3KB2A

Crystal structure of yorr protein in complex with phosphorylated gdp from bacillus subtilis, northeast structural genomics consortium target sr256
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYIEGKDIDSILELYREVMSNAGLHTYSWDTGQWSSDEIAKDIIFLVELEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target SR256
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords SPBc2 prophage-derived uncharacterized protein yorR
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb2A00
3TNFA 5ANRB 4LC1A 4Q1FA 3RDPA 2ZRPA 1X86B 2D74A 3D31A 2H8KA 2JIZA 1N6NA 2CXXA 3QXJA 1XEXA 2K5UA 1ZVQA 3KB2A 2ZI3A 4KBFA 5DSZA 1DAEA 3KKOA 2Q3HA 5EP3A 1XZPA 1VIYA 2YOFA 1YZNA 4ZKEA 2O8FB 1OYWA 3UMFA 4OK3A 1BMFA 4QHSA 2QP9X 4Q4AA 1XD2A 4C7OA 3FMOB 4Q19A 5FUVA 2EYQA 4TQ9A 5SZKB 3NEYA 4OJKA 2KBEA 3ZIAD 4WAUA 4ZDWA 4DLYA 3LBIA 1AJEA 1E94E 2L0XA 2C2HA 4DEXA 5TDHA 2EW1A 2W6JD 1FX0A 2XITA 2GZHA 4EKDA 1ZJ6A 4FINA 3W90A 5AUQA 4MRVA 1K6MA 4GMXA 2JATA 3RYTC 5L3SB 5JRZA 3NIBA 3KXLA 1GTVA 3ZQ6A 1JJVA 4LBZA 2CNWA 4ZDIA 2ANCA 3GCGA 1J99A 2GRJA 1JXOA 2IX3A 1W4CA 4DBLC 1HT2E 4URWR 4UXIA 4BFZA 1Q22A 2HYIC 3BC1A 4MRSA 4EPVA 3K09C 3Q85A 3KZ1E 4LJ6A 4KV9A 2ZRIA 3EX7C 3WHLA 2NZJA 4WZBE 4WXPA 3B60A 3CLVA 2BMDA 4JLNA 2ORIA 1U94A 3A1VA 1FNNA 3O8RA 1QHXA 2WWWA 3OEHD 1DE0A 1G5RA 3OE7A 4TTRA 4F38A 2HXYA 2VA8A 5JMTA 1UBGA 1PLJA 2AFIE 4IW3B 3ZD6A 5BYJA 2FU5C 2WVJA 4LC0A 3SC3A 1JBKA 5CLLA 1SVMA 2VPPA 3U60B 1Q12A 4TT3D 4Z1MA 4BLPA 4AI6A 1ZBDA 4UXJA 1QHHB 3I4LA 3DOFA 3BB3A 1NBMD 4D82A 3GEEA 3LW7A 4R2IA 3SFZA 1Q44A 1DTSA 3P27A 2G9NA 3JVUA 1N5LA 3RS5A 2JIZD 2AWOA 3N5CA 4DSTA 4Q4AB 2CE7A 2ZRMA 4WXRA 1A1VA 1G8YA 1HEIA 4K8OA 2IXEA 2CE2X 5CB8A 3IHLA 1KK1A 4X8LA 1MO6A 2YJTD 1XPUA 4ASUA 4BEBA 3ZGXA 1P60A 2CK3D 4C7OB 1ETUA 1HV8A 2PEYA 1U81A 1YZGA 4JMPA 2WICA 4BPBA 3NTUA 1TL7C 2BV3A 1FTSA 2FSHA 2REBA 1Q1ZA 1PLLA 2XOKA 3KQHA 2ZRAA 1R0YA 1CEEA 1X8LA 5CB6A 2Q0HA 1G8GA 1E2GA 4BLSA 2QG6A 2GCOB 2RCNA 3QF4B 1V5WA 1E9SA 5KHOC 2HF9A 3A8TA 4J0QA 1TUIA 1YHNA 2VHUA 4M9SA 4W5WA 2YWFA 3Q7QA 3K0FB 4IOKA 3SJBA 4AYXA 1SXJD 1ZUIA 1FOEB 2O0KA 2CCKA 1W7AA 3RRNA 2Q3FA 2F1JA 4TYYA 4D4MA 4YMVA 1HE8B 3CRMA 1LNZA 2MSDB 5EE9A 4E07A 4GNKA 3THYA 1BYUA 4WW0A 2ZE8A 5DIFA 2ZE7A 3T06B 4B3DA 1KIMA 1U2RA 3DDCA 4UJ3A 2ZQ5A 3DEFA 1MR3F 4S35A 2R6GA 4HAYA 2CLDX 2ORVA 2VIIA 2ZS8A 3KXKA 1M1YE 2F43B 5JWOA 4BRUA 1D6JA 2PX0A 2QGZA 3T34A 3KUDA 3FKSD 5E3HA 2AKYA 4QBHA 2IXFA 4U02A 2DFKB 1T3LA 2VHQA 2QAGA 4C2UA 1XTRA 4PQYA 4KVAA 1OSNA 3KTAA 4R7ZA 2BOVA 2WJHA 2BEJA 2FV8A 4IDPA 4LJ5A 2CLCX 1UKZA 4EAQA 4RD0A 3AM1A 3TW4A 5G53C 4C9BA 2JLXA 1KO5A 1U9IC 1XEFA 1VCIA 4Q1CA 2FFBA 4MGKR 2VYFA 5FBWB 3SYNA 3HYRA 3WY9A 4WBSA 1UBFA 4MQBA 1GITA 3KKPA 3P4YA 1NMXA 3GLHE 4V0ME 1SHKA 4IDNA 2QTHA 1JI0A 4LPKA 4WZAE 3VFDA 3WRXC 3UMSA 1W0KD 3U7EB 1LB1B 3DKPA 2GJKA 1CJVC 3QPWA 2A3RA 4DB2A 1DO2A 1OXXK 3AVPA 3CB4A 4NZYA 3TLXA 2G0NA 3AV0B 1DAIA 3MD0A 4BFYA 4F4CA 1HUQA 3NBYC 1S0UA 1N5JA 4JSYA 2CL0X 2DR3A 3LH5A 1GNPA 2OAQ1 1AKYA 3A4LA 2H92A 4OHYA 2FG5A 4O2RA 1EWRA 3LWNA 5C18A 1G7RA 1KI1A 3GJ4A 2JLUA 2IUTA 3PUWA 4RFSB 3FMIA 3VX3A 2I1VB 2Q6TA 2QGNA 2KWIA 3AKYA 2OFXA 3VHLB 1Z63A 1KDOA 2O8DB 1QRAA 4ERNA 1WQ1R 1W0JA 1CJUC 3OIWA 4FI3C 2RGDA 2ZRHA 4GOXA 5JWRA 3Q5DA 1TQ2A 2C9OA 3EZFA 2HDNB 3V9PA 1VG9B 2GETA 2IYTA 2J41A 3T1VA 2RKOA 5DI9A 2VHTA 3PITA 5EUQB 5IF9A 1JQLB 1EX6A 1XTSA 1OF1A 4LV8B 1JR3A 2OHFA 4QBGB 3I62A 2EU8A 1T6NA 3C41J 4D2IA 3ETLA 1ZM3A 4Q5IA 1SHZA 4TMTA 3H2YA 3SFVA 3VU9A 3TE6A 2V3CC 4AYTA 821PA 4Z51A 4M9QA 4A0GA 3HP1A 3K70B 1LV7A 1NSTA 2ZSBA 3PENA 2ZR9A 3D3QA 1UFQA 1US8A 1EFTA 1W0JD 3QIAA 2IA5A 2AD1A 2CJWA 2GK7A 3LXXA 1YZTA 1IN5A 1HYQA 1P9WA 5LD2C 4PO9A 3EARA 3RLFA 2WWIA 1RC8A 2IYWA 1N25A 3ADKA 1E2LA 1T9HA 5H1YA 2XXAB 1EGAA 4BFWA 2OT3B 1U0HC 2IF0A 5CITA 4A2WA 3RS2A 2J87A 3EXAA 2G1KA 2ZYVX 3KJHA 3QKRB 4DLRA 3K9HA 4PQRA 3QEOA 1Q0UA 4D80A 2HXSA 2G83A 3TVDA 3L0IB 1F2UB 4KYUA 5CM9C 3OAAA 3TSWA 1EXMA 5GJCA 1OIWA 4R98A 5HTKA 3BJIC 2WJJA 1DARA 4Q1AA 3EASA 2REXB 3A6PC 3AVXA 1UADA 4JBYA 1ESMA 3WMEA 1ZU5A 4Y0AA 4OI1A 4HAWA 5EE5B 5CJPA 4B74A 4DJTA 2VF7A 1H8ED 1AM4D 4LJYA 4OQLA 4JVSB 4M1MA 1P62B 2CL7X 1KK2A 2D7CA 1IN7A 3Q3JB 3R7WA 4IOMA 3KKQA 3ICQB 1QVRA 3K53A 2BKUA 2OCYC 2VHJA 2IS2A 2QZ4A 1RE0A 1FP6A 1ZD8A 4WOPA 4YXWD 4B3XA 3R9WA 1WDTA 2QPAA 2QN6A 1GL6A 4C30A 3F8TA 4LZZA 2GHIA 4LYAA 4Q1BA 1QHSA 3ECCA 1DEKA 3WP1B 2PJRA 3HYTA 3AVTA 1SQ5A 3AEZA 3BFKA 3LA6A 2AKAB 1ZW6A 4G5QA 1P73A 3AP3A 3RNLA 4B34A 2ZRKA 1KI8A 2AX4A 3TSZA 4ZDJA 1IHUA 1UKVY 1DO0A 5KSYA 3AVYA 1W36B 1E9CA 1KO8A 4DEYA 4YMUA 1W36D 2GEVA 2KJQA 2J46A 2FGKA 3IIKA 1R0ZA 2GKSA 1I4DD 2AXPA 1II0A 2ORWA 2REOA 8OHMA 3MRSA 1PVOA 4XSGA 4TLAA 2MSCB 2YHSA 5SZHB 1IAQA 3I72A 2JA1A 1Z0DA 2R6AA 721PA 2BM1A 1PUIA 1G9XA 1XF9A 2IK8A 4JL5A 4UNQA 5M04A 4A6XA 2JCSA 3NWJA 4BFVA 2G77B 5GJWC 4HLUA 5KNCA 2H5EA 1AA9A 1R0WA 3TK1A 2ZRDA 4EFNA 4HB0A 3D7MA 1NI3A 3VR1A 3HU2A 1E98A 1FUUA 3MLEA 3K0EA 3QVUA 3QXCA 4GI7A 3FPAA 5D3MA 5TY0A 4MDEA 4MGZR 5IK2D 3VTKA 3IO3A 5KPDA 4TYNA 2ZYTX 1KSHA 2BMEA 1W5TA 2EQBA 4PO8A 4TL9A 5FBLB 2AR7A 4NKRA 2W6IA 3BRWD 4HAZA 1BS1A 4QM7A 1M34E 3BFXA 4HATA 1R7RA 4EPRA 1AN0A 3CR8A 1G5TA 3HWSA 1JECA 1UBCA 2ZUDA 2DFNA 2MMCA 2P3SA 4A2QA 2Z0MA 5DI3A 4A8JB 1WRBA 2QMOA 2C95A 4PPGA 4IRUB 1CR4A 5J4YA 3CRVA 4B2IA 4NCNA 3FVQA 2ZAOA 4HAVA 4CEHA 3FB4A 4QNRA 4FD2A 4LHZA 4P0TA 1WBDA 3AKEA 3VKGA 3TQFA 5KO2A 1E2KA 3HDTA 221PA 2XZPA 2PT7A 4HB4A 2IS6A 2BKEA 1VECA 3ADBA 3I8XA 1N0WA 5AUNB 2F55A 2ZXUA 1VDZA 1ZNXA 1Z6TA 2Q9AA 4EIWA 5FI1B 1NSFA 3SR0A 1GILA 2ZRGA 2FDCA 1G8FA 1JXMA 2G6BA 1E4VA 3L82B 4URXR 5LB4A 1P2SA 2ZUBA 4DLZA 2HJVA 3B85A 4A9AA 1EFUA 2X2EA 4E5UA 3B1VA 4CYMA 2N42A 4UNSA 3QY0A 1OFHA 4ASUD 2Q9BA 3LO5A 1XPOA 4JIMA 3RC3A 5KNBA 2RGBA 5CYOA 4UNPA 2JDIA 2YWHA 2QU8A 4Z8XA 3THXA 2V8OA 2VP4A 5GADl 4M22A 5B57C 1N5IA 4LHXA 2F43A 4H9GA 1G20E 1R2QA 1SVIA 2ZRBA 4TLEA 5DN6D 3RRYA 2Q3MA 5AJXA 3SOPA 3C5CA 3CF6R 4OL0A 3AVWA 3CIOA 1T5LA 4A15A 1G1MA 2RGNC 3W5IA 1T8TA 2ZS9A 2B7CA 4MGIR 3GLHB 3SEAA 2DFTA 2JJ1D 2XNDA 4S2EA 1F6BA 2NPIA 5FOXA 5CYPA 1M74A 3NHBA 3MJRA 5EE0A 4EUNA 3LLMA 2O8FA 3ZYCA 4FN5A 5DI3B 2P0EA 4JVNA 1P2TA 4X8OA 2GEUA 2GXUA 3KQLA 4U7DA 1KDPA 2BCGY 3BK7A 4KFTA 1JAIA 3IDQA 5FUYA 5F98A 1DAGA 1QG2A 3TKLA 3WHKA 1EFRA 1M7HA 1KDTA 4BWYA 5H8WA 4GT1A 1WP9A 1X6VA 1S96A 1E9DA 1TU3A 4KFUA 1BIFA 1G3RA 4C2TA 3AP2A 1ZC4A 2D4HA 2HLDD 1CKEA 2JLVA 4LYJA 4TLBA 2XNDD 1Y3AA 2DWPA 3JZAA 4ZIRB 2GCNA 2XTNA 2ZJ2A 4ZDKA 4W7SA 1QF9A 2PX3A 3A1TA 3LFUA 1E9RA 1I4LD 1KMQA 3AVUA 2R6FA 1YRBA 3B13B 1E0SA 2ZJ5A 3UWOA 4G0NA 1OKKD 3UMRA 4FMDF 3SHWA 3MWLA 4Q7KA 4B6FA 4GRAA 4CGZA 1Z6XA 5GVRA 3SDZA 3GPLA 1OH8A 2BBSA 4U5XA 3BH0A 1KZ7B 1JJ7A 5DISB 4ABYA 2QRZA 2F1RA 4ILEA 5LBIA 3BAFA 1S3SA 1ZIPA 2PMDA 4V0KA 1XPRA 4XIGS 2AK3A 2IXGA 5KDDA 2VSOA 1IONA 1XD2B 1NN0A 1DVRA 1OYYA 1ZCAA 3HR7A 2B92A 3GP8A 2J59A 4URUR 3PEUA 2EFHB 5LB2A 1MRNA 4A82A 2KE5A 1NBMA 3V4FA 1W47A 4KO8A 1SVSA 4B3FX 4O25A 4JYCA 2FZ4A 2V55B 4IVQA 1ODFA 1ESNA 1GP2A 4CF7A 4IXMA 4US2R 1KSFX 3W8NA 4QGHA 2BIFA 2XB4A 3QSYA 2QP4A 1JEDA 3BXZA 2DYKA 2FZLA 2QENA 4HYYA 2GAOA 1Z6AA 3JVVA 4RD4A 3ZS9A 4QJ3A 3OIYA 2BBTA 3AKCA 4X8MA 5C2JB 5HR5A 1EG7A 3CNOA 1CR1A 4NMMA 2C78A 2QPTA 4NYIR 4NCHA 2QM8A 3B1WA 4DLTA 3C4JA 2ZJZA 2X1VA 4D0LB 4C0SA 2QE7D 5HE9A 3WP0A 2BM0A 5EXXA 3N2IA 4Q4LA 4LCBA 1NLZA 2IYZA 1I2DA 3ZS8A 3MSXA 2FOLA 3H84A 4JLMA 4MGYR 1P9NA 1GZSA 4RZUA 4URZR 5G3ZA 3AB3A 5FOTA 3O47A 3FKQA 2IF2A 5LPNA 3PEVA 3SI7A 1CR2A 2AHOA 1GKUB 421PA 2ODNA 2VL7A 2RGEA 1R0XA 2OXCA 2ZAMA 1U8ZA 1RRCA 2O0JA 4MYUA 4OQXA 2GXAA 2I1QA 1GNRA 2BDTA 2RHDA 2CVFA 2IHBA 1OFTA 1P5ZB 1AIPA 2YVUA 1NBME 4MUAA 2OSBA 2Z83A 2O8EB 1YKSA 3U6KA 5L3VA 1HT1E 4I1VA 4OKSA 2I4IA 1G4UR 1UAAA 4N1AA 4RSGA 3CWQA 1KSJA 2F1IA 1CU1A 3IKJA 2OCAA 4NE2A 1SXJB 4QJ5A 3JZMA 4LV5B 4B3CA 3GLGA 2OEPA 1IJEA 3WYAA 5BQ5A 3D8BA 2GWHA 1NY5A 2RGAA 4K46A 1VHLA 3BS4A 2QL6A 1VIAA 3PEYA 3ZD7A 1PZNA 1S1MA 4KXFB 2RHMA 4CVNA 1E0KA 1T5IA 5E7MA 1S1CA 4CT4B 2NO7A 3HPRA 2BBWA 3ZDQA 4POAA 4P4UA 1DBSA 3AF4A 1KSGA 2FEMA 3ND8A 2P5TB 2HF8A 3PR1A 1RPZA 3OESA 3Q72A 3B1ZA 1KO4A 1JQJC 3SJCA 2SHKA 1RRPA 4EQ6B 5KPJA 2J7PA 3GFOA 1C1YA 3SE0A 4M53A 1Q1QA 4XVRA 5FH9A 3U7FB 4E09A 1ZMXA 2YZ2A 4F92B 2A5DA 2ZI5A 2BBOA 1GL7A 3TGPA 3FHOA 1DAFA 4QKQA 3THYB 2WTUA 4A4DA 2OO7A 1TQ4A 2IT1A 5EE3A 1KI7A 4F7WA 4QC2A 1N0UA 1JALA 4OHXA 1JB1A 4KBGA 1KMHB 3U3KA 2IUSA 2HEIA 4M21A 4F4JA 5KUTA 1W4RA 2X19A 3PXGA 1W48A 3MAAC 1NVVR 1VG0B 1XJ0A 1W2GA 5JHGB 4IDHA 4MITA 3SYKA 4BFXA 3B82A 4V0MA 1NKSA 4B2PA 5CLQA 3IO5A 4TZ0A 1SVKA 1FZQA 4AYWA 3KX2A 4Q47A 4QHYA 1IM2A 5DYGA 3CPHA 1FTNA 4M2LA 1JNYA 3PFIA 2FSFA 5FTMA 1NLFA 5FOSA 2C5LA 4NCIA 3IGFA 2NIPA 3IEUA 1E2QA 4GBMA 4JJZA 2O8EA 2GNOA 2RGNA 4L9WA 1PJRA 1Z8FA 3LQQA 3R8FA 2P6RA 4TL8A 2CCJA 1OXTA 2IYVA 2FFQA 4MRRA 1OIXA 2OBLA 5BW8A 4JVLA 4ZKDA 5IHPA 4A0HA 1Q57A 1E2MA 1N6IA 4A8JA 1G18A 3GLIA 3IIJA 3IBYA 4Z54A 4RJLA 2IYYA 2V9PA 3BD9A 3VR4A 2XTMA 1DAHA 3DMDA 3CW2A 4BFSA 1RFLA 5TARA 5G41A 5TXGA 3UPUA 2F9MA 1ZU4A 1QHHA 3RVBA 5KNDA 4P31A 4DUGD 5JI3E 1KYIA 5J4LA 3BB1A 1KHTA 1F3OA 3BWDD 2QRNA 3SHFA 5F9HA 5K8UA 4QNMA 3QENA 4V0OA 4EDHA 2H16A 4GMDA 2N1BA 1ZP6A 3I5YA 4XTRA 1R5OA 2W0SA 1XEWY 2VP6A 3Q8XB 1X1RA 4HLDA 2WV9A 4BLRA 4CEIB 1CJTC 3CX7A 2D2EA 1G3QA 2ZRFA 2WOOA 2F9LA 4GZLA 4G5RA 1KY2A 1XD9A 1MABB 1D2NA 4DCTA 5JZVA 1EK0A 1XCMA 5BN4A 1P72A 2VRWA 4FMBB 3GLIE 4PC7A 2V54A 1KK0A 1NKTA 3SZRA 1Z0JA 4DCNA 4GFDA 3W6PA 5HPYB 4PR0A 4Q7LA 3G82C 5DN6A 4GL2A 3TUIC 1G3IA 4EFMA 1NVVQ 1D9XA 1U8AA 1NG9A 4IJMA 1TPZA 2GZAA 2QROA 1VPLA 5FPKA 2QQEA 1OB5A 1AZTA 4OBEA 4CEJA 2JLWA 4DSUA 3F0TA 2XEXA 2ZI4A 1XMVA 3AF1A 4I1UA 2QM7A 1E4YA 4PTLA 1OFUX 5K8IA 3G0HA 3OIVA 3VX4A 2OCPA 4UKDA 1SXJE 2EFCB 2VP2A 4P4SB 1UEJA 2OILA 3Q7PA 1EWQA 2FN4A 2ODWA 5FUWA 2C98A 2H17A 2J0QA 5DO9A 1E9BA 2BHRA 1BO6A 2DBYA 3FKSA 4P32A 5LDDC 2QAGB 4RD1A 5JJLA 4AKEA 2RH5A 1EFRD 3LQRA 1HURA 3CO5A 3H1TA 2P5SA 3I1FA 3QF7A 5A0FA 3A1SA 2H57A 3MMPA 4B73A 4GP7A 2F7SA 2GCOA 1AK2A 1H65A 1W4BA 4LJAA 1Q21A 121PA 4MA4A 1ZC3A 1Z0FA 4WZ6A 1XBTA 3VHXA 4NYJR 4DIEA 4Q1DA 1UF9A 2WWXA 3F3YA 4URVR 2LKCA 3IEVA 2NTYC 3MWJA 2QI9C 4C0KA 1R5NA 1QDEA 1XB2A 3CWZA 4PPNA 3B1YA 3DZDA 3VR2A 5DGXA 5SZIA 4US1R 3QVVA 3K70C 1Z6YA 1Y63A 1CBUA 5FOUA 3QKTA 3W5JA 3CF0A 3H4MA 3VR6A 3IBGA 3C7KA 1F5NA 4DCSA 2O8CB 2GESA 4ZPXA 1OH5A 4ACAA 3NDPA 1ZCBA 2Z6VA 5CJ2A 1OPXA 1KGDA 2FSGA 1S3GA 3EA0A 4DXAA 5C1BA 4PAQA 1NMZA 4I1SA 2FPLA 4B6EA 4DDUA 4NHOA 2BWJA 4KITB 4L8GA 1M6NA 3BE4A 1X1SA 2QQ0A 2ZJYA 1PUJA 4MYCA 2ZEJA 5AJYA 1A2BA 1E2JA 2GA8A 1P7CA 1TQ6A 4ARZA 2ZE5A 3PUXA 4CDGA 1KNQA 3U6BA 4UNRA 4A36A 3P26A 2CDNA 3REFA 3W8RA 3WRYC 4IKEA 3TUZC 2GILA 1VCOA 1W44A 1CJKC 1OXUA 1J90A 3OEHA 3MWYW 2VP5A 2C77A 1C4OA 1NIJA 2GF0A 3NH9A 4ESHA 3PEWA 2XJ4A 2A78A 3CUEF 3MGCA 4WA7A 4B44A 1N2CE 1R8SA 1FL9A 3DPUA 4M0LA 3RSOA 2PEZA 4ON9A 2HT1A 2OLKA 5AUPB 1XJQA 5IRCD 1IXSB 3R9XA 2NO0A 1KKMA 2IL1A 1IXZA 4IOJA 3EIEA 4D81A 3VQTA 2C9CA 4NP6A 3AGPA 2OAP1 3CKLA 4EFLA 4F93B 1L7VC 2ZJAA 1GRRA 1N6OA 3EPKA 1EFCA 2YC2C 4RCZA 4BQSA 4UXHA 3FYHA 2CNWD 1L8QA 5JWHA 1GFIA 4DC9A 2JLYA 3SJZA 3AP1A 6Q21A 4LYHA 5H70A 2QORA 2NGRA 4WIAA 3T1TA 2ZJOA 4L15A 5DNYB 5AK0A 1EESA 1BH2A 5FBRB 2GDJA 4TQAA 1IN8A 4ACBA 3QPVA 1AQYA 4D4LA 4B33A 1Q1BA 3NEJA 3BERA 4V0NA 5F9FA 3T1QA 1SULA 3K0AA 1XX6A 5G3YA 4M1SA 4M8NE 1ANKA 2J5XA 1IN6A 4MKIA 4G1UC 4OQFA 1D9ZA 4OYHA 1RW4A 3M1IA 2GJ9A 4TYQA 5DH9A 3GEHA 3IPYA 5KU1A 2ZANA 3B2EA 1E1RD 5KOYA 1N5KA 1AS2A 2MMGA 2WM9B 3W3ZB 5FPHA 3I61A 1U8YA 1E0AA 4QG7A 5HZHA 2QMEA 2WIAA 4RZ3A 3DKVA 3UATA 1TF7A 2KB0A 4NL4H 1S9HA 3IQXA 4HEJA 1S8FA 2OE2A 4TLCA 4EJSB 4OI0A 1T91A 3ZVRA 3GLFB 2GVZC 4I1OA 3TJZA 2QPOA 1A5TA 5KDOA 2ZSAA 3QE0A 1XTIA 3CH5A 4R71A 3QKUA 1VG8A 2OZEA 1RIFA 4AKGA 3TAHA 4DLSA 1Z06A 4NTZA 4B43A 3OEEA 4DKXA 1A82A 4DLUA 4LJ7A 3QXSA 2QSYA 4G5GA 2B6HA 3R9IA 4FCTA 1P9RA 2TMKA 3PUVA 3LV8A 4JZKA 1T3SA 1SVWA 2FFHA 1NN1A 4US0R 2YNMA 4AK9A 2QP3A 4AKIA 2RAPA 4NCJA 3HJNA 4Z8YA 3EZ2A 3R7WB 3W34A 3LNCA 1D8TA 2C8VA 3ZJYA 4X8HA 2P6NA 1NJFA 2PZFA 2EVWX 5K8TA 3TR5A 5BN5A 1E96A 4YONB 2VP9A 4RKEA 2NO6A 4NYJQ 1SKYB 5AJZA 5EXTA 2EFDB 1AQUA 4YC7A 2GCPA 2GK6A 2ZUCA 1U9IA 2AN9A 2DWQA 3B6EA 1S2MA 4QHTA 3GLFA 4XD7A 2ZJ8A 4Q00A 2XZLA 1M2OB 3E2IA 4ZV4A 2FA9A 2HUPA 4JVMA 1KI2A 1CF4A 2GF9A 1IBRA 2ZYWX 3FMPB 4KJZA 3IQWA 3SBDA 4XOIA 1Z47A 4IEEA 2D62A 1MO5A 4XJXA 3RS3A 4CEIA 1Z22A 2IYUA 2OBNA 5HCNA 4DWJA 1KI6A 1KY3A 1AS0A 3K0SA 4DT1A 1DOAA 4PZLA 1MABA 3ZZTA 2JLZA 5B64A 1E3MA 3SJAA 1Z2AA 4JKIA 4I81A 3QF4A 3KJEA 1BOFA 4TMVA 1KI4A 3PQCA 3QBTA 2VH5R 4KLNA 5L3QA 1DELA 2RMKA 3LRPA 2ZITA 2WOJA 2WHXA 2D06A 1GRNA 2JAQA 4Q7JB 4B2LA 1LY1A 2QAJA 1E6CA 1X8KA 4R9UC 5TVKA 1J8MF 1J8YF 1VHTA 1ZM7A 3K1JA 3N2EA 4KSCA 3TQCA 1KOFA 2FF7A 3CM0A 5DLQC 3X1XA 4EJSA 4LBVA 5D3QA 3FOZA 1A4RA 3UANA 3CH4B 3A37A 5FL7A 1BMFD 2HV8A 4D4JA 4PSVA 4CEJB 2R44A 2PCJA 3SU8A 1TUEA 2OLJA 2A7QA 1OB2A 4FWTA 5J4HA 5EP4A 4A1FA 4E03A 4NYMQ 4D25A 3GD7A 4AG5A 4BASA 4D26A 1U90A 4DSNA 3VR3A 5L3SA 4KSBA 1NMYA 2GTPA 2XNSA 3VKWA 4AD8A 2W6JA 5EP1A 2IBMA 4IHQA 3K0CC 2HCJB 3AVQA 1OH7A 3D6TB 1LTQA 3B1XA 3CNLA 4LYFA 2R65A 1W36C 4QM6A 2IEZA 3V00A 4IEIA 2CMKA 2YC4C 1HA3A 4TL7A 1COWA 4GDFA 3LX8A 5EUMA 2ZIAA 3R8CA 4XVUA 2D7DA 3RAPR 4G5SA 2ZYUX 4M1YA 3K70D 2FSIA 3G5UA 1W2HA 2ZR0A 1FW6A 3C14C 3VNUA 3BH6A 1XRJA 4LDJA 3ZVLA 4PSAA 1QHIA 4KFRA 1U98A 5CIQA 1JR6A 2JLRA 3GJ5A 3NBFA 3X1DA 4IVRA 1AS3A 2C03A 3THXB 1OIVA 2JLSA 4BLQA 3AKDA 3S1AB 2UKDA 1Z3IX 2WAXA 1SVOA 1OHHA 1WXQA 3LAWA 5J4VA 1DG1G 4R2HA 1CRQA 1G8PA 5G40A 1GNQA 3T35A 1NN3A 4BFTA 4JLVA 4UQOA 4FMDB 3W6OA 1KK3A 3A1WA 1COWD 5GJBA 5FI0B 3GLHA 1RKBA 1YR7A 5EJEA 4Z1MD 3QJYA 1KZGB 3IUYA 3OEED 4V0LA 1TNDA 5EXPA 3RANA 1AZSC 3TIFA 1NNEA 1KTVA 2J0VA 3A58B 1O87A 1OKKA 5EE1A 5CDFE 1TEVA 2WSSD 3RS7A 2W00A 4DLXA 1HQCA 3OZXA 3GLFE 3U3RA 4C3ZA 2C96A 3U7GA 4B32A 4ESVA 3PUYA 1KAOA 1VYVA 1NL3A 3KDSE 4KFSA 2CVHA 2BEKA 2QT1A 1OHHD 4TSFD 3WMFA 4XWKA 4QOSA 2P65A 1EFHA 3AGQA 4KVGA 4NH0A 4Q4HB 2FE4A 4TQUS 2WIBA 3EG5A 4YMTA 1P75A 3EPHA 1RYHA 2EFGA 2WWFA 2WKRA 1F48A 1QZXA 5FOVA 4AG6A 2FJUA 2WSMA 2ODBA 3QG5A 4FIDA 2FGJA 4DRZA 3MJHA 2XJ9A 3NBXX 4Y0VA 4NYMR 3KTAB 4Q02A 3C16C 1M7GA 1DG3A 4Q21A 4XTCS 3RS0A 4N0EA 3OIUA 3OF5A 1ZNWA 5JLJA 1E32A 1VMAA 4HB2A 4C4PA 5EQTA 3ASZA 4C0QC 4XSHA 2KSQA 2J0UA 4HUTA 4BEJA 4TMWA 4ARZB 2IC5A 1DADA 2WJYA 2UZIR 1U0JA 3FWYA 3U2QA 3NC1C 3Q9LA 4A0FA 1L4YA 4C0BA 3O8DA 4PC2A 2ZI7A 3NG1A 5C46F 1HQYE 1XNJA 1FNMA 3I92A 5F2EA 1YR9A 5AJVB 1W49A 1UJ2A 1R10A 5IDVA 1G64A 2B8WA 4HDCA 4A6PA 3TUJC 2H18A 3S1AA 3ZZUA 3LVRE 1XMJA 2PZEA 3BORA 3EZ6A 2ZETA 1AGPA 1II8A 3EC2A 1IQPA 1OLOA 3UWKA 5CIWA 3GQBA 3M0EA 4PPQA 1D2MA 1VTKA 4MUBA 3DO6A 4E22A 1KI9A 4NU0A 3UKDA 4FCVA 1T8UA 3KQUA 1E2IA 1XCPA 3I3SR 3L8YA 1KJWA 4EPYA 1U0LA 2H7VA 1G16A 2YYZA 3RSLA 2A5YB 5FBQB 3QBVA 2QTFA 2Z5FA 5CK5A 2Q21A 3X2SA 2J7KA 4NBSA 4JJKA 2ZREA 1TEXA 1W4AA 3B5JA 4KHZA 4Q4HA 3FDIA 4IXNA 4M1WA 3P4XA 1P2UA 1S4QA 4QGAA 4DLWA 3P32A 5UKDA 4LGMA 1VCMA 1XEWX 2OFOA 1QHNA 4RZXA 5FTJA 5AWFC 3LY5A 3ZQJA 1GL9B 1R8QA 4QL3A 4D6PA 2O5VA 4QGFA 3NBZC 1VCNA 3U44B 2ZROA 4MKHA 3THWB 1HE1C 4HDQB 4L16A 4JLKA 2N46A 5HE8A 2CJWB 4HSEA 4Q03A 4AY2A 3RRZA 3A4MA 4RFSA 4ZI3A 3IHWA 1MRSA 1XTQA 2F3RA 1NN5A 4MDFA 2JLQA 4V03A 2R6CA 4PC1A 4TMZA 5EZ5A 2P2LA 3I32A 3K9NA 5FUXA 1ZRHA 1O3YA 3GLGE 3U4QB 1GKIA 2GEDA 2QBYA 4QJ4A 3I73A 3B78A 3QPUA 4PC6A 4B35A 5BYKA 4LRWA 1ZUHA 1YU9A 2OBMA 3QKSB 2CL6X 5D3MB 5AUOB 1CS4C 1G17A 2AK2A 1YZUA 3EAQA 4LOAA 1US8B 2J3EA 1BKDR 4DUGA 2UZ3A 2HJGA 2RGCA 4RKFA 4BFUA 1X8JA 2NZ8A 3GFPA 3IPXA 4D0NA 3WNDA 3CZQA 3FGNA 3HR8A 5IK2A 1OH6A 5JI2E 1EX7A 2IHYA 2ZVQX 3RWOA 1E2HA 4B71A 1DAMA 4LUCA 3CONA 4P3YA 4Q18A 4PAOA 1IY0A 4Q48A 3ZLJA 3ZH9B 4W9MC 2R2AA 4DCUA 1XZQA 1XD8A 2WWHA 1FX0B 2ONKA 4LJ8A 1VKJA 4CEHB 2VF8A 1XU4A 2ZRLA 3KQKA 4IOLA 2ERYA 2D2FA 4GOKA 3U4QA 3QNUA 1WA5A 4KODA 2J1LA 3KQNA 2QBYB 1E9EA 2IW3A 2A2ZA 2WMOB 1Z29A 2BJWA 3CPJB 4AWXA 1B0UA 1KJYA 2QE7A 1QG4A 3CRW1 5JHHB 2LCFA 4A92A 5FFMA 2GBLA 2ZPTX 4O0MA 3ICEA 4OQNA 1E2NA 1OE0A 2FEOA 3KB1A 5EZ6B 3E5HA 4Q9IA 1E2PA 1RJ9A 5HCIA 2EFEB 2DY1A 3CX8A 1NRJB 4PHGA 1KO1A 2JEOA 1WE2A 1Z07A 3K9GA 4GZMA 5E7IA 1W5SA 4XD7D 5ELXA 3DVLA 1G5PA 4LBYA 1Z28A 2WWGA 1E1RA 3TMKA 2QNRA 4KLZA 2QUZA 4OHWA 5E95A 4P4TA 1ZM9A 1RZ3A 3SN6A 3GEIA 2C9YA 3QOFA 4GSYA 2VEDA 3W3AA 4O3MA 1W46A 3OE7D 4FXPA 1YZQA 3U5ZB 4CRWB 4TSFA 2V6IA 4LSGA 1XXHE 1G3UA 2ZU6A 3ADDA 1VYUA 4MKGA 4YMSA 3UIEA 5JEDA 4QBIA 3K0FA 5FPTA 3B9QA 3THOA 1CJMA 1L2TA 2LWIA 3H0KA 3WYFA 4KU4A 3KJIA 1Z0KA 2A5FA 4LPSA 4OK6A 4ITRC 2X2FA 5L3QB 5JSZB 2EYUA 2AFHE 1E2DA 1G41A 4RZ2A 1AKEA 1V43A 1ZM2A 4Q9JA 4DCVA 2H1LA 1IY1A 2CCGA 2XX3A 2O8BB 1F2TA 1TADA 4IDQA 4PHTA 2PL3A 2P67A 4DDTA 5F3WB 1AGRA 3FTQA 1E2FA 1QHYA 3M4YA 1MO3A 3L0OA 1QBKC 1XMIA 2IUUA 2Z43A 3L43A 2J7PD 3IILA 2RGGA 4MRNA 2PZGA 4M1TA 3CF2A 4FCWA 4LJ4A 1JR3D 2OUKA 5A4JA 3K9LA 1UEIA 3L8ZA 5BXQC 4G5OA 1YE8A 4PSKA 2VO1A 1E1QA 2ZI6A 3QEJA 1GRQA 1OT3A 2B21A 5HZKA 4HUQB 1H8EA 1N6LA 2FFAA 4IDOA 4DIDA 1XDBA 3EIQA 3X1ZA 4B3BA 4JLOA 3PJRA 3N70A 2BC9A 3BOSA 4TTPA 4P4SA 1GWNA 1P2VA 1ZAKA 5LD2B 2OXRA 2XB2A 2MSEB 4HDOB 1NVWQ 2AXNA 3A1UA 3VKHA 1N6PA 2ONJA 1DS6A 2JDID 4GPTA 3AVVA 1OV4A 2PLFA 1LFDB 4XWOA 2ATXA 4FMCF 2YOHA 4FW9A 4KAXA 5JECA 4RD6A 3NC0C 3EZ7A 3RHFA 3T1OA 4CT5A 2R6DA 2V6JA 2ERXA 1ZUNB 2Z4SA 1IY2A 3VR5A 1W1WA 2ZSFA 2WMNB 2W0MA 3QXXA 2OFWA 1GUAA 1SVLA 5FOWA 1FUKA 3AF0A 3BH7A 2VTKA 1OXVA 5FBVB 1CRPA 1JPNA 4TYPA 5IT5A 1FQKA 4RCYA 1MOZA 3DOEA 3ND9A 2O8DA 1MV5A 1KJZA 2GXSA 1R4AA 2VHCA 3PVSA 3L2OB 5FL3A 1GM5A 1NVUQ 2J0UB 2W2VA 3AQ4A 3KFVA 3KFXA 4YDHB 3RRMA 3WMGA 1Q20A 3KKMA 5C4MA 3UG7A 2RB4A 3NHAA 4TLDA 4EPWA 2O8BA 3CR7A 3CZPA 2BMJA 3OFND 2HCBA 4TL6A 4M9ZA 5J5CA 1E0JA 1NIPA 5KTYA 1X3SA 3CNNA 4DZZA 3KKNA 4Q1EA 1XMSA 2IYXA 3KJGA 2OM2A 3KUCA 3QUSA 3W9YA 3WNCA 4ZCIA 5BWMA 2GJ8A 3T61A 3L0SA 1MT0A 2QMHA 4PHHA 2CHVA 2P6UA 2KBFA 4LHYA 2YWGA 1II8B 2QT0A 4JSTA 1ZD9A 5HKKD 1YQTA 3X1WA 3RABA 4B47A 1WF3A 4PFSA 4XH9B 4HUQA 1HY3A 2PJZA 5A5GA 2WWYA 2JJ1A 2ECKA 5JS8A 3U61B 1GSIA 1S9DA 3LBNA 5JFGA 5B58C 1UKYA 5KSOA 3VNVA 2OG2A 4EPXA 1LF0A 1Z0AA 2XXAA 3E70C 1ZINA 3K0CA 5B2ZA 4LY6A 1YVDA 4ZCLA 3QI2A 2BMFA 2CBZA 3OAAD 4Q9LA 3DHWC 2VBCA 2ATVA 1NY6A 5J4KA 1Z6GA 4LI0A 2WPDD 3AUXA 3ONWA 2QTVB 3GJ3A 1QHGA 4PPFA 4HZUA 3W6NA 3B8HA 2G0TA 3GJ8A 4OI4A 3NVAA 3AUYA 3MFYA 5FTNA 2JJ2A 3FFAA 3GJ7A 2R9VA 1XXHB 2X8AA 3ZVMA 2HLDA 3U44A 1P4SA 4KCGA 1T3HA 4Q7MB 3LW8A 5KSZA 4I99A 3GLGB 3FHCB 1G19A 1NG1A 2CHGA 4PXAA 5DE3A 4DSOA 4Q9KA 5JRJA 4F4IA 4C0AC 5JEEA 3TW8B 2E87A 5TMPA 5GJVC 3RWMB 1W0KA 2I3BA 4EPTA 4I4LA 2GJAA 1II9A 4YLGA 2IYRA 1ZD1A 2NQ2C 2ZJBA 1UBEA 1G291 2XAUA 1A2KC 1XJCA 2AWNA 2QAGC 2X77A 4RD3A 3NDBB 1F2UA 1SKYE 3KL4A 1L4UA 3LLUA 3WXMA 5TV2A 4JBXA 2YV5A 3E1SA 2JJ2D 4BECA 3EPLA 1E1QD 1MO4A 2V4ZA 4HLUC 3SQWA 3MCAA 1YRAA 4U00A 3U3OA 2PCLA 4JS0A 3DL0A 2QMUA 2QSZA 4NYIQ 3RS4A 1XP8A 3AH8A 1G6OA 4JL6A 1I2MA 1JEEA 3MUFA 4A0RA 1KDRA 4PAMA 3FE2A 3LDAA 2IWRA 3T5DA 2F1HA 2A9KA 4NONA 2ZS7A 4OJQA 4PZYA 4CZ2A 5L3RA 4B76A 1TMKA 4N3NA 5EXSA 4HLCA 1H8HD 2F6RA 2OV2A 1KNXA 1LF5A 1Z08A 4HI0E 1XFAA 3TBKA 2G3YA 2WKQA 3NXSA 3HPQA 1GG2A 3F5FA 3BB4A 2WBLC 3MWKA 4BUJA 1FFHA 1R6BX 4YXWA 4F91B 5JJIA 2WJIA 4PC3A 1N3BA 3PUZA 1FMLA 3EWSA 1G7CA 2O0HA 1PV4A 4JLAA 4TMXA 3EA5A 5KDLA 2YINC 1GIAA 4RY2A 5B30A 4C0LA 2W83A 4HZUB 4OHVA 1YR6A 4B75A 3QKSA 1Z83A 1YZLA 2ODEA 4OK5A 3ZIAA 1N0VC 5JCPA 2WJVA 3T12A 1DPFA 2R62A 3OHMA 3P1JA 1JAHA 1UKEA 1HTWA 2PBRA 3CPEA 2ZSEA 1KO7A 1CTQA 1UM8A 1XWIA 2YKGA 1E9FA 1LW7A 5FL7D 2O52A 3H86A 4DHEA 1GAJA 5J47A 2GBLC 2CK3A 4LWZA 2YWEA 1ONBA 4L4UA 1UDXA 3PG5A 4JL8A 5DYIA 3WYGA 1OXSC 1NP6A 3QG1A 1LS6A 1P61B 2IYLD 1TAGA 3VMFA 2NOAA 2XOKD 5CDFA 1RYFA 1E99A 1UPTA 2ZI9A 4HAXA 3WBJA 5JBQA 3BBPA 5JSZA 3P20A 4G01B 4CW7A 2RGXA 1RJ9B 3BFVA 5TB5A 4XVQA 3WNBA 3PV0A 2WSSA 2Y8EA 4QXAA 3T15A 4A2PA 4G3XA 3BIFA 3VU9B 4W5JA 3CX6A 1JR3E 1SKQA 2W2TA 3ZZ0A 4B48A 1CP2A 2NG1A 4M9XA 3EW9A 3PIRA 1Z2CA 5JJKA 2A5GA 2ZRJA 2IEYA 3L0PA 4LX0A 4MYTA 4PHFA 2G1JA 1NF3A 4Q4JA 3SS8A 2CEAA 4V02A 2JJ8A 1NJGA 1G21E 5J40A 4LHWA 2FH5B 2JASA 4PZZA 4TYWA 1PLKA 2W2XA 1A7JA 4TT3A 4BE7B 3GJ0A 4PANA 1N6RA 3DMNA 4DLVA 3TH5A 1K8RA 5E7JA 2BJVA 1VG1A 4JT4A 2J0SA 1ZIOA 4LV6A 3IIMA 4K81B 2GVDC 3Q5EA 1G4AE 2OCBA 2CHQA 4PX9A 4AIIA 1ZM4A 2IS4A 1WCV1 1D5CA 1WMSA 3A4NA 1RRGA 5C4GB 1N6KA 4II7A 1OJLA 2YOGA 2GJSA 2ZTSA 3LX5A 1GVNB 3O8BA 3M6AA 2QEQA 2DWOA 4L9SA 3R20A 2ZRNA 4RD2A 3U3MA 2WAYA 4CIDA 1U99A 2QY9A 1IN4A 1E69A 5K8LA 1F2TB 3SYLA 2QA5A 4NPHA 2ZU0C 4C0HA 4D0GA 1YZKA 2Q9CA 3EIHA 4QRHA 4NDZA 5DHAA 5FTKA 2A5JA 2GAAA 3U7HB 2F3TA 4Q4JB 2NPFA 2E1RA 1LS1A 1G7TA 1B23P 1G3MA 1P3JA 3NH6A 2PT5A 2O8CA 2OESA 2ZVPX 3ZVNA 2FMXA 4KI0A 4ZIRA 2VSXA 4IVPA 2ZE6A 5FTLA 2VQSA 4Q66C 2XTZA 1KI6B 3TVTA 4AURA 4EJSC 3K09A 2ZR7A 4GOJA 4PO1A 2W6ID 3O8CA 2XGJA 1K5GA 3AF3A 4FWIB 3B9PA 5KSPA 4JYBA 2FX3A 2PLRA 4TWZA 4KYIB 4Q9HA 4A8JC 3REGA 1SGWA 1YR8A 2B7BA 1GDDA 1OFIA 1H8HA 3LXRA 4LHVA 4N0DA 2A30A 5FR2A 1D2EA 2WZQA 3QKRA 1CLUA 3GLIB 4XWAA 4BLOA 4NCKA 2VLIA 4HLQB 3SBEA 4ZI2A 1TF2A 2IS1A 4W5HA 4MKFA 1MKYA 2WJGA 2DCUA 3DM9B 1Z5ZA 1ZYUA 2NO1A 4JLPA 4D4KA 4LK2A 1TQDA 1M7BA 1FPMA 2VP0A 1UDWA 3C5HA 5AJWA 1J7KA 4TTQA 4JLDA 4P33A 3CRQA 2B8TA 5CK4A 2ZM5A 2ZSDA 2DHRA 1MH1A 4BGDA 1IJFA 2AL7A 4JT2A 2FNAA 2FWRA 5E4FA 3WBKA 2DPXA 3AF2A 1T4GA 1CR0A 3TR0A 1XTKA 1DAKA 3I5XA 3SNHA 2W58A 1SXJC 4FMCB 3DM5A 1E79D 2V7QD 2EWVA 5JS7A 1R5BA 4JLBA 3TSOA 2UVQA 4HZIA 4HB3A 1ZNYA 4OI2A 2E9SA 2DFLA 4AKHA 1OW3B 3V4RA 3LBHA 4B3GA 3LD9A 3EPJA 1JPJA 4TZ6A 1G8HA 4OQMA 2WPDA 5P21A 2XSZD 3CRRA 1TX4B 4DB4A 5FR1A 2J9RA 4MRPA 1P6XA 5GVSA 2NO9A 1Q1EA 1LVGA 2WKPA 1YJ5A 2VSFA 1T0JB 2C04A 4C0JA 4BZPA 4QBFA 3OFNA 1FQJA 1KAGA 2ANBA 5JCZA 2V1UA 2NMVA 4ZO4A 5FPSA 2GXQA 3BGWA 5CM8B 3ADCA 1ZNZA 5BN3A 2DB3A 2HT6A 1G7SA 1SZPA 4YDSA 1E2EA 2FPMA 1N6HA 1RVDA 3K0AB 5SZJA 4AC9A 4HAUA 1Z0IA 1J2JA 3RC8A 1VYTA 521PA 1IXRC 2XSZA 2C99A 3AVOA 2ASEA 1HH4A 1TF5A 3J81k 4BLTA 1I4TD 1NVXQ 4TN1A 2KI5A 1FMJA 1WBBA 2V1XA 1IOZA 1RRFA 1XEXB 2G88A 2R8RA 3NKVA 621PA 1XCGB 3GFTA 3KXIA 3LVQE 3GMTA 2CLSA 3GJXC 1M8PA 3UXMA 1CXZA 4MYHA 4YMWA 4ZCMA 1Q3TA 2GZDA 3K8YA 3VAAA 3CBQA 3FMFA 1SXJA 1XXHA 4QGGA 5H68A 4BRWA 4RFVA 5KYKA 5AR1A 3DZ8A 4M1OA 4DVGA 4QFMA 3UK6A 5FPYA 3EZ9A 4L5BA 4RVCA 4WVFA 2ZRCA 5EP2A 2XZOA 2IYQA 1WB9A 3X1YA 3FHTA 2D3WA 1CIPA 1J70A 2FPKA 4M1KA 2BCJQ 4YQFA 1C9KA 4DDVA 4IFBA 4Q01A 1KKLA 3A36A 1BYIA 3I8SA 4DDWA 1Q3HA 4JBWA 1E79A 2V7QA 4O2LA 4OHZA 3B7GA 4BZXA 4MH0R 3T5GA 3U3JA 2Z4RA 4EQ6A 1XTJA 4UJ5A 3QXHA 5L8VA 1T0HB 2HYDA 2PH1A 3EWAA 2BVNA 4LBWA 3UG6A 1QVAA 1F60A 5HKKA 1K5DA 2AD5A 2LKDA 3TRFA 1G6HA 3HU1A 4H1VA 4TMKA 4UNNA 5DHFA 1CULC 3C15C 3PCRB 4M4SA 1FP7A 4JLJA 3THWA 1GKYA 2IYSA 1TTTA 1KI3A 1NLYA 3QQ5A 2IWHA 3SQXA 3HU3A 2PMKA 3GJ6A 1GOTA 1E9AA 3FFBA 4DT1B 4JKYA 3MG9A 3TAUA 4GP6A 1KMHA 2JGNA 2EWWA 3ASYA 4IFEA 3C8UA 4H1UA 4PQFA 1ELOA 3EC1A 4LJ9A 2J45A 1TU4A 4URYR 4BZQA
chains in the Genus database with same CATH superfamily
3ETJA 2ZRPA 3D31A 4LRUA 1N6NA 3E22A 1XEXA 2G5CA 1XWWA 3DV2A 3PE3A 4KBFA 4P08A 5KWJA 1QCZA 1X39A 2AXQA 4XJTA 2VG8A 4OBBA 1BU5A 2CDAA 1JYFA 3UMFA 1RWXA 1AGXA 5INTA 3PLAE 1XD2A 4I4NA 1UIMA 2RSLA 1BH6A 3JAMA 3FMOB 4HO1X 3F8SA 4Q19A 4BX3A 1DCMA 4ZI7B 1FA9A 2H51A 4OJKA 3LOPA 1T4CA 1KFBB 2ZRQA 3ETEA 4ARSA 3HFGA 3TX6A 3PXCX 3EXHB 2FUCA 3LHFA 3ZYZA 1SHTX 4ALNA 4EG0A 4IGAA 1HFWA 1ZJ5A 2I6QA 3GL9A 2C2HA 1SIUA 4GUAA 4R2LA 1X3LA 5TDHA 5ALVA 2WKWA 2EW1A 1CW2B 2O8VA 4RDIA 3D5EA 2W6JD 4Y2GA 5FP0A 2QRGA 1D2GA 4EKDA 1J0EA 5HJEA 1ZJ6A 3W90A 5AUQA 2ZB7A 2A59A 2H1RA 4ZREA 4HNGA 4NJEB 5IAAA 1JJVA 4L4RA 3SYTA 2CNWA 5FTWA 3ROFA 2ANCA 4D96A 3WB0A 5J2TB 2A35A 4KGZA 1HT2E 4UXIA 2RI6A 4U7JA 5JSYA 3Q8WA 1M1UA 2VQ6A 4FX2A 2ABWA 2A8YA 3EGWA 4Z0TA 1LDBA 1UCFA 4X6LA 3JU3A 3K09C 4H35A 3KZ1E 1AGNA 5HS6A 3MRXA 4FZVA 2P69A 2H3HA 4KV9A 4Y1RB 2ZRIA 3OJCA 2GPYA 1RBYA 2LV8A 5LU9A 3DBLA 1QGOA 4UDOA 4UMVA 4KQMA 2JBAA 3LF1A 2HI0A 1UH5A 1JLHA 2PKQO 1VCHA 1ZWLA 2PWYA 2VR1A 4EGSA 4DV6B 4HVAA 2EDAA 4TVOA 2HSWA 4LZJA 2DHQA 2FVYA 4DR1B 1IUNA 2R86A 1DC5A 5EIFA 5BW6B 3O4VA 5FEUA 3R6LA 1UBGA 1L5OA 1XC7A 1IOWA 2AFIE 4ZVRA 4EG6A 3VR6D 2HMUA 5AKHA 1JBKA 2X5KO 3L07A 3LS2A 4G56A 4NPCA 4QICA 5CLLA 4Y7DA 3WVNA 4JI4B 3IVCA 4XIYA 4NBKA 4TT3D 5AK3A 4BLPA 5IS2A 1CCWA 3PUHA 2OKCA 1QHHB 4QO7A 3DOFA 4D82A 3KPJA 4H7JA 3SFZA 5F64A 1Q44A 4QVGA 3ONDA 1DIAA 1N5LA 3N5CA 2AWOA 3CURA 2JFVA 2I99A 1V7PC 2CE7A 2ZRMA 4B17A 2RH8A 4Q16A 5K3CA 5KEIA 5AJHA 3ZDDA 3IHLA 1GA6A 1TM3E 1MO6A 2YJTD 1PQPA 5FAXA 3FLAA 1U65A 4BEBA 2NP6A 3MJEA 2XBMA 5DGHA 4C7OB 3B5EA 3P2IA 1M1ZA 4YI3A 4PLHA 3NZEA 4S1VA 1BCSA 1LJLA 5ALPA 4YV0A 3D43A 3NTUA 1I6WA 1JDJA 1MXFA 3FVRA 4HZGA 1QP4A 3AESB 4KWIA 3OZGA 1LKZA 1CUHA 1H22A 4Y6LA 4BZWA 5MDHA 2JVJA 2GEKA 3MC1A 3JYOA 4GOMD 2W9XA 4YAEA 1X8LA 3CUVA 1E2GA 4BLSA 2RCNA 2EZ9A 2QRMA 1V5WA 1E9SA 3A8TA 2HBRA 4BV3A 1AQJA 3HSSA 4WSOA 4OPMA 1UFKA 3UV6A 1Z8NA 3WK9A 4W5WA 3F6YA 3KG2A 1XP5A 2WF9A 3KLMX 5FWXB 3Q7QA 3K0FB 1K7FB 2DTXA 4IOKA 5EOVA 3WSTA 1PG2A 1SXJD 1J0BA 5IJ0B 1J00A 5IU6A 1W7AA 4TYYA 4AJ2A 4D4MA 1EDZA 2F4NA 1CZRA 2ZB8A 2ZZNA 1OA0A 3JQ6A 3F9CA 5EE9A 4R01A 5ETJA 5EUBA 1C50A 5DHUA 1BYUA 2CYCA 4ZAFA 4BEVA 5DIFA 3OZAA 3R0VA 4AY5A 3L9XA 3H83A 2VUUA 5FF9A 3DDCA 2ZTLA 3EMBA 3D4OA 4OY3A 4F8YA 3DEFA 5DASA 5C32A 2IP2A 2Z57A 4KL8S 4S35A 1D6SA 2ORVA 1QIEA 1XK6A 1ARZA 3E23A 4WKBA 4MPTA 2ZS8A 1SCKA 4Z4FA 1N1DA 2BGUA 2VPXA 4GRDA 4LMRA 4ENVA 4FYPA 4XWGA 4L07A 1D6JA 5DX8A 3VPCA 3T34A 1PBTA 2HU8A 2OPHA 3CEJA 3FKSD 5E3HA 2AKYA 1K2WA 1IEQA 2WM8A 1T3LA 4RW0A 4DR3B 2DXIA 2GNAA 5AW1A 2C2WA 2BOVA 1NVTA 2BEJA 1Z4LA 2FV8A 2DFVA 2V5UA 3DVRX 3MJCA 3NLLA 4UBLA 4YWJA 3GWZA 4X00A 5G53C 4HDMB 1DIBA 1GUBA 2P8SA 2VJLA 3ZJ4A 2JLXA 1U9IC 1U2SA 1VCIA 3PHBE 4JX8A 4BB9A 4DMFA 2VYFA 4R8VA 1AMNA 3S7TA 4KZPA 4MQBA 2FWNA 4MIYA 2X3UA 4FJ2A 3LCJA 1FNDA 2PRYA 2ZJ0A 4O4JF 1YASA 1BQ4A 2OK7A 4WZAE 3RK4A 4Y2XA 1VMDA 4TLLB 1CJVC 3JZDA 2A3RA 1IH8A 4F2WA 3N8GA 1DO2A 4FVTA 3OZVA 2RC5A 3F1KA 4Z49A 4Z7QB 2EERA 4IR7A 3AV0B 3MD0A 1DAIA 1KVTA 4Q9DA 4BMXA 4BV2A 5C81A 2ODAA 1H23A 4F4CA 2D6FA 2C92A 2YIDA 5ICFA 3I23A 3MWEA 4H18A 2AUMA 4NZZA 2X9VA 5A3JA 3A6GA 5JVDF 1UFVA 2H92A 1VJ5A 4MHOA 1EWRA 2I2DA 2YZKA 1NRWA 3LWNA 5I7HA 2PQMA 3PUWA 2BEWA 4MZXA 3U4DA 2Q6TA 2KWIA 4QT0A 2DBVO 5FT9A 3CSSA 2O8DB 2HRZA 4FNMA 4ERNA 2W43A 3MMNA 1W0JA 3ES9A 3H18A 2Y1OA 3N76A 4ZU3A 3O4JA 1ZN8A 4GOXA 1R6VA 1SZCA 2ZTUA 3QX9A 3EZFA 4C87A 3V9PA 2HZ7A 5BT8A 5JANA 1UK8A 2GETA 3VR6H 2AIRA 4TTTS 2RKOA 1QRRA 3PITA 3H11A 1QH0A 1RHQA 2WHEA 2ZDHA 3A6DA 3JWIA 3T5CA 4N7BA 3ZDZB 1XTSA 2A92A 4DGQA 4NBLA 1JR3A 1FQOA 1WCIA 1IZ0A 2NSDA 2PUJA 3NANA 4BO1A 3C41J 1PD1A 4D2IA 3PL5A 3N2KB 1BXRA 1G2QA 1WCWA 1Y7LA 2I2XB 1OLXB 4Q5IA 1A04A 1KU0A 1SHZA 2NT4A 4FHCA 4G4SO 4OQQA 4TMTA 5ER9A 2R1UA 4TUYA 3REQA 3SFVA 5JDIA 2CN1A 1R50A 4G26A 4QGBA 1JKFA 3F3MA 3UCFA 3W9UA 1LV7A 2I8AA 3WMXA 1Y1RA 3EWNA 1CY4A 3NT5A 3QIAA 4WLOA 1EFTA 4AZ3A 3NYQA 1EXWA 2J9FA 3D5QA 4MTCA 4PYJA 2GK7A 3D3NA 5BWBA 2OHVA 1RYDA 3LC7O 1YZTA 4MR9B 4AQ7A 1O5TA 4E7OA 2RJNA 4L5AA 3VR5H 2IEAA 1I30A 2GD0A 2WWIA 5LD2C 3JQQA 3ACDA 4ZODA 2PH7A 3PGMA 2HKIA 3UF0A 1E2LA 4B8ZA 3OSUA 4HSGA 1ZLXA 4BNGA 2QPLA 5EJ6A 3CTMA 4PX2A 5CITA 3GEBA 3U1VA 4MV4A 1Z7YA 1B0ZA 5DTQA 4B7CA 2QTMA 5CFPA 2ZUFA 2QMZA 3EB9A 3HADA 3KJHA 5G1PA 4DLRA 1Y5LA 4PQRA 1Y8ZA 3G0GA 3GLFE 1NXQA 1KIFA 1GSHA 1JV2B 1RP7A 2HXSA 5EXDA 2HQSA 2YJNA 1XN4A 4WK0B 3HCOA 3IP7A 2X9QA 3RGWS 2GO1A 4BUCA 3H2BA 1KS2A 2HLNA 4YAWA 5HTKA 3WV4A 1F20A 1Y6JA 3ZIUA 3VDRA 1HI9A 4R69A 4KWCA 4D8WA 3EASA 3PD7A 1Z4NA 2REXB 1CUAA 1PS8A 3DWFA 1Z16A 4BVHA 1UADA 2E4XA 4MINA 4NE7A 2PGXA 4JBYA 4RS3A 3QK7A 5T4EA 3WMEA 5JCJD 1ZU5A 2YIJA 3FVVA 2YZGA 3LKZA 2ODPA 3X43A 4BMPB 3W7VA 1H8ED 4LJYA 4QPZA 3W04A 1BX3A 4JVSB 4TXMA 2CL7X 3QUCA 5KZMB 4FC6A 2AMVA 3NRCA 2ZVDA 3GCXA 1P4JA 3JAWA 3KZKA 1QS0A 1KJIA 1ECFA 3D3KA 3NTQA 2OYCA 2PGLA 3AR3A 4P7JA 3ICQB 3MILA 4O2BF 2J3JA 4MS3B 2QZ4A 5DM60 5CDGA 1WDTA 1XMXA 1U3TA 1WD7A 1YCDA 2LVBA 2QN6A 3WKEA 5IZCA 3ECCA 3BGSA 3OIDA 5FQNA 3AVTA 3IALA 2Y1LA 4G07A 3AB7A 1P3DA 3LA6A 4FBLA 4QUDA 3K31A 4G5QA 1H6AA 1KORA 1E5XA 1BXZA 1P73A 3CRZA 3LT4A 1GPJA 3A9WA 2VXCA 3C87A 3VNQA 5D00A 1NW6A 3RFUA 5LUAA 1N32B 3UB4A 4XRGA 1QHFA 1UZUA 2YWCA 2A1TR 3I83A 4GW3A 1W36B 3K73O 4Y2VA 2XUHA 4E51A 4DVJA 1BMTA 2GKSA 1YCFA 1C7RA 1EVIA 2IE8A 1BX1A 2G82A 4FP9A 4GICA 3KB6A 3RVJA 3DL7A 1IRXA 4NZOA 3MRSA 3ZHYA 4XSGA 1BHO1 2MSCB 4L3WA 1JEQB 3ENVA 2DEUA 3QLVC 1UJ4A 2R1TB 4MNTA 1TVEA 3TG2A 3I72A 4ECAA 5KOHA 3LGXA 1NBIA 3QOYA 1PUIA 3NDIA 1XF9A 1WD5A 4MWSA 4AO6A 2QHXA 4MLPA 4FKMA 4A6XA 3KEFA 3WLQA 3V4OA 4MWOA 4BN5A 4HLUA 3M6MD 3QFHA 2PUFA 3JWGA 1AA9A 1R0WA 4AAYA 1YJBA 1MO2A 2BFOA 2BGGA 2J3DA 5JY1A 3ZWAA 1Y6QA 1ZZGA 2RK6A 3EGVA 3MLEA 1GPMA 5FWDA 4MDEA 4IS3A 5HQJA 4C21A 2GK3A 2QRKA 1N5RA 2R00A 5KPDA 3BWVA 3H4VA 2BMEA 2EQBA 5FBLB 2VZ9A 4PO8A 4C0XA 4Y1RA 4NKRA 1B14A 4ZN6A 2CZCA 1RYYA 1AV6A 2BHTA 3PIDA 3GA0A 5I01A 1BS1A 2HF2A 1P17A 1MJHA 1O94C 2C94A 3COPA 2QNIA 1XZIA 1M34E 4BAUA 2ZWMA 4EPRA 3EHDA 2PKQP 1QC5B 4NVRA 1RXWA 3FLEA 2DFNA 2MMCA 2Z0MA 5J2TF 4RVOA 1PZEA 4JR2A 4U63A 2C95A 1WNTA 5AKGA 4PLCA 1MIOB 1EWKA 1I9CA 4K9SA 3CRVA 3OTHA 1DJNA 4U7FA 2COUA 4ATNA 4HAVA 2WP8J 4GWGA 1IEVA 5LL6P 4OX9Y 1SAYA 1H6CA 5E6UB 5E9AA 1LBIA 1WBDA 3UCXA 3NKFA 1R5JA 4G5FA 4NSNA 4XE5A 5AW7A 3AKEA 3HCRA 2EWMA 3DNPA 4J7XA 1Z6QA 4X60A 4I1PA 3BMOB 2C2OA 3TPCA 3HDTA 3W1EA 4A6DA 3JQAB 4HEA6 2ZUWA 2FQQA 2XMBA 1C9MA 1UBLS 4G2NA 5GZ1A 2AXEA 1CPYA 5AUNB 2YDYA 2F55A 1EM6A 2VF4X 2ZXUA 2UUPA 2NXWA 3H5LA 4D6YA 2I22A 2G9RA 4GKAA 2A9JA 2JAHA 1WWKA 3HKCB 2R79A 3GZNB 1U5AA 3D6HA 1H2ZA 3TZCA 4YGXB 3VZBA 2GBPA 1IY8A 1MUUA 1P2SA 1PVVA 4RK1A 3TD6A 4DLZA 2GS9A 2XTAA 4L3OA 2DLCX 2X2EA 4OA5A 3RG2A 4E5UA 4NARA 1YQQA 5FPPA 4DWVA 4UNSA 4MMZB 4PG8A 5BPHA 3O7WA 3QY0A 1Y80A 4FYMA 3GNQA 1MX3A 2OCDA 2JEYA 3DAHA 3PWTA 3RC3A 1A71A 4J2TA 1H2FA 5CYOA 4YP9A 3HJBA 3T3OA 2QU8A 2Y0CA 2ZULA 4JU8A 5A9SA 4K03A 4LSMA 1QV6A 3DAGA 3EDYA 1G20E 1R2QA 1SVIA 2B8EA 3LX4A 4MWCA 2Q3MA 4BMNA 3D81A 5AJXA 1SQ0A 4LGVA 3SOPA 5HNKA 3AVWA 3CIOA 3LFTA 1UPCA 2RGNC 2ZBRA 4I50A 1G0NA 2YYSA 3FUTA 4MGIR 3T7IA 2ZFUA 1M72A 1NP3A 5DWVA 3C0KA 1VL8A 2JJ1D 3AL0C 3KVNA 2W2LD 4B3IA 1CF9A 2OP0A 3DLAA 4NG5A 3KT8A 5IDYA 3NHBA 1IEXA 2O2JA 3L6UA 5BNWA 1H5UA 3LLMA 4BWFB 3RVRA 4FN5A 2QG4A 3QTBA 4BQFA 1MU0A 4EB6A 3AW9A 4B7XA 1P2TA 1CZUA 3QVTA 1SRQA 3TAXA 4AECA 1KDPA 2BCGY 2Y1DA 4BHTA 5GIOE 3HB7A 3WLTA 4CCWA 2IYEA 3WKDA 1LV8A 3OQOA 3B38A 2FPOA 2COKA 3LHSA 3EFOA 1DJLA 2XUZA 3MWDA 2RE8A 1EJ0A 1T8SA 3UAGA 3TMYA 1MTZA 4BWYA 4RTJA 4RC9A 3UWPA 3G68A 3ZPXA 2PFKA 4AS2A 1WP9A 3DEIA 1LLDA 2X1HA 4JWKA 1M34A 1E9DA 1I4OA 1TU3A 1TD9A 2I62A 1GPLA 1GZ4A 1BIFA 3S28A 3T7RA 1N5OX 3U81A 3VYVA 2DOKA 1IHDA 1ZC4A 3IUSA 4Q4DA 1O89A 3A6JA 1CKEA 2EFJA 1TYCA 4LYJA 2GPSA 4RMNA 3RT7A 3SAJA 3LECA 1I2CA 3UHPA 4CIYA 4KR2A 2GCNA 3PX2A 4ZDKA 3PE6A 4UMEA 4Y2HA 1JDUA 3KEGA 5J2UA 5EHZA 1MC8A 4Q34A 4YP0A 2R6FA 3EFBA 4AIRA 1QIDA 3BCSA 5CFQA 1SVNA 1UR5A 1CUWA 1J22A 2ZJ5A 4HBGA 3TLGA 4G0NA 3BTVA 3DZBA 4O5AA 5DTEA 2C4HA 3UWOA 3FSGA 2WYIA 1U3WA 1YGYA 1Y4UA 3DHYA 1L8XA 3MIIA 1M5TA 2OXIA 5JSQA 3T3MB 3MWLA 4I46A 4V2UA 5J9FA 1A0OA 3JQ7A 2BGNA 5JTUA 5M2QA 2NP7A 2R66A 4XFKA 1E6KA 3H6HA 3SDZA 4EUEA 3GPLA 4U5XA 3ZK7A 1O6FA 1ITZA 3BH0A 1KZ7B 2WPNA 1SOVA 3LM8A 4JUCA 2OSVA 1TZMA 4ABYA 5HUHA 2SKDA 5D2CA 3VC3A 3C1UA 3W1VA 5K0TA 1AQNA 3BAFA 4NV3A 4JD5A 3Q7RA 1ZIPA 4UHBA 1TA4A 4YN3A 3WWPA 5C7IO 4XIGS 3NOVA 1IONA 2Z98A 1K1EA 3G1WA 1NN0A 1PU2A 4TKUB 1Y4SA 1DVRA 1OYYA 3BSYA 3HR7A 4CM4A 5JG7A 1RABA 2Z5VA 3LLSA 4YRQA 2J59A 5AW5A 5LB2A 1MB0A 1FP1D 5AKXA 2HCFA 3ZK8A 4B3FX 2XUGA 3CGWA 4ER7A 4FFBB 3D6JA 4UHJA 5TMEA 2FZ4A 3VJRA 3ASVA 1ODFA 2CF5A 3O3OB 1UPUA 1CUIA 1VMEA 4DMCA 1RLIA 3U4HA 4WY8A 1ZVKA 3PBKA 4CF7A 4ZJZA 5CVTA 1KSFX 2C9MA 3TEJA 3W8NA 4QGHA 1HT3A 2QRLA 2R85A 1QIMA 1VMKA 4L6AA 4ND8A 3TPFA 2DYKA 1ZRSA 1Q1AA 2VCEA 3ILSA 4E3ZA 3IKTA 4FB4A 3ZS9A 2C4TA 3JVVA 1XMQB 3GBPA 4QJ3A 5KNBH 4ZTUB 2XYRA 3ENNA 1ECLA 2GEBA 4Y0NA 2HF7A 5F12A 5DF1A 3RS8A 5A5EA 4N9WA 3I9NA 4RA9B 1YR2A 5BRAA 2QPTA 2EGHA 3GN1A 4NCHA 4F1JA 3FI9A 4LF6B 1K7YA 4LJLA 1M2NA 3EQ2A 4D0LB 4GKKB 4ZJYA 1IL0A 1N0IA 3ANLA 4B4OA 1RPNA 5FQOA 1F0PA 3O8QA 3KU4A 4Y30A 4M89A 1ZUNA 4UVEA 5EXXA 4DAOA 5CCXA 3ZUPA 3RU2A 4BATA 4LCBA 2PD3A 4EGAA 4PLTA 3MSXA 4RZUA 3H84A 3H7IA 1GZSA 1RM4A 2ORYA 2WU0A 2YBEA 3MEQA 4I66A 4MUFA 3BF8A 4XRRA 5FOTA 2IF2A 5LPNA 3TRKA 1C30A 3A4IA 3MGAA 4MVJF 3FCEA 5C35A 5ERYA 3QMPA 421PA 1QGUA 3KL2A 2RGEA 4E2YA 2YCBA 3MCUA 2OXCA 1KOLA 1JHYA 3ZDCA 3IE1A 3JASB 2ZUEA 2GXAA 2JPDA 3DHVA 4OXRA 2JGRA 3HJCA 4AP6A 1LC0A 3EVTA 3KLOA 4ALJA 2OGUA 4DUPA 2R1VA 4HD8A 3RHTA 1P4HA 1RC1A 1Z56C 2ECFA 4GQAA 2QZSA 1Q84A 4ND1A 3WLFA 4CFZA 4FUTA 5KYXB 1PQ4A 3PZRA 3U6KA 5L3VA 1HT1E 4OKSA 4RDXA 4DG5A 2WJ3A 1J9EA 1YQUA 1XZLA 2DETA 1KSJA 7MDHA 2OCAA 4RHXA 5TE9A 1V11A 4QJ5A 4LV5B 5FNVB 4B3CA 4JIGA 3GLGA 4GX2A 4B31A 2BTOA 1DRVA 1BD3A 3ITKA 1ND6A 2GWHA 3PD1A 1U7XA 3D64A 3ZBPA 1XZJA 1P44A 4IG9A 2QL6A 3PEYA 2VA9A 1XKTA 3AR6A 4IL5A 1PZNA 1KMCA 4KXFB 2RHMA 1J09A 2WR8A 2B69A 2OOSA 4C7XA 5K8JB 3HPRA 1L8LA 4POAA 1EVJA 2OQRA 3AF4A 1Q92A 3KVOA 1SUEA 2FEMA 1Y9JA 3NASA 5AKJA 2HF8A 2RHLA 2ZSUA 4U2CA 1JQJC 3OJFA 1DEXA 1RRPA 4MWGA 3BRSA 4EMUA 1EB9A 3EDOA 4YT5A 2WY2D 1C1YA 1IDOA 4Q3KA 2GBFA 4XVRA 5JMWA 2PVCA 2QRUA 1XK7A 1SKBA 4E09A 1BA3A 4R7GA 2AOVA 1JWLA 1JDBB 4HP8A 3ILYA 2HIHA 4OP2A 3HGTA 3RV4A 1CB0A 2SKCA 4XAQA 4Z9BA 1YBMA 3MHPA 4CCYB 4TKVA 1SOUA 5KREA 2WTUA 2QVGA 3UOGA 1FLDA 2FPWA 4WXMA 2AMJA 4F7WA 5LLDA 2J48A 3PNOA 4QC2A 1HC7A 2Z95A 2VOEA 3PT5A 1INLA 1DT3A 2WHPA 3I9V1 4OH1A 4TV9A 1H5NA 4AROA 1JB1A 3VBEA 2BDEA 4BXOA 1KYXA 2NSYA 1UKCA 1LDGA 3AIOA 3WXBA 5KUTA 2XNJA 2C7BA 3TW8A 1OFVA 1W48A 3FSEA 1VG0B 1XJ0A 1EP1B 5JHGB 1YULA 1QQ6A 4B2PA 4RH3A 5JXWA 2NTNA 1YRWA 5EJ7A 2N47A 3OD1A 2OC4A 2W2PA 5REQA 1PWHA 1KE1A 3AUSA 4EYKA 4Q47A 4QHYA 1DMRA 2BONA 3WOVA 2JHAA 5JNUA 2FOIA 5KYYA 2FSFA 2OORC 4LE2A 5EIBD 1Q0QA 1VL2A 3RVKA 2HDOA 3PXUA 5KX5F 5BUSA 2I2BA 3F5SA 1PKXA 2IHZA 5FOSA 1D2CA 4XSVA 2RKBA 1IULA 2PSEA 1ODTC 1ESEA 3IHTA 5K6RA 1T1RA 1E2QA 1ORTA 1UZMA 2QD2A 2E4AA 2HPZA 3AOGA 1NVGA 1EE1A 1VB5A 2BAGA 4CDRA 1PJRA 1IQUA 1L5QA 1RLMA 2WABA 3R8FA 2P6RA 1YVPA 3IPAA 2CCJA 3NORA 3V5NA 4M8IA 4PRLA 1RYEA 4BJHB 1ENYA 1OIXA 3KEMA 4RQUA 4WXYB 5KAMA 1T4BA 4EFKA 4JVOA 3RAJA 4QWWA 4A0HA 1L4HA 1Q57A 1E2MA 1N6IA 3KAPA 1L7XA 2RBGA 3WGTA 3DZKA 2C3UA 1K2VN 2NVBA 4ZOCA 1CQPA 1G4HA 1WY7A 3S2EA 3BD9A 2XTMA 1IG0A 1USVA 1JA0A 5AK4A 3OQNA 5F7XA 4L2IA 4PXSA 2V03A 5TARA 3DT6A 1IU9A 1HOXA 2IDMA 2PH3A 4PYMA 2PLNA 1RXEA 2WIJA 3GX1A 3LCVB 3NEPX 4P31A 3C24A 3DJFA 5FX2A 5J4LA 4I9NA 4YRJA 3BWDD 2FMUA 1O0CA 2QRNA 5EWJB 3NUQA 3DMTC 5F9HA 2A1UA 1W9MA 3OPYB 3FNGA 2G36A 3NM6B 4FYHA 1DTWA 3QVKA 2ACWA 4ZXPA 1JIKA 1P1RA 3GAMA 1FDTA 1CV2A 2W0SA 2B34A 4EO9A 2VP6A 4GLJA 3FCUB 4XIFA 5FWNA 5FRDA 5JD5A 1X1RA 1D8AA 2OYSA 3QU2A 1JVNA 3CX7A 3GW8A 3AONB 4QJIA 1KQFA 5HGJA 2PU7A 1EBFA 1W85A 3D0OA 3C1OA 4R0NA 2AEJA 3RYHB 2Q4TA 1L8OA 4YRRA 5AXBA 4DCTA 4ENRA 5HIAA 1P72A 3QXGA 1S2GA 4MIOA 2JCBA 2VJYA 4FMBB 5TMBA 4ZYVA 1P0QA 3VPSA 1NKTA 2GDZA 3VUEA 2PFGA 2GPJA 3TQSA 1Z62A 3R7FA 3OG9A 3JD4A 3CUUA 4OHOA 4BWVA 4CM9D 5HPYB 3D54D 2RK4A 5A4DA 4LCEA 1JHUA 3D0RA 1EINA 3TLGB 3FNIA 3IQGX 3PRKE 1ZN9A 3SEFA 2AC4A 1LRKA 5L3ZA 2VDVE 1KR5A 1EVEA 2X42A 3HN2A 2QQEA 2PMEA 5EWMB 4S2UA 3CZ4A 4GVPA 4KIFA 1Z75A 4NI5A 4DJFC 1HL3A 2Y4OA 4KJXA 2ZI4A 4YPFA 3RIGA 3TINA 3WLPA 5BWNA 3L49A 4GC5A 3R9KA 3OIVA 3ZCUA 3EXG1 5I7UA 4UKDA 2GM5A 2VP2A 4ZO9A 1DWQA 3H5NA 4P4SB 5FADA 3SX0A 4ZHQA 1T9CA 3Q7PA 3PQ7A 4B6GA 2YRXA 1EWQA 2LD4A 1Z12A 3QYFA 4B6RA 2OQ2A 2DBYA 2QM3A 3FKSA 4K0RA 4MQLA 2HWXA 2QAGB 5JJLA 2PKCA 4DC1A 4O4LB 4EY6A 2QRVA 2QYHA 3EFOB 5AVOA 2BGRA 3LQRA 3VPXA 1KZ4A 3MJFA 3H1TA 3EBPA 3I01A 3CVOA 3G9QA 1R0RE 1GRCA 2YRWA 2WQ6A 1PX2A 2IPAB 3WGVA 4B73A 4AO7A 1TC1A 4TTIA 4M87A 1HLDA 4E4RA 1H65A 3Q0IA 5DK6A 1Q21A 3UGKA 1MBZA 1Z0FA 3IDAA 3WTBA 1MEEA 3JYLA 2BR3A 3F3YA 3GOHA 2BGMA 4YRMA 4IIVA 1H9CA 3I04M 1QFXA 3DA8A 4CLRA 3VR2A 4PPNA 5KVVA 1N92A 4FD3A 5E2IA 5DGXA 3PTAA 2GJ4A 5GV7A 4XYLA 1MB3A 1Y63A 1QX4A 4PLZA 3AI3A 2X0FA 1J6UA 3VDNB 2Q1TA 1ZKMA 4NBWA 3GGCA 4QLAA 2JIRA 5I7EA 4BB6A 3JCZA 2PT9A 6ADHA 4ZPXA 4HDNA 5JXHA 4Q7QA 1OH5A 3TKAA 4FLFA 3AILA 5BN4B 1ZA1A 5HZMA 3E7XA 4X97A 2B1JA 2PXXA 4F5EA 2FSGA 3ET4A 4TMFA 1W25A 4UPVA 4YBZA 2Y1EA 4PAQA 1NMZA 2H11A 4B6EA 4DDUA 4NHOA 1RC0A 1FFSA 2OP1A 2HA6A 1M6NA 1W1UA 1V8ZA 1QFMA 4UE3S 5AJYA 5L51A 3U19A 1Y3FE 1CEXA 3BDVA 1ZI8A 2GA8A 5DYNA 3KRTA 5K2MA 4EY4A 4PAGA 6GPBA 3ZWCA 1QGAA 3DQPA 5B7GA 1QO7A 1E8NA 5CT9A 4L57A 1FXWF 1PEYA 2YWXA 4Z9XA 5JFTA 5FUMA 4DR5B 1BDJA 1WW3A 4A36A 4NEQA 1C1XA 1X19A 4I36A 5M7EA 1Y1TA 3ZHBA 3IUNA 3AG6A 1VCOA 2WFMA 4U2EA 1SUCA 2F8SA 1OXUA 2OCXA 4G84A 4OJTA 3VC7A 1Y5MA 4BC0A 4C0KA 4LYEA 3MWYW 1MAHA 2NVUB 1VGQA 4DREA 1T6ZA 2RHRA 4BLVA 1C4OA 3AIMA 1JKJB 1WMAA 3BTSA 3RH0A 2W8ZA 3RSSA 4ESHA 3RCBA 1DUVG 2EXXA 4ZEWA 3CUEF 2W6QA 2R11A 3MGCA 4WA7A 1U2GC 2EZTA 1R8SA 1TKAA 1FL9A 3TI7A 5B6IA 3AEKA 1LDEA 4M0LA 1FX1A 3ESZA 4REOA 1PHRA 2QLJA 2PEZA 2HT1A 4GP9A 5ADVA 2XXBA 3FXAA 4EEKA 5IRCD 1JG7A 1ST2A 3O1HB 5ES4B 3CNBA 3EGOA 4LF7B 2NO0A 1KKMA 3R9XA 1IXZA 1YHYA 2XUPA 4LTDA 4R1SA 3L7YA 5DKFA 3RW9A 3VQTA 3T4EA 1IWOA 2GYYA 2WINI 3AGPA 4NP6A 4D8UA 4D0SA 4RQBA 4KE6A 1C0KA 3NS7A 3V80A 1OAOA 1L7VC 2ZWAA 4R3NA 4XB2A 1QK3A 3EPKA 2NU6A 4CFSA 1EFCA 5ITWA 1E3JA 2YC2C 1Q11A 3K0HA 4HTFB 2SCUA 4JT8A 4MQEB 4RCZA 4UXHA 4BQSA 5HSGA 5LMNB 2XA9A 1ODKA 2FG6C 5JWHA 4M0MA 3OKFA 4CI9A 3UJNA 3S2GA 4DC9A 1ECPA 1F9AA 1CQZA 5A5FA 1TGVA 3Q8MA 4L6IA 1QQ7A 2FWMX 3D4IA 3OZIA 5H70A 4IMRA 5EMMA 2CV1A 3JVEA 7MHTA 2WJPA 1WZEA 1QFJA 2GZSA 1WU7A 3ANXA 1JW9B 2VC2B 4Z86A 5FBRB 3UK1A 2GDJA 1EESA 1IN8A 1EUQA 4RMGA 2BH2A 4E30A 1Z17A 5T67A 1B26A 4HF7A 3LXMA 3BERA 4ZPJA 2YWRA 5F9FA 3UFXA 4G0ZA 2WG1A 4DLBA 4BXOB 3RV3A 1IN6A 3KU1A 2K87A 4G1UC 3O26A 4P4LA 3L06A 1GXSA 1O6ZA 3DMYA 4ME6A 1RW4A 2Q07A 3SZUA 5EKDA 1SIBE 2GJ9A 3P2YA 4MR9A 5IKOA 4CR7A 4F6LA 3IPYA 3ISVA 3ZV3A 5ENZA 1J25A 1VM6A 5KYVA 2ZBPA 3O2JA 2YY7A 2G28A 3AWIA 3GDOA 3OZBA 3O21A 1AS2A 3SD7A 3I61A 3RUPA 5IM4F 5ALNA 4QG7A 1QYVA 5HZHA 2I3ZA 3JVIA 1UIRA 4RZ3A 3FWZA 2UVDA 4F2GA 4NECA 2H2FA 4CQMA 3UATA 1EH5A 3INRA 3G59A 2KB0A 2FCRA 4NL4H 4DKJA 5JXJA 4GR4A 4PFKA 3AW8A 2Q8PA 1UK7A 3ACCA 4C3OB 2OE2A 1BN7A 1D1PA 4WWHA 5B1YA 2IKQA 4KGXA 2GVZC 4I1OA 3I28A 3C97A 3TJZA 4G6ZA 1Y3CE 2I34A 3H42B 1UQTA 3PZBA 1P1HA 3ZE9A 3ROTA 1RU3A 4DLSA 4NTZA 3Q3CA 1JS1X 4YUZA 4ARVA 1U1EA 1WOMA 2NAPA 3E15A 4FCTA 1BX0A 3MMSA 5JALA 3QU5A 4O2BB 1AKRA 1NN1A 4LCJA 2FMIA 1J1IA 2YNMA 4OIMA 1C0IA 3SIPA 2YIVX 2JANA 2WLTA 4I8IA 1HSZA 3DOJA 3E8XA 2A0XA 3EZ2A 4N12A 3ZJVA 2HQBA 1FXSA 3DF7A 3KQYA 2H1FA 3LNCA 4BP1A 3CH6A 3LUBA 4DIOA 1QKIA 2PJUA 3QLVA 2PZFA 5EIWA 5K8TA 2E5WA 3OE5A 3TR5A 1DEHA 4KIGA 3SS7X 4MR7A 2IV3A 3Q6NA 4PSDA 4YONB 2VP9A 4WRRA 3I39X 1WW2A 2NO6A 4NYJQ 1SKYB 4OH7A 4DM4A 1B73A 3HUDA 1QYDA 2P9ZA 1ZXLA 3P2EA 1TZCA 1S2MA 4QHTA 3LKDA 4A10A 4LJSA 3GLFA 1P31A 5G1OA 2ZJ8A 3Q12A 5FBZA 3V7FA 2XZLA 2PUGA 1XCLA 4QELA 1OFUA 4WH0A 1PJCA 2HSGA 5GAJA 4WXHA 5LDHA 1L4EA 5JJ5A 2ZUSA 3IQWA 4ZFNA 1Z47A 4I5GA 5T4FA 4EJ6A 4RTQA 3S40A 2QTZA 3KLBA 5SYNA 3RS3A 1Z22A 2PZ8A 4V2IA 1LDNA 1PZXA 3FNEA 4U9HS 1KI6A 1KY3A 1AS0A 2LUOA 5H3LA 5HCNA 2M6LA 2EBWA 1MABA 3K0SA 1E3MA 4QEDA 3SJAA 2IEGA 1FFYA 2EP7A 3VTFA 3DB1A 1BOFA 1KI4A 1OLSA 1JA1A 3N2GA 5DBIA 1NQUA 2CUKA 1TQHA 2WFZA 1IHXA 3LRPA 5FV7A 1GRNA 4JJFA 4U8HA 3K6SB 1V16B 4J94A 1AX9A 4YMHA 3K3PA 1UBTS 2AC7A 4B5KA 4LMAA 4KSCA 2B83A 4CR6A 3IUBA 3L93A 3CM0A 4DADA 4EI9A 1M5RA 1C8KA 1PJ8A 3PFGA 2Y66A 2ENWA 2MSKA 4LBVA 4FS3A 2CLLB 3OKCA 3UANA 5LOVB 3A37A 1T8YA 4MUEA 3GLQA 4CEJB 3VH3A 1AMOA 2R44A 3L7IA 2P68A 3L7BA 1TUEA 1XLUA 2HA2A 2HIMA 4H59A 3VI3B 4C5BA 2QDKA 1KEUA 3MINA 3UH1A 1O96A 5DM2A 3SKYA 5AH0A 1SUBA 5DWQA 1UMKA 2DE0X 3JS5A 1P0IA 3AF5A 5E4TA 1HMYA 1U90A 1ZN2A 3VR3A 2WUDA 5C1PA 4YX9A 2BISA 4QTUB 3ZWNA 2AX3A 2GTPA 2BHLA 3WIVA 1Z15A 4OXXA 4DG8A 3UJ8A 3HE3A 3QPDA 1N3YA 1E7WA 1HDZA 4IHQA 3AVQA 3F49S 3EGXB 1LTQA 3C43A 4FQ7A 4Y6RA 1W36C 5LIRA 4H1WA 3R6WA 5B4TA 3U37A 5J1SB 3JTEA 4IEIA 5BO5A 3O03A 4RZIA 3ORFA 1WZNA 4G5HA 3WBFA 3H7AA 1PJ4A 1BU8A 3S55A 2Q3JA 2DPMA 4EAQA 4WDQA 4V1CI 2H6EA 3DG9A 2ZR0A 4MLDA 4X3CA 1Z2PX 3NPMA 3W9SA 1YBAA 4A8JB 4DJ5X 4LDJA 3FNBA 3ZVLA 1GGKA 3IT1A 5J2UF 5LZ5A 4G0QA 1QHIA 2CVZA 4HMPA 4LSZA 5CIQA 1YI8A 5JQGF 3T5AA 1YVRA 2JLRA 4J91A 1EWYA 1W581 3WFZA 5ABPA 5KNCH 3FOFC 1HNXB 4G0UA 2I3AA 1AS3A 2YFKA 3V34A 3I2KA 2J5BA 5L40A 1U2DC 3AR9A 3N86A 3KALA 4RACA 2JHCA 2V9CA 2FK8A 3LUPA 4HNTA 1QGYA 2R751 3CRNA 3P9PA 1Q74A 1U5BA 2P2ZA 4PYKA 1CRQA 1JFRA 4L5YA 4PXYA 4R2HA 5JAUA 5JQGA 1PBNA 3VYUB 3AX6A 4FGLA 3GEMA 4FGWA 2H1HA 2Z58A 2V7UA 3DOHA 5JH7B 3KOZA 5AW0A 5AM4A 1C7QA 1RKBA 4RVNA 3JWPA 1WDKA 2JH8A 4KO4S 1YQWA 4Y6GB 3OEED 4V0LA 3ZNPA 1DRJA 1NXXA 2JGMA