3KB2A

Crystal structure of yorr protein in complex with phosphorylated gdp from bacillus subtilis, northeast structural genomics consortium target sr256
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYIEGKDIDSILELYREVMSNAGLHTYSWDTGQWSSDEIAKDIIFLVELEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPBc2 prophage-derived uncharacterized protein yorR
publication title Northeast Structural Genomics Consortium Target SR256
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb2A00
3AVPA 3U44B 4PC6A 3Q3JB 1HT1E 2CHQA 3AGPA 4L9WA 4KSCA 3U7EB 2VP0A 5FOUA 2BC9A 3QXHA 3T12A 3H1TA 2XITA 3PG5A 2AFHE 3QY0A 4I1OA 4PPQA 4BLQA 4DEXA 3AGQA 1NBMA 3QKRA 4D4LA 1XMVA 2D2EA 2WKPA 2W0SA 5JECA 3KKOA 2QPAA 5AUQA 2BJWA 4MGKR 4DDUA 5JEEA 2WIAA 1HY3A 2FJUA 1L4UA 2PEYA 3ZH9B 1KK0A 4DLXA 3CRW1 4ERNA 3GJ4A 1Z5ZA 1DG3A 2OEPA 1OFTA 4FCTA 3U44A 1S2MA 1VG9B 4NTZA 1TX4B 2IX3A 4LHYA 2JATA 3GEIA 2FPLA 5FUXA 3W3ZB 2XZPA 3CX7A 2JLSA 1JXOA 3BC1A 1YHNA 1GSIA 4RD1A 4HB3A 3TW4A 3K0EA 1CLUA 1N6HA 1L4YA 1T6NA 3DMDA 2JDIA 4US1R 4DRZA 2IS2A 2BV3A 4HDOB 3RAPR 4BRUA 5J4HA 2FF7A 2CL6X 1RZ3A 1PLJA 1TF7A 1XD8A 2GWHA 4X8HA 1BIFA 3EXAA 3QKTA 5B30A 3UATA 4NKRA 5FUVA 4DXAA 5EE9A 4C0SA 1CR4A 2J1LA 1DG1G 4O25A 3BBPA 4A0GA 3K0SA 1W4BA 3F8TA 4ITRC 3X1YA 4UJ5A 4RZ2A 3N5CA 1NG9A 5DSZA 3M1IA 4XVUA 3NBYC 1G16A 1Z6XA 2DFKB 2GZDA 3GJ0A 1U94A 1N6OA 1Q1BA 4HATA 2BMFA 5DYIA 5G3YA 1TU4A 4KBGA 3WMFA 2CL0X 3VNUA 2HV8A 3QJYA 4B35A 1PJRA 5E7MA 2P5TB 2I1VB 5CK4A 2XB4A 1N25A 2GF9A 4WA7A 2VPPA 1AGPA 5LBIA 1HE1C 4TYYA 4YXWD 4HLUA 1YKSA 4JYCA 4C0QC 1VIYA 4BFYA 4W9MC 1R0XA 4PTLA 4IVRA 2AXNA 4AKIA 4L8GA 1W0JA 5AJXA 5DHFA 5TXGA 3CR8A 3MLEA 2IXFA 5FBRB 1NSFA 1LS1A 3WHKA 1F3OA 1LFDB 1XPUA 2HDNB 3TKLA 2Q21A 4CW7A 3AKCA 4O0MA 5CDFE 2V55B 4OHXA 4Q00A 4MUAA 3LO5A 1E1QD 1KSHA 4JBWA 1CRQA 4XTCS 2YNMA 3I32A 1NKTA 3CBQA 2Z4SA 1RVDA 1IOZA 4WW0A 1ZINA 4U00A 2AX4A 4LYHA 2FGJA 3CWQA 5C4GB 3EPHA 3OESA 1R8SA 2YWHA 3QVUA 4LJ5A 5JRZA 1YZQA 2OBLA 1HQYE 4LX0A 4AIIA 3PFIA 2YWEA 1PUIA 4MYTA 2A5GA 4XSGA 1D2EA 1II0A 2OXRA 3SYKA 4MITA 3BIFA 1NVVQ 2HCBA 2QPTA 4CZ2A 2FSIA 2JCSA 2VQSA 3BK7A 3CRQA 2Q3HA 4IEIA 5IDVA 1A2KC 1DARA 1SVOA 1GNPA 1JECA 4POAA 2GJAA 3ZVLA 5J4KA 2CCGA 3CUEF 1YZGA 4GOXA 3PUYA 4XD7D 1R8QA 1R5BA 1TAGA 4Q5IA 5FL7A 5BN4A 2HXSA 2O0HA 3KUDA 5EZ6B 3FDIA 3K70B 2OBMA 4LC0A 4QHSA 2BDTA 3IQWA 3TQCA 1ZM7A 5DE3A 1DO0A 4IOLA 4YQFA 3NDBB 3AVYA 4DC9A 1ZNZA 2ZS7A 2GJ9A 4JL6A 4K46A 2IXGA 1SHZA 2IS4A 3B1XA 1KDPA 2QE7D 4Q9LA 2A2ZA 1SXJA 2GESA 2QMEA 3W9YA 2YKGA 1OH7A 3UKDA 2EFGA 3GFTA 1KZGB 1XMJA 3HU2A 4BFXA 2ZS8A 4QL3A 2F3TA 4XOIA 1OH8A 2W6JD 2ZI7A 2D4HA 1GAJA 4P4SB 3AKDA 3ZS8A 1NY6A 1HURA 4ZO4A 1XNJA 3MRSA 3Q5EA 3RS5A 4UNRA 3A37A 1M74A 2NO9A 2QN6A 1E96A 3A1VA 4KAXA 4LV6A 2NOAA 5DI3B 5KTYA 1KI9A 2R6FA 2DR3A 5ELXA 3KUCA 5L8VA 4BWYA 4F4CA 1DAEA 1P72A 1CJMA 2GRJA 2KBEA 2QPOA 2QP4A 4G5SA 4B3CA 2X19A 3UMSA 1GL9B 2RHMA 1IBRA 2ZXUA 3L0OA 3ASYA 1SKQA 3KTAB 2AHOA 5DNYB 1FL9A 2ZRAA 2BEJA 2FZLA 2V8OA 4P4SA 1QHXA 2HLDA 1DEKA 1PVOA 1QF9A 1EXMA 2GXSA 3FFAA 4JLPA 3NEJA 1MOZA 1V43A 1V5WA 2J46A 3H2YA 1CR2A 5DI3A 1WMSA 1GWNA 3TNFA 4IFEA 5TB5A 3LDAA 3C14C 3EX7C 4AKGA 1AIPA 1E2DA 2VP2A 3RC3A 1AZSC 3OE7D 3DDCA 3GEEA 4TYWA 3NBFA 3RVBA 2XSZD 2ZM5A 5KNDA 1NIPA 2AKYA 3CPHA 4JL5A 1OKKA 3QPUA 1OIWA 3KTAA 4PC7A 4Q4AB 3TVDA 3NG1A 1XBTA 2JGNA 4CF7A 3B2EA 1PZNA 1MO3A 2NTYC 3CW2A 4DLWA 1JPNA 1E3MA 2H5EA 3Q8XB 2FE4A 3RRNA 3LVQE 1Q20A 3TLXA 3QENA 1DOAA 3LV8A 4MYHA 3EZ7A 4HZIA 3ZVRA 1NBMD 2ODNA 3B82A 2ZSFA 3A1SA 2QAGC 2N42A 2ZU6A 4YMSA 5AJWA 4MH0R 4A2QA 1HA3A 4Z51A 3GPLA 2CNWA 3AUXA 4Q4AA 1W2HA 2C98A 3ZIAA 3VNVA 2VHTA 4ZI3A 1VCOA 4PANA 1SVIA 2GEVA 4FWTA 4CEHB 2A5YB 1P62B 4A92A 3ADBA 3CRMA 5DIFA 5LB2A 2EU8A 3K8YA 1XRJA 4Q18A 2BCGY 4E09A 3I1FA 3H0KA 3A1UA 4TT3A 5G41A 4PC1A 1GNQA 2GK7A 1S9DA 1TF2A 3KX2A 4QGGA 3K9HA 2VF8A 1GG2A 1Z29A 4Q1FA 2G88A 1KK3A 5BQ5A 1T5LA 2RGCA 3I3SR 2R6CA 3LNCA 3GLGE 2ZRFA 4DEYA 2WWIA 3HDTA 4IOMA 2OLKA 2CVHA 3C41J 3CH5A 2JDID 4OK3A 1KK2A 1XTJA 2YWFA 4CEHA 1JQJC 1KY3A 4RZ3A 1EGAA 1CR0A 1M8PA 1D2NA 4JT2A 3CIOA 4TYNA 1E0AA 4TYPA 3QUSA 1E2GA 2IS6A 2QSYA 3KJGA 1OFIA 3WY9A 3AH8A 4GP7A 3EARA 1SKYB 1HTWA 3GD7A 4PPGA 4Q9IA 4P3YA 4A8JB 3T61A 2V3CC 3A58B 2X8AA 1EG7A 2ZJ2A 2JJ1A 2REBA 4BLPA 1FQKA 1W0KA 2EFDB 2ZRNA 3IHWA 3LH5A 3TAHA 2B21A 2WWXA 4DDTA 4OI4A 3AVUA 3GJ3A 3K9LA 4XJXA 3A8TA 2VP9A 2CCKA 5P21A 3MFYA 1G7CA 1F48A 4D4KA 3VKHA 1M7HA 3AKEA 2QM8A 1OYWA 3ETLA 2ONJA 1OW3B 3GLIE 3BRWD 5UKDA 3MGCA 1W0JD 5JJLA 1XXHE 1X1RA 5BN5A 2PX0A 5FI1B 4G3XA 3NVAA 1N6LA 3BS4A 1Z6TA 2WWGA 2ORWA 2QMHA 4UXHA 5EZ5A 3W8NA 1T91A 5GJVC 2O5VA 1ZM3A 3WHLA 3AQ4A 3MWYW 1TEVA 1CJKC 1OHHA 2H8KA 1HEIA 3AP1A 4N1AA 1NIJA 3SDZA 3R7WA 4TLDA 2W6ID 1N6KA 1ZYUA 4LBYA 2ZVPX 4PQYA 1MABB 1XCPA 1OE0A 1QHSA 1P73A 2CHVA 1XPOA 4O3MA 1E2MA 3AEZA 3U7GA 1PUJA 3T1QA 3KZ1E 4NHOA 2ZR9A 2BIFA 1VYTA 1GDDA 3QBVA 2CLCX 4JKIA 5A4JA 1DE0A 4LK2A 1KSGA 2WKQA 2W2TA 2LCFA 2HUPA 4QGHA 3QQ5A 2YJTD 1KOFA 3MJRA 4BEJA 4JJKA 3Q5DA 2H17A 4PO9A 4NCHA 2CBZA 3DEFA 1MABA 5FOVA 4Q4LA 2VA8A 1ZU5A 3E70C 5ANRB 4I99A 4WVFA 5DYGA 1XMSA 2PZFA 4FD2A 1DAHA 1MKYA 1ZCBA 1W36B 3ZQ6A 3B1ZA 2PLRA 4L9SA 1UADA 5FL7D 2IL1A 3ZVMA 4YMUA 2QBYB 1G8YA 4ZCLA 1JR3A 4B47A 4JL8A 4IXMA 2WICA 5CLQA 1Z07A 2OCPA 2XTMA 4HAZA 2OM2A 2ZEJA 2WTUA 1UBEA 4E03A 3A36A 3IQXA 4RZXA 3U5ZB 1GP2A 2RGBA 5EXPA 2FPMA 3WXMA 2D74A 2EWVA 4PSAA 1T3HA 1DO2A 4JSYA 4V02A 4QGFA 2RGEA 3DM5A 1NY5A 2ZUDA 1GRQA 1SXJD 3UIEA 2FPKA 5H1YA 2OG2A 3SFVA 4URYR 2QBYA 3B6EA 4LJ4A 4II7A 1GKYA 2DWOA 3K70D 3WNBA 2RGDA 3TR5A 1IN4A 4HB2A 2P67A 2ZJZA 5KOYA 4F38A 2FFHA 2RAPA 3THXA 2N1BA 4XTRA 3SJBA 3IO5A 3HPRA 3MWKA 4N0DA 2J59A 4JVLA 4Z54A 2O8DB 5IF9A 3GLFB 1I4DD 4Z8YA 3NXSA 4LBVA 4D0GA 4HLUC 1G7SA 1SQ5A 3VHXA 1NI3A 1G8HA 3L43A 4Q1BA 3FHTA 1P5ZB 1YRAA 4WZ6A 4DHEA 3PR1A 2HLDD 4BPBA 4ZI2A 3ECCA 4MKFA 3OFNA 4HB4A 4JIMA 2ZRIA 4MUBA 5J4YA 2VP4A 2PCLA 2ZI5A 2IXEA 5CK5A 4ARZB 3RABA 2GNOA 4QG7A 1KAGA 2WBLC 2O8DA 3GLFA 4AYWA 4DT1B 3MMPA 2PMKA 4URXR 2F43A 2FU5C 1H8EA 1OKKD 1TPZA 3IBYA 4NDZA 2NZ8A 2ZE7A 1OXUA 3VR6A 2Y8EA 2A3RA 4DBLC 2BJVA 3A1TA 3W6PA 3Q7PA 3VHLB 3TSOA 5DO9A 1E2EA 5FUWA 1KMHB 4H1UA 1KY2A 1D2MA 4B32A 5JLJA 2WJIA 5HTKA 4ARZA 2J9RA 3MSXA 1VKJA 2Q3MA 4M1OA 4U5XA 5KO2A 3SS8A 4LHWA 2QP3A 2ZYTX 2GJSA 1NG1A 2YOFA 3I4LA 3IKJA 1DS6A 2JIZA 4DT1A 3FFBA 4BFZA 2ZSAA 4ON9A 3R8FA 2CNWD 2C03A 4NMMA 4BFVA 4RD2A 3ZIAD 4BASA 3D7MA 3ZD7A 1Q57A 5HZKA 1G7RA 4CEIB 2C9CA 3D3QA 3QXCA 3RS2A 3SJZA 4HAWA 4BRWA 2ZIAA 1KMHA 4TT3D 1G5RA 2IYSA 2QNRA 4XWOA 3VR1A 4TQ9A 3EWSA 3U2QA 4PQRA 4OI2A 3B7GA 3C7KA 4LWZA 3ONWA 4A2PA 2ZUCA 2EQBA 4NPHA 4Q4HB 2XNDA 3GMTA 1U8AA 2EFCB 1Q21A 3FMPB 1J8MF 5JFGA 3IILA 4M9QA 621PA 2D06A 5FPYA 2FFBA 4LYJA 3RSOA 2WWHA 4MRNA 4DLVA 3IEVA 3IDQA 1QHYA 3MG9A 5KDDA 3LXXA 2JLWA 1IY2A 1NN0A 3O47A 3WMEA 4CYMA 4CEIA 1VYUA 4R9UC 4V0LA 4MKGA 3CRRA 3TQFA 1QBKC 1U0HC 2B7BA 5SZKB 4NYIQ 1CIPA 4R71A 1SXJC 2V7QA 1MO6A 1KDRA 3MCAA 2DYKA 4G5QA 3OEHA 3H86A 3GJXC 1RW4A 2OCAA 4AK9A 2Z6VA 2DB3A 5KPDA 3K70C 2JJ1D 1A5TA 4KFTA 4Q4HA 3ZD6A 1T8TA 1O87A 2YC2C 3L2OB 4UXJA 2BVNA 4V0MA 2ATXA 3D6TB 1W0KD 2K5UA 5CYPA 1WB9A 3CF2A 4PHFA 4RKFA 3RC8A 1KHTA 2CHGA 2FH5B 1AJEA 1LS6A 4M9XA 4F7WA 2ASEA 5FOTA 4Q1DA 3W5IA 3DHWC 5B64A 1P9NA 2BMEA 2DPXA 5CB8A 4PQFA 1ZNXA 1E6CA 1Z06A 4IFBA 1G8PA 2QSZA 1W4AA 3FTQA 4BFUA 4BECA 3F3YA 4M22A 4E07A 1NL3A 1NMXA 2J7KA 3HPQA 3QKSB 4I4LA 3SZRA 1DELA 1NJFA 2G0TA 4M1MA 2F9LA 1NBME 1COWA 1YRBA 4GSYA 4IDPA 4KLZA 4CVNA 1N0VC 2Z43A 5IHPA 2RMKA 1GL7A 4IHQA 3KFVA 3GFOA 3K0AB 1FOEB 4DB2A 1TL7C 5KDLA 1GRNA 1R0ZA 3TUJC 2L0XA 1X1SA 1Z28A 2QTFA 2FSGA 3IIJA 4RD6A 1OHHD 3CNLA 3GLHB 1EFUA 3RRZA 1E1RD 1J2JA 1KI7A 1UDWA 4JBYA 2GVZC 3WYAA 1IY1A 1KDOA 4NU0A 4TTRA 2G83A 2ZI9A 4B3GA 3QKSA 3WYFA 3EZ9A 1YZUA 4MYCA 4DCNA 5J4VA 2C9OA 2BBOA 3RRMA 3WP1B 2Q9CA 4KSBA 4JLKA 2AK2A 2FFQA 3BH6A 3I8SA 1CP2A 1KO8A 4KCGA 3AF2A 1G17A 4B73A 4JLVA 2V1UA 2X2FA 4OK5A 4CT4B 1G64A 1U9IA 3B1WA 3K0AA 5IRCD 4LJ8A 1G6HA 3LY5A 4Q48A 3FKQA 1G19A 3TUIC 121PA 3TE6A 4KYIB 5EE5B 3RYTC 4OHYA 5EUMA 3I72A 2UZIR 2WJYA 5HCNA 3NWJA 1T0JB 2RGXA 4FIDA 5FOWA 1M7GA 3KXIA 5GVRA 5CIQA 3TR0A 1IJEA 1UFQA 3BERA 4GOJA 1S9HA 1Z0DA 5DGXA 2R44A 4LBWA 4KBFA 1X6VA 2AL7A 3BH0A 2WSSA 1JR3D 1KGDA 2J5XA 3QIAA 2ZRLA 3MAAC 5J47A 3PEWA 4C3ZA 1DAKA 3LXRA 4GPTA 1ZAKA 2VP5A 4I1UA 3VTKA 5GVSA 4LYFA 3W5JA 3C16C 5E3HA 4B3BA 3IPXA 2XXAB 2N46A 1HQCA 5DHAA 1TEXA 1WXQA 3TK1A 1W36D 4A6XA 2P65A 1LTQA 5TV2A 4TLBA 3AP2A 3S1AB 4LGMA 5EXTA 2XNSA 721PA 4DCTA 4JYBA 1M7BA 3CZQA 4BLOA 3AF4A 4OJQA 4LJ7A 3W34A 3C4JA 1E2HA 1CJVC 3U3JA 4HAYA 3MD0A 4NYIR 4OKSA 1ZUNB 3H4MA 4NCNA 1BYUA 4DLZA 1J8YF 4DJTA 3PUXA 2YYZA 5JJIA 2OILA 1PLLA 4FMDB 1Z2CA 2HT6A 2NIPA 4JLOA 1UKZA 3L8YA 4RJLA 1G3RA 3WYGA 2DBYA 4QHYA 3DM9B 1C9KA 1E79A 3L8ZA 4LHVA 3S1AA 1TQ6A 3LWNA 4N3NA 3RHFA 1NSTA 2ZYWX 4DCSA 3KKPA 4HUQB 1GZSA 2BCJQ 4JVMA 3ICQB 3OFND 5FPHA 4KFSA 4M2LA 4ZV4A 2JLUA 3UK6A 3UMRA 3ZZUA 4OHWA 1P75A 1S1CA 1OFHA 2WMOB 4X8OA 4Q9JA 2OZEA 1XJCA 1G9XA 5EE0A 3VU9B 3I92A 3KJEA 2ZI6A 4MKIA 2I4IA 4FMCB 1KAOA 1WP9A 3SHWA 3QXSA 1D5CA 2ECKA 3U3OA 1XZQA 5JCPA 1H8ED 1E94E 1ZNWA 2ZRJA 3AP3A 3ZQJA 2HXYA 3FMFA 4XIGS 1WCV1 1MO4A 3KDSE 3EC2A 4ESVA 3KKMA 2F6RA 3AVQA 4HUQA 5EXSA 5JRJA 1U81A 5DN6A 2YV5A 1AM4D 1CS4C 4LOAA 4D82A 4B3XA 5LDDC 2CCJA 3D31A 1MT0A 4HDQB 4Q01A 3VU9A 2IF2A 4HB0A 2F1IA 4QXAA 4IRUB 4JKYA 5JS8A 1OJLA 2JIZD 1UPTA 1ZC3A 2ZAOA 1LF5A 1XTKA 4NCKA 1ZRHA 2PJRA 3VMFA 4BLRA 2IUSA 2AXPA 2HF9A 5H68A 3W6NA 3FPAA 1SXJE 2P5SA 2PX3A 3VFDA 4GL2A 5SZHB 2ANCA 3IUYA 1U8ZA 2ANBA 4EPTA 1RFLA 3SFZA 1JEDA 3X1WA 2HYIC 1PLKA 2EWWA 4LSGA 5H8WA 1RYHA 2ZS9A 5C46F 5KSOA 2G6BA 3UXMA 4DLRA 4IDQA 4XWKA 1HH4A 2NO6A 2Q9BA 3SN6A 3REGA 2GAOA 2XNDD 1MV5A 4W5JA 1ZIPA 2BKEA 4GMXA 2IHYA 5JWOA 3PCRB 4C4PA 4TL9A 3B85A 4QHTA 2VF7A 3PQCA 3BE4A 2IWHA 4C9BA 3KKNA 3I73A 4I1VA 4Q1CA 4A4DA 3WRXC 1E9BA 5BW8A 4RCZA 3E2IA 1FW6A 2V7QD 4PPFA 1W36C 2P0EA 1XP8A 3OEHD 2LKCA 5AK0A 2HJGA 3CNNA 3O8BA 4GZMA 5B2ZA 4B2PA 2GXAA 1EFHA 2J7PD 1OB2A 1ZU4A 4H9GA 2ODWA 2OCBA 3FKSA 1E9FA 4PHHA 1OYYA 2VL7A 2GEDA 4C30A 1EWQA 1O3YA 2IYZA 4IOKA 2BWJA 2HF8A 1WBDA 2QT0A 1AGRA 1T3SA 1KYIA 2LKDA 2BOVA 1KKLA 2Q0HA 3LQQA 3ZS9A 2VHJA 1W5TA 2C9YA 3PIRA 2I1QA 3W6OA 5GADl 1OSNA 2NPIA 2FZ4A 2BBWA 1CU1A 2ZJOA 4JVNA 1VG8A 4LYAA 3VR3A 4XVRA 5JSZB 1AKYA 1W4CA 4P32A 3N2EA 3ND9A 3E5HA 2OAQ1 2V4ZA 1JPJA 2ZRBA 1P2VA 1K5DA 3OF5A 4OQNA 1II9A 3SQWA 1KNQA 1VIAA 1OPXA 1COWD 4NL4H 1XTRA 3GCGA 4PPNA 3P20A 1ZM4A 2YVUA 4NCIA 4BZQA 1XMIA 4WIAA 4WOPA 2CK3D 1N5LA 3R20A 4U02A 1RKBA 1NP6A 4OQMA 1IN8A 3VR4A 1OB5A 5FBLB 4QGAA 4DLTA 4HLQB 4WZAE 1FNNA 3EPJA 1G18A 5CM8B 5HPYB 3N2IA 1D8TA 2W00A 4KYUA 5JSZA 4M1YA 2IYTA 2RKOA 2Q3FA 2I3BA 2WKRA 5EXXA 5AUPB 1TMKA 1M34E 2C78A 3CR7A 4BLTA 1G4UR 1MO5A 3I8XA 2ZRPA 4TLEA 1N6PA 4Z8XA 2WOOA 1RYFA 4JBXA 3KL4A 1R0WA 1VDZA 1WQ1R 3FYHA 1G4AE 3NTUA 2F7SA 4IDHA 1JBKA 3TAUA 4Y0VA 1SVMA 2GZAA 3AM1A 1UDXA 4FWIB 3R8CA 2JA1A 1Z63A 2J0VA 1DPFA 5FI0B 2FNAA 1RRGA 3EASA 1IXSB 4FW9A 3Q7QA 2Z83A 2JEOA 4QJ4A 2QMOA 5EE1A 5GJBA 1N5JA 2TMKA 4NZYA 1NRJB 3NIBA 3I5XA 4KVGA 5KDOA 3C5CA 1ZUIA 3LBNA 2IYVA 4LCBA 1YZTA 3QNUA 4X8LA 3RLFA 4DDWA 3BWDD 2NG1A 5J4LA 4OL0A 3NKVA 2GZHA 3BGWA 2QTHA 2G1JA 2E87A 2HEIA 4A2WA 3QOFA 2A9KA 2WSSD 1Q3TA 3M4YA 1IQPA 1LY1A 4LUCA 4MKHA 3C8UA 3BXZA 2MSEB 2F55A 4R98A 2QENA 1SVSA 2GBLA 3IBGA 1D6JA 2OAP1 3T1VA 2C95A 2FEMA 2JLRA 3K53A 3WBJA 2WJVA 1F6BA 5AWFC 4B3DA 2ZETA 3NH9A 4Q1EA 5F2EA 3SR0A 4PO8A 4ZDIA 4LV5B 1QVAA 4M9ZA 5FTLA 1ZJ6A 3GLGB 3CPJB 3SC3A 1QHHB 3GP8A 2ODBA 4PC3A 2ZAMA 3HR8A 3U6KA 2IYUA 1KI2A 5IK2A 1L7VC 4GZLA 4MDEA 1NN3A 4NYJQ 3GQBA 2ZROA 3FHCB 3B60A 4WAUA 2Q6TA 2P6NA 1LF0A 1R0YA 2HYDA 2NO7A 2IA5A 2IYLD 3QF4B 4AURA 1E9AA 3MWJA 5H70A 1E4VA 1DAMA 3RDPA 1XTSA 4A8JA 5F9FA 4JLDA 1E9DA 3FVQA 4D0LB 1M1YE 2ZI3A 1E79D 1LVGA 2RGGA 3RWMB 4NP6A 3GLGA 3TUZC 1XJ0A 4MRRA 2ZJYA 2YHSA 3KB2A 2CE2X 4IKEA 3PEVA 2ZQ5A 1Z22A 4GBMA 1G21E 1NF3A 2RCNA 3IEUA 2J41A 1JQLB 5TY0A 4BUJA 4TL6A 1ESNA 4TMTA 4D2IA 3NEYA 4V0KA 5FTKA 1FUUA 2B8TA 2E1RA 4R7ZA 1YVDA 1OXXK 1XTIA 2ZR0A 1NJGA 2ZR7A 2IWRA 1I2DA 2QQ0A 4GFDA 3AKYA 3EG5A 1ZM9A 3GLIB 4YC7A 1QHNA 2OCYC 2QT1A 3BAFA 1XXHB 4Q47A 4Q7LA 4CDGA 1TNDA 5CJ2A 3A4NA 5FPTA 3SYLA 4OQLA 4V03A 4B76A 4QKQA 5DN6D 4IOJA 5C18A 1M6NA 1G8GA 1ZBDA 3B1YA 3GFPA 1BMFA 3RS0A 2PCJA 4NH0A 1U9IC 5FTNA 4PZYA 2VTKA 3CZPA 2NO0A 4PFSA 1Z0KA 4PC2A 2OUKA 5LD2B 2GTPA 4LDJA 2OHFA 3DOFA 5KSYA 3I5YA 4B43A 1GM5A 821PA 6Q21A 1P2UA 5EP4A 4DCUA 5KYKA 5BXQC 1PV4A 4MGYR 2IUUA 3THYB 2QP9X 5JMTA 1MH1A 1TU3A 1U90A 1XXHA 3L0PA 4GI7A 1ZD9A 2FWRA 2GETA 2QZ4A 1FTSA 3TIFA 2YOGA 3QEJA 3W90A 1XPRA 1SULA 2H1LA 4DCVA 3WNDA 3DL0A 5FH9A 1DAFA 2OO7A 3DVLA 1D9XA 1OIVA 2F1JA 1KMQA 4FI3C 3QPVA 1HE8B 5A5GA 2WHXA 3KB1A 4V0NA 2GHIA 3B8HA 3UWKA 3I62A 1I4LD 1YE8A 2FSFA 5FFMA 2BMDA 3ADDA 3VKGA 2OFXA 3TH5A 4XSHA 1IN6A 4ACBA 2QI9C 1P3JA 3BB3A 2IK8A 2RGNA 4D4MA 5GJWC 4TMZA 1GILA 2ZRDA 3ZGXA 2F9MA 1CULC 1W44A 3P32A 1UM8A 2QRNA 4QOSA 4C0LA 1E69A 3IO3A 2KWIA 1E32A 1VCMA 2JAQA 5CB6A 3CX6A 4DVGA 4JLJA 2V54A 5AUNB 3FKSD 2H18A 1T5IA 2QAJA 2WJHA 1B0UA 2ZYUX 2X77A 3CRVA 3G82C 4K8OA 5K8UA 1SZPA 3NDPA 4KFRA 4NONA 1JB1A 1RIFA 2VSFA 1G3QA 5EP1A 5FPSA 3RRYA 4L5BA 1CR1A 2BMJA 1XU4A 2GCPA 4AG5A 1Z2AA 3OIVA 2VHUA 4E5UA 4LY6A 2IYYA 1UBGA 2V1XA 4M1WA 4AKEA 1F2TB 3WMGA 4NYJR 4AKHA 1T0HB 1ZM2A 4TLCA 1U98A 2Z0MA 2UKDA 1Q0UA 2BBTA 3HU1A 2F3RA 4D80A 1RRPA 2A5FA 3CPEA 1RC8A 1E0KA 3HYRA 4DKXA 3U4QB 4YXWA 5FR1A 3SU8A 4BZPA 2JJ8A 3IGFA 4KO8A 4ASUA 1WE2A 2KI5A 1J90A 1IN5A 2ZRKA 4Q66C 4D26A 1P6XA 4A0RA 4YMVA 2HT1A 4KFUA 4Q4JB 1L8QA 4TMKA 4TLAA 1F2TA 2JJ2A 8OHMA 3KQHA 4US2R 4M53A 3LRPA 5DLQC 2ZYVX 4A9AA 1QG4A 3B13B 1SVLA 2A78A 3KQNA 2R8RA 1TQDA 1UKYA 4ACAA 2A7QA 1FP7A 5L3RA 3U4QA 4UKDA 1I4TD 4L4UA 1OH6A 2ZSEA 4WXRA 4CEJB 2A5DA 4D81A 5F98A 2FG5A 3E1SA 1E2LA 2XAUA 1E2IA 4HEJA 4LZZA 4XH9B 2QA5A 2ATVA 3PUWA 4Q4JA 3LLMA 2VIIA 4PAQA 3OIUA 1P2TA 3A4MA 3QXJA 5FL3A 3DZDA 3R9XA 4M1KA 5L3VA 1BO6A 4D4JA 1FX0B 4LRWA 1Z47A 1N6NA 2WOJA 3M0EA 4ZDWA 3BFKA 3Q9LA 3RANA 3MJHA 4DUGA 1U99A 1P60A 1SGWA 2WWYA 4DIEA 2G1KA 4Q9HA 1W48A 3JZAA 2CJWB 1T3LA 2GILA 2O0JA 4TN1A 4D25A 2REOA 3RSLA 2FX3A 4CEJA 2FEOA 4UNPA 3JVUA 4Q21A 4KV9A 3T35A 3O8DA 4KVAA 4US0R 3G5UA 1DAGA 2AD1A 1BKDR 1IAQA 3AUYA 3FMOB 1OFUX 4CIDA 1E2KA 4MRPA 4LHXA 1EWRA 5F9HA 4RSGA 3EAQA 1DVRA 4MA4A 1NN1A 1DTSA 1II8B 1FX0A 1XEWX 2OV2A 2PLFA 2UZ3A 2ZUBA 1KSFX 3FE2A 1ZD8A 2QM7A 4D6PA 3QG5A 4JMPA 1E99A 5DISB 1BH2A 1YZKA 2VO1A 4JZKA 1S4QA 2WVJA 4PO1A 1Z8FA 1T8UA 2CJWA 2DFNA 1E4YA 1ZD1A 2QGZA 3ZVNA 2EFEB 4OI0A 3ASZA 2WJJA 4HDCA 4HAVA 1HUQA 3LAWA 3UANA 3K9GA 4LJ6A 4YLGA 5IK2D 2CL7X 4F93B 4HLCA 2D2FA 1KI4A 3GEHA 5BN3A 4YDSA 3L82B 2ZREA 1MRNA 1N6RA 2CDNA 4J0QA 3L0IB 4Q02A 1QG2A 4HI0E 1TQ2A 2F1HA 1UF9A 4BE7B 2O8EB 2ZJBA 3B1VA 2FV8A 4HLDA 1CTQA 2LWIA 5A0FA 2JLZA 1C1YA 4MDFA 4IXNA 1Z6GA 2QG6A 1IJFA 4EQ6B 2PBRA 2PEZA 4PAMA 2H16A 1VYVA 1UBCA 2GJ8A 2WV9A 1H8HA 2YZ2A 3SE0A 3U7FB 1Q22A 2O52A 1E2PA 1AZTA 1AQUA 1N0UA 1WDTA 2CXXA 3SHFA 1Q1ZA 1G5TA 2AWNA 1A7JA 3C5HA 4ILEA 2AWOA 4QC2A 3CX8A 5SZIA 1T4GA 5FPKA 2O8CB 1CKEA 3LFUA 3DPUA 3SJCA 4TZ0A 1B23P 4YDHB 2NMVA 3FWYA 2IYXA 4DZZA 4OJKA 4TTQA 1AKEA 2O8EA 1Z6AA 1VCIA 4TSFA 2QGNA 2P2LA 1S3GA 5D3QA 3NC1C 4N0EA 1XEWY 4KXFB 4EKDA 5LPNA 1DADA 4OYHA 1ODFA 2QTVB 5G53C 2JLXA 1R6BX 2WSMA 4PSKA 4F4IA 2VYFA 3LX5A 2IEYA 2OSBA 2DCUA 4MRSA 2OT3B 5JZVA 2KB0A 2Q9AA 3LA6A 4QBFA 2SHKA 4A15A 4OQFA 1R4AA 4IVQA 2O8CA 1NLFA 4PHTA 2XSZA 1P4SA 3K0CA 3PXGA 3REFA 3V4RA 1G41A 1Z08A 1L2TA 3PV0A 4W5WA 1BMFD 5BYJA 4DSNA 4CGZA 3PEUA 3LVRE 2J0QA 3GLHA 1KJYA 1GVNB 1XCMA 2OLJA 1Z0JA 2FN4A 1OT3A 1NLYA 2ZJ5A 3OIYA 3GJ8A 5CIWA 1FTNA 1OXSC 4HAXA 4QFMA 2OE2A 3BJIC 1TTTA 2GXUA 4RKEA 2XB2A 5K8LA 2GCOB 2DFTA 3IIKA 4A82A 1R7RA 3K9NA 4FCWA 4ZIRB 1YQTA 1OXTA 4LC1A 3TMKA 1W49A 1KI1A 3SYNA 1KO7A 2MMGA 2R6GA 5IT5A 4L16A 3BFXA 2QRZA 3JVVA 2ZRMA 1YZNA 4AYXA 3CKLA 3AVTA 4JLNA 1RRCA 3N70A 1N6IA 1YR9A 2IW3A 5TDHA 4Q03A 5C1BA 2GBLC 4YONB 2R6AA 2ZE6A 2GCOA 221PA 4EPRA 5G3ZA 1WRBA 2ZRGA 4ZIRA 1G1MA 1W1WA 2VP6A 5L3SB 1KDTA 4P33A 3KQUA 1A82A 1MR3F 2PZEA 4Q7KA 4C2TA 3A6PC 4YMWA 2VSOA 1GUAA 3KKQA 5KNBA 3AF3A 2P6RA 2JLQA 1AQYA 2V6IA 2EVWX 2A30A 2GK6A 2ZSDA 1K6MA 3ZZTA 3O8RA 3V4FA 1XF9A 2D3WA 5B57C 1DAIA 1JJVA 1G20E 2GVDC 2XXAA 1UKEA 4FCVA 3IIMA 4QBHA 2W83A 2EW1A 1T9HA 4JVSB 4JS0A 4BLSA 2IYRA 3OEEA 4A8JC 4KHZA 4C2UA 3U6BA 1SVKA 3EZ6A 4LJAA 5L3SA 2EYQA 4B44A 2ZVQX 4LPSA 3RS3A 3U3MA 1NNEA 4DLUA 4YMTA 4M1TA 2XOKA 4WBSA 4TL7A 2XTNA 2VHQA 2XGJA 3H84A 1TF5A 2ERXA 5D3MB 5LB4A 4C0HA 5FBWB 4KJZA 3AF1A 3HJNA 1BYIA 2WM9B 4EIWA 1XTQA 3BOSA 2VBCA 2KSQA 5FBVB 1CJTC 2RHDA 4RVCA 1JXMA 5FTMA 4ASUD 4B75A 2QQEA 2ZTSA 3F0TA 4WXPA 1UAAA 1KI3A 3UG7A 4Q9KA 1SVWA 2X2EA 2ZI4A 5CM9C 1GNRA 1XD9A 3ICEA 2QL6A 4P4UA 1AS3A 2JJ2D 5G40A 4Q1AA 3EZ2A 1AN0A 4Z1MA 2PH1A 2ERYA 2NGRA 5D3MA 4TL8A 4C0AC 4GOKA 3F5FA 5E4FA 4NYMQ 1JJ7A 2DFLA 3TBKA 3VR5A 1UBFA 4PSVA 3TSZA 2D7CA 4G5RA 2O0KA 4F92B 2W6IA 1VHLA 3QE0A 4C0KA 4GRAA 2IHBA 3X2SA 1OXVA 1ANKA 3EC1A 5E7JA 1VPLA 4OBEA 4LHZA 1YR6A 2ZITA 4EUNA 5AJVB 4PZLA 1R5NA 1G7TA 4E22A 1AA9A 1K8RA 4B33A 4LPKA 2F1RA 4A36A 2CVFA 2HJVA 3EW9A 1HT2E 3QSYA 3EIEA 4EPWA 2VRWA 4DUGD 1Q3HA 5CDFA 3HP1A 2VEDA 5LD2C 3OAAA 5J5CA 2ZANA 4KODA 1VG1A 4JLAA 1NVUQ 1ZW6A 1N0WA 4AY2A 1VTKA 4LI0A 3SEAA 3PITA 4S35A 4GT1A 4XVQA 5DH9A 3I61A 1SXJB 2IS1A 3R9IA 1OIXA 3KQLA 2J3EA 2RGNC 1Y3AA 1IXRC 3RS7A 4G0NA 2MSDB 2JASA 1YJ5A 2PJZA 4G01B 4QBGB 3SJAA 4GNKA 3HU3A 4RD4A 1EESA 2J87A 3W8RA 2DWQA 3QG1A 1Y63A 2YC4C 1KJZA 1VECA 4C7OB 3K09A 5EQTA 3ZDQA 2VSXA 3EPKA 3U60B 4ZCIA 3B9PA 1FMLA 2KJQA 3UG6A 4M21A 2VH5R 4KU4A 3QF7A 1JI0A 3TRFA 3CB4A 1E0SA 4ZDJA 1P61B 4UNNA 1W5SA 1YR7A 3AVXA 4TMXA 2ZE8A 3BD9A 4NE2A 2EFHB 1ETUA 4TYQA 521PA 2Z4RA 3GJ6A 4OI1A 1RPZA 2ODEA 1P9WA 2W2XA 4D0NA 2WPDA 3P1JA 5EUQB 4C7OA 2W0MA 4CRWB 1U2RA 1Q1QA 3BORA 4KITB 5EJEA 1H8HD 2C77A 1E0JA 1VHTA 1KO4A 1G3IA 4TMVA 5FBQB 4RFSB 1KJWA 1FMJA 2XZLA 4KI0A 1G6OA 1X8KA 4TZ6A 3QEOA 3V00A 2IYQA 1WF3A 2IYWA 2R2AA 1W46A 4C0JA 1FFHA 5K8IA 4UJ3A 4UNSA 1KO1A 4URZR 4EJSB 1S3SA 2OXCA 1U8YA 4B2LA 3R9WA 1Q12A 2UVQA 4PHGA 4TSFD 4BQSA 1KK1A 4NBSA 3T34A 5HR5A 1N2CE 2W58A 4TQUS 1AS2A 1KO5A 2H57A 3PVSA 2BM1A 3SNHA 3EA0A 4FMDF 1E2JA 2IEZA 5FOXA 3THWB 4BFSA 4RFSA 1F60A 3L0SA 1IM2A 3AVVA 3P26A 4HUTA 1EFRA 1KI8A 5E95A 4EJSA 3CF6R 3VX4A 3LW8A 4B34A 1Z6YA 2AR7A 4DLYA 1ELOA 3FB4A 3NHBA 2CLSA 3DKPA 4K81B 2AFIE 2ZU0C 2H7VA 2IBMA 4ZDKA 3P4YA 4V0OA 3GJ7A 2IC5A 3ADCA 1G291 4FMCF 3QKUA 4IDOA 4NYMR 5JBQA 2WJGA 4QBIA 3THWA 5F3WB 1NKSA 3RNLA 4EFNA 3WRYC 2QMUA 1ONBA 1VCNA 2GEUA 5CITA 3SOPA 2ORIA 1XZPA 4RY2A 4EFLA 4AG6A 3DMNA 5M04A 1G8FA 1N5KA 2XJ4A 3FGNA 4IVPA 5HKKA 4B71A 4A0FA 4AWXA 3EZFA 1GRRA 4GMDA 4H1VA 1E2FA 2B8WA 4DSUA 4GDFA 1SKYE 4JLMA 4AI6A 1KZ7B 3LBHA 4OQXA 4EFMA 2XTZA 4G5OA 1R5OA 3X1DA 4PX9A 2C8VA 3P27A 2FDCA 1NVVR 3TGPA 1N5IA 4W5HA 3FMIA 5JWRA 2D7DA 4QJ3A 1GKUB 1S8FA 4BEBA 2AN9A 1A2BA 1EX7A 4MGIR 1MRSA 3OIWA 4JSTA 3TJZA 3CNOA 1EK0A 3DOEA 1GIAA 2DWPA 3QPWA 3ZLJA 3RWOA 4PR0A 5JEDA 3Q85A 3VKWA 2OFWA 3ND8A 4OHZA 3EPLA 1G3UA 2XX3A 3AVOA 2IT1A 4JJZA 2G77B 1XEFA 1G5PA 1GKIA 3BB1A 1C4OA 1W47A 1XWIA 3CF0A 4A6PA 3OEED 2PZGA 3IHLA 4ABYA 4AC9A 1YZLA 1P7CA 1QZXA 1W2GA 4R2IA 1KNXA 2VHCA 1XD2B 1CXZA 3U61B 1QHHA 2G0NA 2XOKD 4ZKEA 5KSZA 3K0FB 4NCJA 2GF0A 2R6DA 1GFIA 2YWGA 4MYUA 3EA5A 2BHRA 4U7DA 1Q1EA 2CLDX 3OHMA 3KJIA 4F91B 3B5JA 3NHAA 1AS0A 1VG0B 1Z0AA 3QF4A 1RJ9B 3SBDA 5L3QB 3R7WB 4FXPA 1E98A 1CF4A 1IY0A 1IONA 1QVRA 5JWHA 1U0LA 2NZJA 4UNQA 4UXIA 2ZJAA 1XD2A 3T15A 5KU1A 1RE0A 4TWZA 3K0FA 3U3KA 4FINA 5KUTA 3TSWA 4IEEA 4AD8A 4Z1MD 1W7AA 4QM6A 1E9RA 2G9NA 1JR3E 3K0CC 3WP0A 3BB4A 1E1RA 3EIQA 1QDEA 1LNZA 1RJ9A 5EE3A 4DWJA 5L3QA 3WNCA 4B2IA 3EWAA 3O8CA 1TQ4A 2C5LA 3FOZA 1CRPA 3HYTA 1SHKA 1GL6A 2R65A 4LBZA 2C96A 2RH5A 5SZJA 4EPVA 1GOTA 3GLIA 1X86B 1X8LA 3CLVA 4DLSA 4PXAA 3OZXA 5AJZA 4LJ9A 4WZBE 3EIHA 4ZCMA 4QRHA 1DBSA 3DKVA 2G3YA 2QORA 2KBFA 1F2UB 5GJCA 3SQXA 3CH4B 4M4SA 5JI2E 5KSPA 5CJPA 4TTPA 5TVKA 1FNMA 2OESA 3KQKA 2FOLA 4AYTA 1RRFA 3D8BA 4ZKDA 1JAIA 1S0UA 4Q7JB 1LB1B 3B9QA 4M9SA 4B48A 4B74A 2GXQA 2YOHA 3OAAD 2IF0A 1ESMA 3KJHA 4FMBB 3PEYA 1E2NA 3VX3A 2W2VA 1E9SA 1I2MA 3W3AA 4P0TA 1GITA 1Z3IX 2FA9A 4FN5A 3U7HB 3THYA 2JLYA 4M0LA 3UWOA 4BZXA 5KPJA 1VMAA 2GAAA 2WAYA 1EX6A 1WA5A 1R10A 2J45A 1IXZA 1F2UA 2GJKA 1YU9A 1LW7A 4EPXA 1F5NA 1XEXB 2ZRHA 2DHRA 4MQBA 4BFTA 3PUVA 4Y0AA 1UEJA 1R2QA 1TADA 4ESHA 3QBTA 4A0HA 2WZQA 4Q7MB 3A4LA 2BBSA 1GTVA 2C04A 3THXB 1JNYA 3NBXX 1Q44A 4Q19A 3DZ8A 2FSHA 1Z0FA 2X1VA 3AF0A 4L15A 4URWR 1BS1A 4DB4A 2OBNA 5EP3A 2ZRCA 5TMPA 1OH5A 3GLFE 1E2QA 4XWAA 4F4JA 2P3SA 4LV8B 4RZUA 5AUOB 4TQAA 1ZMXA 5AR1A 2BEKA 1IHUA 1XFAA 1XEXA 4HYYA 1HV8A 2QU8A 2B7CA 3HR7A 2NPFA 1FZQA 2GKSA 5KHOC 2O8FB 1LV7A 2HCJB 2GA8A 5HZHA 2PL3A 3V9PA 3X1XA 2WPDD 4DIDA 2NQ2C 3LX8A 1KSJA 5FTJA 3J81k 1J70A 2P6UA 2YINC 1A4RA 4PAOA 3T5DA 2REXB 2J0UB 3C15C 1QHGA 2A5JA 1CBUA 2XZOA 1NMYA 3CONA 4CT5A 4B6EA 2Z5FA 1FPMA 4C0BA 2IUTA 3TVTA 3PENA 1S1MA 1ZIOA 3CWZA 2ORVA 1P9RA 2F43B 2QUZA 3A1WA 2RGAA 3T06B 1UEIA 3NH6A 3QI2A 2JLVA 1E9CA 2V9PA 2RB4A 5JHGB 2O8FA 4W7SA 2O8BB 4URVR 2PT7A 4QNRA 2ZSBA 1XDBA 3SI7A 3ZYCA 3ZZ0A 5JCZA 2XJ9A 1J7KA 1ZVQA 1OLOA 5BWMA 1P2SA 3RS4A 5JHHB 3G0HA 1OF1A 2J0UA 3ADKA 1H65A 3KXLA 5CYOA 2QAGB 1JR6A 1E1QA 2NO1A 2VLIA 1EFRD 1S96A 1EFCA 1QHIA 2WIBA 5JI3E 1X8JA 1FP6A 3JZMA 2FFAA 2GDJA 1EFTA 3KXKA 4OK6A 3AB3A 4BFWA 5K8TA 2O8BA 2AK3A 1JALA 1ZCAA 3PJRA 4DDVA 3VQTA 4URUR 4M1SA 2AD5A 1KI6B 1BOFA 2CE7A 5C2JB 1K5GA 3SBEA 2C2HA 2CMKA 1US8B 5KNCA 2AKAB 3IPYA 2QAGA 5CLLA 3X1ZA 3LW7A 1WBBA 4RD3A 3PUZA 3QVVA 4P4TA 4RFVA 4V0ME 2KE5A 3VAAA 1Z0IA 2XEXA 3Q72A 1UKVY 3CO5A 5FR2A 1XCGB 2QY9A 1NVWQ 3K1JA 5BYKA 1JEEA 2J0SA 1KIMA 1IN7A 1TUEA 4RD0A 4HAUA 5E7IA 3LLUA 3DO6A 5HKKD 2B92A 1KI6A 1NMZA 5C4MA 4OHVA 3BH7A 3GJ5A 4XD7A 3AV0B 4EAQA 2V6JA 4A1FA 2WAXA 5HE9A 1US8A 2BM0A 4KLNA 3ZJYA 4PZZA 5HCIA 5FOSA 3T5GA 4IW3B 4B6FA 4ZPXA 2MSCB 4IDNA 4M8NE 5JS7A 1NVXQ 4X8MA 4I81A 3UPUA 2PT5A 4IJMA 1J99A 1ZC4A 3K09C 4HSEA 2H92A 1W4RA 3KFXA 1E9EA 2ZE5A 1N3BA 1Z83A 2WWFA 2MMCA 5EP2A 5TARA 4EDHA 2QE7A 1AK2A 3CM0A 4O2RA 4RCYA 4UQOA 2PMDA 1JAHA 1XB2A 3HWSA 3B78A 5B58C 3AVWA 1QRAA 1II8A 2W6JA 2C99A 1OV4A 3QXXA 4I1SA 3UMFA 421PA 2FGKA 2J7PA 4MGZR 4DSOA 2WWWA 1YR8A 1X3SA 1FQJA 1ZNYA 3WBKA 3LBIA 1G3MA 4G1UC 1CJUC 4JLBA 5FUYA 4MRVA 1XJQA 3NC0C 4QM7A 2ZJ8A 2R62A 4O2LA 4GP6A 4R2HA 2OFOA 5AJYA 4DSTA 2CEAA 3LD9A 3M6AA 3NBZC 4TMWA 3T1OA 5JJKA 1NLZA 2D62A 3GLHE 2FMXA 4BGDA 4QJ5A 3LQRA 3THOA 4EPYA 2R9VA 4HZUB 1ZUHA 1ZP6A 2EYUA 3BFVA 4LJYA 1A1VA 5J40A 4JT4A 1KKMA 3VR2A 3TW8B 4EQ6A 2ONKA 5HE8A 1FUKA 1U0JA 4G5GA 4QNMA 3T1TA 3MUFA 1KTVA 3QKRB 2BKUA 5DI9A 1TUIA 3OE7A 3U3RA 2WMNB 2CK3A 1CEEA 4P31A 1M2OB 1HYQA 2GCNA 3MWLA 4S2EA 2QROA 2E9SA 2B6HA 2QEQA 4B3FX 1XX6A 3FHOA 4EJSC 4HZUA 2ZPTX 3P4XA 1D9ZA 1UJ2A 2DY1A 1NN5A
chains in the Genus database with same CATH superfamily
4MI6A 2FWJA 3U44B 1RXVA 2QTVA 4M0FA 3H6GA 2CF6A 4L27A 3NPMA 3L8MA 2BGNA 3HJRA 2DRIA 4BVKA 4JUBA 3LBFA 1NXTA 4NDAA 3H42B 3QY0A 1PSZA 4PPQA 4JP2A 1TKCA 3GJZA 4PN3A 4FEGA 2OQIA 2UZAA 3ANNA 4QPDA 5BRJA 3D6UA 3C4QA 2WKPA 4QODA 4MR9A 4N6NA 2PZBA 3KKOA 1J22A 4ZHQF 1I5EA 3FIJA 2H4HA 2BJWA 3VZDA 3QPAA 4JOCA 2Z5VA 5JEEA 4P38A 1F8UA 1HY3A 3ZVKA 3WJ2A 2O2XA 2IITA 3LIPA 3S99A 3R5XA 5BSTA 2RK3A 2EATA 3NGXA 3GJ4A 2C0CA 5AW5A 4BBJA 1L0BA 1TECE 2ZSJA 4CIWA 1LBQA 1P8AA 4MW7A 3I9FA 1IATA 1XDWA 5JO9A 4FCTA 3WV4A 3MIZA 1VG9B 2FMIA 3JWGA 3OCJA 1OROA 3QA9A 3NETA 3KYJB 3W3AD 1T35A 4M0DA 5JW6A 5L7TA 2JATA 3K31A 2GRUA 3GEIA 4ILKA 2VK4A 2Q6IA 5D85A 1IXYA 3AI7A 3LCVB 4X6LA 1N57A 4EHBA 1GSIA 1ZMOA 1S89A 1PTJA 1CLUA 4RLQA 1BCRB 2CMDA 5D87A 4NIMA 1KC3A 1VE3A 2OGUA 1MIOA 4IH4A 2F3PA 4MW2A 3CG0A 1GYQA 4HS4A 3TLKA 1T1JA 2ZYHA 2Y1DA 3HB0A 3U7QB 4DRZA 3DO5A 2IS2A 4FR2A 1USVA 3BX1A 2APJA 3BM5A 2KLBA 2HC9A 3BMNA 4X3CA 5J4HA 1GNTA 1TF7A 4HGNA 3O4JA 3EXAA 3QKTA 5B30A 1GG8A 1AHHA 2WG2A 3IQEA 4PGMA 1C81A 2JL1A 3RWBA 1UANA 2JJYA 4RHCA 4D92A 1DG1G 2YQZA 3WLNA 3AO0B 3GY0A 5DYTA 3NHYA 4NICA 4D97A 1MOQA 5H9WA 1Q50A 2YV1A 1A9XB 3X1YA 2RD2A 1URPA 3JRXA 1VL8A 2J9ZB 3A6LA 3N5CA 4JUIA 4UJ5A 5AIAA 4XM2A 3DF7A 3WZMA 4D8WA 5TEWA 3RIHA 2XYHA 3PB3A 4ZT2A 2DFKB 5KCZA 4HUJA 1RBYA 4BY9E 3GJ0A 3RVMA 3H0EA 1U94A 5ALIA 1N6OA 1NQXA 2J5KA 3P4UA 4HATA 1GQOA 1RKQA 2BMFA 2VBFA 5G3YA 4ODIA 1SCUB 1V7ZA 1XCLA 1YDMA 1CT9A 4HCJA 3JQBC 1X1BA 2JRLA 4IGFA 3SVTA 3UJPA 1BROA 3OLZA 3GJRA 1IQ0A 1SG6A 2P5TB 4J94A 4RK1A 4ZOLF 4C5AA 1BMDA 4WA7A 5CDYA 4F1JA 3O38A 3ZW8A 5LBIA 5C34B 4R1NA 3WMWA 4K0KB 1A5BB 1HE1C 4XA8A 1MGPA 2A9JA 2JJQA 5ICGA 3CNQS 4PTLA 1DIGA 3KIPA 4OSPA 5DRYA 4NAVA 4L8GA 4EVRA 3G59A 2Q4RA 4YACA 4GE3A 5FBRB 1N75A 3I8OA 3KDAA 4KQHA 5BVHB 4F3RA 1LS1A 1ORRA 2AXEA 1O6FA 4WLUA 3V6LA 1U0GA 3GEPA 3WWYA 4NNPA 2HDNB 3VYRB 1BWRA 5CP8A 5BY2A 3G13A 3I9NA 3IQIX 1L5NA 4LRQA 4O1MA 3B53X 3TLGA 1TU0A 1BOOA 3F5DA 2CBXA 3LO5A 3DUWA 3OM0A 4MS1B 4P58A 1OXKB 5JFTA 4Q3LA 5BSEA 3CY6A 1XJWA 4N7BA 3LECA 3MINA 2YHUA 5IJ9A 1D4FA 2YV4A 1ZINA 2P75A 2XRYA 4FZ3A 1G66A 3HXPA 4V38A 2B5VA 5EESA 3TLBA 4YYZA 1L7PA 4JEMA 4U2DA 2VK1A 3EPHA 1GGHA 2JCYA 2P2YA 3H9CA 1A50B 3ROGA 4AJIA 5GOZA 4O02B 1N7GA 3QVUA 2WEKA 1Z13A 3BKWA 3B3FA 4IIXA 3QX8A 3C3JA 3GPBA 2J3HA 4N18A 2OBLA 4E6EA 1HQYE 3H2GA 4YDRA 3CUYA 2HMUA 4EEZA 3PPWA 4HMOA 2YWEA 5EKSA 3IAM1 4MYTA 2A5GA 4TTJA 1RQRA 1II0A 1JW9B 3F4KA 3SYKA 2HQRA 4MITA 2DKNA 5B1EA 2E4AA 2HCBA 2FSIA 5ENVA 2JCSA 1B7GO 1AXEA 1DQNA 2BFDB 2UYOA 2DUUA 2XOEA 2HA5A 4F8EA 5C8ZA 1U5BB 3EUEA 5EKXA 4ZALA 2AW3A 2ZVDA 4Y2SA 5B7QA 1DARA 1SVOA 3T9DA 1GNPA 3Q2IA 3OPXA 4OJMX 3JVDA 4QLBA 5B4UA 3PICA 3WGIA 3ZVLA 2CCGA 3NR2A 3OKFA 4GOXA 3UA4A 2I6GA 1UC4B 3PUYA 3OPQA 4XD7D 1EYZA 1R8QA 2IDMA 2O1EA 5BN4A 3MERA 3TMYA 3FW1A 2Z1MA 5JPCA 2XUZA 3QVTA 3ZJTA 5EZ6B 2GN2A 2OBMA 5IHXA 1I7DA 4IHAA 3L77A 5T4BA 2QZSA 2H29A 1O9GA 2IPMA 3DG9A 5IZCC 4MZDA 2AMLA 1EAYA 1Q84A 1Q7GA 3TCKA 1GXSB 3GVCA 4BB0A 4EMSA 3IUJA 1QC5A 4LVUA 4LF5B 4H7FA 2FCAA 1EGHA 3ZCSA 1QGUB 4YQFA 5CA1A 1V39A 3NDBB 5ESDA 5EHZA 2YIMA 5KYNA 2ZS7A 4E2YA 2GH1A 1BDIA 1D6SA 4O3FA 1E5VA 3B1XA 3NOXA 3L3BA 4M60A 3RUHA 3EXG1 2PNJA 1Y4SA 2A2ZA 1SXJA 2GESA 3PGA1 4RKWA 5HQTA 3Q12A 3RUIA 3H1GA 3UKDA 2E6UX 1UP6A 2EFGA 4BTEA 2VAWA 1T43A 4QL3A 1XZFA 3VJMA 1C9EA 3D8RA 3KTDA 3MILA 4Z3KA 1OH8A 1GAJA 2R97A 1SVNA 2VNJA 2O1XA 4EMUA 1RLOA 1U7WA 4OY3A 5LN1A 4ETWA 1GUBA 1YQEA 4ZO4A 1XNJA 3MRSA 3RU2A 3Q5EA 3RK0A 4ENTA 2DQYA 1U1FA 1VBMA 2OCKA 2NO9A 3A37A 3ZWDA 5KTYA 2JH8A 3WKCA 3PC6A 4ZHSA 3NBAA 1KI9A 2PIAA 2R6FA 2DR3A 2W8ZA 1LD3A 3B3QA 2IRWA 2IUEA 3KUCA 4KVFA 4ZO8A 5CB4B 1DAEA 1WMDA 1UPUA 1NDUA 2V0GA 4X7PA 3HCEA 4G5SA 4G1MB 1TEZA 1V8DA 1HMPA 2WZDA 4CM1A 2RHMA 1P5HA 4I50B 2YHAA 1WZ2A 3FIUA 5ER9A 1RM5A 2FQ1A 3ASYA 1L7EA 1SKQA 3L0OA 2AHOA 4X1YB 5CVEA 2O7SA 1PDWA 4K05A 3JZFA 2Q29A 5LZ7A 4P4SA 2NUAB 3CN9A 2ENUA 4JJFA 1Y9JA 1QF9A 3NEJA 3WYBA 3LSYA 2J46A 4C4ZA 1DKOA 3REQB 3TZBA 1V0JA 3H2YA 3NYQA 1TM2A 2PFGA 1R66A 5DI3A 4UOZA 4OXKA 3GRPA 1A2QA 1GWNA 3N07A 4IFEA 4WXHA 3TNFA 5TB5A 4IUBS 5DTMA 5AW8A 1PI3A 3EX7C 4AKGA 5A06A 4JI8B 4ZTZB 1WWKA 2YCBA 2O5CA 4RIIA 1JEJA 4TN5A 3P2IA 2PYIA 4LX8A 4EG3A 3L4BA 2DR2A 4HP8A 4JKOA 4JL5A 1OKKA 2GLUA 3ZWWA 3MCZA 3E3MA 3L5KA 3NG1A 3LCJA 1EFDN 2JGNA 4HVCA 1JLLB 3B2EA 5B53A 2QUJA 3TCXB 1LRJA 3LL7A 4FEEA 4WADA 3LCRA 3RRNA 3SLRA 2HO5A 1RE1A 4L76A 3EXIB 4U2EA 3B8EA 5KOHA 1VGRA 3O3CA 3EZ7A 4MYHA 4CIXA 2WMYA 2Z9BA 4EOGA 1OYOA 5ER6A 2ZSFA 3DLCA 5DT9A 2FB9A 2RH8A 2I4NA 1AF7A 2QAGC 2ZU6A 4YMSA 5D6OA 2Y0PA 3STXA 3R77A 3WYEA 3R7FA 2BEUB 1ZDMA 5GONA 3IAXA 3VR4H 3GPLA 1RXUA 2ZSIA 3CLSC 4ZQEA 2DKOA 2C98A 3GH1A 1WHTA 4ZI3A 4RE5A 3V1NA 2GEVA 1KWGA 3WLLA 2AFIB 3CRMA 1XL1A 4E09A 4Z7QB 4AKSA 2OHIA 1C0IA 2FEWB 5CFMA 1BW9A 2JGRA 4J7AA 2AR0A 4RU1A 3TINA 4JJ7A 1UINA 1W94A 3VA7A 1W8IA 1S5PA 1WDWB 2VF8A 5EL0A 5DK4A 4OM8A 1M34A 4Q1FA 4ENSA 1KK3A 3OJEA 3LTEA 5BWLA 1M1XB 2EGHA 5IJZA 1S3IA 2RGCA 3ZK7A 3OOYA 4C2BA 3NJ8A 3I3SR 1RWBA 3LNCA 3GLGE 4YT5A 5K51A 2WWIA 3GFQA 3KZMA 1XIVA 2OLKA 1BE1A 3AESA 4L07A 3LC7O 2WI8A 3A3YA 4MVJD 1KK2A 4OK3A 4WRRA 2YWFA 5BV0A 4CEHA 4G9EA 5LZ8A 1GPJA 3ZHYA 2HX1A 5IC5A 3QH4A 2A6PA 1AUOA 1G59A 4MVJM 3HA7A 5KYYA 2A0UA 4TYNA 1FU8A 1RYZA 2IY8A 4QVGA 5BN1A 3KJGA 1M0EA 2E5LB 2XUJA 3WY9A 3LYAA 4GP7A 1SKYB 3EH1A 2RG1A 2BZSA 2ZIZA 3W5UA 1CUEA 1VM6A 1T2FA 2VAMA 1K6IA 2GT1A 1PR2A 2JJ1A 1I80A 4HEA1 2ZUTA 4BLPA 1KYZA 1NUHA 2VDQB 4MUXA 2E2WA 4FZRA 2GAIA 2YL2A 5MN6A 2C4HA 1W93A 4CG2A 3TAHA 3K71B 2B21A 3L41A 4AF6A 3ZWAA 1ID8A 5TIIA 3BF7A 2VOJA 3V8VA 4DM4A 5EXEA 2CYAA 3PF9A 3M1AA 4WESB 4Q15A 3UV7A 1DBRA 1SK8A 1VE9A 2QX4A 5K0BA 4XJXA 2W70A 5C3MA 2ECOA 1N1GA 2ONCA 1G42A 4P53A 5FOQA 2AQKA 1G7CA 3VKHA 3G1UA 3FDZB 2NTJA 4IIGA 4MWGA 3BQ9A 4PGGA 2XGGA 4UDYX 4DC1A 4KQ6A 1H3NA 4B5LA 4F06A 3A2LA 1GN8A 1HL3A 1SC1A 2H5IA 2JVIA 2ON6A 2AYYA 3CWCA 3HP7A 4OHCA 2ONJA 3ZBQA 5DMXA 3AHCA 3QYPA 1JTFA 1O96A 3PWKA 2Q49A 4RJJA 3OZSA 1NBAA 2XXBA 1CUZA 2B25A 2JA2A 1F06A 1UAGA 3B70A 1P1FA 1PFWA 4OB8A 2GCGA 3BS4A 4PSUA 4CQMB 7AT1A 4FP9A 1SUBA 2ORWA 3PCTA 5DX8A 2QMHA 2X4LA 4UXHA 2FUKA 3W8NA 4NEQA 5GJVC 5CIYA 4BGIA 1Y89A 1TEVA 2H8KA 3UMYA 1R15A 1EIWA 3QUCA 1J39A 4M7RA 5E9JA 4EATA 1RAGA 1UMDA 3IPAA 2FP3A 2VWGA 4TLDA 3M6IA 2W6ID 3WWZA 1T26A 3DAHA 4LBYA 3NM6B 2X4GA 1ADCA 1MABB 4XM0A 4YJ3B 1OE0A 3ZIDA 2GN9A 1MTOA 3RREA 2E85A 1O77A 4MQ4A 1XPOA 3VYSB 5CR9A 3UB4A 1EWKA 1PBNA 3U7GA 4FSHA 5SY4A 4IV0A 2QTCA 2I78A 2HBRA 4NHOA 1O6CA 4HFMA 2BIFA 2XKAA 3M1YA 4X65B 1GHTA 3U4CA 3X3HA 1YVEI 2JAOA 5A4JA 2HWYA 5D51S 2VC2B 2W2TA 1MZPA 2GYYA 4RJ2A 2V98A 2EEPA 2HMVA 4XIYA 5JBIA 1DV1A 2J5BA 5BRAA 5FRDA 4BVGA 4BEJA 2DPGA 2AXQA 3E7PA 1U7OA 2NPOA 4PFKA 5JZMA 5DW3A 1H2EA 13PKA 5AICA 4OXYA 3DEFA 4QYXA 4WSOA 2JH3A 2CNBA 3R24A 3UW1A 1UBUS 2VF5X 3ICCA 1CEXA 1EDBA 1XMSA 2ZBVA 4CGYA 1MKYA 1QYDA 5KOJB 5C5DA 5L9AA 5F2KA 5G0TA 1W36B 1XQ6A 1TXGA 1UADA 4L9SA 5GV8A 4QVIA 4MV4A 3FNQA 4EAAA 4FM9A 2QBYB 1B74A 1NF8A 1OFUA 1VLLA 4B31A 1F0PA 4JL8A 3ZBTA 3OQOA 4XJTA 4FILA 2FN3A 3G49A 3WJ7A 2OCPA 5F4BA 2NSLA 2P9YA 3QEMB 5K0JA 5C53B 1YC2A 4JR2A 3STVA 4B8ZA 1BHQ1 3OOEA 1TO6A 1L4LA 1IWOA 1U9JA 1UBEA 2D13A 3A36A 3IQXA 4JENA 3SK0A 4DY4A 3I0NA 3WXMA 5IPFA 5MHTA 2JFQA 2X9NA 1UOEA 2VJYA 4MKZA 4RHYA 5BMVA 3UYLA 2CV0A 1CRZA 4CM3A 1RPTA 4G1FA 3HDQA 3I12A 1P5JA 3RVOA 2H1RA 3DM5A 4FYVA 4KP7A 2WILA 2I7CA 1GRQA 5B7PA 4YYEA 1U0NA 1KDVA 2V45A 1SCAA 3K1AA 1JKFA 3DTTA 5H1YA 4NECA 4REMA 3SFVA 2R79A 4URYR 4UDXX 3B6EA 1IQUA 1J4AA 4LJ4A 4N48A 5G4KB 3VR0A 4LQDA 2RGDA 1X7YA 2BDEA 2Q41A 3M9XA 3P97A 4HB2A 3FZYA 4A8TA 5BPFA 3BWEA 4AJ2A 1AG9A 2HU8A 5LNK1 2GZ1A 4F38A 3RQIA 1RXYA 3ND6A 2FKAA 2N1BA 3THXA 3FB1A 4FVTA 4R6WA 2ZTHA 2AMYA 1TJ4A 3H5RA 3Q9UA 3DVQX 1I5RA 4FU0A 5L53A 2J59A 4JVLA 2ZDGA 3QMWA 1Y9ZA 3FHLA 1QE5A 1UQRA 3GMIA 4I4TA 2O8DB 1PJ3A 1XDDA 2V9ZA 1X7ZB 4HTFB 3GLFB 3TI7A 1OGIA 1LPBB 1H1LB 3RHSA 1RYDA 2CMHA 3UBTA 3Q6IA 3JAWB 5L4LA 3QK7A 4WOJA 3WS7A 3PR1A 4TRRA 2HLDD 4E12A 4BPBA 3ECCA 3SQOA 4MKFA 1K66A 3FLAA 3I2HA 4MUBA 5J4YA 3WKDA 3QUTA 2DJ5A 1MB3A 3RBVA 2ZI5A 3ZR4B 2RE8A 3LRTA 3JATA 1PCXA 3LPLA 1LLUA 2JCBA 5FQNA 1QUFA 1TEHA 2FLKA 1L5OA 3DE3X 3ANSA 4PLPA 4RVNA 2JFUA 3F7OA 2TMYA 4AYWA 1A4IA 2YNMC 1SEPA 4KNWA 2FPUA 4PG7A 1H8EA 2RI6A 4I6GA 4EZEA 3NV7A 3UK0A 2OOKA 2BJVA 3ONDA 3Q7PA 1XALA 4PGAA 4AMVA 3PA8A 3KV1A 1GGVA 4MZXA 3VNRA 3VKUA 2QJTA 4AP6A 5FUWA 1M1NA 4AMUA 5ALVA 1PD1A 5CRIA 4F84A 4RK7A 4B32A 4C6SA 1GPLA 3ETJA 3KSMA 4ARZA 2FSVC 4AB1A 4U7PB 4U5XA 5KO2A 1PV1A 3W1EA 2QP3A 3WK5A 4YRTA 1VLQA 3QVGB 1NG1A 4HYTA 1QP4A 3FPCA 2X0KA 3HBNA 3WDMA 3ZIUA 2B9VA 2QLTA 5ERXA 4M1EA 2ZSAA 3WLMA 4ON9A 1XN4A 3I52A 3SHTA 4RORA 5CW2A 3D7MA 3VO8A 4XGRA 4CMGA 3ZD7A 4N5LA 2QL9A 3MFQA 1D2HA 1ZOOA 3OIDA 1G7RA 3HA3A 2C9CA 3D3QA 1WUTA 5LUBA 3QXCA 3WVNA 5HZKA 4BRWA 2ZIAA 1RM0A 4Y30A 4NXMB 1QG0A 5EZQA 4XWOA 1E8DA 1VFPA 3CNEA 3GRCA 3AIMA 4J0IA 4WLNA 3VR1A 5CB0A 1GDTA 1PK9A 2GUGA 1B42A 3B7GA 5L51A 3O4IA 3ONWA 3ROXA 4A2PA 5THQA 5JS2A 5K3OA 2EQBA 2XNDA 4RK0A 4LF8B 3EWIA 1FDWA 4Z4FA 1QIIA 3FMPB 5JFGA 5BUCA 2NSHA 4F0JA 2J08A 5FUQA 2A33A 1I94B 3FWKA 3WTCA 5LVAA 1JN0A 2E1PA 4MRNA 4OKIA 3UGJA 3IEVA 1SH7A 4RMGA 3O47A 3WGVA 4CEIA 1HZZA 1IB0A 2ZUWA 1D1QA 1VYUA 3AF5A 4R9UC 2PG3A 4MKGA 4V0LA 3LPMA 3TQFA 1U0HC 3AFHA 2B7BA 4DCCA 5AM2A 4WOCA 3WYDA 1CIPA 1ZWLA 3L8CA 1JHMA 2PUDA 3MJCA 3FNEA 4HXEB 3GJXC 4NEGA 2Z6VA 4LDQA 5KPDA 3DQZA 1A5TA 2ZWAA 3PD1A 4Q4HA 3V3TA 4D9HA 2D0OB 4J16A 4QAQA 4C89A 1O87A 4V0MA 4B82A 4PG6A 2BVNA 1EMDA 1T4BA 1X38A 2ATXA 2I8AA 1ZI9A 3KPUA 1ZJ5A 1Z6PA 3SR4A 3WO1A 2FPXA 1USIA 4BXOA 3V1TC 2BH9A 3IDAA 2H85A 5EOVA 4F7WA 2EKLA 2FPIA 4Q1DA 5LCXA 3DHWC 4I2NA 1GV0A 4N8SA 4XRGA 4L7VA 3WWEA 4BZZA 3JAMA 1DL5A 1DIAA 2E4XA 4IFBA 3RTEA 2IYPA 1G8PA 2DWUA 2H4XA 2J3LA 2QSZA 1OXMA 3CX4A 2P9ZA 3N0XA 3EFEA 3K35A 1T34A 4GM1A 4BECA 1QFZA 4C88A 4E07A 5JD5A 2QXYA 1NL3A 1UBRS 1FRZA 3DGFC 1NW4A 4S0XA 3S6JA 3GA7A 3STUA 2Q0XA 2RHJA 2WJ3A 3QKSB 3E61A 3BXGA 4MWZA 1NQ5A 2G0TA 4O6VA 1ULZA 1WOMA 2FZKA 4YK7A 3U9TA 1NBME 5GP1A 1H2YA 2ORYA 1H9CA 4N0QA 2C2GA 4BQIA 4IDPA 4KLZA 3DDOA 1S2LA 4ND2A 4B87A 4CM8B 4CVNA 2HQ1A 4IJKA 2RMKA 3BXFA 4IPTA 4G25A 3KPVA 4Q6WA 3V2IA 4CLRB 1F8GA 1PV2A 5T4HA 3CNBA 3QXGA 3IR6A 3ZCQA 1H2WA 1MMFB 2IEIA 2YICA 1P29A 3K0AB 4EEKA 1GRNA 2PUAA 5F21A 2FRXA 3AR8A 2FSGA 1QK5A 2QM0A 3GLHB 1OGJA 4QO8A 1RWXA 4YMIA 5I7WA 1UDWA 1K06A 2RCYA 3QOYA 3VU3A 4JYZA 1HYBA 3W5SA 2QSJA 4B3GA 4BVHA 3WYFA 2R66A 1FFXB 3EQ2A 4MYCA 2NXEA 3R75A 1Y5MA 2C9OA 1VMDA 2BBOA 4PFJA 3RRMA 3WP1B 4KSBA 1P31A 4EVIA 4JLKA 3QX7A 3S2ZA 5KVSA 5AKZA 3BQNB 3V8NA 4EWLA 2GAFA 3LHSA 1YDHA 3NLLA 4OHPA 1CP2A 1KO8A 1WF6A 5DGCA 3WB9A 4N76A 1O89A 1Y1SA 2A9OA 3E03A 1A7KA 3GT4A 4JLVA 4OK5A 3IV7A 2JIOA 2J3KA 1G64A 1ZSNA 4XX0A 2FDRA 4CT4B 3B48A 5JAIA 1X74A 4REQB 2FPSA 3ESYA 3ENVA 3RU7A 4FE7A 1PEDA 1HDGO 3TUIC 3EXHC 4S1VA 3MJVA 1LRLA 4KYIB 5EE5B 4CBVA 1QK4A 5A9RA 4OHYA 2IPLA 3I72A 1IC6A 3KO8A 5FBKA 3C5EA 2TECE 4XLLA 1ISSA 5KQRA 5CXSA 1RCUA 3NWJA 3D6MA 1KR2A 1WKCA 2YN4A 1SZCA 5GVRA 3HB5X 1ZZGA 3KXIA 5CIQA 2AFHB 1Z6QA 2WHRA 3HNPA 4GMGA 1O94C 3INGA 3QZUA 4A23A 4BBZA 2HBZA 5PNTA 1EJ2A 2FN8A 3MHPA 4F72A 1Z0DA 4P7GA 4R8MA 1XZKA 2Z98A 3DDSA 2YX1A 4LBWA 1X6VA 3A6KA 3AETB 3DP7A 3BH0A 2WSSA 4FHFA 2H2AA 3JARB 2HR1A 3WRVA 5K0NA 5CEFA 4G0OA 1KZHA 2V7GA 3HYCA 2AIRA 2D5BA 2Q5HA 4C3ZA 1XWFA 3UHOA 5GVSA 5D01A 3VTKA 5IBRA 3AKZA 3PGJA 4CNBA 3H2HA 2OHVA 4L57A 4RPHA 5E3HA 2F17A 1PZEA 2C5EA 4B3BA 2XQIA 1JF8A 3I01M 2C4VA 2CJYA 2CLLB 3R09A 4O5OA 4PLGA 4RHFA 4YAOA 2VNSA 4YRFA 2PS9A 3DMTC 4L3VA 4WLOA 1GY8A 4LECA 5ALXA 3WL4A 4BB5A 1QQAA 3GMSA 3G2MA 5L3ZA 4A6XA 5CBPA 4ZQCB 3ZHXA 5IKMA 3A9SA 4KLRA 1U8FO 3SIPA 3UWPA 1TC1A 2F8TA 3D4PA 3HXKA 4JYBA 3OCZA 3WL6A 4B7CA 5JV5A 2XVXA 1OJ7A 4MHTA 1PGOA 2V0CA 2ZCUA 4ZEWA 2GSDA 2YY7A 3A27A 3W34A 1JDSA 1ZN7A 3H9BA 1CJVC 3QELA 3QFCA 3W2GA 1N7JA 3QITA 2RG7A 3MD0A 5F2NA 2GTIA 1ZUNB 1OX6A 3H8JA 4OQEA 1QJCA 1UQUA 2AEEA 4DJTA 5E2AA 2CLEB 1IDOA 3I45A 1ZGBA 5C1DA 4M89A 3ZPXA 4MVJP 2HT6A 1IM5A 2NIPA 4D6XA 1XVVA 1PWZA 3T38A 3CZ4A 1W9HA 3QWBA 4GI5A 4IXDA 1C9KA 4FHCA 4UBNA 1DGQA 5B36A 4NCBA 3S1AA 2B83A 4IMJB 1TQ6A 3FUUA 2WYOA 3LWNA 3N6XA 1P5FA 1T5TA 3KAQA 3QPCA 2ZYWX 3NGMA 4HUQB 1VRCA 2JKYA 5KVCA 2HRBA 1T2DA 4KNVA 1INLA 1IWBB 1E3WA 1P7WA 3IIIA 1SCUA 1Z74A 4FYIA 2CZGA 4RH1A 2JI7A 5TPZA 4FYXA 4BNIA 1P75A 5DNDA 3GUVA 4FJ1A 5G2OA 2HLPA 5GIPE 4D5EA 3E6AA 2OZEA 4RMIA 1C0KA 2CSUA 3TIVA 5JZSA 1G9XA 4FZJA 5EE0A 3VU9B 1DXHA 5SYAA 4BHTA 3EXG2 1V71A 4FMCB 3ED5A 1WP9A 3GA5A 3WHPA 3QXSA 1D5CA 2WABA 1AA6A 1NRWA 4UMEA 4TRMA 3TGWA 5JCPA 3CJTA 5L45A 3ZQJA 3T54A 5ITWA 2W6NA 1MO4A 4NCXA 1R8YA 2Y0BA 3EC2A 3KDSE 5JRJA 1Z4MA 1QDLB 1ZH4A 5CLFA 3HRHA 1U81A 5DLYA 1MC4A 4JYPA 2ZKIA 1BU5A 4ERXA 3GYGA 3MB8A 1J8VA 2AMFA 4B3XA 3CGGA 4Q3OA 2B82A 2EDAA 3NVDA 3TZ6A 5IJ0B 5AKXA 2HMTA 4B2YA 1IBMB 1J49A 1MT0A 2D8MA 4JQYA 1VLJA 3I2GA 3A32A 4YUXA 4IIHA 4GUDA 4NABA 1VB3A 1OJLA 1ZC3A 1LDBA 1Z6ZA 3IPRA 3UB2A 4D02A 2OD9A 4I08A 2PJRA 1U3WA 4IDAA 5I8ZA 3Q88A 2O6HA 1U7TA 2EZ4A 1PQPA 3PRKE 2IIPA 4AIRA 1MUUA 2H2DA 1E5DA 2HWUA 3VFDA 3V1KA 3F4LA 3K2EA 4UW9A 2ANCA 2HBQA 2ANBA 3D0QA 3LT5A 1RRKA 3SKXA 1UJCA 5J23A 1RFLA 3BHIA 1JEDA 4TROA 2FPPB 2B2NA 2NVWA 1OBHA 4EB6B 2HYIC 1VPEA 1PLKA 4GUAA 4GG1A 1ETHA 4G09A 4EELA 1J33A 1RYHA 2ZKLA 3H2JA 4LYGA 4LVOA 1QMPA 1GA4A 3UXMA 2FETA 3DOHA 1BCSB 1HRDA 3DVSX 4S1TA 3F6RA 5FNVB 1LLDA 4BVLA 5LQRA 4IIJA 1UOQA 5ENDA 1EINA 1MV5A 3O4VA 1ZIPA 3QFTA 2IHYA 1NPDA 1EEXB 3EQ6A 3MC1A 2FZWA 4G4GA 1HZJA 4A7PA 3FDJA 4C4PA 2J6HA 2IWHA 4J0JA 4HRVA 2XUIA 3KKNA 2YASA 5D6NA 3WC4A 1R6VA 4A4DA 5JD6A 4W7HA 4RCZA 3E2IA 4Y67A 3EGVA 3K9WA 1HM5A 2ZUSA 2PGXA 1W36C 1XP8A 3OMLA 1HDRA 4X3PA 3AJAA 1VP3A 2C4MA 2V97A 2LGJA 1KH2A 3CNNA 3DCJA 3MMNA 5TPWB 4B2PA 4D9KA 4XUCA 1WUKS 4LXIA 2QN2A 4BJ1A 1VJCA 3PC8A 4J7XA 3H5AA 3NCTA 4H9GA 3ACDA 2IP1A 2OCBA 3FKSA 1GXSA 1QIMA 2YWXA 4PHHA 4N8EA 1GDHA 2PK3A 4R68A 2Z09A 3CEMA 2XRFA 4O8ZA 4C30A 4QYIA 4IOKA 3OOSA 3HO8A 2HF8A 2ZJ6A 5BOVA 3NVMB 1PHPA 2XDQA 2XMSA 1TJPB 4E1BA 2BOVA 5AFSA 2NZWA 2XZDA 3LQQA 8ATCA 4RJTA 1YQDA 3U3DA 2WTAA 1W5TA 2C9YA 2GASA 2OMKA 1QVVA 1CU1A 4LYAA 5LQNA 3FBWA 3WFZA 4U39A 1X7XA 5B3JC 1WB4A 4JBGA 1IEXA 1AKYA 1W4CA 4MKRA 1L1FA 3KEOA 4C7KA 5A4AA 2HWWA 1Q74A 5FPHA 2V4ZA 5EVCA 1JPJA 4UOEA 1B16A 2PSEA 3PDJA 4XSVA 4D0SA 5JDCA 1DRUA 1VIAA 1V5FA 3AT1A 3QV2A 4I3FA 3RARA 1M5TA 2JKZA 2FYTA 1MIHA 3GLSA 3LSTA 3EWNA 3UGTA 1NBEA 4RMJA 4BZQA 1XMIA 1ENPA 4HK4A 2KX7A 2G9ZA 4EECA 2QG9A 4Z53A 1N5LA 2YV3A 1KPHA 4K6OA 3IXLA 3E9QA 1RKBA 2Y4OA 4OQMA 3VR4A 1ACMA 3ZEIA 2GD6A 1L7RA 1Y6QA 1OB5A 1AUXA 4X1YA 2HSDA 1YIAA 1FNNA 4ZYLA 3EPJA 3A3NA 5SV2A 2FW1A 5CM8B 1YS4A 5HPYB 4JGBA 3RYIA 1YBHA 1D8TA 2W00A 3A6JA 3DT6A 4YP1A 1EH5A 1W59A 5HK8A 2NUTA 2QD2A 1NASA 3RGWS 2RKOA 5JSZA 1ZH0A 2Q3FA 4RO0A 4FLEA 4K9OA 5AJUA 3REQA 4BLUA 5IXSA 5AUPB 1HDEA 1TMKA 3C48A 5TQ0B 4IFIA 3FPLA 1YS7A 2BT4A 3KTFA 3SZOA 4ZEVA 1MO5A 5BORA 1BXRB 4TLEA 1ZFNA 2LR0A 1E66A 3INTA 1K7FB 2P3LA 2WOOA 3KV3O 2XQVA 3O0TA 2BELA 4JBXA 4O2BB 1U65A 4XLZA 4DDKA 1N2OA 1KR5A 1L6RA 2LIVA 1ZK0A 2B1JA 3NTUA 1DX9A 3TAUA 4EVSA 3U17A 3PJEA 3BL6A 3ECAA 1XLTC 3EF0A 2H5JA 1JLLA 1CY1A 1Y34E 4RAOA 1T9GS 4FW9A 3Q7QA 3D4LA 1M75A 4Y1RB 4AMYA 1DLJA 1XPJA 1QFMA 2QMOA 2RJ3A 4QJ4A 1JHVA 5EE1A 5AQEA 1U0BB 3C7TA 3KT8A 5IS2A 2C3MA 4LCBA 1ZUIA 1U6JA 4DDWA 3OI7A 4N82A 2ZBRA 2GVNA 1CF9A 1OTXA 4ZMSA 1OLSA 5AM1A 5J4LA 4JLUA 5FLYA 1T9AA 4ZO6A 4X1IB 1NNLA 2E87A 4GEGA 4A2WA 4RVSA 1FUIA 2CFCA 2DWCA 2A9KA 3M6MD 3CF4A 3QOFA 1ORHA 5H16A 5J63A 3JVEA 5IC4A 3N7UA 2AC4A 3EF1A 1T6ZA 3OLXA 4M9CA 3C8UA 2EXXA 2V7XA 3AR2A 4D41A 5AVSA 2MSEB 2HNBA 2VHYA 5DK6A 3KYCA 5IC6A 1N0HA 3EZGA 3GQBB 2NAPA 2ATEA 2EBFX 1MC8A 2C1XA 3IBGA 2PR2A 2OAP1 1KFBB 3R0QA 4IUYA 2FEMA 2EKZA 2JLRA 4J75A 3K53A 1C7QA 1DTWB 2G4CA 1ZIDA 3SHVA 3YASA 1JILA 1Z68A 2JCXA 5ARDA 2XY4A 2C9BA 1YRQA 2BGLA 2Q4BA 1QVAA 5HJEA 1ZJ6A 5JROA 1TCAA 5ESXA 4FFSA 4LOHA 3SC3A 2ODBA 4PC3A 4ZVVA 4GZLA 4ARIA 4NYJQ 4FEAA 2AV6A 1VGVA 1BX3A 5E1DA 5CFLA 3FHCB 2P9CA 4YRZA 1QFXA 2Q6TA 1P9OA 4ZI7A 3B20A 2F4NA 2HYDA 3OLQA 4Q39A 2Q5QA 2IA5A 1K92A 1KZ9A 3KYBA 4H77A 3CPSA 3N8IA 3HNRA 3TX6A 5L4NA 1E4VA 2O2GA 2PS1A 1XTSA 3RDPA 4V3CA 5F9FA 4JLDA 3PP8A 3FVQA 4D0LB 4KMRA 3TL3A 2W2PA 3KQSA 4W1QA 5J43A 1LVGA 5HX7A 4NP6A 2QUAA 1E62A 3ODPA 4MRRA 3AERA 1JLRA 1HXHA 1X1DA 2VI5A 3KB2A 4MWDA 2X3YA 4W1PA 4X9XA 1EZ1A 1YD7A 4DLBA 4E11A 3BRQA 2VJNA 3QMMA 1Z9BA 3SSMA 1RQLA 4L51A 1L4BA 4GI3A 3GK3A 4Q37A 5DNCA 1SXIA 2M32A 2P68A 4EX6A 1EGMB 3S81A 4TL6A 3L1JA 5FWNA 1WXWA 3Q3GE 1ZRMA 2VTBB 5ES3A 3UHJA 2I0FA 3PPIA 4KYTA 3V4PB 2J30A 4G4SP 4PFQA 4RWZA 5JQWA 2E1RA 5FV4A 3U0VA 3HFSA 4MV3A 2PT9A 4HQ0A 2XKBA 4HEQA 1AVTA 5KYVA 2WU3A 4LGCA 2QQ0A 1MBZA 1XG5A 1JMYA 3O4HA 4I9FA 1VPWA 1RHKA 3GLIB 1F0KA 4ZYVA 5D3ZA 3C85A 2CHUA 4Q7LA 1TNDA 3A4NA 4BO9A 3IUNA 5FPTA 1TAHA 3Q40A 3E0QA 4CCYA 4WKNA 4CQMA 3EMVA 2CUNA 3IERA 1YH3A 1HWYA 4IIYA 4QKQA 3O82A 1M6NA 1ZBDA 2FW9A 1B8NA 2RHLA 3B1YA 3G9ZA 3JR7A 3RS0A 1L1EA 4E5YA 1U9IC 1QQ6A 4PZYA 4DA6A 1A7AA 3H9JA 1Q0RA 2C3OA 1YS9A 3N9IA 5LD2B 2OUKA 1UC8A 2SICE 2GTPA 4IKPA 4MYSA 4EHJA 2HPVA 3K0HA 4G0XA 5BV2P 1GM5A 4DCUA 1KAEA 1PWHA 4UHKA 3T7DA 4AKTA 2VJMA 5BWNA 5KYKA 1KIAA 1M66A 2IUUA 2V6MA 1NV9A 1UBOS 2F64A 1LNQA 2O1WA 4QPPA 3WL8A 5JMTA 1U90A 1XXHA 3FYTA 3MNFA 3P0EA 5GONF 2GETA 2FWRA 2JAPA 3NTLA 2QZ4A 1FTSA 2HOQA 4XKJA 5GY7A 4ZYWA 3EVFA 4MWTA 1SULA 3V6MA 1QS0B 1UM9B 3A6HA 1A27A 4Z0NA 1ADBA 3WAKA 4GI1A 1Q16A 2XTJA 3AEXA 4UUOA 1D9XA 1T2UA 1QR2A 2ECFA 4HNTA 1TIBA 2DBRA 1E9VA 3LXUX 2B2XA 1Y98A 1KMQA 3SF8B 3OC6A 2PWPA 3MRXA 4HVTA 4QXOA 3ML1A 3Q3CA 4V0NA 2GHIA 1E3DA 1L5YA 1WEKA 1K3FA 1WG8A 4DZRA 5DWQA 3UWKA 3MIIA 3N8KA 1YE8A 3ADDA 1FDRA 2BMDA 3ISJA 3DF9A 2P9TA 3R2JA 4DV1B 5AOAA 1CS0A 3K92A 3UTCA 2HWXA 1FNCA 4RQTA 1RYYA 1GTL1 2OZKA 3WISA 4ACBA 4CG3A 1P3JA 2WUDA 3ZUGA 3L04A 3ZJUA 4HH0A 4MV0A