3KB2A

Crystal structure of yorr protein in complex with phosphorylated gdp from bacillus subtilis, northeast structural genomics consortium target sr256
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYIEGKDIDSILELYREVMSNAGLHTYSWDTGQWSSDEIAKDIIFLVELEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords SPBc2 prophage-derived uncharacterized protein yorR
publication title Northeast Structural Genomics Consortium Target SR256
rcsb
source organism Bacillus subtilis
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb2A00
1KO8A 3Q7PA 2QAJA 1W46A 2ZYVX 2J0VA 1XPUA 1SXJD 3NH6A 3PXGA 3UXMA 3A37A 4A36A 1XJ0A 2R6CA 1NKTA 2YC2C 4AURA 4MKFA 2EYQA 3QY0A 4TTQA 4A0GA 3GCGA 5FPTA 1E79D 2Q0HA 4YLGA 2XGJA 1OYYA 4C0AC 3LVQE 2BHRA 4V0LA 2P6UA 2P2LA 5FTNA 5GJWC 2P5SA 1SZPA 3PVSA 5EP4A 4IJMA 4B3XA 4DHEA 2MSCB 4LYJA 1G7TA 1E1RD 1W0JD 1IONA 1Z6AA 2NGRA 2O8EB 2QBYA 3OFND 3D8BA 3IDQA 1E9DA 3PUVA 1DG3A 1XJQA 4G5OA 4QNMA 4ZO4A 3FGNA 4B2PA 4KO8A 4B73A 2ZJ2A 4F7WA 2JLRA 2CCJA 2J7KA 4US2R 4TZ0A 2ZRNA 4JBWA 4PFSA 1N6IA 4D82A 3AVOA 2CJWB 1II9A 2BJVA 2IXFA 1OKKA 1S1MA 2B8WA 1D5CA 1II0A 1X86B 1D9ZA 1XBTA 2OLJA 4QBIA 1QHGA 3GLIB 1KK3A 3K0CC 4O2LA 1XMJA 3BD9A 3P26A 3I61A 4IEEA 1DS6A 2WWHA 2JIZD 3T1TA 3CH4B 1FL9A 3EASA 4P33A 5HE8A 3VMFA 4Q4AA 4IHQA 4HAXA 5DI9A 5DIFA 2NZJA 3TE6A 4OK5A 2GCOA 1NLZA 3AF4A 2QM8A 3OEHD 1KI7A 4PPNA 3VQTA 2GVDC 3I72A 4BFVA 2GEVA 3QEJA 1CKEA 2P5TB 1NKSA 4QBHA 4V0ME 2QE7A 2WSSA 4MYUA 4XVQA 2NIPA 4NH0A 2WMOB 3Q5EA 4C3ZA 4PSAA 1Q20A 3FMPB 4WA7A 3KTAB 1P2VA 1XX6A 3NBZC 1WQ1R 2OE2A 2IYXA 2ODNA 2WVJA 5KSYA 1WDTA 3LX8A 4PPGA 4B44A 4WZBE 5SZIA 2O8FA 4HLCA 2IS6A 4B3FX 4XD7D 2FU5C 1G8FA 3E2IA 3RABA 2ZU6A 1SVKA 4KFSA 5B30A 4F91B 1JXMA 1P60A 4MGIR 5FBRB 2F9LA 5JS8A 1G291 2GXAA 4KU4A 2C2HA 4LJ7A 1OB5A 4BLOA 4US0R 2C03A 4MYTA 5JWRA 2FOLA 3T1VA 5J4HA 4V0MA 4D0NA 5DHFA 1ZD1A 2IC5A 3CZQA 2ERYA 3P1JA 3WMFA 1DAGA 3FDIA 1XFAA 2AXNA 4YXWD 3CF0A 3BJIC 3CLVA 4Q00A 1G8PA 1JEDA 3I5XA 1SHKA 3QG1A 1P5ZB 4IOKA 2OHFA 5G3YA 1YZQA 5L3SB 4B3GA 1Z0FA 1J8MF 1GIAA 1XPOA 3KXIA 4BLPA 4FCVA 3DZDA 4HB0A 1Z0KA 4KYIB 3T5GA 3KUCA 1F48A 1QBKC 2G3YA 2WPDD 4DIEA 1E69A 3U3MA 2J7PA 4QGHA 2QP9X 1FQKA 4HYYA 4C0JA 1GL9B 3P27A 4KI0A 4MUAA 1U8AA 1TNDA 2VBCA 5F2EA 4WW0A 2XNSA 2VP6A 1XTIA 2FMXA 1T5IA 5EE1A 4C0HA 3GFOA 2FSHA 2XSZD 3VX4A 4ZKDA 1N6PA 1UKEA 3GLHB 1JQJC 4V0KA 2EFGA 4LSGA 3B1WA 3VHXA 4NCNA 4ERNA 4AY2A 1GNRA 2ZRJA 3GJ6A 4LRWA 5C4MA 1G7CA 5E7MA 1WA5A 1IN6A 1Z6TA 4FWIB 1XTSA 1WRBA 3SDZA 3U5ZB 2J45A 4M9XA 4LUCA 5EXSA 4GZMA 1UAAA 2VTKA 3WP0A 1JXOA 2C96A 5JLJA 4KBGA 3RNLA 1FUKA 2NPIA 5L3QB 3BERA 3ZDQA 5JSZB 4LV8B 5FI1B 4BUJA 3DM5A 5EQTA 2IBMA 4JL6A 4LI0A 5FBVB 3CM0A 1A1VA 4UNQA 4QXAA 2O0KA 2H5EA 1W4AA 3VKGA 2CLSA 5BYKA 2GWHA 2BV3A 2V3CC 3E70C 2G83A 3QPWA 1WP9A 5AJZA 3IBYA 1J8YF 2GEDA 2JDIA 2WOJA 3UG7A 2BBSA 1JR3A 3EA0A 1J70A 5EE5B 4EUNA 2JLQA 3LY5A 1G17A 5J5CA 1W48A 3EZ6A 4NTZA 121PA 1KAOA 4RD6A 2B7BA 3GQBA 1E1QA 3B85A 4Q9LA 1TU4A 5KNDA 2XOKA 3ND8A 3R9WA 3HYTA 4JL8A 2BM0A 4PO8A 1LF5A 1T4GA 3QXSA 3GJ5A 3K9NA 1FQJA 2GTPA 2OFWA 1XTRA 3HPQA 4CEJB 2RGDA 2NPFA 4BFSA 1UEJA 2ZE7A 3VKHA 5FOXA 5KNCA 5B64A 1EX6A 5CIQA 3VNVA 2REBA 2ECKA 2V1UA 5TV2A 1OIWA 1VPLA 1RJ9A 4HZUA 4TLAA 2C8VA 1Z3IX 4R98A 1VTKA 4OQMA 1P4SA 4B71A 3CRQA 1Z0IA 3G5UA 2A5YB 4URYR 4XTRA 1UKVY 2NO6A 4KODA 5SZKB 3DOFA 1OFUX 4BLQA 1AS3A 1N6RA 1S2MA 4B76A 2PH1A 3K70C 2R6GA 1IXZA 3FKSA 2HCJB 2BKEA 5CB6A 1HURA 2B6HA 2OZEA 4ZI2A 4TMKA 4WVFA 2NO0A 2QP3A 4WOPA 2VPPA 3U3OA 2WKQA 1KI6A 3LRPA 1UPTA 1KDTA 2FFBA 2FPKA 1S9HA 2TMKA 4DT1A 1XJCA 1Z0AA 1Z22A 2ATXA 3LLMA 2CE2X 3HU1A 3D31A 2CNWA 4B48A 1ZD8A 4HLUA 3B5JA 4NE2A 2ZJ5A 5DN6A 1GZSA 1NJFA 2GESA 2HXYA 4D6PA 1XXHE 1ZINA 1OKKD 1OF1A 2EQBA 3B1YA 3IQWA 2GCNA 3ICEA 3OE7A 1QHNA 3EWAA 4DC9A 1QF9A 1NG1A 5D3MB 3BH7A 5IDVA 2GJSA 4FMDB 1S9DA 1AGPA 5BN3A 5JRZA 4Q1AA 2XNDD 2FNAA 1KO5A 4FCTA 3BGWA 3GD7A 2ZETA 1YR8A 3PV0A 1LY1A 2E9SA 4ZIRA 2GRJA 1LS1A 2ZRAA 2IWRA 2QBYB 3NEJA 1G8GA 4KLZA 4C0BA 1G3IA 4M1KA 2Q9AA 3BFKA 1E9CA 3GJ8A 1BIFA 2CHQA 3HPRA 2D62A 1IN7A 1IOZA 1J7KA 4FWTA 4PAOA 5AK0A 4DLRA 5CDFA 2QE7D 2WSSD 4QM6A 3MUFA 3AVPA 4JVSB 3OESA 4JLVA 3SS8A 2ZS9A 2OCPA 2FDCA 1MO6A 3L2OB 3LXRA 4DLXA 4X8HA 3HJNA 2MSEB 4NCHA 3NH9A 1YHNA 5JECA 2ZM5A 3BIFA 1SKQA 1TF7A 1KNQA 3Q72A 4TLCA 2YYZA 5D3QA 1KKMA 3FMOB 2A5JA 1BOFA 2F1IA 3U3RA 3K70B 2GXQA 5IF9A 2AWOA 3QJYA 2W00A 1G7SA 4Q4AB 1VDZA 2QMOA 1RZ3A 2GAOA 2QTFA 3FTQA 3QF4B 4QC2A 2RMKA 3M0EA 2VHTA 4M21A 2HJVA 4JLBA 5C1BA 5TVKA 3IGFA 3ZVMA 3TSWA 1RRPA 4MGKR 2Q3MA 2LKDA 1E9EA 1HV8A 1ZM2A 1SHZA 2Y8EA 4HAYA 5LBIA 5JS7A 4PQRA 4TN1A 1E98A 1ZMXA 4XVRA 4A4DA 3OIWA 2PMKA 5BW8A 3ZVRA 1VYTA 1D2EA 1TQ2A 3LWNA 1E94E 1CP2A 3WNBA 2FFHA 5DYIA 1OPXA 2PLFA 1ZNWA 3B1ZA 3ZD6A 4A15A 3U2QA 5CB8A 2O8FB 1X3SA 1QHHA 2QEQA 2J7PD 2I1VB 3EIQA 2GJKA 3RS5A 2QMUA 2LWIA 2G9NA 4KHZA 1FNMA 4Q1BA 5GVSA 2QAGC 1FMJA 1W4CA 2VP0A 2H57A 2ZU0C 3THWB 2RAPA 1I4LD 1SXJE 4RCZA 3CRW1 1DAIA 2YOHA 1LF0A 4LX0A 1GL7A 4MUBA 3X1WA 1IM2A 1F3OA 5FTJA 3GLIE 1T91A 3CO5A 4BLTA 4KXFB 1E9FA 4RFSA 1OFIA 2HJGA 4BZQA 3D7MA 1UF9A 4A6PA 2VA8A 1E9BA 4MQBA 1E2QA 1XNJA 3TAHA 2V6JA 2XTZA 3LVRE 4D4MA 2QN6A 2G6BA 4HAZA 2W2VA 3CPEA 3AM1A 5DGXA 2BCGY 3HP1A 4PZYA 3BFVA 3ICQB 2IW3A 1VIYA 1UBEA 1YZNA 4POAA 2WM9B 3T06B 4F4IA 1DTSA 2D74A 4LDJA 4BRUA 2A9KA 1NI3A 3VX3A 4P0TA 1KO7A 4FIDA 4C0LA 3RYTC 4I4LA 4NCIA 5L8VA 4QBFA 2J59A 3BE4A 2XJ9A 3L0PA 1VCNA 2HF9A 1AIPA 4XOIA 1GKIA 3H1TA 2AFIE 3RANA 3QG5A 2JDID 1DE0A 2H16A 3VR5A 3T1QA 5JI3E 4FMCF 1NL3A 2Q21A 5JWHA 3MCAA 4M1WA 4TQAA 1KYIA 2ZS7A 2ZVQX 2VF8A 1ZCBA 1E1QD 1PVOA 3M4YA 4Q7JB 1D8TA 1CTQA 3O8DA 3JVUA 2ZJBA 2AN9A 2F1JA 4IOLA 1ZUHA 3LDAA 1N5IA 1P9WA 2ZUCA 4RD1A 1JJVA 2JJ2A 2F1RA 4V0NA 5FBWB 1W36C 1N6OA 2QAGB 4TTRA 4LBVA 2OCBA 1U8ZA 2VHQA 4OHYA 3LNCA 2ZPTX 3K0EA 5KDOA 3KTAA 1KDPA 2W6JA 1Z2CA 3SU8A 1ZP6A 2ZRHA 4Z51A 3VR4A 2AK3A 3U6KA 1N0WA 4OQXA 1G64A 2FEMA 2V9PA 3K8YA 1E96A 4AK9A 5FOUA 3U3JA 5CK5A 3KB1A 3CKLA 2QP4A 2Z0MA 4YONB 3U4QA 1UBCA 1SKYB 1DG1G 3KXLA 3MMPA 1HEIA 1Q44A 2QT1A 3FHTA 4KBFA 2A3RA 2FSFA 3BXZA 4GOKA 3FHOA 5AJYA 1G4AE 3LH5A 4IVRA 2DY1A 1AN0A 3FKSD 1YJ5A 2AKAB 2HLDD 4QNRA 4XH9B 4S35A 1KI8A 4A9AA 5C4GB 1W36D 3ADBA 1SGWA 2EWWA 5DO9A 1OFHA 4B34A 2IYLD 3GLGA 3NDPA 3MWJA 2WKPA 4DZZA 2ZXUA 3OZXA 4KAXA 1E0JA 3GLHE 1IHUA 1KO1A 2CNWD 2GZDA 1J90A 1GNPA 3U61B 3IO5A 1NN1A 4JLMA 1KAGA 1T6NA 2BBTA 2VQSA 4ZI3A 4L5BA 3BH6A 3SQXA 1E2DA 2J46A 2OBLA 1DO0A 1MT0A 3RC3A 2GETA 2ZJOA 1P9NA 1N5KA 3FPAA 4LGMA 3ZZUA 4UNPA 4A0RA 1I2DA 4LYHA 3VNUA 3CR7A 1GDDA 2QM7A 4WIAA 4PQYA 4DWJA 2ZYWX 1P3JA 2D7CA 4PC7A 1XMIA 1KY3A 1W7AA 2KSQA 4X8OA 3KFVA 1YZUA 3CF6R 3CRRA 721PA 1W36B 4CGZA 1R5NA 4QGAA 3CWQA 1KNXA 5EZ5A 1OXVA 4EJSB 3IEVA 2F9MA 1EFCA 1KI6B 1NMYA 5FOTA 4DT1B 3GLHA 3AP3A 2J0SA 2C9CA 5B2ZA 3X1DA 4BGDA 2ZRGA 4EDHA 1UDXA 1L7VC 2YNMA 3ZQJA 3AUYA 4Q1CA 3RS7A 3F5FA 3UWOA 4Y0VA 2HT6A 1UJ2A 4M1MA 1W0KA 1NP6A 1YU9A 2G0NA 3QVVA 3RS3A 4O25A 4YMSA 2VIIA 3DEFA 4DEYA 2PLRA 3CRVA 4Q9HA 1QVRA 3KKPA 4ZCIA 3FWYA 2MMGA 5JSZA 1Q0UA 2PX3A 3A1TA 1NLFA 2DYKA 3B60A 4GBMA 3I1FA 3IIJA 3NDBB 1I4DD 4YMVA 1S3GA 5FPSA 1MABB 4TLBA 1CEEA 1KJYA 4TYYA 4ESVA 2AWNA 3AP1A 4IDPA 2HT1A 3LO5A 2FFAA 2QPTA 3W3AA 3KQNA 5BYJA 1F2TA 4A8JA 5JCZA 2GJ9A 5HR5A 4PO1A 3UKDA 4ACAA 1GL6A 1SQ5A 1W2GA 1IJFA 1UM8A 4AG6A 1FOEB 2VH5R 3PR1A 2AFHE 1UEIA 3QKRB 3KKNA 1A82A 1RRCA 4E5UA 1QRAA 2X2FA 1H8EA 4TMZA 4LV6A 5E4FA 2VP2A 4JZKA 4B33A 5JHGB 4JIMA 3RS4A 4CDGA 4DLZA 5JBQA 4BQSA 1Z28A 2BBOA 3TIFA 2Q3HA 1PUIA 3AVWA 5HZKA 4YDHB 5EP2A 4LYAA 3EPKA 4CEJA 4TQ9A 2ZEJA 2JCSA 4P4UA 4U5XA 5K8IA 2A5DA 3KQLA 5FBLB 2IS1A 3A1VA 3EIHA 2IX3A 2H1LA 2QA5A 3KQKA 4P4TA 1PUJA 1XWIA 3L82B 3MWKA 3IEUA 5EXPA 1RW4A 2NTYC 3SYKA 2CVHA 3CZPA 1G1MA 2ZUDA 2JLSA 4IVPA 2ONJA 4M53A 4RCYA 3H0KA 2QENA 1PLJA 4DDWA 1TADA 3EPLA 3C5HA 2R6AA 3QKTA 4GMXA 1TL7C 2VLIA 3LXXA 3T5DA 1HUQA 2CL7X 2WAXA 1E2JA 3AVTA 1VG1A 3MFYA 4QRHA 4P3YA 1A5TA 2LKCA 4HUQA 3W34A 1II8B 2QROA 3TBKA 4HDOB 4Q4HA 2OUKA 2VHJA 1DARA 4D0GA 3T12A 4Z54A 1AS2A 4B3DA 1IY1A 3R20A 2A7QA 2BKUA 4EAQA 4TYWA 1NN5A 1G16A 1KMHA 3SEAA 4BFWA 1QHYA 2XTMA 1WF3A 1WE2A 3AF3A 4XWKA 3B9QA 5D3MA 1FW6A 3D6TB 2P6NA 3BC1A 3C16C 3CNNA 2NO7A 4RFSB 3EPJA 1M7HA 1Q1ZA 1Z29A 1JNYA 2HDNB 1R0WA 2BEKA 3K9HA 1KSGA 1DADA 5H70A 3K0AA 1DEKA 5TARA 1TX4B 4QHTA 2UVQA 4D0LB 4QGFA 1QHIA 4HUTA 1JBKA 1XTJA 4KSBA 1V43A 3B78A 3P20A 5L3RA 4AG5A 5GVRA 4AKGA 3GJ7A 2WHXA 2JJ2D 5FR1A 1KO4A 1TF2A 5FOWA 3W90A 5J4KA 4X8LA 5KYKA 3N5CA 1G41A 1OV4A 1W49A 1AS0A 2GCPA 3TR5A 5JFGA 4ON9A 4URUR 4LJAA 3S1AA 4BFTA 3CPHA 2B21A 3WMEA 5KUTA 2PJZA 1OFTA 2J3EA 1ZM3A 4O2RA 3NG1A 2H92A 2RCNA 1F2UB 2KBFA 2BM1A 3L43A 3WNDA 3ZS9A 5H8WA 1MO4A 4XSHA 3PEYA 2H17A 1FMLA 1E2HA 3ETLA 4TYQA 3AKCA 5FBQB 2X8AA 3QF4A 2DHRA 1ZBDA 5DE3A 1D9XA 3AKEA 2W83A 3N2IA 2QSZA 3VR1A 2N46A 4B35A 1UDWA 4B6FA 5GJBA 2QGNA 1G7RA 3VKWA 4TMWA 221PA 3PEVA 3CX7A 4N0EA 3LQRA 4N3NA 4W9MC 1ZYUA 1IY2A 2W58A 3LLUA 4WZAE 1HQCA 3QVUA 3JVVA 3U44A 1OXXK 2BJWA 4L9WA 4A2QA 2XEXA 2V7QA 4JJZA 1SVOA 1NG9A 4AD8A 1F60A 1N6NA 2MMCA 3QPUA 2FH5B 4IDNA 1JPNA 4UXJA 5LPNA 5DNYB 3PFIA 4EPVA 2C9OA 2FA9A 2ZVPX 5HCNA 4EPWA 2NOAA 2IHBA 3NBXX 2QG6A 3AV0B 3W8RA 4DJTA 3U4QB 4TT3D 4F92B 2OFOA 2XZLA 1ONBA 1VG0B 4JBXA 2ZITA 1CU1A 1IN4A 1KDRA 2WJVA 4OHVA 4GPTA 2IA5A 3THWA 4DBLC 1CJVC 5G40A 3A58B 2IT1A 3A36A 5KHOC 1NNEA 4RY2A 1K5DA 1ZVQA 3GLGB 1Z5ZA 1D2NA 1S0UA 4OQLA 4LHZA 4XTCS 3BORA 2ZUBA 1B23P 3IPYA 4PHHA 4TSFA 2ZRBA 1P2UA 3K09C 1XPRA 4B3BA 5J4LA 4Q9KA 4RD0A 3UANA 1GWNA 4A8JC 4LV5B 3NTUA 1WBBA 3W6PA 4LY6A 4G01B 2HCBA 3WXMA 3ADCA 3MWYW 2CL6X 3MJRA 4PX9A 4WZ6A 1HH4A 4JSTA 3I92A 3NBFA 3AGQA 4IOMA 1UKYA 5AR1A 3BBPA 4MRRA 2CCKA 3B8HA 1ZUIA 3THOA 5FTLA 521PA 2JJ1A 2PJRA 2H7VA 2ZE6A 2ZSEA 4RSGA 4TLEA 2J0UB 2Z5FA 1NVXQ 2PX0A 5L3VA 2ERXA 2EYUA 4TL9A 2VEDA 1NY5A 1XCGB 3G0HA 4MGYR 3I73A 2G1JA 3O8CA 2PZGA 1P9RA 3ZH9B 1MRNA 2IUTA 1E2GA 2ODWA 4Z1MA 2X2EA 1YZTA 1KJWA 1P7CA 4QFMA 2ANCA 1QHSA 3ZQ6A 2NMVA 4TYNA 3WYGA 1JR3E 4LK2A 4BE7B 1KY2A 4C0KA 5CIWA 1SKYE 3PIRA 4CT5A 1JAHA 1H8ED 3H84A 5H1YA 5KO2A 4U02A 1NLYA 1JEEA 3QIAA 4QOSA 1SVMA 4HAUA 3WY9A 4JLNA 3TJZA 1KZ7B 3PEUA 1RPZA 2QAGA 4OI1A 2C77A 1N6LA 1NBMA 3QUSA 2VP9A 2JATA 2HEIA 2ZE8A 2G1KA 1N5LA 2J1LA 4OK6A 1D2MA 4FW9A 3JZMA 1FZQA 4DSNA 1AGRA 1QHXA 2YC4C 3DZ8A 4CEIB 1F2TB 1FNNA 1TQ4A 4A8JB 3EZ7A 1WB9A 1U9IA 2YHSA 1ZIOA 5TDHA 3THXB 2XITA 3TUIC 4Q18A 3F3YA 3AVQA 4TTPA 1LVGA 2HXSA 2ODBA 2QQ0A 1EG7A 1KI2A 4DLUA 1E9SA 1N6HA 3H4MA 4R7ZA 3KDSE 4C2TA 4DUGA 4LHWA 4EFNA 5FPKA 2ZRFA 3CRMA 1ZU5A 3FFBA 3N2EA 4JS0A 5DLQC 5GJCA 3IPXA 3K0FA 3WMGA 2W2XA 2Q6TA 5AUNB 1E2LA 4MKGA 2ZSDA 1AZTA 4G1UC 4BFUA 3U7GA 1NSFA 3KUDA 4H1UA 2ZIAA 1J2JA 5KPJA 2D3WA 1X8LA 1AKYA 1EFUA 5F98A 2MSDB 4B2IA 2L0XA 1FP7A 2OEPA 3I32A 2BMFA 4TL7A 3U7HB 4URZR 4NONA 3X1ZA 1G9XA 3BB4A 2RB4A 3AB3A 4EQ6B 4Q7MB 4L15A 2GJAA 3LQQA 4OQNA 4C9BA 1VCIA 1W4RA 2Q9BA 4PPFA 4XJXA 4NP6A 3B13B 4GSYA 1P61B 2PCJA 4EJSA 4LPKA 4UJ3A 1ZC4A 4Q4JB 4M4SA 4Q66C 4HUQB 4FINA 4Q4HB 1E4VA 1ZIPA 3B7GA 1RKBA 2BMJA 4X8MA 5A0FA 5CDFE 5EXXA 3EAQA 1T0JB 1G18A 1KMHB 3HU3A 5FFMA 4PHGA 4FN5A 2I4IA 1US8B 1H65A 4AIIA 2E1RA 4LPSA 4ASUA 2ORIA 5CYPA 1E2PA 1U0JA 3K70D 3K0SA 2XXAB 1G8HA 3TVTA 3UMSA 1GM5A 4JLJA 1MABA 3RLFA 3U7EB 1NMXA 4CRWB 1WCV1 4Q5IA 3K0AB 3LAWA 1TQ6A 3OEEA 3FHCB 2A5GA 1G8YA 4RD2A 3UIEA 5BN5A 1KDOA 2Z6VA 1AQYA 2PT7A 3O8RA 2O8BB 2IL1A 2FPLA 4QM7A 1SVWA 3AGPA 4U00A 4DKXA 2OLKA 4GT1A 5ELXA 1FX0B 5AWFC 3CX8A 1OYWA 3QKRA 2N1BA 4D81A 4XWOA 2YOFA 3GPLA 1KKLA 3S1AB 3SFZA 1XD2A 2IYUA 2DCUA 2V7QD 3AEZA 5JCPA 1S4QA 4B3CA 2AR7A 4PC6A 4MRVA 4LC1A 4PO9A 2XB4A 2WAYA 4DLWA 3GMTA 5FR2A 821PA 1X1RA 3I8SA 4PC1A 3QOFA 1H8HA 3GFPA 4DDVA 3SNHA 2FN4A 5H68A 4F4CA 2W0SA 3BRWD 4IEIA 2EFCB 3D3QA 4NHOA 1CRQA 2YVUA 4IW3B 1I4TD 4NYJR 3B1VA 1KMQA 3P32A 4CW7A 1UBGA 3DM9B 2DFKB 3HYRA 1JQLB 4TSFD 4ZCLA 4LJ4A 5GADl 3U44B 1WXQA 2R2AA 1NJGA 2KBEA 1YE8A 2PBRA 2GAAA 5FL3A 4HEJA 4QG7A 1EK0A 2QI9C 5JJIA 1A2BA 1NVVR 1OHHA 1G3QA 3OIVA 4EPXA 1BKDR 4EFLA 3R9IA 3E1SA 1W5SA 1RC8A 2GEUA 2QZ4A 3GEHA 4HLQB 1II8A 2EFDB 3MRSA 3E5HA 4GRAA 3MJHA 3V00A 4ZDIA 2FWRA 1EWRA 4HB2A 5IK2A 4URVR 3KQHA 1GTVA 5EXTA 2P65A 4HZIA 2VYFA 2EVWX 4GNKA 4LOAA 3DKPA 1LNZA 3A4LA 4EPTA 3GJ0A 2ZRLA 3O47A 2BMDA 4C30A 2V6IA 2G77B 3WHKA 4KV9A 4AKHA 1U99A 1U9IC 2QT0A 3Q9LA 1JAIA 1T3LA 1CRPA 2P67A 3T35A 4RD4A 1E2IA 3ONWA 3NKVA 4LJYA 2QQEA 2V54A 4LJ6A 3B1XA 3RRZA 2OM2A 3EZFA 1RFLA 1YRBA 5FUVA 3VR2A 4ARZA 1JALA 1VCOA 4M1SA 5CLLA 3QPVA 4LYFA 2QMHA 4MRSA 1VYUA 4TL6A 2WJHA 1LFDB 1IJEA 2KWIA 1L4YA 3LBHA 1NBMD 2AK2A 2JASA 4RKFA 3RS0A 4B6EA 1D6JA 1LS6A 1NSTA 2BDTA 2D4HA 3FVQA 4RVCA 1EFTA 1TUIA 1YQTA 3I62A 3EA5A 4I1VA 2VSXA 4BEBA 4JT2A 1GRRA 2Z4SA 3C8UA 2Z83A 1F2UA 3GFTA 4QHSA 5GJVC 1KK0A 4PXAA 1Z07A 3KJEA 1NVUQ 4QHYA 1XRJA 1JR3D 3SYLA 3AF0A 4GDFA 1XEWY 2EU8A 4V0OA 4TLDA 4H9GA 4DRZA 1ANKA 3TVDA 1TU3A 1A7JA 4A92A 3EPHA 1HT2E 5CJPA 3H86A 2ZI3A 4G5GA 1Z47A 3RWOA 2XOKD 2GA8A 3KB2A 4JKIA 3SJCA 5F3WB 1NN0A 2IF2A 1TUEA 2GF9A 1MOZA 3BB3A 3QBTA 3GLGE 1EWQA 3FB4A 3BOSA 4TMXA 5K8TA 2DWPA 4EJSC 2FF7A 4JSYA 2EW1A 4IKEA 1W44A 2AXPA 3LW8A 3TQCA 1VYVA 4OQFA 4HB4A 4C7OA 1G3MA 1Q1QA 2ZI6A 4JT4A 1XEFA 1E1RA 2VP5A 3OIYA 2GHIA 2AD1A 1R6BX 4P31A 3A4NA 3OF5A 4TMVA 2IUUA 3VU9A 3WYFA 5J47A 4D25A 4I99A 5FOSA 1KIMA 2WWYA 1G6HA 3DO6A 4H1VA 1MH1A 4NYJQ 4Q01A 5FI0B 1PLLA 1HA3A 5DI3A 5CM9C 4I1OA 4D26A 1UFQA 4F93B 2JLUA 4ZPXA 1KSHA 2ZR0A 2RGXA 4XWAA 3PCRB 2WSMA 1NVVQ 2GF0A 3OAAA 2ZJAA 2ZJZA 1S96A 2OG2A 3KJHA 4QJ3A 1SULA 5M04A 3K0FB 4W5WA 4MDFA 3ZVLA 2XX3A 5F9FA 1HY3A 3TQFA 3X1YA 4DCVA 1TF5A 1K6MA 1KSFX 2WZQA 4Q21A 5DN6D 4EIWA 4E03A 2F55A 2O8CA 4WXPA 1FFHA 2IK8A 1IBRA 2JLZA 1TEXA 1EGAA 3R8FA 4URWR 3SHFA 3OE7D 2OILA 1I2MA 2R65A 4A82A 1IAQA 4GP6A 3AH8A 2N42A 1HE1C 2P0EA 4ASUD 5JJLA 3B82A 3W5IA 2GXSA 1TTTA 3P4XA 1E9RA 3L0OA 4HDCA 4LJ9A 3U3KA 2QSYA 4KVAA 1LTQA 2J0UA 4OYHA 3MG9A 5FH9A 1IY0A 4LHYA 3A1WA 3DMDA 4Z8YA 4DEXA 5LD2C 2H8KA 3WP1B 2YJTD 4J0QA 2Z43A 4DDUA 3ADKA 4KFTA 1EFHA 3DPUA 5AJWA 2AHOA 5ANRB 1U8YA 2IWHA 1W1WA 4F4JA 3PITA 3R9XA 1CF4A 2E87A 1G6OA 4PTLA 3A4MA 1XCPA 2WWFA 3HR7A 3NXSA 2F1HA 4Q03A 5EUMA 1KI1A 2F43A 4KSCA 1KK1A 3MGCA 1GAJA 3FMIA 2DWOA 4NL4H 4IVQA 1ZNXA 2EFHB 1CXZA 5F9HA 3BWDD 4AKEA 2FX3A 3REFA 4DCNA 4RKEA 4Q9JA 4Q7LA 1ZM4A 1Z0JA 1KI9A 1E0KA 2WBLC 4MITA 4M1OA 3W5JA 1MRSA 2PEZA 621PA 2IYZA 1ODFA 4IXMA 1H8HD 4NDZA 2B92A 1SVIA 2F3RA 1B0UA 3TW8B 2DR3A 3HDTA 2PEYA 1W5TA 3CH5A 5KNBA 1FUUA 4FD2A 1C9KA 3K09A 4CEIA 2VSFA 2D7DA 3C15C 4LJ8A 2IF0A 1CR1A 4GOXA 4JMPA 3TSOA 4DCUA 4TMTA 3THXA 2OXCA 4G5RA 3GLFB 2OV2A 4MGZR 1ZM9A 1OW3B 4DCSA 4A0FA 2B7CA 2DFTA 3UMRA 3VAAA 2WWGA 3SBEA 5BN4A 4DSUA 2ZR9A 4LHXA 1XD2B 2WMNB 2ZSFA 4KVGA 3K1JA 1GKYA 3T61A 1OHHD 2ZI5A 4N1AA 4BPBA 1Z83A 3Q85A 4PHFA 5TMPA 2OO7A 3QXHA 3SE0A 5FL7A 2BEJA 2I1QA 3GEIA 1NIPA 2P3SA 2QORA 3CBQA 4MDEA 2FE4A 4NCJA 4OI2A 1F5NA 5LD2B 3GJXC 4UNRA 4E09A 3KFXA 2B8TA 3SZRA 4F38A 3B2EA 1U2RA 1Z6XA 1XEXB 1YRAA 4PZLA 4PC2A 1Q1EA 3ADDA 2W6IA 4HI0E 2WIAA 2PT5A 2RHMA 3QEOA 4KCGA 1MO3A 4EQ6A 4M1YA 1GILA 3T1OA 1Q22A 2C9YA 3KX2A 3BH0A 5KSPA 5EE9A 1ZNYA 2R6DA 2WICA 4FMBB 3TH5A 1ZD9A 1AA9A 4EKDA 2CVFA 4AYXA 4Q4JA 3X1XA 4C0SA 1NF3A 1C1YA 2ASEA 3CONA 3PUYA 4M1TA 5FOVA 4C0QC 4JL5A 5IRCD 2PMDA 2YWGA 2HYIC 1E0AA 3EG5A 2X19A 2J87A 4KITB 3FFAA 3ZD7A 1XU4A 2NG1A 4JYBA 3SHWA 1QG2A 4KJZA 1DVRA 1US8A 3IUYA 5B58C 1ELOA 1E2MA 1VG8A 1T5LA 3A8TA 4PQFA 3NEYA 1GRNA 5SZHB 1PV4A 1S3SA 2ZTSA 2ORVA 1IXSB 2V1XA 1E4YA 4RD3A 2XXAA 5LDDC 2RH5A 3L8YA 2YWEA 3LX5A 4DSTA 1ETUA 1CIPA 1MKYA 2IYQA 1N3BA 2PZEA 4NYIR 4OHWA 4QL3A 3DHWC 4IDQA 5EE3A 2O8BA 4DSOA 3RAPR 5CJ2A 3WHLA 4ARZB 2A2ZA 2I3BA 5JEDA 2X1VA 4EPYA 1FX0A 1U0LA 1SVLA 1Z6GA 2FSGA 5KSOA 4MRPA 4FXPA 2C78A 2REXB 2W6JD 3A1UA 4M2LA 2NQ2C 1MR3F 3C41J 4I81A 5FUWA 1DBSA 1LB1B 3K9GA 5JJKA 2QNRA 2GVZC 2IUSA 2R44A 1GITA 5KDLA 3WRYC 1G20E 1BYUA 1NN3A 2FG5A 4FCWA 4YQFA 3QXCA 2BIFA 1M34E 3B9PA 2F7SA 5DHAA 3QNUA 5AUQA 2QU8A 3TUJC 4A2PA 2XTNA 1ZJ6A 4CEHA 2UZ3A 2ZSBA 1VHTA 1PLKA 2BCJQ 5JWOA 4K46A 1SXJB 3C5CA 4C4PA 4DXAA 4G5QA 2F3TA 3G82C 3ZJYA 4JLAA 3OAAD 1CR2A 1U81A 1A2KC 2AL7A 4LBWA 1L8QA 3IO3A 4B74A 4HATA 5HTKA 2WWXA 3PG5A 1N0VC 1M8PA 2BVNA 2XNDA 4C7OB 4MKHA 2V8OA 2CHGA 4R2IA 2JGNA 4LC0A 5B57C 1PJRA 2VO1A 3HR8A 3VU9B 3LFUA 1OLOA 1G5TA 5DH9A 4N0DA 4CF7A 3RRNA 1OE0A 4PSKA 2GBLA 2C99A 3NWJA 3MAAC 5KPDA 2RGCA 2OBMA 3LA6A 2CBZA 3DVLA 2FEOA 2FGJA 1E2FA 2Q3FA 5DI3B 2QTVB 1KSJA 1Z2AA 1WMSA 2CLDX 1O3YA 1KI4A 3QE0A 4GP7A 3LBNA 4M22A 1Q3TA 3PEWA 1COWA 2G88A 3EX7C 3MSXA 3WYAA 1DAFA 1QVAA 2ZRKA 3IBGA 3SBDA 3PUXA 3VR6A 5BXQC 2AX4A 2VSOA 3H2YA 1JECA 1VG9B 2QL6A 1O87A 5JRJA 3IHWA 2WTUA 2IYVA 5AUPB 2P6RA 1N25A 4Q7KA 2O8CB 4FMCB 3WRXC 4URXR 2CL0X 4BWYA 3B6EA 4ILEA 1W0KD 3IKJA 3R8CA 2CMKA 4BASA 2D2EA 1RRFA 2V55B 4ACBA 2O8DA 5KTYA 1IQPA 2ONKA 2W2TA 4US1R 4E07A 2JJ8A 1HTWA 2H18A 1EXMA 3HU2A 3KZ1E 3RWMB 1IN5A 3GP8A 2WWWA 2JAQA 4HLDA 2ZI9A 1UKZA 4OK3A 4JVMA 2R62A 2VHCA 4R2HA 2ANBA 1NBME 1ZRHA 3Q3JB 3EZ9A 1E0SA 1R4AA 4NYIQ 1U98A 3K53A 4OJQA 4QKQA 1P6XA 1RRGA 2A5FA 4ZV4A 2J41A 1VMAA 3A1SA 1CJUC 3NHAA 2NZ8A 4AI6A 5FUYA 4Q19A 1ZU4A 3T34A 4BFYA 5AJVB 1GNQA 1T8UA 3I4LA 2UZIR 1XB2A 2ZRPA 2F43B 4KLNA 3ZYCA 4NBSA 2YWHA 1W47A 3ZS8A 4CVNA 1Z06A 1JI0A 1OJLA 1N5JA 2IEZA 3V4FA 5BQ5A 3KKOA 3ZIAA 2DFNA 3W6NA 1FTNA 4P4SB 2YOGA 3SYNA 5FL7D 3BS4A 3KXKA 3IIMA 4KFUA 3U6BA 1U94A 8OHMA 1HQYE 1OIVA 4UNNA 2RKOA 3U60B 1E3MA 3DL0A 1UADA 4QJ5A 5K8UA 4DCTA 1XF9A 3MWLA 4R9UC 1MV5A 3AVYA 2QRZA 1ZW6A 2W6ID 2UKDA 3EW9A 4JBYA 1R5OA 5EP1A 4OBEA 1HYQA 1ZM7A 2VHUA 5CM8B 3SR0A 1XTKA 3IHLA 1IN8A 2C5LA 2R8RA 3KQUA 1BYIA 4B43A 1YR9A 3DDCA 1VKJA 4M9ZA 1G3UA 3ND9A 4Q48A 4JLKA 4RZ2A 5IT5A 4OKSA 4K81B 4AKIA 2RGEA 4RJLA 3C4JA 1ZNZA 4M0LA 1Z0DA 1G5RA 1VCMA 4JLOA 4RZ3A 4W5HA 1C4OA 1F6BA 4MA4A 1N2CE 2J9RA 4OI0A 1TMKA 4YMUA 4JLDA 3EARA 5HPYB 4D4LA 3A6PC 2IYTA 5G41A 1E2KA 3AF1A 5C46F 3TKLA 5AUOB 2ZQ5A 3VR3A 4IDOA 1OH6A 1BMFA 1CBUA 3UG6A 1EX7A 2CK3A 4XVUA 2ZRDA 3SJZA 4B47A 2XJ4A 2IYWA 1S1CA 2RHDA 4LBZA 4PPQA 1RIFA 2IHYA 2FV8A 2HV8A 2DFLA 2XZOA 2FZLA 4MH0R 3RS2A 4DLYA 4PANA 2VRWA 2CE7A 1T8TA 3QSYA 5HKKA 4ABYA 1N6KA 5E7IA 2YKGA 4UNSA 3GLFE 1EFRA 3NC1C 2QMEA 2FPMA 1K8RA 1P2TA 2WKRA 4Q1FA 1MO5A 2GDJA 5CITA 3O8BA 1E9AA 2HLDA 1OH5A 2F6RA 421PA 3FOZA 5FTMA 4PAQA 1JR6A 4Q02A 4Z8XA 5J40A 2O0JA 3ZVNA 2CEAA 4IXNA 4BZPA 3UPUA 4NMMA 3THYA 2WIBA 1CJKC 1LW7A 3I5YA 1CULC 2GBLC 1RE0A 3AKDA 1T3HA 3LW7A 1G19A 1GFIA 5DYGA 2RGAA 3TLXA 2BOVA 4JYCA 4V02A 4G0NA 1DAMA 4L9SA 1NRJB 2JLYA 3W3ZB 2GILA 4OI4A 5JHHB 2EWVA 4LCBA 3UK6A 5E3HA 1KOFA 2IS4A 2QGZA 4L8GA 1E99A 3SJAA 1RYHA 1K5GA 1X8KA 4II7A 4Y0AA 2EFEB 3ASYA 3GLFA 1ZC3A 1GSIA 1KHTA 3VTKA 4IRUB 1Q57A 4Q4LA 4M9QA 1FPMA 5TY0A 2FFQA 3RDPA 3PQCA 3CUEF 1R0YA 2IYSA 2CLCX 5CYOA 4RFVA 2X77A 4NYMR 1HE8B 2ZYUX 2CDNA 1GP2A 1JJ7A 2DBYA 3RRYA 1YVDA 4ZDJA 3RRMA 3IIKA 3CB4A 1CS4C 1L4UA 2YINC 2HUPA 1V5WA 2RGGA 4CEHB 1XXHA 1Z08A 2OAP1 1QZXA 1BS1A 3W9YA 1Z8FA 3ZZTA 4B75A 4BZXA 5EJEA 1XD9A 3W6OA 1XEXA 2ZAMA 2D2FA 1COWD 5HE9A 1A4RA 4UQOA 4MRNA 1NIJA 4NPHA 4NZYA 4OJKA 4RZUA 3M6AA 2WWIA 4UXIA 3LV8A 3LBIA 2QRNA 4WAUA 3EWSA 4BLRA 5G3ZA 4IDHA 3GEEA 5E95A 4E22A 3TW4A 1HT1E 3C7KA 4LWZA 3ZLJA 4YMWA 2PCLA 3MLEA 3QKSA 2GCOB 4M8NE 4HAWA 2YWFA 4TWZA 1M1YE 2KE5A 2ZREA 2VL7A 3ASZA 3EIEA 5J4YA 3CF2A 5HZHA 1KGDA 2ZR7A 3RVBA 3TGPA 3IQXA 2LCFA 1YZKA 4DDTA 2Q9CA 1Q1BA 1JB1A 3AQ4A 2IS2A 4WXRA 3TMKA 2JJ1D 3F8TA 3QKUA 5UKDA 1KI3A 1R8QA 5AJXA 4V03A 3WNCA 2V4ZA 3UWKA 2G0TA 1XDBA 1CR0A 1NVWQ 4EPRA 4BFXA 2XAUA 2ZROA 3R7WA 1R7RA 3L0IB 1LV7A 5FPYA 4BECA 3CPJB 3TUZC 1XMSA 4A1FA 4Z1MD 1VECA 1DAHA 4CIDA 3NIBA 5HCIA 3CNOA 2C95A 1XZPA 2OAQ1 4PC3A 2KJQA 4DLSA 4Q9IA 1DAEA 4OL0A 2J0QA 3M1IA 1L2TA 3CX6A 3RSLA 4QJ4A 4A6XA 3CIOA 4BLSA 1J99A 1XMVA 1YR7A 4PZZA 1N0UA 5CK4A 2WJGA 1OB2A 3QXJA 4BRWA 3ZIAD 1XEWX 2DPXA 4ZCMA 1OXTA 2O8DB 1Y63A 1TQDA 1M6NA 3L0SA 3AKYA 3CNLA 4L16A 3TSZA 2C98A 4IFBA 1AKEA 1P73A 1R10A 2WJJA 1GVNB 4AYTA 3AP2A 2GXUA 4O3MA 4D4JA 1NY6A 2QPAA 1TAGA 1W4BA 1WBDA 2K5UA 4G5SA 3FYHA 3N70A 4CT4B 3SQWA 4M9SA 2O8EA 2JLVA 5KU1A 3CW2A 4C2UA 2BWJA 3REGA 5EUQB 2ATVA 3CR8A 4CYMA 5J4VA 1DOAA 2QUZA 4LHVA 3QF7A 5EZ6B 4RZXA 3IILA 5JMTA 2AD5A 1KZGB 3P4YA 2DWQA 2RGNA 4ZDKA 1M2OB 1VIAA 4B32A 4S2EA 2GNOA 1JPJA 3VFDA 1U90A 4NKRA 1P75A 4R71A 4B2LA 2SHKA 3WBKA 2CJWA 4QGGA 4DUGD 1SXJA 4TZ6A 1KJZA 2R9VA 4JKYA 1X1SA 4NYMQ 1RYFA 1GG2A 1IXRC 3PUWA 3BK7A 3GLIA 5E7JA 2O5VA 1E79A 1FTSA 3PENA 1G5PA 2YV5A 1E6CA 3RHFA 3SJBA 4HDQB 1X6VA 3PUZA 5A4JA 4O0MA 1ZCAA 2HYDA 4W7SA 2O52A 1Q3HA 1W0JA 2ORWA 3EZ2A 2WJIA 4D80A 3OFNA 1FP6A 3SOPA 2ZE5A 3QQ5A 1SVSA 4MKIA 4KFRA 1P62B 3NC0C 5SZJA 2ZJ8A 4KYUA 5CLQA 1R5BA 3SI7A 5KDDA 3QENA 2XZPA 1P72A 1TPZA 1ESMA 3Q5DA 4GL2A 2OSBA 3I8XA 2ZI4A 4HSEA 2DB3A 3KJGA 3F0TA 3OHMA 1TEVA 1BH2A 2BC9A 4G3XA 4K8OA 1BMFD 2ZYTX 3ZZ0A 1Z63A 2JLWA 2A30A 4GZLA 2CK3D 2VP4A 4GMDA 4PAMA 5EP3A 5FTKA 2ZAOA 1AK2A 5C2JB 4AC9A 1NMZA 4HLUC 1KTVA 4I1UA 1AZSC 2ZI7A 3BFXA 5G53C 2QPOA 5P21A 4DLTA 3AVUA 1R0XA 4TQUS 1YZLA 2FGKA 2VF7A 2HF8A 4L4UA 2JIZA 1E2NA 5HKKD 4ESHA 4GI7A 3UMFA 3X2SA 1EFRD 4A2WA 1AQUA 3AUXA 3OEHA 2OT3B 4P32A 2IXEA 3ECCA 2WV9A 1OH7A 2BBWA 3GJ4A 1ZAKA 4YMTA 1ESNA 2IYYA 5TB5A 2KI5A 3QI2A 5DSZA 1T0HB 2R6FA 5LB4A 3RC8A 2D06A 2C04A 4PSVA 3AVVA 1QDEA 4D4KA 1E32A 4IFEA 4QBGB 4UXHA 2XB2A 5C18A 4DB2A 3Q8XB 1G4UR 1Q21A 3OEED 5L3SA 1G3RA 3K0CA 2RGBA 4YC7A 5FPHA 5TXGA 1RJ9B 4HZUB 3UATA 1DPFA 3QXXA 4XD7A 1OIXA 4EFMA 2GZAA 1OXUA 1ZUNB 4MYCA 3SN6A 4TT3A 2NO1A 2QTHA 2GZHA 5KSZA 2PZFA 4DVGA 3KJIA 4DB4A 3TNFA 1VHLA 3BB1A 2JA1A 1BO6A 2FZ4A 2NO9A 2ZANA 4HB3A 3SFVA 1AM4D 5DISB 1AJEA 2KB0A 3TK1A 4Q47A 4IOJA 3T15A 4DLVA 1M7GA 1GKUB 1XCMA 2IEYA 2Z4RA 4P4SA 3HWSA 3U7FB 2ZJYA 3VHLB 4YXWA 2OCYC 4LZZA 3DKVA 4XIGS 2O0HA 3THYB 1QG4A 4MYHA 1T9HA 1Q12A 2PL3A 3GJ3A 4GOJA 1DELA 2ZRCA 1Y3AA 4XSGA 3EC2A 2GKSA 1DAKA 4GFDA 1YR6A 2ZRIA 3NBYC 3FMFA 1GUAA 1CR4A 3PJRA 4WBSA 2YZ2A 1XP8A 2WPDA 2IYRA 3K9LA 2BMEA 2OCAA 3W8NA 2OXRA 5L3QA 1DO2A 3MD0A 4JVLA 3KKMA 2ZRMA 2JLXA 4ZIRB 3FE2A 1R8SA 1UBFA 3AF2A 2FSIA 1OT3A 2WOOA 3C14C 3I3SR 1YKSA 2OESA 1S8FA 2XSZA 3LD9A 4LJ5A 5JI2E 1GOTA 4D2IA 2OBNA 3NHBA 5KOYA 1U0HC 1XTQA 4CZ2A 3J81k 2WJYA 5IK2D 1XXHB 2A78A 2OFXA 4Q1EA 4W5JA 3TAUA 4AYWA 5IHPA 1XZQA 2CHVA 4PR0A 4BEJA 4AWXA 2CCGA 3TR0A 2GK6A 3KKQA 1CLUA 4FMDF 3DOEA 3JZAA 3L8ZA 1E2EA 5JZVA 5EE0A 1T3SA 2FJUA 1OXSC 4NU0A 3CWZA 3KL4A 3QBVA 4YDSA 4BFZA 3EC1A 1EESA 4TL8A 3V4RA 2CXXA 4I1SA 5JEEA 2RGNC 3BAFA 2J5XA 4NCKA 1X8JA 5K8LA 3QKSB 3FKQA 4TYPA 1P2SA 1M7BA 5LB2A 2QY9A 2ODEA 3OIUA 6Q21A 4U7DA 4OHZA 5A5GA 1SXJC 1OH8A 1Z6YA 3V9PA 1M74A 4JLPA 1OSNA 3Q7QA 4ITRC 1CJTC 4LBYA 1PZNA 4DIDA 4A0HA 4UKDA 2ZSAA 2ZS8A 4UJ5A 3AVXA 2AKYA 4JVNA 4Q1DA 1KK2A 1R2QA 1R0ZA 3R7WB 4ZKEA 1YZGA 4FI3C 3WBJA 1CJMA 5FUXA 1G21E 2GK7A 2IXGA 4HAVA 4OHXA 4JJKA 3NVAA 4ZDWA 3EXAA 3RSOA 3SC3A 1GRQA 5BWMA 2W0MA 1QHHB 2REOA 3ZGXA 4PHTA 1W2HA 1RVDA 2JEOA 2GJ8A 3DMNA 3TRFA 1XD8A
chains in the Genus database with same CATH superfamily
1R6DA 2WABA 3CURA 5IMBA 2C2GA 3UXMA 4TV9B 3PXGA 4CHTA 3H2KA 4RTRA 4LKOA 5JQGB 2X0RA 2CXHA 4B4KA 3DHYA 3OOYA 5BRAA 1R9JA 2A0WA 4ENUA 5AVSA 5EA2A 4I4TA 5T4EA 1TU0A 4MW7A 2Q0HA 4X6XA 2V7BA 4YLGA 2XGJA 3PQEA 1YB5A 1OYYA 1NI5A 4GX5A 3N59A 1E3SA 1C1XA 1SZPA 1T5DX 3B9BA 5EP4A 4RTNA 3ENKA 5SY9A 5J63A 4DIBA 2SICE 4YAWA 4CQMA 1G7TA 1W0JD 2IE0A 2NGRA 2I87A 1NLMA 1T3TA 5JE8A 5K8JB 3OFND 3D8BA 3DAYA 1QIMA 1J07A 3P7MA 2H0RA 2POQX 3W9UA 2IIVA 4GGOA 4IJVA 1W87A 2PAFA 2WFMA 3H5TA 4FFOA 3FUVA 1TCAA 3TEJA 4RZQA 4F7WA 1V7PC 1TIBA 4L0CA 1YJAA 5B3LA 2WSIA 3G6WA 4FHGA 2O2CA 4D82A 3BXOA 1II9A 1J6UA 1ND5A 5JXIA 1OKKA 4OFBA 3L7BA 3WGGA 3FOEC 1D5CA 3TLEA 3ZGLA 3NM5A 2DBRA 1XBTA 4QT4A 4MA0A 2WTMA 1Y8RA 2BLNA 1DDOA 1G5IA 4O2LA 1XYVA 3DO8A 3IE1A 2I3GA 4Y6OA 3FFXA 4QDZA 5T4BA 5BNFA 5KYYA 1C7EA 1Y3FE 3EASA 4L07A 2OFFA 4Z7QB 3T1TA 4Q4AA 4BKPA 3G88A 1C50A 3C1TA 3G85A 1JDBB 3RFCA 5DI9A 3KXDA 5D1NA 3U9LA 4YAFA 1VE1A 4QUEA 1NBIA 4CQLB 4NZNA 2G1UA 5HIKA 3WLNA 4L8WB 1GUFA 1KI7A 2Y0CA 3G2NA 4KQJA 3GZJA 4JNKA 4OHOA 4BFVA 2DC1A 4AF6A 2P5TB 2W2NA 2GI4A 2GPJA 5C34B 4QBHA 1EJ2A 1JDNA 1XMPA 2C0QA 2J3KA 4J1TC 1Z2NX 5G4KA 2W70A 2NIPA 3B48A 2G06A 3SHVA 4W5QA 1YQUA 4FHCA 2WMOB 4O63O 5KTMA 2Z6QA 4M0KA 1P4RA 1QLWA 2VXOA 3A6FA 4WA7A 5AVWA 1P2VA 3NBZC 2PUCA 3S81A 3M49A 4AKTA 1CR6A 1FUEA 2WVJA 2YNMC 4UUBA 1IH8A 1PNOA 4LOJA 1GZVA 3AV3A 4MROA 4PPGA 4Q4DA 2F3SA 4BQEA 4HLCA 2ZULA 4JP5A 2B20A 1O94D 4LE0A 1G8FA 4X60A 3HBAA 4YREA 4DADA 3NFRA 4N9WA 1HE4A 2ZU6A 1EBUA 2VQDA 2C4UA 2ZJ1A 3D2BA 3JV7A 4KFSA 1P60A 4WL0A 1IHYA 3SZUA 3UWMA 1LFAA 1GADO 3A0UA 4LJSA 1J42A 3DOCA 1Q2XA 2GXAA 2FW8A 3JQ8B 4NAHA 3KIPA 8LDHA 2X5OA 3U7QB 4US0R 4I46A 2C2KA 4MX8A 2HRRA 5KAMA 4EL0A 2X5KO 5JWRA 3KQMA 1UM9A 2XTJA 5CLHA 3ILYA 2OKCA 4TTJA 3KYBA 4RLSA 1MIHA 3A70A 2O57A 4CL0A 4YXWD 4MWBA 2HBYA 3BJIC 1E58A 4MEJA 4NECA 2BYTA 1MQ8B 4IKPA 1GEGA 5LMZA 5JCPA 1G8PA 4GWLA 1P74A 1YS9A 3I5XA 1YQ9A 1DGQA 5K6AC 4F9EA 2PKYX 1G55A 5AD1A 2V97A 2UVPB 2WJPA 3RS9A 1JIXA 2UUPA 1HO3A 1R6VA 5L3SB 3TW0A 3VU8A 1J8MF 3BSFA 1UUFA 2C1EA 4F84A 1X2EA 2J5KA 3DZDA 3GWZA 4JEHA 4L2IB 5KTKA 3KUCA 4KDCA 1F48A 1XAHA 3P2OA 4O1MA 2DECA 4GDMA 1U7PA 1E69A 1WXWA 3AIIA 1BVUA 1M2OA 2C9MA 2QP9X 3KZOA 4HYYA 3DEHA 4HQ6A 1U9ZA 1V48A 4KR2A 3RPEA 3RUAA 3P27A 4K1XA 4J6FA 1U8AA 2ZKIA 1CZLA 1V6AA 5JISA 1GQFA 5BSRA 2FR1A 2ZIVB 1LWNA 2DXIA 1H2RS 1Y33E 2Q41A 3EXHA 1S8NA 1U8EA 3ASUA 2XA9A 1A76A 1G9TA 2V0CA 2BFWA 3GFOA 2XSZD 3NANA 1N6PA 5BW6B 1YCFA 2GGSA 4W8HA 1JQJC 2EFGA 2UYGA 3UUGA 3E8XA 4G6ZA 2ZRJA 3KQVA 4LRWA 3Q88A 1PNVA 2YH2A 5AKLA 4CKCA 4WI1A 3EQ8A 3AHHA 3UCEA 2OGWA 3KYCA 1IN6A 1Z6TA 2GAIA 3HCWA 1WRBA 1QIHA 1OXMA 3U09A 2CVOA 1VPEA 3U5ZB 4M9XA 2ZIGA 1MXHA 4LUCA 5EXSA 1NF9A 3PI7A 3T4XA 3VC2A 3WP0A 4RTLA 5HZMA 4OIMA 4CTOA 2PUBA 1NVKA 1YQGA 2NPIA 5L3QB 2JKVA 1JLSA 2X9NA 3MT0A 4LV8B 3DM5A 1SHTX 1JEOA 5D6NA 5FBVB 2I8LA 3CM0A 3GUVA 2NP7A 1Z74A 4FGZA 4WRRA 2H5EA 1W4AA 2PDAA 4F5ZA 2CLSA 5F7JA 4WN3A 5D87A 5D2CA 4EHFA 2G83A 1FFGA 3QPWA 1USKA 3PGXA 4MVJF 5CURA 3RFUA 3HI6A 4GX2A 5ILOA 4OX9B 4MRMB 1E3WB 3COVA 4JU8A 1DWQA 2WOJA 3DL7A 4N0PA 3UG7A 3AETA 1VSUA 3H3XA 1J70A 1U8UA 3GT0A 3DFIA 4B17A 1FLAA 3WLKX 2YYAA 4MQEA 1WWKA 1PYGA 4FKBA 121PA 4UHHA 5I7SA 5FV4A 1F4PA 1KYYA 4MCAA 3TRKA 2XMRA 4Q3EA 2JF0A 2UZ4A 3PIDA 3GVIA 1YC2A 4MVJI 3RBZA 5KNDA 4EA9A 1W96A 2ZM6B 5IAJA 3D59A 3R9WA 2PA3A 4ZU6X 3QLVC 4GM0A 3QXSA 4BFLA 3GJ5A 3K9NA 4IICA 2DQSA 4MQ6A 4X85A 1AQLA 1EXWA 2GTPA 4IHJA 4XM2A 3WJ1A 5BR4A 2BFEA 4CEJB 2RGDA 1OI2A 1FF9A 1MRZA 4Z4QA 2IOYA 3FPSA 1EK5A 1XJ5A 1EX6A 4YRGA 5LQRA 3VNVA 1B76A 2REBA 1YRHA 4HDKB 3CEPB 2V1UA 1OIWA 4DRYA 5ITWA 1WNFA 3DPIA 3STTA 5LQAA 3MGBA 3INNA 4R98A 3ROTA 3FUTA 1KZ9A 4M0CA 5E4TA 1P4SA 2IBTA 1ZLYA 3M6WA 5ERGB 5THQA 1Z0IA 3CN7A 2E4VA 1OWPA 4A16A 2DR2A 4RELA 3BGSA 4REQB 3W1WA 3WBBA 5SZKB 1G8AA 4CBVA 4WSOA 2LUOA 3MWEB 3MCTA 3V2GA 4C08A 4D0SA 1ZX1A 1RI1A 4Y98A 2ZAIA 4RWZA 5BVHA 2HCJB 1RAAA 4L0QA 1ZBQA 1G8JA 4RESA 3T3GA 5IG2A 1M1UA 2HIGA 4TMKA 3T7EA 1EP1B 5ESDA 2CEKA 4WOPA 4MCHA 1RYYA 1ULHA 1MAHA 3EIOA 1UPTA 2FPKA 2PLNA 1S9HA 2WJZB 1DI0A 3GCWA 1I5EA 2I7TA 4N7MA 1YFLA 2LIPA 1NVFA 3HB5X 3IMGA 4KN8A 4BP8A 1TLLA 1PW7A 3D31A 5L4NA 4YCLA 1UT8A 4B48A 3Q8LA 3GPCA 4WPGA 2VJYA 1NJFA 5TE9A 3F46A 2CJYA 1ZINA 2RE8A 4MB6A 4AQDA 2FMIA 1UP6A 2VH2A 3IQWA 1N9GB 2I9PA 1R00A 3P9SA 4AXBA 2ZFUA 3PP8A 3W7VA 5GZ6A 3OI7A 2Q2WA 2FPOA 4HQKA 5IDVA 4DMGA 4CIVA 2GJSA 2WF5A 1S9DA 3VJKA 1FTQA 1JBEA 1P1IA 2GF2A 3E5MA 3HJCA 4FCTA 2BGWA 5K9ZA 1T1SA 1GPKA 2WD7B 3QXGA 1K6IA 3LO8A 3M6MD 4LZPA 3V2UA 1SKAA 3TMYA 3VSBA 4JI7B 2HBRA 5K3FB 5K6TA 2C8LA 2VYNA 3DMGA 3U56A 4KLZA 3NOQA 1G3IA 4M1KA 4C0BA 3BFKA 3P2JA 1E9CA 1GV0A 1RXYA 3GJ8A 2GYYA 1RRKA 2OV8A 4HY3A 4PG7A 4LY0A 4AP9A 4IIDA 1ADGA 3NOOA 4DLRA 3MMZA 5CDFA 1RXSA 3MUFA 3D3WB 1B15A 1OX6A 1FRNA 2O2EA 3HGMA 5JYEA 3T1YB 5F4BA 3ZTTA 2ZCVA 3I2IA 1AHNA 2QW0X 3MQ2A 1L3IA 5JDIA 2CUNA 3NH9A 3Q6MA 3D8RA 3HLTA 1SKQA 3JALB 3Q72A 4GPEA 3VR6D 4TLCA 4EW1A 1XXLA 2BDUA 3LHDA 4NBUA 4FGUA 4FLFA 2AG5A 3VHQA 4BZWA 5ICGA 2BUAA 4BMDA 5BW4A 2A5JA 3CUTA 4JJ8A 4EG1A 3MS2A 3WO0A 1X7WB 3BRQA 3V4OA 1FDIA 1MG0A 3Q0EA 4C7VA 1RZ3A 4Y2RA 5BUZA 3RU9A 1Q91A 4QC2A 5JJ5A 5J59A 5LNK1 4WXMA 3M0EA 3NQ41 2GZRA 2VHTA 1XNRB 1NQOA 3CLUC 3IGFA 1HG1A 1GD1O 3KAKA 3NX4A 4RCVA 4CIAA 2NUAA 2VWQA 2XNKA 4JWTA 3TSWA 4D6YA 4O4HA 4Q12A 3F8WA 1HV8A 1ZM2A 2G4VA 1SHZA 2Y8EA 2DRIA 3EW7A 4ZC1A 5TPWA 1BS9A 3EY4A 3U3XA 5JS7A 6ABPA 1E98A 1PSDA 3V4SA 4W9RA 4A4DA 3M9XA 4PLYA 2XMQA 4BQQA 1VGVA 1XC7A 5BW8A 3GJZA 3LWNA 1HFWA 4MZDA 3WRWA 1ZRSA 1EJ6A 1E94E 4KYVA 1RBZA 3TL6A 1DJPA 3ZK8A 3MPUA 5C80A 3FOAA 1CP2A 2XBLA 1IBSA 4P86A 2PLFA 3KPUA 1ZNWA 3T8YA 3B1ZA 3G9TA 4I50B 4J16C 3HQ4O 1QPBA 4MQUA 1X14A 4N18A 3HCOA 2YBEA 1X3SA 4LXGA 4PQGA 4ZVSA 3UXHA 1Y6RA 1M34B 2NYAA 3D6UA 2J7PD 1N2GA 3TKYA 3EIQA 4R1QA 4HR7A 4ARUA 1VL8A 5A62A 2G9NA 1N92A 5A9TA 1SUIA 5GVSA 1JEQA 2VEOA 1G0OA 4JAVC 2BY4A 2AEFA 2VRCD 2VP0A 3ICCA 1RWVA 1XU9A 2RAPA 3PUJA 4RCZA 1O5TA 3HBJA 3JASA 1T9ZA 4LX0A 2B8JA 1X42A 2NPOA 4UAJA 4AL4A 3X1WA 1F3OA 1H1LB 3WIOA 1T91A 3GLIE 1R1DA 3K5HA 4P08A 1E5QA 4OHFA 4BAGA 3TQHA 2A1TR 2FEKA 2VA8A 2XUGA 2ZTLA 1OX5A 3AM5A 5EZSA 3FBGA 3LIPA 1AHIA 2GPTA 3TW6A 2V6JA 2XTZA 3HKBB 1RM5A 1B8PA 3QITA 3ZY6A 1E8MA 3ON5A 3GOHA 1R8XA 5DGXA 1QV9A 3UY4A 3ZCTA 4E2ZA 1L5MA 1U6JA 2C61A 2E82A 2X2PA 2Z2YA 3F6BX 3GELA 3KYIB 3ICQB 4F96A 3I58A 1A9SA 1T2AA 5FWXA 2Q45A 4YCBA 1NUHA 2Q1TA 1YNSA 4BRUA 2NUPA 5GAJA 1ZK0A 3C7DB 5GQSA 2I4TA 3VX3A 2AT1A 2Y27A 4P0TA 1SUPA 1W9HA 5JVDF 1H2HA 4NMHA 2XMDA 2XJ9A 1AZWA 3PRYA 1WSBA 2NYUA 4GL4A 2I78A 4WXEA 4L3OA 1LD3A 2AFIE 3KU4A 4S1WA 2FN9A 3QG5A 4UQLA 1Z5NA 1DE0A 2C3OA 4YRPA 2BFOA 3QVSA 5JI3E 2CMGA 1KS2A 3B9RA 1PNQA 1JKJB 2CJXA 5JPCA 3HG7A 4QELA 1WZNA 4QQNA 2Y1CA 4M1WA 1TIKA 3UA3A 3BD6A 4GGPA 4EF5A 4ZVMA 1RLIA 1ZCBA 1EUDA 1E1QD 2GEJA 1WY5A 2PWZA 3HZRA 4GNRA 1D8TA 5E2BA 5IX8A 1CTQA 5B1YA 4IOLA 3RCBA 2F8SA 3PFCA 4JYZA 5BXQC 2HIAA 2OOSA 2ZUCA 2VYCA 5TGTA 1JJVA 4CLRA 1ZUD1 1W36C 1QCCA 1N6OA 4TTRA 4XRRA 4LQLA 2OCBA 1U8ZA 3QZUA 1KIAA 4PU0A 1U80A 4DPLA 4LFAB 2OBXA 4K6CA 4K28A 2PKRA 5ALMA 5KNCD 4E13A 1ZP6A 4Z51A 5HKOA 2I4MA 2AK3A 4CLXA 3PR2B 4DTCA 4KIJA 1EWTA 3T7AA 2FUG6 2X1LA 3F6PA 2AUNA 4ICIA 1DEXA 5FOUA 1L7MA 2O06A 2QR2A 2V6GA 3KB1A 2PXXA 4ZJYA 2QP4A 4REOA 4WOCA 2YASA 5A9SB 5HOEA 1BD3A 1SKYB 3HYLA 1XNGA 3MMPA 1OA1A 2QT1A 1SZCA 2CDCA 4KBFA 1D6NA 3E2MA 3JQPA 5AJYA 5PGMA 4S12A 3GQBB 3NYIA 1A8HA 1G4AE 4CM1A 1M5TA 2VHVA 3FKSD 1YJ5A 3EVGA 3ITEA 3L06A 2E4AA 2J5QA 2W71A 1JT9A 4MO2A 4S35A 4A9AA 5C4GB 3W5DA 1H2YA 1SGWA 2IOHA 3NT5A 5DO9A 5KTOA 3JYQA 1NT4A 3FMVA 2WKPA 1X7ZB 2ZXUA 1QZUA 2BHNA 5DW0A 2I6UA 2UDPA 3GLHE 4RV9A 4DV7B 1OBHA 1HGXA 1IHUA 3GFFA 1CY0A 2GZDA 1J90A 2YN2A 2X3YA 3HEAA 3MYYA 1NVDA 4ZI3A 8AT1A 3LPMA 4TWAA 3SYTA 3JWEA 3BH6A 5IJ0B 1FVHA 3BSYA 3I6MA 2G8NA 1IK4A 2J46A 2OBLA 3H9UA 3OJFA 4LGMA 1TTHA 1M66A 2TMGA 4ZYXA 3D8TA 4IMJB 4UAUA 4JJIA 1BH6A 3ESRA 4TGLA 4E5PA 3KBOA 1GDDA 4DV1B 4L8FA 2V7EA 4PC7A 1LSJA 5LM3A 1HR0B 5DNUA 3R9XB 1KY3A 1RYBA 1MW8X 4MWTA 1VLHA 4BUCA 4QAQA 5MN6A 1DIAA 4Z2AA 1VL1A 1YZUA 4Y2PA 4W5OA 4XX0A 1W36B 3H7AA 1IBLB 2ZCJA 1LVUA 3CWQA 5GZ3A 1KNXA 1DJQA 2R00C 2RAFA 5EZ5A 1C0IA 2F9MA 3ESQA 4ROTA 2VAXA 2DULA 2J0SA 2XOXA 3I9LA 2DP4E 2XBMA 1FFWA 1GSAA 2Z8XA 3KT6A 3QPAA 5A5EA 4AMUA 3K96A 3R5FA 3ZQJA 3VDNB 4LCJA 3KZKA 2ALJA 3EQ7A 3F5FA 4G5HA 3K9QO 1N2JA 1PNRA 3COSA 4O2BF 3HZHA 2G0NA 2Z2ZA 2IP4A 3QVVA 4E70A 3IEMA 2IU4A 4FEYA 3A2LA 3DEFA 4YMSA 4Q3OA 1PIWA 2PLRA 3CRVA 3SZ3A 4DEYA 5AVQA 3KKPA 3R5TA 4ZCIA 2MMGA 4PW0A 1CQZA 1Q0UA 2PX3A 3AQIA 4IINA 3A1TA 1VP9A 4J29A 1CV2A 1O9BA 2QYOA 3F90A 3I1FA 4GBMA 4ETMA 3DNFA 3LX6A 3G1TA 2QD1A 4TLBA 2I2CA 1FRZA 1KJYA 2B5VA 1F8YA 3DYIA 4HH3C 1O95A 2BELA 3FNEA 3P0JA 1GRVA 1L5WA 4ZTUB 2HT1A 2XT0A 2QPTA 3W3AA 4N3GA 1ZK2A 3H6GA 4OGGA 1F2TA 1X2BA 4CI0B 4A8JA 2IPOA 5JCZA 1FU8A 5GGXA 3UKDA 3ZE1B 3WGJA 5KYXB 2HJ9A 4PBRA 1IK6A 1ODLA 1G2QA 1RHKA 1Z0UA 1JFVA 3DBHA 3FI9A 3QU2A 1QRAA 2X2FA 4I9NA 4WLNA 4E5UA 5E4FA 3EXIB 2VP2A 4TPKA 1IBKB 5FB3A 4DLZA 1NOJA 3BIJA 2EJVA 5JBQA 4BQSA 2BE7A 3TE7A 3H16A 2ZGVA 4DNFA 1PJ2A 2HHLA 2OP0A 2PR2A 4GMHA 4CLEA 4RACA 1DXOA 3DKRA 3GZNB 4QYIA 2WFLB 3SX0A 2O2DA 5CB0A 2BGMA 5HZKA 5JARA 1YFJA 4DMUB 2NZUG 3EFBA 5EP2A 1ZGHA 2IP1A 3EYWA 5ILGA 3O6VA 3EBOA 5JSQA 2HADA 4NU6A 2IS1A 4IIBA 1FYVA 2Q5OA 2H1LA 5C8DA 4P4TA 4B3RB 1X7YB 2BR5A 3M6LA 2PYIA 3W6UA 1XWIA 3MWKA 3IEUA 1AUQA 2NTYC 2CVHA 5AVXA 4IVPA 1JSZA 3OPVA 3AEYA 3BKXA 5JCOC 4DMMA 5L51A 3H0KA 3B52X 4DDWA 1TADA 1AE1A 1OI3A 1ZJZA 3KWJA 1ZIXA 1XVLA 2R6AA 4S3MA 3K6KA 1CNFA 2CFRA 1BFDA 1HUQA 2JAWA 2NTEA 2WT4A 5A7FA 2WAXA 4RMGA 2R5NA 5B12A 4W9NA 1P1BA 5I7AA 1XRQA 5IVKA 1QQBA 1HXHA 4P3YA 3L9XA 2BDEA 4ZT3A 3ZLTA 5CDTA 5KB3A 2C88A 4HUQA 4X1KA 5BMVA 4D9NA 1YZ3A 1GRCA 4FOOA 4HDOB 3BXHA 3TBKA 2JGIA 3PXBA 1DWPA 4D0GA 3IURA 1AS2A 5CVJA 1IY1A 2HQRA 2Z5VA 3E58A 3M5CA 4ZGWA 2BKUA 5HILA 1NN5A 5THXA 4YR7A 2XIJA 5I48A 4CF4A 5J3JA 2QB5A 4JFAA 1L7DA 1AU9A 4XWKA 3OF2A 1JE0A 2W11A 2QQ5A 3PE4A 1JWAB 3JR7A 1C0KA 2DHEA 3D6TB 5FNVB 2P6NA 3CNNA 4IZIA 2OGTA 3W3AH 4KUHA 4RFSB 1WXXA 1A9ZA 4WK4B 4YP5A 3EPJA 2HHHB 5K4HA 2X86A 4EZEA 3Q1KA 3UW3A 2BEKA 2RI0A 3V8PA 1L7OA 2P2GA 3HUEA 2ZAYA 3SZMA 3T0GA 5HJ7A 4QPJC 3I2KA 1MOQA 1Y98A 1LW6E 5TARA 1RWKA 1GPNA 3N9IA 2QN1A 4L6IA 4PLZA 4PZEA 2QRJA 4QGFA 5ALJA 5F1YA 3V33A 3OY2A 1XTJA 1CS0A 1RQPA 3T3IA 4YAIA 3DFZA 3MB5A 1V43A 4AG5A 3P20A 3T99A 5J2UF 2O8VA 5C7OO 5J4KA 5KYKA 1BS2A 3OCWA 4EDFA 2BHLA 2Q7XA 1G41A 1Y8ZA 1KEEB 2Y0PA 1EHYA 1J5XA 5BSWA 4QYWA 2IRWA 1VE5A 1W88A 2GPWA 2I33A 3S1AA 4BFTA 3CPHA 3G5MA 4LX8A 3VR4D 1CY4A 3V1UA 5KUTA 1R6TA 1ZM3A 4MGEA 5T8KC 1DIHA 1MW9X 1PW5A 2EG5A 2QWXA 3WAGA 1A4UA 2BP7B 3MCZA 1RAFA 4F4HA 2C5FA 4DGSA 1FMLA 3A14A 3OKAA 4MPDA 5AYVA 3I6IA 3GLQA 1TFRA 2RIRA 2X8AA 3C87A 3ZHCA 1IBMB 3JRNA 2HHCA 1JQKA 1LLCA 1ZBDA 1ZOIA 2JS7A 4GKBA 2FRVA 3BX1A 3L4EA 4IDCA 3DBRB 3N2IA 3OZGA 3EVEA 4I3FA 1YR2A 1U2ZA 4XYEA 1I80A 1UDWA 1VE9A 5F23A 2RSLA 3OX2A 8ABPA 3NT4A 5KKNB 5U9CA 2ZBUA 4RIFA 2NSHA 3NBKA 5KYWB 4ZOCA 1CNMA 3BWMA 1VPWA 3BN3A 3LWZA 2Z1NA 1QH1B 4MWSA 5JROA 3AK4A 3QH4A 3L93A 1HQCA 2HA6A 4HNSA 3FLAA 5IT0A 5JASA 1OXXK 4EP1A 3RIYA 1A9OA 4A2QA 2GPYA 3ENNA 1Y1KE 2L19A 4YJ3F 1E3DA 2MMCA 2UYQA 2VCEA 5DNYB 5LPNA 1CZNA 3E7FA 1FVXA 4EPVA 4G81A 4UTVA 1J4AA 1DQSA 4RF5A 1Y9DA 4E15A 1IN1A 1PWYE 3WLLA 4CR7A 4DJTA 3WYNA 1ONBA 2Y92A 4R41A 2OK8A 1VG0B 2DQYA 3D02A 2AYXA 5GMOA 5LYJB 4WASA 3JQ9C 5IVIA 3WYAA 1ZRNA 3MYRA 3R7FA 4AQ7A 2R751 2R97A 1BRMA 1PD1A 1VJRA 3IR7A 4N5IX 4DBLC 3THWA 1CJVC 4RY0A 2WTXA 3TRIA 3BRWA 3A58B 3A36A 3F71A 4K3UA 4YJDA 4C4YA 1ZVQA 3SIWA 3GJRA 1D2NA 1TM3E 3D81A 4R2KA 4ZQHA 3WLJA 3OIDA 1BXKA 4YCJA 3ZCPA 1ZJYA 5KOHB 1P2UA 3R6DA 4ZTZB 3C6YA 4GI2A 2K2WA 4RAOA 3S5JA 4B3BA 5J4LA 4RD0A 5K6AA 2YNMD 3DXYA 4FNOA 4WNIA 5A1TA 1UJ6A 4YA6A 3DE4X 3WXMA 1QTQA 2QRKA 4FFPA 5FA8A 1SD5A 3KQWA 4PX9A 5JAHA 1HH4A 1XQ1A 2YWXA 1CEXA 3KUUA 3VH1A 2WG1A 3WZLA 4IDEA 4BNTA 3BQ9A 1VPTA 4ALIA 1FJHA 2I34A 2EAUA 3ABOB 3BBPA 5LQNA 3B8HA 3THOA 5SICE 3II6X 1GKKA 3DBVO 2GN0A 2H7VA 2Q49A 4TLEA 4LY3A 2WA1A 5EMNA 2PJRA 1NVXQ 3WOVA 1L6IA 3PF9A 5L3VA 4A2CA 2EYUA 1M6WA 3WIVA 4MGYR 2CNLA 2G1JA 4S2UA 3SD7A 5JCJD 1P9RA 4M83A 2IUTA 1DV2A 3DLAA 5JD6A 2ZB3A 5CJJA 2E6UX 3GGCA 1YZTA 4ZOLB 3VPBA 1BXGB 2RHGB 2A4MA 1UK7A 2YJ6A 3OZDA 2FHSA 4HQFA 4L22A 4QFMA 2NMVA 3KHTA 3WYGA 1UT6A 4HVAA 5HF5A 4O1IA 4R2WA 3KLMX 3BT7A 2Z04A 1R27A 3WE7A 4CT5A 1TO6A 2XRYA 4GYJA 5KU7A 4CR8A 3H5OA 1NLYA 2EDCA 4G26A 4QOSA 3O8QB 2XQJA 4QLOA 4DCCA 4NFSA 4HAUA 4RF3A 2QN7A 1TMGE 3FPBA 4HCJA 3B3AA 3PEUA 4S0ZA 3A04A 4DC0A 2GN2A 2M2IA 5JBNA 1QQ6A 1XGKA 2FW1A 3RYFB 3QVOA 3D3NA 2OSVA 2BFBB 3KKZA 4EL5A 1DWUA 3MJFA 2VP9A 2CZGA 3UCFA 3WLTA 1V2HE 1N5LA 1YRYE 3N2LA 4FW9A 1LQ2A 2QT9A 1XZJA 3OTIA 4B6RA 4JBNA 1DC6A 1I5OA 1QHXA 3GDWA 5J43A 5BV2P 1BZYA 3IKVA 1PWEA 5IAGA 1VRWA 2GZ2A 2YHSA 3THXB 5KQGA 1RC1A 3A31A 1LTKA 2H65A 4M0MA 2ZSUA 3E9MA 2HXSA 1OMOA 4Z53A 1A9XA 2VRBA 2PVPA 2B30A 3NLLA 1NQAO 3TQQA 3TSCA 3IDFA 4L8LA 2I91A 1LBTA 2O2SA 3B1JA 4BQOA 4F2HA 5F3RA 5FPKA 2ZRFA 3ZCSA 4E94A 1DFGA 2XKAA 3EDYA 3OP1A 3HKEA 2W2XA 3WMGA 2Q6TA 1N78A 1WHSB 1QIKA 3RF6A 4B7CA 1Q11A 2WKWA 4FM9A 3UWDA 1C5KA 2ZSDA 1WVGA 4BFUA 1C29B 3FYSA 3K6SA 4LG1A 4DM3A 4EHLA 5AK6A 1TYCA 4M86A 4PSUA 4TXMA 3B1FA 2ZXEA 1Q5PA 3F73A 2WHRA 2PFSA 1D2CA 1JDJA 1OYOA 1T26A 2ZTUA 3OVMA 3PFWO 2XNHA 4B2IA 2OEPA 3I32A 6REQB 2VKQA 2UZAA 1U6IA 1G9XA 1YUBA 1XTZA 3LKDA 1A8IA 4FR5A 5D5PA 3VVLA 4EUHA 1DUVG 3AB3A 4GZ6A 1GPYA 4YPFA 3DMYA 3UGTA 4L15A 4EQ6B 2RC5A 1KDZA 2HSDA 2YDXA 2ATEA 1NNUA 1JU9A 1VCIA 1EHIA 4F1KA 4J3NA 3ZCUA 3F3MA 2Z1DA 3NVKI 4X62B 1P61B 4OFZA 1KH3A 4Z99A 1X9IA 3FZGA 4UJ3A 1ZC4A 5K0BA 4DGQA 2B35A 3Q9NA 1PR0A 2XPCA 3HNOA 4GSKA 4HX2A 3B7GA 4D8VA 2WV7A 3JQBC 1Z9BA 5ER9A 1CUUA 4D02A 1V1MB 4Y6SA 4JR0A 3EJWA 2QLNA 3KVVA 3NIWA 5EXXA 2YY5A 3WL6A 1JMVA 1LBSA 2J3DA 3ZCQA 5CW1A 3L7JA 4LVUA 2JFWA 2X42A 2PKQP 1J0DA 1P6UA 4AIIA 3NBAA 2E1RA 1J2TA 1QFMA 3KAPA 4LPSA 3TG8A 3AB7A 1J2EA 4EQZA 5F5LA 1U0JA 3LHKA 2HX1A 3FHLA 3EAGA 4UPDA 3T9EA 3OX3A 3L6BA 3MRTA 4JLJA 1GM5A 4ENQA 3MELA 3QBEA 4YS6A 1WCV1 4DABA 2BUBA 1U0NA 4KG7A 4BBPA 2K7ZA 4MUIA 1KDOA 4FFDA 2XQVA 4HX9A 1OTXA 5D7NA 4M7WA 2ZUVA 3AM4A 4ZK2A 4X7BA 1Y6QA 3U4DA 4F5YA 4QM7A 4GI5A 4DKXA 4U00A 4BMXA 4GT1A 1E6LA 4CL3A 4PLWA 4BXOB 5AWFC 3O2NA 3T7KA 3CX8A 3X0DA 1RWQA 1OYWA 1GAEO 4H0FA 1V5EA 2FN8A 4CM9D 2C00A 4PLHA 1QH9A 1SQ0A 4WHMA 5MF6A 2YOFA 3UBMA 3AW9A 5C7YA 4RU1A 3SFZA 2IYUA 4Q93A 1WTCA 1WULS 1X7XB 2BFMA 2QTAA 1R4MA 1OASA 4G1VA 1U4OA 2VHYA 4PO9A 4Q3KA 5IASA 3RAFC 5DTEA 2FCAA 3ZGYA 3AR3A 3DT9A 3KR9A 2GNAA 1NW3A 1Z7YA 3QM1A 3WI7A 2XHEA 1YIOA 4L73A 4PLCA 3L7DA 3C6ZA 1YSCA 4X64B 2FR0A 1NQWA 4R05A 5EGNA 1LPAB 3LCVB 1JHUA 5FT9A 3AI1A 2YVUA 5TT1A 3I6YA 4WNAB 1SPXA 1UBGA 3H5WA 1KRXA 3DM9B 3G2HA 4U3JB 4WTOA 3PNYA 3L8DA 4ZCLA 3NP7A 4LJ4A 3FWKA 1U5AA 5K3AA 1O6ZA 3AFOA 1NJGA 4M6WA 3JQFC 3NDIA 2GAAA 3L79A 4HEJA 4NH4A 4QG7A 3UJ6A 3EDCA 1OHHA 3LBYA 2VTBA 1C9YA 4M1ZA 5FFNA 2DUMA 2ZBVA 3L0CA 2OUIA 2R1VA 3WDSA 4BNNA 2H1SA 3H2SA 4MJXA 1JF8A 4BNGA 4P34A 5BQ3A 3OE4A 2XI4A 1K63A 3F7MA 4GRAA 4BV3A 1GYRA 5IUJC 1MAWA 1G60A 1Y7HA 1KARA 1S2OA 2FWRA 4HB2A 1DX6A 4ZDIA 2GM4A 5K99A 1E7WA 1GAWA 1CVIA 2AN3A 1EBFA 1KR2A 4JODA 3ICOA 3WKEA 1JHYA 2G25A 3G8AA 4RA9B 3CUKA 4RKWA 2CNBA 2IE8A 3B2NA 3DKPA 5CYFA 3BGDA 1LU9A 3LCMA 5IYZF 2HW8A 3GJ0A 4F3RA 5GPBA 2IH5A 4WE3A 4M1EA 2VLBA 4PYRA 4IJUA 4L6AA 3JSAA 3SX2A 1S2LA 2RGYA 4KV9A 4U7WA 2BGJA 1U9IC 1VBMA 1JAIA 2IODA 2JGMA 4MUMA 4NABA 4CM8A 4EVIA 2B3DA 3DLPX 4GF5A 2OV3A 2IUEA 2QQEA 3ZE9A 3RRZA 3GUHA 3EZFA 5FLYA 3V1MA 4RVOA 2C3UA 3C97A 4QXQA 3UUWA 4QRDA 5CLLA 1VCOA 4DSZA 4QO7A 4ZT2A 2OL4A 3BG5A 3AJ8A 3OLWA 3BZUA 1VLJA 4TL6A 4KPEC 1LCIA 1AGNA 3ZJUA 1IJEA 3LBHA 1CZHA 4DRXB 1NBMD 2JD1A 1SZJG 3KLBA 1YASA 2WM3A 2EC5A 4RKFA 3RS0A 1IUPA 4QYTA 4B6EA 2D4HA 3FVQA 5DCYA 4Z4HA 1U7ZA 4K6MA 1EFTA 1S2GA 3P9QA 4EEZA 2OV4A 3I5MA 5C1OA 3EA5A 3QMWA 3HSSA 2VSXA 4JN6B 1MDBA 2C5EA 2HMWA 1GRRA 4CV0A 3C8UA 1BTOA 1K08A 3BPSA 4DCOA 1F2UA 3G2PA 5CU7A 5MFZA 3LLSA 5ALEA 4PXAA 1Z07A 3EDMA 1CZKA 1VRCA 5EI5A 1XEWY 2EU8A 4MIKA 5FWNA 5I01A 2W6CX 4TLDA 1A0OA 5ALDA 1Z4NA 1QYRA 3RC2A 1CUYA 1A7JA 1ZGZA 1Y48E 3MW8A 3TRHA 4ZQGA 2BZ0A 2W22A 4IL5A 3H86A 4IXTA 2PG3A 4G5GA 1O97C 1Z47A 2OGSA 2GA8A 3KB2A 4QLBA 3WQHA 3VV2A 1C2TA 2Y71A 3DZBA 1NN0A 2IF2A 1MEOA 1TUEA 1VOTA 4IILA 1V3VA 2CXUA 4QOHA 5LA6B 3D1LA 3QBTA 3V1YA 3FTCA 4DN6A 1N5OX 1A5AB 2RONA 3UFBA 1NAIA 2EW1A 5EEGA 2VUSA 2UXDB 1VYVA 3A6KA 5BV8A 1G3MA 1XR3A 4BNZA 1VMEA 2ZI6A 4LECA 4NEHB 4E2XA 1XEFA 3OIYA 1DDGA 1QZTA 2W6NA 3AIOA 2CN1A 4I99A 5FOSA 1KIMA 3EVDA 4NYJQ 3WMWA 2P35A 1ZIDA 3W05A 4BMSA 1XZLA 2MT9A 1PLLA 4HXEB 3TLAA 3JZFA 1RC0A 2F9FA 2I6TA 3NHLA 1XA0A 4OJMX 4M0FA 5CFZA 4ZO6A 2P78A 3G0GA 4FZ3A 3L5OA 4OXKA 3CE6A 3VOTA 4ENSA 1KSHA 3H87A 4XWAA 4UAVA 5FUBA 1VJ1A 2GZ3A 2OVBA 2H1WA 4Y7CA 5H82A 5IM4F 1VIDA 2ZUFA 3KPWA 1SULA 4WA8A 5D3ZA 5LQSA 1O0SA 1ZEMA 4W5WA 4OQZA 2VK1A 4GC5A 5F9FA 5DGHA 5BSFA 3ZY4A 4DCVA 2DF8A 4OQYA 4BNDB 1OROA 4ZEWA 1JJBA 1KSFX 1O1YA 4BX9A 2O2JA 2WZQA 5DN6D 4N76A 1SRRA 5IT9A 2O2XA 1U0EA 3EXEA 2IK8A 4WXPA 1IBRA 2O8CA 2XUHA 2G4LA 4JI1B 4JB2A 2ASVA 2HTFA 2JCVA 3EEYA 4QDTA 2KMLA 3HUTA 1I2MA 2HK6A 3OPYB 1J8VA 1IAQA 1WUHS 4PF1A 1JHMA 1IPFA 3S68A 1YB7A 2ACWA 3AH8A 3EE6A 2PVSA 3NTRA 4GE3A 3BTOA 1HE1C 3AI7A 4G67A 1BQEA 3OFSA 3L0OA 2H52A 4ARIA 1TXGA 1Y7TA 2R86A 3R7DA 4K88A 2R2GA 3F5SA 2J0UA 1IY0A 3AILA 4XXHA 3ZHRA 1XKQA 2FLWA 3A1WA 2WIDA 4IIEA 3LOQA 2NU8B 4BWVA 3AB8A 4D4IA 1KYQA 4IG9A 4WXHA 4XFDA 5EMKA 4DEXA 4DUPA 4CFZA 5LD2C 5H02A 4AF8A 1MB2A 1J0AA 3D4PA 4DDUA 1RRMA 4KFTA 2QTRA 1EFHA 2ZTHA 3EWNA 5AJWA 2R5FA 2E49A 1U8YA 1AQ6A 3ISJA 4LI3X 1ZA2A 1CF4A 3V42A 3ERCA 4CF5A 5EJ5A 1M2KA 2XDWA 1FXWF 1P29A 3OJOA 3I0MA 3V8MA 1RBYA 3HR7A 1TKRA 2GCGA 1IUKA 4H6PA 1Z68A 4MCIA 1M2EA 4DNOA 3SQMA 1ZQ9A 4ZEXA 3CNEA