3KB2A

Crystal structure of yorr protein in complex with phosphorylated gdp from bacillus subtilis, northeast structural genomics consortium target sr256
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
b'TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYIEGKDIDSILELYREVMSNAGLHTYSWDTGQWSSDEIAKDIIFLVELEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPBc2 prophage-derived uncharacterized protein yorR
publication title Northeast Structural Genomics Consortium Target SR256
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kb2A00
1P5ZB 4ZCLA 3B82A 5TY0A 5FUVA 1E2QA 1PLKA 4TYNA 4D0NA 2IXFA 4R2HA 2VHUA 5FOUA 3RVBA 1KY3A 3EAQA 3Q5EA 4A36A 2W0MA 2R6AA 2ZETA 2WWFA 5DO9A 3GLGB 4LHWA 1NRJB 4OI4A 2XNSA 2QRZA 1LNZA 2QT1A 5KSYA 4JL6A 3AF4A 3RRMA 1LV7A 2OBNA 1U8AA 2CDNA 2W6IA 4YQFA 4WVFA 1ZU4A 1IOZA 1JXMA 2CCKA 3BC1A 4YLGA 5C2JB 2CMKA 1G6OA 3NBYC 1IN7A 1Z3IX 4LJ9A 3RS5A 4DCVA 1CKEA 3CX6A 121PA 2V9PA 1G4AE 3SOPA 3NH6A 1XD2B 3CM0A 3RC3A 3RDPA 2WMOB 2XITA 5FL3A 2WSSD 3LVQE 3VNUA 3ECCA 3DO6A 1Q21A 1OFIA 3KJIA 5FOXA 2NPIA 3VHLB 3U6BA 4FD2A 1NIPA 4JL8A 2YWHA 1EGAA 2VF7A 2QZ4A 3NKVA 4DDUA 2QPAA 4D0LB 1X1RA 2QY9A 3VU9B 1VTKA 4M9QA 3AV0B 1I2MA 4Q19A 3WYGA 3AUXA 4KYIB 3P32A 3MGCA 5J4LA 2OFOA 3WY9A 4OHVA 1F2UB 3OFND 4C7OB 5GJVC 3RC8A 3T61A 4L9SA 4M9SA 3I73A 4ZIRA 2RB4A 2CVFA 3MJRA 3VR1A 2JDIA 3UPUA 3RANA 1OB2A 2R6GA 4Z1MD 3EPLA 5J4HA 1NG9A 4ACBA 2RHDA 2OILA 1RJ9A 4M1MA 3GLGE 4Q9LA 1EESA 4M53A 4LHXA 2W2TA 3LAWA 4B71A 1AN0A 4C0HA 1JXOA 1VG1A 2D06A 3BH0A 1XEFA 2BBWA 4FXPA 5FI1B 4BE7B 4DSTA 2QBYB 1CRPA 4NCJA 1XCPA 3ZH9B 2TMKA 1WQ1R 5C1BA 2GCNA 3KJEA 3NBXX 1GRNA 4HLUA 1IONA 4U7DA 1KKLA 1AK2A 4JBWA 4D4JA 4TSFA 1TU4A 1Z22A 1XTQA 3KDSE 4DSUA 4ZDKA 4G1UC 3ZLJA 1IJFA 5FTLA 4NONA 3T1VA 4E22A 1XD8A 5GVRA 4MKGA 3WYAA 3UANA 5HTKA 3GLIA 1E4YA 2WWHA 1G6HA 5JWRA 2BBTA 2CL6X 4TTRA 4Z8XA 2ZRFA 2C95A 4JZKA 4HB4A 2OXRA 3B1ZA 3TR5A 4KHZA 4RSGA 3I5YA 3CF2A 3GPLA 1DAGA 2CNWD 2WZQA 1XFAA 2WWIA 3T35A 3EC1A 1G3QA 4EJSC 1YZKA 1TMKA 2EFEB 3OEHA 4AURA 1OIVA 1DOAA 2X2FA 4JSYA 3LNCA 3K0FB 4EPXA 1J8YF 2P6RA 3BAFA 2R62A 1E1RA 2LKCA 3W8RA 3K8YA 1D9ZA 4P0TA 4B3XA 4B6FA 3E5HA 1QG4A 1MO3A 3B5JA 4HAXA 4ABYA 3L0IB 4OK6A 1IQPA 2EWWA 4D80A 1S1CA 2P65A 2P6UA 2ZR9A 2AK3A 4HAWA 4X8MA 2Q21A 3EG5A 2O52A 1PLLA 2WJIA 1HE1C 3QPUA 5F2EA 1OLOA 4RY2A 4A2QA 4O3MA 3N2EA 4PHTA 2LCFA 2WAXA 1SVSA 4GDFA 1G8GA 4LCBA 5IRCD 1AZTA 1OXSC 4A92A 4P4SA 1W2HA 3I8SA 5CLQA 3GLIE 4AKGA 3ZD7A 1EWQA 2YHSA 3NTUA 4PAMA 2EWVA 2IYQA 3LO5A 4KVGA 2YV5A 2XTNA 1P9RA 1Z07A 4JLPA 2EYUA 4WXRA 5CB8A 1E9RA 3DL0A 4A8JB 1N5LA 1TPZA 2FGKA 4HLCA 4PPFA 1OB5A 4UNQA 2ZSAA 3VKWA 2XTZA 4LJYA 5L3QB 2D74A 1WF3A 1XTSA 3HJNA 2GDJA 4Q7KA 5CIWA 4F91B 1W47A 4JMPA 4MRSA 1XZQA 2ZE5A 4ZV4A 1YZGA 4LJAA 2Z6VA 4NHOA 5IK2D 3ZQ6A 2IS4A 1ODFA 1QHGA 4Q4AA 1JR3A 1TAGA 4C0QC 1L7VC 3UWKA 3O8BA 2ZRHA 2V1UA 2OO7A 4RKFA 3E2IA 4C0LA 4DIDA 4F4CA 5FPKA 4R7ZA 3KUDA 8OHMA 3K70B 4FCWA 4NYIR 4I1UA 5KTYA 4OQFA 1M7BA 4JLVA 2GVZC 2VH5R 4B3GA 1G9XA 5ANRB 5KO2A 1A1VA 2WKRA 1NN5A 3VTKA 1HT2E 1N0WA 1ZUNB 1QRAA 5HPYB 1IXSB 2P5SA 4M1TA 2W58A 3NC0C 2D4HA 3MAAC 3AVTA 1PJRA 3MWLA 1N0UA 3EIHA 3UATA 3D7MA 4V0LA 4B3FX 3KFVA 2GZDA 2F9MA 1P2VA 1D2NA 4ASUA 1OYYA 1XXHA 4KSBA 2MMGA 1HY3A 3D8BA 3TVTA 3QJYA 2WSSA 3GLHA 5EE5B 1MO4A 2RMKA 1HTWA 1JECA 2C9YA 2ZRDA 3KKPA 3GMTA 2H5EA 2HJVA 4MKIA 4Q4LA 5FL7D 5J4VA 4Q00A 5F3WB 2IWRA 4OI1A 1CTQA 1JB1A 1XX6A 3IGFA 1XDBA 4DSNA 4HUQA 1NP6A 3RYTC 4DBLC 1TQDA 3C16C 3KKOA 3U3KA 2JLQA 1N5JA 4QM7A 2G3YA 2ZRKA 1OFUX 1KJZA 4AG5A 3GEHA 4PZZA 4JYBA 2ZRIA 3Q5DA 1D8TA 3VR3A 4BGDA 2PJRA 2N42A 3OFNA 3LW7A 2ZYTX 4MGKR 3KTAB 1JR6A 4PAQA 3QKTA 2GJ8A 5KPDA 3A4LA 1ELOA 3FGNA 4YMUA 2G83A 2DFLA 3BE4A 3UWOA 5JS8A 2IF0A 1IBRA 4Z1MA 4POAA 2QMUA 2VEDA 1Z0AA 3GLFA 2XJ4A 3L2OB 3U60B 3WBKA 4OI2A 3B1YA 1RW4A 3V4FA 3W6OA 3EPKA 1Z6GA 2IXGA 1FTNA 1AKEA 1QHXA 4Q1DA 4PO8A 1W36B 2FU5C 3AVQA 4HZUB 1ZIOA 4A4DA 3OEEA 1DO2A 4FIDA 4NCKA 2CE2X 2Z43A 1FP6A 3OAAD 5JEEA 5GJWC 4M9XA 5DISB 3AVVA 2QSYA 4Y0VA 1T5IA 4OQXA 1CR2A 4H1VA 4NCNA 4CEJB 2JA1A 1WB9A 4E5UA 2VHQA 1E2MA 4LHVA 4GZMA 3EA5A 4P32A 1DG1G 1NBMD 4M22A 3GFTA 2FPKA 2ZSDA 4K8OA 2BKUA 2D7CA 4DZZA 4YMSA 2JLYA 4DUGA 2BBOA 2GBLA 2HF8A 1TQ4A 3THWA 4LZZA 1NNEA 3QKSB 4JT4A 1A82A 4QHYA 4G5OA 5FUXA 3SJBA 3KX2A 2QA5A 2V6JA 1KI2A 3W5IA 1TQ6A 2PZFA 1E9FA 4B3BA 1YU9A 5EXXA 2FFBA 1DADA 3BB4A 4AYTA 2KE5A 3I1FA 2P0EA 2GZAA 2WIBA 1XMJA 1MO6A 3VNVA 5DI9A 4DSOA 3U3OA 4JSTA 4TLDA 4YONB 2EQBA 3W34A 2CXXA 1VCIA 4BLQA 5AUPB 1E79D 1RRCA 2OUKA 3EW9A 3QKRA 4S2EA 4QG7A 1AGPA 3ZVLA 4XJXA 4I81A 1LVGA 5JRZA 3AEZA 1XMVA 4IXMA 4NKRA 4BFVA 3C41J 4XTCS 2OLJA 1VYVA 2H16A 2PZGA 1ESMA 5TVKA 1M8PA 3GEIA 3MWJA 4C0AC 1TADA 2GAOA 4DC9A 2O8EB 1M6NA 3G82C 5EZ6B 4DWJA 3PEVA 4C2UA 5IHPA 4XVUA 2QMEA 2VF8A 3G5UA 4F4IA 1SKYE 1JBKA 2MSCB 3KKNA 1VG8A 4IVQA 4U5XA 4A6XA 4IFEA 3IUYA 1FUKA 4KU4A 3BH6A 1P72A 1ONBA 2O8DA 3MMPA 3TVDA 1G3MA 2GCOA 1NLZA 2J1LA 1LFDB 2QQ0A 2YZ2A 3S1AA 1G8HA 1D2EA 2WWWA 2C98A 2YC4C 2ZI5A 4RZ2A 4OKSA 2JAQA 1MRSA 2NGRA 2F3RA 3PFIA 1S9HA 4RFSA 4V0NA 2BBSA 1E2JA 1G5PA 2HDNB 2ZUBA 2R2AA 1FZQA 2VTKA 4QHSA 5B58C 2ZJ8A 3EXAA 4GP7A 4IOJA 4BWYA 1KI6B 4DDWA 3TK1A 1X6VA 3EC2A 2KJQA 4PPGA 2IS2A 2QAGB 2AX4A 3RS0A 2UKDA 1SVKA 5FBRB 2ZANA 3AF1A 4F7WA 1SXJB 4EPTA 4Q02A 5LBIA 4LJ4A 4A82A 1KHTA 1P9NA 2WV9A 4KFSA 4LBVA 5G3YA 1YZTA 2JLWA 1AIPA 3GJ5A 1LTQA 1YZQA 1S4QA 4PTLA 4QOSA 1U8ZA 5DNYB 2EYQA 2R65A 1X8JA 1QHHA 2CEAA 2A3RA 1OH6A 1E98A 2FMXA 1R6BX 2Q3FA 3O8RA 4Q1FA 3PV0A 4DJTA 3TUJC 1XB2A 2AR7A 1KO1A 2GKSA 2V54A 1LY1A 3BXZA 1TEVA 2ZYUX 2GRJA 4JLKA 4P33A 4XWOA 3B2EA 2BOVA 3TR0A 2XNDD 1NY5A 3O8DA 2QM7A 4S35A 3U5ZB 1WRBA 5BN3A 2Z4RA 3CNLA 1IN8A 1SZPA 2FPLA 1ZRHA 2PMDA 3HPQA 5KNCA 1UKYA 3B1WA 4X8HA 1FNMA 3BB1A 1U0HC 4KLZA 4F93B 5FTKA 1UPTA 4F92B 3NBFA 3CPHA 1CJTC 3TLXA 4RD0A 1IN6A 1UFQA 2ONKA 1M74A 2ZJ5A 4TMXA 1FMJA 1HUQA 1BO6A 4KYUA 1JPNA 1L2TA 4LUCA 4C0JA 4W9MC 2WWGA 3K9GA 1N6IA 3SN6A 1KIMA 1HT1E 4EJSA 5CB6A 3NXSA 3ND9A 4D82A 1E4VA 1DAIA 4HB2A 5E7JA 3NVAA 4US2R 3IILA 3C4JA 1N6HA 3KB2A 3PUWA 3WNCA 5JSZA 3AF2A 2ZRNA 2A5GA 2J9RA 5C18A 2OG2A 3C8UA 4CYMA 5JECA 1SVLA 2GEUA 2V3CC 2H1LA 3QF7A 4Q1CA 1G41A 1EX6A 1YZNA 3ICQB 3QENA 4OBEA 4TQAA 2X1VA 4RKEA 4TL9A 2I1VB 621PA 3WBJA 1WP9A 1NMYA 3U44B 1CEEA 4QNRA 2D2FA 1NMXA 1OHHA 1Q3HA 1KI8A 1Q1QA 4BUJA 1ZVQA 3BJIC 1H8ED 1DAMA 4AY2A 1G3UA 3PCRB 1IHUA 4MGIR 1OKKD 3MUFA 4BFTA 5KNDA 4V0ME 4QGHA 2IW3A 3RWMB 3CB4A 5L3VA 3CR8A 2FSFA 1FQJA 1NBMA 1ZW6A 3CRW1 3CZPA 1UAAA 5CDFA 3EIEA 3FHTA 4MDFA 1G8YA 2ATXA 4M4SA 4O0MA 2X8AA 1N5KA 3QXHA 1Z0IA 4QHTA 3A4NA 3FYHA 1U98A 3LQRA 1OIXA 4QC2A 2HXYA 2KB0A 1Z29A 3UMRA 3V4RA 5DHFA 1F6BA 4IEIA 5HE8A 4PHFA 1EFRD 2CCGA 2MMCA 1MH1A 3IO5A 2AKYA 2JATA 4TL6A 1KO8A 1TNDA 3CUEF 1DAKA 2REBA 2CVHA 4A8JC 2JLXA 1KO4A 5J5CA 1Z0DA 1FTSA 2RGBA 1PLJA 4WZBE 1DAEA 1E79A 1G7SA 5JRJA 5FUWA 1QF9A 2PBRA 3CKLA 1F3OA 4KFTA 1OT3A 3EASA 2QL6A 3LLMA 1OE0A 2DWQA 4KO8A 4JVMA 3T1TA 3C7KA 2J0UB 2QNRA 4LYFA 4MRVA 4MUAA 2J46A 5FOVA 1CJMA 4D6PA 2YWEA 2N46A 3QF4B 4URUR 1U81A 1ETUA 1Z47A 3QPVA 4NL4H 4R98A 3LD9A 1N0VC 3K70C 2XOKD 4JLJA 4URWR 1KI1A 4O25A 1E9BA 5DI3B 4ACAA 3U7HB 5KPJA 5DHAA 1F60A 3K9LA 1AA9A 4QJ3A 2VA8A 5EXSA 3L0PA 2CK3A 1RC8A 3R7WA 4YC7A 3X1XA 4G0NA 5FPYA 2C2HA 1QHYA 3MRSA 3MWYW 1GM5A 1DTSA 3U4QB 2IYWA 3PXGA 1P60A 1CRQA 4GBMA 3P20A 4OQNA 1COWD 3K0EA 2IYLD 1CJKC 1JEDA 1KZ7B 2QU8A 4B47A 4KFRA 5JBQA 1YZLA 1Q3TA 3TQCA 1ZM4A 4LWZA 4ZO4A 1II0A 521PA 3M1IA 3CRRA 4Q9JA 1ZC3A 1US8B 4KFUA 1M7GA 2NIPA 4FCVA 1YRBA 1F5NA 4N3NA 2GVDC 2IT1A 1QHIA 1LW7A 2DR3A 1G7CA 4K81B 1KMQA 3REFA 1XJQA 3QSYA 3OF5A 4XD7A 3C15C 4PQYA 3H1TA 3I62A 3R8FA 4MYUA 1SQ5A 4P4UA 3PUZA 2JLVA 1N6OA 4F38A 1FX0A 4LYAA 5EE9A 2WOJA 5L3SA 2AL7A 4CIDA 2HT1A 1FW6A 1JJ7A 3IQXA 3QXJA 4EDHA 1WXQA 2BKEA 3THXA 3BH7A 3TUIC 1KJWA 2FZLA 3GJXC 1F2TB 4Q4JA 5FPHA 1OV4A 1Y63A 3LY5A 3KKQA 1R0WA 2XZPA 1W36C 4DT1A 1HE8B 1M1YE 4AIIA 1KOFA 1OXUA 1W0JD 3C5HA 3MG9A 4GMXA 4WW0A 2O0HA 4DDTA 4H9GA 3QVVA 2FEOA 2ZSEA 2P2LA 2CLCX 3SYLA 2XB4A 5DIFA 5LB4A 1CU1A 3ZIAA 1E3MA 2WIAA 3UK6A 2O8FB 2IA5A 1NMZA 1E9CA 2DWPA 1N6LA 3D6TB 3RS4A 5AUNB 1KDPA 1NN1A 2FE4A 2FFQA 4PFSA 4OI0A 1RVDA 2GJSA 4NCIA 4GT1A 1TX4B 4TL8A 3TIFA 4B35A 2Q3HA 4A0GA 1Z0KA 2FPMA 4Q01A 1CR1A 2JASA 4IDNA 1EXMA 1KSHA 2REXB 2YINC 1X8LA 1XMSA 2XEXA 2R44A 2BEJA 3NEJA 4PO9A 3FOZA 5LDDC 2ZAOA 2WJJA 4WAUA 1KAGA 1KK3A 3MWKA 4DLZA 3K9HA 1IAQA 4DCSA 3FMPB 2VP6A 4B32A 2GETA 1R4AA 2RGAA 4IKEA 4Q1AA 1U9IA 3OIVA 3KQUA 3HPRA 1TTTA 3WMGA 3CRVA 1WDTA 2RHMA 3CO5A 4RCZA 3ADDA 3FTQA 3K70D 2AFIE 1E2NA 4KITB 3A36A 1CF4A 2VBCA 1Z6TA 2BMJA 5HCNA 1GZSA 1N2CE 1Q22A 1AKYA 1D2MA 4TLAA 2QUZA 3IBYA 4ZKEA 2WHXA 5EP4A 2W6JA 3LWNA 3IHWA 4A6PA 3PG5A 3N2IA 4B74A 2J5XA 2WJYA 4G5SA 2R8RA 4HLQB 4PR0A 4L8GA 4AI6A 4ESVA 2ECKA 4JVNA 1R5BA 4RD6A 5C4MA 2LKDA 1W7AA 2QEQA 2IL1A 1Q1EA 2HLDD 4IDOA 1RJ9B 1XD2A 4PAOA 5JLJA 4TLEA 2OE2A 2ZR7A 1BIFA 2IX3A 2WSMA 4PC6A 2XGJA 3SQWA 4GP6A 1ZD9A 3TAUA 2KSQA 1VHTA 3LH5A 3AKCA 2NTYC 4MGZR 2OCPA 3OIYA 2ZXUA 2ZPTX 1Z6AA 1G3RA 4FCTA 2FFAA 2Q9BA 1GOTA 2C8VA 4B6EA 3VU9A 1CLUA 3QPWA 2C03A 4BLSA 2QPTA 4B33A 1W44A 4MDEA 2Q0HA 2QAGC 5KU1A 1ZJ6A 2FV8A 1F2UA 4HB3A 2IHBA 4Y0AA 3GLIB 1SXJC 1D9XA 2IS6A 3WHLA 1W4BA 4PHGA 5E4FA 1C9KA 1CIPA 3WYFA 5EP2A 3U7FB 1NG1A 1BMFD 2CHGA 2HEIA 1Q0UA 2NO6A 3I72A 2CCJA 3LX5A 3VAAA 1E0AA 3M4YA 4C4PA 1J99A 1GUAA 4IW3B 4BLTA 1WA5A 3FDIA 4V03A 4EKDA 1OH8A 2GK6A 2QGNA 1W36D 1E2DA 3VFDA 1TF2A 3FMFA 4DLSA 2XOKA 4KJZA 4A1FA 1NVVR 1HURA 2WOOA 4OK5A 4TMKA 2QBYA 2QAJA 1R0XA 2JIZD 4HUTA 1X1SA 1MABA 1N25A 1Z0JA 4GOKA 4C0BA 1KNXA 1MR3F 1UKEA 1DARA 2C9CA 2JJ8A 2ZJZA 4JBXA 4E07A 4EFMA 2CJWA 2VP9A 1ZNZA 4WBSA 4B3DA 4X8OA 1E9SA 2W2VA 3W5JA 1XF9A 1COWA 1GNQA 3DHWC 3U7EB 1D6JA 2AFHE 2JJ1D 2ZR0A 5E7IA 2RGXA 5FR1A 3CH4B 1GKUB 4KXFB 3RAPR 1E2EA 3I92A 3VR5A 4NU0A 4D81A 2OLKA 1N6RA 3AKYA 1R0ZA 2WJGA 4JJKA 4LV8B 1KGDA 4TZ6A 4JLNA 2FOLA 4Q9IA 2OT3B 3V9PA 4CT5A 4TYYA 1FQKA 4Q03A 2J7KA 2N1BA 4O2LA 1J70A 5CYOA 3K0FA 4KSCA 3B13B 1WBDA 4YMWA 1KK1A 2ODEA 2ZE7A 1M7HA 3K53A 5JJLA 1Q1ZA 1KI7A 2WPDA 2ZREA 2F55A 2GXSA 3ZZTA 3SHFA 2GJ9A 3DDCA 4FW9A 4GNKA 5FR2A 2IYZA 1JEEA 2OCYC 4B75A 2L0XA 2A78A 2R6DA 2O8CB 2MSDB 4HLDA 1R5OA 3P4XA 4Q4AB 1QHNA 4LPSA 1JJVA 4IJMA 1OW3B 5J4YA 4CT4B 4I1SA 5KUTA 5DE3A 3R20A 4UXIA 1KO5A 3BWDD 4TN1A 4BZQA 3F5FA 1AM4D 2PMKA 5DN6D 1TUIA 3ZS9A 2WICA 1W0JA 2UZIR 4PC2A 3W8NA 1KMHB 1ZNXA 3GD7A 1AZSC 3ONWA 4EQ6B 1G291 1B23P 3NEYA 3VR4A 4HB0A 3SU8A 4YXWD 3KQNA 4A2WA 5AJWA 2OHFA 3DOFA 5EE1A 1P9WA 4ZI2A 4A8JA 2AN9A 5TDHA 1VPLA 3VQTA 3AB3A 2PT5A 1Y3AA 2EFDB 4R71A 5K8IA 3IPXA 1GKYA 4ILEA 3LBNA 4K46A 3WNBA 2WVJA 3KB1A 1XXHB 1SXJD 2FSGA 1VDZA 3CX8A 3QBTA 5B64A 3AF3A 2ZTSA 2JJ2D 2ZE8A 4ZDWA 1H65A 4HEJA 2G1KA 4M9ZA 4PSVA 4TTQA 4TYQA 1E2KA 1W4RA 1R8SA 1ZM2A 2O5VA 4ZPXA 4GMDA 4JKIA 4LRWA 2IXEA 4BFYA 1HH4A 4URXR 5IF9A 3EX7C 1UJ2A 4LBWA 2VIIA 1UM8A 2J7PD 4HAZA 4AKEA 1T0JB 1T91A 3QXXA 1ZAKA 1Z63A 1P2UA 1MV5A 2E9SA 2DCUA 3B6EA 4DLRA 3AF0A 1C1YA 4JT2A 4IXNA 4MRNA 1GRQA 221PA 2ZQ5A 1UEIA 3NHAA 3P27A 1T0HB 2QE7D 2HUPA 3QE0A 3QIAA 1VMAA 5SZKB 1JR3E 1ZCAA 2H92A 3UXMA 3L82B 3QY0A 1OFHA 1QG2A 2PEYA 4L9WA 1AS2A 3SDZA 1G3IA 1RRGA 2EU8A 2F43B 1R10A 2GA8A 1XEWX 3SI7A 1IY2A 1SHKA 3U2QA 1OPXA 4JLAA 5KNBA 1QZXA 2AHOA 3KXLA 1ZC4A 5AJXA 1XU4A 2ZIAA 4N0EA 2ZS8A 3U3JA 1KK0A 3H4MA 1XP8A 2J0VA 2IC5A 2RGDA 1L4UA 4A0FA 4C30A 2HYDA 5BW8A 3SBDA 5KSOA 3RRZA 5D3QA 2IYTA 4DKXA 3PR1A 2CHQA 4OL0A 3IO3A 2C99A 5JJIA 1DBSA 2YC2C 4WZ6A 1GITA 3AUYA 1E32A 2W83A 2D7DA 2YWFA 1SKYB 4G5QA 2IYXA 3AKDA 3GFOA 1XTJA 1Z28A 1XXHE 3AP1A 5AJVB 1IY1A 1E2IA 1E9DA 4DDVA 3HYTA 4Z8YA 1UDWA 3GLHE 1GRRA 3W90A 1CS4C 1W1WA 3KTAA 2AXPA 2ZRJA 3MCAA 4JYCA 1MKYA 2XAUA 2IYVA 3L0OA 4LBZA 1U99A 1IY0A 2DHRA 4B73A 1H8HD 2QM8A 4XTRA 2C5LA 1XNJA 1IXRC 4CZ2A 1Z2CA 1XJ0A 2PL3A 2Z4SA 3FE2A 2OCBA 2Q6TA 1G4UR 4IRUB 1NI3A 4RVCA 3MSXA 5L8VA 1WMSA 3GCGA 3AM1A 4A9AA 5FFMA 2O8EA 3EPHA 4HZUA 2D3WA 2FSIA 5TV2A 2A9KA 1AQYA 4YDSA 4MYTA 1QHSA 2CNWA 4EFNA 3IEVA 2V8OA 3TGPA 5EE3A 3O47A 1E94E 3OHMA 4TMZA 3QKRB 4AD8A 4TT3D 4LYHA 4EPRA 4CEJA 3GJ6A 2RH5A 1RE0A 5DH9A 3DMDA 5EXPA 4DLXA 3HU2A 3LV8A 1IXZA 5KDOA 3GLFE 1E1QD 4RZUA 1P61B 3K09C 1VCNA 3KKMA 2QI9C 4YMVA 2ZUDA 3KL4A 4NTZA 4TQUS 2ATVA 4UJ3A 1JQJC 2OV2A 2JJ1A 2P6NA 3W3AA 3J81k 1TF7A 4A2PA 3DZDA 4HATA 3SHWA 4QGGA 2JLSA 1EFTA 4Q48A 1HQCA 3VHXA 3GQBA 4DB4A 2W00A 4NCHA 1MOZA 4KBFA 2FDCA 2O8DB 3CPEA 3PUXA 2GCOB 1LF0A 1NVXQ 3GP8A 1P62B 1VG9B 2ORVA 5G53C 2YVUA 1LF5A 2VP4A 3SE0A 3AGQA 4BFSA 1GWNA 3GJ3A 4YMTA 1CXZA 1GAJA 4L16A 3THYB 4DXAA 4MH0R 1R8QA 2IF2A 2R6FA 5KSZA 4DLTA 2J45A 2G1JA 4PC7A 5H8WA 1UBFA 2F1IA 2WKQA 5D3MA 3E1SA 3EZ9A 4G01B 4FINA 3WRYC 2NQ2C 3RWOA 5CM9C 3CPJB 3K9NA 4M21A 2DB3A 1JQLB 1K6MA 4EPVA 3FKSD 4QJ5A 2W0SA 4J0QA 4PC1A 2F6RA 4JVSB 5FOTA 5KDDA 2JGNA 5IK2A 3EIQA 4QBGB 4FMBB 3HR8A 5FTMA 4ON9A 2BVNA 4MITA 2FG5A 2FWRA 3FKQA 4BRUA 4D0GA 1FMLA 3ZVMA 5F9HA 4RD1A 4P4TA 3CZQA 2IYYA 4UNPA 2ZI4A 3A1SA 2HT6A 1KI3A 1NSTA 3GJ0A 1ZBDA 2IHYA 3F3YA 3QUSA 3KXIA 3MFYA 2IK8A 2V4ZA 3N70A 5J47A 2FX3A 1KI6A 2AXNA 2B8WA 2GK7A 3Q8XB 5HR5A 4ESHA 3AQ4A 4CGZA 3RNLA 2QAGA 1II8A 1OH5A 4CVNA 3SYKA 3U61B 1T5LA 2G6BA 5SZJA 1SXJA 1ZYUA 1P4SA 3PENA 5JHHB 3NH9A 2PJZA 2JJ2A 1AS3A 2B21A 2REOA 3R9XA 5JCZA 4QGFA 4L15A 1DVRA 4CEIB 4DCUA 1J7KA 5FTNA 1PVOA 3K0SA 1ZCBA 1CJUC 5JJKA 2PEZA 2J0QA 1OXTA 4V02A 1O3YA 1II9A 4LPKA 2J41A 5FL7A 2PT7A 3K0AB 1S1MA 2IYRA 4CEHB 4ZDJA 2WKPA 2YYZA 1S3GA 5G3ZA 1RPZA 1G8PA 4TTPA 3TUZC 4NP6A 1EWRA 3CNOA 5LD2B 3SBEA 1GVNB 1NLFA 1ZU5A 2YOHA 4RD4A 3PEWA 2ZJAA 1KI4A 5CM8B 2ERXA 5JS7A 3CLVA 4CDGA 4B2PA 3PJRA 5L3RA 4RZXA 1G21E 3EWSA 2GNOA 2ZRAA 2O8BA 3ZVNA 1E2HA 4Q1EA 5H68A 1BYUA 3ZJYA 3RHFA 4AG6A 1D5CA 2H17A 3BFKA 1SGWA 3CBQA 4DIEA 5GJBA 1T8UA 2IUSA 4EUNA 2FGJA 3X1YA 5CIQA 1U0JA 2G77B 2BJWA 1N5IA 3T1OA 4P3YA 4EAQA 2A5DA 1QDEA 2XX3A 1M34E 5GVSA 4AKHA 2IUTA 4B48A 3TQFA 3IBGA 3AVYA 1E2PA 3U3MA 4GFDA 1Z08A 1G20E 2YOFA 2VP2A 1E69A 3CNNA 1NVVQ 3OAAA 4ARZB 4PPQA 3BBPA 2BV3A 4B34A 1ANKA 4B2IA 4URYR 1W46A 5HCIA 3BOSA 1S9DA 1LS6A 1EX7A 2C96A 4HAUA 4KLNA 3DM9B 3X1ZA 2O0JA 1S3SA 1NKTA 3A8TA 3NDPA 5CK5A 1T9HA 1XEXB 1H8HA 3CF0A 3Q7QA 3HU3A 3JVVA 2BC9A 1ESNA 4W5HA 2CBZA 3NWJA 3KQHA 2RGCA 3EARA 3ICEA 1DEKA 4PXAA 421PA 4W5WA 4Q4HB 3I32A 1NN3A 1ZNYA 4TMVA 3H0KA 2ZVQX 2BWJA 5JHGB 3FHOA 3DM5A 3LDAA 4M2LA 4TZ0A 5DYIA 1P2TA 2B7BA 4QRHA 3A4MA 4MRRA 4GOJA 4UNRA 5JEDA 4TT3A 4TLBA 4QBIA 2WBLC 5C4GB 1Q1BA 1TU3A 3K1JA 3GFPA 4HYYA 2HXSA 2FH5B 2WTUA 2OEPA 2ERYA 3QKUA 1MT0A 3LVRE 4V0KA 1CR0A 3E70C 2VHTA 4LGMA 1KSFX 1GILA 1Z6YA 4IHQA 3RS3A 2Q9AA 1RZ3A 2R6CA 4Q18A 3THOA 1CP2A 4IOMA 4JVLA 721PA 1OIWA 1P7CA 3ETLA 1UADA 1OYWA 1GL9B 1ZM7A 3CRMA 4D4KA 2IEYA 3GJ7A 4LJ6A 3ZS8A 4BEBA 3R7WB 2NPFA 1NBME 1UDXA 3GEEA 2NO9A 2XXAB 1CULC 1M2OB 2ODNA 4TSFD 2KWIA 5CDFE 4XOIA 5M04A 1GNPA 4AWXA 1ZD1A 3PITA 1ZM3A 4MQBA 4RCYA 1Z2AA 3CONA 4C2TA 5CYPA 1DG3A 3HR7A 4NE2A 4NDZA 3B9QA 4RD3A 2WJHA 1KYIA 1HEIA 3DMNA 1HV8A 1IN4A 5HZKA 3SQXA 2JEOA 1OH7A 2J0UA 3CW2A 1JPJA 3KXKA 4FI3C 1UEJA 3O8CA 3AKEA 2QTHA 3PUVA 4DCTA 3QF4A 2VQSA 2FEMA 3OEHD 2WWYA 1I4TD 1TUEA 1Z5ZA 3CR7A 3FB4A 2I1QA 5G41A 3AGPA 4I1OA 4PQRA 5BYKA 2XZLA 4OK3A 5K8LA 1KY2A 2OCAA 2C9OA 4MUBA 4FWIB 1SVOA 1Z83A 1J2JA 2CL0X 2ZVPX 4D4LA 3LA6A 1X3SA 5L3SB 4QBFA 2Y8EA 3Q85A 4ZKDA 4Q1BA 1KSGA 3U3RA 4AC9A 3HU1A 2GZHA 4B76A 2I3BA 2DFNA 1IN5A 1OSNA 1YHNA 3P26A 4LJ7A 5CITA 3THXB 3BFVA 3IEUA 2UZ3A 3CF6R 2XNDA 1XPOA 3W9YA 1NLYA 4BEJA 4DT1B 1PUIA 4RD2A 4BQSA 1G18A 1G7RA 2FSHA 1N6PA 5E7MA 5TXGA 2BDTA 2A7QA 5UKDA 3REGA 2NZJA 3F8TA 2PCJA 3NC1C 1FPMA 1N6NA 3LXRA 5KHOC 3QXSA 5TMPA 3CRQA 2KBFA 4IDHA 5K8UA 1HYQA 2I4IA 3MJHA 4LK2A 3A37A 2VP0A 3ADKA 3ZDQA 1XPRA 3H2YA 2ZRPA 5CK4A 2BCJQ 2E1RA 1I4DD 5AK0A 2H7VA 5FI0B 2VHCA 5IT5A 1VIAA 3VX3A 4PZLA 4JS0A 1AQUA 3IIKA 4DEYA 4URVR 2ZJBA 3WXMA 3OIUA 2ASEA 4OQMA 2ZROA 2B92A 1F2TA 2ZE6A 5BQ5A 3BK7A 5J4KA 3D3QA 3UMFA 2JCSA 4GOXA 2XTMA 1NVUQ 4JLOA 4NPHA 4PZYA 4Q7LA 3EWAA 1S96A 2QTVB 2GXUA 4W7SA 4PHHA 4MGYR 2GXQA 2A2ZA 4OHZA 4JLDA 4Q7JB 4X8LA 1UBEA 3ZQJA 3MD0A 4WXPA 2BEKA 4ZDIA 4KI0A 4KAXA 2LWIA 3FWYA 2RKOA 4LBYA 2O8FA 3AVPA 1P6XA 3GLGA 3BB3A 1S0UA 4PX9A 4GRAA 1U0LA 1J90A 5ELXA 2MSEB 1BH2A 1H8EA 3OZXA 4NZYA 5P21A 2NO1A 4QM6A 2QT0A 3GJ8A 5EE0A 4PPNA 2GCPA 5EUQB 4ASUD 3U7GA 4ZIRB 1OKKA 1E0KA 5DGXA 3IDQA 4IVPA 1PZNA 3PEUA 4IEEA 1OFTA 4M0LA 4CW7A 2V6IA 1ZINA 4BLOA 2IUUA 2WMNB 2BM1A 3SFZA 2VYFA 3EZ7A 4PC3A 1SHZA 2BIFA 2NO7A 4URZR 2PCLA 1SVIA 3H84A 5G40A 2OSBA 2P5TB 4DVGA 1T3LA 2OXCA 1EFRA 4XSHA 4IOLA 1ZUHA 3PEYA 1P2SA 3SYNA 3I3SR 3I8XA 2ZS9A 5JZVA 2GILA 2ORWA 4F4JA 1SVMA 4XVRA 3AVOA 1VKJA 3ADBA 4C7OA 1K5DA 5IDVA 1W49A 2KI5A 1GP2A 4WIAA 2P67A 1R2QA 1JAIA 1LS1A 1W5TA 4WZAE 5KDLA 4D26A 1J8MF 1KZGB 2G88A 1TF5A 4Q47A 2FZ4A 3OEED 3RRNA 1XBTA 3BFXA 4QNMA 4MA4A 1CBUA 1GFIA 1S2MA 4D4MA 4QJ4A 3FVQA 1VECA 1KKMA 4XWAA 5E3HA 5TARA 4WOPA 1MABB 4ZCIA 5EZ5A 3LW8A 1DO0A 1GDDA 4L5BA 2VLIA 2V1XA 1BYIA 3NBZC 1YR6A 2CJWB 2HCJB 3A1VA 1V43A 5J40A 3LFUA 3EA0A 4DUGD 3UIEA 3EZFA 3X1WA 1U94A 1OXXK 1U90A 3AVXA 4GZLA 3TE6A 4IDPA 3RRYA 1FP7A 3ZZ0A 1YRAA 4M1YA 4DLVA 3VKHA 5CLLA 4A15A 1Q57A 4PO1A 3RABA 2AKAB 4DLUA 4XVQA 3TMKA 3NDBB 2D62A 3RSOA 5BWMA 2QMOA 4R2IA 4BFWA 4G3XA 2IWHA 4LI0A 2YJTD 2X77A 4RZ3A 4P4SB 1NN0A 3HYRA 4C9BA 5A4JA 3IQWA 4C3ZA 4E03A 3M0EA 3TKLA 1TL7C 2ZITA 2Z0MA 2R9VA 3BORA 1KSJA 4IOKA 4TQ9A 3SEAA 3B1XA 5LD2C 3T5GA 2ANBA 3RSLA 3CWZA 3IHLA 1P73A 1FUUA 2B8TA 1B0UA 1VYUA 4R9UC 4Q66C 1KDOA 3TAHA 4DCNA 3U4QA 4LJ8A 2GXAA 1ZIPA 5EQTA 3T5DA 3RS2A 4ZCMA 4FWTA 4KVAA 3JZAA 1E2GA 3TSWA 4EFLA 2ONJA 5DLQC 1E2LA 821PA 1XTRA 2ZJOA 5JCPA 2EFCB 1PV4A 2CHVA 3L8YA 4JKYA 2SHKA 1W5SA 2A5JA 4XH9B 5B2ZA 1K8RA 1E9EA 2J3EA 1EFUA 3SZRA 3KQKA 2IS1A 1KI9A 1UKVY 1UKZA 5LPNA 5EP1A 4QKQA 1NVWQ 3L0SA 4NMMA 3QG1A 2QPOA 4XIGS 2QRNA 4NYJQ 1RYFA 1TQ2A 1KDTA 2CL7X 1Z06A 2OZEA 3ND8A 3CX7A 2F1HA 2XSZD 3SJAA 4I99A 2RGNC 5JI3E 1XPUA 3B1VA 2E87A 4FMDF 2F3TA 2ZRMA 5BYJA 2ZEJA 1E6CA 5GADl 1NL3A 1RFLA 3HP1A 3SJCA 3T15A 4M1OA 2O8CA 2GAAA 5L3QA 2A5FA 4IFBA 4MKFA 3B85A 5HKKD 4GPTA 5FUYA 1E9AA 3GLHB 2XZOA 1NY6A 3JZMA 3WRXC 5DYGA 4FMDB 3V00A 2UVQA 2ZU6A 3G0HA 3EZ6A 2ZRLA 2QN6A 3LX8A 1KMHA 2GEVA 3OESA 2OBLA 3RLFA 2PH1A 4I4LA 4Q5IA 4Z51A 4EQ6A 4HUQB 2AD1A 3DZ8A 2QROA 3BIFA 1UBGA 4D25A 1HA3A 1DAHA 2AK2A 3W3ZB 2BMDA 1N3BA 5FBLB 4XSGA 4BLPA 1G1MA 3TBKA 4JL5A 3FMIA 2OAQ1 1LB1B 2ZYVX 1RIFA 1SKQA 4OYHA 3UG6A 2H18A 5FBQB 3DEFA 4UXHA 2KBEA 2EVWX 5FBWB 1OJLA 3OE7D 2ZI6A 2F1JA 2RGGA 3PIRA 1YR9A 2GESA 2PX3A 4W5JA 2ZUCA 3GLFB 4FN5A 4QXAA 2AWOA 2HLDA 3QEJA 2K5UA 3FFBA 2GHIA 1R7RA 4UXJA 3L8ZA 3I61A 3I5XA 1GL6A 3R9WA 5AJZA 2BJVA 1Q12A 2ZJ2A 3SC3A 2BCGY 2VL7A 3TSZA 5JFGA 3QEOA 3W6PA 1VYTA 1E0SA 2FJUA 4BFXA 5AWFC 3K0CC 2ZU0C 1RRPA 3T06B 1FL9A 4C0SA 2F43A 2VSOA 4US0R 1ZP6A 4TMWA 3THWB 5EJEA 2ZSBA 4LV6A 4LJ5A 4BRWA 3NHBA 4AYXA 3LXXA 3P1JA 1UBCA 3TW4A 1GKIA 1OHHD 2C77A 1BMFA 2NMVA 4NYMQ 2PLFA 3L43A 3QNUA 3CH5A 4UNNA 4QGAA 3KUCA 2F9LA 1W48A 1YR7A 3BERA 1XCGB 4U02A 3LQQA 2Q3MA 2IBMA 2WWXA 3AH8A 2ZI7A 5JWOA 3CWQA 2GJKA 3PQCA 3QG5A 3W6NA 4UKDA 2OBMA 2WJVA 4C0KA 3VMFA 3SR0A 1W4AA 4Q9HA 2JIZA 3OIWA 3Q72A 3B8HA 3P4YA 4HAVA 4BLRA 1EFCA 2VO1A 1DELA 2DFKB 1YQTA 1GSIA 4MYCA 1NIJA 1W4CA 3HDTA 2YWGA 3DOEA 4D2IA 4ERNA 3QKSA 3QI2A 5FPTA 2GF9A 5HE9A 2FA9A 1WBBA 1QVRA 1VIYA 3IIJA 1VG0B 1ZUIA 5B57C 1VCOA 3B78A 4A0HA 1T6NA 2QG6A 4O2RA 1WCV1 2ZJYA 3PVSA 1XMIA 3ZVRA 1GL7A 3KZ1E 1YVDA 2C04A 2VHJA 3S1AB 1XRJA 2V7QD 2GEDA 3QXCA 1Q20A 1I4LD 4N1AA 1KJYA 4RFSB 3WMEA 3A6PC 5D3MB 3MLEA 4BZXA 2CLDX 5FPSA 1Q44A 3AP2A 1U9IC 3A58B 2ZI9A 1JI0A 1OF1A 3KFXA 1VHLA 3WP0A 1DPFA 1C4OA 1CJVC 1QBKC 2JLUA 1FOEB 2G0TA 3D31A 4JBYA 1A2KC 1XTIA 2V55B 4TWZA 3U6KA 2CK3D 3SS8A 4DLWA 2BMEA 4B3CA 5AJYA 1GG2A 1QHHB 5DN6A 2HV8A 1E96A 3ASYA 5C46F 3FPAA 2ZRCA 1E2FA 1RYHA 1UF9A 2ZYWX 2FFHA 4I1VA 4Q7MB 4HAYA 5AR1A 3THYA 1K5GA 2P3SA 1YE8A 2B7CA 5E95A 2J0SA 2G0NA 4LSGA 2XSZA 1YR8A 1JNYA 2DYKA 3WP1B 4YXWA 4DLYA 4GL2A 1II8B 4BECA 4IDQA 2ZRBA 1A5TA 4P31A 1EK0A 1X86B 4B43A 2NO0A 3KJHA 1NKSA 3Q9LA 2OESA 4OHXA 2HYIC 4OJKA 5H1YA 1XEWY 3UMSA 3WHKA 4XD7D 3SNHA 1Z0FA 5HKKA 3TH5A 3B60A 4Q9KA 3QOFA 4KBGA 1HQYE 3VR2A 4HLUC 4KODA 5DSZA 3QVUA 4FMCF 2OM2A 2WAYA 2J7PA 4EJSB 1W0KD 1SVWA 4Q21A 2Z83A 4NH0A 3UKDA 5EP3A 1QVAA 1GTVA 2F1RA 4UJ5A 1G5TA 3I4LA 2D2EA 4LHZA 3AP3A 2J59A 1XWIA 1YKSA 4L4UA 3DPUA 3H86A 4LV5B 5FTJA 3ZZUA 5JSZB 2ODWA 2O8BB 2PZEA 2DFTA 2GJAA 1U2RA 1FFHA 4LHYA 1R5NA 1F48A 4LY6A 2QE7A 1VCMA 4TL7A 5H70A 2G9NA 2DY1A 2JLZA 4TYWA 2WM9B 3T1QA 3TRFA 4YDHB 2AD5A 4FMCB 1AS0A 1IJEA 3KQLA 3VR6A 1JAHA 5KYKA 2VP5A 2QSZA 3OE7A 4HDOB 5HZHA 4KCGA 4V0MA 4JLMA 1GNRA 2ZS7A 5A5GA 4HDQB 5BN5A 4CEIA 4UQOA 4DRZA 1OXVA 2FF7A 3ZGXA 3ZIAD 3N5CA 1G5RA 4PANA 2QP4A 4M1WA 4NYJR 1N6KA 4PSAA 4AYWA 2W2XA 4LDJA 3LBHA 4G5GA 3C5CA 4M1KA 3ZD6A 3X2SA 2QGZA 3K0AA 1ZM9A 4CEHA 4RFVA 2YOGA 1TEXA 1G19A 2W6ID 1SXJE 1XTKA 4H1UA 2BMFA 2QQEA 3DKVA 3ZYCA 1FNNA 1DAFA 1ZD8A 3LRPA 4G5RA 4JLBA 3AVUA 4WA7A 3ADCA 1XJCA 4BFZA 1XZPA 2OAP1 2RGEA 5EUMA 4NBSA 1G8FA 5F9FA 1Z6XA 3TSOA 4EPWA 1KNQA 4XWKA 1P75A 2GWHA 1O87A 3AVWA 3PUYA 3B9PA 1T3HA 4GI7A 5AUQA 1SULA 3A1TA 4M1SA 3LLUA 3UG7A 1R0YA 2QP3A 2HF9A 3A1WA 1DS6A 3U44A 2AWNA 2IYSA 4OHYA 2GF0A 2W6JD 4M8NE 4CRWB 2IYUA 2ZAMA 4LX0A 2J87A 4BZPA 2QTFA 2VSXA 2X19A 1MRNA 2DBYA 4MYHA 4ARZA 2NZ8A 1PUJA 3BS4A 1BOFA 4B44A 4QFMA 2BM0A 4DB2A 1XD9A 2RGNA 2JDID 1NJFA 1G16A 4EIWA 2EW1A 4DHEA 4A0RA 4MKHA 3T12A 1W2GA 1E1QA 2ZM5A 2YNMA 4IVRA 3R8CA 5BXQC 2ODBA 2ANCA 2O0KA 1XEXA 4EPYA 5JMTA 5F98A 2FN4A 2QP9X 4CF7A 5FBVB 2DPXA 1BS1A 3Q3JB 1L8QA 3BD9A 3BGWA 2ZRGA 3M6AA 3Q7PA 4HSEA 1S8FA 5CJ2A 5SZHB 4BFUA 2F7SA 3DVLA 4DEXA 1T8TA 2H57A 2IEZA 3IIMA 4ITRC 1BKDR 4OHWA 4BPBA 3FFAA 2X2EA 5KSPA 5B30A 2QMHA 1L4YA 4Q4HA 2OFWA 2HJGA 3SJZA 5FOSA 3NG1A 3SFVA 2DWOA 3DKPA 1X8KA 5JWHA 4UNSA 2EFHB 2PX0A 3FHCB 6Q21A 2VPPA 5JI2E 3GJ4A 1XCMA 2V7QA 5FH9A 2JLRA 3BRWD 2ZSFA 4OJQA 4TMTA 4BASA 5KOYA 1KTVA 1G17A 5TB5A 3FMOB 1A2BA 2QENA 1GIAA 2VSFA 2XB2A 1KO7A 3IPYA 2GTPA 1E0JA 4GSYA 4QL3A 4JJZA 4RJLA 2YKGA 2ZI3A 5GJCA 3C14C 4AK9A 4NYMR 1E99A 5K8TA 1ZMXA 1CR4A 2VRWA 2C78A 4JIMA 2PLRA 3IKJA 4TLCA 5SZIA 4AKIA 3FKSA 1RKBA 4HI0E 3A1UA 2RCNA 1G64A 1A4RA 2FNAA 4LC1A 5LB2A 3X1DA 3ASZA 5EXTA 5DI3A 4TYPA 1E1RD 2EFGA 2B6HA 4MRPA 5A0FA 1T4GA 3F0TA 3WNDA 3TNFA 2XXAA 3TW8B 1NF3A 5FOWA 3R9IA 1NJGA 4US1R 1FX0B 1P3JA 4NYIQ 4LYJA 1KK2A 4B2LA 4PQFA 3WMFA 1JALA 4LOAA 2XJ9A 4V0OA 1Z8FA 4E09A 3K0CA 3RS7A 2OFXA 2CLSA 1YJ5A 2Z5FA 4PSKA 2BHRA 1AGRA 1U8YA 4Q4JB 2NOAA 2Q9CA 4U00A 3VKGA 1RRFA 4ZI3A 4LC0A 1WE2A 1US8A 1KDRA 3EZ2A 1IM2A 4HDCA 2CE7A 1A7JA 1ZNWA 5AUOB 4QBHA 1G7TA 5CJPA 3QQ5A 4OQLA 3LBIA 3QBVA 4N0DA 4Z54A 2ORIA 3NIBA 3CIOA 2WPDD 2H8KA 1EG7A 1NSFA 3B7GA 2A30A 2QORA 3T34A 1W0KA 2RAPA 3HWSA 1KAOA 2GBLC 3JVUA 3KJGA 1MO5A 1AJEA 1DE0A 3EPJA 1I2DA 1YZUA 5BN4A 4HZIA 4II7A 1EFHA 3TJZA 1V5WA 3VX4A 1T3SA 4KV9A 2HCBA 1JR3D 3K09A 2NG1A 2A5YB
chains in the Genus database with same CATH superfamily
4HH3C 1P5ZB 3ZWOA 2YZNA 5JD5A 1I80A 4TYNA 1G2IA 4L4YA 1YB2A 3VDRA 1GPBA 1PTJC 3NHRA 2J6IA 3HM2A 3Q5EA 1WZ2A 5MN5A 3OOWA 5IAKA 4EKIA 2ZETA 4YXFA 3I09A 4GE0A 2Q5OA 2XNSA 5ERGB 5FNVA 5CDUA 1LNZA 1ECLA 2CXQA 1AUOA 2V5AA 3CSUA 4JL6A 5B2EA 3SGLA 4MVYA 3ER6A 3TG2A 2EKPA 1BA3A 1MG0A 2QGFA 2Q6VA 4OA5A 1FFEA 5JCJA 2YXDA 2CDNA 2GPWA 2W6IA 4U7JA 2WB4A 2ES4A 4EI7A 1PWZA 3PU6A 4LZPA 4ESOA 2J6HA 3EXG2 5KYTA 4LJ9A 3RS5A 3ZCPA 4IH1A 4N7RA 3ZKWA 2LXNA 4D8WA 1RPAA 4IDAA 4EVIA 3T3OA 1RP1A 2WSIA 2WMOB 2CV1A 2XCRB 4OXNA 3DCJA 3O90A 1OBFO 2FPRA 3JAMA 3KJIA 1FMTA 4XCQA 3BSFA 4BQPA 4BX9A 4FD2A 1A77A 1NIPA 2YWHA 3ZD6A 3G1WA 2VF7A 4IKOA 3SZ3A 4AQ7A 4YMHA 1PJ2A 3HVJA 1IZ9A 1B16A 3B7PA 3I58A 3JD0A 4DDUA 2VCHA 2GLXA 1Z37A 1HBJA 1X1RA 3MVEA 4LVNA 4D0LB 3WI7A 1V1RB 1HGXA 5HIJA 4UTXA 3MJFA 1SN7A 3U3ZA 4GWGA 1T2AA 4M9QA 1VGVA 3JQBA 1JQAA 1I2MA 3AV0B 1IIRA 3IT3A 4KXUA 4Q19A 3WWPA 4CQJA 2PGAA 3WIOA 2DR2A 1BJTA 2OFOA 2ASVA 4GQIA 3VR3D 4OHVA 1F2UB 1UXIA 4HDSA 3WY9A 4AZ0B 4DCCA 2FG7C 2A3NA 2CFOA 1L4MA 4M7WA 5CG2A 2PZMA 2CD9A 4BTLA 3T0GA 5KNBD 5KX5B 2O2SA 3VR1A 1AXRA 2JDIA 3HB1A 2V3WA 4PNPA 3RANA 2R6GA 2Z04A 4MROA 3SE7A 2N75A 5B55A 3AUTA 3L6EA 4JEHA 3ZCQA 4ACBA 4FYIA 4OMFG 5AVOA 5A6VA 1X7WB 4HUJA 2EP7A 2XT9A 3O0DA 3FIJA 2C7OA 4Q9LA 3CF4A 4UTOA 1N0IA 3ZE1B 2NZUG 1HYEA 5GONA 3WB0A 3H17A 2RD2A 3IXQA 4B71A 5AW7A 4EHKA 5HUHA 5IXYA 1AN0A 4OB6A 1VL8A 3D6UA 4GWLA 1KFEB 3B52X 3BH0A 2QRHA 4FXPA 2ZW9A 3TLBA 3OP4A 3TNYA 2QBYB 3GRFA 1X74A 2TMKA 2GCNA 3NBXX 4PCAA 5JIBA 3WGZA 1GRNA 2B1QA 3UOWA 1FYWA 1Q0PA 4K1XA 3VU3A 1EWVA 3ZDZB 1ULUA 3TIIA 5LOVF 1AK2A 1SXGA 4TSFA 4FP9A 3RTEA 4BRSA 1Z22A 4ZDKA 8ATCA 2EHDA 3KDSE 3MBIA 4G1UC 3ZLJA 1IJFA 2W71A 3T1VA 5F5NA 2R68A 2CWWA 4MKGA 4PO8A 4WXMA 2CXSA 4U2GA 5HTKA 3UANA 3WYAA 1E4YA 1HNZB 2XWPA 3LCUA 1PT8A 5JWRA 1H0SA 5AQ1A 2FFJA 4MZXA 4XRGA 5HRCA 5JZ9A 2ZRFA 3GFSA 2SICE 3S2SA 3TR5A 3V2IA 3VV3A 3ZGZA 3IJ5A 3LBFA 4KHZA 4RSGA 3I5YA 3GPLA 1YTLA 1DAGA 2WZQA 1XFAA 2DECA 4NJOA 3UNXA 2WWIA 3IOYA 1G3QA 1TMKA 5JDCC 3QMMA 3OZAA 3ZI7A 2DHCA 4JSYA 4X1KA 3T38A 2WT8A 4FBMA 5BT8A 5IJ0A 1I4OA 3ZUGA 4FS8A 2P6RA 4CM4B 3BAFA 5HGXA 3EH1A 3ZDAA 3JD3A 4Q16A 4UEKA 3QU7A 3W8RA 2MTBA 3H8VA 1CDOA 5K2MA 1D9ZA 3RU3A 2JKVA 4MQFB 2JGDA 1KZHA 3U4AA 4MP3A 4ABYA 1R50A 4KGVA 4D80A 4OK6A 2EERA 5EY5B 5D5HA 4UOQA 3A6GA 2HMWA 2WEKA 1O9HA 2O7RA 1RLJA 2AE2A 4X8MA 2Q21A 1YFLA 2O52A 4FNOA 1HE1C 4LDQA 4W5NA 2PD3A 4AKTA 1XTTA 4HNAB 3N2EA 4MDYA 3G5TA 4UHEA 1JFLA 2LCFA 4BZWA 1BX3A 2WAXA 2LZ0A 1PK9A 4NICA 5CB4F 4I8XA 4JFAA 1IHDA 1OI4A 2JIOA 1UPXA 2ZULA 1LRKA 1S2GA 3E8SA 3JQ9C 2FN9A 4YJ3A 4A92A 3CINA 2PS0A 3JARA 3ZH2A 3JQ7A 2VJQA 3I8SA 4KQHA 5CLQA 2PIAA 4C4TA 4R81A 1CRWG 4R1TA 3DJYA 3KHTA 5JH7B 1T3TA 4PBSA 2C5AA 2E4WA 4EQZA 1PZMA 1MQAA 1P7ZA 3RUFA 3UB3A 2VDUE 1YQQA 4L76A 2IDZA 1BW9B 2XTNA 2C3UA 5AJHA 2OFPA 1Z07A 1CEQA 3U17A 5IHXA 1VBMA 1RYBA 3BMXA 4QFCA 4A8JB 4NMHA 5IKMA 3CLUD 4K6FA 3NTQA 3R77A 4A0QA 5B3KA 2WE7A 1M6VB 3FPCA 4FX2A 4INPA 4PLPA 4BNJA 4KUHA 1T9ZA 2Q49A 4LJYA 5L3QB 4ZOLB 3RQIA 1XTSA 4MULA 4IEFB 1C50A 4MRSA 1XZQA 3H4VA 4NHOA 1ADGA 1SD2A 2FUEA 4CIYA 1QHGA 3K3PA 4FWBA 3PNQA 4QASA 3GLRA 1NT2A 4C0QC 3LYHA 1T1EA 1XKXA 2ZRHA 3O8BA 4N49A 3E2IA 2QS9A 1VJ5A 3W6ZA 3E35A 2OA0A 3RRJA 4C0LA 4A8PA 4IIGA 2P3LA 4M83A 2DUMA 3KOUA 4RESA 5FPKA 4XWYA 1U2GA 2PR2A 4R7ZA 1FLNA 1IAVA 2PFGA 3DQZA 4GLOA 3ENKA 1P81A 4PG6A 1NVAA 3C7CB 4FCWA 1ZESA 2Q1TA 1RXWA 3P9YA 3A27A 3P0RA 3HNPA 1MDBA 1M7BA 5KTYA 2GVZC 1WM1A 2VH5R 4B3GA 1X7GA 4NC9A 3O31A 2YQ5A 3I5MA 4ILKA 1GUYA 2RIRA 1GNVA 4TXMA 1ZUNB 3EFHA 4K87A 5BXYA 4OXRA 5M7EA 2OV4A 3NHJA 1CUVA 1XRMA 1TK3A 1OWLA 2D4HA 2P11A 2QUAA 3MAAC 2TS1A 3AVTA 4DAEA 3OA0A 1TM1E 2VBIA 3KFVA 1GDTA 1J22A 1D2NA 3TI9A 1NRWA 1OYYA 1GGFA 2EJVA 2QB5A 3TDNA 2VAMA 4KSBA 2MMGA 3RBXA 1UQUA 1MPXA 1DEOA 2JBAB 1LXCA 1V4VA 2K4MA 3NHUA 1C9NA 3MQFA 4CQLA 3RW9A 3CSDA 3Q1LA 7ADHA 4OSEA 1HTWA 2MOKA 2X9GA 2ZRDA 3KFLA 4R0VA 2HJVA 3CRNA 4GOLD 3PYLA 1TA9A 2Z95A 2IWRA 4HF7A 4RY9A 4GM0A 4N9WA 1CTQA 1LK7A 4YJFA 4MMZB 1P0IA 1V5IA 4Z4HA 4HUQA 1G59A 2KLHA 3EUEA 2P2CA 3DTVA 1J0DA 1Z5UA 3C16C 4FQ8A 4XUDA 1Z5OA 1PSDA 3TEMA 3ER8A 3U3KA 4I55B 1N5JA 4PCVA 5I8WA 5CYGA 2G3YA 2ZRKA 4TKUB 1GU7A 1GPH1 1KJZA 3PDCA 2HDWA 5A4AA 3RK0A 1YVRA 3T4XA 4BDSA 3Q5DA 1V16B 1QYWA 5FYDA 3OZTA 4YWHA 3VOSA 2FEXA 5DYYA 1U4NA 3LW7A 2PJRA 4MGKR 4QXPA 5IMBA 4JI0B 3QKTA 2RK6A 2KM1A 4GQAA 2YWBA 5SY9A 4QULA 4CUJA 4I3FA 2IF0A 1D2GA 3FXAA 2XNKA 4RX1A 1J0AA 1WCIA 5EVJA 1JQEA 1MB4A 2Z9CA 2ISQA 5EESA 3U4HA 1GJRA 4IQGA 3KP1A 2B36A 3KTFA 5DKFA 2GD1O 2NTNA 1RW4A 2XVXA 1QGUA 3AWIA 4GI5A 2GFIA 1IG0A 1EJ6A 4MUMA 3V4FA 1QHXA 5D7BA 2FU5C 2MT9A 3AI7A 1AO3A 4FIDA 4NCKA 1VSTA 1Z16A 1FP6A 3FR7A 2DH6A 1IUNA 1CR2A 4H1VA 1Y7PA 4H18A 4RANA 4CFSA 4BQEA 4CEJB 1YI8A 1OXBB 3PJFA 1E2MA 1R4ZA 2W2KB 3T9EA 3L7LA 4RAOA 3HZHA 1LLCA 4GKAA 1RIIA 3EA5A 3DVQX 3I6MA 2GEJA 2VYNA 2DTDA 5AJUA 4RJKA 2C7PA 1O54A 2ZSDA 2JLYA 2BKUA 1MW8X 2DPHA 2IP2A 1NTRA 3LKDA 2O8VA 4D4GA 2J9YB 1TQ4A 4D9GA 1ZJ5A 3DV0A 3LOPA 3OVMA 3QKSB 4M54A 4XIJA 1Z4IA 3QVJA 5J2TF 4G5OA 2ESRA 1XDDA 4HNTA 3OMWA 3OJFA 3RTBA 3W5IA 3G17A 1OC4A 4RJTA 1E9FA 5MFPA 4LMAA 4EDFA 3IEMA 3WB1A 1I5OA 4BNIA 2CXPA 5AVSA 1UBLS 2DLDA 1A4IA 2OBXA 3BB4A 4D0SA 4QUHA 4Y9RA 2P9CA 4CHTA 4EHBA 4QU8A 1MO6A 5DI9A 3M4JA 1GPDG 1VP9A 2PRIA 1FTQA 4TGLA 1UBKS 3W06A 1ML4A 3VSDA 3I2JA 1TT5B 2TRSB 3UJ6A 3WGIA 5KYYB 2ZRQA 4YR9A 4TKVB 3WLFA 4ATNA 3HYLA 1E8NA 3EW9A 4EABA 5M3BA 3N2YA 2HHAA 5DBEX 3ZWAA 5ICCA 3NNDA 4IIFA 4XJXA 3MS7A 4RMJA 1LVGA 2ACWA 1WCWA 1XMVA 3W5UA 4C0XA 4NKRA 3O8QB 3WHPA 2F9FA 2OLJA 1VYVA 2X0JA 4ZREA 4A3SA 4RQUA 1NF2A 1X7XA 1ZOLA 4FYKA 1AVTA 1N5MA 1RFGE 1PT7A 3BSSA 3GEIA 3KQQA 4ZRDA 2BY4A 5TVKA 1U63A 3AR2A 4FDMA 5CA1B 2BEUB 2VXBA 1ISRA 5TF0A 5ES3A 3PEVA 1A96A 3K6RA 2CNBA 1X87A 3NOXA 4XVUA 2C7GA 2VF8A 1ZCFA 1SKYE 2MSCB 3KKNA 1VG8A 2EFJA 4LDAA 1FY2A 4I9GA 1TVCA 3K4QA 2VYVA 3IUYA 3QM1A 4JEIA 1U8TA 3D54D 3H1PA 3JVEA 4MVJI 4F8JA 5HQTA 4CDNA 3IDSA 2YIJA 4IWXA 3MMPA 4DOMA 1NLZA 1RWWA 4E5MA 1G8JA 1WXFA 1ICIA 1G8HA 1NFFA 1XO1A 1Y3FE 2C98A 2IP1A 2ZI5A 3GRRA 2Y93A 4OKSA 4RGQA 4UUAA 5B2FA 1VBNA 1PGPA 1BEUB 1E2JA 4Q82A 2XYPA 2HDNB 2BFDB 3ACBA 1OY1A 2R2AA 1FZQA 3DUFA 3U1BA 1EJBA 2ZJ8A 3MTBA 3DGFC 2DT8A 3EVFA 4BVKA 4I1PA 4OXYA 3BTOA 4MB2A 3PGXA 1X0VA 3IP5A 2AX4A 4J0IA 2MR5A 3O9VA 3INNA 3S7TA 1FS5A 2UKDA 2G0AA 2PWZA 3HXKA 1YO6A 1B0PA 1P77A 2ZANA 4JCOA 1ZOPA 4R40A 4XVHA 3RG8A 2NV2B 2ORYA 4PGFA 2ZTHA 4ESEA 3KNZA 2W11A 2NZVG 2JLWA 1AIPA 1I1NA 3BIOA 3D1LA 2XUGA 1S4QA 2QIPA 1KORA 2Q07A 1V1MB 3JQ8B 2FLVA 3HN2A 5DNYB 1EDDA 1GRVA 2R65A 2CEAA 1R3UA 2GHQA 1YUBA 2WFMA 1FDWA 2A3RA 3GYBA 3HZZA 2EBHX 2IZ5A 3T3PB 2GEKA 3WB2A 5DJ5A 1FK8A 3UC5A 4RH1A 1VJTA 2NXJA 2AUTA 3DLTA 3WG9A 1WLYA 2XUAA 2CHFA 1NVGA 5A62A 2GKSA 1LY1A 3HDGA 3LT1A 3REQB 2R47A 2FQWA 3B2EA 3O4HA 3DSRA 1JJFA 1NY5A 1PJTA 3EXHC 5AHOA 3NONA 1YC5A 3ROEA 4E5DA 1MNAA 3U5ZB 2FMTA 3MM4A 3INGA 2Q5LA 2QJTA 3CNLA 3KZOA 4DCGA 4Q9AA 1ZRHA 1UKYA 4KVFA 5C8DA 4IYJA 4X8HA 3E3NA 5C7YA 4K1LA 5BSHA 1OX4A 1P0QA 2EARA 1H3EA 1BD3A 1DV2A 3AL2A 3JWPA 3VDXA 3CHYA 3AJAA 1ZITA 3R09A 1GLNA 2VRNA 2YV2A 2ONKA 4YQZA 2ZJ5A 4TMFA 2DHQA 4DCJA 1JPNA 2X13A 3ZTYA 2WWGA 4FZ5A 2FEPA 2EKLA 1KIMA 5FHRA 3S8EA 5CB6A 1FRFS 3ND9A 1YOVB 1E4VA 3MOSA 4CV3A 1ADFA 3NVAA 1S7GA 3A3YA 4E70A 5LZ2A 1RJGA 4US2R 3P2MA 4RLQA 5GV7A 2JKZA 3PUWA 2IZ7A 5ED0A 3TMYA 3TKYA 3AF2A 1ZK3A 5H9VA 4E21A 1TZJA 3O3MB 4FS3A 1RI1A 4A27A 2J9RA 5K6AC 1U7WA 1J07A 4GX2A 3LDFA 3U81A 5C18A 1OD6A 2PSJA 2QOEA 1VXRA 1NVBA 4G0WA 1WXHA 1YB1A 2XNHA 3JYLA 5AI6A 1KHHA 3TSYA 4AJ2A 3OEWA 3V5NA 1YZNA 3CH7A 1H9AA 3QENA 5ALOA 4TQAA 4DG9A 3HM9A 4V1CI 2I1VB 4X6YA 3BMCB 5FPPA 3FZNA 4MIKA 3VJKA 1CEEA 4QT0A 1YRLA 4MV4A 2JK0A 4QNRA 4CQMB 2E2WA 3OQIB 4LTNA 4NVRA 4KFCA 5DSTA 4B4UA 1KI8A 3TM5A 4P0PB 1OFGA 1JFFA 1ZLXA 2WP8J 3BJIC 2PVPA 4Z0NA 3SPXA 3U7JA 1LK0A 1DAMA 1R66A 3OU2A 1ZSNA 4LFCB 3WGTA 1Q3KA 2C9MA 3B3JA 4UBKA 4AY2A 4ZXFA 4MGIR 3AHIA 3MUFA 3ZQKA 4BFTA 4B17A 2RJNA 3VC7A 3P0EA 3Q9NA 4D9JA 4DQ0A 4QGHA 4WCFA 5L3VA 3CB4A 2A4KA 4U2KA 4V3BA 1QTIA 1ZJ4A 1EE2A 1NBMA 2C4WA 2JI6A 4OOEA 1L3BA 4D92A 3N75A 4AL4A 3ONNA 3TCXB 3CRW1 5CDFA 3ESYA 1IN1A 2LD4A 3EIEA 1T2VA 5EMNA 1G8YA 3FVTA 1A9RA 1X80B 4KGXA 1WBJB 4KN6A 4O0MA 5ALHA 5EMLA 1Z0IA 2ZYDA 3ROZA 5KWJA 3F6SA 4QHTA 3A4NA 3MMSA 3I64A 2O2JA 3FYHA 1U98A 3LQRA 3NNSA 4QC2A 3FUTA 5ARDA 2HXYA 1QYVA 3TVYA 1CUEA 4CNQA 4IEIA 4PHFA 4EFDA 3SMQA 5E2IA 2AKYA 3IKLA 4PF1A 3OE4A 2V6MA 4NECA 1BCRA 3ZY6A 2O2GA 3CUEF 1H4VB 1ZIYA 5FOQA 4ZYWA 2Z6UA 5CBKA 2FK7A 2I4OA 3WRXA 3FKJA 3HA7A 1Z62A 4GYJA 5EJ9A 3A4VA 4XJTA 4I08A 1DQZA 4TWJA 1DAEA 1E5TA 1E79A 4CMBA 3OFVA 2ZZMA 3E23A 5FUWA 5B4TA 2VK8A 1QF9A 1YACA 3CKLA 3BMQB 3E9MA 3ILSA 4DQUA 3VTZA 1JU9A 2FPIA 2P9EA 4L5IA 1F3OA 4KFTA 1SUCA 5AD1A 3E18A 3G9ZA 2DWQA 2C2KA 3NHSA 3MJEA 3MPUA 5JE8A 3CU5A 1I01A 1QIHA 3T1TA 3C7KA 1I1HA 1CJMA 2YWEA 4P3OA 3L40A 1QIJA 2DTEA 1Z4JA 1T5TA 2AYXA 1J42A 2ZBPA 3LD9A 3G8BA 4WWHA 4ACAA 4HR7A 3U7HB 5DI3B 5DCYA 3BWEA 3BZWA 3HFJA 4URFA 5TX7A 3UMYA 1F60A 3DAPA 2B35A 4DAOA 2AOWA 2NVWA 2GJ4A 1X2EA 2IV7A 4BNGA 1AD2A 2PHZA 2B8EA 1QIKA 4BMSA 4MIEA 3R7WA 4YC7A 2G7MC 3JATA 4G0NA 2I4LA 2ADMA 1QHYA 2PKYX 3MRSA 2CFSA 3GJQA 3VR5H 4OFBA 1GCIA 2NNWB 4P22A 5IULC 1P60A 1A8UA 1M1YA 5D01A 2NUAA 4GVPA 1COWD 1LWOA 4IIBA 3K0EA 4KR0A 4OQNA 4CG0A 5C5DA 1WMDA 2WIGA 3LC0A 3OQNA 1LK5A 2G72A 2QU8A 4BV2A 4OUDB 4RNDB 1Q3TA 3F7NA 4XM2A 2O05A 3SZLA 2C2XA 3MD9A 1CQIB 1KRXA 1ZCJA 3CRRA 3FDXA 4Q9JA 5ALFA 8LDHA 1I33A 1O94A 2HIHA 4YCLA 1PNQA 4ZVPA 4NJEA 4OBBA 4DMCA 1W36B 4DUYB 2QJOA 2IT1A 3MF4A 3IBFA 4K9MA 2BMAA 3OZEA 4K81B 4BMDA 4DV3B 4DIFA 5IVHA 5I9BA 4QVKA 1TUGA 1P31A 4PZEA 4C5BA 1KMNA 3H1TA 2XXBA 2IHZA 3QBEA 3QFCA 4TTJA 1W85B 1YJAA 5HIAA 1VIMA 3WAJA 5LBTA 4Z3KA 2R2GA 3PUZA 4NCBA 3WJ2A 3Q9SA 3EF1A 2Q0QA 2J5QA 4LYAA 2ZIXB 3FSJX 3DUWA 1GGVA 1QXSA 3H19A 5AKKA 4C7JA 1TTHA 3G0DA 2C5HA 5C8VA 1SWVA 1L5WA 2C3PA 4TWIA 1AQNA 3HLYA 1EXDA 1PD1A 1JJ7A 1NC3A 5EUCA 1G2OA 5M2QA 4AZVA 4O4JF 1JMYA 5IJ9A 1JT2A 3T7SA 2BKEA 4DW8A 2F67A 3O8LA 4J9UE 4OY3A 3SYTA 5CH8A 3TUIC 1KJWA 1U2TA 2QVGA 4KXMA 2GZ2A 2I33A 1ES9A 1R0WA 5JQWA 4YGXB 5JXHA 3GP3A 4AIIA 4J03A 3PCXA 3JQQA 3ZDRA 3LPNA 1GA6A 2O0HA 3RSFA 2EZ9A 1Q95A 3OPYA 4R9SA 2VDOB 4ZAGA 2IXAA 1ZK0A 2XDAA 2HQRA 2BKXA 5DIFA 4GQBA 1CU1A 1TB4A 3ZIAA 4GRDA 5BSKA 1L5VA 2O8FB 2IA5A 1E9CA 1K89A 1K63A 3D6TB 4UMEA 1AT1A 5AUNB 3SEFA 3I3OA 4G65A 2BUAA 4QOGA 4DR2B 2POQX 3W1EA 1N3YA 5T4BA 3HDHA 4NMLA 3C5WP 4PR3A 1H3FA 4TL8A 5TR9A 1W52X 5DEOA 2OXFA 1IQUA 2JJYA 2MIIA 2H63A 2IHTA 1BE1A 1XMSA 3KWMA 5SV2A 2VWHA 3NEJA 1LD3A 2OAEA 1MB2A 4U8HA 1IL0A 1EKXA 3MWKA 1KK3A 2O20A 4TS3A 5FCDA 1DCMA 1ODLA 4Y6RA 4CIBA 4BMYA 4B32A 2GETA 1R4AA 4K6KA 3U7QA 3FWKA 1SAYA 2BHLA 1C0IA 5T6BA 3DOUA 4PTYA 3O2NA 2WV7A 3HPRA 1HPLA 2HCTA 4FFRA 4HHEA 3HBFA 1WDTA 1GZ5A 3K0BA 3CO5A 3ADDA 4PAGA 1AC5A 3ITKA 2JL1A 4O4HF 3LF2A 4PE5B 3B5IA 5DASA 3SICE 4DN6A 5CXUA 3N39C 4KITB 5C9ZA 1CF4A 1TTQB 2BMJA 2GLUA 1N2CE 1U02A 1C3XA 1RWOA 1AN9A 3MWGA 5EQDA 1D2MA 2P69A 1G42A 2QUZA 4U7PB 5DGTA 3GUUA 1IC6A 2Q99A 3VZPA 4UUOA 5EP4A 1Y6JA 2JHPA 1C9YA 4A6PA 2BGGA 1TZMA 1U3WA 3N2IA 3BXPA 3DEZA 4G5SA 2IHNA 1Q0SA 4M98A 2J9FA 1JI3A 5IAGA 2DBRA 3T0FA 1GARA 3GJRA 2A0UA 2G04A 5C4MA 2VEOA 3WDKA 3Q3GE 5A2QA 3BK2A 3FCAA 4JJ6A 2PPVA 2BFCB 2IOYA 4TLEA 2OE2A 2HQ1A 3LT4A 4TKZA 5BMVB 3O1IC 2WJ3A 4QSMA 4PC6A 2IX3A 3PFGA 4DC1A 2QR2A 4R6WA 2XGJA 1QSGA 5A4MS 2KSQA 1G55A 4F84A 3AKCA 2QN3A 3BWCA 4MO9A 4AY6A 3MTQA 1KFJB 1YS6A 3PNSA 2ZXUA 4EI2A 4YUXA 1LPOA 4NOLA 3TTTA 1KQPA 1JAXA 2W70A 3KSMA 3EGXB 3U49A 1EFVB 1B6TA 1HT0A 3NGXA 4RK6A 4EG1A 3G9XA 1OI2A 1POXA 4RZIA 1V1RA 1XWWA 2Y67A 1RBYA 1WXXA 5A02A 2QPTA 4LG1A 4MI3A 4D99A 2RAVA 4NQRA 3ZJTA 3O73A 1Y6FA 2QAGC 1ZJ6A 1F2UA 4AZ0A 3ELUA 3PICA 1I6MA 1M1NB 1ZGAA 4Y0AA 3HRHA 3GLIB 4B9EA 3FMVA 3ELBA 3WQSB 2CV0A 5GIPE 5E4FA 3PR2B 5B7QA 3GGPA 3HJTA 5I7OA 4X62B 1YB5A 2AF4C 3U7FB 1NG1A 1BMFD 2CHGA 4Q3KA 2EQ5A 4LQDA 1Q0UA 3AW8A 3EWIA 3VAAA 2CCJA 1E0AA 3INRA 1J99A 3EGVA 4Q6WA 1JE0A 4V03A 3AI1A 1JIVA 3U16A 2C42A 3HJUA 2QGNA 3G2QA 1W36D 3S29A 4HH1A 1E18A 1EGMB 4NQZA 2VJPA 2XOKA 2PANA 3QVWA 5AH0A 4KJZA 2BHNA 5EFOA 3ZCUA 4OQEA 3AONB 4LWPA 2QBYA 1THZA 2HSZA 4L07A 5H02A 3VH1A 1IE3A 1VXOA 2BGIA 4B9AA 2YCBA 4G5HA 4FPXA 4CPDA 3EDOA 3P97A 3TF5A 3OQ1A 4C0BA 5CFOA 2ZJZA 1MR3F 2C2GA 3WNQA 3HEMA 2VP9A 1ZNZA 3IODA 1E9SA 2W2VA 3DKIA 1XF9A 4UVHA 4ZMBA 1JW9B 2AEEA 1P18A 5F3DA 4K9OA 4FHDA 4C6TB 4ZT2A 4LXXA 1TO6A 2NVUB 5FHQA 3RAPR 1F0YA 3M89A 2GOYA 1E2EA 1R6TA 4NU0A 3L4BC 4GDMA 5CFMA 5H7XA 1KEEA 1TFRA 2CJYA 3L79A 2XWQA 3AKYA 1R0ZA 4P3XA 3MTEA 4PQEA 4Q9IA 4TYYA 2OT3B 1DIHA 4Q3AA 4QODA 4CT5A 4Q03A 1WXWA 2VLBA 2G71A 4R4JA 1J70A 2FP3A 4C4RA 2BH2A 3B13B 4CM4A 2YKGA 4IQ4A 4J90A 1YWGO 2ODEA 1CV2A 1M7HA 2V8BA 1DJPA 3K53A 4CKXA 4LF5B 2HU8A 3E0XA 5JCOC 5JJLA 2FLWA 1Q1ZA 4MQFA 2F55A 1I94B 2GXSA 3JWEA 3JYHA 3ZZTA 1KERA 3SXPA 4Y2QA 1YL6A 4L6AA 5FR2A 2IYZA 5E2AA 1M76A 1N2OA 1VI5A 2FEWB 2R6DA 4CKCB 1J2YA 2O8CB 2MSDB 2R6JA 3P4XA 3BCUA 1QHNA 1JJVA 2R66A 4HNAA 1OW3B 2OC4A 4IJMA 1OBHA 3OQJA 4BVHA 5JSUA 3G2KA 1K5PA 2JFNA 3O84A 4UAGA 2B94A 4YRDA 1O8CA 4BZQA 3F5FA 5J5AA 5G1OA 2ZKIA 3UV7A 2PUDA 3ZS9A 3PLRA 2I62A 4REQB 2X14A 4X45A 4J0KA 4ZVTA 4DBZA 1N0HA 3OUTA 1EQAA 1PCXA 3D81A 3NI2A 1SNYA 3SCZA 1AZSC 4BCDA 3ONWA 1P4AA 4YMIA 1ACMA 1LNSA 3FNQA 3NEYA 4FC7A 1BMTA 2C57A 2HAEA 2GS9A 3SU8A 2QDXA 1U65A 4CM3A 3LVBA 5EIFA 2OHFA 3WLEA 5H80A 4A8JA 3EDMA 2KPOA 1P3Y1 3M9LA 2WJAA 4D9CA 1QNFA 2IKQA 5AYVA 3OZUA 2DVMA 2CGEA 3GUCA 4DADA 3VM6A 3QEBZ 2VH1A 3LBNA 3WNBA 2WVJA 3DB2A 1XXHB 2C07A 3T54A 3TQIA 5B64A 4NBTA 3KZKA 5KCMA 3ANNA 3QE4A 1YS9A 4ND4A 2FF5A 2VJYA 4DPLA 4GVXA 4PSVA 4HEJA 2G1KA 4UD2A 1BEZA 3GT4A 5C32A 4ZPXA 3TFOA 2IXEA 2V58A 1HH4A 1DNPA 1DRJA 4OKNA 3EX7C 2NTEA 1T13A 4RY8A 4AUMA 4LSMA 2J7PD 1CQWA 5JQGB 5K8CA 4KW7A 4NARA 5KVQA 1Z63A 5L6MB 5IYZA 4DLRA 2GH1A 3D4LA 2IOFA 1IEVA 3BHIA 3DH0A 2HPAA 4NIMA 5IBRA 1AQJA 3NTRA 1E59A 3D7RA 2HQBA 4DNPA 3NHAA 1C8KA 3R0VA 4U9IS 1Q14A 1FC0A 1WR8A 4KL8S 4W1SA 1PWXA 1VMAA 2O3TA 5DVZA 1JR3E 1ZUNA 1JHRA 3RUIA 4K88A 2H92A 1DJQA 2FWMX 3UTDA 2HUNA 4KB5A 3UXMA 3WIVA 4BV3A 4OP3A 3KAKA 3VR6D 5GZ6A 2QRJA 3PF9A 4ENVA 2GN6A 3EXEB 1G3IA 1QS0B 1RRGA 3GCXA 3L5KA 2GA8A 4FFBB 4QEKA 4DA6A 1Y34E 2CJXA 2YHBA 2Z08A 4FZ3A 1TE2A 2J3KA 4ZI7B 2I99A 3HXPA 5KNBA 4CWAA 1MX5A 2JBAA 1MGPA 1QZXA 1KXJA 3D3NA 4LQCA 3DLBA 3G79A 3UJ9A 3KXLA 5MHTA 1MD9A 5AJXA 1XU4A 2C92A 1UBNA 2ZIAA 2ZS8A 3RFVA 1J5EB 3WNVA 4PLYA 3CS3A 4GKBA 4ZT5A 3UAOA 5EJMA 4J1SA 1XQ6A 4J7AA 1KJ9A 2HYDA 3DDOA 1KYXA 4NAHA 1Z88A 1ZMRA 4QTZA 5KSOA 3GBSA 5D3QA 1TU0A 3IO3A 4NDNE 4AN1A 3GXOA 4BO7A 2XE8A 3RVDA 1A8HA 1U2DC 4MB0A 1ODIA 2YWFA 3F6BX 4I55A 4UEQA 3AKDA 5B5SA 1XTJA 1XXHE 4DDVA 3GA0A 1V16A 1TMGE 2DPGA 1WMBA 3WBBA 2VJMB 1XTPA 2BFFA 3MCAA 2PZLA 4IUYA 2JZCA 4JYCA 1LUAA 2XAUA 4LOKA 3TNLA 2I8CA 1U4SA 3V1KA 3L0OA 3C3XA 4LBZA 2QAIA 3UHFA 1U99A 1SMKA 4JB0A 4B73A 4PGMA 1N9GA 1V71A 3N7TA 2QM3A 4XTRA 1UOQA 1IXRC 4TX1A 1A27A 3TLMA 5K0CA 1PJ3A 4XUGB 4TROA 4IRUB 4RVCA 2JK1A 2QF7A 2VOJA 4OH7A 1KWKA 4D8YA 1WMSA 2I55A 3I9NA 3VVLA 1V5FA 1WXIA 5FFMA 1TYDE 2YYYA 3LHIA 3DW3X 3JQAB 1ULZA 4TMZA 1WZCA 4AD8A 2AZTA 2WJPA 4EPRA 4CEJA 4B3TB 1J2RA 1KYTA 2QMYA 1JUDA 3HJAA 5DH9A 4AUEA 1J9ZA 2W2KA 2XB9A 3GRKA 3LV8A 1IXZA 2HLPA 1Z4LA 3GLFE 3HXMA 1Q7CA 2P77A 3G3EA 4PG4A 2JI4A 1VCNA 3KKMA 2QI9C 4D9BA 2WU8A 5CPBA 1VIDA 2XMCA 4PRKA 4FUQA 1ISHA 2XVZA 4R2LA 4TQUS 4U9HS 4BB5A 4ODIA 1GDHA 2FOIA 1TF7A 2EAUA 5KYNA 3UK7A 2ZDQA 1XTUA 3DZDA 4I6GA 3BM5A 3WFZA 2WF7A 5ABPA 4RKRA 4QGGA 1K27A 2JLSA 1EFTA 2WYOA 3LPDA 1QE0A 5J43A 4D9MA 5LDGA 5JNLA 4EATA 3F98A 4X6UA 3KPJA 4QBKA 5DT2A 4EAAA 3LBAA 3VU1A 2I6UA 1RSZA 1YUNA 1W5EA 2GCOB 3FNBA 3QU9A 3QU4A 4RMNA 2QUJA 1P62B 4XJSA 4XYMA 3OIFA 2JC3A 2YVUA 2VP4A 4MICA 3VDMA 1TT5A 2YVKA 4BFSA 3PPIA 3V1LA 1K3UB 5KYYA 1DKQA 1MGOA 3M82A 4FT4A 3V46A 1MAVA 1GZHB 2YHIB 1E3DA 2J45A 1HXHA 2JIQA 5D87A 5EHZA 3KTDA 2I3AA 2F1IA 3WKDA 3KKLA 3ISJA 3IP9A 3IURA 4GC5A 3O8QA 4Y1RB 4LF4B 2M6RA 1N5RA 1VSVA 4BGEA 3L0YA 4AJKA 4FYYA 3CPJB 3DZGA 3K9NA 1FZTA 3U9SA 3DB1A 3DT8A 2BEUA 2P27A 5HILA 4WNIA 4J0QA 1Q1AA 4N5IX 2XNCA 4JVSB 1JP7A 5KQRA 1L5GB 2BE9A 4N7JA 3E1GA 3PCTA 4Q05A 3TLYA 4FMBB 3DHVA 4YRNA 1GN9A 2X1LA 4LDRA 4TTSA 3HR8A 2DZDA 4BRUA 1WD7A 4BQIA 1XEAA 3DWEX 4N6NA 3VZBA 4EX7A 9ABPA 4D46A 1V5EA 1MOQA 4JX8A 5ENZA 4P4TA 4FOPA 4UUMA 2IYYA 4PLTA 2HT6A 3BIJA 1KI3A 4ETIA 1QV7A 3HCCA 3DMRA 2JRLA 2WM2A 3M1LA 1FIUA 3L0ZA 4E7PA 4EHJA 4ZOBA 1IBLB 3SF0A 3FYUC 4KDRA 5IZ4A 2XUHA 3RSZA 1FUEA 2XRMA 2XT0A 2WVGA 2V4ZA 3KBBA 3QMPA 1YL7A 1DG9A 2B8WA 5BN3B 5HR5A 3R0QA 1UIRA 1U0NA 1H5QA 3AQ4A 3ET5A 2AG1A 3L84A 4MHTA 1OH5A 1SU4A 3KSRA 1LBIA 1DJMA 4R5HA 1UPBA 2QZPA 4L6IA 5SZJA 1UKCA 4ER5A 1P4SA 5JHHB 4TVOA 3IX7A 2JJ2A 1E2UA 4IX1A 1CE8B 4NK5A 5A04A 5FEUA 2QDKA 2WUFA 1RKVA 4L15A 4CEIB 2B99A 2Y76A 1BFUA 1J7KA 1RAAA 3C1UA 1O2DA 3LT0A 4KQJA 1V1MA 3JQ8A 4YCCA 3X2EA 4UE2A 4V02A 3I1YA 1II9A 1BDHA 3VYTB 4UMVA 1W5AA 5EKTA 1D4FA 2IYRA 4BKOA 4ZDJA 4CEHB 1UPUA 1W88B 2ZJ6A 1KYVA 4TTPA 3B70A 3CJQA 3H5LA 2R8EA 1PQYA 1P44A 1PFGA 4NBLA 5KHAA 1NLFA 2CD7A 4PZUA 4RVUA 3PEWA 4UW9A 4UTNA 5CM8B 2AZ4A 3CLVA 4B2PA 2H8GA 1EMDA 4OX9B 1UH5A 1XVAA 3EWSA 4LVCA 2ZRAA 1ZJYA 1KY5A 1O4VA 3OCUA 3LX4A 1E2HA 3WL7A 3CUKA 1ZZGA 5AKYA 4BBZA 3LY8A 5KQSA 5IC5A 1W9HA 1SGWA 2QW8A 3CBQA 4FEEA 4I1YA 4HRVA 3MERA 4WZBB 5IJWA 3X1YA 1G66A 1WB5A 1ZI9A 2OZPA 4QRDA 1U0JA 5CIQA 1JQBA 4HWPA 2E48A 4ID3A 4KE8A 4RIIA 2G77B 4C3OB 2BUBA 4JHLA 5LZ7A 1DQYA 1V6CA 2A5DA 2NT4A 3IMKA 4DQKA 1L5ZA 1RM0A 1M34E 3HCNA 4MCJA 5GVSA 4B48A 3BXEA 3EQ2A 2WI8A 3IBGA 4UUBA 3TQFA 5HOQA 4C4XA 4EELA 3RE1A 1Z08A 2YOFA 2FRDA 2VP2A 1KS9A 5AW4A 1YOVA 5HF9A 4ARZB 1CEYA 3V4ZA 2ACEA 5BV2P 3DNMA 1F38A 2FUG6 2IOQA 5HMLA 1H2BA 1ANKA 1PR3A 1SB9A 2H2DA 3EQZA 3BXXA 4IIUA 5HCIA 5TS3A 4B2IA 2ZJ7A 1GQQA 3I76A 1LS6A 4YRCA 4IG9A 4R0MA