 1DWQA 3OM8A 2P8SA 1K8QA 2XUFA 4H18A 5DTJA 1LNSA 3QM1A 3MGAA 3WK8A 4LKOA 3STUA 5AJHA 2ROQA 3R3XA 5CMLA 3STTA 3JYHA 3BL8A 5ALGA 4AO6A 2WLSA 3WJ2A 1D07A 1GPLA 1W1IA 2XUQA 3A70A 4K2AA 1SC9A 4EY5A 2W22A 5D7BA 4UFNA 1VE6A 2XUGA 1HBJA 3ANSA 1FJ2A 4BTVA 1ZD5A 3U1TA 5JANA 4BDTA 4GHWA 3DQZA 3NWOA 3WA7A 4ZRDA 3WZMA 4XIIA 2EDCA 5E4JA 2LIPA 2VJAA 3PUIA 1TIBA 4FNMA 1HKHA 3WWEA 3BJRA 2HL6A 1GT6A 4UBKA 1UKCA 1QO7A 4AN0A 1E89A 1LPSA 2XLCA 3SWWA 4Q1VA 1XFDA 5K3CA 4X6UA 4F0JA 3G9UA 4PW0A 4EY4A 5K5EA 1K63A 1N5MA 1X2EA 5LIPA 1ZI6A 2DCMA 4N8DA 3W9UA 2XMDA 6YASA 3O4HA 2WG1A 3WWCA 1DWPA 4BDSA 2V9ZA 3WMRA 5HF6A 1AMNA 2QT9A 3BWXA 2WILA 2G5TA 1OILA 2WKWA 4PV7A 5AK6A 1QZ3A 1G4HA 3HACA 2VEOA 3OG9A 5JAUA 1AKNA 2YYSA 1MJ5A 5IVDA 1VKHA 2Y1KA 1QTRA 1X2BA 1BCSA 5ALRA 5JZSA 1Y7IA 3V1KA 2WU4A 3WIBA 2FJ0A 3KSRA 4CCYB 3O9MA 5IVIA 4N5IX 1XZCA 2AJCA 5I8PA 1OCEA 3D2BA 4G8DA 2WFMA 1CIJA 5IVKA 5AM1A 4ARAA 1BU8A 1DWOA 3K6KA 4HAIA 5HFNA 3K2IA 1DINA 1A8SA 1C7IA 3LS2A 4B84A 4NMWA 3VISA 3WL8A 1G66A 2IITA 4KAJA 3GA7A 4LXHA 1MAHA 3BF7A 4UBJA 1QONA 5CURA 2OCKA 4HVTA 4X7BA 1QTIA 2G63A 5C8XA 1H23A 3VVMA 3LCRA 5HF9A 3QYJA 1UK9A 1AC5A 1XRQA 1QE3A 3QMMA 3Q0TA 3TEJA 1Q84A 1DU4A 1QIGA 1WOMA 3EIOA 3D4LA 3V48A 5IH7A 5ALXA 5E4TA 4L9AA 2Z3ZA 2PU7A 4Q3OA 1XLVA 1HPLA 2XMSA 4OUKX 1T2NA 1F0NA 4PSCA 4U2EA 4PNZA 4ZV7A 1CUDA 4AXBA 2W6CX 3DDUA 4UHBA 3PFBA 5EIHA 3I2HA 4JYMA 4GBGA 4Y2YA 2HA3A 1R50A 4K5QA 4AB1A 4BCDA 4ROTA 2VF2A 3M83A 2WG0A 4RGYA 3D59A 4D9JA 2XUAA 3G0GA 4WDQA 3PF9A 3D2CA 1SOMA 5ALNA 2XQJA 3WK4A 4BATA 4Y2UA 3UUEA 4E46A 3N2ZB 5JATA 3LIPA 3WLAA 5E4YA 2CKMA 4Q3KA 3O4IA 3GZJA 5A7FA 4UHEA 5FOQA 1LPAB 1EK2A 1JU3A 4JH0A 5JD4A 3ZPXA 1P0MA 3I2KA 4MYSA 3AIOA 4X95A 4RE5A 3OPMA 3KWJA 5HFAA 1TCCA 4MQMA 2VJCA 1ZGCA 3LLCA 5DNWA 3ZV7A 2O2GA 5ALFA 1HDEA 3I6YA 1ZI9A 4QEKA 5ALTA 4X92A 3DLTA 5FDFA 2VJBA 4DNPA 4KEAA 4CIBA 4GWLA 3HABA 4H35A 3AJAA 5ALSA 3A2MA 4DSZA 1ZIXA 4Y2VA 3KXPA 2ONCA 3W06A 1Z68A 4CI9A 5EHXA 3S2ZA 5CT8A 1QIIA 2WIJA 4IHAA 2VSQA 1UK8A 1UOPA 4N8EA 2QXTA 1ORVA 1J1IA 2C4HA 4Y2PA 1HLGA 1I6WA 4BE9A 3QZUA 1QIFA 3M81A 4MJ3A 4QDZA 4UBLA 4P9NA 1EX9A 1ZIYA 5DYYA 4KACA 1AQLA 2JGMA 3M3DA 4G9GA 1JMKC 4AMZA 5C81A 3OTQA 4PF1A 4DMHA 3V1NA 4B0PA 1XZDA 2OAGA 4BTLA 1MTZA 4EZIA 5C7YA 1LZKA 2HHAA 4A5SA 5JAOA 3WQHA 2K2QB 1BS9A 1MNQA 2VTVA 2X5XA 1Y37A 4UBOA 3MVEA 2CMFA 1IZ7A 4Y2JA 5IKXA 1CUCA 1K4YA 4LHEA 5EIAA 1ISPA 5DJ5A 3CN9A 4GEGA 2Z8ZA 3WL7A 5ISMA 4ZGBA 3IVMA 1ZD3A 1P0PA 1WM1A 5DYWA 2QZPA 2RHTA 1VE7A 4H7HA 1FFEA 3H2KA 4MEAA 1XRLA 3IIIA 2GZRA 4ZXFA 1YASA 3H2JA 3RLIA 2OQVA 1JT2A 1XKTA 3YASA 4OYLA 1Y7HA 3PICA 4KJXA 4B85A 4HRXA 5BOVA 4AO8A 2CEKA 5IVHA 4K6GA 3DNMA 1SFRA 2HU8A 4INZA 5AKEA 4G8BA 4TVKA 1LLFA 1EB8A 4B9AA 2Y6UA 2I3ZA 3GELA 2RONA 1X70A 5JIBA 4C89A 3L1IA 4PSUA 3PE6A 2C0QA 2PSFA 4B6GA 3K9BA 4FOLA 5ALZA 1IVYA 5AOBA 1U2EA 4W9RA 3FVTA 2XB6A 1R9MA 1CUUA 5ALVA 2WUEA 4C4ZA 2QR5A 5CXUA 3ZLUA 4I3FA 3AIMA 4DTCA 3FBWA 4U2CA 3H2HA 2OAEA 2O2IA 2ZJ7A 5AIBA 3G9XA 3C43A 3PFCA 1XZMA 2GBGA 4ZV9A 2QS9A 4OU5A 2JBWA 3M82A 3A2NA 3GUUA 3ANTA 3DCNA 2XMRA 1CUXA 1H2WA 2JEYA 5FUMA 2JGEA 1GKLA 2ZSHA 4L3WA 3BIXA 3DL4A 4CCWA 1C7JA 1F6WA 5AI5A 3QBJA 2Q0XA 1EXWA 4U2DA 5J3JA 5HQ3B 3D0KA 3D2AA 5LKAA 1QO9A 4U2BA 5AH0A 3F98A 1XZAA 2NW6A 3L1HA 4G4JA 3TGLA 1JI3A 3RM3A 3DOIA 4QE3A 3DKKA 1PFQA 2J3QA 1ORWA 4QLAA 5CRIA 2HU5A 1H22A 4OPMA 5A62A 3FCXA 2D0DA 5CT6A 1XQVA 3G0DA 3V1MA 4J0GA 3WKEA 4BRZA 2H7CA 2BUCA 1CUFA 3ESAA 2JGFA 1EINA 5I9IA 5EHZA 1Q0ZA 4KE6A 5HF5A 3WYNA 3F97A 2DHEA 4V2IA 2XQKA 5AM3A 4ZREA 5FLKA 5EIEA 1CUAA 3GFFA 2QJWA 4HZGA 5EGNA 4FBMA 4AN1A 4GECA 1H2YA 1A8QA 1LPPA 3DOHA 3FLBA 2DQZA 3B5EA 3IULA 1XZLA 5JZ9A 1E8NA 1RWQA 4B82A 2HA4A 1YS2X 3AZPA 5JZBA 3G02A 2WG2A 3HYSA 4H0CA 2ACKA 3C45A 1IUOA 2O7RA 2YXPX 2FUKA 4J0HA 1ODSA 4RE6A 2VT6A 3WL5A 1KU0A 3KD2A 5JYCA 5DNVA 4QDOA 3T4UA 5T4HA 1QIKA 5T4BA 3C5WP 1J2EA 4OSEA 2JGJA 3DJYA 1HQDA 2GBIA 5EHNA 4C88A 1CUSA 3WKAA 3H17A 2WTMA 4C4XA 1CR6A 1CUVA 3AINA 2CZQA 4HTAA 5AK5A 1WB5A 4B0OA 4LYDA 3ESBA 3R3YA 5FP0A 4Q34A 3AFIA 5JALA 2XMGA 4DLNA 1BN6A 4PQEA 1MAAA 4XVCA 1WPXA 4Z49A 2DQYA 5ESRA 1FFCA 5I7UA 2OXEA 1CUZA 2WFZA 5FPPA 3IDAA 3JW8A 4FKBA 2V98A 4BC0A 2AXEA 1J06A 1VOTA 4A23A 3DL7A 2WUGA 3WI7A 4K6KA 2WIFA 1QIDA 4H7JA 1ACLA 1XRPA 2XI4A 5KWJA 3HSSA 3Q8WA 5K3FB 4CG2A 2OCLA 3QVMA 1UOQA 5FXMA 1GPNA 1YAJA 4WY8A 3HEAA 3I1IA 4JYPA 5K3FA 1VA4A 3ESCA 3IB3A 3C5VA 3W9BA 4EHBA 1G42A 3AUKA 4E14A 1JJBA 3IURA 4MWTA 5AKGA 1ETHA 1MN6A 1EB9A 4J0CA 3WJ1A 1E8DA 1IUPA 4J0KA 4B7ZA 1WHSA 4J7AA 3C8DA 3FAKA 3JWEA 5ALWA 2XQIA 3GBSA 1CQZA 1ACJA 1WCYA 2FX5A 5LZ2A 4YASA 4QNNA 3AZOA 3N0TA 2BUBA 1FFDA 4LXIA 1E66A 4IQ4A 5K3AA 1N5RA 5CW2A 2PUHA 3BJMA 3WKBA 4MYDA 1BEZA 4M0EA 2JGLA 3OOSA 2WQZA 4EA6A 1CUIA 1QIMA 3WK7A 1VXRA 2XUPA 4CCYA 3KWFA 4Y2XA 2HM7A 2RI6A 4WFJA 1L7RA 2IIVA 4QDUA 1CRLA 2C5GA 5SYMA 4EY6A 3GROA 2ZJ6A 2PM8A 2ORYA 1C4XA 4W1RA 4E15A 2WFLB 1JJIA 5JARA 4W1SA 1GQSA 2JIDA 1GQRA 2R11A 1XLUA 1NX9A 3EQ7A 2PPLA 3WYDA 4BRSA 4NS4A 3VVLA 4PO3X 1PJAA 1QIJA 4X94A 4XWGA 2YH2A 1XROA 1AURA 2DR0A 5LZ8A 3S8YA 1PV1A 2G4LA 3I1YA 3RK4A 4G1FA 3U0VA 3BXPA 2XMBA 2QXUA 2ES4A 4DMCA 5K3EA 4JEIA 4X93A 4M0FA 2RAUA 3ZWQA 5K3BA 3QPDA 1TRHA 5ALQA 3VJKA 4X91A 2JEZA 1AGYA 2HFKA 2HIHA 2DHCA 4MXDA 4RPCA 2XE4A 4U2FA 3VKFA 2CUTA 1MX5A 1U65A 3D5EA 3VJMA 3WK9A 3KOOA 5LLSA 2WTNA 4XJVA 3I6MA
chains in the Genus database with same CATH superfamily
1KY2A 3NORA 4GP7A 4KQEA 3RAPR 4XDGA 2AUTA 2QRVB 2XHZA 3GLUA 4F45A 1Z8HA 3BDVA 3LKZA 4B3TB 1X1SA 3R6GA 2BZSA 2X77A 2QR3A 1XMQB 1NR7A 3EVFA 4B75A 2V8BA 2AJTA 1K7EB 2JLZA 5NULA 5D5HA 1A71A 2BLLA 3IEKA 4OBWA 1Y8RA 4RVUA 3G85A 5HBRA 4CMEA 5KDOA 3I5UA 3R4CA 2HEGA 4FN5A 1XU4A 3GD7A 3JD2A 4CE6A 4EJSC 5GOZA 5CDFE 1AG9A 1YR2A 4DPKA 1QVWA 3EZXA 2EKPA 2XNSA 2GPAA 5F5NA 2EP5A 3WYEA 1PW7A 3S1AA 1NJFA 3RODA 1DT5A 1IHDA 1PGQA 3ZHCA 4CL8A 5G0WA 1M2OA 3ZCPA 4JLVA 1ULAA 5DK6A 3VTZA 4RVCA 1AMOA 1XQWA 1YMQA 1SQFA 3BHIA 1OPRA 3KTAA 4FGJA 5REQB 1B74A 2HD4A 1W6RA 1BH6A 2QDKA 1XDDA 3CUUA 3RSOA 4LZZA 4X7RA 3LQ2A 3BRCA 2IUFA 1M2OB 2C9CA 4L9RA 2CZCA 1MOSA 1EGAA 2BKEA 3O47A 5DF1A 3TCXB 5CA1F 4O3MA 2VRWA 1SB8A 4WNAB 2Q41A 3QOFA 1EDOA 4Q05A 4YRPA 2FGKA 3IPLA 4FFVA 1PSDA 5CBPA 1ILEA 3FDIA 3PL5A 1JHVA 4RYLA 1N2SA 2B8JA 4J03A 3UV6A 3NHWA 1CUHA 5IKOA 4B4UA 4EUEA 3AVVA 4DB2A 3SIPA 8OHMA 1SXIA 4UTXA 3WIDA 5JYBA 4I4TA 5DYTA 4TUYF 1DTWB 3G82C 3DEAA 3X1KA 4CCSA 2Q5EA 2PGNA 3VV2A 3K5IA 1OI7A 3KPYA 4HEJA 1DDOA 1TD1A 3IQWA 1XLWA 2IQ5A 2J9YB 4DOMA 1NRWA 1WXFA 1IOZA 4HNRA 2LD4A 4A6EA 3BJEA 4QDTA 1N92A 1LPNA 2C96A 2ZZKA 3I09A 5CJ2A 1DQZA 2VXCA 2WT8A 3PD0A 4KQ2A 3NCTA 4JBLA 4W8HA 4KIJA 1YRHA 2H18A 1NPYA 3MCZA 4WLUA 5K3SA 1DX6A 1ZEJA 2JFZA 1G1MA 4A8JA 2EKLA 1Y5IA 2EYQA 3H4IA 1TCAA 2X5JO 3JR7A 4U2GA 4WEQA 4C30A 1N6RA 4WCDA 5MGNA 3FF4A 5AIAA 3EFHA 3ZLTA 3EG5A 4RA9A 4OHBA 1BD3A 3NUZA 4YXWD 3AI1A 3K96A 3U7QA 4BMYA 1OVGA 4AO7A 3DMHA 2RFLA 4FMPA 3CCCA 3M3HA 3I6QA 5J1SB 5IN4A 1ZWLA 1IY0A 1M6HA 1QF7A 4CL0A 2HU7A 4WKGA 3OLVA 1GIAA 4GDMA 3F90A 2FA9A 4J0JA 2FUEA 2V1XA 1GQYA 1ZGJA 4DG8A 1Z63A 2C2OA 4M8IA 1B15A 3EVCA 2QUBA 2OAP1 4FGLA 1KI6B 2AYYA 2FCRA 2HF8A 2QORA 1W96A 3EAGA 5F77A 3I5AA 2JFNA 3PC7A 1IONA 1A72A 3FKQA 1LV8A 2C58A 3H4MA 2MT9A 3F5FA 1E8MA 1ZO8A 4NEHB 2GBFA 3OWOA 1NN0A 2FG7C 4ZJUA 3ML1A 1OQAA 2JJ8A 4B6JA 1UH5A 3HS3A 3VZCA 3TX6A 5JCJD 1ZGZA 2RIPA 2CXNA 3BJZA 3CLUC 4HAOA 1KP9A 2DTXA 4P08A 1QANA 1XQXA 2RB4A 3NJ4A 4JDPA 3LSYA 3TL2A 1CETA 1O3YA 4R2HA 3L6OO 3P2KA 4GM4A 3VZRA 1HDRA 2GPSA 3JY6A 4IXWA 1WMFA 3B1YA 2O6HA 4IZIA 1UMKA 3IT3A 1JA0A 5JR3A 3IA7A 1J25A 4PFQA 3DBRA 4AYXA 5E7QA 5LYJB 4H7DA 3IUNA 4OAPA 5D86A 5DM1A 2O8EA 4OHMA 3PKZA 4JL5A 3ZJVA 2ZLBA 1XKQA 4RW0A 3SJUA 1WCWA 3X43A 4LHWA 2PRZA 1XAHA 5LXTA 1T35A 3K9QO 2OBYA 1WQ3A 3E1SA 5K51A 4CM3A 4K88A 4CKBA 4FMDB 1D6MA 1JLRA 1CQXA 4ES6A 1JNYA 4O4HA 1WSDA 3WRWA 2GAFA 5HBGA 3E81A 2Q1XA 4HF7A 4IOLA 4NEQA 3D8TA 3LCVB 4OQEA 4P7GA 4PY2A 4X1KA 3T7CA 3GJ0A 3IKTA 5KVQA 5LXTB 1K66A 4OK5A 4CGZA 1RI5A 1H2AS 2JI7A 3H65A 3HEMA 3IAM6 2VPIA 4TRNA 2X0DA 4AX4A 4LNAA 4C07A 4ZV4A 5JVDF 1L4NA 1R3UA 4UREA 3WIOA 4DB4A 1JHRA 1VA5A 1Y80A 3DDSA 1BE0A 4K0RA 4E2ZA 1L4LA 3H0CA 3LV8A 4JQOA 4CMGA 4A9AA 1X7WB 2ZRFA 1QCYA 3K05A 4M87A 2YN4A 3CWQA 3ZHQA 2EP7A 2VT7A 1SCQA 4NAHA 3BS4A 4CFZA 3QX8A 4FFOA 1VG1A 4FE4A 4YXWA 3O84A 1F20A 3C24A 4NU8X 4DUZB 2FFHA 2PKEA 2F1HA 1K08A 2TMGA 1BX3A 2R6JA 3K30A 4GRAA 4C03A 2NTYC 4XE5A 1EFRD 9LDBA 2WU1A 1DJMA 5FPYA 1D6SA 1HE8B 1BVYF 3HCOA 3WWPA 3E0XA 1PEKE 3F78A 2FYTA 4ARIA 3WK6A 3QBTA 1F8GA 3PTLA 1BZYA 3F6RA 2FSGA 3ETJA 3P52A 3CONA 2WWYA 4TS4A 4O8ZA 3EWAA 2WWRA 1Z0KA 2R7AA 5JZVA 1UMBA 3BH0A 4FZ3A 3AESA 1FVXA 2J5KA 4I19A 1T2AA 1JMYA 3W1WA 5FAXA 2CLCX 4CG3A 1AUQA 1IZYA 1INLA 4MCJA 4WEOA 3U56A 5EZ5A 3BCRA 5JBIA 2BZGA 1Z38A 3BD6A 1TO1E 3VAYA 3P2JA 4H3VA 4TMYA 3VZPA 1GWNA 5HS6A 3QXXA 4LDPA 5FJJA 3E9DA 4CPDA 5CCEA 3SG0A 5KTPA 2A5JA 4M99A 2Y1GA 2ZRAA 4YRCA 1JDVA 1VKOA 3C8ZA 4MPJA 3ROPA 3NAGA 4IF4A 1YVUA 4MYTA 1TM7E 3R9KA 3W5UA 2I7TA 1H4SA 2B20A 5D6OA 3LNCA 4ZI7B 3FCOA 5DT9A 3OA2A 3EWSA 4RFSA 2HNBA 2XOKA 4V02A 3O8BA 1KGSA 1TUGA 1YB4A 1MB9A 3AOEA 5IS2A 2DZDA 4UEQA 3ZK8A 3N05A 1JQDA 1QZUA 1NU6A 3TZEA 2AN5A 3BSFA 3PEYA 1BDMA 5JC1A 5HE8A 1DFGA 1QSGA 1G5TA 1KMHB 3GLQA 1XVIA 5BP7A 4UUAA 3FDZA 5KYUA 3VPBA 1P5JA 1Z0JA 3AQIA 1TI7A 2PS0A 4L4SA 4F38A 1E4OA 3V97A 1BQ3A 5KSWB 2WAAA 2Z6AA 2O2YA 4OQFA 2P9HA 2HSJA 2Q1UA 1L7XA 3LUFA 2GLTA 3TXYA 3BK1A 1EE1A 3ENQA 1AZTA 2H48A 3OLXA 4BL5A 5BWMA 1XMOB 4URVR 3E9MA 5EQTA 2Q07A 3DA8A 4EG3A 1YB6A 1FYXA 4CLOB 2BMJA 2VNHA 2QTVA 4LZNA 1C3JA 2CC2A 2WSIA 1BFKA 2YIVX 1V9CA 2OXCA 4FFDA 4Q66C 1E9EA 2GJSA 2EJBA 3D4PA 5EPUA 5EEHA 5BVGA 2IS1A 2HMUA 2CLOB 4IDDA 3ILHA 3QFHA 4M4SA 5B12A 3KU1A 4KRYA 2VHUA 4RKQA 1UR5A 5JDIA 3BWDD 4H08A 2R6GA 3DEJA 1PG2A 2WJ3A 4GOJA 4NG4A 1P3JA 4X3CA 2QVXX 4GYKA 1R0WA 1UFVA 1DT3A 3H87A 1DTEA 3B12A 1Z4LA 1YB7A 4M8NE 1H8HD 1MO2A 2R6FA 4Q4DA 5E1MA 4BNXA 2XB4A 1EFAA 2QW1A 2YWEA 2CHEA 3OTWA 4WUTA 5ADWA 3AV0B 2PZFA 3F8SA 3KQNA 1MZVA 1VLZA 2P2SA 3JQ8B 3P9KA 4HH3C 1YQDA 1I6LA 1GAEO 3G0IA 4ZYYA 4FDUA 3LUDA 3UQZA 4AVYA 2O5RA 3RT1A 1CBUA 1U6KA 4ZCIA 3DGEC 3VKUA 2FFJA 3IT0A 2IU0A 2W7TA 4EMBA 3MWFA 5H3LA 1PSZA 2XTMA 5JSYA 3AJ8A 4Y9SA 2ATXA 1VJ5A 2C9DA 2NVUA 2QMUA 2QRUA 1GGEA 2IF0A 2DSNA 2YNMD 3ASZA 3DZCA 2GYUA 2IYZA 2JANA 3VHQA 1QK5A 2HQSA 5KCMA 5HZGA 5EWJA 1ZHOA 1FXUA 2XNDD 2W2VA 2PG3A 3NIWA 3FOAA 2IV3A 1LBIA 1RQRA 1UMCB 3PJRA 1JYEA 4X8LA 5BOSB 4EUSA 1VI6A 1I9CA 3FWNA 4PRZA 2IZZA 4NFHA 1Y3FE 4R2XA 1JEEA 1XRRA 3GK3A 4PBSA 2W6JA 4BASA 4LRSB 2JAQA 1P1RA 1Y3BE 3BUSA 3C7DB 4QDXA 2WM9B 3ICVA 5MFZA 2AC7A 4R7TA 3NNSA 2AZ4A 4E21A 1LX7A 4EHHA 3HKCA 1QHYA 3UMRA 3VNQA 4C6HA 4J2TA 5U4XA 4WINA 1OXSC 1JTFA 2XMZA 3ICWA 1KR5A 4JX8A 1Z4MA 3LD9A 1RFLA 3A9VA 3AUJB 3PG5A 4R7GA 4DCJA 5COQA 4KX5A 4F60A 1PGJA 1R8XA 3CF0A 1SK8A 3G9TA 3PFWO 4CMIB 3HM2A 1XZIA 3NHLA 3V8MA 4DNFA 4QLOA 4DLWA 2JJYA 1C50A 2IDJA 2ZETA 3AQ4A 4R2KA 2GBCA 1X14A 3M4JA 1KO8A 1MRNA 3H3FA 1BDBA 4BMCA 5K7SA 2FPXA 1FYDA 2VJDA 3C3XA 3CT6A 4NDZA 4DE5A 2PGJA 3DAYA 5ELMA 4DCSA 2YMPA 1N2JA 6ABPA 2YZ7A 3JRWA 4QJBA 2D54A 3JR3A 4Q1FA 3SIWA 4Y9UA 4MR9A 1Q0PA 3UA4A 5JSQA 1PZEA 4YCAA 1SO8A 3NOQA 2A1UA 4R9UC 1TYBE 2QD4A 3D81A 3E1GA 1E62A 2D2IA 2ZU0C 2ZYRA 3LH5A 1Z33A 1OXUA 3MFYA 2O5EA 4EDFA 3N7AA 3AKCA 1NL3A 4R81A 1E9BA 1C3LA 1ZA1A 1U9IC 1UMBB 5EXTA 3RKSA 1AKUA 3QXCA 1DHTA 4L0CA 5IYZA 5FT9A 1NMYA 1Y6JA 3BXEA 3DCYA 4RXUA 4HMQA 1IZ0A 5KAPA 1TZBA 1LVGA 1P19A 5EYPB 4DLVA 1FDUA 4BAUA 3N74A 4O0LA 3B60A 3PQCA 4ZD6A 1YACA 2VF8A 1BU5A 3BRWD 4C01A 3FX2A 4LJYA 3UM9A 3MUOA 1N7IA 2BAGA 1USUA 3AF4A 3DYBA 5DGIA 2W2KB 4H15A 1P2UA 5DHFA 2WNIA 5B5SA 2QOEA 4CV1A 2O7VA 3VYVA 2ZUFA 1JG7A 1XTKA 4U6QA 4KXVA 1M5TA 4KIUA 2FSSA 3ZXSA 4JT8A 1YK1A 5LZ5A 3H5RA 1W0CA 2A9OA 1MFPA 3O2JA 4FWIB 3I4LA 2JGDA 1G3MA 1KZ9A 2NV0A 3OCXA 3QVSA 4XQ0A 3AZQA 2QQFA 3OCVA 3ABIA 3G2QA 5KWVA 1EGHA 3GYGA 5EP3A 2BDUA 4E2WA 1N9ZA 2Y9PB 5AXDA 1XZHA 2FQWA 3TZCA 1Z0AA 2QW8A 2CLEB 4XWOA 4UD2A 4EI8A 4UQLA 1JGTA 4OM8A 1D5CA 5IULC 3IFSA 4MGEA 4BVHA 3BG5A 4AP9A 2QVGA 2VVTA 3LDHA 5DXAA 1L4UA 1Z62A 1UKAA 1IMJA 2BCEA 1N4AA 3RTDA 5KYUB 4JXXA 2PJRA 1BGXT 2BRUC 5CXQA 3RKRA 4C0HA 2AL7A 3A8TA 4XD2A 2O3UA 5DGHA 5CFRA 2YOHA 3WQQA 1SBHA 2WAXA 3QLUA 5K01A 4KI7A 3BFJA 4YAEA 4FHDA 3Q0EA 1ZIDA 2C4UA 2X2PA 1IBLB 1YVDA 4NCNA 4DF3A 5B7GA 1J99A 2M6RA 4LJ8A 3TGWA 1VJCA 5ARBA 1X7ZA 3U3ZA 3L7OA 3LX6A 2VTKA 4P34A 1WP4A 1MNAA 1NU8A 2XUOA 4M7WA 4D82A 2E6KA 2FUG1 2C54A 2WABA 3G8BA 4YRGA 3GJSA 1R0KA 1MH1A 2ACVA 3DTTA 2ZJ0A 3EZ9A 3PEUA 3UPTA 2YVAA 1NQOA 1R0CA 2OT3B 2WF7A 3CURA 2RBEA 4U6SA 3RJTA 3Q3HA 2BMVA 4TLCA 4NL4H 1R0SA 4BGUA 4C7BA 2ZGVA 4DZZA 5TPZD 3E7XA 4FHZA 3FMIA 3DOFA 1SZPA 1QC5B 2OGWA 2V74B 2DUNA 1BHSA 1KZ4A 2AE1A 1U8AA 3BDIA 3MG9A 1I5OA 2RHHA 3EOBI 3QBDA 4Y1RB 2VC2B 2DM6A 3VR4H 3LWBA 1Q7BA 1U3TA 2C2BA 3G5UA 3TOVA 3DZ8A 3U3XA 1JIQA 1GUYA 1LK5A 2EHDA 1DJPA 5ALLA 3CRVA 1ZC3A 4J3NA 2CNLA 4WECA 1PZFA 3K0CA 3R40A 4JCOA 4PFKA 3D1JA 1DXHA 1EX1A 1HY3A 1VCHA 1T3TA 4A0SA 2GLUA 3SR0A 1F2TB 1EFPB 2PCJA 5DNUA 1W5SA 2WZBA 1ZA2A 2I29A 3QPCA 3DFFA 3W5IA 1A76A 4PYIA 1OLUB 1R9NA 3GU3A 1VXOA 4JVLA 3WB0A 1VJRA 1KQOA 4LNUA 4AJPA 2E4WA 4UE2A 5EQFA 1W4ZA 3KXIA 1LZLA 4WVFA 1UJ4A 1SCKA 2A94A 4BNYA 1BQ4A 2J87A 2J7KA 1NV9A 1OTYA 3OEWA 4BN0A 4ER7A 3M2PA 3O8OA 2OG1A 3CNEA 5JMWA 1PUIA 4F4CA 1U2QA 2AG0A 1U6JA 5HKKD 3A2KA 1Z26A 4EHAA 2XWQA 5C8ZA 2BM0A 1R8QA 4LJAA 1DFHA 4U39A 3ZN2A 2F00A 3OQNA 2OWEA 2BSXA 3HGTA 3VXKA 1IH8A 2NO0A 3V00A 1Q1ZA 5CDYA 1RQPA 3GMIA 3PYXA 2FEMA 1SQSA 4IM7A 2WYWA 2I1VB 2Q9CA 3HDJA 3KSMA 3KSAC 5ALEA 2RBKA 2V9CA 4NC9A 5IK2D 4F6RB 4ZDJA 1AKTA 1CRQA 5E1DA 3ZHOA 4EZBA 4IKEA 3G2NA 2X9GA 4O4JA 4R8KA 3DXFA 2H2DA 3IQIX 2WMDA 3UT5A 3LBHA 4LWPA 2JK1A 1G9SA 4MINA 1V26A 4UPVA 1W4LA 2EKZA 2BJHA 3WDKA 3ZVLA 4PLZA 3HWX1 5EJ9A 4E88A 5FD8A 2EQ5A 4ZJYA 2IH5A 2O2ZA 4PZEA 4AQYB 3IJPA 3N8HA 2X6TA 2WIDA 3QX3A 4OO3A 4N40A 4R7ZA 2DWPA 4MVJP 2EQBA 4DR5B 3V80A 2F62A 3H1BA 2XW6A 3BKXA 5HMLA 1L5OA 4D3XA 5DHPA 2B69A 4OJTA 2CXPA 5ALDA 2FY8A 2PFGA 1XZNA 1LPMA 2Q62A 3C7AA 2OO3A 3P7MA 5EIFA 2OZLA 5JDIC 4BFLA 6LDHA 3KEMA 2H8KA 1UM9B 3KETA 3HA7A 4ZGWA 1KO5A 1M0SA 1ZIPA 3PDCA 5AK4A 1G6Q1 1GGMA 4JMPA 2FMFA 2RHGB 2ZJFA 3OZAA 4KE7A 1I8TA 4R1LA 2ZUTA 2WFAA 3FR7A 3UCFA 2EP8A 3ZWNA 3SZRA 4BU1A 3DTVD 5ITSA 2EC5A 2PX4A 4W1PA 1NQXA 3F47A 4HXEB 2J48A 2GZHA 2VATA 2XWPA 4UNPA 5CTJA 5B6IA 1VKJA 1Z6XA 1T4MA 4RPJA 2ZJ1A 3L4JA 2GCOB 3R3WA 3I6ZA 4ZT7A 3U4CA 5M29A 3STVA 3U16A 3L4BC 5HZMA 3B9QA 5D51S 4O33A 5LZ7A 1GUBA 1NY5A 2R8YA 1UKVY 2QRMA 3IAHA 4BVGA 3BYZA 2R4UA 1JQBA 1BCRA 1XJQA 2VJKA 1BXGB 2YV4A 2B2XA 2HMWA 5IT0A 2YWCA 3OOEA 1QYCA 4UU1A 1QM5A 2JCYA 2I2XB 3IQEA 2Z30A 4Z4CA 3NC1C 1UBKS 4I55B 1Z4JA 3AEQA 5JAZA 1OB5A 2D1YA 5TNXA 1BJTA 3MWLA 3FCYA 1F0YA 1Q11A 2Q8PA 3IKVA 4XWKA 4DV7B 3FPGA 2C5AA 3E05A 3O8RA 4HWRA 1LH0A 3QXSA 1GKKA 2D74A 5FA5A 5C8YA 3SDBA 4ZHSA 2CFOA 1BA3A 3BQ9A 3FE2A 2ZDGA 1NLYA 2JGNA 4L3VA 1QAMA 4KBYA 5JISA 3EISA 4FCCA 2Q50A 2QLMA 3DONA 3PHLA 4GPBA 3N75A 5FUWA 3HP4A 2G9UA 3K2EA 4C0JA 1VI5A 3W2FA 3T9FA 4C78A 1NXTA 3N0XA 4QHSA 2C7OA 2WR8A 3FYUA 1AF4A 3B5JA 1ZXXA 3PNOA 3QUQA 1T0JB 1E7RA 4C4OA 3S1SA 3AT1A 3TPFA 3SN6A 3IV6A 4DEXA 4MQFB 5TY0A 4U7WA 1W5BA 3P2MA 3G23A 5CB4A 2GXUA 3K0BA 4B8ZA 1LF0A 1SD2A 1QH9A 1MXFA 3FI0A 3QLUC 1JDPA 2HRQA 7REQA 2O54A 2VTBA 3IDFA 4X54A 3AVTA 1FYWA 3CWCA 2ONJA 1UWVA 4BQRA 4IJMA 4Y2QA 4MWSA 3M5PA 2PWBA 4Z4QA 3Q12A 3BGIA 2C2MA 4F96A 1U2DA 1SIWA 3GUCA 1BXRB 2NXEA 3HXKA 1U8YA 3W5JA 4BUJA 5C3UA 1VG0B 1FFSA 1JXOA 3F6SA 4C3UA 1LS6A 1RCTE 4CKWA 1KJYA 4DV5B 1CULC 1NUPA 2IHZA 3ONWA 2AXNA 1E6UA 3RUHA 2XVXA 4EB6B 3QQ5A 1EZZA 4UDXX 3GEGA 4FJ1A 5JJCA 4MDYA 4BKOA 2MWMA 1VZ3A 5CLFA 2H92A 3U6KA 3IXQA 4EPWA 3O4FA 5ITZA 1ZHFA 1Z0UA 3JQGA 4PFJA 1H8EA 1UJNA 2OFPA 4KAXA 4PIMA 5HQTA 5EMHA 5AESA 2MYPA 2ZRIA 3HP1A 3EQ8A 1JN0A 3BD9A 3M4NA 4YRMA 1SKBA 4MW1A 4N3CA 1RXUA 2EGHA 3L7AA 4TXHA 4W6QA 1ZR4A 5HKOA 4CQLB 3WP0A 1MVOA 1PX0A 2PX8A 1TJPB 4BUZA 2JIOA 4AZSA 4DCPA 3G1UA 2BGLA 2QN3A 1GGHA 2C97A 2YDYA 3WK5A 1Y6GA 4BVLA 2XH8A 3OM0A 3AH8A 1CR2A 2JHGA 1UBHS 2PL9A 2ZXEA 5SY4A 2IFTA 2QW0X 3KFLA 3DAHA 4DKXA 2IYQA 3L7BA 5E8JA 3UPUA 4M2LA 3MSXA 1YBVA 3B2QA 3H5LA 5KNBH 2VHQA 3AF1A 1E3TA 3GX1A 4QU0A 3D4NA 3HFJA 4IJKA 4I3HA 3FUVA 3RVOA 1SBNE 5ALUA 5FTKA 2D5LA 5FHQA 3OX1A 4AICA 4A0GA 2A5DA 3O1LA 4DLUA 5KIAA 5JJIA 5BRAA 1D7AA 3QF7A 4KLAA 3OT1A 1NONA 2H1SA 4MW2A 2ARKA 1OBCA 2VP2A 4PQRA 4WLEA 5CPBA 1NJ8A 5ER9A 4BWVA 1IEXA 1L2TA 2B7LA 3EAQA 1PS9A 1OU0A 1RZVA 4QGAA 4Q1CA 4TL8A 1RC1A 3V9PA 5A1JA 5JHHB 3PRHA 4AC9A 2QBYB 3CZ9A 2PWZA 1KA9H 3O9VA 1Y1KE 2HPVA 2PMFA 2C4KA 1FFAA 4LV5B 4RLSA 4EY3A 5IEBA 2K6GA 1YQWA 3UNXA 5ERXA 1XDBA 2P9QA 1QH0A 4RVGA 4IQ0A 3UAXA 4M8LA 2HN9A 2PRSA 4WOBA 2O2EA 2ZRDA 1WLYA 2DUWA 2BFPA 2X0KA 1L4GA 1U7UA 1VJ0A 3PDUA 2VXOA 4LZWA 4YVFA 2CT8A 3ILVA 3H1AA 2ISCA 3K32A 1RZRD 4NU6A 3QKUA 4Z0NA 1KJ8A 4Q4JA 2M6LA 3KKMA 4KAFA 2GD0A 2TMYA 4B80A 3HVRA 2RC5A 1PVDA 2DUMA 2ZRKA 4ALIA 1FYFA 1T10A 4IVNA 1DADA 3P97A 2RG1A 1PJSA 1EHYA 3I2JA 4UHCA 7YASA 3ND8A 1IEWA 1PR3A 3INTA 5DBEX 1HORA 2B4AA 4HNUA 1I4TD 4ZI5A 1IN6A 1NE7A 1RQGA 2VBGA 4GX2A 3SNKA 1LQ2A 4FDVA 3FWHA 4KL8S 4ZRNA 3JQAB 3SQMA 4Q21A 2PSDA 1SOUA 3W05A 3DPUA 3G89A 3GT3A 5KYXB 4FYYA 4KRGA 4V0NA 5EXDA 2MSNA 3SJZA 4GXNA 3EIXA 1SK9A 2H4FA 2V0GA 4PXSA 3C8HA 2QX9A 1TA0A 1HA3A 1UT5A 2PVCA 5EZYA 1G8AA 2OCIA 3O3MB 3RTAA 1DNPA 4Z4FA 1MRSA 2VDPB 2NPOA 1NASA 3G0BA 3GIDA 2BHRA 3LP5A 4MVXA 5DM2A 3SBEA 1J9EA 3A1VA 5L40A 1WBBA 3UAYA 2QL9A 3C7TA 2YINC 2DLCX 3TQCA 1NW4A 1H8HA 2BI7A 2G5PA 2RKWA 4HS4A 3LPLA 4TKUB 3N1UA 1BH2A 3FPEA 2QL6A 1Z7BA 3VHXA 2JA2A 3GPIA 2JIBA 3PNBA 2F4NA 4UHKA 4EKEA 3VRHA 4KODA 1UKBA 1TVKA 2VDOB 2HDWA 1NZFA 2QX7A 4J43A 5F52A 4MA0A 2FN7A 4M49A 4KQFA 3FSGA 2YZKA 4P2GA 4HFMA 2YVKA 2QJRA 4UXJA 2ZIEA 4RJ2A 1OT5A 2ASVA 3CKYA 4ZCQA 1XVTA 4BP8A 1I01A 3IRUA 5TT1A 1ZL2A 2DU8A 2NVWA 2AN3A 3E8SA 1R7RA 3AKDA 4HH0A 4REQA 3D6MA 3UJPA 5FL7D 1EDBA 1KETA 2DR3A 2R9VA 4IX1A 3A04A 4FILA 1WKBA 4X8HA 3TRHA 6AT1A 2VI5A 2AEFA 3DBHA 4IGAA 3T7TA 3LOQA 4LI3X 1CHNA 4Q4CA 3TGPA 4Z4HA 1MC8A 4R5HA 3FLEA 3A7EA 3SKYA 5JBNA 2W6JD 1P4HA 4HH4A 3PHJA 3OIDA 3A6FA 3B9RA 4RGQA 2IS4A 2J5BA 2ON6A 1GL7A 1LLQA 3KFVA 3QH4A 4HQLA 2C07A 4MI1A 4JL6A 3T0GA 3TW4A 1NRJB 2I6SA 3LBIA 5I7HA 2FH5B 4LJRA 2GN6A 3IRVA 2PWAA 4GAEA 1M2FA 4J2OA 3RGWS 1HRDA 1N33B 4ZVUA 1DLJA 2QP4A 4H7IA 1U9CA 4MWZA 4JOCA 1GPBA 5FB3A 1A7JA 2PTHA 5DNYB 2PMCA 3CGGA 1W36C 4X6YA 2FPMA 3E5NA 1AX9A 1DARA 1GD1O 4LOKA 4YO7A 1PGOA 2YL2A 3RIHA 1O1YA 2IJGX 3OE5A 4EB0A 4XQEA 2PH3A 3ESYA 2HADA 1IZ8A 4LF9B 1TQ8A 2QIOA 1BW9A 2FPPB 4N7BA 5CIYA 4J0IA 1OH5A 3SM9A 1E1KA 1TRKA 1UDAA 1SVMA 4Q4HA 1FF9A 3H5NA 4FLMA 4QNMA 3TFQA 4EVQA 3IB6A 4WXPA 1KE2A 2IHNA 2R68A 1S3GA 3UXEA 1UEXC 4P33A 1Q7EA 1UPUA 3HO8A 4IIJA 2I78A 4B71A 1OGIA 1R9GA 1N2ZA 3QRWA 5TVKA 2ZS9A 1MPXA 1Y3IA 1POWA 2WNSA 2FZCA 4Y2SA 5EWMA 1CDDA 3P4UA 4BX8A 4KIWA 3F9CA 4AMUA 1SGWA 2O3QA 3R6TA 3KYBA 1JJFA 1O4WA 4C87A 4I0WB 2CK3A 4F04A 5HKKA 2W6QA 4CLRA 4A8HA 3WDMA 2WSMA 2QMYA 1JRLA 5FWXB 4Z4IA 4D43A 2DJ5A 4ZCRA 5MDHA 4PG5A 1VHQA 3STYA 2XTJA 1CD5A 5EUMA 3DBRB 1AA6A 2C2KA 3QMWA 1AHHA 1ZZEA 1JHQA 2ANBA 3EWIA 3G6KA 3IP1A 1YVEI 4FFBB 4W9MC 4ZWNA 4ZYTA 4EJ2A 4XVHA 3UK7A 1A8UA 3AF3A 3ER6A 3K0AB 1OMOA 3LHFA 3D6UA 4UJ3A 4CLEA 4ZT6A 4L5IA 2V6FA 3TLBA 2H1IA 2IELA 4QOIA 1OXTA 3D3NA 3U3KA 2EEPA 3PC4A 4AYTA 5JLJA 1E7YA 2PZBA 4MKGA 5EE0A 1NF9A 3LUJA 2P69A 4XGNA 4K40A 1QB7A 3TD6A 3QTLA 3TQSA 2B8NA 4DCCA 2QBYA 3QITA 3ROQA 4BQPA 2PBZA 1JLKA 2QSJA 4AP6A 4US1R 5KMGA 4YP9A 5HVNA 2Q28A 4BNMA 1I2AA 2VH2A 3KQPA 1N5KA 3HADA 4JD5A 3FPBA 2QTHA 2X2OA 4NZZA 2VCEA 4TRRA 1QFZA 4Z0HO 4N8SA 1UBEA 3OFVA 2HA7A 5M34A 4B76A 3UJ8A 5IM4F 2QYOA 4I4NA 5TSDA 4D6PA 2A86A 4OP3A 3O74A 1CJCA 2W6MA 2PRIA 1JS1X 1N5IA 3B48A 2D1RA 1TKRA 4M22A 4MI3A 4R8LA 3ZEIA 1CDOA 5G3ZA 1X3SA 3A6HA 1PUJA 1XDGA 1ZU5A 1LQUA 1RKVA 1E3SA 1YC5A 1QFMA 3QVOA 1EBFA 1L7EA 2PX2A 2WU0A 1E5QA 4C43A 1XEXA 1SRRA 1X74A 1XCOA 3RJ9A 2L0XA 1CF2O 3MERA 3MWKA 2QI9C 4JLKA 1FA9A 3E2PA 4RELA 4TZTA 2AXPA 1F60A 1UC5B 3QM1A 2WKQA 3STUA 2CVFA 4F92B 4YT4A 3QFFA 3V55A 3Q7TA 1UQRA 4DR3B 1WXDA 3STTA 4S1TA 1ZC4A 1F38A 3JYHA 2B99A 4BO1A 1E1RA 3OSUA 3GMTA 2Y1EA 4D3SA 4OIFA 2QU7A 1GARA 4EG0A 2H57A 4X66B 4MR8B 3D7LA 1KZ1A 4EDHA 1M6VA 1D07A 4LOJA 3IV9A 4EG6A 2QRZA 4MH0R 3JWIA 1EFHA 3EXEB 3UB2A 4UUNA 3DSRA 3JARA 2AFHB 1XU7A 4EY5A 4HDSB 3BOSA 5JXIA 2W22A 3JWPA 3T7IA 4Z7JA 4JITA 3T41A 1HTWA 4RX1A 3LC7O 4MVJI 4RZUA 4PLFA 2Q7OE 2BFOA 1AZSC 4JJZA 3HKEB 3ZQJA 3EXEA 4I5EA 2ZBDA 3QOYA 1T6XA 2YHBA 3A1CA 1FJ2A 2NSLA 2BRUA 1E4EA 1AHNA 2JAOA 4E5DA 2R4TA 1PJBA 2QVYX 2AKEA 4YALA 3EPHA 4LRYA 3AUAA 1P3Y1 1F4VA 2WWXA 4O5AA 4FXOA 2BKXA 1K97A 1P33A 3AVOA 4UUBA 1MV8A 3WZMA 1NDUA 1ST2A 2IQIA 3JD1A 4FC6A 4XIIA 1KSFX 1YCFA 1G2IA 4BS9A 1BWRA 4E7PA 2LIPA 1WXGA 2VPPA 1Q3KA 3HPRA 1W1WA 4OL9A 4ZOLB 3ZCTA 1IPHA 2CLIB 3DFMA 4AUKA 4DMUB 1XV5A 1SD1A 2PXAA 2W6NA 4IIHA 1CY2A 2A0WA 1BHQ1 1HKHA 1G38A 3M6FA 3BJRA 3H83A 3RANA 4PC3A 1PT9A 1S1MA 2BBSA 5I4IA 5KYNA 1GT6A 1THZA 1G8HA 1WVMA 5GM2A 2FSUA 4OL0A 1CJBA 4WMLA 1JKJA 4XUDA 1RYBA 3WAJA 3PFFA 4HD8A 3W2IA 4UBKA 1ML3A 4RCVA 1PLKA 1U0SY 4GKBA 1U28A 4MS4B 3HSYA 3VI3B 3CSDA 4RKEA 1CK4A 4DSNA 1WXXA 4GFDA 4WGGA 1KPIA 2OHOA 5TJ9A 1UPAA 3N2LA 2QG6A 2WJJA 1CFZA 3MS7A 2XLCA 3OZXA 4RA6A 3AC0A 4UVHA 3BHNA 3W2EA 1QHXA 1V43A 1ZN2A 4EUNA 5DLQC 1J2UA 3PDJA 3SOZA 3EUAA 4PAQA 5T64A 4YQFA 2C8JA 3UMYA 4OHPA 2RSLA 2HT1A 1IQPA 3IUPA 3RV3A 4PW0A 3AM5A 3EARA 5K8UA 1B0PA 1YI1A 5DOVA 3VSCA 4P0TA 1K63A 3JVUA 4P4SB 4NR0A 3WLTA 3ZDXB 3P5SA 4EKDA 5HUJA 5F3WB 3MEQA 2W2KA 4WXRA 1X2EA 2IBMA 1ZI6A 3W9UA 3P94A 1FFYA 1D8AA 3RK0A 2ID4A 2QD2A 3CNHA 5FI3A 3EDYA 4YACA 2O6LA 2ZJYA 1TO2E 1VYTA 2FWNA 2IZ0A 4DHEA 5PNTA 2ASEA 1KFJB 1K0UA 1VIMA 1HYQA 2V9ZA 1WPGA 5EVJA 1ONPA 4OQNA 5HF6A 3UWKA 4XYLA 1H9CA 3RVJA 2Q9AA 5LIRA 2WILA 3H6HA 3WGIA 1OILA 4CMEC 1D2GA 9ATCA 4ZICA 4TTIA 1IBKB 5G53C 2PGDA 4LSZA 4BO3A 1NXPA 2D8MA 2DWQA 3HO1A 2JAXA 4R8VA 2FEOA 2ZUEA 2ZYGA 4Y2VA 1MT0A 4N47A 4UM5A 4YS6A 1YR6A 2VEOA 2OYCA 5K8JB 5DGXA 5EE5B 3OG9A 1C9KA 3PENA 1GPH1 1RRPA 4RPIA 3RSQA 4R2JA 1UWLA 2P41A 1N1GA 3AVWA 5KSOA 2Y1KA 2PUVA 4II2A 5JPIA 1ZESA 4RIHA 5ALRA 1OIXA 1DHRA 3VZBA 4P98A 1APBA 2A5YB 2R48A 2WU4A 2NZ8A 2PXHA 2ZJBA 2GAIA 2DPLA 4ZZIA 4YBRA 4PAMA 3AL2A 3FHCB 3GZNB 1A5TA 3S2ZA 3SJCA 2UYHA 1VGRA 2WMNB 4LJKA 4OBBA 2JGRA 3OBIA 2IIPA 3A6LA 2HMVA 4AJOA 1GTJ1 5I7OA 1U6IA 4V0QA 4EHJA 1YKFA 4ETIA 3NEJA 2ZT6A 2QQEA 3FWKA 3RS2A 1U4OA 2IHJA 2BJVA 2V7XA 1XWFA 2BEWA 2ECQA 4LQDA 3KJQA 5JCXA 1QDUA 4G8DA 1E3MA 1T2VA 1W35A 4WZAA 1L1QA 1WABA 3D8UA 1NV8A 4ILKA 1LA2A 1U02A 3LVRE 3PCTA 5A4KA 1LX6A 2R3SA 3CJRA 4MZXA 5AM1A 4ARAA 1BU8A 1DWOA 3OF2A 4HAIA 4WOCA 4C5CA 1P8JA 5D3MB 2A92A 1X8LA 2PLAA 3AP1A 2XZPA 4A92A 1RIFA 1X86B 2DWUA 1KTIA 4YHHB 1K2VN 3LT4A 1A8SA 2RKBA 3B1JA 3LS2A 2OG2A 4M0KA 4TTPA 3RSSA 4E08A 4F71A 1A3CA 4B40A 2XZLA 3QHAA 3N5KA 1G66A 1KZ7B 1U0EA 2QLBA 3QNUA 4J90A 2IITA 2P2GA 5IUNC 2O3SA 1KVRA 1U3GA 1NOIA 1WV1A 1I2CA 1NM5C 2FB9A 3GA7A 1MAHA 3R3JA 4UBJA 4PTLA 2YWXA 3JQRA 3MWDB 2JKYA 1A5AB 3L8HA 1TYZA 4WI1A 2OCKA 1SXGA 1QYXA 3IKMB 1BE8A 4MITA 4DANA 2O8NA 3QG1A 4YT5A 3G5MA 2A9JA 2QRJA 2VBFA 2ACWA 2Y68A 3ZOKA 4ND1A 1K68A 1EE9A 2EJCA 2M6KA 2V9PA 4KN6A 5C8XA 2YBEA 2OCAA 3IMFA 4FEYA 1WLSA 4QPDA 3EYWA 1FDIA 3KVRA 2P2LA 4MQBA 2X9NA 3DV0B 3R1IA 2WF9A 3GN2A 4ADSG 3VAAA 2QM3A 2AC2A 3D0RA 1AC5A 4HO1X 2P2CA 4CLDA 2QLJA 5EE3A 4YAOA 3TTSA 1XRQA 3HI6A 1WHSB 3Q0TA 3T5BA 2BR5A 3TEJA 5FLXA 3VR5A 1DU4A 1JQLB 1G3UA 2IRWA 2GF2A 3V48A 1JXAA 2J07A 3QUTA 4KLCA 2I2DA 4RLHA 4UJ5A 1W19A 4NYMR 2A0XA 2A7QA 1M6NA 1QH1A 3NTVA 3ZIAD 2GA9A 5HWSA 3AMVA 1XLVA 3Q0IA 3TCNA 3VYSB 3X1ZA 1HPLA 1QP7A 1UL1X 5GMOA 1ISGA 4F4UA 3O1JC 2Q4OA 3DOCA 4U2EA 5JD3A 5DX1A 4UTPA 4AXBA 1NC3A 4RTRA 2UUOA 2JAUA 1Z5GA 2J6HA 2W6CX 4FR5A 3W79A 4TYQA 1XTPA 2GILA 4LEIA 5SZKB 3MXOA 1WKCA 2OFXA 2EW1A 5I7VA 3G8CA 4JT9A 5I9LA 2I71A 3R7AA 3ZGZA 1T3LA 5BMOA 2KQUA 5IRCD 1G18A 1GFSA 4L2IB 1AA9A 1RDFA 1R4MA 2XUZA 1GFWA 2XF2A 2HA3A 4OHKA 1P2TA 2HWWA 4K5QA 5G1OA 4NCAA 4AQDA 3THWB 2IY9A 1LSJA 4JASB 2UVQA 2D59A 3FI9A 2CFCA 3CX4A 3CZ5A 1NQUA 1NULA 4GQAA 4ROTA 5FUVA 3VNUA 3CVUA 2QLLA 2C4TA 2D5BA 3PP8A 1Z0IA 3D59A 3GAMA 4RIEA 4NE7A 5E95A 3RFCA 3D3JA 1PDWA 3VVCA 3OPYI 3PF9A 3RSZA 2O8CB 1WVGA 3TLJA 1QYRA 3BK2A 1TF7A 1VRWA 3FNHA 4N4AA 1J22A 4CUJA 4DABA 5TMPA 2OORA 5ALNA 5TR9A 3U40A 1BYIA 2QRLA 2JJMA 3RAEC 1G16A 2Z4SA 4OXXA 4LSGA 2PMWB 3LPAA 4PHTA 1XD2A 1VP3A 1R66A 4M6WA 2G9RA 3N2ZB 2QZSA 4R1QA 2ZSBA 4Q5IA 1Z8FA 3PC2A 1R6XA 2QJOA 2CKMA 3IQFA 2G83A 1JLLB 1B14A 2CSUA 2EJVA 1CZUA 3CRW1 4YFVA 5JU6A 4CWAA 2H4JA 4UHEA 4JCCA 4WNAA 2HLPA 2PA3A 4QDJA 5HTKA 1J8QA 2X0FA 3CRQA 1UKZA 1D03A 1FNCA 1GTZA 1TK9A 3EEYA 2H1VA 2Y99A 3C6QA 3L6DA 4R0MA 4F85A 1GGFA 3VNBA 4EFKA 3T7KA 1P0MA 4YTEA 1NYRA 1RLIA 4IDHA 3EXAA 5B37A 1NSYA 1ZX1A 3KWJA 2H8GA 2ET6A 2NU6A 3NO4A 4ATNA 4HLNA 4MQMA 4QTUB 3K0KA 4Z9YA 4WHMA 3R0XA 3X1MA 3KQLA 4ON9A 1ADCA 4M9UA 4YMSA 1KJNA 2I4NA 1YRYE 3X0DA 1UJ6A 2JIZA 3PNKA 1WNTA 4I1OA 3RWOA 4DIKA 4Z7NB 1UKYA 1YO6A 2I4RA 2X58A 2ZANA 4M7PA 3LDGA 4PCUA 3SYNA 2FWAA 3OLQA 4MIEA 4Y1EA 5KTNA 2ZAOA 4D56A 5L3VA 4LG1A 1FS4A 3P9YA 3U49A 5ALTA 5LQRA 4X92A 4R3WA 3DLTA 2VJBA 2WD7B 3OZRA 3B70A 3ZIUA 4D9KA 1GQQA 3O8DA 5JAIA 3RADC 3QEMA 5B6PA 4NX2A 5DHSA 5L4NA 3R7WA 4LCJA 4YRKA 2Q1TA 2AIRA 2FSVA 3KUXA 1A69A 2Y66A 3DMFA 3GQBA 5ARCA 3RIYA 4ZHQF 1QP0A 4IGEA 4GKJB 4V0KA 4KEAA 2B4RO 2PQ0A 1YOBA 3PWTA 4TMKA 3URMA 5HCNA 2W8BB 1OH8A 1DAPA 2HTFA 5AXAA 4MW4A 2XA2A 2DFLA 2AX3A 3BE6A 3DUWA 4ND5A 3NOVA 4M1YA 4OJNA 1ULUA 1Q0SA 3GR6A 1T1IA 1ZMBA 2QF7A 4H35A 1K7CA 1ZUHA 3REGA 4A15A 2V3CC 3AJAA 4A8PA 1GG9A 1FUUA 3A2MA 3BXZA 5C0OE 4GLJA 1GPDG 1DMRA 2JL1A 4MHTA 1EUQA 1JJAA 1TT5A 1YV9A 1M7BA 1N1DA 2JLCA 2A9QA 2LKDA 1QHFA 2AI3A 2NZWA 5GONF 3HO6A 1OREA 3N59A 3GJQA 2IDZA 1L7VC 3FNQA 3IS3A 5EHXA 1T2UA 2PZMA 2P4HX 2XYHA 2LWIA 4K6OA 5CT8A 1VHTA 2AQHA 1DUIA 4P2BA 5H1YA 5HRUA 1QIIA 3JD0A 2HUNA 4O4JF 4IHAA 3TIIA 1JZSA 1JV2B 5HIJA 4RL6A 1HDYA 3GJ8A 2P68A 3L01A 5IT4A 5JUWA 4JHLA 3NVMB 2CFSA 4X7MA 1EBUA 5CEJA 4FIZA 1QHSA 1TVKB 4V1CB 1V1MB 4Y2PA 2JHFA 4XTRA 1IN5A 3D9QX 3FTQA 4UARA 2IUSA 2I99A 1THMA 3UK6A 1ZJ6A 1I6WA 3EGOA 1BDHA 5K2MA 3QZUA 4NDAA 2FEPA 2LIVA 2CVHA 2JZCA 2YFYA 4FN4A 3I3OA 2SCUB 5FH9A 1B76A 3V4RA 1S3IA 3WGVA 1K86A 4V0LA 1P73A 1DBIA 2PGOA 5ULLA 4B3RB 1G8SA 4GLFA 2EF0A 3VNRA 4UBLA 3DJFA 4TVSA 4TN5A 5DX0A 2J9FB 4N18A 1K3FA 1RD4A 3AJRA 1SUBA 2BE9A 4P7JA 5EY5B 4YRJA 3DEIA 2Q27A 2H08A 2JGMA 5ICEA 3SU8A 2C88A 4G9GA 3U9LA 1KDPA 3TLZA 1EPUA 1S9HA 2B21A 2IEDA 3VSDA 3Q7QA 4GPIB 3WGTA 1RLMA 1WG8A 3KKZA 2P1ZA 3KV1A 4XX0A 1TA4A 4CKEB 2BTQA 2RH5A 4NV0A 5C81A 2O8DB 1OFUA 4AY5A 3CVXA 2B98A 3C5HA 1FVHA 2FPIA 1PV4A 2O52A 4PX2A 1B3BA 3DDCA 1ACMA 1MEOA 2V0NA 3D8BA 4UUPA 1G7CA 3NIDB 2W98A 4TMXA 4RD2A 1DCKA 2W2LD 5JWRA 5JAOA 2Y1XA 3CR7A 3BL6A 1NVEA 3UYKA 1UBJS 3K53A 4X8OA 3TIXB 1XA4A 4NXMB 4TYWA 2FTKE 2VTVA 3MK31 3CNLA 4C7JA 4CKWB 4CF7A 1KOLA 1Y37A 4H1VA 3ST7A 3Q41A 4RVFA 3RC2A 1EX7A 1J97A 1TL7C 3KQVA 1W85A 4UBOA 5A4DA 3BEOA 3W5AA 2DSTA 1FMFA 1HETA 1BOFA 3RIGA 3LSTA 3RYCA 2QAIA 3DMRA 2PR2A 4XB6B 2ERXA 4LVOA 1P4AA 1RS0A 4DBVO 1ISPA 4JOSA 3ONEA 1DQNA 1OZFA 3QUSA 4HAVA 1G9XA 3CN9A 4WKCA 4PG7A 3E1KA 2C77A 3ED5A 4UZFA 3WL7A 2QXYA 3NHBA 4S2EA 5HIIA 1MQ9A 5ISMA 3JAWA 4PAGA 2AUNA 3KQUA 2JFYA 3WYBA 5EC8A 2OKCA 1P0PA 1KYZA 1WM1A 4DLXA 2W0MA 1FRVA 1OC4A 1H8ED 3IVXA 3JVVA 3NHJA 1P0FA 2HRCA 4L4YA 1AXEA 4H7HA 1JIIA 1FP6A 2HK8A 3PGXA 4HB3A 3AETA 3FSEA 3H2KA 4MEAA 1FNMA 1L8OA 4E5SA 1WZNA 4GR9A 1FC0A 2H5LA 1NI4B 4BXOB 5D1NA 1O4VA 2B5OA 5FBWB 1D4OA 2WINI 3G9QA 2R84A 3CLHA 1W44A 2F43B 1JT2A 2CXHA 4ZT5A 3YASA 4K86A 5HCIA 4TSFA 3U19A 2IYWA 1DAOA 2OECA 5CDFA 2O5CA 2YFKA 4FDLA 4CN9A 4EENA 4JBNA 4KJXA 2IOHA 1JFVA 4B85A 2RB5A 1V9SA 2GZAA 1KO4A 2FPWA 1HFWA 3H84A 4AZ0B 4KVAA 4AO8A 1V1RB 5IVHA 1S8AA 4KMRA 2ZWAA 4OA8A 1PN3A 4Z4EA 3DNMA 1A1SA 2K5UA 1DV1A 3BVPA 3PUWA 4CM8A 1VKNA 3L49A 4G1CA 2NV6A 4LBWA 1B73A 2VHTA 1V9LA 3JS5A 1ECCA 5JCOA 1NA5A 2AWNA 4ZJPA 5JNSA 5ES3A 2CDCA 4G8BA 4MUGA 3G6WA 3K5HA 4CEIA 3BRSA 1GFZA 2Y6UA 1YQXA 3UFXA 4X3PA 1PZNA 2Q3CA 3RJ5A 4B3BA 4A36A 3WOHA 5KYVA 5CA1A 2YJ5A 1FTSA 2EJWA 2QM8A 2RONA 3EA4A 3ESQA 5A5DA 1M5RA 3CO0S 1DEOA 1KVTA 3PKJA 3VI4B 4GPAA 3AV3A 4PSUA 1RACA 5A4MS 4CM7A 2PSFA 4B6GA 1OKKD 2Z5LA 2CNOA 2JAHA 5MN5A 1EUYA 3NHYA 4IIYA 1LRJA 3K4QA 4FOLA 5CP8A 3UFXB 1AQNA 4A2WA 2QM7A 3ETGA 4DA7A 5L3SA 1GUDA 1U2EA 3L0ZA 3ME5A 3TFWA 2PH1A 2I4IA 3FVTA 4PSKA 3IXLA 3CR3C 1ZHHA 3H5OA 1O9GA 1IWBB 3W3AH 5CFLA 5IT5A 3OE4A 5CLIA 2VAPA 4QIHA 2SKCA 1FQKA 1FP4B 2NU7B 2VNJA 3ORYA 1MGPA 4IS2A 4QUHA 3DL0A 4U0KA 1NUHA 2VDUE 5ALVA 2NZJA 5AW1A 4JXZA 5ABPA 4D3ZA 4MS1A 1FMCA 1GYRA 3JARB 3FUTA 3T3DA 4C4ZA 2YYZA 2QMEA 4PGFA 1UAGA 2BMWA 2JJ1A 5CXUA 1ZOLA 2GPWA 2CB0A 3BORA 3I37X 2P9BA 4HWTA 3ITDA 3VU3A 2R8OA 5IANA 4ZJZA 2Y05A 1WU8A 1UIRA 4UDNA 1JAXA 1JBKA 2YS7A 1YZQA 5H5JA 1P74A 1N2CE 2F8TA 3H2HA 3MB8A 3QIAA 5EZQA 2OAEA 4A4DA 1KBOA 5JEDA 3JWGA 5AIBA 3PR1A 3Q3IA 2IE8A 2Y9MB 1TF2A 3C43A 1XZMA 4WKBA 2YY6A 4WN3A 5AW2A 5KS2A 2QS9A 1U0HC 4GWGA 5IDYA 4OU5A 1B42A 2JCSA 1E6CA 2YJ4A 3AU9A 3AI2A 2NUAA 3BMOA 1JFFA 3MWEA 5T67A 3VHLB 2ZCJA 1COWD 2IEIA 4HNVA 3ANTA 3MJDA 3DXXA 3DCNA 2X6QA 4HLUC 4O0MA 3T9DA 1KHTA 2B83A 2W6PA 5EIOA 3W4JA 6CHYA 5FUMA 3GRVA 2BC9A 4A6PA 1Y9EA 5FLYA 1ZUIA 1GKLA 4L3WA 3ZYCA 3PQFA 5SZHB 4UTNA 3HNPA 1MG0A 1ZM9A 5ER6A 1CNEA 2P6NA 4HPJB 5EUCA 5ILGA 2PZAA 4WH0A 4RQUA 3SHVA 3R75A 4MYRA 4AKEA 2PX5A 2HF7A 1KS9A 4CEHA 1OHHD 3D2AA 1JG2A 3I9V6 4PR3A 4UTZA 5LKAA 1CZKA 1QO9A 4J2HA 4ZOEA 1KEUA 1YU9A 3L0CA 1UBOS 3F98A 5C7OO 1S9DA 2DPGA 3TCKA 3FNGA 1CLUA 2NZ2A 2F17A 3F7OA 3OQIA 1H2BA 1JI3A 3H16A 3QELA 1ZNYA 4YRNA 2JLYA 1K7SN 1OI4A 4QBKA 1TZJA 4PEVA 3DKKA 3QU7A 1PFQA 4XRRA 5IBPA 4E03A 1FPMA 1E0AA 1E5XA 3A6GA 3KR9A 1XCJA 5EMNA 5AUOB 3W8RA 4FFSA 2VJMB 3GA5A 3SZUA 4RH0A 4HZUA 1G2OA 5H4HA 3FCXA 2D0DA 3KB6A 3NXKA 1T2EA 1W85B 3WKEA 3ZV4A 4CMAA 1L1EA 2H7CA 5DM4A 3EZLA 3ESAA 3U1BA 1M2VA 1T4CA 5B3KA 3OQPA 3AR8A 3OCCA 4IVQA 1S2MA 3KOZA 4C76A 4ZYXA 5CYOA 5I7FA 1DQPA 4KE6A 3SHWA 2RGEA 4JKYA 1BTOA 2G1UA 3D7KA 5AYVA 1QZZA 3WYNA 5LU9A 3GEBA 3OEED 4S1VA 3HRIA 3DWFA 4V2IA 1SUSA 2GJAA 2Q4EA 2ZB4A 4FQ8A 4PZUA 1D4FA 5AD1A 5CA0B 1O0BA 4KR6A 2BCJQ 5AM3A 4GZ6A 3JQFA 1J8FA 3E27A 3GFFA 2JIMA 3PL1A 4HCJA 4MMYB 4RABA 4ZVLA 4B1FA 4G41A 1DCTA 2RGGA 1RVDA 1ZD9A 1ZVQA 2YV2A 1DEHA 3B38A 1RRFA 4Q1DA 4R1TA 3UHOA 2IYYA 3KDSE 1W59A 4O2AA 4PM4A 4Z86A 1BVRA 1A8QA 2DFDA 5EN4A 3R5TA 4MRSA 3DOHA 4AF7A 1PT8A 1TB4A 2DQZA 3B5EA 3I9NA 3L18A 3QVJA 3KDPA 3SXPA 4DFDA 4DQKA 1COZA 3IULA 5DX8A 4LJ5A 3Q2IA 3DHWC 2ZRJA 4G3XA 2YHSA 2VDMB 4NBRA 5DBFA 5BUCA 1E8NA 3GLKA 4GL4A 4YC7A 4B82A 1RRVA 4IW3B 1M76A 1UDRA 2NXNA 2SKDA 2BV3A 3WZ2A 5K9ZA 2K7FA 3G02A 2WG2A 4C6TA 4Q7LA 3KRTA 3OZWA 1WE2A 2JLSA 2EWMA 2F4VB 1OFTA 1ZNXA 2W42A 5HOEA 3K1YA 3MMSA 2IEGA 2DTEA 4R8RA 1CY0A 2ZT7A 1HLPA 2AZMA 3C45A 2WI8A 3GDFA 3QF4A 4E32A 4GGMX 1VL2A 2NUTA 1IUOA 1V11B 5FFMA 5L4LA 1KAQA 3E58A 1ZM7A 2YJZA 3N70A 4J0HA 2AFIB 3GGGA 1X7XA 1DO2A 2C9OA 1CE8A 2JVKA 2P6PA 4HY3A 1H1TA 4LJ9A 4RE6A 5F3RA 4KPFC 1KU0A 3KD2A 1T91A 2FMUA 1PKEA 1GRRA 2VOJA 2WKRA 3FPLA 3KR0A 1X8KA 2V65A 4WLNA 3EH2A 4K9KA 1EIZA 3VGJA 4A0RA 5B36A 1KORA 1X38A 3GLTA 4JLBA 3I6BA 2OD7A 2LE0A 4PLGA 1M0WA 5DNVA 4MUJA 3KSBC 1FEZA 2ZJOA 1QIKA 2WAMA 1T15A 2JDIA 1NVWQ 4YAJA 3WMEA 3ZY4A 1YZUA 3CUWA 3OEHD 4BB5A 4EMSA 1FSFA 3HVKA 1F4LA 3ZVRA 2PNFA 4QKQA 5LA6F 4Y67A 3RYIB 2M9MA 4V0OA 1UEIA 4TV9A 3F74A 5CHEA 3KZCA 3WKAA 3X1WA 1W30A 3H17A 2WTMA 2ZAGA 2JLQA 2H2WA 2OHVA 4FCTA 4YRIA 1Q92A 1JJVA 4BNHA 3GC6A 1Y3HA 2P7HA 3DFIA 2Q9UA 2CZQA 3F5SA 2D8AA 4H0NA 4M9XA 4JIGA 3P2EA 5DMXA 5HUQA 1GUAA 1P6QA 4UM7A 2Z9CA 1D0VA 2AN9A 4LGVA 4Y6GB 2N1BA 4B0OA 4NI5A 1T5LA 2FLWA 1GTG1 3P5BA 4LYDA 1I2MA 3V7NA 3RU3A 4NBVA 2F1OA 2GVDC 1ESNA 1NIJA 3NYRA 1E61A 2JFOA 4DQUA 4DQVA 4LSWA 5IXSA 2HK9A 5JALA 3UH1A 1QCZA 3IQXA 3VO9A 2F8MA 4XOIA 4ZTBA 4YR7A 1GNVA 2PZEA 4QREA 1IPEA 1MAAA 1NQTA 3OLYA 1GA4A 3U62A 2R65A 1RRMA 4CDNA 3H8WA 4EO9A 1MDBA 2QYTA 3TDMA 3BBPA 5FF9A 4E31A 4YV0A 8ATCA 1P61B 1YGYA 3ZY6A 1WPQA 2P4EA 4MUMA 4CXMA 3PXXA 3WLQA 4G5RA 3H6KA 4YCSA 1ZK4A 1H1LB 3O4RA 3CRNA 1T5BA 5A5EA 1JIUA 1QTQA 4F9GA 1MABA 1J06A 5J2UB 1C7RA 3C16C 3BD7A 1L7PA 3W6NA 1QK4A 2BEKA 2JIPA 2R8EA 5HPYB 4QXPA 4RPLA 2GM5A 2Z4RA 1D1QA 2CF5A 1Y8QA 1X7HA 4D25A 1S3SA 1XSEA 1WCIA 1W46A 5TRTA 3AR9A 3GBPA 3JALA 1OR8A 2IK8A 2J3KA 5AJWA 1AGXA 3BMCA 4U2KA 3A37A 3FBGA 5KWJA 2A9RA 3G2KA 1XTSA 3MAGA 3PRYA 2Z2KA 4FM9A 3AXSA 4MQ6A 1ZH0A 4QU9A 1OX4B 4F3YA 3VKHA 4DAOA 4OGWA 4NOJA 3OA0A 1GPNA 2AI1A 3GFGA 1NX6A 3V4ZA 4K9MA 4NBWA 5FOUA 1YL6A 2O57A 2O8VA 4I81A 4BU0A 4QRHA 4Z7OB 1V8OA 5JT1A 1PYOA 4KPEC 1ZOPA 2FEXA 3I64A 2J59A 2OD9A 4H1UA 2ZRQA 4HAWA 3DO5A 4ICIA 2W48A 3LHDA 3VU0A 5CDSA 1S7GA 5CW1A 1I6MA 3JD3A 1I0IA 4Z7QB 3G7UA 4GF5A 1UXJA 5TPWB 4BVEA 1XMJA 1K8XB 4Q15A 2C82A 5E3HA 2REOA 4RSRA 1NMEA 1W0JA 4BNNA 2R62A 3LO5A 1GCOA 1HH4A 3K0EA 3QKSB 4WL0A 4Z1OA 3T9BA 4WKPA 1G42A 2O2JA 2WOOA 4L4XA 5F73A 2C5SA 1HE5A 5FI1B 3RG8A 4IMRA 1W36B 1IWOA 3EDCA 1ZMTA 3R5HA 4RK5A 2YNMA 4B3JA 2O23A 1US8B 3IMGA 2AEMA 3R0QA 1QDLB 3ZHYA 1G2QA 1KGDA 4NK5A 5FWDA 2C04A 3W5HA 3K20A 1EB9A 1SCAA 2XD4A 4KUHA 1RRKA 1O6BA 3L4BA 4J0CA 4JR0A 3WJ1A 1BGWA 4YAFA 4RYDA 1YS4A 5HJ2A 3P0HA 1E8DA 1I10A 3BGWA 2PJZA 1QHNA 4W8GA 4DZTA 4M9QA 1DPFA 1GYQA 3FCSB 3GJ4A 3ND6A 1VGVA 2Q3JA 3JWEA 1Q2UA 2HY7A 4XQCA 2ZOSA 3QW2A 3KLMX 4O2RA 1FMJA 3WBBA 5ALWA 1T5OA 4Y6SA 4ZDWA 5IN5A 5GJWC 5KYYA 2ESRA 1AS3A 3NBUA 4TQ9A 2X19A 4JK3A 3AVPA 4QYXA 2CYAA 3Q8KA 2BE7A 3ICOA 1HT2E 2D5AA 4JWTA 5KU7A 5KZMB 2FX5A 3GPDG 1TC1A 1XCMA 2PHZA 3P4YA 3AI3A 3DMTA 3OQVA 4YASA 3U26A 5CG2A 4IV0A 2E85A 4JLAA 3IAS1 2ZRNA 4XI9A 3NWJA 2XYPA 3EBOA 4XFDA 4PPYA 2GO7A 4G0QA 4MQUA 3IHLA 4M1KA 1W7AA 2PT9A 2H59A 5ILQA 2QSUA 5L3ZA 1RPJA 3E7WA 4KQJA 3II6X 4KSCA 3U80A 5GONB 4EOGA 4RJTA 4KMOA 4LW8A 3ZIDA 3C1OA 3QU4A 4KPYA 4A0QA 5E3JA 4D5GA 2XSZA 4JJKA 5AVVA 3T1HB 5FBKA 2G88A 2AFRA 1NBOA 4ZKEA 1YJAA 2C8KA 2J6IA 3RRBA 4C9BA 1KFBB 2QVZX 5MN4A 2WQZA 3GQBB 4NQZA 5IC5A 3NATA 1MH9A 3CPHA 3GBVA 1E2MA 1F2DA 1QAOA 2PIAA 1EVJA 4MJ7A 3W90A 4TKMA 3WK7A 1KKMA 1LC0A 1WZEA 2HXSA 2PBRA 1KTVA 5GJVC 2CCGA 2IY8A 1U8FO 1JSXA 2WM8A 4PIVA 3O8QA 4UAGA 4YHBA 2G0TA 4R84A 1P81A 5K8TA 4YQYA 3GHYA 3WLHA 3K9CA 5IX8A 5JMOA 2GDZA 3PIRA 2V7VA 1YS7A 3MBIA 3NYIA 2BD0A 1EBBA 2EV9A 3OZCA 1FW8A 1C9MA 4BZXA 5JOQA 4X1IB 1VSTA 5LQUA 3GROA 4MP6A 1CJKC 4HATA 5HMMA 2JW5A 3M4YA 1HTBA 5JVDB 4BJHB 2C7QA 4W1RA 1OH7A 1VLVA 3A1FA 3NS7A 5DW0A 5CX1B 4W1SA 3O21A 1JXMA 3G68A 4M88A 2GVNA 2HGZA 3B52X 1YC2A 3ELUA 5DIFA 1GQRA 4E12A 5C5DA 2V1UA 1AM4D 1NX9A 1K89A 2SBTA 1CJTC 5TMBA 3EQ7A 3N8DA 3GFOA 2PFSA 5JBQA 4G2TA 4WXEA 3IOYA 1DG9A 3ND9A 4TTJA 1FJGB 4ED9A 2AYZA 2CBZA 4IHJA 1Q17A 4JFAA 1TJ5A 3RYFA 3AHJA 1HNWB 1XMSA 2BFCA 3RU2A 2XCSB 4PQFA 1XHLA 4XWGA 1T4BA 2ZS8A 2YH2A 4PIPA 3BWBA 3V4SA 4BY9E 1XROA 1VDZA 4HDKA 3P9SA 4TVOA 4DDWA 2A3NA 5AVUA 2ZUDA 3SX2A 3Q8LA 4G1FA 3CEMA 1AXGA 5BYKA 1EXNA 1L4BA 2B7CA 1HZZA 4XTCS 5B1DA 2AR0A 4E6EA 2NO7A 2GBLA