3KB2A

Crystal structure of yorr protein in complex with phosphorylated gdp from bacillus subtilis, northeast structural genomics consortium target sr256
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYIEGKDIDSILELYREVMSNAGLHTYSWDTGQWSSDEIAKDIIFLVELEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPBc2 prophage-derived uncharacterized protein yorR
publication title Northeast Structural Genomics Consortium Target SR256
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb2A00
3MCAA 4X8HA 4A8JA 1KI7A 1DO2A 2E87A 3AUXA 3LV8A 2ZROA 3RS4A 2J46A 4FIDA 4OQNA 2OFOA 3F0TA 1D8TA 1QHGA 4MRVA 3RRYA 3TUIC 4QGGA 3THYA 4ON9A 1OFTA 2IUSA 1NP6A 2G0NA 2QAGA 3KB1A 3BIFA 2C8VA 3VMFA 1T8TA 1OXXK 3LWNA 2ZREA 5FR2A 1MRSA 3UXMA 4Z51A 4Z54A 3L0OA 4IOKA 5J4KA 2CCJA 4AURA 1UDXA 2OCBA 1C1YA 2V7QD 3CZQA 4HAYA 1XEWX 2R9VA 1GRRA 821PA 4PO8A 3UWKA 3I61A 5EUQB 1U90A 4CDGA 1VYTA 5EZ6B 3QKTA 4A2PA 2AD1A 4Q1BA 4JJZA 5DGXA 2BMDA 4YMTA 2TMKA 3C14C 1S1MA 3KUCA 4QBFA 3TSOA 1HQCA 1OIVA 1NKTA 3QKRB 3PFIA 4WOPA 4B2LA 4C0SA 3U6BA 4IVPA 4NYMQ 1P5ZB 5TDHA 4GZLA 3GLHA 1TU4A 4UNSA 4OKSA 1AM4D 1II8B 1E2MA 3LLMA 4G0NA 1KMHB 4Q1DA 3ICQB 3VR6A 4XVRA 2NO6A 4OHWA 1H8HD 2IEZA 4YXWA 5FTJA 2ZE6A 4LBVA 1H8HA 3QBVA 3FB4A 1DPFA 1IOZA 3IQWA 1XTKA 2GF0A 3T1TA 2O0HA 4AI6A 1ZD9A 3TVDA 3OEEA 3W9YA 1Q20A 4A4DA 4HUQB 4GP6A 2ZJYA 2IX3A 1D2EA 4R71A 2Q9CA 3I8SA 3P1JA 2NOAA 2XTMA 4MKHA 3ZIAA 5FBQB 1PLJA 4MRSA 3AVTA 1G5TA 5HE8A 1U94A 3CPHA 1US8B 4IVQA 4MQBA 4CT4B 4RVCA 3RC8A 3I4LA 2BBTA 5E4FA 1I4LD 3EWAA 3CUEF 3Q9LA 4YMSA 4YMUA 1R4AA 4XTCS 3SJCA 4EPTA 1S4QA 2C99A 4OHVA 1XP8A 2OV2A 2J0UA 3OF5A 1AZTA 1DEKA 1OKKA 4KLNA 2X2EA 2WZQA 2DWQA 3BBPA 5JMTA 1NY5A 1XEXB 5FL7D 5FL7A 4TTQA 5AWFC 1TEXA 3Q7QA 3L8YA 3EA0A 3SS8A 3KQHA 3LLUA 5DSZA 2C04A 4TTRA 2GVDC 1A82A 2PEZA 2CL6X 2NGRA 4LYHA 5FTNA 4MKGA 3T1VA 4DSUA 1JQLB 3R8CA 1CXZA 3RDPA 2GBLA 4GI7A 3U6KA 3ADDA 4RJLA 1JJVA 3GJ6A 1D6JA 1G3UA 1EGAA 1PZNA 3P4XA 3SE0A 1P2TA 2OT3B 621PA 2VF7A 2RCNA 1Z6AA 4C0JA 1J8YF 4NCNA 3BS4A 3SYKA 4B6EA 1N6PA 3HR7A 4EJSB 2OCAA 4MH0R 1KY3A 1G5RA 1OIXA 1U2RA 2J7PD 4Q5IA 3B9PA 2OCYC 5KYKA 4O3MA 4NHOA 2REBA 3U7FB 1DAGA 3DZ8A 5KSZA 1R10A 3CF2A 3CB4A 4G5OA 3L0SA 4F4JA 3OFND 1RKBA 4M4SA 3OFNA 4DT1A 4HB2A 4TSFD 1JEEA 1F2UB 1KNQA 1MO4A 2CHVA 4H1UA 4Q4LA 1ZINA 5JI3E 1U0LA 1XCPA 1QHXA 5JEDA 2YOHA 4EKDA 3AVYA 4L4UA 3G0HA 2J3EA 4AG6A 2JJ2A 2FSGA 4URXR 2O8EA 1S1CA 3FYHA 2GXAA 2IF2A 1BS1A 2J1LA 2OHFA 4CEIB 4WA7A 2HYDA 1WCV1 2ZRMA 4MDFA 2QAGC 2BM1A 1A4RA 2RKOA 1IN4A 3ZS9A 2GCOB 4TLCA 4MRRA 1FP6A 3TAUA 5CJPA 1ZC3A 1XXHB 2FX3A 4HUTA 2F1JA 5C46F 2ZR0A 4JKYA 3LDAA 4KSCA 4ACAA 5A0FA 4BGDA 1TADA 2ATXA 1TX4B 2Y8EA 5GVRA 3HPQA 1KSJA 3V9PA 5H70A 4EPVA 1U99A 3GJ4A 1HEIA 1M34E 4LBWA 4OBEA 3VQTA 1B0UA 3A58B 4GL2A 1MKYA 1H8ED 1U8ZA 2JLWA 3TQFA 1H8EA 2QRZA 2X1VA 2WJJA 1T5IA 3IBYA 5CYPA 2CHGA 4BASA 2C9YA 5FUYA 4P32A 1WDTA 3LBNA 3WP1B 2YNMA 1YU9A 2D2FA 5F9HA 4YLGA 3FFBA 4EIWA 2JLVA 2RGNC 4KCGA 3CRMA 2H57A 2F43B 3K70C 1AA9A 4GFDA 1DARA 4XWKA 2BMEA 3DKPA 1UKYA 3LW7A 3AVQA 4FMBB 3JVUA 3QPUA 1M1YE 5B30A 2HT1A 3GEIA 1A2KC 1KO5A 3VR4A 1N25A 4O0MA 3L2OB 1UBFA 2F3RA 2G1KA 4LHXA 2JJ8A 1KSFX 2O0KA 1SXJB 1KY2A 1F48A 1NVWQ 1GIAA 2W00A 1KK1A 4G01B 3SR0A 2YZ2A 2C5LA 4IXMA 1X1RA 4CEJB 1L4YA 1E1QD 1AIPA 1T0HB 4JYBA 1E1QA 4M1WA 1J2JA 5DLQC 2GTPA 1M74A 4C0QC 2ZRFA 3OIWA 4NCHA 1RRFA 3D31A 1G18A 4U02A 1FNNA 1IHUA 1P60A 2A7QA 2OSBA 4FCWA 3U3RA 4A0HA 4V0MA 3K0SA 3TIFA 2FV8A 1ZIPA 3HYTA 3TKLA 1RPZA 1Y63A 1P9RA 3E5HA 4ZCLA 3EW9A 4UJ5A 5D3MB 4BZQA 1DE0A 1S8FA 2XNDD 1M2OB 4M8NE 1ZD1A 1XMJA 5IF9A 2O8CA 3CX8A 4ACBA 2JAQA 2R6CA 3O47A 1IONA 2GZAA 1N6HA 3SZRA 3KQUA 2YC4C 1YJ5A 3I1FA 3WYAA 2ZRDA 2HV8A 1W46A 2AL7A 1KO1A 4UNNA 1ESMA 1DAEA 1TPZA 1LW7A 2ZRIA 4B3FX 1OFUX 2BHRA 1E32A 4BZXA 5JSZB 3KJEA 1GAJA 4IVRA 1E9CA 1MR3F 1Z47A 1JALA 1IY2A 4IEEA 1W44A 5SZIA 1JECA 2BKUA 2NTYC 3AEZA 3F3YA 3CR7A 5DIFA 3ZDQA 2V6JA 2XB4A 4HAUA 5BYKA 1N6IA 5KPJA 3DEFA 2VSFA 1PV4A 1GL6A 1E9SA 2P5SA 2SHKA 3VX4A 2AKYA 2IA5A 4PQYA 5CK5A 1VCIA 4PAOA 4PPFA 5L3VA 3U7GA 2IT1A 4M1YA 4WZ6A 1CJMA 2F1IA 3ASZA 2ZETA 1QRAA 3CRVA 1ZW6A 2CLSA 4Q02A 3SHFA 2ZRBA 521PA 2RHMA 1OXTA 1ZNXA 5KUTA 2O8DA 1OV4A 3W6OA 1DAIA 1UJ2A 2ZEJA 3QOFA 2QG6A 2VBCA 4A6XA 2ZJBA 1E2GA 1JXOA 1FTNA 2A5DA 2G1JA 4BQSA 2QPOA 2F9MA 3K1JA 1FW6A 4DRZA 4BEBA 5KO2A 3UMSA 1CF4A 3BH6A 1UBEA 5KSYA 4TLAA 2LKCA 4Q7JB 1ODFA 1HQYE 1NVUQ 1WP9A 3WNBA 1Z6YA 3BD9A 1J70A 3WY9A 3RSOA 3X1YA 3A6PC 2CEAA 1RYHA 4C2UA 1SVSA 1YHNA 1N5JA 4DDWA 2WHXA 5AJZA 3VU9A 2B21A 5AJXA 4WXRA 3BB3A 1KKLA 2R2AA 1Q1EA 2ZU6A 3CRRA 3OIUA 3P4YA 2OILA 3QG1A 4RD1A 4AD8A 3JZAA 5JHHB 2PJRA 4IOLA 2JEOA 4LJAA 4P3YA 1M7GA 2VP0A 3CONA 4ZI2A 4DLTA 4LZZA 1LB1B 3IPXA 4F92B 1Q0UA 3PUZA 4M9XA 4OJKA 5KHOC 2VHUA 1E69A 1E9FA 4QBGB 4LHWA 1U8YA 3UMRA 3PQCA 4G3XA 1AQYA 1OW3B 4CEHB 4XH9B 1N3BA 2JATA 3AP1A 3EG5A 4FMDB 4RD4A 4Q1AA 3E1SA 4JZKA 2CCKA 5DN6D 2IYTA 4EQ6B 2ONKA 4W5JA 1EWRA 4HLUA 3OE7D 4D2IA 3L82B 1Q22A 2UZIR 4QC2A 1ZAKA 1YRAA 1XEWY 4LK2A 1MO3A 1U8AA 1E9BA 2N46A 1G8GA 1M7BA 5GJCA 4B48A 1T91A 5AJVB 2QTHA 2LCFA 3WMGA 4TYWA 2FH5B 4MKIA 3J81k 4DBLC 1VG0B 1Z6GA 2BJWA 4KODA 4WZAE 3THXB 2QMEA 1QHHA 3VKWA 2AN9A 3PEYA 3LNCA 3SFVA 1JPJA 5FH9A 1OSNA 3EPHA 4QGAA 2GDJA 1U9IA 1Z06A 4N3NA 3REFA 1NKSA 5TMPA 5GVSA 1RJ9B 1NLYA 4WZBE 1P2SA 1U0JA 2GJ8A 3R9IA 2GEUA 1KI3A 4KFUA 4ZIRB 2NO9A 1XPRA 2NPIA 3G5UA 5FPYA 1IXZA 3T61A 3I5XA 1WBDA 5CIQA 4EUNA 2PH1A 1DO0A 4C9BA 1KI1A 1VPLA 1AZSC 3A36A 2CJWB 1KAOA 1BYIA 4MRPA 4HAXA 3ND8A 3SBDA 3UG6A 2QT1A 1EESA 421PA 1M6NA 1OH6A 3UIEA 2ORIA 3TAHA 2XTNA 3NC0C 3FMFA 3UKDA 2FPKA 2G83A 2OXRA 1DADA 2IUTA 4C0LA 2YINC 4KBFA 4NP6A 4ABYA 4F38A 2JLZA 5FOUA 1J7KA 4JL6A 1P61B 5CLQA 3SJAA 1TNDA 4DZZA 4A82A 2ZUCA 2IS6A 1E4YA 3KXLA 4AKEA 2ZRKA 1Q12A 1LS6A 1YZQA 4V0LA 5HZHA 3N70A 5GJBA 1VDZA 3U3MA 1E2HA 2J0VA 2XZLA 1HY3A 2GEDA 2J59A 2IS1A 4HSEA 1E2QA 1TU3A 2IW3A 3M0EA 3B5JA 1JXMA 2OBLA 5CM8B 3FTQA 4LV8B 1KZ7B 4Q1EA 4B3CA 1G16A 4DCVA 3U44A 1PVOA 2A5YB 2XTZA 2V3CC 3U4QA 5F2EA 4XVUA 2ZITA 5DHAA 4GBMA 4P4SA 3GLHB 4NYIR 1EFHA 1Z3IX 2JJ1D 3Q7PA 2B7CA 4V0KA 4C3ZA 1OXSC 2JJ1A 5BXQC 1GILA 2VF8A 3OZXA 3CR8A 1DBSA 1OXVA 1CKEA 2OLKA 2VO1A 3BGWA 3T34A 4CF7A 1UKVY 3KFXA 1D2NA 2DFLA 2GZHA 1Z6TA 3F8TA 4JBYA 3TK1A 1RFLA 4IDNA 3AGQA 2CL0X 5A5GA 1HH4A 4JL5A 4IOMA 5L3QB 4LHZA 1YVDA 2C98A 4EPXA 2ZJAA 3LY5A 1OFIA 1UBCA 2HJVA 1XMVA 5DHFA 5JWRA 4R7ZA 1HA3A 2AK3A 3OEHD 2MSCB 4IDQA 4RSGA 3OEHA 4EJSC 4HAVA 4LJ7A 2B8WA 2AWOA 3R7WA 5BW8A 5FUVA 3AVPA 3AF4A 2GJKA 1TF7A 3T1OA 3A8TA 5JHGB 3CNOA 4RD6A 4B75A 3LA6A 4URUR 4Y0VA 5SZKB 2VH5R 3VHLB 2PEYA 3TRFA 1BH2A 3RS7A 2J0UB 2EWWA 1Z0FA 3I62A 3NH9A 3EARA 1N6LA 2NO1A 3OIVA 4Q7MB 1IXRC 1K6MA 4E03A 5JEEA 1X8JA 2UKDA 3A1TA 3IKJA 2CVFA 1SHZA 1W4AA 2BJVA 4MITA 2ORWA 4QM6A 1W47A 3B85A 4LRWA 2H8KA 2CE7A 4DCTA 2WKRA 3NVAA 4JLBA 4DSOA 2EYQA 2PLFA 1E0SA 4QBHA 3ICEA 2BIFA 1JPNA 1ESNA 3AKDA 2Q21A 1CS4C 1GRNA 3D6TB 4LDJA 1N6OA 2HLDD 2ZANA 3ZJYA 4IKEA 1KJWA 2HLDA 2XEXA 1N6RA 3VR1A 1XZQA 2ANCA 1GDDA 1G5PA 3JVVA 1F2TB 2FFQA 3QKSA 2G77B 1Z0IA 2WVJA 4PC3A 3QG5A 5SZHB 1OLOA 4D4KA 5FI1B 1CBUA 3NTUA 2F6RA 2F1HA 3IEVA 4XOIA 3IPYA 1UKZA 1GSIA 4MA4A 1Z22A 2G3YA 1NBMA 2D74A 2PZFA 5BYJA 2WMNB 5CDFA 4BPBA 2FOLA 1OB2A 4PZYA 4D25A 1Q57A 2DFKB 2W0MA 3I73A 4Q66C 3SEAA 4NKRA 2MMCA 1ZM7A 4DT1B 1MRNA 1NIJA 1KAGA 1NN3A 2NO7A 2NZJA 2ZI9A 1AK2A 4HATA 5DISB 1LF0A 3LBHA 4PAMA 1H65A 1P75A 2XJ9A 3NEYA 3QF4A 4RZ2A 2ODNA 1NJFA 3UANA 4GDFA 4C7OB 4TYYA 2AHOA 4S2EA 2O8EB 2C95A 3WNCA 2P6NA 1R6BX 2O5VA 2IYVA 2P6UA 2GILA 2CCGA 3BE4A 1EX7A 1EFRA 1KDOA 1E96A 2D4HA 3QPWA 1YRBA 5IK2D 5HCNA 1OF1A 2OO7A 3B6EA 3U2QA 5E3HA 3GLIE 4CGZA 1E79D 2V8OA 3ZH9B 2WAXA 1SXJC 3A1SA 2EW1A 2VP4A 5CJ2A 3RC3A 2QY9A 1Z08A 3W8NA 4QL3A 1AGPA 2QMOA 1R8QA 3EIEA 4F4IA 2ZJZA 1LTQA 1HT2E 1J90A 2I3BA 4NDZA 1ZC4A 2ZRCA 3GEHA 4QBIA 3D8BA 4HYYA 3K9HA 1QHYA 4KYIB 2GESA 1NLZA 3NBYC 2CE2X 2D3WA 2IYZA 2XXAA 3H2YA 4OYHA 4M21A 2JASA 2ZI5A 4I99A 2VTKA 4QJ5A 1MOZA 2GNOA 2FWRA 1FL9A 3P27A 1KDPA 4IDOA 2A5JA 3TR5A 2J9RA 1OYYA 5DI9A 1YZUA 4UJ3A 1N0VC 1SVKA 221PA 2X2FA 4JBXA 4UQOA 3GLGA 4TWZA 3AP2A 3KQNA 4QHSA 1IJFA 1KSHA 3B13B 2GXQA 4R98A 4RKEA 5FI0B 5KDOA 2WWYA 2Z0MA 5J47A 1GKYA 3CX7A 4HDOB 4LV6A 1NVXQ 5H8WA 4F4CA 4BUJA 3TNFA 4PHTA 1KNXA 3CKLA 4A0RA 1LF5A 2EFGA 4DLUA 2ZE7A 2E1RA 2IC5A 1W5TA 1P9NA 1NSTA 4EPWA 3GJ5A 3EPLA 1VKJA 1HV8A 3C41J 4ESVA 2QM8A 1XX6A 5JWOA 1A5TA 5TVKA 2YYZA 2IS2A 4LYFA 2Q9BA 3EASA 2AFIE 2REOA 2JCSA 2FU5C 2MMGA 1E2NA 3TW4A 2VHQA 3AKEA 2V1XA 4RZUA 1N5LA 2REXB 4N0DA 2QE7A 4LJ6A 2RGNA 1BMFA 1JAIA 3K0AA 4HDQB 2R8RA 4Z8YA 1FP7A 2BVNA 5FBWB 2GZDA 4D4LA 2AXPA 3TQCA 1T5LA 3X1DA 2R6FA 1XEFA 2OXCA 2A5FA 4LJ9A 1VCNA 4EFMA 1VYUA 2K5UA 2PCLA 4X8MA 5FOSA 5EE1A 1KSGA 4YXWD 4II7A 4LYJA 4PTLA 2CVHA 3NBFA 1OH5A 3DMNA 2W6JD 3OEED 2W6JA 2VRWA 3EAQA 1W48A 4D0GA 3TUJC 3QI2A 4Q1CA 5BQ5A 6Q21A 1A2BA 1EX6A 1NVVR 3LD9A 3ZIAD 1N6NA 3FHOA 4GOKA 4PAQA 1K5DA 2RHDA 4US1R 2ZI4A 3M1IA 4KJZA 4IXNA 1MABA 1FMJA 2F9LA 2IS4A 4HZUB 4NMMA 1NNEA 3NXSA 1G9XA 5G53C 2QENA 3B9QA 3BERA 1AGRA 1V5WA 3FWYA 1IM2A 2EFCB 4A0GA 4F91B 2JLUA 1OKKD 1YR6A 1R5OA 3HWSA 1E0JA 3EZ7A 2P0EA 3K0FB 1W0KA 2N1BA 4Q48A 3GJXC 1E94E 2ZE8A 3AP3A 5B58C 1OB5A 1SVLA 3LX8A 1TQDA 4RZXA 3RRZA 2ZE5A 4YMVA 3GLHE 1U81A 5J4HA 1OIWA 4KSBA 4OQMA 1OXUA 2PX3A 2IYUA 1G6OA 4FXPA 3CNLA 1F60A 4ESHA 1UFQA 2OCPA 2Z43A 3B1VA 4K8OA 4V0OA 4DVGA 3FMOB 4C4PA 1OFHA 5FOVA 3IIJA 3QXXA 1Z28A 1Z0DA 3VNVA 1T3HA 3X1XA 3FPAA 3T15A 3QKUA 4XWAA 4W9MC 4A1FA 5DI3B 2ZPTX 2DYKA 1KI2A 4QHYA 3UPUA 2JA1A 5BWMA 3Q5EA 5JJLA 2ZRAA 4JKIA 3SBEA 5SZJA 3T5DA 4ASUD 4B43A 3U3JA 2JLQA 4OQLA 3SYLA 1OPXA 2DHRA 4ASUA 4UKDA 4A36A 3K09C 2ZRHA 5LB2A 4OHYA 3WYGA 4RFVA 3TBKA 1YR8A 3A4MA 1HUQA 3NEJA 1HE1C 4TLEA 1NY6A 2F7SA 1ZJ6A 2ZS9A 1ZD8A 4PPNA 4DB2A 4V0NA 1FZQA 1BIFA 3L0IB 5EXPA 2FDCA 2CBZA 3DO6A 3ONWA 1G4UR 1XTJA 4RD2A 5FPTA 2QTFA 4DCUA 1KI8A 3IGFA 3Q3JB 3SQWA 1GNQA 4URZR 4Q4HA 2ZRJA 4KI0A 2VP5A 4NYMR 2JJ2D 5FOXA 1E9DA 2WOJA 2PX0A 1P73A 4PZZA 3FHCB 4LX0A 1VTKA 4ZI3A 3BH0A 4E09A 4IDPA 4B44A 4IFBA 2PZGA 4LJYA 4GT1A 1JQJC 4D26A 3R9WA 1AN0A 1WBBA 4BFWA 2VQSA 4L9WA 4I1OA 4JS0A 1CP2A 1JJ7A 1G7RA 1KTVA 2B7BA 2KBEA 3FOZA 2ZYVX 4US2R 1TUIA 5KSOA 4RD0A 4DSTA 2EYUA 4L9SA 1XPUA 2RB4A 3AF3A 4DXAA 1UDWA 2ZIAA 1COWA 3RLFA 1NI3A 2WSSA 3NDBB 2DY1A 2PCJA 4QJ4A 1YE8A 2O8BA 3ZYCA 2HCBA 1ZCBA 3NIBA 3IHLA 2FJUA 4Q9HA 3G82C 1I4DD 3PEUA 4TMKA 4KFSA 5L3SA 1E1RA 3SN6A 2BCGY 4JLVA 1XD8A 2D62A 2RGBA 3DOEA 5C1BA 2ZYTX 3RSLA 1G8FA 4FWTA 3IO5A 1SQ5A 2YKGA 2WWGA 4Q18A 3VHXA 3NH6A 1VECA 2ONJA 3LBIA 4DIDA 5JLJA 3LQRA 4PHGA 2WTUA 4Q4AA 1YZGA 4C0AC 1RZ3A 4BLPA 4PPQA 1OJLA 3TGPA 3PVSA 3SC3A 1Z0AA 3KKPA 3DPUA 3SI7A 2R62A 1LV7A 1G7SA 1PUIA 2ZUBA 2O52A 4B32A 4B74A 5JRZA 2RAPA 2FGKA 4GRAA 4NCIA 4M9ZA 2DR3A 1Z0KA 1E2PA 3KUDA 3ZVLA 4E22A 3MJHA 1VYVA 1SKYB 4G1UC 3SHWA 2WSMA 5HZKA 1FPMA 2QUZA 2IF0A 1G20E 4MYHA 2BMFA 4DWJA 2J41A 2QNRA 4TL9A 1XCGB 3MUFA 4LHYA 5FL3A 4D81A 3SU8A 3CPJB 2BMJA 2V54A 2P65A 1P4SA 3SYNA 3CF0A 2XNSA 3C5HA 1QG2A 1Z29A 1XD2A 2WM9B 2ZJ8A 1S3SA 2Z83A 3GJ7A 1JEDA 5TB5A 4D0NA 1GP2A 3CM0A 4O2RA 3ASYA 3QKRA 4PC6A 4YQFA 1QHNA 3F5FA 4P4TA 1EFUA 1G7CA 1HE8B 1K5GA 1TEVA 3CRQA 4IW3B 5G41A 4AYTA 4BEJA 2I1VB 3K53A 3SFZA 2W2VA 4B3BA 2OZEA 5EJEA 1G21E 3RAPR 4B33A 1IN7A 3K9LA 2IL1A 3U44B 1II8A 2QMUA 2EVWX 1D9XA 2GA8A 2ZS8A 1IN8A 1RRCA 3U4QB 3GJ3A 1W36C 1Z63A 1S3GA 1OE0A 4N1AA 1ZU5A 5EP3A 1KI6B 1Q1ZA 4P4SB 5CYOA 2JLXA 1KMHA 5JFGA 1XZPA 1UF9A 1VMAA 2OFXA 2QN6A 2W2XA 3O8RA 3PG5A 3C7KA 1SGWA 5G3ZA 4MDEA 2ZQ5A 1N0WA 2FMXA 2QORA 3EZ6A 3QNUA 5KDLA 3KJIA 3TMKA 1ZNZA 4HUQA 3QQ5A 5EZ5A 1YZTA 3SQXA 4XD7D 3R8FA 4XD7A 1Q3HA 5GJWC 1CR4A 5EP2A 4F93B 3KQLA 2NIPA 4EFLA 1E9RA 2BBWA 3BAFA 3I72A 2O8FB 3CH5A 3H84A 4GOJA 3LX5A 4TMTA 1GKUB 3GQBA 4V0ME 4M2LA 1S0UA 4C0KA 4RFSB 4TMZA 3KDSE 4ILEA 1XPOA 3Q8XB 3CLVA 4ARZB 3OIYA 2CL7X 3ZQJA 4C30A 2DBYA 3QUSA 1UAAA 2G0TA 2FPLA 4G5SA 4XWOA 4YDSA 3VKHA 4EDHA 2E9SA 4M9QA 3DZDA 1XEXA 3LQQA 1G17A 2Q3HA 4P33A 4M1MA 3AVXA 1QG4A 1XB2A 3DM9B 1DAHA 4I81A 4W5HA 1EK0A 3X1ZA 2QA5A 4KYUA 5HTKA 4HDCA 4O25A 4TT3D 1P6XA 3GEEA 3OAAD 4TT3A 3OAAA 4Q9LA 4ZCMA 2CNWA 4M1TA 4KVGA 4P0TA 2DWPA 1PJRA 4TQAA 5EE3A 3GLIB 3A37A 4KU4A 4XJXA 3EZ2A 4BFSA 3QXCA 4CRWB 1XJ0A 3BFVA 3GPLA 3DOFA 1DAMA 1HT1E 1TTTA 4TYQA 4TZ6A 4M1KA 2RGCA 5AR1A 3CO5A 4EJSA 1IBRA 3H4MA 1W4CA 3EWSA 1Z2CA 3WP0A 2QROA 2V9PA 4YONB 1QVRA 5G40A 2GF9A 4RCYA 4YDHB 3PUYA 2KI5A 3EPKA 4QKQA 3THWB 3NHAA 4WIAA 3ZD7A 3SOPA 5HPYB 2WKPA 3PJRA 1XD9A 3AGPA 1F2UA 1KHTA 3WBKA 4AG5A 3A4LA 3CRW1 1CTQA 2H92A 2JDIA 4KAXA 4TMWA 5JS8A 1ZNWA 2PLRA 4LCBA 5J40A 3KL4A 1QHIA 1XDBA 3WXMA 5M04A 4Q9IA 4U00A 3EC1A 2X77A 3QXHA 3MRSA 2PBRA 4UXHA 4DJTA 2IYLD 3BORA 4CEIA 4B76A 4JLOA 2WICA 1OHHD 3CNNA 1OHHA 1SVMA 1Z07A 2IHYA 1RE0A 3IQXA 5AUOB 2XZPA 1LS1A 2GCOA 3K0EA 4TZ0A 1T6NA 3RHFA 4AC9A 1XXHA 5B64A 4Q4JB 4DLXA 2QBYB 2V4ZA 3BJIC 4JT2A 3S1AB 5FOWA 1NMXA 1Q3TA 1OYWA 4HEJA 2B92A 1G1MA 3FHTA 3WYFA 1YZNA 2DPXA 5L3RA 2ZS7A 5IT5A 4Z8XA 4Y0AA 3H0KA 1Z83A 3AH8A 4MKFA 3DMDA 2ODEA 4YC7A 5LDDC 2J0SA 2H7VA 1YR9A 3ZQ6A 3HP1A 3KTAB 3TSZA 1NF3A 4H9GA 4QJ3A 3CPEA 4OI1A 1VG8A 4PR0A 4A8JB 3TW8B 3W8RA 3ECCA 4NU0A 5CIWA 4AIIA 5C2JB 2OESA 1NL3A 2F43A 3THYB 1JR3A 4PC2A 4HLQB 4LYAA 1XF9A 4FMCB 3PXGA 4RKFA 5KSPA 4G5GA 4BFVA 1CRQA 1GZSA 2QAGB 3CWZA 2WAYA 4EPYA 3X2SA 4L5BA 4HI0E 5FBLB 1FQJA 1KO4A 4A0FA 4Q1FA 4GP7A 1SXJA 3IIKA 4QHTA 1DAKA 3MMPA 1KMQA 4V03A 1GTVA 4CEJA 2W6IA 2VL7A 3RWOA 4KO8A 1QZXA 3GLFA 3TSWA 1C9KA 2WWXA 4C0HA 3GFTA 3HDTA 4CW7A 3EIQA 4NONA 5CM9C 3B1XA 4BE7B 1SULA 2VA8A 3C4JA 1R2QA 3ZVMA 4HAWA 4OHXA 1VG9B 2X19A 4HLCA 1W1WA 1W0JA 3CWQA 1R0XA 1ZBDA 1DELA 3GJ0A 4OL0A 2WWIA 3RWMB 1EG7A 4FW9A 5D3MA 2L0XA 1GFIA 2AWNA 3NBZC 1KKMA 1RIFA 1T3SA 3UMFA 3LVRE 2FEOA 2QU8A 3MWKA 3BFKA 1FUKA 1GUAA 3HJNA 4DLWA 3C15C 1YZLA 1Z5ZA 4Q03A 4GOXA 4UNQA 4U5XA 1SKYE 2JLSA 4ITRC 1ZMXA 1FQKA 1IAQA 2WPDA 1CU1A 5JZVA 3MLEA 2NPFA 1JI0A 5AK0A 1WXQA 1VIYA 2ZYUX 4URVR 4DDVA 5JSZA 4PPGA 1G3IA 1LVGA 2F55A 4Q19A 1L7VC 4S35A 4PXAA 4FINA 4B3XA 1GG2A 3L0PA 3AKYA 4LHVA 2ANBA 3CH4B 4MYCA 2ZM5A 1GITA 3BB4A 4E5UA 1QDEA 2C03A 1CJKC 2A30A 4DEYA 4C2TA 2QAJA 1XMSA 2BEJA 2GWHA 1G64A 5EP1A 3I32A 2FFAA 4FI3C 1ZM3A 2JGNA 3GCGA 1DG1G 3CZPA 1NIPA 1SZPA 1R5BA 3REGA 2B8TA 2Q9AA 3OHMA 2FZ4A 1IXSB 3GFPA 4JVNA 5TARA 2ZAMA 1K8RA 3MWYW 4LPKA 2QPAA 3SJBA 2OBNA 5K8UA 1Z6XA 1MO5A 4IDHA 4A9AA 1ZM9A 3QJYA 5J4VA 4POAA 4NYJQ 2Q3FA 1IJEA 4O2LA 2HF8A 2LKDA 4PSVA 4BLOA 4URYR 2YJTD 5DE3A 1E2LA 2HEIA 4PQRA 3P26A 4PSAA 1R0ZA 2IHBA 2C9OA 1T3LA 3AUYA 2ZI3A 2D7DA 1ZUHA 1ZU4A 2BEKA 5LD2B 1OH8A 2XGJA 4HZIA 4MUBA 1E2DA 3WRYC 2Z4RA 3BWDD 5C4GB 3K8YA 4DLYA 3R9XA 3U60B 1NBMD 2XOKA 2ZVPX 1CJTC 1JNYA 2P6RA 1E2JA 4LGMA 1N5KA 2JIZD 3B1WA 3PR1A 3IILA 2JIZA 3MD0A 5CB6A 5DNYB 3RYTC 2AK2A 3CIOA 2ODWA 3IUYA 4NPHA 2OM2A 1VG1A 3FDIA 4TTPA 3U7HB 4MYTA 3C5CA 3I92A 2XZOA 3VAAA 3MG9A 3PUVA 5FBRB 2CMKA 2VPPA 5EQTA 3O8CA 1Q1QA 1ONBA 4JMPA 4M0LA 4DDUA 4CEHA 1R8SA 4OI2A 3B1ZA 3TLXA 4DCSA 1EFRD 2DFNA 3ZS8A 5AUPB 2QTVB 4EQ6A 1LY1A 1Q21A 1TF5A 5D3QA 3KQKA 1DS6A 1W49A 2ZJ5A 4QXAA 1WMSA 2AXNA 2IXEA 1XWIA 3K09A 1LNZA 4MGKR 2IYWA 1Z0JA 1NG9A 1JBKA 2C96A 2YWGA 2OLJA 2ASEA 3QF7A 1P3JA 3RANA 1KO8A 4ZDIA 1W7AA 3D7MA 5ANRB 2ZUDA 4HLDA 1W2GA 1GM5A 4X8LA 5FPKA 4C0BA 1KO7A 2ZSDA 1UEJA 3RRMA 3ZLJA 2FF7A 4TN1A 1F6BA 1NVVQ 4WW0A 5JCPA 2VYFA 1NBME 5CDFE 1X8LA 4I4LA 1RC8A 1IY0A 1CR2A 1XFAA 2A78A 5AJWA 5E7IA 5FTMA 2BM0A 3WHLA 5L3SB 5EE5B 1ZNYA 3T06B 4QG7A 3QPVA 1TUEA 1IQPA 1J99A 2QRNA 1RJ9A 2WBLC 4Q01A 2FZLA 5K8IA 4IRUB 2BKEA 2ECKA 1MH1A 1I2DA 4ZIRA 1D9ZA 3V00A 1T0JB 1CR0A 1AKEA 4LC0A 2KE5A 3HYRA 4PC1A 3MFYA 4MGIR 2CJWA 4Q47A 5JBQA 3IO3A 3QE0A 1LFDB 2FGJA 4JLPA 2GVZC 1XRJA 2HYIC 4OK5A 4M53A 2FSHA 2V6IA 3L8ZA 5J4YA 1Z2AA 3SNHA 3AQ4A 2H16A 4FMCF 2WWWA 1CJVC 5KNDA 2ZSEA 3M6AA 4CT5A 2QGZA 3U3OA 1AS0A 4JLJA 2IYSA 1WQ1R 3FE2A 1TAGA 4TLDA 5E7JA 2MSDB 2GEVA 4IOJA 1JB1A 1I2MA 2QE7D 2V7QA 1YQTA 5B57C 4WAUA 1TQ4A 1FX0A 1W2HA 3WHKA 4D82A 1BMFD 3V4FA 3K70D 1KI9A 3IBGA 1DVRA 4DHEA 4GNKA 1O87A 2ZR7A 1G3MA 3HU1A 3WMFA 2ZXUA 1XD2B 1A1VA 2ZI7A 4LPSA 4D6PA 1KJYA 2ZJ2A 2ORVA 1I4TD 3AVUA 3KJGA 1DAFA 2VIIA 4RZ3A 4BWYA 3VTKA 2O8CB 4OJQA 3WNDA 5E95A 1E9EA 4GSYA 4WBSA 3MGCA 3GLGE 4QGFA 4D80A 1XJCA 3AF2A 4Q7LA 2G88A 5DO9A 3EA5A 3KX2A 3A1VA 4DIEA 3DM5A 2NMVA 1GL9B 4Q00A 1MT0A 1VCMA 2XX3A 3DHWC 2H17A 3FMPB 4HB0A 1QF9A 1ZP6A 2YHSA 3A4NA 4TL7A 1UBGA 5BN3A 1D2MA 2BOVA 3WMEA 2VP6A 1YKSA 4DLSA 2CDNA 2ZSFA 5FPSA 2J45A 3VKGA 2OFWA 2XB2A 1JAHA 3BFXA 3QXSA 2ZRLA 1DTSA 3BH7A 5JECA 5L3QA 2CK3D 3LXRA 2CK3A 4EFNA 1ANKA 3CF6R 1W0KD 2KB0A 4PFSA 3ZZTA 2UZ3A 2QL6A 4AKIA 1W4RA 5EXTA 2VHJA 3NKVA 3T35A 3C8UA 1WF3A 2VEDA 3KB2A 4JLNA 5TY0A 2RGXA 4OHZA 4BRUA 2O8DB 1S96A 5K8TA 3QVUA 1Z8FA 4EAQA 4PSKA 2ZRNA 4PO9A 4BLTA 5ELXA 5TV2A 2FN4A 2IK8A 3W3ZB 4B3DA 2CHQA 2GK6A 5EE9A 3P32A 1TL7C 1S9HA 3SJZA 3ZVRA 3GP8A 1TF2A 4PO1A 1W36D 1G3RA 3KFVA 2HT6A 1B23P 2PT5A 2ZRPA 3K9NA 4JLDA 2GHIA 2PJZA 4TLBA 2HDNB 1ZM4A 2QSYA 5P21A 2WJYA 5EP4A 4A92A 1SKQA 1XNJA 4UNPA 3E2IA 4QRHA 3PENA 2FNAA 1CULC 1IY1A 5IRCD 2RH5A 2IYRA 2YVUA 3QEOA 4LY6A 1M7HA 5J5CA 5IHPA 2J5XA 4KITB 3L43A 3K9GA 3VU9B 4R2HA 2KBFA 4CZ2A 5FOTA 1GNRA 2OAP1 4DLVA 1TQ2A 3I3SR 4TL8A 2ZAOA 2XJ4A 2VHCA 2J87A 3KXIA 1F2TA 2QQEA 3AKCA 1DG3A 5FBVB 1W5SA 2WIAA 1EFTA 4Z1MD 2RGDA 4Z1MA 5JS7A 2IYXA 3LVQE 5LPNA 1L2TA 4WVFA 1S9DA 1NN0A 5EXXA 2QP3A 2IYQA 2WOOA 1BYUA 2J7PA 2FFBA 1E6CA 1E0KA 4JVSB 2WMOB 4CIDA 3QSYA 1KIMA 5FPHA 2DB3A 2GK7A 4DB4A 4DKXA 4LOAA 2V1UA 2HF9A 2I1QA 4I1SA 4IFEA 4JVMA 4PZLA 1P2UA 1IN6A 2QI9C 1Q1BA 3VR2A 4BFZA 1E3MA 4DSNA 2C77A 4TSFA 4M1SA 3QVVA 2ERYA 3KKMA 4A2QA 1NN1A 2JLRA 2IXFA 4BFUA 3JZMA 1MO6A 3LO5A 1KK3A 4MRNA 3RS0A 4A8JC 2X8AA 4NTZA 4C7OA 1G8HA 2O0JA 3MWLA 4BECA 3LAWA 3PUXA 5GJVC 4B73A 3ZZ0A 1RRGA 4PHHA 1COWD 2QT0A 2WSSD 1O3YA 3OESA 4AYWA 3X1WA 4B6FA 5AUQA 4W5WA 3NC1C 4W7SA 3EIHA 4OK6A 2GXSA 4OI0A 4K81B 2QSZA 4D0LB 1E1RD 3IIMA 1Q44A 1QHHB 3AM1A 2I4IA 4NZYA 3NHBA 4YMWA 3BB1A 2VSXA 1KK2A 3N5CA 2XAUA 4HB4A 2FSIA 2QGNA 3PUWA 1VHLA 4R2IA 1II0A 1N0UA 2EFHB 1E2KA 4FCVA 5JI2E 1GKIA 2YOGA 2R6AA 2NZ8A 1CR1A 1NMYA 2Z5FA 3HU3A 2BCJQ 4BLQA 2GRJA 3DDCA 1SVWA 3FMIA 4M22A 1YR7A 2YC2C 3NWJA 5KPDA 4LJ5A 2P3SA 3UK6A 5HR5A 4DDTA 5EUMA 3B1YA 2WKQA 2FG5A 2EWVA 4B2IA 4GZMA 2HCJB 5UKDA 3WRXC 4JBWA 4DLRA 3NG1A 2R6GA 4RD3A 4ZDJA 4JJKA 4LSGA 3AF0A 2BDTA 2G6BA 4L16A 2J0QA 4ERNA 3LW8A 1VIAA 3HPRA 2IUUA 3A1UA 3GLFB 4NE2A 5FUXA 4B2PA 1BO6A 1XTRA 1ETUA 3U61B 4JYCA 1QHSA 3W3AA 2WJIA 4MYUA 1RRPA 2ODBA 1XMIA 2P2LA 2C9CA 4DCNA 1AQUA 2FFHA 4ZDKA 2IWHA 2Z6VA 3ZZUA 2ZRGA 4TMVA 3QIAA 4V02A 2WJGA 4XVQA 3DVLA 3QXJA 1L4UA 1ZCAA 2C2HA 2QPTA 3H86A 2XNDA 3Q5DA 1CEEA 3GMTA 1VHTA 4M1OA 5KTYA 1D5CA 4KVAA 3KKOA 4TYNA 4E07A 4R9UC 1G3QA 2WV9A 2IEYA 1AS2A 5JJIA 2FEMA 3TJZA 2ZSAA 4UXJA 2GBLC 2JLYA 4HB3A 1KDRA 2OUKA 2ZVQX 4BRWA 5L8VA 5TXGA 2ZSBA 2HJGA 1EWQA 5LD2C 1NN5A 1FOEB 1US8A 3U3KA 3C16C 2FA9A 2DFTA 4HZUA 5G3YA 2NG1A 2P67A 4M9SA 3BXZA 5F3WB 4ZKEA 3B8HA 1E2FA 4LWZA 4OI4A 4Q7KA 3R7WB 1TMKA 3Q85A 1R5NA 3VFDA 4TYPA 4JSYA 1X8KA 2KJQA 3AVOA 2ZYWX 3D3QA 5HKKD 3EPJA 4LBZA 4BLSA 5HKKA 4PANA 1M8PA 1E9AA 1PLKA 1T4GA 1CJUC 1ZIOA 2AX4A 1N6KA 2WIBA 4G5RA 3K0FA 4PX9A 5DYGA 4JLMA 4DLZA 3NBXX 2YWEA 4JLKA 2R6DA 2BV3A 5KDDA 2N42A 2DCUA 1W4BA 2PT7A 2J7KA 4TQ9A 3VX3A 1VCOA 3O8BA 2CNWD 4AWXA 4AYXA 2BBSA 1GVNB 4KBGA 3ZVNA 3TVTA 4LI0A 2QZ4A 3QBTA 1E2EA 1P2VA 1U98A 3GFOA 1P9WA 4G5QA 2ZR9A 5AJYA 8OHMA 1SVOA 2PMDA 3FKSD 3FKSA 2YOFA 5DI3A 1T8UA 2MSEB 4XSHA 4KFTA 1L8QA 5J4LA 3BC1A 5CLLA 3TR0A 1WB9A 4PC7A 3UWOA 1NLFA 3K0CA 4B47A 1ZM2A 3QKSB 2AR7A 2V55B 2WWFA 3ND9A 4KLZA 4Q9KA 2XITA 1MV5A 3AVVA 5FTLA 3TUZC 1NG1A 1V43A 4XSGA 1BOFA 3EZFA 5B2ZA 2GJAA 2Q6TA 3KKQA 1UM8A 3PITA 1F5NA 2D2EA 3I5YA 3HU2A 4QM7A 3UG7A 3PEWA 3M4YA 1P62B 1YZKA 4ZCIA 4D4JA 2JDID 4GMDA 1G4AE 5F9FA 3CBQA 4GMXA 3BOSA 1EFCA 3VR3A 4MUAA 3EXAA 121PA 1ZYUA 3ZD6A 1GL7A 3PCRB 1GWNA 1G291 4LBYA 2ZI6A 1DOAA 3QF4B 3B2EA 4KHZA 1WA5A 1ZUIA 4BLRA 1AJEA 4FCTA 3H1TA 3N2IA 2HXYA 2BC9A 4NH0A 5KU1A 2YWFA 4NYIQ 3W5JA 5DN6A 3RRNA 3BRWD 3OE7A 4I1VA 3W6NA 1WE2A 4ZV4A 2QP4A 2GCNA 1KOFA 1KI4A 4Q9JA 2CXXA 2GCPA 1UEIA 2QP9X 2YV5A 1SHKA 3DKVA 1RW4A 1KZGB 2W2TA 5CK4A 2B6HA 2RGAA 4A2WA 2KWIA 1WRBA 3AVWA 1HYQA 2P5TB 2YWHA 5LB4A 4A15A 1X6VA 1AS3A 3GD7A 4AK9A 3IEUA 3VNUA 1R0WA 4RY2A 2GAAA 2AFHE 1J8MF 1FMLA 1EXMA 1XJQA 2XXAB 4H1VA 1JR6A 4OK3A 4P31A 4Q21A 1T9HA 3RS2A 1X3SA 5FFMA 3AB3A 3QY0A 1FUUA 3RNLA 1JR3D 2W0SA 1E98A 3CW2A 2PZEA 2Q3MA 3GLGB 3PV0A 4ZO4A 3FVQA 4JLAA 2EQBA 5JCZA 2ATVA 3TE6A 2BWJA 3IDQA 3KKNA 3ADKA 1RYFA 1G19A 1SXJD 3RS3A 3MJRA 4AKHA 5FR1A 5HCIA 1IN5A 2W6ID 2A3RA 1XBTA 4B35A 4F7WA 2GJ9A 2WJVA 3T5GA 5C18A 1XXHE 3AF1A 3FGNA 4UNRA 3RVBA 1KDTA 2D7CA 4JVLA 3N2EA 2EFEB 2UVQA 5KNBA 4JSTA 3BK7A 2R65A 2RGGA 3PEVA 2KSQA 1X1SA 2C78A 3DL0A 4NBSA 3NDPA 4KFRA 1W0JD 4NL4H 1G8PA 1KGDA 4ZDWA 2QMHA 1E4VA 5DH9A 3FKQA 4MGYR 1F3OA 1GOTA 1OH7A 4LJ4A 5CB8A 2QM7A 4ZPXA 2IWRA 3W5IA 5BN5A 1FX0B 4L8GA 1CLUA 1NSFA 3K0AB 4LC1A 3B60A 3K70B 1UADA 5FTKA 1U0HC 1KYIA 4CVNA 2NQ2C 4IHQA 4DUGD 4GPTA 4B34A 3MSXA 1P7CA 2LWIA 4DUGA 3MWJA 1N2CE 4FWIB 1G41A 5A4JA 3A1WA 2WPDD 1JR3E 2VHTA 4J0QA 1E99A 1CRPA 4UXIA 2GKSA 2FE4A 4BFTA 3RABA 2OEPA 2VSOA 1KI6A 2WJHA 4QNRA 2XSZD 4AY2A 1SXJE 2XSZA 3K0CC 1FFHA 4OQXA 4ZKDA 3U7EB 1XTIA 1MABB 2VP2A 3B82A 3GLFE 5KNCA 2VLIA 2A9KA 1RVDA 2ZJOA 1Y3AA 4FD2A 4BFXA 2ZU0C 4DEXA 2FPMA 2O8FA 3EZ9A 1R7RA 4WXPA 4NCJA 2WWHA 2F3TA 2W83A 4JL8A 5C4MA 3IHWA 4BZPA 4K46A 4XIGS 4U7DA 1II9A 721PA 4RFSA 4KV9A 2H1LA 5JJKA 1ELOA 1SVIA 2OE2A 5EE0A 5KOYA 4QFMA 4MGZR 1E2IA 4ARZA 5DYIA 4TMXA 1TQ6A 2IYYA 2PMKA 5BN4A 3B78A 1FTSA 3P20A 5F98A 3KXKA 2QQ0A 4LJ8A 3R20A 5FUWA 1HTWA 3KJHA 5HE9A 4URWR 2D06A 2Q0HA 3T12A 3ETLA 1W36B 2RMKA 2OBMA 4IEIA 1GRQA 2CLDX 2IBMA 3W6PA 3ADBA 2DWOA 2GAOA 4HLUC 5E7MA 3LFUA 2RGEA 3Q72A 4AKGA 2GXUA 1ZRHA 1KK0A 3UATA 2HUPA 2XOKD 4QGHA 5LBIA 3TH5A 3GLIA 1XU4A 2AKAB 4LV5B 5JRJA 1UKEA 3KZ1E 3ZGXA 1G6HA 5CITA 4JIMA 1XTQA 1PUJA 2OG2A 3T1QA 4B3GA 1PLLA 4DC9A 3EX7C 3W90A 1QVAA 2W58A 4LUCA 3HR8A 4PHFA 4TQUS 3FFAA 3ADCA 1ZVQA 2A2ZA 2H18A 3WBJA 4Q4HB 1C4OA 4IJMA 3THWA 4P4UA 2ZTSA 4XTRA 1HURA 2CLCX 3EC2A 4X8OA 3LXXA 4CYMA 2GJSA 4RCZA 3RS5A 4JT4A 3QENA 2R44A 2Z4SA 1U9IC 1AKYA 4L15A 1KJZA 1QBKC 3E70C 3V4RA 4B71A 2F1RA 2EU8A 1N5IA 4QOSA 2G9NA 3SDZA 1GNPA 4A6PA 5GADl 1NJGA 1XTSA 1XCMA 3I8XA 4PQFA 2EFDB 2AD5A 4FN5A 3AV0B 4KXFB 3PIRA 1G7TA 2NO0A 1ZUNB 1R0YA 3QEJA 4HAZA 5JWHA 4Q4JA 1OT3A 4US0R 4FMDF 2QBYA 3O8DA 3W34A 2GETA 5H68A 3U5ZB 5IDVA 1NRJB 5H1YA 5IK2A 3S1AA 4BFYA 3THXA 2BBOA 1X86B 2VP9A 1BKDR 2O8BB 1E79A 2A5GA 1G8YA 1A7JA 1P72A 5EXSA 2FSFA 3B7GA 4D4MA 3LH5A 4TL6A 2HXSA 3GJ8A 1E0AA 1NMZA 1FNMA 1UPTA 3LRPA 3CX6A 3VR5A 4I1UA 2QEQA 4EPRA 1CIPA 1S2MA 4OQFA 2H5EA 3KTAA 3MAAC 4N0EA 2IXGA 4QNMA 2ERXA 5K8LA 4NYJR 5AUNB 2OAQ1 4NCKA 4Q4AB 2PL3A 3THOA
chains in the Genus database with same CATH superfamily
4BP1A 1WDMA 4CLOA 3TW8A 1QCCA 2HSGA 1KMNA 3I53A 4KVZA 5KTOA 2J46A 2XVAA 2ZIZA 1IHDA 4FIDA 2Q2QA 2D6FA 2HLNA 2BFBA 3K16A 1D8TA 1ZL0A 4MRVA 3TTSA 3THYA 4Z1OA 2E5FA 4WLUA 3MTGA 2IUSA 4ZI5A 3CURA 3DP9A 3BIFA 2H7CA 2P2CA 3MINB 2AA3A 2F59A 2G76A 4QEKA 3R7DA 2C8VA 3VMFA 2MWMA 4PG7A 4YRBA 3DF9A 5GPBA 3IL2A 3R40A 4KV7A 4FFWA 1N4DA 2V96A 1Y6JA 5J4KA 4HBZA 4AURA 3OJFA 1OBHA 1SHLA 4JBIA 4BVBA 1TKAA 5AKYA 1X19A 3HB5X 3D3EA 1GA6A 1XEWX 4YRMA 4KE8A 5JNWA 5DWDA 4PO8A 4J2HA 3KZCA 3BXHA 4R1PA 4EI7A 4ZXFA 4CDGA 1VYTA 5EKSA 1RYYA 2AD1A 5D7NA 4XGRA 3PKIA 2XE8A 4M7OA 4AJ2A 2BMDA 2TMKA 4Z9YA 3BXEA 3Q6NA 2G80A 4WXEA 4IF4A 3TSOA 3L1IA 1T2CA 3P9XA 5A5EA 1LZLA 4YMIA 3IVXA 2QLLA 2GK3A 1WKCA 2YFHA 3E9YA 4UU1A 4E3ZA 1PKXA 1XZMA 3U6BA 3EH1A 5M3BA 2GUWA 2R3SA 5TDHA 2H4YA 1XDZA 2FVYA 3PFCA 5HRUA 1S5PA 1XELA 1AM4D 1VSQA 3MELA 4OKSA 3AYXB 3RAJA 4HG2A 4UEJA 2RH8A 3R5HA 5ALMA 3HDQA 3EQ7A 3LLMA 3A6ZA 4H18A 2QL9A 4Q0MA 4NPAA 4P2GA 3VR6D 2YIDA 4LWPA 3M7IA 2UYHA 1M75A 3SQDA 1NQXA 1Z37A 4OHWA 1H8HD 3PK0A 4TN5A 5CA1B 1BJTA 2ZE6A 3QLUC 5B2FA 3FB4A 1DPFA 2D1QA 1WS6A 1RJDA 3IQWA 3PQFA 4I14A 4L8WB 1XTKA 4TQGA 2GF0A 2HNKA 3T1TA 3PFWO 1EP1B 3ASVA 3GRZA 1Q20A 3OEEA 4HUQB 3W9YA 5C5CA 2Q3LA 5LQMA 1KQGA 2QTMA 1MX1A 3I8SA 3AO0B 1WR8A 3NDRA 5AVOA 4C6TA 2NOAA 5IXSA 5M2QA 4JYAB 2QLNA 4MRSA 3BUSA 2ESRA 3M9LA 5FBQB 4ZK2A 3AVTA 3GT4A 1H1TA 1XLTA 2R66A 2VYNA 4KW7A 3O93A 2D1TA 4CT4B 3I4LA 1RHJA 2GF2A 2BBTA 3ROXA 1X92A 4EJ2A 1QBGA 3EWAA 2QD5A 1P33A 4YMSA 4YMUA 1SXIA 4KB5A 4EENA 4TS4A 1NXPA 3PQ2A 4BBAA 1RSZA 2BR3A 1XP8A 1Y9JA 1ZK2A 4G0VA 2WIGA 2WU3A 5CDSA 5CFRA 4TTQA 2NZYA 3OZVA 3FMGA 3G89A 2WINI 3BKWA 3TN7A 1IATA 3EA0A 2BZSA 3O94A 4MHTA 1QFZA 2P91A 2X5OA 4D02A 1A82A 3L9WA 1V8OA 5GM1A 4TGLA 1M8FA 5JVDB 2DP4E 1KJ8A 3PEFA 1L7BA 3LQKA 3RODA 3BHMA 3IDSA 4LDQA 5I7OA 2ZYHA 3EBLA 4JEMA 4MW4A 3CZRA 4R84A 5DHTA 5FEMA 3AEUA 3WGQA 4DQLA 2CV0A 1NF9A 3ADDA 4R5HA 1G3UA 1EGAA 1YIAA 2AE1A 1PZNA 2VG8A 1P81A 1P2TA 3P4XA 4L5IA 5F1OA 3Q7IA 1GR1A 3N87A 1ZEJA 2W5UA 2B4TO 4UAUA 4OA5A 2FCAA 1ILEA 1DXQA 2YS6A 4JXJA 1TW2A 1N6PA 4EJSB 3F1LA 3NTOA 5CT8A 1H2WA 3K6JA 1YFLA 2OCYC 2JHFA 4YRJA 4DV6B 3KM0A 1BQEA 2XXJA 2REBA 3U7FB 3DZ8A 5KSZA 5T6BA 3RUAA 3K72B 3CF2A 2YWBA 4IJWA 4Z86A 1W5AA 3KEQA 4RGYA 1RKBA 4M4SA 4I9GA 3S27A 3EQ2A 3M6MD 1BE0A 1F2UB 1MO4A 1W52X 2CHVA 3EJ6A 4Q4LA 1ZINA 1JJAA 3V4LA 1XCPA 3EUAA 4D5GA 5NULA 1GLGA 4G56A 3ZHUA 4R2KA 4CG0A 4EHKA 5AD1A 4FUQA 2O7RA 4L4UA 4OU5A 5C8YA 3HKCA 4RM3A 1N1EA 3TNDA 2FSGA 3UUWA 1S1CA 3FYHA 2GD1O 2IU3A 4PLGA 1I5EA 2NUTB 1OBCA 2ZB7A 3LYAA 3OI7A 1U2SA 3GGSA 9MHTA 2J1LA 4KREA 3K9QO 1HOTA 1VSUA 3Q6IA 2OXIA 2FOXA 1N1DA 4WA8A 4MRRA 3FCXA 2YFQA 4H7FA 5DZSA 1U04A 3TAUA 2W6PA 3U5TA 4DOMA 5KYWA 2B2CA 4N12A 3VI4B 2QTNA 4ACAA 1RQGA 4MUIA 2I1WA 5JYBA 3CJRA 4FLMA 3FCOA 2GN6A 3PQ7A 3RFUA 4EARA 1G38A 5BW5A 1KSJA 2WSBA 4KQFA 5HUHA 3KV3O 1B0AA 1U99A 1HEIA 2PSFA 3CVUA 2C83A 2W8BB 4H7PA 4OBEA 5HHTA 1IQUA 2C4VA 2HGSA 1MKYA 4Y2SA 1JJIA 2C0QA 2WVHA 4J0IA 4CL2A 1RDFA 5F78A 2WJJA 1T5IA 1A2OA 2X9NA 4YGYA 3SE7A 1MQAA 4E7PA 3T9EA 2C9YA 4P32A 1WDTA 3LBNA 1L1RA 4OP3A 3IHKA 3LDGA 3IAS6 2YNMA 1O6GA 2FZ5A 2Q5OA 3IUJA 4IRXA 3TDMA 3AK4A 4XA8A 5K05A 2XVXA 3CH6A 4YLGA 3V8VA 3FFBA 2YWJA 4E94A 4C05A 3CMCO 3VH2A 2ZUFA 3W5BA 2PU5A 5FWXA 1T4MA 1EWKA 2N9UA 4ZVMA 2BYTA 3OLCX 2QE6A 4U8HA 5EC8A 4E21A 1Y4AE 3WJ7A 2H9YA 5JXJA 3J81A 3HV0A 3LW7A 5BT8A 1P44A 2EKDA 3QPUA 5IC5A 4ZEXA 2HT1A 3GEIA 3BAZA 1R16A 2XBLA 4UUBA 1G8MA 3MAGA 3SMQA 3LQFA 1IU9A 1Z5WA 1YGYA 2HPHA 1F48A 5ED0A 5JT1A 2BM9A 2W00A 4MA0A 5IC4A 2NSHA 3RGGA 3WZLA 2J5QA 3KQQA 5AHOA 1AIPA 1M67A 2LUOA 2Y2UA 3H7AA 4NG5A 2OGUA 3QMVA 1MHTA 2G82A 1J2JA 4L28A 4YUYA 2M2IA 2UUOA 2GTPA 1M74A 3A4IA 3T5TA 5CX4A 4BC0A 4C0QC 5A5DA 4NCHA 2B4RO 3E5RA 3D31A 3IMGA 5A6SB 3QBEA 4RENA 5G1PA 4FCWA 3IVGA 4LK3A 2X4DA 1RM4A 3U3RA 1RXUA 3T7JA 3K1YA 4V0MA 4A0HA 3I6ZA 2VWHA 4D9BA 1GTRA 2AZMA 4YCDA 3ENVA 5DT2A 3E5HA 3IEMA 3EW9A 4UJ5A 4XLTA 5ALGA 3VSAA 3OCVA 3O92A 4CV0A 3RQSA 3UUFA 3DUWA 4M8NE 3G79A 1B73A 1NU6A 3KKLA 5DHUA 1P0CA 2O20A 4JGBA 4F6RB 2D1YA 4ACBA 2YVQA 2JAQA 3BZWA 2ZWAA 3M33A 3SZRA 3WSWA 3WSVA 2YC4C 1JPVA 5B1HA 4BX3A 2QLBA 1JKFA 2Q4TA 3I1FA 3WYAA 4KX3A 4OHCA 3EEOA 3CIFA 3FBTA 3PE6A 4DMUB 1DAEA 5I7UA 3UNXA 3BDIA 5J59A 2PWYA 4PG4A 2X6TA 3OIGA 5DGCA 3ESXA 3RV4A 3ZGVA 2BHRA 4TKUB 3D8SA 3TR6A 1JZTA 1GAJA 5LZ7A 5T7BA 1E9CA 1G66A 3D9QX 3NATA 1IY2A 1EDOA 3HCRA 1W44A 4IEEA 1V47A 4ZZ2A 3AMVA 3O73A 1JECA 3QJ5A 4YWHA 2VCEA 1PZMA 2H29A 3FWPA 1ORRA 1YBHA 2UZ4A 1N6IA 2OVFA 1K7FB 4PSUA 2A1TR 1D04A 4D9KA 5C34B 4C6RA 5KPJA 5DHSA 4WEOA 1Q7GA 2ZWVA 2AKYA 2G28A 2IA5A 2CLIB 1VCIA 1W96A 2QVZX 3KAQA 2Q5EA 3N2YA 2IT1A 4M1YA 3WWEA 1MAWA 2F1IA 3KYDB 4BB0A 2ZETA 1GARA 1LLUA 4GE3A 4RWZA 4B6JA 1X7HA 3RLIA 3QVOA 3PXUA 3K96A 4BB9A 4E0BA 3SHFA 2ZRBA 2P2YA 3SC2A 2IEIA 3L7MA 1MB3A 2OB1A 1DAIA 4P93A 1GZDA 1NC3A 4YRCA 5L7YA 4BO5A 5JDCA 2O6HA 2QG6A 2X14A 4DQVA 1HMYA 5C37A 2NSLA 3VJLA 1H93A 3COYA 3EUEA 4KQXA 2B82A 4KP7A 4RTMA 3NT2A 3MJVA 5ER9A 2G1JA 1HETA 1PZXA 1EX9A 1YR2A 1ZCZA 5BSTA 3TPCA 2IHNA 1GQSA 2G09A 4DRZA 2OD9A 2Y1LA 1CF4A 3BH6A 4W5QA 2Q4RA 3H8WA 3H16A 3AEKB 3EXHC 1JIKA 1UQTA 4UUAA 1B74A 1NVUQ 1UOEA 1U3DA 1D09A 1J42A 1L6IA 3N7TA 3X1YA 2CEAA 1CQIB 3OWOA 1Y6GA 1ZW1A 2LBPA 4KOAA 1LTKA 2RGRA 2C82A 2HU5A 4NCBA 1U6JA 3K32A 5JASA 3R9XB 4G1CA 1TJYA 1Z7YA 2UV8A 3QTTA 3OIUA 3HA5A 2OILA 4DQUA 4KK3A 2D0OB 3KIPA 4EI2A 2O59A 4IOLA 2JAUA 5SY6A 3V8MA 4LJAA 2UXDB 5ADVA 2JAPA 2O8BB 1M7GA 2OMKA 2Z5GA 4H27A 3G2PA 3IUNA 1TZMA 1ZESA 2HFKA 5REQB 3HCCA 5IULC 4PQEA 4TWBA 3GP3A 4F92B 4FB5A 4J6EA 2JGDA 2JEZA 4ETIA 1KWGA 3U3DA 1E9FA 4QBGB 4FOTA 2FLVA 1RAHA 1AQYA 2DE0X 2Z8YM 4DANA 1RWBA 4FI3F 2JB9A 3AM3A 2XD9A 1N3BA 1GL3A 3EG5A 3ICWA 2GZMA 1E7MA 3BMXA 5AM3A 4DA4A 1JT2A 3E1SA 3HRHA 3WBBA 4D43A 2HV9A 4QRDA 3SZ3A 3WLKX 2SKCA 1T9BA 3OE7D 1K7SN 2LDXA 4FQ5A 2BGIA 3L82B 4N41A 3TLYA 3B2NA 2NYAA 1U8AA 1CY0A 1IEVA 1AHIA 2N46A 1I1HA 1REQB 3R0QA 3L9XA 1L4HA 4FOLA 2PXCA 5GJCA 3GOHA 3HVRA 1P1FA 1OWMA 2DFPA 5AJVB 3FPHA 2NVUB 3RSGA 5HIKA 2BFEB 1GQYA 5JSUA 4AY5A 5I48A 2B2NA 2PSHA 1N7JA 4ZT4A 4U7GA 1QQBA 5ERYA 1NR1A 3LX6A 4UBOA 1Z6GA 2O9JA 2YY5A 1TUBB 2BJWA 1NXQA 2OYSA 3JQEA 1XN1A 3L8MA 2QMEA 2PU7A 4YRAA 1QHHA 5JPCA 1Y5MA 3THXB 2AN9A 2ZT7A 1P9LA 1C8VB 1DEXA 4JVOA 3GLQA 1MO2A 1N2SA 3CCBA 3SQMA 2XUPA 4IIHA 3RVJA 5CJJA 2WC1A 5BNZA 5C3UA 1Z06A 2E82A 3AIKA 2NVWA 5KI6A 3INYA 1FTQA 3FVTA 1A5SB 2HJRA 4AT1A 5GVSA 3DXFA 1MA3A 4LSZA 1L3IA 2XRMA 5DCLA 4BB5A 2C4HA 4QDTA 1DQPA 3IEIA 3F78A 1PP4A 3R9IA 5C51B 4KRYA 1XPRA 2NO9A 3DDZX 3H2ZA 3W7AA 4C4XA 4EHDA 3G5UA 2I9PA 3MUOA 1QB7A 1IXZA 2HC9A 4HWKA 4BQRA 1FDTA 4EUNA 5JNRA 3I5XA 2PH1A 5AXCA 1KI1A 4X93A 1GUZA 3N39C 5IT0A 4FGWA 4C7JA 4AS1A 4MULA 3T8YA 2PANA 4DV2B 3G8AA 2ZIVB 3JQ8B 3ND8A 2QT1A 5AKXA 4AS3A 1EK2A 1MXHA 3CNQS 4DQDA 3UIEA 2XGGA 3TAHA 3UKDA 3H4VA 5TT1A 1T2NA 5DP1A 1POXA 2P4UA 1CJSA 5GGYA 1WXDA 3SHOA 3BZUA 4NP6A 2B35A 2NSYA 3QXGA 4Z0NA 2JLZA 2YV1A 4BYMA 1Z12A 2I3DA 1XR3A 3TLZA 2PQMA 1P6UA 3SJAA 3IPLA 4DZZA 1SUIA 3EY9A 5H4HA 2WNIA 2ZUCA 1O03A 3CXUA 3KXLA 2IS6A 3NEPX 2ZRKA 1KEZA 1Q12A 1C5KA 1YC5A 1YZQA 2KX7A 2BSXA 4KZPA 3UK2A 5BV7A 5IHXA 1VDZA 3U3MA 2IS1A 2J59A 4IBOA 3FNRA 1U7PA 4HSEA 4LTMA 5ECWA 2OKGA 2QW0X 4WNYA 1W85B 3TGWA 1J06A 3PP8A 1IHOA 5L4LA 1XVAA 1KIFA 5FD8A 1ESCA 3FA2A 4QSMA 5CM8B 3RUEA 1SHUX 3LFTA 1KU0A 2POQX 1N8NA 3QE3A 2PMBA 4FC7A 4JLUA 4BU0A 3RTBA 1KZ7B 3I64A 4Q1EA 4B3CA 5BSMA 4DCVA 4G86A 3DJYA 2Q2NA 4G0WA 2I7CA 2VF5X 3MJEA 1LPBB 2F3QA 2ZITA 1F4PA 3M6IA 5GV8A 5A4FS 4GM1A 4I4TB 2P3OA 4Y6OA 1EFVB 5EJIA 2AUMA 1S6YA 2B7CA 2IPNA 1UJNA 1KYXA 2JJ1A 3CLRC 2W11A 3VNQA 3VC7A 3I30X 4M55A 2YJGA 1GILA 2VF8A 4KHPB 1SKAA 3CR8A 1OXVA 4L0CA 4NNJA 4UCXA 4EZEA 4CF7A 4NAUA 4YJ3A 4DG5A 1Y1PA 2E3JA 1Z6TA 3UY4A 5I45A 3SM9A 2PWPA 1NASA 3SF0A 4IDNA 2FHSA 4D79A 4ZU6X 1HH4A 4JL5A 4IOMA 3EGDA 3IELA 5K1ZA 1CVLA 2IDJA 2ZJAA 3LY5A 1OFIA 5TQ2A 2LRHA 5JWRA 2EARA 1F17A 1E3SA 3KNZA 2GYYA 4GNRA 5LIRA 2W71A 3CISA 2FK8A 4N82A 2OHHA 1S3IA 2MSCB 2QD2A 2YRFA 3WLTA 4EJSC 4HAVA 5D1NA 2B8WA 4CEHA 4P83A 4Y67A 4FZ3A 3D1JA 1M2GA 2GJKA 2EP8A 3AF4A 4ID9A 4Y2PA 4F2HA 3JYOA 3IUEA 3T3PB 1BDJA 3I9LA 2RH9B 2AMYA 1I2ZA 3F4KA 3PQEA 3K2IA 4HK4A 4BGVA 4OH7A 5JSYA 5KWJA 2R1VB 4DCMA 2DERA 3G9TA 5JNTA 3SYRA 2AGVA 4X90A 1XFDA 3TRFA 1BGWA 5KQPA 4Q3AA 2LTAA 4FYMA 1TM4E 1Z13A 4H16A 3RTCA 1EJ0A 5TF0A 1AV6A 1JA1A 4TQUS 4M36A 4D4HA 3D3KA 3OIVA 4I8DA 2W2LD 3OG9A 4BRZA 2JS7A 1C9NA 1K6MA 2VZ0A 3PQ3A 4LS3A 4E03A 2Z6UA 5JEEA 4KE7A 3CR3C 3PUJA 3X2FA 1AURA 1H1LB 2P68A 3DWFA 1Q7RA 5FQNA 3KSUA 4QM6A 3B85A 3BMCB 4LRWA 1A0OA 5TQJA 3VPGA 4DCTA 4DSOA 3KKEA 3IE1A 1D6MA 4JLBA 1NV8A 1Q84A 5E3IA 2BIFA 1JPNA 4RTQA 4LDJA 3ZJYA 2Q28A 4OHKA 3VC3A 2WAOA 5B1DA 2HLDA 2Z95A 2XEXA 1K5PA 3HCOA 1XZQA 3JVVA 3VR1A 1G5PA 3ELWA 1VRVA 3MN1A 3NXKA 4EL5A 2FFQA 4JI1B 3DZBA 1RQRA 1QDUA 1J9EA 2IYAA 2Z3WA 3MWEB 4F86A 5HNKA 1EDEA 2H00A 3D64A 3QG5A 3RYIA 3QHQA 1OLOA 3GIDA 2I6FA 1T9DA 1SBCA 5IS2A 1VI5A 2XD4A 1J0XO 2F1HA 1D0SA 3CKYA 3NTUA 4AN0A 4B6RA 5A1JA 3HV2A 3CG0A 4MA4A 2G3YA 2Y0PA 2H4FA 2JFYA 2RAVA 3HADA 4QFBA 1KQOA 4TMYA 4P82A 4U7PB 2FOLA 4ND5A 3SHQA 4GC9A 1J49A 1DCKA 2Q5LA 3KVYA 1A4XA 3DC2A 4CIWA 3WOHA 1EBUA 3CRNA 2AMFA 2DFKB 2W0MA 5G0VA 4DLPA 2B94A 3WWOA 2VDWB 1ZM7A 3OZFA 4JUCA 5T64A 2GD0A 2AQKA 3MMXA 5IARA 2NO7A 2NZJA 1AK2A 3HHPA 3ZBQA 1T5HX 2D00A 1LF0A 3BGSA 1SB9A 1H65A 1YH3A 3Q3EA 3QF4A 3R7BA 1JWLA 2ZWIA 4R9VA 4BUCA 1NV9A 2O4UX 4TYYA 2Q0QA 4UOQA 4X44A 1R6BX 4EI9A 5DWVA 2IYVA 4V3BA 3UJCA 3P71T 1UOQA 2D4HA 3G9XA 3FHJA 4LVUA 5I7HA 1FMCA 1R3UA 1AHNA 4U3JA 3GLIE 5FBHA 2ZIGA 2IJGX 2VH2A 2CXQA 4UZFA 2X0RA 4YJ2A 1E1NA 1K9SA 1ZN9A 3GELA 5HKOA 2QY9A 3W8NA 4LZOA 5JBNA 4WOKA 5I4CA 1R8QA 3VR5D 1L7RA 1ES9A 3D8BA 3G68A 1QHYA 3K9HA 4KYIB 1XWWA 3L93A 2W6QA 2CE2X 2XNCA 2IYZA 2XXAA 3H2YA 2W2KB 4OYHA 2POCA 4CMCA 4M1QA 4QJ5A 1P9OA 4XFJA 1KJNA 1FL9A 1KDPA 3RUDA 1UC4B 3CGGA 1B3RA 3L84A 2H59A 3PYLA 2Y1XA 1N0VC 1N5MA 1SVKA 2X2FA 3KT8A 1EVZA 4FNAA 3V9AA 4G67A 4RVFA 3T0IA 3ISJA 1OAOA 4BV9A 3KQNA 3ZYZA 1M66A 1QYDA 1TGVA 1ZH4A 2J48A 2X1HA 3B13B 3QHPA 4KI7A 1TJ4A 3TKYA 2QTTA 3JVEA 5FWXB 5KDOA 1RTTA 4KQEA 2ETVA 5JD5A 3C3CA 4OMUA 3P94A 1DKUA 5DTRA 2EV9A 1FC0A 4DEVA 4KPEC 1YRQA 2QOEA 4LV6A 3K1AB 4MWOA 1VZ2A 3ZV5A 4BFCA 1L7XA 3N58A 3FCSB 2O3RA 4YBRA 1EA7A 5BV2P 3TNFA 4PHTA 3BCSA 1OX4A 1PIWA 1E8MA 3BXOA 5CB4B 4JN6B 2IC5A 1JXAA 1NSTA 2KMLA 2OLEA 3L1HA 4EPWA 3MHPA 3FPSA 1Y1SA 4BYGA 3TAXA 3C41J 4Q39A 4YT5A 4ESVA 1YBAA 4R69A 5JWOA 1TKRA 3GJRA 2P9GA 1R8JA 1XRQA 1ZJ4A 2XUZA 3GK3A 3KWJA 1XGKA 4WNAA 5AMXA 4LYFA 4EHFA 2IS2A 3EASA 1GZ5A 1PBTA 3JALB 4C04A 1SUPA 4NOJA 3DZCA 4RS3A 2V1XA 3NC4A 4YPOA 2PWAA 2PKRA 3OKFA 2JFFA 4FTWA 4U2KA 2VUSA 2KQUA 1OUMA 2ZPUA 3FJ1A 3GU3A 5HJEA 1BGXT 3F3KA 2BVNA 3I6BA 4D4LA 2WWRA 4MS3B 1BD4A 3GDWA 1T5LA 3X1DA 1A9PA 1XEFA 2MYTA 2OXCA 3MXOA 2QN1A 4KH1A 3ND7A 2FRXA 4L4ZA 4I2VA 4EFMA 1KYWA 3COJA 1HM5A 1V1RA 2PCLA 1C30B 4II7A 3GH3A 4EO7A 3K7EA 1AO3A 5J2TA 1CQJA 3M4ZA 1TFUA 1UBKS 4TLLB 2CVHA 3NBFA 3OMWA 4LMBA 4NI5A 5U9CA 1KC1A 2QL5A 3EQZA 3EOAI 1RKVA 1OH5A 4R7GA 3ZHQA 2JG3A 1XK7A 2RHWA 5ARDA 1RM3A 2W9XA 3I8OA 1NKVA 4OYRA 2FK7A 3GBPA 1LSOA 1X7YA 5HDQA 1VE5A 2O1SA 1TJ5A 521PA 3TUJC 4D0GA 1YFJA 3QI2A 4Q1CA 1EX6A 3HKDB 3ZIAD 3FHOA 4PAQA 2ZUWA 4US1R 2XMBA 4GQAA 1V6CA 4KJZA 1MABA 1NDHA 3VV3A 1FMJA 2IS4A 1IZYA 1F5SA 3KEGA 1XJWA 3KDPA 3GC6A 3NXSA 4GR5A 4NH4A 4TV8A 3FZEA 2GFIA 2IPXA 3N86A 2AG5A 3N6RA 4H31A 4EKYA 5HZMA 1LGYA 1IM2A 1NAHA 4FCCA 2BZ1A 1ZONA 4WFKA 4F91B 1R5OA 1CNEA 1RZUA 1SU6A 2WYOA 4DJJA 3NX4A 2QR2A 1V5EA 1C80A 1NFRA 1Y8RA 4XLZA 1QIHA 3LIIA 5ESWA 4TKVA 2DX7A 3HEAA 3LX8A 3DKKA 2QLTA 5D00A 4FE3A 2PYIA 1U81A 4KXXA 4OQMA 6ADHA 5LMZA 1FCJA 2IYUA 2Z2KA 5EYPA 3ZU5A 3CNLA 1GPAA 1F60A 1N2XA 3A3PA 4CKZA 2Z43A 3B1VA 4V0OA 1YIOA 4MV0A 3UOGA 2RIRA 3NJRA 4C3OB 5TS2A 5HOEA 4YACA 4UMFA 1EE2A 3X1XA 2DQZA 1YDHA 4H60A 4RHFA 2ZPTX 2SCUA 3UPUA 2JA1A 3ZX4A 5BWMA 5A7HA 4JI0B 2O8VA 3IVAA 2GCIA 4JKIA 3SBEA 4B43A 4LZLA 5CB0A 3O4VA 2DHRA 2GZRA 3CO0S 1JHPA 1OZGA 3HJAA 3K09C 4HGZA 4RFVA 3WYGA 1N34B 3A6LA 1YR8A 3A4MA 2J85A 3NEJA 4XASA 3UICA 4AS2A 1NY6A 1ESEA 1ZVVA 1ACMA 3GNSA 2IQIA 3PWSA 3KYCA 4IPTA 4RYDA 1OZ0A 2RHRA 3GX1A 1I8TA 4KL8S 4RWEA 2FDCA 2AOTA 3NS7A 4CI9A 3G1TA 1IQRA 2CLFB 3O2SB 3RGWS 2QTFA 4AY4A 3QHAA 1NM5C 1FNDA 3O31A 2ZRJA 2BGNA 3CLUC 4L78A 4B3HA 3ZXIA 2JJ2D 2L17A 5FOXA 2ZSIA 3ESYA 4W82A 1RCFA 4PZZA 4E5KA 1ZR4A 3UFBA 1ZQ9A 1VTKA 3LYUA 3OU6A 5CA0A 1S7GA 4PLCA 4LYGA 3S40A 4IFBA 3D0RA 4MVJE 5DWQA 1X70A 4EITA 5J5VA 1ORHA 1PYDA 3H05A 1JQJC 1KETA 3ER9A 4D26A 2PKXA 4IUDS 4YUVA 1RHKA 3TG8A 1PF7E 1JJ7A 4HH4A 4US2R 3COSA 3PDJA 5CT4A 2GWRA 2O3QA 2HMTA 4RGQA 5H3LA 1GTJ1 4S1WA 1B8VA 2XNHA 2ZBDA 4L9SA 4QUGA 4WKPA 4NBWA 5C8YF 1U0EA 2RB4A 1LSSA 3RASA 3T9BA 1A4IA 1COWA 4CQMD 4XYBA 3T3EA 2DY1A 4QJ4A 3AF6A 2FJUA 1EZ1A 4Q24A 5T67A 4DC0A 3G82C 3GFFA 4JWKA 2CLKB 2FN7A 2JRLA 5FA8A 2Q1TA 2XNJA 4HD8A 3BSFA 1KVQA 1IPEA 3EPPA 3SN6A 4OB6A 2BCGY 4UQLA 1XZDA 3AL3A 4BNUA 5C1BA 5HRAA 3E8MA 4UAGA 3IO5A 2VWPA 3UHJA 2YKGA 3AEQB 3VHXA 3NH6A 3DAHA 3HNRA 2ONJA 2EQAA 5JLJA 3LQRA 4PHGA 3UHAA 3VR4D 1E5QA 4Q4AA 2C3YA 2L18A 1YZGA 5F2OA 2JK1A 1RI1A 3RAEC 5FADA 3A28A 1B41A 1BCSB 1OJLA 4FYPA 1B42A 2HQOA 4RMIA 3FGPA 1IRXA 4REOA 1Y6FA 1PUIA 4EGJA 5JRZA 1FLDA 2EJCA 4YAWA 2DR3A 4ER3A 1E2PA 5LP1A 3ZVLA 3MJHA 3B7WA 1QMPA 3E3MA 4DR4B 3SHWA 3VO2A 1G0NA 1HNXB 3PGA1 2P7IA 4D8UA 1G20E 4MYHA 2YMMA 1HTTA 5AI0A 5THXA 3WLSA 4DZTA 2QNRA 1G9TA 3K4PA 1XCGB 4PZUA 5FL3A 1WMFA 5TMDA 4L8VA 1DNPA 2BMJA 1KL7A 2V54A 1NF8A 3DXZA 2VRNA 4MQEA 4UPDA 4B46A 5A4IS 4QICA 1FDWA 3R0ZA 3FZQA 1QG2A 3RVQA 1RLUA 1JLRA 1KJQA 1M0TA 1XD2A 2PS9A 3LRTA 5FIUA 1H4TA 5BN5B 3H2SA 5CB4F 1SUEA 3BE5A 3VVCA 4D0NA 3CM0A 4WBNA 3QKRA 3K4QA 4PC6A 5H83A 4YQFA 1G7CA 1HE8B 1K5GA 2C59A 3CFYA 4IW3B 5G41A 1Z6ZA 1JT9A 3UMVA 1QC5B 2I1VB 7AT1A 5JS7A 5IKXA 2RK4A 3H9CA 3MIIA 3PU6A 4MEAA 3VNAA 5EJEA 3B1KA 4F11A 1G21E 1N0IA 1U65A 3QP9A 1EU1A 4C4TA 3ECAA 5IWCA 4J0KA 5ENDA 5IVHA 2ZUTA 3K9LA 1KKUA 2PE5A 3LCCA 1Q0HA 1II8A 3EFHA 1OJ7A 2EVWX 3GXOA 5L6LB 4Y7DA 3SKYA 3DBOB 3Q0TA 1C9YA 3I4FA 1MEOA 2Y1DA 3B38A 4R3WA 3WE7A 5I7VA 1Z63A 1SR8A 5LC1A 1KMHA 6LDHA 2ADMA 2Y27A 3FOCA 1XZPA 1MGPA 1UCFA 1VMAA 2W2XA 4G9GA 4IP0A 5ETJA 3KDAA 3W4KA 4NY1A 4KWEA 1N0WA 2FMXA 1TYCA 1DIRA 2HSJA 2NXWA 1YXMA 1R0RE 3E23A 3A1EA 3V32A 4KVFA 1A76A 5JH7A 2FW1A 1ZNZA 4CLEA 4CM7A 5EZ5A 3S1LA 3PPXA 1PR3A 1H2XA 4L6AA 4G5XA 1CR4A 3QX3A 2YW9A 5HK9A 4BQFA 4G1MB 4W9NA 5CFQA 4QU8A 4XWYA 1EHIA 2BR5A 3BAFA 3H84A 2BFWA 3A14A 2VZ9A 3LX5A 3PFFA 3QU9A 3SSNA 4TMTA 2BEVB 4BKQA 3OPXA 4M2LA 5IAAA 2XWBF 1R5JA 1K08A 1NVAA 1A1SA 1Z26A 3AY3A 3AHGA 1E5LA 4ILEA 3CLVA 4UMVA 1RAGA 2J9GA 3S2FA 4GKVA 4EO9A 3FYUC 4P81A 5BN4B 1H5NA 1HBJA 3G9ZA 1RWNA 3U7QB 5HWSA 3Q98A 2HA5A 4KZKA 1NATA 4EDHA 3VKHA 1BXKA 1WAMA 2E9SA 2H6EA 3IDFA 1XEXA 1IDOA 2B3DA 4M9QA 3ORYA 2Q3HA 2VOJA 1FJXA 1QG4A 4O1HA 4L7QA 2EBHX 2C3UA 3DM9B 1JHMA 2FN9A 4DNOA 1ITZA 2ONYA 8AT1A 1C0EA 4J1NA 5C1IA 4P92A 4BQIA 4TT3D 5E9WA 3MJCA 4YR7A 3OAAD 3OTQA 2D8MA 3N9IA 1D3AA 3U7JA 1ZOSA 4RTOA 1XRMA 1U1FA 5FWNA 3KHUA 1JSCA 1NVTA 2ZBQA 3GLIB 5EGNA 4KU4A 4XJXA 2L2QA 4O6VA 1PNOA 4JXZA 4CRWB 5CR9A 1XJ0A 2XPCA 3DOFA 3LWBA 5EKDA 4F9EA 3GLSA 1IY9A 1GYPA 4TYQA 4TZ6A 2RGCA 1QGOA 4R2MA 4ZAZA 2O3TA 1GGEA 2W48A 3EXEB 1PL6A 3M4JA 3IT2A 1I9CA 1C7ZA 4YONB 3SSAA 5EEGA 4RPJA 4YDHB 2GN0A 2KI5A 2X0DA 4QKQA 4Q9DA 1XLVA 2WUGA 4YP1A 3TSYA 3THWB 3IP8A 1EXVA 1EZZA 3UENA 1GAXA 4UTPA 3SOPA 4E1BA 3AHEA 1DJQA 3PFKA 1JQAA 4JX9A 4OH1A 2MYNA 5A62A 3AGPA 3B6MA 1QAQA 2G4CA 1BNCA 1ZA1A 3A4LA 4AXXA 1NFQA 2C2GA 2EFJA 2JDIA 3V1UA 2J9FB 2QRMA 1SCNE 2R1UA 4HDMA 2MCFA 3TOVA 3REQB 1QHIA 5JV5A 1R66A 4U00A 3QXHA 1U2PA 4G9EA 4ZMBA 2H8GA 1ONPA 3FAZA 1SKBA 4X9XA 4UXHA 4PYJA 4H3HB 2I80A 5CRIA 5DOVA 3RUCA 2JKYA 2P69A 4PBTA 3WMWA 2B5VA 1RE0A 2E49A 4LDNA 4DCJA 3OO0A 3VZPA 4M89A 4ZAYA 4F6CA 4TZ0A 1T6NA 2MR5A 1C1HA 3DSRA 2V65A 4Y6PA 3V2IA 4AC9A 1WW3A 4Q4JB 5C3MA 3OE4A 1AKTA 1IK6A 2VDPB 1UWVA 1BMTA 4U3JB 1A72A 1RVV1 3B3FA 1U0TA 3FKJA 1RT9A 2AQ8A 5IJXA 1UBSB 2GEJA 2PGNA 5GTDA 2JI4A 4U0JA 2WSYB 4UTOA 2LW7A 5K3EA 2PMWB 3CSUA 5JR3A 4QGBA 2C2ZA 4IUYA 1M83A 2UXCB 1T10A 3FHTA 2G6TA 5L3RA 5IT5A 2ZS7A 2IGBA 3FCAA 5B3KA 1Z2NX 4Y0AA 3AH8A 1DUSA 3FVWA 1NBIA 1YJBA 1C3JA 1F4VA 1T2EA 2H7VA 2P1DA 1BEUB 2Y3IA 3HEBA 3HKBB 3OMLA 5H02A 5TGZA 3ZBUA 4B6OA 1FX1A 1NF3A 2HCRA 4ND1A 5AK4A 3UKOA 2IV7A 1OXBB 4H9GA 2UZAA 4U2CA 3CPEA 2EZTA 3P0FA 1KOLA 3B3QA 3PBKA 2I87A 2OFPA 3PJGA 2H11A 3LQ2A 3NTLA 4Q6BA 3N8IA 1JYFA 3ECCA 4BKMA 5FT9A 5IH3A 2FPPA 5L6MB 4BP8A 2OESA 2VDOB 2HRQA 3I34X 3MCUA 4LOIA 3KO8A 3PXGA 3GJQA 1IBKB 1XF9A 5B37A 4NECA 4RIHA 3MTBA 4G5GA 4BFVA 2GH1A 1CRQA 2QAGB 5LUAA 1MNQA 4EPYA 2P79A 2CNBA 3A11A 3HCFA 5D6NA 3TZQA 5FBLB 4RA6A 3NTVA 4UEKA 4Q1FA 2WG1A 1SXJA 4K9PA 3VU0A 4BKRA 4V03A 1GTVA 4D9EA 4INZA 5IT9A 4CEJA 1AF7A 5JZBA 1A27A 2X4GA 1AZLA 1BXGB 2GN4A 1PT5A 4V39A 5D5HA 3T4XA 4CMKA 2AFVA 2IU4A 4NDAA 3TSWA 3WL3A 1EPUA 2WWXA 2XCUA 3GFTA 3HDTA 3OTHA 5CM9C 3P0EA 2EXXA 2BGTA 2HBYA 2WAMA 4KLCA 3UV7A 3F6EX 3PA6A 4GXQA 3OJEA 1ZJWA 2G40A 4OHXA 4E13A 5M29A 4XWWA 3SAJA 1I5OA 3LT5A 5ICFA 1CHNA 1ZCJA 2DFDA 1AUXA 1QJCA 2C7BA 2HWKA 2OPBA 3DZJA 5D3ZA 3DO8A 4PYQA 3H0EA 3LOPA 4EYQA 1Y9ZA 1FYEA 2O48X 3H6HA 2HBRA 3FFWA 1PGNA 3NBZC 2UUPA 3B5IA 4MVCA 4IIVA 2Q5FA 3V5NA 1RIFA 4BNKA 4D9CA 1L5QA 5LZ4A 2FEOA 3JQCA 3OC6A 5KWEA 4IV5A 3HCEA 3OQMA 1GUAA 3GFQA 4HEHA 4HF7A 1U1DA 4DLWA 3II6X 3IVRA 4ETNA 1E3TA 3C15C 4V0RA 4GKJB 3E8SA 4KQIA 4U5XA 1SKYE 3E6AA 1RZRA 1ZMXA 1FQKA 1IAQA 5D2CA 2NPFA 1GPMA 4LAFA 2NADA 1XG5A 1W1UA 4J91A 3THSA 3P0HA 3BMQA 1U2DA 4DDVA 4CIBA 2Q7XA 5TMEA 1KR5A 4YAEA 1MX5A 1YS6A 3V1LA 3PRKE 3NETA 4BN5A 1L4EA 4FINA 1CLEA 1GG2A 1KQPA 4GR4A 2JI9A 2ANBA 4LE1A 1PG5A 4C29A 4E11A 5BUSA 1JYSA 1FRQA 1QDEA 2XQJA 4CMIA 3DGFC 3ELBA 5EIBC 2A30A 4H4CA 4DEYA 3I58A 1OBFO 3L4BC