3H17A

Crystal structure of este5-pmsf (i)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
292
Chain Sequence
b'AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title The crystal structure of an HSL-homolog EstE5 complex with PMSF reveals a unique configuration that inhibits the nucleophile Ser144 in catalytic triads.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 107
structure length 292
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h17A00
1LPSA 1TKRA 2QXUA 2BAGA 4DTCA 2VA9A 2QVBA 1W52X 3CCBA 1H22A 1C7JA 2OQVA 3O4JA 1F6WA 1E5TA 1XQXA 4EUSA 3CN9A 2QJRA 3H1AA 4Q1VA 1DT3A 3DLTA 1DU4A 4AO6A 1MO2A 4DSZA 2W22A 4L0CA 1Y7IA 4FNMA 3WL7A 3KOOA 1CUCA 1SC9A 5K3FB 1MU0A 2VJAA 1F0PA 4BCDA 1EDDA 2JEZA 5IVKA 2XUQA 4DNOA 4ZI5A 1B41A 5D7BA 1G5FA 3F97A 1FFCA 3TGLA 4UFPA 2X8BA 3K2IA 5I8PA 4LKOA 2ZSHA 3BXPA 4MXDA 4I3FA 1PJAA 3FVRA 3A2MA 1CUAA 3E0XA 1TCBA 5CH3A 1R9NA 1ODTC 2I03A 2V9ZA 3GUUA 2C0PA 5C7YA 3QH4A 3EQ8A 3F96A 4BAGA 4N5HX 1YA4A 2XUPA 4H18A 2RAUA 5ALUA 4ITVA 3YASA 2OQIA 3EIOA 5I7UA 1XZCA 2VTVA 1EB9A 2QR5A 2PL5A 5AH0A 1UT6A 5AKXA 4WCVA 4CCYB 4ROTA 1MTZA 3H19A 1T2NA 1CUZA 3H2IA 1YS1X 1Q0RA 2WIJA 1YB7A 4WFJA 1XZAA 3WZMA 5A6VA 5AICA 3AZOA 3Q0TA 3AIKA 4UBKA 4KAJA 3A2NA 5AK4A 5JD4A 2VATA 1XZMA 4INZA 4LYDA 4DGQA 2VT7A 1TQHA 4EY8A 1R9MA 5JARA 4X95A 4WY5A 1RYYA 4RPCA 4QWMA 5JAHA 4C6HA 1E8NA 2PX6A 2WQZA 4W1PA 3B3QA 1JKMA 1YAJA 1U2EA 5AOCA 1VZ2A 2QJWA 3L1JA 3I2GA 4BBZA 4J3JA 3EQ7A 4S0XA 2ZJ6A 3WLAA 3GZJA 2AJLI 4X97A 1IMJA 1H2WA 5LP1A 2QUAA 1K6EA 4B84A 2FJPA 1EI9A 1VE7A 5ALXA 1ZI8A 3LIIA 5HKAA 2RIPA 1JFRA 4C88A 2DSNA 3DDUA 3F9CA 4W1RA 4AB1A 2WG0A 4MWTA 1L7QA 2HHAA 5AM2A 2B61A 4FBMA 2CMFA 5ALFA 5JZSA 4NS4A 2C7BA 2H1IA 3C70A 4EY5A 2D0DA 1BE0A 3G9UA 3OM8A 2JGLA 2YASA 4YK7A 5LZ8A 3BL8A 5LZ4A 3QPAA 2XUGA 2GBGA 5AKZA 4MJ3A 2WIKA 1KU0A 4P93A 1XQWA 1XKLA 2QXTA 2PSEA 1MX9A 4LIPD 2ZJFA 3WJ1A 1XZJA 2HIHA 3CXUA 3WKEA 1EXWA 3R3VA 1CVLA 2EEPA 2Z3ZA 3KWFA 3VXKA 3G9ZA 5FP0A 4E15A 5AIBA 3QPDA 3BF8A 5HK8A 1I6WA 3JWEA 3AIMA 2XUFA 1XZKA 4BAZA 3KWJA 2IITA 5K3FA 3ZI7A 5AOBA 3E3AA 4PSCA 3C6ZA 1TIBA 1MX5A 2HRQA 2ZVDA 2VAXA 2WU4A 3HACA 2HA3A 4H0CA 1CIJA 4OD0A 4Y2VA 1K4YA 3FSGA 5FLKA 4D9JA 4KE7A 2FX5A 1BRTA 2QS9A 4LYEA 5SYMA 3ZPXA 3ANSA 3W05A 5EFZA 3Q8WA 3WZLA 4X90A 1D07A 1XKTA 1XRRA 5A62A 5K3AA 1DTEA 3GBSA 4AX4A 1MX1A 2XMBA 3CN7A 2AJDA 1VXRA 4OYLA 5ALZA 1EVQA 4MQLA 1BN7A 1QIJA 2ZYRA 2GYWA 4L9AA 2BFNA 1XFDA 2ACEA 2OGZA 1XZEA 4QNNA 2CJPA 2ZYHA 2Q0XA 4XX1A 4UHHA 1AGYA 4FTWA 3LP5A 1DX4A 4DIUA 5DYTA 4X71A 4KRYA 4YASA 3VJLA 5LIPA 2OCGA 5D3KA 5LKRA 4UHCA 5J3JA 3QITA 3F8SA 3C6BA 5K3BA 4LHEA 1CQZA 1W1IA 4LXIA 3PE6A 3WWDA 4BZWA 1TCAA 5FDFA 3RARA 1YB6A 1W76A 1B6GA 3N2ZB 1IZ8A 2I3DA 4NZZA 3RK4A 5ALSA 1CPYA 4H7HA 3V1NA 3FYUA 1P0PA 4Y2XA 5BWCA 1JU3A 3PICA 2CKMA 5JANA 1XZBA 4KACA 6YASA 3EQ9A 5JAPA 2WFZA 5ALVA 3ESCA 4N5IX 4OB7A 4Z49A 4Y7DA 3PUHA 4M0FA 4ZREA 2H7YA 3AZQA 1O6FA 2GYVA 4UBJA 2PSHA 5JIBA 4N8SA 3C6XA 3OTQA 2JBWA 4W9RA 2XQJA 4AXBA 4MQMA 4Y2SA 4BCBA 1LGYA 4Y2UA 2RGUA 2DCMA 2XMSA 5ALRA 1ODCA 1QLWA 2Z3WA 4X00A 3ZLVA 5AM3A 4Y2JA 1XQVA 2C4HA 5AM1A 3VISA 3WIOA 3CCCA 4WFKA 1CUVA 4QA9A 4KE6A 4AQDA 4HTAA 2WFMA 4HRXA 4A23A 3ESAA 1DINA 4MEBA 5CH8A 4AO8A 2WTMA 1THGA 2QM0A 4K6GA 1THTA 2ZJ7A 1ZGBA 1CUSA 1IZ7A 3DKRA 4F60A 5ALTA 1K8QA 5K3CA 4DNPA 4KR0A 4H7EA 5HK9A 4W63A 2XB6A 5E4YA 2VQ6A 1UKBA 4DMKA 5ALYA 5CT4A 4J0CA 2JGEA 5ALKA 3WKDA 4U2GA 2O7VA 2XI4A 4I19A 4OYYA 1UOPA 3M83A 2IX9A 4JEIA 2NW6A 3W04A 1XROA 4JNCA 1HL7A 4C4XA 1WB6A 2XT0A 4FNGA 3WL6A 4L72A 1PFQA 4WDRA 1FFBA 5JD6A 3D3NA 4ARAA 4KRXA 5AKGA 1GZ7A 2OG1A 4GXNA 3FCYA 3C5VA 5DYYA 5LZ2A 2WHPA 4FLFA 1ZI9A 3WKBA 5E4TA 2XUKA 1ZIYA 5FRDA 5A7FA 2EDAA 1WOMA 1J07A 4G4GA 3WYDA 1BN6A 3FLAA 2XMGA 3PUIA 5JATA 2VF2A 3HABA 3F98A 3FYTA 3F67A 2CZQA 3W9BA 1VLQA 3STTA 4RE6A 3RLIA 4IH1A 4J0DA 4H7IA 4AZ0A 5C81A 4A16A 3FLEA 4KAFA 4QLAA 4GI1A 3HJUA 4U2EA 5AHXA 5HZGA 1AURA 1YA8A 5EGNA 1LLFA 3ICWA 1GT6A 3VVLA 1ODSA 1UOQA 2JF0A 2FJ0A 3R3YA 1UOOA 2FUKA 4WY8A 2B4KA 3QYJA 2XUAA 3O0DA 4Y2PA 4WJLA 3S8YA 1LPOA 1ZD5A 2HA4A 5KWJA 3E4DA 1HBJA 3I1YA 2PPLA 3TRDA 2BKLA 2XMRA 5D6OA 2XQGA 4UHDA 4RGYA 5HCUA 4B0PA 5DTIA 4OCZA 2Y6UA 3FYUC 2ECFA 1AZWA 4HXGA 1ZGCA 3ZLUA 3G9XA 4H7DA 2ZSIA 3O4GA 1CUIA 4LXGA 3STXA 1YASA 2RI6A 1JI3A 1MAHA 2B9VA 2QMQA 3L1HA 3S2ZA 1AKNA 2P8SA 4Y2QA 3HXKA 5HF8A 5JASA 4QDTA 1R4ZA 1VKHA 4ZGBA 4HRYA 2HM7A 3D2CA 4PNZA 3NWOA 4O08A 4Y9SA 4BVJA 1MJ5A 2YXPX 3UUEA 4CIBA 5IVIA 5HQ3B 5IVHA 2UZ0A 2YH2A 1CUEA 3LS2A 1L7RA 3A6ZA 1JMYA 1JU4A 1P0IA 2VSQA 3V48A 1CV2A 4HS9A 1GKLA 3FLBA 3H2HA 3WK9A 1EK1A 2C58A 2GYUA 2JGKA 3BJMA 5AI4A 2AJBA 2DQZA 3AZPA 5ALMA 4BAUA 2OXEA 1EDEA 1EHYA 1EK2A 1CUDA 4Q34A 1H2XA 1ACLA 1QOZA 1UFOA 3IUJA 5K3DA 4FKBA 2DFPA 4HAIA 1C7IA 3FYUB 1E8DA 5E2IA 4X7BA 3UMJA 4DNFA 2VJBA 1UK9A 1DT5A 3DCNA 1A8SA 1VZ3A 4E46A 3DEAA 2XMQA 5ALGA 2R8BA 3BIXA 4MEAA 5ALQA 3T4UA 1OXMA 3VDXA 4IHAA 1OILA 3BDVA 2ORYA 2ES4A 5CRIA 4KEAA 5AK6A 2J4CA 3ESDA 4DSAA 1ZI6A 3C43A 4C01A 3TJMA 1CUYA 1YAHA 1KEZA 3KXPA 2VJDA 2OAGA 5AM0A 5AK3A 1ZD3A 1VOTA 1XRMA 2JGMA 3WWCA 4UFNA 1MNAA 5JZ9A 5AKYA 2OCLA 4J0JA 4UBNA 1LPNA 2ONCA 5EIAA 4YX9A 3AFIA 3NGMA 2PKYX 4X6UA 1P0MA 4P92A 4EY7A 1WHTA 2WJ4A 3BJRA 3IUMA 2WKWA 2PU5A 2HA7A 4RNCA 1XZFA 4IQ4A 2OAEA 1G42A 4X6XA 3AJAA 3DL4A 1HLGA 3BWXA 3G0GA 3D0KA 4CCWA 5ISMA 2HA2A 1IUOA 4Q3OA 3DQZA 3I1IA 2WHQA 4UBMA 4FFWA 2WLSA 3P2MA 1E66A 4BZZA 2Y6VA 1J2EA 3HI4A 1EX9A 1XZDA 5D3ZA 2QKYA 4EA6A 5LKAA 4HXEB 5K3EA 1G66A 5JALA 5JADA 3C87A 2C5FA 4OB6A 4QDXA 5AK5A 5FOQA 4E14A 1EA5A 2WU3A 2VT6A 1MT3A 2HU7A 1SFRA 1YR2A 1EDBA 3WMRA 3G0IA 5BWBA 1N8SA 2WHPB 3NOXA 3FWHA 2RONA 1JJFA 3FSGD 1T4MA 5E4JA 5CURA 1CUWA 1Q83A 3MVEA 1LZLA 2E3JA 5HFNA 5I9IA 2HFKA 3ICVA 4H7JA 4B7ZA 1UZAA 3WQHA 3C5WP 1HQDA 4CI9A 2DQYA 5T4EA 3WK4A 4X93A 5IH7A 4FLMA 2WIGA 1A8QA 2EDCA 1IVYA 3R0VA 5ALLA 3DKKA 3R3ZA 5K5EA 1XLVA 1QFMA 4KYVA 1MPXA 4OU4A 1AC5A 4G4IA 4ZV7A 4AMYA 3WI7A 2DHCA 4CIAA 4AN1A 1H2ZA 2PSJA 2BUBA 4F21A 4DYHA 3QMWA 3R3XA 1GGVA 4BE4A 2XUJA 5HQ3A 5EIHA 2JGFA 4LXHA 4BVKA 2PVSA 1UK8A 4M0EA 1QZ3A 2HRRA 3DOIA 5T4HA 1JMKC 2DHDA 3STUA 1AMNA 1O6GA 5CMLA 3W06A 1OCEA 5AKKA 1CRLA 5A2GA 4OSEA 3FNBA 3G02A 1FFDA 2O7RA 4BP8A 5DJ5A 4MWSA 1TK3A 3ZV7A 5CXXA 1K5PA 1FFAA 1QGED 2Z5GA 5BV7A 3OOSA 1CUFA 1WB4A 2WG1A 2RHWA 3DYIA 1QFSA 2XDWA 1TRHA 3TEJA 3K9BA 1JT2A 2WUGA 4GBGA 3WKAA 3V1KA 4DNQA 1U8EA 3H1BA 4UFOA 1CUJA 2G4LA 2VJCA 4UHBA 1A7UA 2PSFA 3WK7A 4I4CA 4HXFB 1CUGA 1QIMA 3X3HA 5F4ZA 3H2KA 1DWQA 2O2GA 3O9MA 3M82A 1Q0ZA 5LZ5A 2V97A 4QDUA 1NU6A 2XMDA 1G4HA 1E3QA 4GHWA 3JW8A 3FAKA 4X92A 4X85A 3I6YA 3WWEA 3FVTA 2WSLA 5AI0A 1H2YA 5CBKA 5CT5A 2QZPA 2OCKA 3B12A 3GELA 3BF7A 4AO7A 3LIPA 2JIDA 3NUZA 1GQRA 4BTLA 4B82A 2J4FA 1CUBA 4BATA 3MGAA 5DLPA 1XZIA 4YPVA 4EHBA 1QIHA 1M33A 1FSSA 4BYMA 4QZVA 4EY6A 4PV7A 2PM8A 2CEKA 4CG1A 4DMHA 1MNQA 2VAVA 1E89A 4NVRA 1SCQA 3I2FA 5C8VA 4CFSA 4ETWA 5AKLA 1S8OA 2PUHA 5A7HA 2G5TA 4G4JA 4EZIA 4MYDA 5A71A 4C89A 1GPLA 3I6ZA 1QO9A 1U65A 1DX6A 3C6YA 3HZOA 1QIDA 1UK6A 4RE5A 4UHFA 2WJ6A 3I2IA 2R11A 3R40A 4XWGA 2XUHA 3V1MA 1UK7A 1ZD4A 5EHNA 1ORVA 4FDMA 1GQSA 1P0QA 5AIAA 3D59A 3DL7A 1NU8A 1H23A 2J3QA 5BOVA 1A88A 4UBLA 5EIEA 3WL5A 2WILA 4GW3A 3WA7A 1YS2X 1Z68A 1R1DA 1IUNA 2XMZA 4PQEA 4OPMA 5AKHA 3STYA 5CW2A 3PI6A 3V9AA 4BC1A 2BGRA 3HLKA 5KREA 4B81A 2WHRA 3M3DA 3IDAA 3VVMA 3WK6A 3SX4A 3A70A 1ZIXA 5ESRA 1XLWA 3DD5A 1UKCA 1DQYA 4OUKX 3O95A 3AIOA 4JUIA 3C8DA 2AXEA 4ARBA 2HA5A 2OLEA 4A5SA 4FOLA 2GBCA 5JAOA 5EHZA 3RKSA 5IKXA 1Y7HA 2BUAA 2HU5A 2QOEA 4CG3A 1CEXA 4GEGA 4EBBA 4TVKA 2OGTA 4NMWA 1JJIA 2DR0A 1QO7A 5EHXA 1W75A 3EBLA 1QONA 4TGLA 5AI6A 4J7AA 4JYPA 4QLOA 2BCEA 5DYWA 3HC7A 1AX9A 3OURA 3B5EA 5KWIA 1ORWA 4U2CA 4X91A 1VA4A 4DLNA 3QVMA 4Y2YA 3KDAA 3WWOA 1LPBB 1DWPA 4DMFA 5EI5A 2XUDA 5ALWA 1XRLA 2H7CA 1F0NA 5ALOA 1U4NA 5ALIA 3MUOA 2H7XA 1TCCA 2GZSA 1MAAA 3WK8A 5CT8A 2Z8ZA 1PV1A 1ZJ5A 3GROA 3D7RA 1ZICA 1CUUA 4ZXFA 2JGJA 5AM5A 1MN6A 4ZV9A 4GECA 3R3UA 3HSSA 4GLBA 2G5PA 3BE8A 2AJ8A 4Y2TA 1EVEA 1SCIA 3DYVA 4E11A 2CB9A 2VEOA 4B9AA 2QUBA 4U2BA 1W4LA 3IULA 4Y2RA 4M0MA 4GWLA 4BVLA 5HKBA 3E1GA 2J3DA 4H77A 3HYSA 5H3HA 3EF3A 1AUOA 2XLBA 4BDSA 3HEAA 4QEKA 4HVTA 1X2EA 1A8UA 1RWQA 1XZHA 3FCXA 3QMVA 4PO3X 3IIIA 1ISPA 5FXMA 3G8YA 2QRUA 2Y2VA 3AILA 4PW0A 2XLCA 4JH0A 1GXSA 4XIIA 1WPXA 2V96A 4B85A 1DQZA 1UXOA 2WM2A 5KBYA 2ACKA 1CUHA 1CUXA 3IVMA 2XQIA 3M81A 3WA6A 3D4LA 4P9NA 2C0QA 2HA0A 4P08A 5ALNA 4KAAA 3I2KA 1QTIA 5JD5A 5AKIA 4JYMA 1BROA 2JEYA 3C8HA 3WJ2A 3AUKA 3H2JA 3LCRA 2I3ZA 4W1SA 1XRPA 2HU8A 1R88A 1KU6A 1XRNA 3PF9A 2C5GA 4Q3LA 5JAUA 2XUOA 5AI5A 2GBFA 4K6KA 2PUJA 3AINA 2Y2UA 3O4IA 5DWDA 7YASA 4FLEA 1ACJA 1IUPA 2XQFA 4J0GA 4G8CA 1VE6A 1XRQA 1R50A 2X5XA 3PFBA 4OU5A 3MUNA 4B83A 4FWBA 1BU8A 4V2IA 3VKFA 1AQLA 1TAHA 1WM1A 1BS9A 3DNMA 3IB3A 4X3CA 1WPRA 3WK5A 4G9EA 2PSDA 1LNSA 5DTJA 2BUCA 2ROQA 5DNWA 4G5XA 3UUFA 4QE3A 2OCIA 2HA6A 3LLCA 5ALEA 1E8MA 1BCSA 3QMMA 1EH5A 5C8ZA 3IUNA 5HF6A 4L3WA 5FV4A 2WFLB 4UBOA 1YSCA 3OPMA 3QPCA 1SCKA 1ZOIA 1GPKA 1XQYA 3IURA 2RHTA 5AKEA 5EHQA 4H7FA 3D2AA 1R3DA 1LZKA 4UHEA 4EY4A 4TPKA 5FUMA 1XLUA 4XVCA 4ZRDA 2LIPA 1GPNA 3N0TA 5AKJA 4H7KA 1GKKA 3I6MA 2OGSA 2WUDA 1LPPA 2QTBA 4GDMA 4UUQA 3DS8A 3H0CA 2WTNA 3SC2A 5LYYA 5CH5A 3I2HA 5HFAA 5AJHA 4BRSA 1W6RA 1DWOA 3BDIA 1X70A 1BCRA 4BB0A 5ALJA 3G9TA 3L1IA 3PDCA 3G0CA 3WWPA 1HPLA 4G1FA 3U1TA 2HADA 3G0BA 4X6YA 1Y37A 3U0VA 3FBWA 5SYNA 5AO9A 4XJVA 3R3WA 3W2TA 2BJHA 2CBGA 3C45A 1CR6A 4KE8A 5ALHA 4F0JA 1XZGA 3R41A 4BTVA 1CQWA 3IA2A 1LPMA 3ZLTA 1J1IA 5AI9A 4FHZA 1QIKA 2B20A 3O9VA 2I78A 3ILSA 4PSDA 1SOMA 2PU7A 4N8EA 4BE9A 3WKCA 1ZD2P 3KD2A 2GZRA 5FKJA 1LBSA 4QDZA 5LZ9A 1ZJ4A 3STWA 3VJMA 3STVA 3QBJA 1VJ5A 1YCDA 1VA5A 3DJYA 5T4BA 5ALPA 4CCYA 1K63A 2WIFA 4U2DA 4IH4A 3T52A 4Q3KA 3QZUA 4BC0A 2DHEA 3ESBA 1XZLA 5CTAA 2XMCA 2K2QB 3GA7A 3W9UA 5HF5A 4BDTA 4QDOA 3GFFA 4FBLA 2XQKA 4HZGA 4J0KA 1F8UA 2HL6A 3QM1A 3OG9A 3WL8A 2ZYSA 3ANTA 4K5QA 4DMCA 4UBIA 1Q84A 4B80A 2WUFA 2W6CX 5LZ7A 3SWWA 3D5EA 4U2FA 3G0DA 4AMZA 5JYCA 3ZWQA 2PBLA 4BRZA 5T4FA 1VXOA 2YYSA 1RP1A 4AN0A 3VJKA 4C4ZA 2AJCA 3ED1A 5FPPA 4DM7A 1LBTA 1CFJA 4WDQA 2O2IA 4N8DA 3IUQA 2WUEA 2HDWA 2Y1KA 1QIEA 5DNVA 4ZWNA 2WG2A 5ALDA 4B9EA 3H17A 1ETHA 2V98A 3WYNA 2Z8XA 2BGNA 1LPAB 2XE4A 2O2HA 4G8BA 1QIIA 4FMPA 1WB5A 1L7AA 2XUIA 2HFJA 1N1MA 1UWCA 4Q82A 4PSUA 4J0IA 2D5LA 4PF1A 3H18A 5AOAA 5LLSA 2G63A 4FFVA 4QWWA 4H35A 2H9YA 4BCCA 4IH9A 2X76A 5CT6A 4F5ZA 3WIBA 1FJ2A 3IBTA 4UPDA 2IIVA 1BEEA 5AM4A 1WHSA 4MYSA 5IVDA 4K6HA 2WFLA 2JGIA 4C87A 5JZBA 3FOBA 1EB8A 1J06A 3SK0A 4AZ3A 3A2LA 4J03A 3JYHA 4CG2A 3I28A 2QT9A 5CXUA 4X94A 4Q05A 4J0HA 3I2JA 4C4YA 5DNUA 3H04A 1QIFA 4W1QA 4K2AA 4KJXA 5C8XA 5YASA 5CT9A 1WCYA 3HRHA 1HDEA 3H2GA 5AP9A 4B0OA 4OB8A 2OPHA 3PFCA 4B6GA 3RM3A 3G7NA 4BP9A 2CUTA 1X2BA 4G8DA 3DOHA 3O4HA 3KSRA 4G9GA 1JJBA 1CLEA 1N5RA 3BIWA 1EINA 1QE3A 3OC0A 1NX9A 1HKHA 1N5MA 4EB0A 5A7GA 3PF8A 1BEZA 1QIGA 2GBIA 2WIDA 4KE9A 4IO0A 2ZYIA 1UKAA 2WJ3A 1FFEA 3V1LA 1QTRA 1USWA 5AI8A 3D2BA 1C4XA 1QJ4A 5FPQA 5HF9A 4WFIA 3K6KA
chains in the Genus database with same CATH superfamily
2XTMA 3CEJA 1ZISA 3THXA 2IYNA 3T38A 5AVYA 3BGIA 2QYHA 1G5RA 2P1RA 3CCBA 4JITA 3TLXA 3KBOA 5FULA 3ZTWA 4G0UA 4GC9A 3VZPA 4OLBA 4ZTZB 1YJQA 4LY0A 4TMVA 2VKTA 1MJHA 2CLMB 1GZSA 1BVUA 2WAMA 4FEGA 3SYTA 4TRRA 1XQXA 2FDRA 3T5CA 1LV7A 3CN9A 3V3KA 3NAGA 3QU5A 4A91A 5JW6A 2FFJA 3H1AA 4CIXA 1DO2A 1V96A 3D7MA 4XIYA 4WKPA 1DHTA 5BN4B 3BSFA 4P53A 4E5MA 4G67A 1A77A 2BWJA 2EKZA 3DDNA 4B6PA 4DSZA 2FR8A 3CC8A 4U7GA 3N0RA 1I32A 1NVDA 4L0CA 5L3QA 2Q2QA 3BJEA 4I66A 2RE8A 3ONFA 1T0BA 2FQQA 4PBSA 1DRJA 3FGZA 4EG0A 3KQQA 5CVUA 2Q4OA 4EA9A 1WEHA 1ZD1A 1X13A 1CUCA 2A9QA 1E2IA 1MU0A 1P31A 2LTAA 3W2HA 2H2GA 4XE5A 5J59A 3DTNA 4WXEA 5JJBA 3ISTA 3OX1A 1JEYA 3EEYA 2QRKA 3LUPA 4RQBA 4UE3S 2V9PA 5EG5A 5LU9A 5E3JA 1GG8A 1KIFA 2V55B 4FJ2A 3DEJA 3EXG1 3ASZA 4KPUB 4BV2A 1Y8AA 1IPHA 1YB4A 1Z34A 3BMNB 5EP4A 1JQ3A 1PBTA 2OA0A 1QBGA 1JPNA 3UOAB 3ICQB 4H3SA 4F12A 5IVKA 2EKQA 3KU4A 1YC2A 1Z7WA 2GFHA 2VDNB 2WJIA 4XEHA 3DO5A 5DASA 4N48A 3BD8A 3N87A 2WIAA 1NV8A 2XOKA 1A98A 1I7LA 3VTKA 5B4VA 5JZVA 2Q8NA 2PZJA 4GIBA 3TUIC 5FI0B 4G89A 4PHCA 4Q3CA 3RTDA 2O3TA 1MHTA 1RI1A 5HIJA 3K8OE 2IS1A 1GTL1 1SGWA 4GS5A 3A25A 3O1IC 2QV7A 3I8SA 4RPJA 1WLSA 4MW7A 2HK7A 3E48A 4EW1A 2IHVA 1YMVA 3TMYA 4NPCA 1PTKA 1MZVA 2QIPA 4OJYA 3BH6A 4UFPA 4W82A 5GGYA 1W88B 5JHGB 4CKBA 4RAQA 2OQRA 4JBXA 1UXHA 4LKOA 2NUTB 4PPNA 5KYGA 1ZNXA 3P19A 3WGTA 1S2IA 2PH7A 4G5SA 4KPGA 1KR2A 1ZHHA 3UMFA 3FVRA 4JCCA 3A2MA 1I6KA 2AK3A 3MWDA 5FL7A 3VR6A 2V7GA 3AP1A 4HDAA 4M6WB 5FO0A 1ZGZA 1TCBA 1J20A 1OH8A 5A4JA 1ODTC 1LW6E 3EEOA 4DA6A 1P17A 3VZQA 4D6XA 2PGOA 3PDIA 3CLRC 1RI3A 5DWQA 2ZTSA 3QH4A 4BLPA 4Y9TA 4LRXA 1UF9A 2QLTA 2Y05A 1IBKB 2XUPA 4IAOA 2Q2VA 4QIHA 5J5VA 1Q16A 1D0IA 2ETVA 1V3VA 1U0TA 1A69A 3AETA 3IBCA 3NRCA 1E9DA 4OLFA 4YJGB 5DCUA 2XYHA 2LD4A 4G9BA 4BMCA 5IC6A 1R6UA 3L82B 2DXIA 4FGWA 1FP4A 5AW4A 4FOPA 3O92A 3OBIA 4KWIA 4CUZA 1AUXA 1EIZA 1K86A 4HDOB 1U7OA 1X39A 1VHWA 3PFIA 2FW8A 3THOA 3THYB 3QYAA 2D5BA 4FPXA 5AH0A 1CJCA 4NATA 4MB0A 1NLFA 3MTGA 3OUZA 4M2LA 4ATNA 2JLQA 3OWHA 1RRPA 3OLQA 3PVZA 4P7GA 5CEFA 1NVKA 1KZ9A 3IE2A 3CLHA 1O5TA 2VDMB 3E22B 2ORED 2ZTUA 4YLEA 1B8OA 1Q0RA 4YRZA 4L0QA 1BGWA 2KBEA 2ZSJA 3QVXA 4WFJA 1W19A 4YTEA 2HQRA 1DSSG 1O95A 3PSHA 5EJFA 5GOZA 3RVRA 2F43B 3GP3A 3QEBZ 2J1LA 3BGVA 3JRXA 1YFLA 4CM7A 2QUHA 4KAJA 3RROA 4GVPA 3U7IA 4EPYA 1UJNA 5CYFA 3A2NA 3E3LA 4G65A 5DLQC 4F9TA 1UMCA 3ZZ1A 1VJDA 4B47A 1WQ3A 3VU1A 1XZMA 2E4ZA 2FXVA 3B2QA 1KDRA 1PR5A 3W3ZB 1NVXQ 5LMCA 4C0JA 5ITWA 1CZLA 2ZZNA 3ND7A 1R9MA 3E8MA 3T1NA 5IDWA 1PCXA 1Q3HA 3L9XA 3SHWA 2OHVA 1D6JA 1TIPA 4OMFG 5GAJA 5JARA 3D81A 3A6KA 2W6JD 3KKPA 4KR3A 1J0XO 5SZIA 3GLFE 1QHSA 3P9NA 4WY5A 1RYYA 2WK1A 1KQOA 1T4CA 3DW3X 4URHA 1J5EB 2QYSA 4JI6B 4C6HA 2J5XA 2I6TA 4RJTA 2WQZA 4GXRA 4WI1A 4W1PA 3B3QA 3VPHA 4L50A 3WMXA 4DT1A 4ER0A 1H66A 2REQB 4XGKA 5L3SB 3PT9A 3SXPA 1GZVA 2P9JA 4EMTA 5AOCA 1JAHA 1Z3IX 1E5VA 2QJWA 1N5OX 3C16C 1M8FA 4GM0A 4JHXA 3QQ5A 3VR2D 2YJZA 3TFWA 3O03A 3EXEA 2O52A 4ALMA 2VZ8A 4S1WA 3ZCUA 1GCUA 3L8ZA 4JLSA 1NQUA 1H2WA 2C5EA 1K92A 4TTVA 3DWGA 3HY3A 5CFQA 2QUAA 4KO8A 1T9DA 1IXZA 1SUPA 2A5DA 2OCYC 3HKDA 4PQRA 1UFVA 4V1CA 1RBZA 1XCGB 4G36A 5BN5A 5C7OO 1UODA 2ASVA 3AFOA 3UHOA 1W5AA 1D6SA 3KTDA 1LLQA 3S6JA 5HKAA 5K0SA 2C94A 4PLHA 3RT9A 1MO6A 3ISVA 4NQZA 4REOA 2QA5A 1JFRA 3OTGA 4LRUA 4QYIA 4XARA 2VDKB 4DMKA 3PGVA 4AB1A 1KO7A 4U7PB 5GM2A 4N3BA 1XHEA 1D2HA 1GZ3A 2HBZA 1OA0A 1L7QA 4BFYA 3G3EA 1MVOA 4IGFA 1KEKA 4D9KA 5G4KB 1FMTA 1IMOA 2I76A 1K89A 1X92A 5IAAA 4MUKA 1QP7A 4BNIA 4LRWA 3BBPA 1UBCA 4BO0A 2ZXFA 4RV4A 4DMUB 3G2PA 4K87A 5FCDA 4OI0A 4LC1A 4NS4A 3KP1A 4G0OA 4AQ7A 1GCIA 3C70A 4IUDS 4M8SA 1BE0A 2DPMA 2IEIA 3ROPA 3TZEA 4EY5A 4ALNA 2VHCA 2YASA 4HWOA 1TYCA 2J8ZA 1UDXA 4XWYA 5BNWA 1ABFA 1VKZA 5KOJA 2OLKA 1FQJA 1P39A 1QX4A 3O8OB 4P7BA 4XB2A 1R5BA 5JVDA 2TMDA 2YV2A 4P6VF 1C50A 5LZ4A 1Q50A 2CJXA 2EQAA 3HJCA 3ROZA 3UWSA 1ZYUA 4PYMA 3EZFA 4US1R 4P33A 2JH9A 1UBTS 2ZGVA 4MJ3A 1IYZA 4P93A 1NSYA 4PYRA 4FHFA 4LBYA 2VSXA 2R5FA 3W5UA 4CDNA 2QXTA 4Q3DA 3ZHXA 4LIPD 4V0SA 2ZJFA 1MC8A 1GSHA 3QXCA 3ME5A 3D8HA 4Z4IA 1CZHA 2W2QA 3CF4A 3X44A 5KVCA 5MN6A 2NYVA 3WKEA 4TKZA 3QI2A 1EXWA 1XTTA 2G72A 2VZEA 3E7PA 4S1TA 3HTXA 1H9AA 1CVLA 1W5TA 2I29A 3ZY6A 2FUEA 4IDBA 4JLMA 4KQWA 2VTKA 4CMGA 4I5GA 4QPNA 4AQYB 2ORIA 3JYQA 1DJMA 4QYSA 3G9ZA 3COSA 3ZDEA 5AIBA 1P9OA 3MWFA 3IV9A 1GZ4A 2C2MA 5BN4A 1T8UA 2OQ2A 4D79A 4TTAA 1M54A 1YONA 3QOXA 2WIBA 4FFLA 4C04A 2PAAA 4BPRA 3AR4A 4BAZA 1GQOA 1U1CA 2I2AA 2ILTA 4FE7A 4WTOA 2IITA 4WY2A 1TJNA 1PL0A 3NEYA 4K0KB 2Z57A 2QRNA 2Q5CA 4PSCA 1NVVR 3DFMA 3ZHZA 3A9RA 2HRQA 1E1RD 1U2DA 3HRKA 4LY3A 1YS9A 1SXQA 2VAXA 2HA3A 3C5CA 3B78A 3K5HA 4KPUA 4Y2VA 4B48A 3CBQA 1S01A 4XFDA 2DWPA 1DAKA 1C9JA 1JG4A 1SAYA 4MS1B 1T5SA 2HTEA 4KE7A 1RM5A 3RV4A 4CI0B 1MW9X 4NBUA 4OA8A 2V4MA 4RJ2A 2CFSA 2YWBA 4P8RA 3CZQA 5EERA 3FE2A 3KQYA 5BSTA 3T7SA 2HMYB 4B45A 1CHDA 1CJBA 3VNVA 3ECSA 3P9IA 1HRDA 1SHTX 4MVJP 1SOWA 3BX1A 3EC1A 3NOQA 4KVGA 4EF5A 4RS4A 5DGHA 4P7KA 1PR1A 1QJCA 4IBOA 1QYDA 3IVXA 5HKKD 4GOOD 4L15A 3NX4A 2CFRA 4L4XA 4WNAB 2BKUA 3T0FA 2E2WA 3FVVA 3T3MB 1W88A 3UCEA 5A62A 5CDHA 4D57A 4WOPA 2JHFA 3CKKA 4AM8A 2NUTA 3IQDB 3L06A 4LXXA 2ZAGA 3AERB 2XMBA 3UGQA 1KEVA 2JI8A 4LBVA 1J9EA 4LV5B 1KA9H 5I3ZA 3ZI0A 1D4AA 1WDKA 1EWKA 2EFJA 1HEYA 1V1MB 1Z17A 1XVIA 2EZ4A 4OYLA 1GSIA 2AOXA 4M6WA 4RKFA 2GO1A 5BMVF 5IS2A 4TYYA 4LX8A 2B6HA 2BHLA 2IW3A 3CTMA 3VYUB 3R9XB 4M7WA 1YR1A 4FMCB 4HYEA 2QE7A 2V4ZA 3EDCA 1ZOSA 2WJAA 1S4MA 2H07A 1VPEA 2ZYRA 4H1HA 5TGZA 3ZOZA 1FRNA 2DFVA 5EP3A 2AVDA 2P78A 1A97A 1HG1A 1JHXA 2ACEA 1SKAA 1XCPA 2BFNA 2QN3A 3L4SO 3NNNA 4JENA 4OOEA 1TFUA 3QXHA 4D9BA 5DCLA 1XI2A 3HMQA 1MO3A 4J1NA 4YJGA 3EIWA 2WT9A 5FD8A 4PZDA 1UJ5A 1ZU5A 2II6A 5G41A 1H1LB 1T0UA 4FHEA 4FFOA 5JPIA 5DVZA 1E2UA 4DCMA 1I36A 1DX4A 1K9VF 1AK1A 1G7TA 2F3SA 1CZRA 3ETHA 5DYTA 3F2IA 4X71A 4F04A 3THYA 3MAGA 4KRYA 4YASA 3VUFA 3WLPA 4F11A 4ESOA 3TQQA 3CLKA 3FHCB 3EQ2A 1V35A 1JILA 5LIPA 4LWZA 5TQJA 1M0TA 5JEDA 5LKRA 3L1VA 3P0EA 4R7ZA 5K0GA 3HB1A 2JA1A 4LHVA 4YNBA 3EXHC 3JU3A 4LOKA 2PVCA 4KB5A 5EJIA 3LRXA 1RRCA 1OYYA 1W1WA 3T5AA 4ARCA 2MSNA 3E22A 4UVHA 1TCAA 1ZN8A 5FFMA 4FKZA 3JQ9A 3VX3A 2FZWA 2J41A 2R8YA 3F6BX 1GNTA 4NZMA 2XBUA 3A9VA 4XTRA 5F7OA 1NIJA 3I9V6 3IYLW 2F43A 2XA1A 1NQAO 4RDXA 4N18A 1SELA 4NZZA 4A0RA 3SDZA 4MRRA 5A04A 1LI7A 1I33A 4NAHA 3D9QX 5D1HA 1K06A 3GJYA 3RGWS 5ICFA 3P2OA 3V1NA 1WW2A 2OXRA 4B4OA 2QIOA 4L3OA 4YRFA 2OORA 2AG0A 1OW3B 4Y2XA 3PICA 4GG1A 1G3MA 4EATA 2GEFA 2WYIA 3VO2A 1UBHS 4IDGA 4RTOA 2C2OA 5JANA 1U0NA 1XZBA 3K30A 1S8NA 1BWSA 6YASA 5KWEA 1OLSB 1SHZA 4G25A 4YGXB 2L69A 1GSOA 1PJCA 4LSWA 1LWOA 3WADA 3C7AA 1SXJE 1P1KA 2BISA 1OX5A 3E0QA 3KJQA 4GRIA 2ZCVA 3HU1A 5CLLA 1R5NA 4N5IX 5EZSA 1T1GA 5F35A 3U3MA 1DRKA 1YZFA 4KR9A 4Y7DA 4YHBA 3T9DA 2NTEA 4GH5A 5EKDA 5HILA 4BNWA 3OF3A 1DQRA 4M7RA 4CKWB 1MV5A 4AU1A 3UOWA 1E9RA 3UGJA 5CYPA 2VPYA 2OHXA 1T8YA 3U7GA 4CCAA 4UBJA 1WPGA 1K8XB 4Z0PA 2QLFA 5CHEA 2JBWA 3QHQA 5COQA 1GADO 2VDWB 3GFOA 4MKXA 3ZG6A 4DG8A 3EG9A 4Y2SA 3Q8KA 4DM4A 1ONSA 2XZLA 4RSRA 1LGYA 1XPRA 3D7KA 4R81A 4O4JB 5B1DA 2CDAA 2KMLA 2W83A 4KQCA 4AJKA 2RAFA 4I50F 1XJ5A 1Z0SA 4CV0A 4E5YA 1L1RA 4HJRA 2B99A 2B4AA 4C4RA 1HDGO 3JPYA 2JKVA 4ZOQI 1QLWA 2O23A 3FWNA 4QTUB 4AY3A 4DF3A 2Z3WA 3C1TA 1BVYF 3U4AA 3R7NA 1Q21A 3QEJA 3M3PA 1SCNE 3SHTA 4FSHA 3PPWA 3ZLVA 5FWDA 2C4HA 2G09A 5GJCA 1T10A 1GSAA 2UXDB 2VCHA 4IJUA 4DDKA 5J2UB 2AL7A 3PJDA 2EBWA 4KE6A 4G0MA 3ITEA 1QG6A 4JAVC 5AFSA 4FWTA 1JUDA 3DLPX 1IXKA 2Q28A 6GPBA 2R7KA 3MW8A 1ZIDA 4P83A 4JDUA 2C5SA 3H9UA 3ESAA 4TLLB 1WUTA 1DINA 4LQCA 3O8NA 1KPHA 3OP1A 2P8JA 4O02B 1B26A 1U98A 2BFWA 2P4SA 4AO8A 1NLZA 1Z63A 2Y1GA 2YFHA 4HDKA 5L51A 4LZZA 3BTSA 4OXYA 8ABPA 3U17A 3TW4A 1THTA 5G4KA 3BEOA 2CJYA 1FDOA 4DLRA 1WCIB 4MKZA 4AC9A 1WPQA 1XXHE 4RPHA 4IQGA 4DCJA 3O83A 4D5GA 3L6RA 4CV2A 4OXQA 2PKRA 2HJVA 5I7FA 3NR2A 3U4QB 1BE8A 3O84A 4L9RA 4XFJA 3H5WA 4H59A 4KR0A 4CUJA 2GCGA 1KVTA 3VYVA 4W63A 5KHLB 1JDBB 3LPMA 1YE8A 2PGDA 2QLBA 2O0JA 3TTTA 3ZV5A 1K68A 4GQAA 3N28A 3KEGA 4X20B 3P9QA 3O8OA 2A88A 4J0CA 4EMSA 3CNQS 6CHYA 3W5SA 5CAEA 1Z0UA 3L04A 3MBOA 4IDPA 2Y0BA 3G89A 3GGPA 2VJOA 3UFXB 4ITUA 2GBLC 3LDUA 1JYSA 5D5PA 2FK8A 3UTCA 1F4VA 3M6LA 2GZDA 4QEZA 1YU6A 2B3TA 3D1VA 2C00A 3IBYA 5A0TA 2V03A 1QU3A 1DC3A 2YMQA 4XLLA 3USCS 1GTVA 3BRCA 3DBIA 4PPQA 3VR3D 2OT3B 3QWFA 4CU2A 3CUTA 1IG0A 3DVQX 4Z51A 3OOEA 4BRWA 2IX9A 4LGYA 2QD4A 3QPUA 4B44A 3B3FA 4GX0A 4F8YA 4XASA 5TEVA 5CLIA 5EUBA 4QUDA 3M4XA 2MDTA 3JARB 2R8EA 4A0GA 4YAJA 2OK7A 2REBA 3PCTA 3RUCA 4CGZA 1L8OA 4LNUB 2PCJA 3BG5A 4X7RA 3WL6A 2G07A 1CB7A 3KYIB 5T67A 4ARAA 4KRXA 1QO0A 4QXOA 2JHGA 1GZ7A 1BHSA 4GXNA 2Q2NA 3C5VA 5JE8A 3UQYS 1RI5A 4BO9A 4MI3A 1WHTB 1L4FA 5LZ2A 1FLVA 1LRLA 1NLMA 1ZI9A 5ADHA 2H1OA 1MLDA 2I2BA 4DQLA 5LFAA 4KGDA 4ZVMA 3GYBA 2FKAA 1EM6A 3IP3A 5A7FA 4EFDA 2OV3A 2EDAA 5F1KA 1WOMA 1WW3A 4J75A 4XM0A 2AUNA 2GPAA 5LDHA 1JAYA 3GRPA 1QK5A 1TJYA 2VQEB 5AVXA 4WESB 2R3SA 4D3FA 1GT91 4G4GA 3E9NA 3B8EA 4LTNA 3WSVA 4MS1A 3ZWOA 2XMGA 1S2NA 4HDCA 4L0DA 4LJSA 4RDIA 4XWKA 2B5WA 5HRUA 1OMOA 2VF2A 4B46A 3EFOB 3F98A 2ZIFA 3F67A 1D8AA 1RRFA 3TOVA 1IXSB 3A4NA 3GFRA 4GR9A 4RHTA 5D86A 2OC9A 1A2QA 2ZRGA 2OP1A 3STTA 3RLIA 4DNXA 1XCLA 3OESA 3NHMA 4O1IA 3CG0A 4CEHA 4J0DA 4PGMA 3HHEA 2ZSKA 3EDQA 2FPPB 1CC1S 3E03A 4H7IA 4C30A 3WRYA 4YYEA 1I4DD 1EBBA 4V03A 4HWPA 5C81A 1UQRA 1Z4OA 1SC6A 4BN4A 3FLEA 2PZAA 3IEPA 4H6PA 4KAFA 3HJUA 3AR3A 3AYZB 3B6MA 4ON9A 3DL2A 1R66A 3FGNA 4M37A 3HH8A 4NZPA 3EPRA 3DOJA 1AURA 5JC8A 3AP3A 2Z08A 5EGNA 5GVSA 5F4BA 2LIVA 3VVLA 1S3FA 1B23P 3R4VA 4QTZA 2YWXA 1Z4JA 3AERA 2A92A 5EAIA 3U2QA 2O2DA 4ENWA 1UXKA 3R3YA 5A3QA 3AVTA 1KRHA 4ZI2A 1KOJA 3TSYA 1V1MA 1Q22A 2B4KA 3QYJA 4JJKA 4LUCA 5EHGA 4ERNA 2XUAA 5KC8A 4RF5A 2YMPA 4LKRA 2JJ8A 1TCUA 5FUXA 5KQGA 3R9XA 2X15A 2IYYA 3TGWA 1JAXA 4PX9A 1ZVMA 3EBOA 4Y2PA 3ZUPA 2IXDA 3VOBA 2QENA 5DT9A 3BFPA 5BNZA 3AUXA 1O6BA 4ND8B 4QG7A 3Q0IA 3PXAA 3K0FB 4PU0A 5T6MA 3LW7A 2UUOA 2X5NA 4LHXA 4B8YA 2KWIA 2C9ZA 3IHTA 2Q7OE 4G0ZA 1EFUA 4WLOA 2GXSA 3HO1A 1GNRA 2BJWA 2C7RA 1RDFA 1B8NA 1H1LA 4OKIA 4JR0A 4RYDA 3PWTA 1D2MA 2P3OA 4MPTA 4ND1A 5HCUA 3WBFA 6REQB 3AMVA 3KR0A 3DV9A 4RTRA 2XOKD 4MQ4A 4OJNA 4CQMD 1ZGCA 2BLNA 3RC2A 2QWXA 3SFTA 4BFSA 3QUBA 1HNZB 4A36A 4ARIA 3DR3A 4MRMA 1I2ZA 3JQ7B 4MUYA 3UXYA 4H7DA 4H9GA 2ZSIA 3VKWA 1W34A 2A33A 2DF8A 3LUAA 3O4GA 5C2JB 1FZTA 4CCSA 1NI4B 4P3YA 2F4VB 2HPZA 4YRSA 1RJDA 1MO4A 1T9CA 2HHCA 2ZIEA 1KFEB 2RI6A 2BZGA 3D5QA 2W2LA 1KQPA 1H2AS 1YFKA 2QMQA 3E1KA 4R2MA 1UC9A 3AHEA 5TNXA 4C3ZA 4ZI3A 1U8TA 3BT7A 1QGZA 2AGVA 3A27A 3GGGA 2GN1A 4HAVA 4UE2A 5AT1A 3GF4A 1U0RA 3G2JA 3KEQA 4PVDA 5BNFA 1R4ZA 4OAPA 3AWIA 4MWOA 3CR3C 2DERA 1YS6A 2BFOA 3QY0A 1U8FO 4I2VA 5FL7D 1KNXA 3Q3GE 3TJRA 1RNLA 5CJ2A 1RPZA 4U6QA 5E7QA 4BV3A 3N0VA 4PZZA 5LLTA 4US2R 4YUXA 5CDFE 3TI7A 4TT8A 5I4BA 3DLBA 1C41A 2NPOA 4IXMA 4R9VA 1C9DB 1TA0A 2Y8EA 1F8FA 1LFAA 4PNZA 3VR6H 1BVRA 1PW5A 3GLVA 4Y9SA 3DF7A 3H99A 3V00A 2WJVA 3SKXA 2PLAA 3HUTA 1X6VA 1RLUA 4BVJA 5HYVA 2AYXA 3QPBA 1UPFA 4X8OA 4JBNA 4G24A 3Q40A 3NJ4A 2VP4A 2LWIA 3ZGXA 4CIBA 3NIFB 3BWBA 2FOXA 4BIIA 2FH5B 1OFTA 1SUWA 1USGA 1CQJA 3L7DA 5HQ3B 5JAQA 5H3CA 4S04A 4CKWA 4U8GA 2R96A 3LS2A 4NIMA 4QATA 4B3XA 3HJBA 2PDAA 3MC1A 2PIDA 3RTEA 1BX1A 3KFXA 1JU4A 1XELA 3C74A 2TS1A 1P0IA 4G37A 4HSGA 4YB8A 1KXZA 2E49A 2VDWA 5FBKA 2EP8A 3PUYA 2VSQA 4BFLA 1GV1A 3PXXA 5ICSA 2ZR7A 3V48A 2JJMA 1CV2A 3AJ9A 3FLBA 2LP4Y 4Z4GA 2VOEA 2YVQA 4QSMA 5FBZA 3H2HA 3URMA 4D0NA 3T5PA 2OZLA 4DUPA 3NYWA 4O4JA 1SHJA 4L4SA 2UUAB 3ZNPA 4JI5B 2ZBDA 4LYGA 3VO8A 2FZLA 4L8GA 2AJBA 3CV3A 3DT9A 4AJIA 3AZPA 1O95D 4BAUA 3HA7A 3CPHA 1U7DA 4ZI7A 3P0JA 4JJAA 3AEQB 3KQKA 2B3DA 1EDEA 1G7SA 1P74A 3CMMA 1SVIA 1WVGA 2FW7A 3OMLA 1H94A 5J2UA 1CUDA 4KGVA 4Q34A 1P2FA 1G55A 2NU9B 1ACLA 4P3XA 1ECPA 3EQZA 1D3AA 1VJ0A 4DCNA 1S4QA 5MFPA 4UTRA 3KUUA 3F9RA 3KD3A 2Q1SA 3BSYA 5K3DA 1A27A 4WADA 1JG7A 1JQ5A 4RV9A 1Y5MA 5F1OA 1RXVA 1DAGA 3EMBA 3FYUB 3FB1A 3HXPA 5C4MA 4RVGA 3GFBA 1WCIA 2AIRA 3VA7A 2O8EB 2A94A 4XWTA 2GXUA 1VZ3A 1T4BA 2X14A 2ZWMA 4MR8B 1QG4A 1PNRA 3PHJA 4AYWA 3AB8A 1YCHA 3NAQA 3WOVA 1I2DA 1ONPA 4LQLA 1J2YA 1NL3A 3D8UA 4G5FA 1JL3A 3V8RA 4QOHA 2PO5A 4I4TB 4RSHA 2P75A 2ZRDA 4X20A 3RC7A 1D9ZA 5EUCA 4JI7B 3P1JA 4IHAA 2IXAA 2FSVA 1OILA 3BQ9A 2XKJE 3OUUA 3BDVA 1ADGA 1HO3A 3B82A 1IOWA 2QGNA 2BM0A 3AHGA 2PBZA 4Q24A 3UFXA 1SJ9A 2ZKIA 1NI3A 2H2FA 2Z8YM 3IPAA 3SYRA 1TVCA 4ZEVA 5JWOA 2IHNA 1BFUA 4Q7QA 3RYHB 5I48A 2BPOA 4L5IA 1ZH6A 2O5VA 4Q1AA 3UT5B 5KKCA 3ZU6A 4E07A 3W5IA 4AN1A 4UM7A 2X0EA 3TJMA 3WNDA 1CUYA 4XD2A 1YAHA 3HNOA 3SIWA 3RVQA 1ZJWA 1T8WA 1GPH1 3DFFA 2IH4A 3CT6A 3V2GA 3TCXB 5LA6F 5J58A 1M2KA 2AEEA 4R5MA 1VOTA 1G60A 4C0SA 1XRMA 2ZUSA 4Q02A 1CULC 3SVZA 1MZPA 5GV7A 3T3IA 2SNIE 3RUFA 1P2VA 3JARA 4J0JA 3LYHA 4IJMA 3CEHA 1NVVQ 2WSBA 2XMPA 3CB4A 1J39A 2ZKLA 4FYJA 4PQFA 4IIGA 1CY7A 5J43A 1QHXA 1F17A 3SCZA 4CF6A 3FZEA 4YX9A 4LVCA 3ETDA 4WKCA 5EUQB 3PL5A 2JLBA 3SZRA 2IDKA 1IZ0A 2ZVPX 4N6GA 4GSLA 4EY7A 1WHTA 4GICA 4CT4B 1FDVA 1V9LA 4ENVA 2JLCA 3FKJA 3LT0A 2QL6A 1VRCA 4Q37A 2G08A 4EI2A 3NHSA 4A8PA 3PFHA 2ZSFA 3HCNA 2PU5A 2KJQA 2GCNA 3CPEA 1QFYA 2Z2XA 1OGYA 2ZB7A 4GNRA 2QDKA 4KXFB 2H4JA 4IQ4A 5AHKA 3ZXIA 1V11B 3EULA 5B3JA 3FDXA 3EWNA 3DL4A 3TDMA 2NMVA 1HLGA 2IQIA 3LCCA 4OREX 3D0KA 3GPCA 5F1YA 5A1TA 1P7PA 3VPCA 4F96A 3LZ6A 1SM4A 3S68A 3EFOA 1KFKB 3I1IA 4JJ6A 3RS5A 2F1HA 1YU9A 2H85A 5EQFA 4FFWA 1CRQA 3ZE6A 5KKAA 2ID9A 4II2A 4BL5A 4E4RA 2R1TB 4BZZA 3KKEA 2NZVG 2FMKA 1B8PA 4RO0A 3HI4A 1EX9A 1XZDA 4NLLA 5D3ZA 2FPPA 1AXEA 4QFCA 4R69A 3RSGA 3INNA 1A1SA 1NXWA 2A7XA 4HXEB 2I6FA 1YI8A 3EYAA 1RWMA 1YE5A 4IOKA 5ITSA 3FHTA 3GUZA 1X7WB 5B1EA 1GPDG 1XVVA 4QVKA 1Z5NA 3DE3X 2X2FA 4I3HA 1MD9A 2XCIA 4OB6A 4XIGS 4YP0A 4G0WA 1WXFA 2D62A 1U3VA 3SJCA 3GUVA 2P2ZA 4W5NA 5I7AA 4TLEA 3S7TA 3N75A 1HG0A 3N2IA 1LXCA 2ZJ4A 4Q6WA 3O91A 4R1PA 2XVYA 1VKNA 3EOZA 5EE5B 2HWUA 1E64A 5LMUB 2I3BA 2D1TA 3LPNA 1QDUA 1QKIA 3R9KA 3VPDA 2I87A 3WJAA 5K4HA 1B4DA 3I9NA 3R75A 1W4CA 1TW2A 3QSYA 1Z36A 1HQCA 4UHKA 1OC4A 2WRZA 5LYJF 4JU8A 2HBQA 4JL8A 4L8VA 1N6IA 5AW3A 1ZR2A 4JBIA 3S5UA 5AW8A 1ECFA 2BZ1A 3D1JA 2WSSA 4PX5A 5BWBA 1AS2A 1FRFS 1YS4A 3MGCA 3R6GA 2I4RA 3O90A 1XKXA 3I05A 4V0ME 3K0FA 2Q45A 3C85A 3ASVA 4QG3A 1TQ2A 4RDHA 2WB4A 1W0KD 2YQZA 3NV9A 10MHA 1NM5C 1QG0A 2Q5FA 3FWHA 2WDZA 1JJFA 3NG1A 4ZC1A 4LISA 4MP3A 3GX1A 4R05A 3QJ5A 3TTUA 2P4EA 3AUFA 2A5FA 3NVDA 3RDPA 2DETA 2BN4A 1SCDA 2D7JA 4PPYA 1KO4A 1FYXA 5HCIA 1PJ4A 1BGXT 3QU9A 1U0FA 3ZDAA 4JC8A 4DDWA 1XTBA 3JQ7A 4B7ZA 2YUTA 1JHYA 4CI9A 2UZ4A 4ALLA 1NI4A 5T4EA 3F6YA 1DAOA 3OCJA 2W8ZA 4HD8A 1S2DA 1J8FA 1GTG1 3HCWA 4U2KA 5K01A 2CYAA 2JRCA 3A9WA 3CZ5A 3BWYA 4PSAA 4MHTA 2VFAA 2HK8A 2ID4A 2C96A 2EDCA 4IXWA 1BYUA 1I7SB 2JIOA 5BSUA 3GLKA 4IQFA 1UPCA 3BTOA 2XGSA 4DCSA 5ALLA 2QL5A 4X62B 4M22A 3SD7A 1CLUA 4B6FA 2VQFB 3BE6A 4HN9A 4X1YB 1IB6A 1T9BA 3CUKA 4URUR 3F1LA 5K5EA 4K05A 1NHGA 3UK6A 4KYVA 1H5NA 2NZUG 5GONB 4M0KA 1MPXA 2TMYA 3N8DA 1YJAA 1NE7A 1RRMA 1T25A 3WGNA 1ESCA 3HKBB 1KC3A 3GFQA 3FGOA 4OU4A 1N4AA 4G4IA 4QT4A 5KNLA 1YZYA 3MG9A 4ZV7A 5C37A 4AMYA 4KH0A 1KQ3A 4N7JA 5FUVA 3WI7A 4B3CA 3TKYA 3PYLA 3QX9A 1KYYA 5H02A 4HLCA 2E85A 2GYYA 3Q5GA 2R4TA 4KXMA 3MXTA 5JNLA 4ABYA 3L92A 4ETMA 4DHEA 5EJ5A 1T3TA 3A6GA 3ILHA 4YN3A 2V1XA 4HAOA 2FFQA 2FQYA 3C7TA 3RWOA 2H54A 5HQ3A 3DE0X 5JSFA 5KYXB 3EWSA 2Q3JA 3LSTA 1HR0B 5EIHA 1ZCFA 4JT2A 2Z43A 3CSUA 1GA6A 2NO6A 1H9BA 3C6QA 4KLCA 3L8CA 4KV9A 1FXWA 2FOLA 1VYTA 3IVCA 1PW7A 4KUHA 4ESHA 2OCXA 3OFNA 5ILOA 5LJLA 2QLMA 2YOHA 5T4HA 1FFHA 1JMKC 3D4OA 4KR6A 2PYIA 3OLWA 4HGRA 3HYTA 3ZY2A 5I7EA 1VDZA 4GUDA 4J3FA 2JLZA 1O6GA 3BBLA 2X6RA 4U6NA 3E27A 5ILQA 5JRJA 4DA9A 4K9RA 3LX4A 3VZBA 1R3UA 2A14A 3JWIA 3B85A 5AKKA 2LCQA 5A2GA 3T94A 3FCOA 1XRSB 1YE3A 2OG2A 1DAPA 4ZO6A 2XUZA 2P67A 2VLIA 3G02A 1GUAA 5IABA 2O7RA 4OQFA 4BP8A 2DE0X 4MWSA 1Y4DE 3WG9A 3NEJA 4EGCB 2OFWA 2FB9A 2WJPA 4EHNA 1GDTA 5EE3A 1ZOPA 5SV2A 1JQEA 1PSDA 4WFQA 3CSDA 3AOEC 3RHZA 2H5JA 3AEQA 1V47A 2MR6A 1UOEA 2CMDA 3DEKA 4PFKA 1GGMA 1TU4A 1WB4A 4RD0A 3UMCA 4M1ZA 4KNWA 1YVDA 2WG1A 2OZEA 1C1HA 3MPOA 4NF2A 5AJTA 2Q62A 4I9UA 4ZK6A 1XMIA 5BVGA 2NU9A 3HWWA 2D3TA 2ZRCA 3FWZA 3OZCA 4N49A 3SQNA 2I55A 4QT0A 4ECEA 5ULLA 5B4UA 3K71B 6ADHA 3PHHA 2QYTA 4KRGA 2OBXA 2GVNA 2RAPA 4GBGA 1D4FA 4O5OA 2R7AA 1I4EB 2EHJA 4DIMA 1UZUA 3V1KA 2H59A 5HWSA 3JQPA 2ACVA 3GJSA 5IVPA 5EWJB 3G9QA 2WWGA 1IFXA 2DBQA 4MOWA 2HNBA 4L73A 4UHBA 3KZ1E 5AK0A 3ENNA 1OVGA 3SJ7A 9LDTA 3IB6A 1QRAA 2PSFA 4PHGA 3WGHA 4F6CA 3MWLA 1G2OA 2PX2A 1KH2A 2ZDQA 5I7RA 3GLIE 4HXFB 2FUG1 1F0KA 5CA1F 1XOIA 4LWOA 4MR8A 3X3HA 5L3VA 4PSKA 5P21A 1OV6A 5IJXA 1H05A 2Q6LA 3S2SA 3LC2O 3H2KA 1TVKB 5LLDA 2PY6A 3HNPA 3HPQA 3IOMA 3RODA 1X1CA 1V8BA 2FF7A 2PJZA 1TEHA 2P4QA 1P9NA 2EATA 3O9MA 3QENA 4JOCA 4RGVA 4QDUA 2V7VA 1DJLA 1E2GA 3UJ9A 1WG8A 1D0SA 2C3OA 3DVSX 1IBCA 3K4PA 2F1OA 4JP5A 3WYAA 3DBRB 5TB5A 5KNDA 1JEQB 1DFIA 2I66A 2NUBA 3EH2A 3FAKA 3JW8A 4X92A 5DX8A 3NATA 4MPDA 4X85A 1T2UA 3F3MA 5G0VA 4BNVA 3OVMA 4BLWA 3I6YA 3RYHA 4R0VA 2OYSA 1BAPA 2QU8A 3FRIA 3OE5A 1KMQA 1TK2A 1XTJA 4YRNA 1JPVA 1JTEA 2XYRA 4HLNA 4RU1A 3A1CA 2IWHA 2NT3A 3RS8A 2VTBB 2DYKA 5TQVA 1P2TA 3JZFA 4MR9B 5CT5A 3TW8B 4E2YA 3WS7A 4PPFA 3W9YA 4FDUA 4QFDA 1BC5A 4I6JA 1X0XA 3V42A 8MHTA 1ONOA 1RYMA 4KFTA 3BF7A 4HAXA 4PYNA 3RSFA 2JIDA 2G4CA 2C98A 2GAJA 2ZJ2A 3NUZA 1P2BA 4Y8VA 4KSYA 3MS2A 1EESA 5CXQA 1JIXA 4JX9A 4PXSA 3W78A 4YP1A 2CXSA 4B6RA 4BATA 1OX6A 4BO7A 4RK7A 4D3SA 4EW3A 2G5CA 5AW0A 1P33A 1YUMA 4UVEA 3ZTTA 3F7TA 4YPVA 2ZPAA 3RKRA 1UBRS 1DBVO 2B4YA 4XSGA 2QSZA 1HL3A 4RY9A 4UTVA 1U3CA 3NWPA 1QGAA 3QWHA 2AJTA 1M33A 3WLNA 2M1XA 4FD2A 4KDFA 4XSHA 2O57A 2V74B 1Y4UA 2CJFA 4R2XA 3T5TA 2GVDC 1U0SY 4CLEA 2C8LA 3MJDA 1AZLA 1V11A 2XHEA 3QV2A 4BZQA 2QG4A 2BGTA 2B1QA 2QDXA 2R9VA 2VAVA 3ELBA 3KAKA 5DE3A 1TPZA 5HQJA 1EK0A 4DR2B 4R3NA 3I2FA 3NIDB 1YNSA 5K0BA 3PXEA 5FA5A 4MQUA 1Q11A 1ZEJA 4ZTBA 5JO0A 3UQZA 1GL6A 5BORA 3G2KA 1JLSA 1S2OA 1ZRMA 2PUHA 2WTUA 3A1TA 2CNLA 2R1TA 2AFHE 3ZGYA 1JSXA 1A50B 2FEXA 4IILA 2G5TA 4OAOA 4FNOA 3UM9A 3DZDA 3L6BA 4MYDA 3Q3CA 1EK5A 2ZUFA 4FMCF 1DDIA 2OP0A 2VN8A 3AQIA 3I6ZA 1TYDE 2BY4A 1VL1A 2SECE 4HNRA 5BV1A 1X7WA 2OZVA 4YYZA 1F20A 1UMKA 3QUSA 4HFJA 4MPJA 4RMJA 4RPLA 3DEZA 4LJKA 4TUYB 4C4TA 4DQUA 2FUNB 4FYPA 5K7SA 1EIWA 2M6RA 4FX5A 5GPBA 1N2CB 2NSHA 1UK6A 1AUPA 4J1TA 2P65A 4XXHA 2YJ3A 3U3OA 4B6QA 4W5OA 2QL7A 1W59A 4E5PA 4C5CA 2QTWB 2VH2A 4NONA 1OVMA 2RDMA 1TAUA 4I4LA 2R2GA 1QO0D 3WQRA 5JPCA 1N2BA 3I2IA 2WYVA 2FXIA 3IOCA 2HSGA 3ZGOA 2AQIA 3DGEC 4P1ZA 3RSCA 4QHTA 3VJRA 1ZC3A 2ZWAA 4WN3A 4BNXA 4C76A 4CQJA 5JZOA 4OK5A 3IKJA 4ZJUA 1PFGA 4YC7A 3WLKX 2EC5A 1Z5UA 4HFMA 4E2ZA 4W5QA 1BW9B 3D59A 2W58A 1A82A 3L8DA 4HEQA 1MG5A 4ZOAA 2FEOA 2H4FA 4I4IA 1NU8A 3SSMA 2J3QA 2ZU0C 4RADA 3RU2A 3LGSA 4E1VA 5JQWA 1D04A 4I08A 1SU8A 1POWA 2DWQA 4IWXA 3UJNA 5GIOE 1Z35A 3HJRA 3STHA 1A88A 4WMLA 3S99A 1N2ZA 1QWSA 3E9QA 3PFKA 1TGVA 4HFRA 1RC1A 5E1BA 5SZHB 1T6ZA 2QAGB 3GJ3A 3HB7A 2JFHA 3O8QA 3OPYA 3WL5A 3PRYA 4URYR 3UWDA 4LE1A 5J2TA 1OWMA 1WABA 2V8OA 3KVOA 4GYJA 4EK9A 3AM1A 1E7MA 2OOKA 1EXNA 2XXBA 3Q3HA 4ZA2A 4FP9A 4J6EA 3STYA 4G1MB 1HURA 4N03A 3H5OA 5A2QA 2VC2B 5TS2A 2VJKA 3UJ7A 4BFVA 2JLAA 4UMDA 3BQNB 2XT6A 1EWYA 4LGVA 2G80A 1EBFA 3CUEF 4NX2A 4D0LB 5JAIA 5HUHA 2ISSD 4QYTA 5EESA 1T34A 1MBZA 1RLOA 2RBEA 4I5EA 2W6MA 5G2OA 1N2EA 5B58T 3T54A 5A5DA 5JNUA 3ERCA 2EJVA 3M3DA 5CU7A 1HDIA 1JP7A 2F62A 4OXNA 3EPPA 4XEUA 3TQFA 1YDHA 3A70A 2ZI7A 2QRVB 4NESA 2CXRA 4Z9FA 5KYWB 1V45E 9ATCA 1XLWA 3FPBA 4JGIA 5HJ7A 3UK2A 1FTWA 3CRVA 1DQYA 3NQ41 2FG6C 1T26A 4DRZA 3CIFA 1R0ZA 4JJFA 3R6TA 4E70A 2Q21A 2MSKA 3AIOA 4JUIA 4XQEA 3O8CA 3MM4A 5GONA 2JG3A 4KMRA 5GQSA 2F6RA 4EA8A 2P2SA 2HA5A 4KREA 1LCIA 1VGVA 3HKBA 3RIYA 1NMQA 5TE9A 2JFUA 1ZXLA 1Q20A 1TC2A 1XNJA 3RUHA 3H11A 1ADJA 3LUDA 3NH6A 4X1IB 5EXXA 4A5SA 5HBGA 2IFTA 2GBCA 1OXSC 4P35A 2CXQA 3ZS9A 3RASA 2QQ5A 1J0EA 2IDJA 3PT5A 1ZMTA 5JSYA 2BUAA 4OQ4A 3PWZA 4HAZA 3T5DA 5KYXA 4G0QA 2RJOA 3GEBA 4C3OB 1P5HA 3W1EA 3JR3A 2IUYA 1C2TA 2B7CA 3GJ5A 3R6DA 4GEGA 1R7RA 2XGOA 4ZI7F 1UAYA 4AMUA 3BWVA 1Z08A 4NABA 2J5QA 3GWZA 2PS0A 4YEDA 1CP2A 2ZYDA 1M1XB 1N5DA 2PTGA 1GFIA 2DR0A 2R47A 5J2UF 2VXOA 4Z3DA 2GN2A 2NZXA 4EA7A 1Y0BA 5EHXA 5EUMA 3ZD6A 2X1VA 3DFKA 5DM4A 3EBLA 5HR5A 1MQ9A 2BHRA 2VO1A 4JYPA 1MFPA 3HFGA 3QEMB 4L2IB 2W2LD 1HA3A 4QLOA 4DV5B 5ELLA 1QNLA 5I7SA 1WSWA 3U81A 1UMDA 3B5EA 1BE1A 4LZNA 4OP3A 2GD6A 3OZFA 2P6OA 3BXOA 5JMOA 1ZNWA 1ORWA 1CTQA 1WCV1 2EZ9A 4MHOA 5T5QA 4E3ZA 5BW5A 2IY7A 3LD9A 1RJWA 3K1AB 4I0WB 4X24A 3TM4A 4KO3S 3S55A 1VA4A 4MUJA 5TIIA 1TM7E 4H4EA 3T3GA 2Q46A 1UZLA 2A67A 2RB4A 3G68A 2YJ5A 3A7EA 4YMGA 1CCWA 5JBQA 4Y2YA 1KQGA 4E21A 3A6LA 2EIHA 2FPIA 2QN6A 1LPBB 4C7MA 3U7HB 3A4YA 4OQNA 4B3JA 3A6DA 1X3LA 1WDMA 1ZVKA 1RZVA 3O74A 2E37A 4MQEB 4W6ZA 2RHGB 1EGMB 4WZAB 5J9FA 4RFSB 2WAAA 1FLNA 2DFDA 1NF8A 4YRBA 1JSLA 2J7PD 4L8WB 1LQTA 5DSZA 5KCZA 1N6RA 1COWA 2ZM5A 2XGMA 3MCZA 1M2NA 5A6SA 1MAAA 4MP8A 1KJNA 1TVKA 1YVEI 2CLIB 1WKVA 5CT8A 3IOBA 3GPDG 3ZJTA 2BHTA 3CNBA 1PG0A 5C1IA 1JHVA 1IL0A 4D81A 2YZ2A 2X1MA 3QY9A 4XA8A 4B3HA 2XWPA 3EIXA 3F4KA 4J4BA 5J63A 4TLDA 2Q9UA 1H6AA 3DBRA 1WZCA 5HJ5A 3O31A 4B4WA 2XIQA 3PXUA 4ZEWA 5FNVB 4NBNA 5CD1A 4ZV9A 1MN6A 2OHFA 4A2PA 4AUMA 4HBZA 4XOUA 1KMNA 1T3ZA 4KIUA 4UOZA 3DFZA 3GDGA 1TKCA 3OMWA 4KKXB 1NBAA 4LYYA 3F6RA 1E5QA 4MKHA 1IM2A 3HSSA 1YRBA 2R62A 1BZYA 3E7WA 4GLBA 2G5PA 1K6MA 2OBFA 4NDZA 5C4GB 2O5CA 2QTAA 2VTBA 1EVEA 2DH6A 3L0DA 1SCIA 3TEFA 2FPKA 4I55A 4MR9A 4PONA 3UPDA 4BU1A 4DG5A 2IF2A 3I37X 3TW8A 1AHIA 3K2QA 1CJVC 2IOYA 2JFQA 2VEOA 1G7CA 3G1WA 3FPGA 3R3JA 3RHTA 4E88A 1QP0A 1GGHA 2G1UA 2HJRA 2D5AA 4G8JA 3V4LA 1DUSA 1HM5A 1ZNZA 3IULA 1I7NA 2VNKA 3IP5A 4OVKA 4GWLA 5B2FA 1XAIA 3H84A 3AG5A 3FRJA 3E1GA 3MQ2A 1T43A 4XI9A 2BDUA 4NDNE 3B1KA 2EJWA 4I5IA 3JQQA 4QHYA 1AV6A 2XLBA 1Z7EA 5U1PA 4DLLA 4BDSA 2OECA 4EI7A 1HV8A 3N74A 4AY2A 4CU5A 3LBFA 1S5PA 2PYZA 2Z4RA 1H42A 2EL7A 5KTNA 1RWQA 3P9XA 4AKTA 3D8BA 1YQUA 1XZHA 2Q0QA 1CIPA 4L3VA 4PO3X 4TMXA 1UM8A 2P40A 2XZOA 4R5HA 3HN2A 4JT9A 1ISPA 4LYAA 5EXTA 5A3VA 5BVHB 3G8YA 2QRUA 3D3EA 3ONEA 2E4XA 3KXLA 3ORHA 4PW0A 2NO5A 3CNNA 3O7WA 4OOFA 1N8KA 2O6HA 4M8NE 2AN5A 4ZO4A 4EUHA 3NDIA 3MWEB 3BZUA 5LN1A 2AN1A 2GPJA 1TDJA 3FF4A 1FL9A 3PDJA 4Q3EA 3OTHA 4QYWA 3RC1A 1T9AA 4AI6A 3GY0A 2X5JO 2O8FB 3IGFA 1DQZA 2LKDA 5DKFA 1U7ZA 1YKFA 4TTPA 2WM2A 4UPVA 1IN5A 2ACKA 1FP6A 3ZQ4A 1XD9A 4POAA 5IHXA 2BFDB 3Q3EA 4JXZA 1BX3A 3ZZNA 1II8B 2PWZA 4JVLA 4FZ3A 4ER5A 3P5SA 4IS2A 5THQA 3WA6A 4GKKB 4P9NA 5E9QA 1KO5A 2QVCA 1GDDA 3ZD9A 4XAQA 2CWDA 2HA0A 4WXYB 2P9FA 4EHIA 2UYHA 1SPBS 1A95A 1OZAA 5J5CA 3TNLA 3T15A 4GGPA 1F3LA 1NMSA 3P97A 4HQLA 2Y1LA 1QXSA 3IAUA 3DPSA 4IMRA 3SQMA 1I6MA 1NVWQ 4KQIA 1FE8A 3H42B 4RIHA 1E1QD 1S8FA 3WJ2A 1BEUB 2J7KA 5EKTA 3UKDA 3H2JA 4MDFA 3G5AA 4ZZ0A 3ESXA 4IDCA 5DGDA 3DOOA 4TTQA 2I2DA 5HMLA 1ODJA 3SU8A 5K8TA 3MTDA 7MDHA 2HAEA 2JIMA 3OY7A 5FB3A 1K5HA 3OP4A 2O8CB 1YZLA 2JAUA 1ZXBA 3QXXA 1QHIA 3GPLA 2C7QA 1QV7A 2DEUA 3AUTA 3MZ0A 1BFKA 3HS3A 1IWPB 1BW9A 3O4IA 1Q0LA 3ENKA 5DWDA 5FYQA 2X2PA 3UMVA 7YASA 5JWRA 3ABRB 1QLJA 1LB1B 2IHBA 4JEUA 1MXHA 2XQFA 1PS8A 1XRQA 3DMTC 3PNQA 1U0BB 4HQOA 4WGGA 1G8PA 2QAGA 4KOAA 4PYIA 4XQ9A 4KXXA 3SOZA 4RKQA 3W3AA 3PFBA 3G0HA 1U2TA 4I46A 1BKDR 5CK5A 1OGIA 2GPYA 5DFAA 5B7GA 3BD7A 3PXCX 1A71A 3GMSA 5IAOA 1B0ZA 1BU8A 4V2IA 5E9JA 4G0PA 1JVSA 3FTFA 3OX3A 4N39A 1K97A 1TB4A 3NM4A 3A36A 2FLKA 2NTVA 1B2RA 2W37A 3BHMA 3UA4A 2DUWA 1UJ4A 3EA5A 1WM1A 4J4TA 4N9QA 1U31A 3FBTA 2H1HA 2E21A 1DKLA 3UHJA 3UK1A 2ORWA 1NYQA 3EODA 4JUDX 5JSQA 2C20A 1ISIA 2W4QA 2QRVA 4H3HB 4Y6PA 4ZAWA 3WK5A 5KYWA 3FPEA 1W9HA 4G9EA 5BXYA 3BD9A 1UC5B 2PSDA 2X7JA 2UVPB 4OK3A 4RDCA 3LBAA 3ADCA 4KW7A 1DNPA 1QFXA 2BUCA 3OZVA 2YMMA 5DNWA 3KTFA 1OBVA 3LOPA 5IANA 4QE3A 3CLTC 4KLAA 2C8VA 3LLCA 1E8MA 3E82A 5FIUA 2PH3A 1HKUA 3S7ZA 3VUEA 2VDRB 2I7DA 4YRIA 1M6VB 3Q85A 5M04A 3Q7QA 4LW8A 2Y0EA 4X1IA 1DARA 3W6NA 3VI4B 5L4SA 5TMEA 2WSSD 3DMNA 4D3YA 2JJQA 2H4HA 2IVFA 4CIWA 1JQKA 1J8YF 2FSSA 4XDYA 2BF7A 3KM0A 3WICA 3GLQA 3CY6A 5FV4A 1VHLA 4M98A 4BBJA 3CS3A 2VHWA 4TSKA 5CTJA 2X8JB 2XTZA 4BO4A 4TWRA 2GJ8A 1NDQA 1ZOIA 1SQ6A 1PDVA 4O2LA 2RHTA 3OQ1A 3TD9A 3H75A 4G97A 3PUZA 4HNSA 5E8JA 3W5VA 3AM3A 2PLFA 4H4CA 3D2AA 5K1ZA 2W5UA 2BONA 3OZEA 1JHUA 4TN1A 2F59A 4YS6A 1KZ6A 2WDPA 1T35A 2WNSA 5EE0A 5GM1A 5IUKC 4QTYA 1R3DA 4KITB 2VDOB 3B3JA 4I1UA 4YROA 1LZKA 3I53A 3DR5A 5MF6A 3VPSA 1G9TA 1RT9A 2DGDA 3CX4A 3E9YA 1XTZA 3OX4A 4Y18A 3N5KA 2GESA 3QQPA 3OOHA 4L2IA 4D2IA 1Z25A 3B3AA 1RC8A 1EFRA 2O8NA 1S6YA 3EAFA 4I3GA 4H7KA 1T2AA 3TAXA 3R5KA 3EHEA 4UDNA 2CD9A 1X19A 3Q98A 3GP8A 4M0UA 1Z22A 1GKKA 7REQB 1C80A 4DIDA 4L6AA 4L27A 4E2FA 1Y3IA 1DC5A 2WUDA 3HN7A 2NM0A 3ZE2B 4OKSA 1SG6A 3PYMA 4GDMA 3WAKA 3T9EA 2X0RA 4JWTA 4PWYA 1M6YA 1QF9A 3WWYA 5K0TA 4PZEA 4YUZA 2R2AA 1U3DA 2PNFA 3I01M 4QPDA 2W70A 2J59A 3ABOB 4NE7A 5IJWA 2P41A 5AJHA 5KQRA 4QGHA 3VNUA 3SVTA 5JAZA 1XCJA 3K9GA 4M3NA 5MN4A 3O94A 3BDIA 1DWOA 2YBEA 4ZVKA 1KF0A 2G9ZA 1EQAA 2P9YA 2RHMA 1VGRA 3DAHA 2X6QA 4P4UA 2QRPA 1HFJA 3GRFA 1DV2A 2EJCA 1AKUA 1ZK4A 1O57A 4MQEA 5C4IA 1W48A 1WA5A 1C7EA 3U39A 3TNYA 4WZAA 3E53A 4RFSA 4F6LA 3D7SA 4CMEA 2V6BA 3FH0A 3LV8A 1FUYB 3UMYA 1HPLA 1NUHA 2AYYA 2G9RA 2QX6A 2ZAYA 3KB2A 5DOZA 3K5IA 3NEAA 4HDSB 1A9SA 2X2OA 2A0UA 3D3KA 4TQUS 2CLLB 3AHIA 4KWCA 5K99A 3I0ZA 4B74A 5FEMA 3AI3A 3RB8A 3P32A 3GJ8A 3L7AA 1SUDA 3IAHA 4P3PA 4CEIB 3B1JA 3PTLA 4J3NA 5FA6A 3FBWA 3OFND 1E2JA 3TOXA 3KHSA 3DWEX 3LBIA 1W85B 4O4IB 4JK3A 4XJVA 5AO9A 5IM5A 1NV9A 4DZZA 4XW2A 1L5VA 5FORA 2N1MA 3V4RA 3W2TA 5EEHA 2NNWB 3D6JA 5ALHA 2BSAA 1JN0A 1JVNA 3MGKA 3PL1A 3L8GA 3Q87B 2EXXA 4D9NA 1NP7A 4BTVA 5F76A 5FNVA 3H8JA 4L7VA 4IDNA 4JS0A 2X9LA 4LWPA 4UD6A 2C04A 2RI0A 2I2WA 4LVNA 3D02A 4MGHA 2YCLA 4HGOA 4HADA 5FLEX 4D3DA 1F5SA 1M8JA 1XL1A 3EAGA 2HGSA 4G1CA 4DXHA 1TA4A 2R00A 3DA8A 4O1HA 3TMKA 4CMHA 2VS1A 3DT8A 3UJAA 5DM70 2PEYA 3R24A 4NCJA 4BE9A 4IHQA 1HFWA 2JW5A 1MX3A 4QDZA 1I8TA 3VMMA 3T1HB 5JOQA 4AZSA 1BKYA 1U5BB 2R7NA 5TF0A 3ASUA 3GGCA 1JLKA 1PVDA 1QYCA 3IEKA 1S9DA 4Y2HA 5KSOA 4ZVTA 4YCSA 4RJIA 3TVYA 1V7CA 1HDXA 4C14A 1EVLA 1VA5A 2V3VA 1T9KA 5COAA 1OR8A 2P4HX 4ZYUA 2OY0A 5JQGB 4HV4A 3UC5A 1LV8A 1U0LA 1CVIA 3QTBA 5DNDA 4CCYA 4JB2A 3PFNA 1BTOA 2A9JA 2REXB 3B53X 5LB2A 1UFRA 1W47A 2QEQA 2QM3A 3N3AC 3NXKA 2EU8A 1XEWX 2GHQA 5FOVA 1XVAA 2O2SA 3T52A 1AF4A 4BC0A 2DHEA 4FUTA 1U9YA 4HNGA 1XZLA 2OZPA 5TGDA 3MUFA 2FV8A 3HBFA 2PFSA 4U0KA 1ECJA 3ORYA 4B2PA 1VMKA 3MGGA 1C3XA 5HSGA 2IEDA 1M73E 4CNBA 5I9NA 5FH9A 2FLWA 3HZRA 3MWEA 3WFZA 3I3SR 4QDOA 4MVJD 1KTVA 4TTRA 1TPYA 4BQFA 2PD4A 1SVSA 2JIPA 4RACA 2O8FA 3SBXA 2XQKA 4LC9A 1F8UA 1NZDA 1WSBA 4C7OB 4DJEC 3U09A 2HL6A 3DAOA 5E3HA 3E9CA 3OG9A 3FMGA 5DBGA 3UB4A 2BFDA 5KNDH 1II8A 3P26A 1L7DA 2F9MA 2KI5A 1G3RA 2PTHA 3INGA 4XB6B 1NR1A 1VLMA 3L7OA 3FR8A 2VK8A 2OXTA 4KN8A 4MARA 3WB9A 5K6TA 3E9RA 4JJEA 3FWYA 4FQ5A 3ZBPA 1Q84A 3RYTC 1SHUX 1ZUWA 2RHLA 3ZHUA 1AHNA 1ZSVA 3GLHE 3R8XA 4FE3A 4YP6A 1TW3A 3NHPA 2GOYA 1AF7A 2WZCA 2IW1A 1I2BA 3O4RA 3R23A 2A58A 4N41A 5TY0A 4D7AA 2P5TB 4PIVA 5GMOA 3S2FA 2Z56A 2JRLA 5HGJA 3FPJA 1R0XA 2YJNA 3KCQA 3JD3A 1B1CA 2ZAMA 4X7PA 1F2DA 3HV0A 3LQ1A 5LQSA 2H3EA 3I04A 2H92A 2QJFA 3R6WA 3EVDA 4RELA 3ZXXA 2Z2YA 3M6IA 3ENWA 1G98A 3N07A 3AF6A 4AN0A 1JDZA 1OXUA 1SVWA 1ZC4A 4C4ZA 4ILKA 1M9NA 1E7WA 4V0MA 2Q4TA 3OZRA 5BXQC 3U61B 5J2TF 3S5JA 2AQKA 2AFIB 2ZJYA 5IJ0B 2B4TO 1W2WB 1LBTA 3OJLA 4HOYA 4YJHB 5EN4A 1XJWA 3S28A 3GDWA 3OECA 3ZDCA 3PE3A 3LRPA 4P84A 3WMFA 2ZE7A 3R0QA 4CIVA 5DI9A 4FGLA 4K9OA 2O50A 2Y9MB 2E4UA 3IUQA 3IHKA 3SX2A 3P2JA 3UMGA 3LX6A 5I45A 4KXNA 2Y1KA 2ZREA 3OPXA 1QIEA 1W5BA 3KSZO 2F3RA 2HXSA 3CUVA 2WG2A 1L4YA 3UATA 2XWJI 3KOUA 3WB1A 4YJ2F 2UDPA 5KVVA 1UT5A 4NG4A 3DDCA 5DM60 3OQHA 3F3SA 3ESZA 1ACMA 2JCYA 2YR0A 3CNLA 2F3TA 3PQ5A 2H52A 2Z8XA 3AJDA 3GZTB 1L5QA 2HW8A 1II9A 2Q3EA 1E0AA 4GT1A 3N2KB 3S2GA 1XYGA 1OFHA 2AB0A 2QPLA 2BGNA 3A3PA 4HO1X 5DI3B 1D2RA 1X7HA 3QLUC 4JGGA 4X45A 3CZMA 4GR4A 4RW0A 2O2HA 1NNSA 1R0KA 2NU7B 3DXXA 3IPXA 1N1MA 3WGYA 2QP3A 3W4JA 2VPXA 4PSUA 1G8HA 3B7WA 2WNIA 1YQWA 2D5LA 3PQ7A 4O2AB 4OFWA 1RSZA 5BUSA 3KPVA 3OE4A 1ZU4A 3K0HA 3TAUA 3JCZA 1FFYA 1V16B 3L0OA 4MV6A 4YRMA 1X94A 5AJYA 2X4LA 4MPPA 2UVPA 4WNIA 3NAMA 4BCCA 1BS1A 4KQ2A 4KXYA 4WKBA 2X76A 3T9FA 2PKQP 2I54A 5CT6A 4FX2A 4F5ZA 2OO7A 2GJKA 5I4IA 2PZFA 4N0EA 3QE9Y 1GHTA 1C7RA 1M6VA 4FXOA 2OBMA 3THWB 2ARKA 1JX6A 1IZZA 4MIEA 5IBCA 4JJGA 1ZY2A 4UPDA 2ZB4A 5D85A 4MVXA 4R8KA 3RRBA 3WRVA 2JFBA 3WLQA 1R6TA 4KL8S 5JZBA 4JIMA 1P73A 1EB8A 3LCJA 3UUWA 4DMRA 2PT5A 2R6AA 2X8JA 2JLVA 1J06A 3IRUA 3SK0A 4CBVA 5K8IA 1HTBA 4AJ9A 1SUCA 2HF7A 3A2LA 4J03A 3JYHA 3KQWA 2UUBB 1CDDA 2J9RA 2Z9CA 4YJKA 1O4VA 1QV6A 1X7YB 4RABA 5IBPA 1XMJA 3C48A 4X94A 3HXMA 1ZLYA 1E0DA 2EERA 3I2JA 4RA6A 5FWYA 1KOFA 4IJ6A 2G28A 1A5ZA 2PXCA 2WT4A 4W1QA 1ZHFA 2WMDA 3Q9NA 1T2DA 3BSSA 4RZ2A 2YICA 3RFCA 3TZKA 3UH0A 4YPOA 3GZ4A 2RHJA 3BK7A 3GUHA 1EZZA 3DTTA 5EZQA 5I9MA 2AN3A 2OV1A 5YASA 1SEPA 3OJXA 2GJSA 4D8UA 3QE3A 4MI9A 1WCYA 4ZAFA 1FMFA 4ISCA 1YDWA 3EVBA 1HDEA 4GD3Q 1O94C 1VYUA 1WTAA 5AP9A 2EX4A 1S89A 1ZPDA 2RMKA 2XJ9A 2YL2A 3KTOA 4D6PA 4DDHA 7REQA 2OPHA 1W36B 1G18A 4GMHA 2QMHA 5IMSA 3NWJA 1WB9A 5CDSA 2OFPA 4BP9A 2VAMA 4R8LA 1X2BA 2PKXA 1E3SA 2Z5LA 2AC2A 2V7QA 1NNUA 3HQ4O 4K9MA 4PHHA 2X40A 3IESA 3WP0A 4ZCLA 2VUUA 1L5KA 2IIPA 3PFFA 1JDNA 1PD0A 2IHUA 4X3PA 2PQ0A 3GMTA 1W581 4WOJA 4BKQA 1O0CA 1HKHA 1MJGA 3GLIA 1JSRA 2BEUA 5HZKA 5LDDC 1QFJA 5LQKA 1NXSA 1U3UA 2WI8A 4KIJA 4NS1A 5DO9A 3J7AC 3ZGZA 2BF4A 1NIPA 4QUKA 2WFAA 3NFRA 4QBFA 5A7GA 1BEZA 4S24A 1CE8B 3ES9A 4PLPA 5EJAA 2RBGA 4I14A 1NLYA 1T91A 5ETJA 4KYUA 4ZJZA 1ANKA 1RWPA 2ZB3A 3AY7A 4HDSA 4AULA 5E6UB 1OWPA 1U3GA 1KWKA 1NR7A 1KZ4A