1T2NA

Structure of a thermostable triple mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKAPPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of selection and thermostability of laboratory evolved Bacillus subtilis lipase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 68
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2004-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t2nA00
1AX9A 2G5TA 3H1BA 1GPNA 3QH4A 2RHTA 5J3JA 2Z3WA 2HA4A 1C7JA 4J0CA 1AGYA 3G7NA 1WM1A 3C70A 4IH1A 4DGQA 1QIFA 1VXOA 5HZGA 4M0EA 5E4YA 5FOQA 4KAAA 3ESAA 2OPHA 2Z8ZA 4Q3LA 4OCZA 2OGTA 4X71A 5FP0A 4YX9A 1LPAB 4KAFA 4UUQA 1QO7A 4H7FA 3WA6A 3HI4A 4QWWA 5IVDA 3KWJA 4W1PA 5AM5A 3DQZA 1XZLA 2XLBA 3MVEA 4XIIA 1UT6A 3SK0A 3I6YA 5AM4A 1HBJA 2VATA 2WHQA 1IMJA 2WTNA 1IVYA 3A6ZA 2V96A 4ZXFA 2XQGA 3C5VA 1CFJA 2NW6A 2X5XA 2QT9A 3KSRA 2ES4A 3W2TA 3W05A 4Q3OA 4PSCA 3YASA 4W1RA 1MT3A 3WI7A 3I6MA 4W9RA 1X70A 1ZJ5A 3WL6A 2XUGA 3O9VA 1GPLA 4X91A 5JATA 1CUYA 1VKHA 5AICA 5BWCA 4J0GA 3L1HA 6YASA 4K6KA 1JMYA 3ZPXA 5K3BA 1VE7A 4WFJA 2VJDA 1MU0A 5LYYA 1J07A 3FOBA 3O4HA 5LKRA 2OGSA 5CH5A 3D2BA 5HF5A 1GXSA 4QDUA 2QJRA 2QMQA 4ZGBA 1VJ5A 2XB6A 1DWOA 1EINA 4MJ3A 3X3HA 5AP9A 5AKJA 3O4IA 4GBGA 1NU8A 4UHFA 5ALHA 1CUIA 1LPMA 4AN1A 1YS2X 3H2KA 3DD5A 3WL7A 4CG3A 1LPSA 2XUJA 5C7YA 1ZD5A 2GBIA 1TK3A 3UUEA 3D2AA 1XLVA 4K5QA 1VZ3A 2CJPA 2XMBA 4A16A 4B9AA 2XQKA 5ALNA 4G8CA 1C4XA 2XMRA 3DOHA 5FXMA 2OLEA 3SC2A 4X3CA 5AM2A 5IVKA 2XE4A 3FYUA 3HLKA 1MPXA 1K4YA 2D5LA 1AC5A 3WZLA 5BV7A 4U2DA 4DIUA 5ALUA 2WIKA 1CUSA 4OUKX 1MX5A 3HXKA 4OYLA 3ZLVA 4GWLA 3LIPA 2HA0A 2XUAA 3I2JA 5ALOA 3D4LA 3PUIA 1BRTA 5DYYA 5ALRA 2QUAA 3CN9A 2HA6A 4KR0A 3A70A 2OG1A 5EI5A 4B81A 4IHAA 3O4JA 2R8BA 4OB7A 3BXPA 1CUEA 4Y2SA 2JF0A 1AKNA 1QE3A 3GUUA 1PV1A 3PFBA 3IUQA 4AMZA 1FFCA 1JJBA 3G0BA 1Q0ZA 5CH3A 1Y37A 1MAHA 3DL4A 1BN6A 2WILA 4AO6A 3HACA 1F0NA 1X2EA 4L0CA 3OM8A 4BAGA 3E0XA 4HVTA 5HFAA 3G9TA 4X00A 5LZ8A 1RYYA 3V9AA 2XUOA 1UK8A 5DWDA 2OXEA 2RONA 3IBTA 4BRSA 3H04A 3A2MA 5FPQA 5AKIA 3B5EA 2CEKA 1A7UA 4GECA 4UHHA 2FUKA 2ZSHA 3U1TA 2WG0A 4I19A 3DOIA 1XZCA 2Z8XA 2QJWA 3H2GA 5HK9A 2AJLI 1R4ZA 4IO0A 4P9NA 3EQ9A 1BN7A 1E8MA 4A23A 1DT5A 3DYIA 5D3KA 1SC9A 5AM1A 5HK8A 3WKBA 2IITA 4WCVA 1QOZA 4PSDA 4B83A 5ALZA 5D3ZA 5ALWA 5DLPA 1U8EA 1EVQA 2WU3A 5JAHA 4KE8A 2I03A 4RPCA 2CBGA 3G0DA 3JW8A 4U2EA 4PV7A 4KEAA 4NVRA 1XLWA 1WCYA 4WFKA 1YB7A 1ZICA 3RM3A 2PUHA 5KWJA 2QM0A 2ZYHA 5ALDA 4XX1A 5AI6A 3FAKA 4BC0A 4AO8A 1EDDA 3JWEA 2JGKA 2PUJA 2B9VA 4NS4A 2ZVDA 5JAUA 1W75A 1BS9A 2I78A 2K2QB 1GQRA 1KU6A 4J0HA 2VA9A 4UFNA 2GBFA 2JBWA 4J3JA 1AMNA 2JGMA 1XROA 5K3EA 1QIJA 5C8ZA 1YSCA 4GHWA 2XMQA 4EUSA 3QPCA 3WA7A 4KJXA 4J0DA 4MQLA 3DYVA 4LXGA 2FJPA 3WWDA 2C0PA 2WSLA 4YK7A 5AI5A 4MQMA 4PO3X 1WB6A 1ZI9A 1AZWA 3IB3A 2ZYSA 4EHBA 2Y1KA 3ICVA 1YB6A 5JD5A 3VJKA 3WK6A 2PSDA 2WUDA 2DHCA 3IULA 2WHPA 2HU8A 2V97A 4P92A 2C5FA 3V1LA 2J3QA 3R3ZA 2BGNA 1KU0A 1B6GA 1XZIA 3GELA 4HRXA 1H2XA 5HKAA 1QFMA 4J0JA 3WKEA 3QM1A 5FV4A 4EY6A 3STVA 4UFOA 3KD2A 4LYDA 4BC1A 2WJ6A 1VA4A 4EY4A 2G4LA 1XZBA 2WFLB 3I2IA 4B0PA 4M0FA 4OSEA 2CZQA 3I1YA 4CIAA 2YYSA 1CUJA 3M82A 5I7UA 3K9BA 1R9MA 4UHEA 3C6BA 1CUAA 4FNGA 2VT6A 3ZLTA 1DQYA 5AM3A 3WWOA 4JYMA 5AI4A 3RKSA 4X97A 4UBNA 4G9GA 2PU7A 2XMCA 4Y2QA 5CXXA 3H17A 4BE9A 1XFDA 1XKLA 2XMSA 4RE5A 2YXPX 1DWPA 2XUFA 3RLIA 2WM2A 3NGMA 1XZJA 4UBLA 1R88A 5JZSA 3I2KA 2GZRA 2BKLA 3I1IA 5ALIA 5C81A 3M81A 4H7EA 2WUFA 1ZI8A 3ESCA 2ZJ6A 3E4DA 3EIOA 5JARA 5CT9A 2OAGA 4Y9SA 4FTWA 3V1MA 2QOEA 3OOSA 2I3ZA 1EHYA 3ZWQA 4H77A 4IH4A 5JD6A 4N8DA 1A8UA 5AKLA 1YAJA 5JAOA 4FLEA 2HM7A 5KBYA 2D0DA 4L9AA 1XZMA 5ALQA 5K5EA 3BIWA 1QIGA 2Y6UA 4A5SA 4E14A 4Y2XA 2ACKA 4DMKA 4DSAA 5K3DA 1JJFA 1XQYA 3AFIA 4EY7A 5HCUA 2BJHA 1TRHA 1QIIA 4OYYA 4X95A 1I6WA 3BF7A 2X8BA 3VJMA 4BP8A 4UBMA 4HXEB 4BCCA 5ALEA 2WHRA 5LZ4A 2WHPB 1MO2A 4X90A 3M83A 1CUWA 1OILA 2OCIA 2XMZA 4JYPA 5AIAA 4L72A 1UWCA 4B7ZA 1CUCA 1EB8A 4C89A 2PSJA 5ALYA 2WU4A 2CUTA 2O2GA 3NWOA 1QTIA 4KYVA 4J7AA 1LZLA 4MWSA 3WLAA 2HA7A 3IIIA 1G66A 4U2FA 1K8QA 3T52A 1QIEA 1W6RA 2WKWA 3PDCA 5FRDA 1QGED 1YR2A 2GYVA 5I9IA 2VJBA 3ZI7A 5A7HA 5A62A 2HA5A 5ALTA 1GKLA 4QEKA 5CXUA 2DQZA 1VA5A 4WJLA 2BGRA 3G9ZA 3QITA 5AO9A 2JGLA 3FSGA 1BROA 1VLQA 2XUIA 2WG1A 4H7KA 2P8SA 4EB0A 3R0VA 2UZ0A 5EFZA 2O7VA 1OCEA 1Y7HA 4AMYA 1VXRA 4ITVA 5E2IA 2ONCA 3VVLA 2QS9A 1FFBA 3B12A 2HL6A 4OB8A 3H19A 1EK1A 1XLUA 3F67A 2VJCA 4LKOA 5JIBA 3MGAA 1QLWA 2C4HA 4FDMA 1LPNA 2RGUA 4KRYA 1TKRA 1JJIA 3Q8WA 4D9JA 5ALLA 3AZPA 2ECFA 4HXFB 4C4XA 4BZWA 5AI9A 3OURA 4F0JA 4U2CA 3PUHA 2XDWA 3MUOA 1EX9A 5CMLA 4DNQA 5ALJA 3R3WA 3G9UA 3VISA 5JZ9A 4HAIA 5E4TA 1WB4A 4FHZA 4BYMA 5AK5A 4Z49A 4ZREA 4GEGA 4KACA 2XUPA 1HL7A 2H1IA 2C7BA 2PPLA 5LIPA 1DX4A 1XRQA 5DYTA 1SCKA 5C8VA 1E8DA 3PICA 3FVRA 3WIBA 4AO7A 1UK7A 2IIVA 3IUMA 1WOMA 4N5HX 4Y2YA 2JEYA 1K6EA 3CCCA 4M0MA 1DQZA 3WWEA 4DYHA 2V98A 3DNMA 1SFRA 4KE7A 3WK4A 3T4UA 3HEAA 5AKHA 4HTAA 2HRQA 5SYMA 4BB0A 2JEZA 2QXTA 4ZI5A 1ZOIA 5FDFA 2R11A 5ALKA 1MNQA 5JADA 2DR0A 1T4MA 3EBLA 5T4BA 4PF1A 3FCXA 4WY5A 3HRHA 5EHNA 2CMFA 4QNNA 2EDAA 4DTCA 4G1FA 2WFMA 3H18A 1ZGBA 1DINA 1P0QA 5HKBA 3QMVA 2HIHA 1TQHA 4J03A 3IDAA 1JU4A 4C88A 2BUCA 1ETHA 4G4JA 3WK8A 3V48A 4Q34A 3DDUA 1JI3A 4BAZA 1D07A 2I3DA 3I2HA 5ALVA 1EVEA 4ZV9A 2WIDA 4C87A 5ALPA 3U0VA 4N8SA 1H23A 1N1MA 4Y2UA 3H0CA 3WWCA 2FJ0A 2PU5A 3C8HA 3STTA 1AQLA 3KWFA 4BDSA 5I8PA 1VZ2A 4KRXA 1JKMA 4HZGA 1ZGCA 5AIBA 3D3NA 2GYUA 3ESBA 3H2HA 2WJ3A 4G4GA 2WTMA 5K3FA 4K2AA 2H9YA 3QBJA 3DCNA 3FNBA 3AIKA 3HJUA 4H35A 5AI0A 4AN0A 3CN7A 3V1NA 4AQDA 5JZBA 3ANSA 4CI9A 3STYA 4BTLA 4H7IA 4X93A 4BCDA 2VF2A 2Y2VA 5CTAA 5ISMA 4U2GA 1G5FA 3FYUB 5FLKA 1E8NA 3OG9A 2HFKA 1GPKA 1E89A 3AZOA 1DX6A 1NX9A 5DNVA 4QDOA 3RARA 3I2FA 4EY5A 2VSQA 1QIMA 2OCGA 3VVMA 3MUNA 1O6FA 1VE6A 5A7FA 4WDQA 3ZLUA 2B61A 4BTVA 1XKTA 1G42A 1C7IA 4P93A 1CV2A 5T4HA 3O4GA 4X6YA 1FFAA 5CBKA 2XT0A 3EQ7A 1B41A 1CIJA 1QO9A 5CT4A 2DQYA 1Y7IA 1Z68A 3C6XA 3K6KA 3A2NA 3WQHA 4E11A 5LZ7A 1CPYA 5ESRA 4JNCA 1QFSA 5AM0A 2HU7A 5JAPA 1ACJA 3WL5A 4RE6A 2ZYIA 3C5WP 3D5EA 4ROTA 1CQWA 2JGEA 4FLFA 1JFRA 4IQ4A 4OD0A 4DLNA 1UK9A 1HKHA 2B4KA 3TRDA 2G5PA 4W1SA 5EIHA 3GFFA 2AJBA 3EF3A 4FBMA 3R3XA 4CIBA 3W04A 5LZ2A 2JGJA 4BVJA 1RP1A 3BE8A 2XUDA 1GQSA 1TCBA 1DT3A 4QDXA 5JALA 2LIPA 1EDBA 4WY8A 3VDXA 1EDEA 2RHWA 2XQIA 4H7JA 1LZKA 2XUKA 4I3FA 3IVMA 3LLCA 2W6CX 2YH2A 1ORWA 1XZFA 2Z3ZA 3FLAA 5AKZA 2QXUA 1R1DA 1R9NA 4PW0A 4WFIA 5F4ZA 2ZJFA 1LPBB 1PFQA 3ESDA 2IX9A 3NOXA 4QDTA 5IKXA 2BAGA 4ZRDA 3FCYA 1JU3A 2J4CA 3FYTA 1AURA 5H3HA 3G0IA 4BRZA 1QONA 3HZOA 2BCEA 4P08A 4INZA 4H7DA 3JYHA 4AXBA 1DU4A 2AJCA 1H2WA 3HSSA 1EB9A 1J1IA 2BUAA 5LZ5A 3TGLA 4QZVA 3F96A 2EEPA 3G0CA 3RK4A 4N8EA 1TCCA 4B9EA 4J0IA 1N5MA 2O7RA 3QPDA 4C4YA 2HADA 2VT7A 1OXMA 4KAJA 5EIAA 5FPPA 5EHQA 4Y7DA 1N5RA 1BCSA 4GW3A 4PQEA 5AI8A 1Q83A 2JGIA 3DKRA 2WUGA 1CRLA 1CUFA 1UFOA 3FBWA 1XZGA 1FFDA 1U4NA 1DWQA 1UKBA 2HRRA 4L3WA 5JD4A 1TCAA 3AINA 4H0CA 1BE0A 4KE6A 3BF8A 5JASA 3H2IA 3D7RA 1P0IA 2V9ZA 1A8QA 4BVLA 3QPAA 3IA2A 4I4CA 4QDZA 5HQ3A 5LKAA 1RWQA 4AB1A 5DTIA 1L7AA 2AJ8A 2RIPA 3G02A 2WLSA 5CURA 3SX4A 5K3AA 2ORYA 3LP5A 4AZ0A 5IVIA 1ZD3A 1EXWA 1XRMA 5K3CA 3PF9A 3WWPA 2PVSA 4F21A 1ZI6A 1EA5A 4LHEA 3FLEA 1FJ2A 3GBSA 1L7RA 3DEAA 1SOMA 3F9CA 5CRIA 1EI9A 2WIFA 2O2IA 4BATA 4BAUA 3M3DA 3D2CA 4ARBA 3WK5A 4E15A 1F0PA 4MWTA 2OAEA 1YA8A 1QTRA 1YASA 4BDTA 2VAVA 3V1KA 4QLOA 5AJHA 2G63A 1GKKA 2O2HA 1XZHA 1EK2A 3R3UA 2HU5A 3OC0A 4NZZA 3QZUA 3PFCA 4RGYA 5YASA 1YCDA 5ALGA 3E3AA 4QA9A 3KOOA 5A6VA 1UOPA 1L7QA 1CUXA 3ANTA 3F98A 1LPPA 1J2EA 3WJ1A 1QZ3A 4E46A 1Q84A 2H7CA 2ROQA 2J3DA 1H22A 4LXIA 3F97A 3ED1A 4EBBA 4J0KA 5CT8A 5DJ5A 5AHXA 2RAUA 4CG1A 4EZIA 4G8DA 4QWMA 1UOQA 3G9XA 3CCBA 3FSGD 4B0OA 3I28A 1W52X 2ZJ7A 4XWGA 4MXDA 3O0DA 1MJ5A 1IZ7A 1QJ4A 2DSNA 3FWHA 1XZAA 3WZMA 3STWA 5SYNA 4NMWA 1CQZA 2DHEA 4Q1VA 3O95A 4BP9A 1IUOA 4Y2TA 2WJ4A 2W22A 2XUQA 1S8OA 5AKYA 3UMJA 4X94A 2XUHA 4GXNA 3WKAA 4DMFA 3NUZA 1IUNA 4X6XA 5KREA 3QYJA 4FMPA 1LBTA 1WHTA 1UK6A 3LS2A 1CVLA 1CUGA 1E3QA 1TAHA 4MEAA 4LYEA 4B82A 1YA4A 3G8YA 4DNPA 3DKKA 3O9MA 4K6GA 4JUIA 1WPRA 4FLMA 5ALXA 2CKMA 3HABA 4FOLA 4OU5A 2GZSA 1X2BA 1XZKA 1SCQA 3A2LA 3ZV7A 3QMWA 5AK3A 3KDAA 2VQ6A 3WYNA 2E3JA 1MAAA 5FUMA 4OPMA 1BCRA 2VAXA 4MYDA 2EDCA 5AKXA 5T4EA 1MNAA 2C0QA 4MYSA 4Y2RA 3IURA 4G9EA 4MEBA 2OGZA 4B85A 4Q82A 1NU6A 3SWWA 1ISPA 1LBSA 5KWIA 2BFNA 2B20A 5EHXA 1XQWA 1XRRA 4X6UA 4Y2JA 1ODCA 3LIIA 4DMCA 3R3VA 3LCRA 2XI4A 5EIEA 1QIKA 1TIBA 1ZD2P 3GA7A 4QLAA 3WK7A 3W9BA 4K6HA 1UZAA 3DS8A 2XQFA 3B3QA 2ZSIA 4TPKA 1J06A 5HF6A 3VJLA 4G8BA 5A7GA 4JEIA 3WIOA 4UPDA 3N2ZB 5ALFA 5AK4A 1P0PA 3WKCA 5JANA 2XQJA 2DHDA 1MX1A 4TVKA 2PX6A 3GROA 4OB6A 2CB9A 5E4JA 5AH0A 1XRPA 3S8YA 4U2BA 2ACEA 1A88A 2GBGA 2Q0XA 5JYCA 2WG2A 5ALMA 1E5TA 4H7HA 1E66A 3AJAA 5FKJA 2XMGA 1K63A 2HA2A 1ZIXA 4AX4A 3BWXA 1R50A 1XQVA 1XZDA 4DMHA 4F5ZA 4Y2PA 1HQDA 4PNZA 4DNOA 2GBCA 4X7BA 3F8SA 4O08A 5LZ9A 1LPOA 2PM8A 3I6ZA 2OCLA 2OCKA 1CUHA 2DFPA 4H18A 2BUBA 5HF9A 7YASA 1K5PA 3QMMA 2C5GA 2QTBA 1IZ8A 5HQ3B 4G5XA 2H7XA 1CR6A 2FX5A 3I2GA 4HS9A 3G0GA 4BBZA 5D6OA 3L1JA 3DJYA 1Q0RA 3W9UA 3D59A 1H2ZA 1YAHA 3BDIA 4BVKA 3CXUA 3P2MA 4XJVA 4UHDA 2X76A 4C4ZA 1ACLA 5LP1A 3KXPA 3TJMA 2VJAA 4UBKA 4GDMA 2AXEA 1N8SA 4HXGA 3L1IA 4BCBA 2QUBA 1LLFA 3R40A 4CCYB 1WHSA 4X92A 1LGYA 5AOAA 4C01A 1ZD4A 2PSEA 3AIOA 3H2JA 5AOCA 3TEJA 3AZQA 3VXKA 3AIMA 4CCWA 2QZPA 5DNUA 4X85A 1XZEA 4DM7A 4DNFA 3HYSA 2PL5A 4FFVA 1BU8A 2WFLA 4LIPD 2WUEA 3R3YA 3OPMA 1XQXA 1FFEA 5DNWA 4CCYA 1SCIA 4RNCA 1ZJ4A 4OU4A 3DLTA 3BIXA 4W63A 1U2EA 1BEEA 1MX9A 2QRUA 2VEOA 4N5IX 5LLSA 1U65A 4LXHA 4CFSA 4BZZA 1G4HA 3BL8A 3C43A 3UUFA 3DL7A 3K2IA 3W06A 2QR5A 1HDEA 4Y2VA 2GYWA 3E1GA 1ODTC 1CUBA 1T2NA 5DTJA 4FWBA 1CUDA 1IUPA 5CT5A 3ICWA 2WIJA 4EY8A 5EHZA 2OQVA 4B6GA 5K3FB 1F8UA 1UKCA 3WKDA 1W4LA 3WYDA 1EH5A 1R3DA 1WB5A 1WPXA 2H7YA 2VTVA 1DTEA 2PBLA 1QIHA 2HHAA 1XRNA 1THGA 1GT6A 1O6GA 3QVMA 2PSHA 3FLBA 2XLCA 2J4FA 3HC7A 2QVBA 1CLEA 2JGFA 3N0TA 2PKYX 1CUVA 4WDRA 5T4FA 3WJ2A 5AK6A 1W76A 1UXOA 2WIGA 3IUJA 4UFPA 2DCMA 1MTZA 1P0MA 4GI1A 1CUZA 3AILA 5ALSA 4FFWA 1YS1X 4ARAA 3D0KA 4Q05A 2C58A 3C45A 3C8DA 1UKAA 1UOOA 2XMDA 1HLGA 2WQZA 4YASA 3STUA 5CH8A 1XRLA 4UHCA 1A8SA 2QKYA 4UBOA 4FKBA 1BEZA 3BDVA 4S0XA 3WMRA 4XVCA 2WFZA 1GZ7A 3C6YA 4TGLA 4ETWA 3R41A 3ILSA 4ZWNA 3GZJA 3PF8A 2HA3A 3S2ZA 5BWBA 5D7BA 1F6WA 5A2GA 2YASA 3PI6A 5HFNA 1HPLA 4G4IA 3EQ8A 2HDWA 4Q3KA 3STXA 4ZV7A 2JIDA 4UHBA 3FVTA 5IH7A 3C87A 3BJRA 3AUKA 4V2IA 3WL8A 2Y6VA 1JT2A 3BJMA 1JMKC 4DSZA 5AKKA 1AUOA 1KEZA 5IVHA 4BE4A 2PSFA 1M33A 4PSUA 4YPVA 5AKEA 3WK9A 3H1AA 3Q0TA 4FNMA 1MN6A 4B80A 4QE3A 4EA6A 4UBIA 1CUUA 5CT6A 1W1IA 2RI6A 5DYWA 4FBLA 2ZYRA 3C6ZA 3PE6A 1QIDA 1VOTA 5EGNA 1CEXA 2HFJA 1THTA 1ZIYA 5A71A 1H2YA 4C6HA 1LNSA 1ORVA 4B84A 4CG2A 1USWA 3OTQA 4IH9A 3FYUC 4HRYA 1FSSA 4UBJA 5BOVA 2Z5GA 1ODSA 5CW2A 5HF8A 4F60A 4JH0A 4GLBA 2OQIA 1GGVA 5AKGA 4AZ3A 2AJDA 3IUNA 3VKFA 4W1QA 5C8XA 1PJAA 4KE9A 2Y2UA 5AOBA
chains in the Genus database with same CATH superfamily
2G5TA 4BFCA 3KR0A 2VT3A 1U3TA 1GPNA 4RPLA 1WW3A 2WHYA 3OCXA 1T2FA 5F21A 2OYSA 2O5EA 3LC2O 4QTZA 2V7XA 5HOQA 5EXPA 2RHTA 2X5OA 1Z4MA 4KPUB 1JUDA 5IC6A 5J3JA 4G37A 3N6XA 3VAYA 2NWQA 1OFUA 4NYIQ 1JIKA 3IEPA 2VAMA 3SHTA 5IN4A 2ZB7A 5K20A 2VDJA 4MWOA 3HQ4O 4N5DA 1AGYA 4E5PA 2VA8A 3MIIA 3AR8A 3C70A 2ZRNA 2W6ZA 4IH1A 2FQ1A 5DBGA 1RC1A 1VXOA 2WWIA 3CX8A 5JBNA 3EMKA 1TW3A 4M0EA 2I67A 4CGZA 3KZ1E 1L4KA 2OPHA 5KO2A 4OCZA 4H6VA 5DZSA 1LVUA 2GZ2A 3TTTA 4EX7A 2RHMA 3NVAA 2PKCA 4RKYA 3FDZB 4CT5A 2DERA 1Y5NA 1H0RA 1RI4A 2M6SA 1IBMB 3GT4A 2IXTA 1GUDA 1RVV1 2OYCA 3LC7O 1NJ6A 5LU8A 3GLHB 2FEWB 5BQ5A 3UMVA 3WA6A 3GCZA 3HI4A 4Q3DA 3OEWA 4P84A 4OHBA 4WZ6A 4AY2A 3KWJA 4W1PA 5AM5A 2H31A 1EFLA 3HEMA 3VR4D 4XKJA 1TKAA 1RP7A 1U3DA 5BUCA 2CJWA 4HZUB 4TYNA 2QPTA 1BVUA 2JVJA 3DQZA 3R24A 4KAXA 5DOVA 5JPCA 2OTCA 1X9HA 4WWHA 1DARA 1MA3A 1UT6A 2NZVG 3R76A 5HIIA 4ZI7A 3ER8A 1G5QA 1X7HA 1PJ4A 2Q2NA 4AY6A 1NW4A 2Y76A 4PRKA 4QTTB 2PMWB 3ISTA 3KSZO 1OH8A 3HV2A 4XWYA 2V96A 4ZXFA 2H4ZA 2C04A 1AM4D 1FU8A 1MJHA 1FXSA 5AUPB 3N7AA 3ZIAA 4NHEA 1PFVA 3OLVA 2WWVD 3OF5A 4BVGA 4DAOA 2PQMA 1N7GA 4PR3A 4DJTA 1YRHA 1HKUA 2GILA 4MV4A 1Z5WA 2X5XA 4K28A 3MJCA 2ZB4A 2JFGA 2W93A 1K27A 2F3RA 3ELWA 3OF3A 3PFFA 4TRMA 3R7FA 3KJZA 2HIAA 3M3HA 1HTTA 3P8ZA 3B9PA 1Z26A 3PKJA 1P7WA 2PTHA 4PSCA 3YASA 4L15A 5F7JA 5KTYA 2OXCA 3NI2A 1DELA 3I6MA 2F8TA 3SLRA 3T1QA 2JZCA 3WL6A 3SP1A 3VR6D 1HNXB 4WTOA 1A7JA 3O9VA 3BG5A 2L42A 2WYOA 4EZEA 3PX7A 2XNJA 4B3TB 1IIBA 3EYAA 4R51A 3KUDA 2PBRA 3BCHA 2BMEA 4IQGA 4ZMSA 5AICA 1RWOA 3OWHA 3PHHA 4Q4AA 4J29A 1PJBA 1U8FO 3VHXA 5KYNA 2IZZA 3L1HA 6YASA 4MUMA 3EXIA 4K6KA 4MS1B 2AR9A 3FGZA 1WIWA 3THWA 3VSBA 3GLGA 2QTHA 4QDJA 1A8IA 2P67A 2NMVA 5JPIA 1K6MA 2VJDA 4MDYA 3ZGXA 4ZYLA 2Q9CA 3FGPA 4GMGA 1QANA 3BXZA 5AVWA 1UXKA 3PXBA 1KI2A 5H1YA 4LRYA 3VR3D 1KAQA 2R4UA 2WINI 1M34E 2FN8A 3ILXA 4FXPA 4Q6WA 1KDOA 2D2FA 1ODKA 1K68A 5L45A 4CUZA 2VNKA 5LKRA 1PK9A 1RXUA 4PNEA 1E2JA 4JVOA 1DL5A 5HF5A 2E2WA 3QSGA 4RL4A 1HYGA 4EB6A 2ASEA 2P2GA 1NM5C 3CZRA 5A06A 2OB1A 1WU8A 5CCXA 2J6CA 4P5PA 4IVRA 2MMCA 4C2AA 4WLOA 4FUTA 3KAKA 1VJ5A 3BZBA 3NW9A 3QWBA 1I2MA 3KYCA 4MVJD 4D8VA 4DM3A 3PPWA 4Q47A 5BMVA 1FVFA 1J09A 1R8YA 2G9UA 2D06A 3SE0A 4UM9B 2XB6A 2BEVB 2R0QC 2F62A 1W94A 3G2NA 1FPQA 3P9SA 1UBTS 2NTVA 3M7IA 2FFHA 2G5CA 3PUKA 4KRFA 3TZCA 3PXDA 3QYFA 4QOFA 5ELXA 1LB1B 1FYWA 4JVLA 5FPSA 1JI0A 1G3QA 3KD3A 2PZGA 2WPNA 4IOKA 5ALHA 4L74A 3DNFA 4AN1A 2IBSA 1DKUA 1ZHHA 3BWBA 3U80A 3A9UA 5DSZA 2VNJA 4IVQA 3DD5A 4YJ2B 1BYUA 2TECE 2CV1A 1K7SN 1LBHA 1VKJA 5B7PA 4BKRA 1SGWA 5C7YA 2GBIA 1Z6PA 5E9QA 1W8DA 1BE1A 3EWNA 2YFYA 2CHQA 3GR6A 3HJBA 2ZIXA 2C9MA 5EVCA 3PVCA 1K3TA 3UATA 4BFXA 1F14A 4K5QA 4CR8A 1E1YA 3CRQA 2PZAA 3EUFA 4F4CA 2V4MA 3IOMA 4YBRA 1RI5A 2OBYA 1ZNXA 4RXTA 2XMBA 3SOZA 3MWJA 1Y6FA 2CE2X 2HNBA 5EE3A 1LI5A 1U0FA 2FRDC 2XQKA 3TI7A 5FV7A 2BDUA 4LJAA 4A16A 4NU8X 1DC7A 5FUQA 2NPOA 3U7RA 5IUJC 1C4XA 4NYJR 1KRXA 2AVNA 2PCJA 2DFTA 3DOHA 3FY4A 3QUBA 4JFRA 5FXMA 2OLEA 3PTZA 4ZJZA 3MUEA 3DC7A 4PM4A 1NG9A 1XDUA 2ZATA 2WJZB 3V8VA 1VMEA 3DBLB 3R9WA 2OQ2A 3ZHBA 1PSWA 4DR1B 5BMVF 4HN9A 2QSYA 4HGYA 5KAMA 4FMBB 4FYMA 4RF2A 1HEYA 3GAZA 2GN2A 3GOQA 3Q4GA 1CSEE 3TAXA 4ABYA 2Y27A 4P2GA 3TNFA 4K81B 4DBZA 1E3DA 4YR9A 1F6BA 1MPXA 1NW5A 1NAIA 5KVAA 1WABA 1XCBA 5B57C 3JALA 1KWKA 1CS4C 3A6EA 3OT4A 1AVTA 3I32A 5FA5A 4RUKA 2P4EA 4E5NA 3VYTB 1T43A 1WCXA 2PZ8A 3BEDA 4EAAA 3CUYA 1ILWA 1GPAA 1JB1A 2ZP1A 1RSZA 5ALUA 4OHOA 2WIKA 1T5DX 1EE1A 1LQTA 4HWTA 4KQGA 1KFJB 2BFDB 1Q1AA 4I1RA 1FUKA 4O1MA 3D6UA 2CMKA 2O2EA 4PRLA 1A9ZA 4OYLA 5LD2C 4LCEA 1OOEA 2GHTA 3I9NA 5D2CA 3FPEA 2JKVA 3AYZB 2G71A 4Q4AB 3BGDA 3VHXB 5ENDA 1LEHA 4MV6A 1GZUA 1MVOA 1ODIA 2A9VA 2AEFA 2F3SA 4XGIA 3ET4A 4Y30A 5ALOA 1W5AA 2FUG6 1CRPA 4YUXA 4FHDA 1VLHA 5IEJA 4ZOQI 4BUZA 1H9AA 1L1QA 1NMZA 3L0ZA 3OIGA 5F3RA 5FJIA 3LYAA 4RYDA 1BTOA 3W2IA 4ERXA 1OV4A 1H1LA 2G04A 3ANNA 3GYBA 1DIOB 4PPYA 2PO5A 4DJEC 5ALRA 2ATXA 4YMHA 2B5VA 2V74B 3FVVA 2QUAA 3MXTA 4QQRA 5LU9A 1JDTA 1M2HA 1H0HA 5BRJA 3BORA 1IJBA 1I9GA 1PEAA 2X0RA 4KR0A 2FB9A 3AL0C 3ZDRA 3A1SA 1YOVB 3U5ZB 2O8FA 3D7MA 4BFLA 3G6KA 4HDCA 2BBTA 5L6LB 1C30B 2Q0HA 1NW7A 1HYBA 3F6CA 1TL7C 1CUEA 3I73A 1VDZA 4OB7A 2OBMA 4UVGA 4WADA 1O0SA 2C9ZA 3HCAA 4A2PA 3ZD9A 3FF4A 3W5DA 4W6QA 1SO8A 2C5HA 2D3WA 2YV4A 3JSAA 4Z4GA 1UM9B 4M21A 3L9XA 4C06A 1E94E 1XAIA 3GUUA 3IVCA 2I4TA 1GU7A 1GN8A 3BGIA 5L7WA 4AMZA 2ZZNA 3AEQB 3QFFA 3NHPA 1FLNA 4DDHA 1NI3A 5CDFE 3ZD7A 3H4IA 1S96A 1XQ1A 3IKMB 2AEMA 4HLUC 4B7AA 4E5DA 1J00A 3A3NA 3DL4A 4KQ6A 5AR1A 1OA0A 1X6VA 2QXYA 5K0GA 1P7VA 1S1CA 2GGSA 1F0NA 1QTNA 3H5VA 1KVUA 2DTDA 4CKCA 4E31A 4ZYTA 2ZBRA 2NO4A 3N8HA 4HVTA 1P18A 2IIQA 4QXOA 2NVOA 3IOBA 1MP0A 3SSOA 3WDKA 4EFDA 5G2OA 1R5OA 1JDSA 2PXHA 2ZWAA 3SM9A 3V9AA 2XUOA 1NBEA 2HXYA 4GYJA 4KLRA 2P6RA 5AXDA 1CQIB 3UPTA 2QAGA 2C9BA 2EKLA 2IHBA 4X7MA 1IXKA 3TTUA 4XCVA 1BH6A 3ONWA 1FSGA 5GOTA 2V5VA 3NIBA 3GJZA 3MC1A 4AZWA 5WRFA 3NDPA 1E0KA 3E0QA 3G23A 5FPQA 3H6GA 1VM6A 3NHLA 4HEJA 4Z4IA 3CW9A 1Y5IA 1T4DA 2CEKA 1N9GB 3HB1A 1IWBB 1HSOA 4GECA 5CK4A 2B2CA 5DEIA 3UMGA 3F4LA 2DB3A 2VQDA 2Z30A 2FUKA 2DQ4A 3K3PA 4OAOA 5KX5B 2YMPA 2AXNA 3U1TA 4I19A 3B52X 1II8B 1EUCA 3SSNA 1T9CA 1YZHA 4U7JA 3EY9A 4FZ3A 3ZUGA 2JBAA 2Y92A 3FAZA 4IJ5A 4J43A 4G67A 3RH0A 3WRVA 2WJWA 2AJLI 4JOSA 2IEAA 5KHAA 3AUSA 5L4NA 4IIUA 3GLGB 3IELA 1ZM7A 4ME6A 4YAEA 1ZGJA 1BGWA 1UFRA 4Y6LA 4A7PA 3E5MA 3PD1A 2ZJZA 3IUEA 3EH2A 3DYIA 1XO1A 3E8XA 1YR6A 2WHEA 2ZJ8A 3AYXB 5B7GA 4C6SA 1DAKA 1TQ4A 5AM1A 4BFUA 5JTUA 5G3ZA 1RD4A 1XT6A 5HDQA 3D6HA 3KU4A 4C2BA 5HE8A 5KTTA 3I8OA 3OJ0A 4LZNA 2XTJA 1R6BX 3W2FA 4KYUA 2E1RA 5JT1A 1JSRA 1HE2A 2V7PA 4MQFB 5JYEA 1K89A 1G8JA 1H85A 1NLYA 4I1IA 1R6XA 1ISJA 1RMQA 4IMPA 4Q7LA 1TI7A 1D8TA 4B83A 5IULC 3KZOA 5ALZA 2UUAB 1GYPA 3TM5A 5H82A 3AEUB 4D9NA 1MB9A 3D8TA 5AVQA 5DLPA 4EHIA 3ZH9B 1KZ9A 1RWNA 1VE9A 1UZUA 4IBOA 4IV5A 3UAXA 1EVQA 3CUKA 3K05A 1U31A 1YI0A 4NAUA 2F7SA 3LH5A 2I9KA 2C82A 1Z0UA 4US0R 3GT7A 1U7UA 1MQ9A 2I03A 3THYA 2O8VA 3CZMA 1Y6QA 2PUCA 1TTQB 1WRBA 4EP1A 5EESA 2GJSA 3G8BA 2CLHB 5FFNA 4GMKA 4WD3A 1A9PA 4D6PA 4KG7A 3DE1X 1QGDA 1GG9A 4DCMA 1ZN7A 1S89A 1GPMA 3B6MA 1J90A 1WCYA 4N7JA 3SNHA 3ESZA 4QHTA 4E1VA 3GMDA 4LPKA 5GZ6A 1UWKA 2BN4A 4OGFA 1D03A 2FPPB 4L07A 4WFKA 4AURA 3TW4A 2AOTA 5LMNB 3D0QA 4Y0AA 5LXTB 3TUIC 4BLPA 2PUHA 2OV6A 3USZA 4E0BA 2B7BA 2QM0A 3HBJA 2ZYHA 4FYVA 1IH8A 4QQ8A 4TS1A 5ALDA 2GLUA 4I1PA 1RBMA 4OMCA 3PEVA 5A02A 1N9ZA 5HX7A 2GK3A 1XSEA 2LKDA 4BC0A 4YQEA 3EW9A 2C2BA 1DAPA 4V3CA 4E5YA 3V4LA 1X39A 2HSGA 1GA1A 4D3SA 2VK8A 2JGKA 2NQ2C 3F4BA 3FDZA 2QN7A 3WE7A 3EAFA 3UMCA 4G5YA 4B3GA 4TTAA 3WGGA 3QHQA 2FXVA 5JAUA 3DLBA 1DNPA 3EGXB 3AF4A 2YICA 5JRZA 1RPJA 5D7NA 4L2IA 2K2QB 1XEWY 4ZANA 2X19A 3EH1A 1E63A 2VPIA 2Y99A 3OAAA 3OPYB 3RVNA 4CCAA 4EYQA 4I8DA 4HATA 4J3JA 2IXGA 1KMNA 4WNIA 2JGMA 1XROA 3E8SA 2C5EA 3CWQA 1NVUQ 1YSCA 2XHEA 3MFQA 4GHWA 5DX1A 3S2FA 4F11A 3QPCA 4UEKA 3K8OE 2BMVA 3PXCX 3RU7A 3QXHA 3WA7A 2CVZA 5DLQC 3B1JA 3G6WA 4K6MA 4BFYA 1Z6XA 3O92A 1OJLA 4K40A 2JFWA 4OQQA 4URFA 1YIAA 7ABPA 3RF6A 1ULHA 5EZQA 2VF7A 5KYVA 4UKDA 4QOHA 3WWDA 4J76A 2WSLA 2G0AA 1HTWA 3CX3A 4KR9A 3AI1A 4RTPA 1YUBA 3JY6A 5ER6A 2YRFA 3A1UA 1QRRA 1R5BA 1OD6A 4ND8B 2YL2A 5EMJA 2HQOA 3GA0A 1WB6A 1JLKA 2NUAB 2XCUA 1ZI9A 2XRMA 2P3OA 1H1LB 5GAJA 3GLFA 3A2KA 5TY0A 2HK6A 1IN8A 2VRWA 5GONF 2ZRIA 4M4SA 3AWDA 3H2SA 1U9ZA 2HXGA 2JL1A 5DO9A 2WK1A 1XD8A 2RBGA 2Y1DA 3ZW7A 5IDQA 2IXBA 2Q5OA 1KH1A 4URXR 1IZYA 2DT5A 3CJTA 3SR4A 5HZHA 2EP5A 1DKQA 1YB6A 3WAGA 3CYFA 4OMUA 2FSIA 3O3MB 3KFLA 3N1UA 2DHCA 1M75A 4Q9HA 2HZ7A 4XX0B 1QFYA 3IILA 2A1TR 1PZEA 3II6X 1QZTA 1OAAA 3K0KA 4NZYA 4RK7A 1CC1S 3LBYA 4PYRA 1EFAA 2C5FA 2FSFA 1XELA 2OM2A 3JWHA 3LBIA 4JBIA 4KOAA 2XVAA 2PMCA 2CFRA 2CSUA 4KO3S 5ERGB 3V1LA 4XARA 5BY2A 5IAOA 2H54A 1EVIA 4F2DA 2BGNA 1FFSA 3B3FA 3HNRA 1KU0A 2BV3A 3QF4A 5DNEA 4JV5B 1UJ6A 1V11A 2J0UB 2QL7A 1Y34E 4OAPA 2IEBA 3TZ6A 4ZHQF 2ZWMA 4S2UA 3ORRA 1BMQA 4JT9A 2DCUA 2PKQP 1TC1A 3GH3A 1LDGA 3I4FA 1IULA 3QM1A 2VHJA 5BT8A 4UAGA 3KBBA 4PWZA 1WW2A 4OQMA 3W8NA 2XCOA 3STVA 5GONA 1NC3A 3DEFA 5DE3A 4JZYA 1QHEA 3KD2A 1KEKA 3FDXA 2GNOA 1YNOA 2Q6VA 2O5CA 4DLSA 4HDOB 2AR0A 4EY4A 1ISRA 4ZQEA 5DM4A 1DIBA 1Q1GA 4RSRA 4CV3A 3LCVB 3F7NA 4LRSB 4CKEB 3LP8A 2EGHA 2ZIXB 1AKEA 1R10A 2HN9A 2R6CA 2VEDA 3I2IA 3LHFA 1ADBA 3PRJA 3QYPA 4OSEA 5HS4A 3I1YA 5K0CA 3CNNA 1F2DA 1P7ZA 3DO8A 4O25A 4PLWA 5FL7A 1S3SA 4FMCB 5BSRA 4Y9TA 3VM6A 3PHIA 3DO6A 3K9BA 4X3OA 2RI0A 1KIMA 1QH8B 2J8ZA 4UHEA 1FDTA 2FW6A 2PGLA 2BC9A 4MV9A 4E3WA 4PN3A 3HADA 3V33A 3KHTA 2JA1A 4WACA 1JR6A 4WFQA 3GRCA 4RELA 3TLJA 4D9MA 1KZYC 4KJZA 4BX9A 1LLCA 3TRKA 5SZKB 1SKYB 1T5SA 1FMTA 1COWA 3GLIB 3FD8A 3KUKA 3I5UA 3RKSA 4Q6BA 2DF8A 2QBYB 2P11A 2XMCA 1Z73A 1S8FA 4DDWA 1PAUA 3HDYA 5CXXA 2ZUEA 4JGIA 2Z0MA 3H17A 1F2UA 3U7IA 4CMGA 1QGUB 3O83A 2WSYB 4ZU3A 4YHBA 1SIUA 3ZGOA 1FFXB 2DPGA 2GNPA 2SCUB 1UANA 4H08A 4RE5A 1OIXA 3ND5A 2E1PA 2YXPX 5CLQA 1V7QA 4EQZA 2IYNA 1DWPA 1QMPA 1ZOSA 2J31A 2XUFA 3RLIA 1XBTA 2HK8A 4REMA 4DKJA 1J23A 2G1PA 1XZJA 1ISFA 4C78A 1EWKA 4FMCF 1R88A 4XYEA 3CZQA 4IUCS 3V7UA 3MHTA 1LQUA 4PLFA 1ESZA 1Z2NX 2EFJA 3VGPA 4IXWA 1NE7A 1JKJA 4LHZA 2OKCA 4PRYA 3OX4A 3RSSA 1XDBA 1RHRA 4FFSA 2ILVA 4M0UA 3QTTA 3ZE9A 2NYAA 3CE9A 4P6VF 3FCOA 1ZI8A 3ESCA 2VH5R 2ZJ6A 4PO1A 2I8CA 1GPBA 1DC5A 1RJ9A 3LHKA 1DKNA 1L5WA 2LE0A 1FYFA 4LG1A 1CWUA 4Y2GA 5JARA 1XDDA 4P3PA 1QTQA 4Y9SA 1K06A 1MC5A 1Z8NA 4RADA 2ATVA 3FDJA 4S1VA 2IVZA 3V7WA 4HLUA 4YMSA 1JA9A 1U0JA 4RULA 2F00A 1N5IA 1TTHA 2Q1WA 4LDJA 1E3WB 1EHYA 1W5BA 3H3XA 1GKYA 4LHWA 3WLLA 1CZNA 1MIHA 3A9SA 3LUGA 4A4DA 3U39A 2HEIA 4B6FA 1M8GA 4N8DA 1W0CA 3ZV4A 3EZ7A 1VB3A 4S35A 3J7TA 1J8VA 3QUCA 3W6PA 1NJ2A 3UZUA 4LJRA 4FLEA 5GGXA 3AERB 4WJZA 5HP4A 3HFJA 1KFCB 1KF0A 3CMCO 4XVHA 4IY1A 5K5EA 1OWLA 2G9ZA 4K9RA 3H8WA 3HKDA 5PGMA 2Q8PA 2JLCA 2R68A 4QFCA 4YA6A 1I2CA 5KCMA 2Y6UA 4PQRA 5TC4A 1F0KA 1U8TA 4RK0A 1VG8A 3JARB 2X0EA 3JD3A 5L6MB 5DDIP 4IDQA 3DT9A 2WTXA 2R66A 2DKOA 9GPBA 1ZM4A 3AJRA 4GOKA 1Q5PA 3M1YA 1RKVA 2R6GA 1R5JA 5MN6A 4XQ9A 1VFNA 4X95A 3PR1A 3HCOA 3BGWA 4D02A 3E4CA 2OORC 3PGJA 5KYWB 5K0FA 3GB9A 2H1WA 3HUFA 3BF7A 4LX8A 2D4HA 4DF3A 1AE1A 1PS9A 5CDUA 4KIGA 2GFQA 1H4VB 2VLBA 4TN1A 3ONFA 2QQEA 5TPZA 3RRZA 3VJMA 4DXDA 2I9PA 5H5JA 2ZITA 1C1DA 1V4BA 2E6UX 3GDGA 1T9GR 3NLLA 4PINA 2R85A 5ALEA 4B3CA 2F67A 3V8NA 4DR4B 4OJQA 1L5MA 2H0QA 2VHVA 3LOUA 3QI7A 1WUYA 2WHPB 1NF9A 3FPJA 3FPCA 4LYAA 2IYOA 4KBGA 4ADSG 4DCTA 1YS7A 1T3LA 2H9IA 2O5RA 3CR3C 3MT0A 4IKPA 1D1SA 4BNKA 2W6JA 4F4FA 3IESA 1U3GA 2WJPA 4QOEA 3B3JA 2CFCA 1AB6A 1JA1A 1ZM9A 5TQ2A 1AN9A 5FFFA 3DQQA 1KTVA 1XEXA 1UZNA 3AUXA 2XMZA 3O90A 4II3A 1V11B 3GVIA 4R40A 3R4VA 3ZHOA 1L5VA 3EFOA 2DBQA 1YE3A 2MYUA 1YZGA 2ETVA 2YC2C 5LUBA 4F96A 5BN5A 5BV8A 4OXKA 5ECWA 1JAXA 1ZH4A 2PJZA 5ALYA 2CUTA 2JLUA 3GC6A 1QTIA 4J7AA 3ECAA 2YINC 1AQYA 3GCWA 4PPFA 4ZI2A 1DJQA 2WYIA 2VDWA 2YWFA 5FI0B 2E7ZA 3SYTA 1Z08A 4H2DA 4LV5B 1QNFA 2YIMA 1G66A 2XHZA 3W5VA 4QOIA 5C18A 1PJSA 1NVAA 1P33A 2C5AA 1TADA 2QR3A 3T52A 2AF4C 2BEKA 2RGNC 3HFRA 1DQRA 5EJ2A 3QV2A 3NKFA 3EMDA 3QLVC 1B2LA 3TOCA 2ADOA 4NG4A 3IQZA 1LTHR 3JX9A 3EA0A 4D45A 4IUDS 3CLSC 5ALTA 2PZFA 1U5BB 2RBEA 4B6PA 1WWKA 4RMHA 3ZHCA 2EW1A 1NLUA 1VA5A 1XMPA 4FDVA 3JRNA 4U9HS 4MYHA 2CL7X 3MLBA 1CY1A 1E5DA 2BGRA 3SIPA 1HY3A 5AO9A 3PFNA 3QXJA 1E60A 3TQTA 3FSGA 3HKBA 2VF5X 3KX2A 2XNKA 5FO1A 3RRJA 2A58A 1Q21A 4Z0HO 1FRQA 1MEOA 3TLKA 2PJRA 1HOXA 2WV9A 4U7PB 1AO0A 1SVWA 1PG5A 3BXGA 3A6HA 3M8KA 1YB2A 4UULA 4JC0A 2PNJA 4XSHA 4IWNA 3KE8A 2BM9A 2O7QA 1XTTA 4HEHA 1YVDA 3KEQA 2WG1A 3W7BA 1LJUA 1E2QA 1ES9A 3I6IA 3OU6A 4QJ4A 3W79A 4EB0A 3R0VA 5A4DA 3L18A 3PRYA 1HE4A 4UDXX 1TT7A 2DHQA 3A9TA 1T5BA 5EFZA 4ZVKA 1Y7HA 3F4KA 4F6RB 2CMGA 3RS2A 5E2IA 2VQEB 2AS0A 3PPXA 3U7FB 3UWSA 2V1UA 1UH5A 2BJVA 3B82A 1N3BA 1PGNA 2QDKA 3CGWA 4L6CA 3C7DB 3B12A 2HL6A 1BXGB 3BB4A 4BKOA 4OQXA 4RA9A 5E8JA 4AYTA 1YVRA 1OAOC 2Z5LA 4RY0A 1RTTA 3F67A 4PCVA 4GBJA 4G89A 1EGMB 3C6MA 5JIBA 3H9UA 5ERXA 1X1AA 5EEHA 1ADYA 3AHCA 1NIPA 5ADVA 1QLWA 5FI5A 3PITA 1TK9A 2PKXA 4FDMA 3F3SA 1LPNA 3GNTA 5EKDA 2D1FA 5TR9A 3WTBA 3DZCA 3H05A 5IZCA 3N8GA 4FBGA 1Z0SA 3H87A 2PLAA 3RSFA 1AKQA 1TKRA 3WFJA 3ICQB 4PC2A 3IEUA 2O1XA 3QI2A 5B1HA 3UHAA 3AZPA 4F72A 5C1PA 4OHWA 9LDBA 3I64A 2I8AA 1T2VA 4P83A 4C4XA 4OLAA 5FADA 1ONBA 3VRHA 2O2YA 1E6MA 4B1FA 3SX0A 4MR8B 4RFVA 1VSUA 3HWWA 2D2IA 4U2CA 4HGRA 1Q1EA 2RAFA 5CMLA 4D56A 4DNQA 4P36A 1IWOA 4M54A 5EQTA 1S7GA 1SVNA 4ZAWA 4FILA 5BN3B 2PIAA 3G9UA 3R2JA 3GJ5A 5JZ9A 3UXYA 1WDTA 1EAMA 2Q4OA 2QX4A 5BN4B 3ZWBA 4Z2AA 4H1HA 1IXZA 4NEHB 5DXJA 5E4TA 2IZ1A 2Z4SA 1WB4A 5BR4A 3T15A 4CDGA 1DCFA 3A06A 4O2RA 4Z49A 4ZREA 1BX3A 3QKSB 5B3AA 4J16A 4GEGA 621PA 2XUPA 1ARZA 1L5YA 1JL3A 3K0FA 2Y1EA 1IEXA 3AUYA 2JJQA 3CSUA 3IMCA 4UVDA 1XRQA 2JHFA 4D0NA 4G1CA 1E8DA 1VLVA 3R5SA 2VDOB 4ND3A 3TZKA 4BNJA 3SCZA 2IF0A 4X45A 1YMVA 3G0OA 4HMQA 5EG5A 1YRYE 1FZTA 2II6A 4P35A 5BR1A 4RTOA 1IY8A 2G6TA 4NZPA 1J4AA 1AH2A 4PNHA 4G5HA 5LBIA 4RD6A 4ZYUA 4BNGA 5IXYA 5J2TB 3HY6A 4Y2YA 1QDEA 4LRWA 1K6EA 1TVMA 3HNOA 4Z86A 6AT1A 1PX0A 2C94A 2VDVE 5J5VA 3L7JA 5JMPA 4D82A 4IOLA 4QUAA 3DDNA 3KJQA 4C2UA 3ULKA 3FWNA 2XCIA 4BB6A 1QU2A 2G40A 3M1LA 4G07A 4GUDA 5TPZD 3ITNA 1GV0A 1Z5ZA 1T4CA 3PDHA 1VB5A 1TZCA 2DUJA 2V98A 3UWPA 2YWGA 4KLNA 3T5MA 1J2JA 3Q3VA 1ZGGA 1SFRA 4YRTA 2FQXA 1L8LA 4CTJA 4NJEA 3KQHA 1W34A 3R44A 5LQJA 4LMBA 4TMZA 3QPVA 1I4EB 3T4UA 5K0JA 1W36D 3VPCA 3HEAA 3IMGA 4M46A 2V7UA 5K6AA 5G1NA 4LVUA 4UXIA 5DHRA 4TXLA 5IAGA 5F1KA 1JHOA 4KQ2A 5FHQA 5FTWA 2QBYA 1GRQA 4GLFA 3EISA 5EKTA 1M8PA 2QXTA 4GD3Q 2PVCA 3RYFB 1WMEA 2Q5EA 5I9BA 4Z0TA 3RU9A 1UC8A 3K6RA 3PX2A 4GI3A 3V00A 2RJ3A 1FUIA 3EUAA 1KYIA 2O2DA 1L5SA 2ZUCA 4B33A 5IJ0B 2I4NA 5T8KC 1PD1A 3WXBA 4XVRA 1Q0TA 1PK7A 1E3SA 2SHKA 1C4OA 2EYQA 1XCJA 2K2WA 3MTDA 4R6XA 4BLOA 3ZVNA 4MQEA 3QFCA 3JSXA 4JSRA 1CTQA 2M6RA 3MAAC 1N32B 1T36B 4BECA 1CULC 2CMFA 1AN0A 2GCIA 5CB0A 1PEYA 5CR9A 3VSAA 5LQKA 1I2ZA 2OZLB 1THZA 5FWYA 3ILVA 3PWTA 4ZALA 4OLFA 1NHWA 4W5RA 4O1HA 3ZQKA 3W6NA 1ZCZA 5HKBA 2E37A 2PJUA 1J2UA 3QMVA 1OE0A 2O6LA 4FT4A 5BRNA 5DOZA 1EZZA 3NRCA 3ZY2A 1Z4PX 1JU4A 1XDSA 3PSHA 2GR9A 4R68A 2DMRA 3BQNB 4WXHA 3UNXA 4FWIB 1FF9A 3LWBA 3VU1A 3DZKA 1L7BA 1PDWA 2KS6A 1UFQA 3H16A 4HFMA 4Q34A 4HNGA 2X6RA 5TMBA 4CUKA 5EE5B 4ENWA 5AVZA 2RK4A 1HRDA 2X4LA 1QHGA 1TIKA 3ST7A 1TA4A 3W77A 1ONNA 3OTIA 1DI0A 1PS8A 4NBWA 1HORA 4DIOA 1PGOA 2BI4A 2P4UA 2ZCVA 3QY9A 1K6IA 4FIZA 4UNSA 4C0KA 2AHOA 4KU4A 5KQMA 5KTMA 2VN8A 3JRXA 2IHUA 3MXOA 2FRXA 1UZLA 4NTZA 2D5CA 4OGWA 4RENA 3WGJA 4BXOA 1JHZA 1JLMA 4KL8S 1O0CA 2CT8A 2IPOA 2IXDA 1YO6A 3QWFA 1Z6TA 1LWNA 1MJNA 2QF7A 4M8LA 5DT2A 3VPBA 1SULA 1KJQA 2WNIA 2FUG1 3AEKA 5DNAA 5E1BA 3C8HA 1CR0A 3OT1A 1N1DA 4JHLA 1E2IA 4P34A 2CLIB 2DM6A 5IBQA 4QKQA 1CQIA 4PX9A 3GLGE 3BWEA 4MB2A 3KWFA 1W2HA 1NMSA 4BDSA 1QVZA 3TVTA 1G291 4R0NA 3R9XA 4KRXA 2L18A 4M6WA 5EA2A 2I7VA 3ZZNA 1ZGCA 4FEGA 3FIUA 2OT3B 4GC5A 5FT9A 4G23A 1Q91A 1PUIA 1Z7YA 3DYBA 1QZXA 4I5DA 3D3NA 5F77A 2I2FA 4OQNA 4DG5A 3H2HA 3CIOA 4DUZB 1MW8X 3V6LA 2Q45A 1HC7A 1S2GA 3RASA 4EKIA 2DUWA 4P7KA 2NO0A 2Q8QA 3TOSA 3GLIE 5AVRA 1GGJA 2CF6A 3DR3A 4O0MA 4P31A 2QJTA 5C31A 4Q1FA 5CP8A 4FGWA 3FNBA 1IHUA 2PPVA 5E6SB 1KRHA 1CIVA 2H2AA 2NM0A 3VX4A 5LIRA 2CFTA 1KH3A 1X7YA 3AY0A 4YP6A 3WHPA 4K1XA 3QE0A 1Q0HA 3UF0A 5CB4F 3NHRA 1BQ3A 3ZVKA 3DZGA 1GN9A 1QO0D 4R2MA 2XOEA 4YREA 4YV2A 1OI3A 1QGOA 1PI3A 1Q7BA 3IKLA 4X93A 2I6TA 5FBKA 1YBMA 2VF2A 1OGIA 2BSAA 3RFFA 2X6TA 4U2GA 5F52A 4ACBA 4XYGA 1YQUA 4U5QA 5KMGB 4X64B 3FYUB 3GEIA 3IOYA 5FLKA 1TUBB 2FSPA 3JQFC 3OG9A 4PAMA 4UD6A 1GPKA 3Q8KA 3I62A 4OF4A 5ER9A 2OHHA 3TXYA 4ASUD 4FCWA 3S1AA 1NOIA 2VTDA 3PYMA 1V5WA 4YRAA 4N3GA 2P9HA 4WOCA 3R5XA 4UJ5A 3NFYA 3F3MA 5DNVA 3RARA 4ZOAA 4D9GA 1P7CA 2A9JA 2OV3A 3FUXA 4L7QA 4GOMD 2H48A 1TLLA 2QNRA 3GXBA 2X0JA 3GRPA 3JRWA 2I4LA 1BQ4A 1E0AA 2DZDA 3MUNA 1O6FA 1VE6A 2H5LA 2PMDA 2ZU0C 3NWPA 3ZLUA 2K4MA 3L0CA 3RS0A 3BH7A 2QTVA 1Z33A 3FHTA 3BWDD 4UZEA 3BDAA 4PVCA 2R5WA 4BLWA 1XKTA 1G42A 3IGFA 3T3PB 5D51S 3V42A 5K0SA 3HJFA 5T4HA 5CLGA 3BMQB 3GHYA 5KNBD 1GAXA 3ASUA 3IPCA 3EXHC 1GPYA 3O4GA 4IO1A 3FYHA 5AQEA 1WG8A 1FFAA 4LDQA 1KZ6A 3M49A 1M1UA 5CBKA 2ZS7A 4MO2A 1WCIB 1SD2A 4D0GA 4OXNA 2O8NA 1PNVA 1QVVA 2Q3CA 1SHTX 2JD2A 3W7AA 4DABA 1N5OX 1MABA 4BJ6A 1XA4A 3OX3A 4RSHA 3R7BA 3BB1A 4L5AA 4YJGA 4B71A 3NB0A 3EXEA 3SKXA 3EGEA 1DFIA 1ZJZA 3AJ9A 1EXVA 1UJBA 1ZBDA 2B3TA 2FSHA 3HUDA 3AFOA 5ESRA 4V03A 3SICE 4E22A 4RKWA 1SWVA 5G0WA 2ODBA 4QOSA 1QFSA 2VKQA 2O2CA 4ZJYA 3I9LA 2H0RA 1NI4B 3SFVA 1I30A 2GZ1A 3W90A 2C0CA 1MO5A 1CCWA 1L2TA 5HMMA 4WK2B 3K1TA 1PTJC 1I10A 4LYJA 4O4IB 3HGQA 2DKFA 1BO6A 3K2EA 2BHNA 2JW5A 2UVDA 4RE6A 3H75A 3C5WP 3D5EA 5F1PA 4BQOA 1VPWA 3BULA 5FWAA 3G88A 3LKDA 2JGEA 2NAPA 4IQ4A 2IT1A 3VKUA 4QYXA 2IP2A 1UK9A 3QUAA 4KQXA 3P0HA 1HKHA 3TRDA 2ZUUA 1MVLA 1PT5A 2GM3A 3FOFC 3MTAA 3VNRA 2LZ0A 1IVNA 1JEYB 1DAOA 2EX4A 1G3MA 4I55F 3GJ0A 2GEKA 1HMPA 1PT6A 3C3XA 4RA6A 5I7FA 3L0IB 3KYCB 2JFOA 2V54A 4IFEA 4M0LA 1DRKA 1MPTA 4O5OA 5J1TB 1L8AA 1J0CA 3ZV3A 2H9AA 1PL7A 3DE7X 4BB9A 3SHVA 4LXQA 3TO5A 5CCBA 1IB6A 3IHKA 3R3XA 4CIBA 4YUYA 4M8NE 4IXDA 3JWGA 1ZS9A 2X40A 1EFRD 2YOGA 4W8GA 1UJNA 4BVJA 1RP1A 4ZTBA 4ARSA 1J7JA 1NQ5A 1T3ZA 1GQSA 2XUDA 3DMTA 4RZ2A 3RJ5A 1TAUA 1ZRHA 2LIPA 4H17A 4WY8A 4PXYA 1ONOA 5CYPA 3VDXA 1IU9A 4JITA 4UTPA 2C7OA 2RKWA 3BJEA 1GG8A 1SVIA 4MR7A 1D2NA 1W5EA 3FUUA 4H7JA 4JJIA 4MVJA 2M6LA 3WDSA 3MYYA 4LCBA 4IIEA 4J94A 3ZBQA 1PBNA 1M2NA 3P94A 1E6WA 1Z2OX 3DSRA 3JQ9C 4EG8A 4YT2A 3GMTA 1Y3CE 3TNLA 5DNCA 1JAIA 3AUAA 5JCZA 5FTMA 1VKZA 1YQEA 2QXUA 1D2EA 1T5TA 1R1DA 2FUEA 2IY9A 2IY7A 3EUEA 3IXLA 3DVQX 3GQBB 2WQ6A 3WYBA 3ZVMA 1LLUA 1GRVA 3HMQA 3T3NA 2X2PA 3T1OA 3HLYA 4OO3A 2IQIA 2QZSA 3K0EA 2FPOA 5CFLA 4KC0A 2HD4A 3NOXA 3WS7A 4F04A 4MRVA 4Q93A 2DTXA 4EYKA 4V24A 1E2LA 4TT3D 1Y82A 4XM2A 2Q6IA 3DWIA 1KZ1A 1TU4A 4U00A 3AVQA 5EJAA 1FP4B 3LCCA 5H3HA 4D81A 2HW8A 4EY3A 4DNXA 3CO5A 1QONA 1Y9AA 3C1UA 5J2UF 2HF8A 4P08A 4HGOA 1WUJS 4V1CI 1P4SA 3AB8A 1IOVA 4XUGB 5AW5A 3QNUA 3TBKA 4LGYA 1UWVA 5BPHA 2XKKA 3DL2A 2H5IA 3FBGA 2W8ZA 4H7DA 2B1IA 4IGKA 4LDPA 3R7DA 4AXBA 4CM4B 1N9KA 2C03A 3Q3GE 2AJCA 1J9ZA 1F48A 3C3EA 3H7IA 3HSSA 4R9UC 4ZCQA 1P77A 1YCFA 1GPJA 2N46A 1EB9A 2GEFA 3ESRA 1ZNWA 2VP4A 5KB3A 4FKMA 2G72A 1VI5A 1X9IA 4QZVA 4TTPA 2P62A 3A1CA 3A3PA 2PYDA 5EYPA 4HDKB 1F8YA 2PWBA 1K5GA 2X4GA 3RK4A 4N8EA 4RVHA 1B76A 4JIGA 2NT3A 3GBVA 2QV7A 4J0IA 5LQRA 2QZJA 1H6BA 1L7PA 3JQ9A 5TX7A 4Q7QA 5EIAA 1OXMA 521PA 3Q8MA 3BRSA 3L7KA 3UOWA 4RKEA 5EHQA 5I4KA 4M1QA 5IHPA 3W5AA 5AVOA 1L4BA 2A5GA 1GLGA 4WK0B 1X7WB 4I5FA 2A0XA 4EOGA 1ZY2A 3COPA 5MF6A 2G1UA 5INTA 3I42A 1NJSA 2VT2A 1GSAA 5GIOE 3D8BA 4MA5A 2FWJA 3WGQA 2QVZX 3JQ7B 1I3OA 3OQJA 1QWSA 4NX2A 1Z28A 4GI2A 3JAMA 1FFDA 4KH1A 5J2UA 2V0CA 2ZJ5A 5T5QA 4IIXA 1DWQA 1G60A 1QF9A 3OO1A 5DGCA 1WKVA 4CLOB 1YV9A 1QQ7A 2V4ZA 4X44A 1J8YF 3BIOA 1UKBA 1YQGA 3ON5A 3OOHA 4M8KA 4AMBA 5BP7A 4KXVA 5ADUS 2PBZA 3AINA 2H1LA 3UB4A 1V3QE 3WY9A 1QVAA 2WVHA 1YFLA 4FD3A 4LJ9A 2XCQA 5HGJA 1HT1E 4BN5A 5DU2A 1JQLB 2EERA 5EVJA 3BEOA 2A9OA 2I65A 3H2IA 2XB9A 5JWOA 2OY0A 5CG2A 2P0EA 1XR3A 3ELBA 2ZM6B 1UWLA 3IA2A 1W5SA 4I4CA 4QDZA 5HQ3A 1J0EA 1EE9A 2PKQO 4EJSC 3GJXC 4R1TA 3P2OA 4KDEA 4O4IA 1BDMA 2B1QA 2BWJA 2MINB 3IVXA 3L7BA 1XLTC 1XVTA 4GZ6A 4PEVA 1RKQA 2WLSA 1X1BA 3OZ7A 3ZJYA 4MV7A 4YEDA 2B5WA 1YONA 3BBLA 3FXAA 2HSEA 4W5TA 1BMDA 4FX5A 1JKFA 2X23A 2C7PA 2PN1A 4NS1A 2GA9A 3ROMA 3T61A 2P65A 5KOJA 4V0SA 1SXGA 1NUAA 4J75A 1CEEA 1C5KA 4ALNA 2PSSA 3PF9A 3GNLA 5K3CA 1MH1A 1PEDA 5HW0A 3KO8A 1DRJA 1Y6JA 4R9NA 3TFQA 2WNHA 3O7WA 2ZSDA 1ZI6A 3CMMA 4LHEA 3B36A 4Z4EA 1EBBA 1BYIA 3FLEA 3L7CA 1MO4A 1FJ2A 3EBPA 4B7UA 2JHPA 3GBSA 1L1EA 4RVOA 1M2KA 5DCUA 1AK9A 1WCV1 1SC1A 5REQB 2ONYA 1NW9B 1EPUA 1OREA 2UYYA 1XMIA 5CHEA 1R6VA 1ZISA 4QUEA 4YJHB 4U9UA 1W88B 4CV1A 5LB2A 4D4GA 2BSXA 2B4RO 2WIFA 5DM60 5FLYA 1RW4A 3O4FA 3VSEA 3UJ3X 4IAOA 1ZUD1 4GPAA 4TYPA 5TPWB 2I7CA 3WK5A 3X1ZA 4DQLA 2W4IA 2WJGA 4HUJA 1KS9A 1E4EB 1NZFA 3U49A 2OAEA 4J3FA 3L6UA 2ZWIA 4NR0A 4RZXA 1YA8A 1QTRA 5JAZA 1YASA 4BDTA 4HLNA 4U5XA 2CXRA 1ZD9A 3BD9A 3EAGA 3HKCB 3QVWA 4K3UA 4X0EA 5G53C 1OYOA 3GQVA 3ZCQA 5JH7A 4ES6A 1QCYA 2I1WA 2ZCUA 2JJ1A 3NX4A 4PFQA 1P9WA 4Q9DA 1HH4A 1P4RA 2I62A 5G0SA 5JJCA 1FUUA 3JXEA 3ZHYA 5ETJA 3ADPA 4YLYA 4KLZA 2NPFA 3RVDA 2OESA 2RH4A 3HZHA 3GPCA 2HK7A 1TM4E 4R0VA 3MJEA 2JI8A 4D6XA 3RADC 3REGA 5AJXA 2QR2A 4OSOA 3QQPA 3O4VA 2J0SA 4ZEWA 4NATA 4QXMA 1RPNA 1FU7A 2ID4A 3I5MA 4NZZA 3KOZA 1ODFA 2A35A 3UY4A 1DFHA 3FZGA 4D4KA 4KHPB 1DXYA 4E3ZA 4F3TA 1OXUA 3KOOA 5A6VA 2Y0EA 1L7QA 4JC8A 3K9WA 4L9RA 4F1JA 5I4IA 2PAFA 1PF7E 4I4TB 2HMUA 1YFKA 5THXA 3QELA 4BFVA 1U1GA 1E3TA 2HMYB 3AF2A 1GIAA 3QVXA 5KNBA 1HXHA 2XBLA 2PZMA 1VCMA 4GICA 2QI9C 4UZSA 2FKNA 3GGPA 5FI3A 2EW8A 2BFCB 4HUQA 3K9NA 1N57A 1NJFA 4ZQHA 3WLPA 2AC2A 4KGZA 1UR5A 4NCIA 5EP2A 1RIFA 3H99A 1R6TA 3JATA 4NKRA 4Z7JA 2C20A 4ZK2A 4N0MA 4QAQA 4EBBA 2J3JA 4KIUA 2BEWB 3ZBPA 4I2NA 4J0KA 2O3JA 5L3SB 4RCVA 4CGYA 4HUQB 2YXNA 2OSBA 1WY7A 3OKPA 4G97A 1PT9A 1G9TA 1B0UA 1SHLA 1ZH2A 2A0KA 1XRJA 4XB6B 3G49A 3V4OA 1NR1A 4QWMA 1NWHA 3ZDAA 1S2MA 2NTNA 1NG1A 1MAVA 1O1YA 2C4UA 2FETA 2VDQB 2EJTA 3CCBA 3G9XA 4MI1A 4UW9A 5BQXA 4IJQA 5L3ZA 3F73A 3I28A 4XWGA 2VR1A 1VGVA 4NBNA 4KXNA 1MJ5A 2DJ5A 1QJ4A 4XI9A 1E6LA 1Q57A 3GA5A 3S6JA 5LDHA 4ANFA 2TMGA 4D80A 2I7XA 3T1HB 4KGVA 1DIAA 5BSTA 3STWA 4B2YA 1LTKA 2ALJA 1WX1A 2HJWA 2BRUA 3NOOA 4NMWA 4ER3A 5A0TA 1CQZA 2MU1A 1HEIA 2WAAA 3H5RA 4F93B 4PHTA 4BP9A 2D1TA 3O6VA 2VSYA 4FB4A 3K5IA 3H3FA 3LQKA 1XHFA 3OT5A 2HT1A 4Z53A 2QMYA 3L0PA 3NWEA 4P7BA 4D46A 1LD3A 1RM3A 2IXEA 3NC0C 4AL4A 1OPXA 4D4IA 3AW8A 5AKYA 2XUHA 4GXNA 3B2EA 2N42A 2A7QA 4ZD6A 4UTOA 3WNVA 5JCPA 1SU7A 1RR6A 3L1VA 3NUZA 1JLSA 3DB1A 2CKDA 1P0FA 4L9SA 1T9KA 2RG7A 3D3JA 1ZRMA 1Z22A 3G89A 3SZGA 1GVHA 3ZWDA 3TM4A 2KBEA 1P2SA 5DBIA 1U0TA 2GD2A 1A2OA 2Z95A 3OJCA 1EP1B 1BWQA 4HBZA 5KVCA 4W9MC 5EZYA 5EHIA 3H4MA 2XYVA 2WTBA 2HU2A 2L69A 3K9QO 3N0VA 4DWJA 1CVLA 4F97A 1E3QA 4P3XA 3SEAA 4MEAA 4FGSA 4LYEA 5ECYA 4D3ZA 4DT1A 2DR2A 1RAHA 1YA4A 3BPSA 1KK2A 3PNKA 4AD8A 5K8TA 1D0VA 5E7JA 2GFIA 2XPCA 4DNPA 2H1VA 2PANA 1XYGA 3W9YA 4G4SO 4NYJQ 4CODB 4JUIA 3P0RA 1KHHA 1E99A 4FLMA 2PT9A 5GJWC 5ALXA 4MIYA 1XD2A 3KHUA 4FOLA 4ZZ3A 1C8LA 4Y6SA 2QMZA 3MS2A 4QOJA 3EDCA 1EFTA 3IT2A 3L43A 4UXHA 5KOIA 7MDHA 3H5WA 5LMZA 1H4TA 2RB5A 1DE0A 5LPNA 1XZKA 2QORA 1IBCA 2IQ5A 5DGXA 1O9HA 5DI9A 2GESA 2NU9A 1I51A 3LQ1A 1P4GA 3P9QA 1W88A 1PEKE 1U3CA 4PXAA 5AK3A 3LUDA 3RC1A 1SOVA 4OHYA 4JSTA 4WESA 1EFDN 4MJXA 4Y1GA 4CEHB 1YQQA 4EPRA 3F3KA 4CCSA 3L8CA 3NHBA 1WXEA 3WBJA 3F1LA 5FUMA 4LFAB 3HXPA 1MFPA 2ECKA 3FIJA 3ORYA 4ZO7A 4I8IA 4M1KA 5T4EA 1K3UB 4EMBA 1E1QA 1MNAA 2C4WA 1GSIA 3O8BA 1J7KA 4RH3A 3NP9A 4KPGA 3O8LA 1XJ5A 3WRXA 2P9JA 2BR3A 3ZZMA 2Q5IA 1BX0A 1E2HA 4OQDA 1Y4UA 2GXQA 2OL4A 1JQ3A 3O47A 4LZPA 1O89A 4Q82A 4BASA 1NU6A 3P2EA 3SWWA 3OSZA 1LBSA 1T8TA 4CT4B 1CR2A 2V7TA 3MSCA 3R1IA 2DWPA 3NTXA 1L8XA 4E03A 3E9YA 2P90A 4X6UA 5EC8A 2DPYA 1ODCA 1R16A 1VMAA 2IZ5A 3PZRA 4FFDA 4IZHA 5E38A 3COJA 2JJ2A 3ET5A 1S02A 1L4NA 2QI9F 1V9LA 3PENA 2FWAA 4NOJA 4O2BF 3N7UA 5EIEA 2D7DA 4H15A 4D9CA 2WA2A 1R5NA 1TIBA 3DAFA 1FMFA 3BGSA 5LYJA 1ZD2P 4YC7A 1K88A 5ICGA 4M1WA 2P69A 1NJ8A 3BRCA 1PQPA 2GA8A 1J21A 2PDAA 5K6RA 1RRGA 1UBEA 1X7WA 4BVEA 1P2BA 4CWAA 1ATZA 1HUQA 1I1QB 1Z5VA 3O3NB 2XQFA 4TKLA 3B3QA 4NC9A 2ZSIA 4TPKA 1T91A 2HAEA 2NZXA 1Y4DE 1G6HA 4F2GA 4HAWA 5IAEA 2OQRA 3IQGX 2D2EA 2IOFK 4UPDA 1BJKA 4N4AA 1TJ4A 2GSDA 3N2ZB 4MR7B 1GUYA 4U7HA 1CJCA 1D5WA 2O48X 4WZBA 5TS2A 3KJEA 3MS4A 4JB8A 2QRLA 1Z2EA 4ZDWA 8ABPA 2UZ4A 4P3NA 3NBMA 5JZMA 1JNYA 4MS4A 3KYDA 5CAEB 2XQJA 2DBYA 1M6NA 1WZCA 3DMGA 3W8RA 4OXXA 1KO4A 1UBKS 3HMKA 2JK1A 3BFPA 1SBNE 1U5AA 2PX6A 3TRIA 3ER6A 1L7DA 1M34A 4ZVMA 3PFWO 1V5IA 2G0NA 2PGJA 4XSVA 2QHXA 3DW3X 3VR2A 5AH0A 1A2KC 2LR0A 5AW3A 1XRPA 3H1TA 2ACEA 3OOWA 3ZGNA 4DLXA 1X86B 3G13A 4LOKA 1BA2A 1U3UA 2HNKA 2Q0XA 3CLSD 4LYYA 2JFQA 4GPZA 4R2LA 3MB8A 3DOFA 3A4LA 2E87A 3MINA 3RS3A 1BDBA 2WG2A 2BL4A 3E3MA 5ALMA 1E5TA 1S4MA 4KP7A 3AJAA 5BQPA 2NU8B 1TM3E 2QTZA 2X15A 3S5UA 3T9FA 1NMQA 3B6IA 3G7UA 4N76A 3X2SA 1ZIXA 4TM7A 1ULAA 3L0DA 3F5MA 1AS2A 3EK2A 4AI6A 5KQPA 1DOHA 1R0RE 3BMNA 3DT6A 4GVXA 1GAEO 1M10A 4D8WA 1GEEA 1B8VA 1U2TA 1XZPA 4Y2PA 1HQDA 4PNZA 2PS1A 2GO1A 4BMCA 4U7FA 3HU1A 1J0AA 5CG1A 1E1MA 1TX4B 5LZ9A 1CVRA 3HNPA 3WAJA 4QVGA 4EARA 1LPOA 4B3IA 2VYFA 3NRJA 3ZDXB 2ZG6A 3VOTA 3AC0A 1L6RA 1QX4A 4NMMA 3VZQA 2VSFA 1CRWG 3KEFA 3GGJA 5EQFA 2RGDA 5HF9A 1OIWA 3NBAA 3GV0A 3QMMA 3A1VA 4OGKA 4AMVA 4C4AA 5TLSA 3QA9A 4X8LA 1IZ8A 4BGEA 3OLYA 3IRUA 4J90A 4EG7A 3GT0A 4RFLA 3NYQA 2ZJYA 4G5XA 3WLOA 3QEOA 2DTEA 4OVKA 5JG7A 5JPDA 1W7AA 1JVBA 1FUYB 2FZCA 2R47A 4ZVTA 4DRZA 5H4GA 3I2GA 5JCXA 4WOJA 1OPRA 1PGQA 4RHFA 3AFMA 3NTUA 3GEPA 2WKSA 1GO2A 2DSTA 1LK7A 2DH6A 4WGFA 5KU1A 3VYUB 1EFVA 4Q00A 4XUEA 5D6OA 3W2HA 2J32A 4BQPA 1EZ1A 1YR1A 2WD8A 4HX5A 4WBXC 3SS8A 1UCFA 3D59A 3WO0A 3CF4A 4Q3CA 5DNYB 2FGJA 3W34A 1DVRA 4K0RA 1B43A 4BVKA 4EUHA 1GUAA 1FFYA 2IPAB 3O73A 1PNQA 1U1FA 4GOXA 4Z7OB 4MDHA 3QEMB 2QN1A 2WZQA 1STOA 2H4XA 2H52A 3E18A 3TE7A 4DSOA 4RKQA 3HLTA 1KP9A 1Y63A 1TOAA 2J0VA 4JYCA 1NQOA 2X8LA 3PC7A 2OOKA 2PGDA 1HOTA 1AUQA 4CIDA 3TJMA 5BN5B 3GVHA 2VJAA 3LFTA 1O3YA 5B3JC 4HAYA 1A82A 4TV8A 2AXEA 3WQBA 4HXGA 3CX6A 4CE6A 1F38A 3L1IA 2QUBA 3N53A 1VGRA 3A25A 1QYRA 1K1EA 3C3YA 4KH0A 1E62A 2NSYA 2PMBA 3EF1A 4OP3A 5AHRA 2NV0A 4B31A 1FZQA 4C7JA 4GT1A 1QS0A 2WWTA 1CY8A 4KLCA 1WJGA 2CZCA 2P9GA 1XVAA 4E33A 5K03A 1PG2A 2Z9BA 1P1FA 3EVBA 3RRMA 2V7VA 4Q7KA 4C01A 3A1NA 4IG9A 1EEHA 1TNDA 2BEVA 4TXHA 3AIOA 5AOCA 3UAYA 1ZK3A 2A30A 3DUWA 1NRXA 2H00A 2H4YA 2SECE 3VXKA 4Z3KA 1JHPA 4MVJG 1GRRA 4X85A 1EJ2A 5EIWA 4DM7A 4HEA1 4DNFA 3HYSA 2GF0A 4IR7A 5EE9A 8OHMA 2FVXA 3GRRA 1SG0A 3IOCA 3MELA 2P2NA 4EJSB 5HKLA 1YA6A 1FRFS 1RWVA 3GJ4A 2MCFA 5K0EA 3SEFA 5B1YA 3RVJA 1WQ3A 2V6IA 3BX1A 5HA5A 5IU6A 1A27A 1S9HA 1YDWA 2BEUA 1TYZA 5IWCA 3RVRA 5CCEA 3E05A 1MB4A 1EWYA 3F8WA 1Z63A 2YOHA 1YULA 3P1JA 3T99A 4CCYA 4EJ0A 3BMCA 1SCIA 4RNCA 1PZFA 3DLTA 4UNIA 4FGUA 1LDBA 4OTZA 1A72A 1MX9A 1OY1A 3A11A 3B3GA 4IHKA 4J7UA 5B1EA 2VEOA 2YN4A 3B6KA 2VSOA 4A0SA 2J85A 1CBUA 3HU2A 1P91A 5TQJA 2TS1A 3VV3A 5LLSA 1CYDA 4LXHA 3RKUA 3ROPA 4GH5A 4BZZA 1LW7A 4GXRA 4B87A 3MWEB 2Y05A 3G82C 1E9AA 4G5SA 3BL8A 3QRWA 1ZIOA 5EIBD 4ZQIA 3VSCA 5AXAA 1DBRA 3I23A 4UDNA 3IR7A 2QR5A 3R5JA 1N3YA 5BQFA 1C1YA 3NZEA 1EFPA 5DT9A 1I3KA 2FR0A 2Z04A 2NU8A 1MEEA 1X3LA 3OLQA 4E70A 1V8PA 2P2SA 1ZIDA 1CY4A 4GP9A 2GN9A 2IBTA 1GZDA 5DTJA 2PLFA 2ZUTA 3NATA 4QIHA 3RKRA 3V8QA 5IASA 4N40A 3GFQA 5DSXA 3ZI4A 5B4TA 2QN8A 2XOXA 3VPAA 2H2GA 3E1KA 4Q9IA 1CS0B 3GRUA 1NW6A 3AHEA 2OZKA 3V3KA 1JEJA 1K0FA 2ZBDA 4EY8A 3I61A 1HM5A 4X65B 1S8AA 1C8VB 5K3FB 1UKCA 2EKQA 2H65A 2WD9A 3SZMA 3A6KA 3KZMA 4JLUA 1R3DA 4F5DA 2COUA 1VBMA 3KOXA 4C0QC 5IRCD 4A26A 4D4MA 2K7FA 1O77A 5IC5A 4XFJA 3H1GA 1E5LA 5B2ZA 2Q2QA 2PBLA 1QIHA 1EVKA 3TBFA 3URKA 3N5KA 1PQUA 4E13A 1KO7A 3G2LA 1I3LA 1QV9A 2EHJA 1ESDA 3NRBA 3TB4A 1KE2A 1TQ2A 4O2LA 3EEOA 4CHTA 2JFYA 2CLDX 2P1DA 1GL6A 1GT6A 1PJ2A 2CXUA 3DBLA 1RPAA 1Z4KA 2ZE7A 4ZVUA 1QX3A 4CMCA 3GG2A 4C7OA 1BDHA 1Q0SA 2PSHA 4S1WA 5I7OA 4KUGA 1LBEA 3I3SR 3HC7A 1J20A 5J2TF 1DKRA 2IV7A 3U4QA 3OJXA 4JLVA 4OQ4A 3JR3A 1Y98A 2JIZA 4Z9XA 1KPHA 2B34A 1I36A 4K26A 1X7DA 1N3IA 4LJ8A 4PLGA 3RRXA 2XYGA 5CVJA 5CEFA 2YY5A 4QSMA 1DRUA 5HJ2A 4A10A 2DT8A 5DV9A 4EF6A 3D3WA 3LWZA 1T29A 3HVRA 1OUMA 3DE4X 2VJMA 4NCHA 5E7MA 2IYPA 1UXOA 2JBHA 4TKVB 1NNSA 3WGTA 4TLCA 3UANA 3DAYA 1T9BA 3DBIA 4UFPA 4HNVA 4XWKA 2WMOB 4GX2A 1Y8ZA 4L95C 2C88A 4JBHA 4YT5A 1N2JA 1XCOA 3P97A 4GI1A 2PL9A 3H8VA 1YBVA 4KHZA 4QPNA 4D43A 1EFKA 4YXFA 3GLSA 2QD5A 4E6PA 1X7XB 2J08A 4U7TB 1KJWA 2OO7A 2C4KA 3KYJB 1P6UA 4RD3A 5GQSA 5CDSA 1NN3A 1W5FA 2FJUA 2WZBA 4Y9UA 1USVA 4IMIB 3UTDA 5L7YA 2ZBFA 4CV0A 5C5IA 3C48A 2VHEA 4ALJA 5GZ3A 1IJEA 1YB1A 4ATNA 5E95A 3T9AA 3ZW9A 1J9GA 1VKNA 4GE3A 3RV4A 3AEQA 1N0WA 1LSJA 3FHJA 4P80A 3UBMA 2WQZA 1WPQA 3LY9A 4YASA 3TOVA 2VP5A 3EWIA 3STUA 2H4HA 2QUZA 3T5AA 1ZUWA 1I5RA 3K4HA 4INJA 3IAXA 3QX3A 5HFJA 3VC3A 3KYIB 1A4XA 4OHVA 2QJFA 2WAYA 1WDKA 4F3CA 2Q9AA 2FMHA 2HCJB 3RFUA 2FZKA 3A1WA 3CUUA 4G6ZA 2GAIA 1PNTA 4B3BA 4DGSA 5C4IA 3WMRA 3F7MA 3C6YA 2WSIA 4IEIA 3C8UA 4UCXA 5G0TA 4A27A 1UC9A 3CUSA 3ILSA 3IAM6 3DGFC 1KETA 4B7XA 4NPHA 4WLVA 3R7AA 4X1KB 1AKTA 2JAWA 3DBHB 3KPWA 8LDHA 4E5MA 721PA 1W29A 3EULA 4YXWD 4YY3B 1T9DA 2Q5HA 2YASA 1KIFA 1XJ0A 2EF0A 2QX8A 2Z1NA 3KKNA 4FOSA 5I7RA 1OAOA 2FUNB 4Y7CA 3S5JA 4CU2A 4LYHA 5M2QA 3WGIA 4Q3KA 2NN3C 2WMNB 2JIDA 4GVPA 2AQKA 4UHBA 1RCFA 4EAQA 3FVTA 5I3ZA 5IABA 5IH7A 4CTKA 2QLFA 4P33A 5FA6A 4MV0A 4V3BA 5ESWA 1JWAB 2VF8A 3AUKA 1WTAA 4F3KA 1XYVA 3BE5A 4JP8A 4GL4A 3TKYA 3ZXXA 2Y6VA 1JHQA 1CLUA 1J0BA 1WEHA 3K2QA 1NT2A 3O9ZA 4JB3A 3LKBA 3NDRA 1WDMA 4MMYB 4ZOEA 1YUMA 4F6CA 3OQNA 5EIXA 1H2HA 2R1UA 4GOND 3RSHA 4XGNA 1AKUA 1M74A 1Z15A 4OAQA 1P62B 3RT1A 1P4HA 5IJ0A 3A9WA 2PSFA 3N6RA 2VUSA 1P2DA 5KYXA 3OIVA 1M33A 5DYNA 3ZYZA 4NENA 3TQQA 2COEA 4C4SA 1FOEB 2I6XA 2X7XA 2OOSA 4XLZA 2G5GX 2Z6UA 1DRVA 4K03A 2FPWA 4FNMA 3ZHTA 4Z9FA 3EDOA 4AMUA 4JXZA 4QE3A 3T12A 3OMXA 2I55A 4GLLA 1QK4A 5FIUA 3QE9Y 4EF5A 5JNUA 3LX5A 3H5OA 1O96B 1CG6A 1N6NA 4C0SA 2O3UA 1KL7A 1QH9A 1W1IA 5DTMA 1K8YB 1M2FA 4OEHA 4AJLA 1PN3A 2V7QD 2ZSJA 3L8ZA 4JEHA 1P1CA 2GD6A 3QX9A 1E1DA 1RI1A 1SIBE 1U7DA 1DDGA 4JR0A 4P4UA 2PGIA 1QIDA 4LBVA 1OBOA 4PZLA 1VOTA 4D98A 1CEXA 2GF2A 2B8EA 4UASA 4UDOA 4EVSA 1BMTA 3A1DA 5A71A 1OMOA 3OLWA 1ZA2A 1U6KA 1NYRA 3D9QX 3QVKA 4J16C 4KWEA 4NENB 1U9JA 3U62A 4YCCA 2XOKA 4R81A 4D4JA 1R6DA 3FYUC 2Q5QA 4R5MA 3A7EA 3G3EA 1O7JA 4I3GA 4NJMA 1S2DA 5THQA 3SJUA 4QSHA 3UT6A 1VSTA 4H7PA 1I4WA 4UCWA 4Y0VA 1OZAA