3H17A

Crystal structure of este5-pmsf (i)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
292
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of an HSL-homolog EstE5 complex with PMSF reveals a unique configuration that inhibits the nucleophile Ser144 in catalytic triads.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 107
structure length 292
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h17A00
2HDWA 4RNCA 3I6ZA 1SCIA 3KXPA 4W1PA 2YXPX 5LZ4A 2QUAA 1WB4A 3C43A 1TIBA 4GW3A 1THTA 1CPYA 2ACEA 1HLGA 1W52X 2ACKA 2PBLA 4P93A 2XQJA 4X92A 1VZ3A 2IX9A 5E2IA 5LYYA 3H2GA 2WSLA 4BC0A 4GDMA 1UXOA 1VE7A 3IVMA 2H7CA 1K4YA 4UHFA 2DR0A 4QZVA 3KWJA 4LHEA 4GWLA 1MO2A 1CUYA 3DKKA 1XQVA 2WG0A 2GZRA 2XUDA 3QMMA 1H2WA 4G8DA 3RK4A 4H0CA 1A8QA 4L3WA 1XRQA 3VJKA 1XZLA 2K2QB 4Q82A 1LPPA 1W4LA 3VJLA 2WG1A 3N2ZB 4Y2JA 4ZGBA 3QBJA 4Y7DA 5FDFA 2Y1KA 2C0PA 4N5HX 1OXMA 4B84A 5FPQA 3FSGD 3O4JA 2Y6UA 2YYSA 4DIUA 1CUSA 4ARAA 1DU4A 1XZMA 4U2GA 1MNQA 1O6FA 4K2AA 1U65A 3W9UA 2XQGA 2XMZA 2QVBA 5AI8A 5AK4A 5JAHA 5ALRA 1QOZA 1J07A 3G02A 1H2ZA 4J0KA 4U2EA 1CEXA 1CRLA 1EXWA 1GPNA 1Q0RA 2WLSA 1CUGA 4YK7A 3WK9A 3MUNA 4J0IA 3ZLVA 3K6KA 3WI7A 4PNZA 5AM5A 1W75A 1ZD4A 4QDXA 2V97A 1XZKA 3QH4A 3X3HA 5DTIA 5JARA 1FFCA 4FBMA 5EGNA 2CEKA 1R9NA 4XX1A 3C45A 2PU5A 4CG1A 1EI9A 1KEZA 2V98A 1LPAB 4MWSA 1EB9A 4BC1A 1LPBB 3V1NA 2BUAA 3PE6A 1EH5A 1LGYA 4X94A 5AM4A 3F67A 5DNWA 1F6WA 4BDTA 1JFRA 4EUSA 1MAAA 4ZV7A 1WM1A 5EHNA 1LBSA 5FLKA 2C5FA 5LKAA 3C70A 1AGYA 4ITVA 3KOOA 3IB3A 3ESCA 2DSNA 4BTVA 3IUNA 2XI4A 4Y2SA 4BAZA 4UBJA 3OURA 4BRSA 2H7YA 1EA5A 3C87A 4X85A 4ETWA 2EDCA 5D3ZA 1BROA 2Z3ZA 2WM2A 4KAJA 4H7HA 3AIMA 1UOOA 1J1IA 5AK3A 1VA4A 1S8OA 4LIPD 4ZREA 4JUIA 1AURA 1XZIA 4G5XA 5I7UA 4J0CA 5JATA 2AJDA 3WWOA 1L7RA 5T4FA 2AXEA 3H04A 2QR5A 3DLTA 2ZYSA 1F0NA 2XB6A 5AI4A 1BEEA 5C7YA 5AKXA 2HA4A 3O4HA 3STTA 1W6RA 1N8SA 1TK3A 3HI4A 4F5ZA 5JASA 4G9GA 5EFZA 1ZI8A 2PSFA 2XUIA 1G42A 2VT6A 2QUBA 1DINA 3C6YA 5HKBA 1H2YA 5JANA 4ARBA 4FLMA 1CUXA 1UK8A 2AJ8A 3ZLTA 4HTAA 2OXEA 3GELA 4PW0A 1MT3A 1DT5A 1Z68A 5LZ7A 4AMZA 4LXIA 4G9EA 1AMNA 4OSEA 4GBGA 4I19A 2ROQA 5JALA 5DWDA 1ORVA 2PSDA 3SC2A 3F97A 3FLBA 2WILA 4HXFB 5JAUA 4IH1A 2QJWA 1QFMA 2RI6A 2WJ4A 5K3AA 2AJLI 4BYMA 3DKRA 5T4EA 3W06A 3WYNA 1Y37A 4PSDA 3O9MA 2XMCA 5AKLA 5EIHA 4M0EA 1CV2A 4IHAA 4ZWNA 5ALKA 5AHXA 2WIFA 2H9YA 5ALFA 4HXEB 2PSEA 4EBBA 5AI9A 3W9BA 3IBTA 2QTBA 1P0IA 2VQ6A 3WKAA 4X97A 1T2NA 5CXUA 1U8EA 3WKCA 2HADA 3ZLUA 5AIAA 2VA9A 2HA5A 2XMRA 1QFSA 4YX9A 1DT3A 1G5FA 1B41A 3HJUA 4BATA 5IKXA 3QPAA 2WUEA 4CIAA 3EQ8A 4H35A 4EY6A 3Q0TA 3WWCA 4BVJA 1YA4A 4GXNA 4LYDA 3A2NA 3BIXA 1TCCA 1MTZA 2JGEA 2CMFA 1VA5A 3I6YA 1VXRA 1XLWA 3KSRA 3OPMA 3R3WA 3FOBA 4DLNA 4G4JA 3RARA 3L1IA 5HKAA 2J4FA 4FOLA 3O4GA 2GYWA 4C89A 1FFDA 3BJMA 1CLEA 4KYVA 1N5RA 2HRRA 1OCEA 4E15A 2HA3A 3M82A 2OPHA 5JD5A 2XQFA 4N5IX 2WTNA 3WL8A 1LPSA 4QDZA 5JZSA 3BL8A 4OD0A 1PV1A 3WYDA 2WG2A 3Q8WA 3V9AA 2HU5A 3GZJA 3S8YA 1ZJ5A 3BJRA 5JIBA 5AK5A 3ESAA 4CCWA 3WLAA 3DOHA 1EK2A 1HPLA 4MWTA 5ALZA 4H7EA 3NWOA 2DHCA 1ZJ4A 1XQXA 3G0GA 4FKBA 5CRIA 5EIEA 3KWFA 4X71A 4KEAA 2OQIA 2JGMA 1XZFA 1ISPA 2QJRA 3I2HA 1W1IA 3KD2A 3R3YA 3N0TA 2GBGA 1HQDA 4OU5A 1XZGA 1CUEA 2O2HA 3STWA 3WK8A 1JMKC 5IVIA 4GECA 2BGNA 3IUQA 1XZHA 4HZGA 3LIIA 4HRYA 5CH8A 3FSGA 2BUBA 4BP8A 1L7AA 3F98A 1GKKA 4U2DA 3BF8A 1N1MA 2XMSA 5ALJA 4A5SA 4KRXA 1CIJA 4FHZA 2OCGA 1XZDA 2JIDA 2JGJA 2C58A 2PUHA 5IVKA 4PSCA 5AM1A 2ZYIA 4L72A 3O9VA 4QEKA 4P92A 3BDIA 1UT6A 1UFOA 1MX9A 2JF0A 4TGLA 3BE8A 3WZLA 3D59A 3G9UA 4X6XA 2XUAA 2QXUA 1ZIXA 5A6VA 4C4XA 2XUQA 1USWA 5FV4A 1HL7A 5AM0A 2HA2A 4BCDA 4UBMA 3W04A 3JWEA 3R40A 5ALVA 5CH5A 4EY8A 2RIPA 3ZWQA 4JNCA 5EI5A 2W6CX 3WWEA 3T52A 4B6GA 2DQYA 4DMHA 2FX5A 4Q1VA 3UUEA 2WQZA 5ISMA 3HEAA 4V2IA 4DMFA 5J3JA 3E0XA 5K3FA 1LPOA 4BCBA 2CBGA 3E3AA 2WHQA 1GPKA 4W63A 1UKBA 3IURA 5A7FA 3M81A 2HFKA 1D07A 3BIWA 4MQMA 3OM8A 3DNMA 4U2CA 1G4HA 2VT7A 1XRNA 1VE6A 3B5EA 1R9MA 2XLCA 5CBKA 3QYJA 1IZ7A 4EB0A 1X70A 2PUJA 1VJ5A 2VAVA 5LIPA 1VXOA 1CFJA 3D4LA 4D9JA 1ZI9A 3RKSA 5HF6A 1VOTA 4H18A 1XZEA 1ZGCA 5HFNA 4B82A 4IQ4A 3LS2A 1LLFA 4F21A 3FCXA 2Z3WA 3RLIA 4INZA 1DX6A 4MYSA 1ODSA 2OGSA 4MXDA 3I2JA 5HCUA 5A71A 2YASA 4X3CA 4Z49A 1H2XA 2HL6A 3WA7A 1QE3A 3K2IA 1QO9A 4M0MA 1VKHA 1X2EA 1EDBA 5DYTA 3FNBA 3DCNA 3ZV7A 3WKEA 2I03A 4Q3OA 4WDRA 1P0QA 2QZPA 1BCSA 1BCRA 3G9XA 4XIIA 5HZGA 1XRRA 2ZJ6A 1MX5A 5HF9A 5EHXA 5EHZA 5E4TA 2Z8XA 2JGFA 2Y6VA 4WJLA 1QIEA 1CUVA 3EQ7A 1JJBA 1QGED 1SC9A 4Y2UA 2JEZA 3AZQA 3WIBA 2FJPA 1C7JA 4BAGA 1ODCA 3ESDA 1QIFA 3FYUB 2WIJA 2H7XA 4X90A 4J0HA 3K9BA 1FFAA 3M83A 5I8PA 1LPMA 2ZSHA 4DMKA 4BVLA 5SYNA 5CT8A 1DQYA 3OC0A 2WFLA 2B9VA 4F60A 4B0OA 1C4XA 4NS4A 4PV7A 4Y2PA 3LP5A 4K6KA 2PPLA 4BCCA 2G4LA 5BV7A 1XKTA 1Q83A 5E4YA 4KJXA 2JGKA 4KAFA 4J7AA 4XVCA 2UZ0A 5A62A 5AKEA 3A2MA 3DL7A 1BEZA 4S0XA 1XKLA 2EEPA 2WUDA 3NGMA 4J0JA 5AI6A 1FFBA 3IULA 4GLBA 1UKCA 4NVRA 3CCBA 2DQZA 1EDDA 2V9ZA 1XRMA 3D5EA 4OPMA 5FPPA 2GYUA 5ALDA 2HA7A 4I4CA 4U2FA 1ZD2P 2B4KA 4EZIA 2WJ6A 5C8ZA 5KWIA 2PVSA 1CUFA 3QPCA 3R3UA 4KE7A 2BAGA 5LKRA 3C6XA 4K5QA 1YS1X 3O4IA 4JYMA 5CT6A 2E3JA 1GT6A 2PM8A 1BS9A 4C6HA 5SYMA 4WFKA 1GXSA 5CURA 2VTVA 5LLSA 2AJCA 4QWWA 5K3DA 4Q34A 5ALLA 3VKFA 4X93A 4WDQA 3I6MA 2HHAA 3QPDA 1EK1A 1UZAA 5JD4A 3HZOA 3HABA 3H2JA 3MUOA 4UBLA 2Z5GA 3G9TA 4AO8A 1R3DA 5BWCA 4LXHA 2ZVDA 5F4ZA 4DGQA 1VLQA 3BDVA 1NX9A 1A7UA 4RE5A 3H2KA 5JZ9A 3AIKA 4Q3LA 1QIDA 4B80A 4OB6A 5KBYA 2RONA 1E89A 2Y2UA 3CN9A 5DNUA 5HF8A 3I28A 4C01A 5JAPA 5CT9A 3C6ZA 4QWMA 1SCKA 5AIBA 1QIIA 1XZJA 4CI9A 4PQEA 1XZCA 1J06A 2WKWA 2X5XA 5ALSA 4C4YA 2JEYA 4IO0A 3L1HA 2B61A 2XMGA 4W1QA 4QDTA 2WTMA 3QITA 4OU4A 3WA6A 2I3ZA 4AQDA 4X95A 3H2IA 1KU0A 4I3FA 3IUJA 5HF5A 1FSSA 4J3JA 4UHBA 2WHPA 3C5WP 5ALPA 1ZD3A 2OGTA 1YASA 4OB8A 4AXBA 1U2EA 1FJ2A 5K3FB 4DNQA 2QRUA 3CCCA 1U4NA 5FOQA 5DYYA 1T4MA 1UK9A 2WFLB 3AINA 4OB7A 3C5VA 4DSZA 4QA9A 2AJBA 4FNGA 5AKYA 1AC5A 5C81A 4MEBA 4L0CA 4U2BA 4P08A 4K6GA 4BZZA 4B0PA 1H22A 1NU8A 3PICA 2XMBA 3U1TA 4RE6A 3NUZA 3HYSA 3B3QA 4N8SA 3IUMA 3PF8A 3D2CA 1QTRA 3I1IA 4QNNA 3TEJA 2JGLA 4HRXA 4C88A 4QLAA 2OCKA 3MVEA 4OCZA 4RPCA 2RAUA 4B83A 4AZ3A 4UFNA 4AN0A 1E8NA 1XLUA 4CIBA 2DFPA 5DJ5A 4ZXFA 1F0PA 1ACLA 2ZSIA 3EIOA 5ALWA 5ALMA 1DTEA 5LZ9A 2GBFA 2HFJA 2Y2VA 3PUIA 4H7IA 2QOEA 3IDAA 2ORYA 5HQ3A 1LZLA 1ACJA 3OTQA 1A8UA 5C8XA 1AX9A 4FMPA 5K3EA 5AK6A 2CJPA 3ESBA 1AUOA 2V96A 1XRPA 3WJ1A 4Y2RA 1JU4A 2ZYRA 4G8BA 3JYHA 1MJ5A 2G63A 3YASA 3C8HA 3FVTA 3I2FA 5HK8A 3FYTA 1QIJA 4L9AA 2H1IA 1QO7A 1KU6A 2C4HA 3SX4A 4A23A 2LIPA 1CUJA 1CQWA 3WL5A 3A6ZA 1ODTC 3E1GA 1CUUA 4Y2TA 5T4HA 5AJHA 5H3HA 3RM3A 2OCIA 3G8YA 3ZI7A 4HAIA 3G7NA 4GEGA 4DTCA 1QIKA 2DHEA 3H1BA 4MQLA 1TAHA 1MAHA 5C8VA 2BFNA 2XUGA 1N5MA 5DTJA 3W2TA 4UHCA 4UUQA 3HRHA 2D5LA 3AJAA 4BRZA 1MU0A 3GROA 3AILA 4UBKA 1UKAA 1R50A 1DWQA 5AO9A 1XZBA 3ILSA 4C4ZA 3EBLA 3T4UA 3NOXA 3DDUA 2OQVA 3P2MA 1X2BA 5T4BA 1LZKA 4YASA 5D6OA 4CG3A 2WJ3A 5AOCA 3HXKA 4MEAA 4Y9SA 4AZ0A 3D0KA 3DOIA 5D3KA 3M3DA 4WY8A 3SK0A 1E66A 3BWXA 1HDEA 2C7BA 1QZ3A 5ALTA 3WWPA 4DSAA 4BZWA 1Y7HA 4NZZA 5AM2A 4O08A 1GPLA 4OYLA 2ZJFA 3A70A 5ALUA 3GA7A 1AZWA 1CUBA 2BJHA 4Y2QA 1LBTA 2VJBA 3H1AA 3I1YA 4EA6A 6YASA 3I2GA 2BCEA 4ZI5A 4TVKA 1XLVA 2VSQA 1C7IA 4FLFA 1EX9A 2Z8ZA 2ONCA 2BGRA 3FVRA 1QIMA 5FRDA 2GBCA 3E4DA 4FLEA 3QVMA 1IUPA 2HU8A 5K3CA 4UBOA 3MGAA 2J3DA 3HLKA 1WPRA 1SFRA 1BRTA 4C87A 4PO3X 1WPXA 3B12A 4WCVA 3ANTA 2XUHA 2FUKA 3AZPA 5IH7A 3D2BA 5HQ3B 4ROTA 4X6YA 1BE0A 3FLAA 4H7KA 1M33A 2QXTA 1XQWA 2PU7A 2VJDA 3V1LA 3C8DA 5LZ5A 4K6HA 3IIIA 1GQRA 3FYUA 4BE4A 4F0JA 2ECFA 3FCYA 2D0DA 2RHWA 5ALYA 1W76A 1HBJA 2ZYHA 2QS9A 5AH0A 3WL6A 2XUKA 5AOBA 2R8BA 1TRHA 3DS8A 1R4ZA 2OGZA 1A88A 2HA6A 2G5PA 1J2EA 1XRLA 5FXMA 2VATA 3O95A 5LZ8A 4J0DA 5ALXA 2WFZA 5FP0A 3TGLA 2C0QA 3H2HA 3AZOA 4N8EA 5BOVA 4UBNA 3STYA 2PL5A 2IIVA 2QMQA 1K8QA 4DNOA 4B9AA 1RP1A 3DQZA 3I2KA 3GUUA 1SCQA 2XMDA 1WHSA 1RYYA 3HACA 1WB6A 3DYVA 2PSJA 3TJMA 3G0CA 1TCAA 3EF3A 1ZI6A 2XMQA 5DNVA 5KREA 3EQ9A 4J03A 5JADA 1MX1A 3QZUA 1YCDA 3ZPXA 1A8SA 3G0BA 3FLEA 3WQHA 2NW6A 3D7RA 1WHTA 4E14A 4MYDA 2VJCA 4Q3KA 4IH9A 2WFMA 5AICA 3IA2A 1ORWA 3F8SA 3HSSA 2OLEA 3QMWA 3WKBA 5ALNA 2VJAA 3ICWA 3D3NA 4TPKA 4EY7A 3VJMA 2CUTA 4CCYA 1GKLA 5LZ2A 4BB0A 5AM3A 2XUFA 4JYPA 2CKMA 1RWQA 4AB1A 3G0DA 1R88A 1EDEA 5AKJA 1PJAA 4GI1A 2XDWA 3R3ZA 1FFEA 3G9ZA 5CW2A 1IVYA 1TKRA 2CZQA 2XUPA 5DYWA 3ICVA 2HU7A 4H7FA 3WK6A 4H77A 4FDMA 2BUCA 1K5PA 4LXGA 3PI6A 1E3QA 4IH4A 2HIHA 4N8DA 3STVA 4UPDA 1Q0ZA 1YSCA 1Q84A 4X00A 3VXKA 1L7QA 4AX4A 1YAJA 1JMYA 4W9RA 4W1SA 4Y2YA 3W05A 1AQLA 1O6GA 1JJFA 3JW8A 5AP9A 4UHEA 4J0GA 2I78A 4UHDA 1THGA 4H7DA 1TCBA 3SWWA 2WUFA 2XQIA 3H19A 5CMLA 5D7BA 3WWDA 3L1JA 1DWOA 1MNAA 4DMCA 4XJVA 2WHPB 3V48A 1QJ4A 4X7BA 1YB6A 1TQHA 4UBIA 4KACA 1CUCA 3R41A 1YA8A 4PSUA 5JAOA 1YS2X 1EHYA 3LCRA 2GZSA 1EINA 1Y7IA 4QE3A 3TRDA 2WIDA 2HM7A 4LKOA 4BE9A 3FWHA 4QLOA 1LNSA 1SOMA 4B9EA 3F9CA 5ALHA 2QM0A 4RGYA 2OCLA 4BVKA 3VVMA 5AKZA 5HFAA 4KE8A 5JYCA 3PDCA 4HS9A 5KWJA 5ALQA 4CFSA 4EY4A 4EHBA 5CXXA 4CCYB 4DM7A 3LIPA 4CG2A 4HXGA 3QMVA 5A2GA 1XFDA 1IZ8A 2O7VA 2C5GA 2OAEA 3OOSA 1AKNA 1QIHA 5IVDA 3R3XA 1ETHA 2HRQA 3D2AA 1CUDA 4FWBA 4Y2XA 4G4GA 4QDOA 4LYEA 4M0FA 3UUFA 1ZOIA 2YH2A 1DQZA 2WU3A 4W1RA 4H7JA 4UFOA 2WU4A 4FTWA 4DYHA 2FJ0A 1QIGA 1JU3A 2VF2A 4EY5A 2R11A 1GQSA 2DCMA 4NMWA 1ZICA 4AO6A 4YPVA 1UK6A 2X8BA 4OYYA 2W22A 1PFQA 4KE9A 1ZGBA 4AN1A 4OUKX 5BWBA 5IVHA 1B6GA 3AFIA 1CUWA 2XUOA 4QDUA 1UWCA 3DD5A 1I6WA 1VZ2A 1H23A 4G1FA 5K3BA 1CR6A 3ANSA 4UFPA 1LPNA 3S2ZA 3FAKA 1EVQA 2JGIA 2QT9A 3PFBA 4ZRDA 3PFCA 3GBSA 3WIOA 1EB8A 3DL4A 4E46A 1QTIA 1MPXA 1OILA 1F8UA 2OAGA 2GYVA 2DHDA 2GBIA 4X91A 4DNFA 1IUNA 1MN6A 5A7GA 1K6EA 3PF9A 2I3DA 5AKGA 2RGUA 1XROA 4B81A 1DWPA 5E4JA 2QKYA 1P0PA 1DX4A 2X76A 1GGVA 1JKMA 3VVLA 4B85A 3C6BA 3WZMA 1YAHA 1K63A 2WIGA 1R1DA 4AO7A 3O0DA 2CB9A 5A7HA 5AOAA 3V1MA 1BN7A 5HK9A 4HVTA 3KDAA 1G66A 3STXA 1WB5A 7YASA 4MJ3A 4BDSA 1CVLA 1E8MA 1IUOA 1EVEA 3HC7A 2OG1A 1E5TA 1QLWA 4ZV9A 1JT2A 1NU6A 4WFIA 1ZD5A 2J4CA 3AUKA 4GHWA 5CH3A 5AKKA 2J3QA 1UOQA 2Q0XA 5CT5A 2WIKA 2PSHA 2VAXA 1CUAA 4Y2VA 4BP9A 4WFJA 3GFFA 1CUIA 1ZIYA 3LLCA 5JZBA 2ZJ7A 2PKYX 3WKDA 3WK4A 3F96A 1QONA 4B7ZA 4JEIA 5JD6A 5K5EA 5EHQA 5I9IA 2RHTA 3CN7A 4KE6A 4FBLA 3UMJA 1JI3A 4KRYA 3BXPA 5FKJA 3WK5A 4G4IA 5AI5A 3ED1A 1WOMA 5ALEA 3WJ2A 4KR0A 2ES4A 3A2LA 1JJIA 1CUHA 2HA0A 1BU8A 4FFVA 3WL7A 2VEOA 5AKIA 3AIOA 4P9NA 3VISA 3QM1A 3PUHA 1WCYA 4FNMA 2O2GA 3I2IA 1YB7A 1XZAA 3OG9A 4DNPA 3FYUC 3G0IA 3H18A 2BKLA 1E8DA 1YR2A 4X6UA 2O7RA 5DLPA 3VDXA 4KAAA 5LP1A 3FBWA 2P8SA 4UHHA 5ALGA 3H17A 2XE4A 3R3VA 5EIAA 1UK7A 2XQKA 4BAUA 3STUA 3CXUA 4AMYA 1HKHA 5CTAA 5AKHA 3DEAA 3V1KA 1CQZA 5YASA 4PF1A 2JBWA 5ALIA 4JH0A 3U0VA 2IITA 1UOPA 4E11A 5CT4A 4A16A 4BBZA 1CUZA 3WMRA 2B20A 1XQYA 3DJYA 4G8CA 5FUMA 2PX6A 2EDAA 2XUJA 1P0MA 2WHRA 3BF7A 2O2IA 4XWGA 4Q05A 4FFWA 4BTLA 3DYIA 1GZ7A 2XLBA 5AI0A 2G5TA 2WUGA 5ALOA 5ESRA 3R0VA 2XT0A 1IMJA 3H0CA 4WY5A 3WK7A 1BN6A
chains in the Genus database with same CATH superfamily
1WXDA 4FZJA 4E6PA 4AYXA 5DN9A 2HJSA 4HMOA 3ETHA 4KLCA 4RNCA 4E5MA 3I6ZA 4MP6A 3HJAA 2RG7A 2VVTA 4LC9A 1GRQA 2YXPX 3M6UA 4QBFA 1HRDA 5LZ4A 5C80A 4MYTA 1P6QA 3GEDA 1ZRHA 3MTDA 1DB3A 1THTA 4HWSA 3B1FA 3BB4A 2ACEA 1Q3HA 5T3UA 4JI6B 1EFUA 5JS2A 2P6RA 1WRBA 2QE7A 2VK8A 2WP8J 1CY1A 1OTYA 4P93A 2GAJA 5WRFA 3TTYA 4M0LA 1KRWA 4GOMD 4WIAA 1P5ZB 4ZTBA 1SQSA 4DFDA 4D82A 2H5LA 4DLSA 2XBUA 3PNQA 4PQRA 2I5PO 4JSRA 1LK5A 1I6LA 4Z4HA 5CDHA 5BPFA 3EMDA 1KP3A 2FSSA 1IM8A 2ENWA 3WL3A 4I99A 3LX4A 2J30A 1ZPDA 2A92A 1KXZA 1JQJC 5IAKA 3UMGA 1NA5A 3UMMA 1B0UA 3P4XA 1A3CA 1DO0A 2Q5LA 4PZLA 4BNLA 5K4HA 1F51E 4KNYA 5JVDF 3PQEA 3H2YA 4DDMA 1VE7A 5DBHX 1JKIA 3Q3CA 1Z62A 4WERA 3IEXA 3PNMA 4LZWA 5KOJA 2GESA 2IELA 1CX9B 3UMBA 4EPRA 1TUBA 2H7CA 5B3KA 4J1SA 4PHFA 8ABPA 3SKXA 4DDTA 5KWSA 2YQZA 2JJ1D 5FR2A 2DR0A 1Y9AA 2VYFA 1C3VA 3HB0A 1F0KA 3B6EA 3IBCA 3EXEA 1OBFO 3ST7A 3NVAA 5H70A 1G6OA 1ZYUA 2IHUA 3I01M 1F3OA 1UXGA 3MB5A 1WPGA 1I1HA 1OGJA 2HF8A 3EXFB 3H6GA 2R2AA 1E2EA 1NPDA 1XDSA 4G65A 4ZVPA 4AVYA 4DV6B 1SVOA 3WGYA 1MO2A 4JMPA 4EHJA 1X6VA 3E5RA 1XV5A 4YT8A 3Q9UA 3LRXA 3DKKA 1TYAE 3SHFA 2YOGA 3GPLA 2WG0A 2P3OA 3ROMA 1H2WA 1Q0PA 4N3NA 3LBHA 5B2ZA 1EYZA 5FIUA 4BU0A 3KE8A 4HX9A 3NGXA 1U9YA 3K1JA 2FPMA 4CM9A 3JWIA 2DZDA 4I1PA 2F8TA 3RK4A 5CEEA 3HM9A 6GPBA 1OOEA 1I4WA 2GF9A 2W6NA 1JFFB 5G0VA 4AG6A 4TYWA 4P38A 3M5CA 1D4FA 1GZ3A 2WG1A 1PN3A 5COAA 1O89A 4ZIRA 4OHZA 4LOKA 2NZWA 3N2ZB 2DLCX 4MGEA 1SBTA 2GHIA 1A95A 1GZ5A 4M9SA 1FYXA 5JH7F 5CD1A 2HYIC 2Y1KA 1DXYA 3AR9A 4ZC8A 3GN1A 4FBGA 1KYQA 2P6NA 2VYQA 2XNDD 3K9QO 4KPEC 4J4BA 3N2KA 4EP1A 3OC6A 4HFJA 5FPQA 4R9UC 2VJYA 3EVGA 3FSGD 4J0QA 4C0WA 1PVDA 2ORVA 5DHTA 4QOEA 4ZI2A 3N7UA 4DIUA 1P7CA 3DCIA 2XDYA 1HEIA 4A8PA 2Y0DA 3CQ9A 2OZPA 3ENVA 3V3KA 2DWCA 1SPXA 4D4IA 4W9NA 1YI1A 2HMSA 1OYOA 3G8CA 3OEEA 4FCCA 4GNKA 3OQBA 1MNQA 3MSCA 3HUDA 5CUQA 3JQGA 4J8PA 4K2AA 1BXZA 4QXAA 1ESEA 3UAOA 3RE1A 2POQX 4EJMA 2OC4A 4FQ7A 2CHVA 2XQGA 4J7UA 3ZGNA 2HQBA 3RVPA 1DAPA 2X40A 2QVBA 3HDQA 2WWRA 3RREA 4RL6A 1IJBA 5AK4A 5JAHA 1J00A 1UAGA 4NBUA 3OOJA 4PTYA 3SSAA 5ALRA 5HG0A 4B79A 1CY2A 1QOZA 3O3CA 5JSFA 2DPMA 2CMKA 2BGUA 3DE5X 1C8KA 1YE3A 3KB6A 3UH0A 1M2NA 4Z7OB 5C32A 2IP2A 2PV7A 3DE6X 1I30A 1SU6A 4IUYA 3JQPA 1JJAA 4I4TF 4KN9S 3RODA 4A26A 1NX6A 1CRLA 4YAKA 4TWRA 3GGOA 3N8HA 3NRBA 1Q0RA 5CVVA 3LZ6A 4OKSA 1PWEA 3OESA 3ZLBA 1UJ6A 4BV9A 4RHYA 5J23A 5HNKA 1L4LA 1P3Y1 2JCGA 2QX8A 3LHKA 2O05A 1VIVA 4GC9A 3KAQA 5BSVA 1R9GA 4BMCA 4RADA 1H4VB 2Z8YM 3RRFA 5CYPA 1ZG3A 4UD6A 3H99A 5JNUA 2C9DA 1ZD4A 1K86A 3DF9A 4BJHB 4EHFA 2IZ5A 4GX1A 2Z5LA 4NG5A 4TLAA 2V97A 3MJ4A 1JLKA 4ESOA 4X8OA 1GCOA 1G8GA 2WM8A 4DZRA 3I9NA 3V4RA 1GPJA 3GQBB 1GADO 1KFBB 3ZC3A 1SA0B 3LUKA 3QLTA 4JT2A 1IQUA 3X3HA 1E6WA 2UYCA 4F4IA 4D42A 1NLUA 2BM8A 1XJQA 1E92A 2Y1XA 4LXQA 3K8ZA 1NOJA 4GX2A 1UZUA 3A0UA 3GNTA 4YT2A 5CB0A 1A98A 5EGNA 5J2TB 2ESRA 3UCFA 1L7XA 1P73A 3LT5A 4XVUA 5J4VA 1PK8A 1MAWA 1KEVA 4I08A 2IY8A 4DKJA 4RZUA 3JV7A 1AHHA 3H1FA 4TLMB 5GADl 1E2QA 4BBJA 1E9EA 3OO1A 4EJ6A 2QRLA 3A9TA 3VVBA 3COVA 3UFXB 4YO8A 1EB9A 4GNRA 1J99A 4JSTA 3R8CA 1E2JA 3ECAA 4EF4A 1I4TD 3V1NA 1FDRA 2QLFA 3OZDA 1JQEA 4PS1A 3VV3A 1IDOA 5EAIA 3RABA 4XE5A 4PG7A 1GAEO 2GKOA 3E3NA 1C4WA 4BTEA 1UM9B 5HUQA 3DCJA 4HRVA 4BLPA 2ZJ0A 4US2R 1SU8A 1K3TA 4EEZA 1YQXA 4L6CA 1E1QD 3F67A 1FTYA 3K72B 1I80A 4KQ1A 5EYPA 5KB3A 1XP5A 4OI1A 1KFKB 1BNCA 2MU1A 4LFBB 4C03A 3OZEA 1ATIA 1C3XA 4DLYA 4I9HA 1ECFA 3M2TA 4N01A 1DSSG 2IL1A 4F97A 1KH2A 1OYYA 4RSHA 1WDMA 1HNWB 2EP8A 1U0HC 3OF5A 4PXAA 4FQ5A 1O96A 3MAJA 1NFFA 3RYFB 3ZIDA 1DQSA 1UH5A 2WWTA 2A1TR 5FLKA 2H2HA 3NB0A 2DQSA 3AR7A 3NM4A 2CDBA 5IYZF 3T99A 2L17A 3E18A 3NTOA 4IRMA 4CKEB 4CTNA 3IAM1 3BWCA 3O83A 4HWKA 2O3RA 3ESCA 3TI7A 1BAPA 5UKDA 1RRFA 3H75A 2ZAGA 3AUYA 3IUNA 4WASA 1HE4A 2XI4A 4WJKB 3NBXX 4ND3A 2YV1A 1ODJA 1TJPB 4L6IA 3DLHA 2Y66A 5CDGA 2FZWA 1M3SA 3U16A 3ICQB 2QN6A 2ZCJA 2V3VA 5INTA 1Z6PA 2AK3A 4LGMA 2IHZA 1KI1A 2REQB 3DB1A 1L4FA 3BMQB 2RSLA 5P8WA 3UB3A 3VDMA 3KETA 1LVGA 2H7YA 1DG3A 1W30A 1D03A 1ZXLA 2O0HA 3C87A 3FHJA 2FYTA 4YRDA 4B4DA 3OSUA 4QOGA 2Q4TA 1B15A 2QVXX 2R68A 3MBOA 1SXJC 2BZSA 4ETWA 3DPUA 3QVKA 3VC1A 1T3TA 5D3ZA 5K6AC 2BMFA 6LDHA 1HQYE 3AIMA 4DA9A 1J1IA 4C4OA 3QKSB 1KJ9A 4R2KA 3RS7A 3K70B 1SXJB 3NIGB 4GSLA 4UVGA 4L5BA 3T0FA 3K8QA 1U5BA 2QP9X 1L5GB 2RGBA 2VK2A 5KCMA 1EUYA 5TMBA 2F3PA 1AURA 1X7WA 1XZIA 4NZYA 5I7UA 4RD0A 1FZQA 4D25A 3HBJA 1Z22A 4J16C 4TRJA 2XEDA 4IQGA 3EFBA 1E1CA 1VBFA 3CZRA 1EZ4A 3COPA 6CHYA 3WWOA 3JWJA 1ZL0A 1BFUA 5DIFA 3GMIA 4PU0A 4YP9A 2PXAA 2VJOA 4UAVA 4F3KA 2WD8A 3H04A 3DLTA 4N6GA 4TLBA 1T4DA 2C5HA 2XB6A 3PEUA 3QX9A 2H59A 1S9HA 1JKJB 2C03A 4ZCMA 3WWDA 1D4AA 3VKUA 3WFZA 5LLTA 2Y3IA 5CVCA 5KHOC 4IL5A 4KFUA 3QF7A 3QYAA 1B8VA 5KQLA 3QXHA 2WJVA 3O4HA 1YL5A 4H3SA 2BGWA 4TVSA 5DBIA 5A3RA 3TN7A 2AFRA 4ZVRA 2J0UB 4N7JA 3UJBA 3LV8A 1BMTA 2IP1A 3C0KA 5TEWA 1IMOA 3UK6A 4BVGA 1SG9A 4F6RB 2KW5A 3HGQA 5LQAA 1Q1NA 2Y93A 1F2VA 2YZNA 5JSZA 5AVKA 2QL9A 4QU8A 1PG5A 1D5WA 2TSYB 4MUGA 4UE3S 5EFZA 2E18A 4KLZA 3WQQA 4BFLA 1H3FA 3W8DA 1F8YA 4ARBA 1U8ZA 2D1YA 2FRDC 1J8VA 1KE1A 4IG9A 1CUXA 3KQHA 1JVBA 3HNRA 4CETA 1DUIA 4PAQA 3H5TA 2HYDA 4MGHA 3FHLA 3TNJA 1XMSA 3ZLTA 3FPGA 1IN6A 4C08A 3IT3A 4EMTA 1FTGA 2Z09A 4IIUA 1Z8FA 4KYIB 5EIBD 3EIUA 3DE4X 4JN6B 3MWKA 4L15A 2ZI6A 3GELA 3TRKA 2C3PA 4B32A 3QTTA 3GLUA 3H4TA 1MT3A 2F2TA 4QPPA 1ABBA 3UG7A 3U5ZB 3WIVA 3AVWA 4NU0A 1P2SA 2OMKA 4BO4A 3D8BA 6PFKA 1Z68A 1YZ3A 2QRZA 1N6HA 1TVMA 1XQ9A 3Q5GA 5CDFA 1N77A 1P3DA 1GYPA 1MR3F 1UIRA 1FP4B 1W5FA 1Z4IA 1ZJ6A 3L40A 4HAVA 4P58A 4F6LA 1Y7PA 3O8RA 2ROQA 1ZC4A 3ANXA 1VE9A 3MAGA 4BLQA 1FTSA 4GBED 4DQ0A 1ORVA 2PSDA 1RPTA 2RBGA 4YYZA 3R7BA 4CIXA 1EWVA 2AMLA 3F97A 2Q62A 2ZAYA 4LVUA 2VPWA 3LNCA 4LF5B 4HXFB 5JAUA 3BOSA 1BMDA 4MGYR 4DLWA 3QA9A 2RI6A 4TV8A 2O6HA 1AQYA 4I14A 1BHSA 1W34A 2H48A 1E3DA 2BFCB 2VLBA 1T29A 4I5GA 3LHFA 3BD7A 4YRRA 4ZANA 1JPUA 4ISCA 5REQB 3WGZA 2J41A 4BYMA 5EVCA 3V7WA 4MZDA 3DKRA 1Q7RA 2WNSA 5C34B 2VHEA 3KDSE 1JSXA 1QYXA 1S2NA 1E7QA 2GZHA 3NONA 2YHAA 2HGSA 4JCOA 4MIEA 1T8TA 3CLVA 3W06A 4DRZA 4JLOA 4NCAA 4PSDA 2Z98A 5NULA 3Q4GA 5JAIA 2W8BA 1MGPA 1US8B 4D9GA 4YMVA 1CV2A 1KO7A 3FPCA 3EZGA 2BEJA 4IHAA 4P6VF 4OHOA 3LL4A 5AHXA 3E35A 1IM5A 2WIFA 5ALKA 1U04A 5E6SB 2H9YA 2UUBB 1NN1A 3CLKA 4IMIB 1V6AA 2ZRCA 3P2EA 4ESHA 2BYTA 5ALFA 3JYLA 1M1NB 4FQ8A 4EBBA 2AN9A 1OFIA 1I4EB 2O0JA 2E4UA 1T0PA 2O3QA 3L7NA 4CG0A 1TIPA 2PT9A 2OSVA 1P0IA 2VUHB 3FUVA 3VR4H 3X44A 4BXOB 3DZJA 3BIFA 5C8YB 1U8EA 1AS2A 1XNQB 2EFCB 4GOJA 2C31A 2CUZA 3HA7A 3UM9A 3WKCA 4ZCIA 1C9JA 4TMZA 1CULC 2HADA 5CITA 1WPQA 3LJKA 5AIAA 5B64A 4YRKA 1G2OA 1E2IA 4QEZA 2HA5A 1RC8A 4Q03A 2YW9A 3OPYI 1GTRA 3O1HB 3WYEA 5H8WA 1M2FA 1G5FA 1NULA 2K2WA 3DL2A 2UXDB 3D8HA 1QK4A 3WYFA 2R8XA 2YBDA 1D6MA 4I8IA 4OX9Y 5BQFA 3VC7A 2H0QA 4CIAA 3AM4A 1V6CA 1X7YB 4EY6A 1Z6TA 1UINA 4HB3A 2ECPA 1Q92A 1UANA 2HQOA 3WWCA 5LU9A 2VP3A 5EXEA 3L6RA 1YA4A 3IO5A 1SUSA 4LYDA 4NBKA 3LUBA 4NJEA 2VHCA 2ZUUA 3E1KA 3SYMA 5IFKA 3KM0A 1NMXA 1TCCA 3C8MA 5EVJA 4B17A 3Q1LA 5FBWB 4GUAA 2QBYB 5J4HA 4EB6B 2I6GA 2YVKA 2JGEA 3RRBA 5A3QA 1VA5A 4BB6A 2HCJB 4ZU1X 4H1HA 4V0OA 2LKDA 4Z0TA 1P17A 1XLWA 2DT8A 3UJAA 1M76A 3KFVA 5HEKA 1M1YB 2OYCA 5KS2A 3N39C 1Z28A 2WLTA 4PCAA 2H8KA 5G4KA 5FBRB 1Q16A 2DP4E 1G7SA 1UIMA 3WNZA 4DLNA 5BSEA 4GGMX 1N8KA 4X1IA 3RARA 2Y4OA 2ZSEA 4ZICA 3UH1A 5HKAA 1XZNA 4FYWA 4MJLA 4ZHQA 3GEEA 1K7EB 1FLNA 1UQUA 1XVLA 1H85A 2N47A 2XHEA 4G07A 5IPFA 1X14A 6ABPA 3LNTA 3ZV4A 3IPYA 2AMYA 3E8MA 4L08A 4QQRA 4C89A 1JDBB 4H0FA 2FOLA 4DC1A 1EFCA 4PX3A 5DISB 1FFDA 1Z2AA 3THYB 1R6UA 4FHCA 4HH3C 1GY8A 4IM7A 4KZKA 3ZW7A 4F96A 1OHHA 3PDWA 4B6RA 4E15A 1PF7E 1VYHA 3DDHA 2Z57A 3E3MA 2CB0A 5FWYB 4RVHA 1Z33A 2V65A 4DJ5X 3CV3A 3L6OO 3M82A 2ZU0C 2PQ6A 1PZGA 1UMCB 1DJMA 3BMQA 4I9NA 2JLYA 3CH7A 5A04A 4BV8A 2AFIE 2YKGA 1LPSA 3CFYA 3E1SA 4DJJA 2VO1A 3HRIA 2R60A 3JARB 3WLPA 3EXHC 5JZSA 5CVJA 3BL8A 1P0CA 3ZGZA 4FD3A 4OD0A 3F4LA 4WN9B 2AB0A 5IBRA 2I9KA 3M4NA 4O2BB 3IP5A 2I3AA 4FVTA 1DRKA 4U9IS 5FQNA 3BWEA 4C5CA 1NF2A 4R6WA 3GFVA 1ZJ5A 5K8IA 2XXAA 4DWJA 3WRYC 1OB5A 4CCWA 4R05A 3M6MD 5D00A 5HGXA 2CXUA 4IDGA 2GN9A 4LYYA 5KKAA 1QK5A 4OM8A 5D8DA 3KKQA 4MWTA 4YCAA 4LMRA 1KOGA 1LQUA 3R5TA 1QQ5A 2ZYTX 2OT3B 2FSGA 4UU1A 2A2ZA 4QYXA 1EE1A 3RI3A 2K5UA 2YIMA 1XQXA 5CRIA 2NZ8A 1X80B 2Q7OE 4LJ6A 5TLSA 1P9WA 3RAJA 1ZUD1 4IIJF 3LUDA 4H27A 3LCCA 4AQYB 1AG9A 1CJSA 3FKSD 4PPNA 4ANFA 1GCIA 2OQIA 4Y98A 2YRFA 1JAIA 2FEXA 1XZFA 2G77B 1ISPA 1QKJA 3ONDA 5BNFA 5TF0A 4QLBA 4OL9A 3UYKA 6NULA 3ENKA 2YHUA 3KD2A 3R3YA 3NUGA 5A4IS 2I4IA 1E6MA 2EU8A 1E32A 2GBGA 3DEIA 4O4IB 1HQDA 1QLHA 1V0JA 1XVUA 2EZ4A 4NNJA 3STWA 3WK8A 3ZE8A 3JAWA 3NTLA 4K0RA 3VHQA 3KQPA 5EL0A 1JQ3A 3VZDA 2X3UA 3L9WA 5F35A 4GECA 1BD4A 2P4QA 2PX5A 2DY0A 4YDHB 5JFOA 4GMFA 2B8TA 2BGNA 3HEBA 2BI8A 2AWNA 3O93A 4TQAA 5AXDA 521PA 1ZCJA 3REQA 1N3BA 1TAUA 3EGXB 5JMPA 2X0IA 3CF2A 1IHUA 2GM9A 1EBBA 3MT0A 3SX2A 2NNWB 3LIIA 4TV9A 3FSGA 1NONA 1XCPA 2ZETA 1Y9EA 1B4DA 1H5UA 1E9AA 1L7AA 3F98A 3H11B 3K8YA 4D8XA 4S0ZA 4AU1A 1N7JA 1LLCA 3A4IA 3BF8A 3GN2A 1PJ3A 2XMSA 4MVJF 5ALJA 3U4CA 2GASA 5IMBA 4DA8A 2HR1A 2KPOA 2X22A 1L4UA 1YBMA 4R9VA 2WJWA 4KRXA 2NO1A 5THKA 4A5SA 4QFMA 4K9OA 1L5KA 3TH5A 3VU9A 4HEQA 1HI9A 4FHZA 3T3HA 3NBFA 4F04A 2OCGA 2JIDA 4L16A 4NBTA 5A4JA 2C58A 2CNDA 2EV9A 1NW3A 3BRWA 3LPCA 3QI2A 3MTJA 2A58A 2ISSD 4RAQA 5EJ5A 2QN7A 3C3KA 4I55F 2VYND 3BX1A 4P92A 4HWOA 3S8MA 3BXEA 1UT6A 3U9LA 1UFOA 2RHLA 4FM9A 1ZK2A 3CRRA 3J81A 4RPIA 4TGLA 1IB0A 4MIKA 5BW4A 3WZLA 3VNSA 1JE0A 4AY6A 2WE7A 2OB2A 3N28A 3D59A 4EFMA 2JKZA 4F11A 3EY4A 5BQ5A 2XUAA 1ZIXA 1QE5A 1IOVA 3KWLA 2CSXA 4QUIA 4RV9A 5A6VA 3SBDA 1Z45A 3TD9A 4CF4A 3QE9Y 1GV1A 5EP3A 5TXGA 2YJ4A 1SBHA 2CBXA 1NXVA 4NYIR 2WA2A 5M5BA 4J6FA 1CDEA 3EVFA 3RHFA 1AO0A 1XMQB 2GPNA 2G9QA 3H5RA 3K9CA 4OYRA 2ASVA 1EZ1A 5JSUA 3KOUA 3GUYA 4REMA 3HB7A 4RW0A 4RCYA 1Y8QA 2CY0A 1SIWA 1J9GA 2P2SA 3AI3A 5GAJA 2VWPA 2FQXA 2BISA 5E6UA 2I62A 2W6CX 1VDMA 3WWEA 5JQGB 3CBGA 3DZHA 4Z5XA 1FEZA 4MPRA 5JSQA 3ZI0A 3SE0A 3LOQA 4DMHA 1LW7A 1K7CA 3ELYA 3OZ7A 4X1IB 1C0LA 4Q1VA 2GYYA 3MCWA 2Z6AA 3ZHOA 3F6CA 3WHLA 5B1SA 2AQ8A 2Q5CA 1X8JA 2B69A 2FU5C 4BZXA 3O8CA 3NS7A 5C51B 1RWWA 1UJMA 3IMEA 4K0KB 1SPBS 3CIFA 1JQAA 5HR5A 4OP2A 1JT9A 1RJ9B 3RB8A 4QAQA 2E0IA 3E0XA 4BKPA 1QLJA 5IK2A 4IV0A 3KP1A 4ER0A 2VPQA 4Q7KA 2YJGA 4KQWA 1KSFX 1RFLA 5DASA 3E3AA 1SKYB 2WHQA 1QC5A 4CM5A 3OZRA 4UXIA 2VNIA 5K0GA 2G06A 2GA8A 1I9GA 1T0BA 3M81A 5H3LA 3GFRA 4A0HA 3S1SA 3F71A 1AS3A 3GDWA 8ADHA 4G0UA 3MWLA 2QQGA 3HVKA 4Q0MA 5DCYA 3B20A 3VM6A 4QPCA 3VSDA 2OM2A 3C4VA 1H66A 1XPUA 4ZARA 1WIWA 4U2CA 1MEEA 2H63A 2VDWB 3EYAA 3OJCA 3QE4A 4IQ8A 4XIGS 5KUTA 3UZUA 1IN4A 1YIAA 4BVEA 2EX4A 1HE3A 1T1EA 3HB1A 5DWVA 3EH2A 3QYJA 5ED0A 5DHSA 3EVEA 1GZVA 2QTNA 4CKWA 2P91A 2R97A 1KAEA 1M6VB 4H1UA 3H4VA 1AOXA 3TSWA 1KJYA 3VKVA 2PUJA 3NTQA 1EIWA 2ZIFA 3T6KA 3GRRA 3A3KA 4QGGA 2Q3JA 1IQ0A 1N0UA 4GVXA 1JNYA 3WNCA 5LIPA 4LAFA 2GLUA 4GPTA 5G53C 5CM8B 3RD5A 5AVZA 1N78A 3D4LA 2DFNA 2K7ZA 3LU1A 5HF6A 3C4JA 4FYXA 1KYZA 4L8YA 3AHIA 5CLQA 3B85A 5EPOA 2E55A 2QQEA 2CV1A 1EK0A 3C3XA 3OO0A 2P7HA 4NCIA 5CHEA 3RSFA 3CRMA 3VH1A 1WQ1R 3GEMA 5D5QA 3SI7A 1N2BA 3D6VA 3O3MB 3WLQA 1TT5A 4XPIA 3J7AC 4O4IA 4FZ3A 2EQBA 1AKWA 1B74A 1QANA 3KLNA 3CLSD 1ODSA 4GQIA 4WFQA 1Y42X 4Y9RA 3KVOA 3ZI4A 4MKIA 3ZWAA 1BMFA 2OFFA 1IAQA 4BLSA 3I2JA 4YUVA 4JR0A 3SD7A 3SFVA 2N46A 3OZXA 5A02A 2I2AA 3IX7A 4LDRA 3UT5B 4G25A 1XF9A 4XDGA 4EF6A 3ES9A 5B3JC 2PV0A 3ZE9A 3ZUGA 2JFFA 1SJ9A 2R86A 2V4ZA 3DFMA 3OETA 4UHJA 1BKDR 1X38A 4Y6GB 3ADBA 3WA7A 2X7JA 4D9KA 2FSPA 4M1OA 1F7VA 1IEXA 1C3LA 1OA1A 1TZMA 1J49A 1E96A 4JOSA 4YPOA 4JYZA 3N2IA 4G0MA 1EDBA 2FQQA 3MFYA 5D1HA 4ESEA 4S3MA 5L45A 2G0TA 3T12A 4E31A 2DUUA 4BRUA 3UY4A 5FOUA 2PGIA 4G37A 3FMOB 4MW0A 1NM5C 1AUQA 3EAQA 1YQDA 4Y67A 3R7WB 1Z7EA 2PUEA 1W36D 3W2FA 2QJFA 1C0IA 1XRRA 1E2PA 2A94A 2GJSA 1MX5A 3GVHA 3I8OA 4M36A 3FMPB 5ECWA 1C0PA 4RD3A 1D5CA 5EHXA 5D3QA 4GI7A 4NOLA 2Z8XA 5CA1B 3SF8A 4QYIB 2YZKA 3G49A 1GFIA 1TI7A 4LHWA 4V02A 1JJBA 3BEOA 4UMDA 2B1GA 2QX9A 4FJ2A 1JA9A 3W6ZA 3VSAA 4EFNA 4ZCTA 4CKXA 3KELA 3FG9A 3WIBA 2FJPA 1C7JA 2AHOA 4B09A 3BEDA 4FYIA 4FDVA 4DLXA 5EQJB 3ESDA 3KAPA 3V00A 2IY9A 2NPOA 2OHXA 4D4JA 1Q1ZA 4YO7A 2HCTA 5BW6B 2VF7A 3VR3A 3NIWA 1WXGA 1ICIA 1Z2NX 1CB7A 3N7TA 1DDGA 4X90A 4L27A 5DIZA 4ETNA 1FFAA 3G5TA 4EJSC 1N0WA 3MG9A 4A3SA 3K5IA 4LWQA 2O3SA 1QHNA 1JYSA 1OZFA 1SG0A 4TLDA 4C43A 3GJ3A 2B30A 2WWIA 1YULA 2P3LA 3SQWA 1LPMA 4KUGA 3PNYA 3JSXA 4L28A 3MHTA 1XTPA 1Z3CA 3GRVA 4DMKA 2PH1A 3TFWA 4TRNA 4BV2A 4H59A 2X13A 3S2SA 4DLUA 1N2CE 4HDRA 3DB2A 4ER5A 2Q41A 2Z30A 3ICPA 4E7PA 4EUKA 1WOYA 3V80A 3BMCB 2B7LA 2V7WA 2P41A 4B0OA 4PV7A 2QMHA 3U6KA 2WVAA 3BRCA 3WP1B 2PPLA 1GHTA 4TM7A 2G4LA 4CFZA 1J22A 1KRHA 1UFQA 2FQYA 3B70A 4LCEA 2RK4A 3QELB 2XKAA 4QBIA 3SYLA 3LQQA 1Q7GA 1VYVA 4IVPA 4KK4A 4XVCA 3KO8A 4LY9A 3GGDA 4AY3A 3NKFA 3DL7A 3QYPA 4JITA 5BSMA 4ZO4A 4D9CA 1SURA 3EZ9A 3AY0A 2XBLA 1XKLA 3K05A 1B3BA 3PS9A 1SM4A 3PC4A 3QLEA 2JAOA 4CV0A 2P6OA 3OJLA 1GAXA 1R8QA 3E05A 2OFWA 3PGJA 4GLBA 1J4AA 3BZWA 2OSBA 3UMYA 4INAA 3CCBA 2DQZA 1EDDA 3DTTA 2WF5A 3OLZA 1Z08A 2H00A 5BN5B 4KFCA 1XRMA 3LLUA 4YRBA 1X1SA 2ACVA 1W4RA 3NQ41 4LI3X 4OPMA 5BRJA 4GKKB 4WZAE 2OO5A 3RTAA 1MPTA 3OWHA 1GPUA 2HA7A 4KPUA 2PZAA 4OI2A 4ER6A 5ER6A 5K4AA 1UXJA 4HN4B 4R2LA 5C8ZA 4ZVSA 2PVSA 4ZYYA 1CBUA 4NTZA 1RP7A 4OJYA 1TF5A 1CUFA 5HQJA 2V8OA 3RUAA 3UHPA 3U6BA 3U26A 1S8FA 3QPCA 2BGJA 1DTSA 3N70A 4IKPA 3C8ZA 4TTPA 1NUUA 2FKNA 1N1EA 4HQ6A 4QUGA 3SJCA 3VR6A 1C7RA 1FXWA 2OESA 2ZTUA 4KE7A 2CXTA 5MF6A 5HE9A 3LT0A 5AK0A 5FD8A 4GM1A 1Q1AA 4BQPA 1PSWA 4LRTB 4IZIA 1JDSA 1WZIA 1X3SA 1WTAA 1ZD1A 2FHPA 2JW5A 3MBIA 1YS1X 2IZ7A 3O4IA 3SXJA 5CT6A 3GLHA 9LDBA 3PJRA 3F3MA 1T5HX 3NJ8A 1GT6A 2PM8A 3IMGA 4YIHA 2AOWA 4KR6A 2JLQA 1KJQA 4HN2A 1I1NA 3TPCA 3DOJA 2XD9A 2EIHA 2F1RA 2AN4A 3DO8A 1Z2CA 3LLSA 4HHEA 4WFKA 2NVUB 2F4VB 1P1JA 2X8WA 5EIBC 2GHQA 3MERA 5BV8A 1YR8A 1ULHA 4CMBA 1IXRC 3CA8A 5CURA 2O5CA 3QKUA 1PJZA 3A28A 4E2YA 4P22A 4ALNA 4BQRA 5ABPA 4XRRA 1ZN8A 2YNMC 3AR5A 3FD8A 4TZ6A 2OK7A 3FCAA 2ZYGA 1L4MA 3EOBI 1ZMXA 1YFKA 3JD3A 4QPNA 4RDIA 5E2AA 4JSYA 2AJCA 2HUNA 4LZNA 1B3RA 3G5MA 1XIVA 3MINB 5I47A 3FMGA 4D3ZA 1KI6A 1NW4A 3HM2A 2KQUA 4JROA 1YQQA 5HXAA 4XB1A 5ALLA 3VKFA 1ZVQA 4X93A 4PXSA 1SC4A 4WDQA 4N3AA 1ZAYA 1KARA 3WGJA 1N6PA 3HZRA 4QHTA 3PFFA 4HEA1 3N87A 4RK5A 5M04A 3ZGXA 3KQSA 4X7PA 4NENA 2WYOA 4YRMA 1J90A 3ADOA 4CCAA 4MW4A 5DTEA 2Z5GA 4BNUA 2EFHB 1LWNA 3CW9A 3OZGA 5CFQA 2IPNA 1LLDA 1RMQA 2GEJA 2Q1SA 2RH4A 3AR6A 3JRNA 4LXHA 5TE9A 4Z2AA 2ZVDA 3KS9A 3ZWPA 2KBFA 3DZFA 1VLQA 4PBSA 2R4UA 1J8FA 4TSRA 3HDVA 2CT8A 1EUCB 1K08A 5A3VA 1XNRB 2BKXA 2NIPA 3IBSA 2ZULA 4YCNA 1IN1A 3BC1A 5E7JA 1C7FA 1X7ZB 5FTWA 4U5XA 2UUAB 2IYSA 2GK4A 2ZSFA 3KQYA 1QHSA 2V9CA 3GAAA 3O2NA 3RVJA 1QIDA 3CGWA 3SQMA 3ZXYA 4DCOA 4ZJUA 5HUHA 4GE0A 4ODIA 4DQLA 3LHIA 3TMYA 4F7DA 2YDXA 1YKFA 3VH4A 2G82A 2E7ZA 4KYTA 4UNNA 1QK3A 1E89A 2I6SA 3FUWA 4DABA 2Q5OA 2BSQA 1P5RA 1X1EA 3QLUC 5EWJA 5FA6A 1CEYA 1Y9JA 1ZLXA 5HF8A 3GGPA 3I1JA 5J1TB 3GNSA 5DBFA 3I28A 2XGGA 1F48A 4IINA 1MHPA 2WQ7A 2NUPA 3NP9A 1B42A 1CR4A 1BS2A 3B6MA 2PZKA 2J31A 3C6ZA 3QUBA 1G7TA 2YN4A 1VL5A 3H3XA 3ZBPA 1FTQA 2VR1A 4Z9FA 3WTBA 1WF6A 1K98A 3MRVA 3ZH2A 4ZK6A 5U9CA 2XXAB 1FTWA 2W2NA 1P2VA 5TVKA 2GPYA 4FYVA 2W6IA 1GPAA 4NMMA 4R84A 5JBQA 2DT5A 2GFQA 2JH3A 3MGBA 2C8KA 1YVUA 4RTRA 1SHUX 4MCIA 4Q18A 1BKSB 2VHYA 2X5XA 2ZCVA 5G1NA 2JEYA 1PKXA 2LIVA 2Z4SA 3PA6A 4JODA 3VBEA 1M0SA 3CW8X 2G25A 1GCAA 3KJZA 2JBAA 3RSZA 2E9SA 2YWGA 2HPAA 5BSKA 1V11A 3MJHA 1X9HA 4CTKA 2FDCA 1WXEA 3OLWA 2EIXA 4ZMBA 1JAXA 4WK2B 2B61A 3EGWA 3GBPA 5SZHB 2PS9A 4P0PB 1DCFA 1O9GA 1KFCB 3LZCA 5DN6A 2WTMA 3QITA 3WA6A 2OY0A 4DQUA 1MDBA 4PPQA 3WYGA 1C9EA 1YK0A 2WOOA 1GITA 3F1KA 4X95A 4AIRA 4AQDA 4DEXA 2NP6A 3OZAA 2OM6A 2YYAA 3D3KA 3TTUA 1EHCA 4Q7LA 1KI6B 1VJRA 3A10A 4I3FA 3EJ6A 1FSSA 4B46A 1FYFA 2PDAA 4J3JA 3ZY3A 1QKKA 1S1CA 1YONA 2X7HA 1E3TA 1KNXA 2J3EA 4QRIA 5I9TA 1PE0A 3U62A 4C6TB 2EQ5A 2FSHA 1YR9A 4TROA 4OB8A 3JTEA 4AXBA 3WQSB 5JTTA 4OQFA 1H9AA 5C5DA 1FJ2A 3JYQA 4NY1A 4YRAA 1NW8A 3GOQA 1QR6A 2ZYWX 1X1QA 3BUSA 2B35A 4RABA 5AHWA 1VJ0A 3DMDA 3OBIA 1RSZA 2IHVA 1GZSA 1PR3A 4CHGA 2IU4A 4BO6A 1QU3A 2QM7A 3IIMA 3RS8A 1Y8ZA 5AYVA 1T3LA 1T4BA 1UK9A 2WFLB 2FB9A 2BGGA 3J7TA 3IEPA 2CL6X 3S28A 2AE1A 3C5VA 4LY3A 4O33A 4ILKA 5FNZA 1V1RB 2YWCA 5CA0F 1WBDA 1U0FA 5C4MA 3PWTA 3SS8A 1JH9A 1ZXBA 4P7FA 4F8JA 2FOXA 3CSUA 4KFTA 2WTEA 4NCNA 3SQOA 4YT5A 2RHCA 2ZB8A 3AY3A 3KZKA 1OGIA 2JAXA 4P08A 2C5AA 3UWDA 4BZZA 3ZGYA 1C1XA 1ENYA 1PS9A 2QIOA 2Q6TA 4IDHA 4B0PA 3OPXA 1BVUA 1XR3A 4OP1A 1L5FA 2HWUA 1D2HA 3PICA 3SU8A 3EGCA 3I5MA 1Y1PA 2EJCA 2JC3A 4G0ZA 4BGIA 2EX1A 4C7KA 3U1TA 4LCBA 3AI1A 4UDNA 4BVBA 5B6PA 3ZHXA 3NUZA 1KVSA 1Y98A 2Z5VA 1CZOA 4B1FA 3O8LA 4XDYA 2QAGA 1ZK4A 5AHOA 4BNDA 16PKA 2Z04A 4DQXA 5CB4F 1MX3A 3MCUA 4F2PA 2NYAA 1IBLB 2WA1A 2Q7XA 4RBNA 2PTGA 4RTNA 1BX0A 1P62B 1G5QA 5BYKA 3EPJA 3MVEA 4OCZA 2IIQA 4LHSA 2RAUA 3QV2A 4AZ3A 1SMKA 2FZVA 4I5EA 4K9LA 3SC6A 1MC8A 4GZ3A 1S2OA 2DFPA 4E7OA 3SZ3A 3M70A 2RBKA 1Q14A 2GJKA 1NVFA 1F0PA 1ACLA 2X2FA 3IGFA 4QASA 1PX2A 4ZXFA 2ZSIA 3NV7A 3Q5DA 4X8LA 3EIOA 4E5YA 5IXYA 5ALWA 1JEQB 5ALMA 2JCVA 2HO5A 4QUHA 4ALKA 3TNDA 3BG5A 4ZVOA 1G3RA 3K35A 2GO7A 3KC2A 5IZCA 3HZZA 3HKDB 1Y6JA 4JI3B 1LSJA 2XYPA 1LRLA 2I3BA 1LD3A 3ZR4B 4E33A 4EELA 3FDZA 4H7IA 1QBKC 3VDQA 4XUCA 4EYQA 4CLXA 1A7JA 4JP3A 3T5GA 3ZNQA 1HZZC 2C0CA 4AYTA 2WYUA 4B2LA 1ACJA 4PCUA 3OTQA 4UTXA 3DEKA 4KDCA 4MUAA 5C8XA 4MR8A 3P5BA 3F3KA 5K3EA 5KCZA 2RK3A 4DJFC 1QS0B 4QPDA 1DL5A 1UDWA 3N3BC 2HXYA 4R2MA 2GN4A 4W7IA 4ZYVA 1CRWG 1R5BA 5GINE 4YMWA 1R6XA 4JBWA 1XYVA 4OHKA 2ALJA 2DR3A 4TL9A 1LQTA 2XT6A 4QTXA 5LB4A 4DEYA 4I66A 5KVAA 1NMSA 5FR1A 4H3VA 1EE9A 2J8ZA 3EOAI 3GHYA 4ZDWA 1TEVA 3P96A 3NWPA 3TOXA 4CNQA 2X3FA 1GAWA 4ZEVA 4BNXA 4GYKA 4PIPA 4ABYA 4Q9LA 1ID8A 1KETA 3QW2A 5BORA 2NU9A 1SGWA 2B9EA 2G63A 2GRUA 4TLCA 4DIFA 4XWYA 1PX0A 1V5IA 4V1CB 3LBIA 3O3OB 4P3KA 2VLIA 3ZHUA 3O2SB 3DOEA 1TNDA 4L9AA 4M83A 3K09A 4KTTE 4KPGA 2X9GA 3DZ8A 2RAPA 1P77A 1DCKA 3HEMA 4PR3A 1HYHA 3U61B 5DLYA 3OF2A 2C4HA 3SX4A 2LIPA 1YA6A 3JQ8A 1AB6A 2A7QA 5B2EA 3K09C 2I87A 4UAGA 5AJZA 3RFXA 5T4HA 1I14A 3GLSA 5FHQA 1VPWA 3GW8A 3WXBA 4KRFA 3G9QA 3MCTA 1FYDA 4X84A 5FTLA 4OK5A 3L8FA 4KIWA 2OCIA 2XSZD 1KP2A 3UK0A 1SVWA 3B9RA 1T6ZA 3CWZA 3RTGA 4Z4EA 1WCIB 1Y33E 1GQQA 2A5DA 2P4SA 1KKMA 4R9NA 1T25A 4I3HA 1QQTA 1Z4OA 3KOWA 3WRYA 4MQLA 1RQRA 1YWGO 3JQCA 1TAHA 2WE8A 3ER9A 4UASA 3TM4A 2X0EA 1N5MA 4LOHA 5DTJA 6ADHA 3QJGA 4HLUA 2CLCX 1QGUB 3PJDA 1HL3A 1RHKA 2B98A 2Y1CA 3A4VA 1NVWQ 3N76A 4N65A 4UHCA 4CIVA 5LQJA 2GAFA 3T1QA 3PT9A 2Z2ZA 2HK7A 1A96A 2PMFA 3AFNA 3X43A 3I9V1 5EUMA 1HX7A 1JNXX 1W0CA 3COYA 2G9UA 3LUAA 4BQOA 3EEFA 3MXOA 2GDZA 3VO8A 2GXQA 1RRKA 3M6LA 2JK0A 3RS2A 1Z7YA 2EZ8A 1OX6A 4X44A 3MWDA 3FNQA 2NM0A 1R50A 3U40A 1DWQA 1M83A 3RC2A 3ZGVA 3U7HB 3OZTA 4D9FA 3CJQA 3A25A 4O4HF 1BC5A 3AVPA 3F7TA 4R1NA 2ZUDA 1P7YA 3DUFB 1ZO8A 4EGFA 1D04A 3QUTA 1W25A 5BWMA 2ZE5A 3A1VA 2QF7A 3QVLA 5EJAA 5IASA 2P79A 5IUKC 3KD3A 5CFLA 1BE8A 2YY5A 1EEHA 1IHOA 3M49A 5JQGF 2WJ3A 1LBQA 4DDWA 1NUQA 4UMEA 1ODFA 4Y9SA 5JE8A 3AJDA 1H8ED 5DWQA 1CKEA 2L19A 5C35A 2NO4A 1TQ6A 3DOIA 4P82A 2V6GA 3M3DA 1BWPA 8GPBA 4RA6A 3IEIA 4U7TB 4WESB 3A6EA 4R69A 1X42A 3E0QA 3UANA 2AX3A 5LQRA 4DSAA 3C7AA 5BVGB 1C1DB 1Y7HA 3DLBA 3ANYB 4D9EA 5C2JB 5KQGA 4O08A 1DOAA 5EE9A 1LDEA 1TCVA 4EGSA 3J81k 2ZBQA 3AW9A 3A70A 3DTVD 1EQ2A 2CDCA 5E0OA 5EZYB 3BH7A 1WCWA 2DKNA 3U4DA 4YJHB 2ZPAA 3GA7A 3OIUA 5COBA 2Q4EA 2WJPA 2I91A 1QFXA 2TS1A 1OBCA 3N3AC 4LRUA 1BD3A 1ZOOA 1BU5A 2HD4A 2IYPA 2NT4A 4KWCA 3VBCA 2HHCA 3VPXA 3X0DA 3OHPA 5H81A 3LA6A 4B2YA 2Q1UA 1KSHA 3E48A 3ICCA 3INYA 4MW1A 6YASA 3PCTA 1C8LA 3I2GA 4IOJA 1TM1E 1SCUB 2BCEA 2G80A 3GLFA 5A1TA 4GMXA 4JBXA 3D6JA 1XLVA 1MJNA 1C7IA 2HTEA 3DF7A 4O2RA 1DBQA 3IKMB 4DJAA 4CF5A 2CJFA 2Q1XA 4LV8B 2ONCA 2PA3A 2R5WA 4UUPA 4N0MA 2Z2JA 3FVRA 4IKOA 2VOEA 3BD6A 4ARZB 1V11B 3QELA 4I4NA 3MTBA 1FJXA 5ANRB 1CNFA 2PZBA 2FK8A 1XNGA 2PZEA 4G1BA 4PYQA 4QQ8A 2CE7A 1IUPA 1GTL1 1U7UA 4YAJA 5DGIA 3D43A 4HX2A 3RJ9A 5LD2B 3E9CA 1C4KA 1R4MA 3TLZA 4DKXA 4MYRA 1Y8QB 1CVRA 1ZUWA 1PFUA 3TDNA 4HK4A 2HRZA 2FPIA 2R9VA 2HWKA 3HPRA 4FS8A 1OKKA 4E4YA 3ABIA 1SK8A 3AVUA 3PB3A 1FSFA 1G16A 1TVKB 2ZLBA 121PA 1GZUA 2FUKA 2OFXA 2WMDA 3AZPA 4FE7A 3N9IA 1OFHA 4LXXA 5TGTA 3VC2A 5J2TA 1BE0A 3FLAA 4X6YA 3VYUB 3BSWA 4AJEA 2AS0A 2WBLC 3Q15C 5I6DA 3FDXA 1LB1B 2ODNA 2BFFB 3MLEA 3EXIB 3HKDA 1G1MA 3IPRA 3RVKA 5LZ5A 4DHWA 2QT1A 1N6OA 1EQUA 2JAUA 4URZR 2PZ8A 5C4GB 3LYUA 3W2IA 4XYBA 4JXXA 4FEAA 3VNRA 5CB8A 2G1UA 2P9BA 3AYXB 3SNKA 3R3JA 1DRUA 2ECFA 4KAXA 3UXYA 3FCYA 3D0OA 3GIDA 4RZIA 3IMFA 3IXLA 1QB7A 4JS0A 3OLQA 3SDSA 2PYZA 1CETA 1CP2A 2NX2A 1CIPA 3H2SA 4Q1EA 4BX0A 2RHWA 5JEEA 5ALYA 5LMCA 1S2IA 2IEAA 1E61A 3RWBA 5B4VA 4Q7QA 1LF5A 3MWYW 4WVFA 4KTVE 3K0FA 4PRZA 3WL6A 3AP2A 4BMYA 3PR3A 1SUCA 4RLQA 1T1SA 4GZ5A 2AC4A 3DBVO 1TRHA 4IR7A 4MWOA 5EZYF 5I3CA 3M89A 3DS8A 1SULA 1QZXA 1J23A 1UC5B 4MULA 4GOKA 1CQIA 1FRNA 3TVYA 4CJXA 4V3BA 2F6RA 4YCDA 2XODA 2YDYA 1XRLA 4LRWA 2G3YA 5IEJA 1U7OA 4BNZA 3K16A 4JMLA 3C3EA 1ZCBA 4J0DA 4U0KA 5HPYB 1M72A 4OBWA 3NHLA 2W2MA 5CLIA 5ALXA 1PLLA 1UWVA 4C7XA 1NVGA 4CM6A 4ZK2A 1PEDA 3W4JA 2I3GA 4YRIA 4IGAA 2C0QA 3IP6A 3L4JA 4QOJA 3QSYA 5BOVA 3QVUA 2XOKA 4UBNA 1SQ6A 2ZGVA 3G79A 1N4AA 4ZT4A 4OMCA 3AEUA 3Q7IA 5C52B 3WHIA 1YHNA 3N58A 2WAXA 3T3PB 2ERXA 1RIFA 1XMOB 1XP8A 4CMEC 1V4BA 1T34A 3CSSA 4JGGA 3SQXA 1B76A 2ENUA 2FN4A 5FQOA 4Y2GA 2D7DA 4V0ME 1SCQA 1O2DA 1EJ6A 3UC9A 1RYYA 4WPGA 1FSGA 4JLAA 1CCWA 1JJVA 3HACA 5AUPB 3DYVA 1DEOA 3NETA 4UM9D 1Z8NA 3ZYCA 2JZCA 1OBHA 4HD8A 2IDJA 4UM9B 3RYHA 1P7ZA 1ZI6A 5DNVA 1Z73A 4UNIA 2XDAA 1C7EA 2W2QA 1VFPA 3BGOS 1CY0A 3F0TA 4CKBA 1H42A 4XX0A 1Y9DA 1LNQA 4B48A 4CEIB 4NESA 4NZ9A 4MWCA 4IKEA 1S9DA 2HO4A 3MF4A 1I7DA 1H4SA 3HQ4O 1TFUA 1XTBA 3EG9B 3G0BA 3FLEA 1TZCA 2W6JD 4MWBA 2F9FA 3TZLA 1YRLA 3LC2O 2X77A 4YJ3A 4ZYWA 4I81A 1K2WA 3ZZ0A 4M1MA 4EKDA 2R6AA 4DCCA 1VKNA 3MJRA 5K0JA 4LJYA 1RNLA 2WWXA 2VJCA 4DUPA 5EMNA 4YUZA 1X1BA 1TMYA 2EOAA 4J1TA 4LZPA 4CU5A 2IF2A 4UTPA 2WFMA 3N0XA 4ENRA 2Z2XA 5AICA 4MROA 3IA2A 3UBTA 4Y9DA 3PRHA 2OLEA 5K0SA 2GK6A 4G0XA 4CFYA 1EZZA 1SOUA 2VJAA 3ZU2A 1AK9A 2CBZA 5ILOA 3UJHA 4EY7A 1WE2A 3BB1A 2VTKA 2CUTA 3NCTA 3C14C 4HQFA 4TS1A 4J76A 4N39A 3BFJA 1R0LA 3EDOA 1SBZA 3O4FA 3QFFA 4YUYA 3OWXA 2HT1A 1ISSA 2EWVA 4JT4A 2CKMA 1GDDA 3RUDA 3EC2A 2FMFA 4G8JA 4MV6A 3HP1A 1KYXA 5G4KB 5BYBA 4DA6A 2ZUBA 3HJHA 1XHFA 4P3PA 5BP7A 1H8HD 1FMFA 4LG1A 3N74A 3JD1A 1A9XB 4B4KA 3T1HB 3N2KB 2RGNC 2QNBA 3WLKX 2ZI3A 2JFZA 4BFSA 4YREA 3B8HA 1TKRA 2A35A 2XUPA 2H2GA 3D8RA 3RU3A 1IVSA 2D54A 4ARSA 3WK6A 1NWCA 3D3WA 4OHCA 4EMSA 4OQZA 1V3UA 2GR9A 1HT1E 3MWEB 4FDMA 1CDZA 3PNVA 4PG5A 1VPTA 1KKLA 2H0AA 4Y9UA 1BGWA 1EGHA 4LMPA 4RH3A 4ATNA 1FRQA 4CLDA 4L5JA 4CW7A 3JVEA 1Q0QA 5EIOA 2I22A 1A1VA 1R5JA 3GOHA 4N8DA 3THXA 1ILEA 2R751 3C41J 4RQAA 2XIJA 3QUAA 2H92A 2VRNA 2YZ7A 1DWUA 1I33A 2NYRA 3GVCA 3PPVA 4Q1CA 4JASB 3STVA 3GDGA 4U9UA 3T9FA 4MKGA 4ZEXA 3HYLA 4H9GA 1YSCA 1Q84A 3H9GA 3VGPA 2AYYA 3WB9A 1IJEA 3RFUA 3ZCRA 4DQKA 2X5NA 1TT7A 1BH6A 4OX9B 3CH4B 2ZSUA 4AX4A 2Z6QA 3E58A 2IP4A 2BCJQ 3K0AB 3TM5A 3ULKA 4W1SA 4C2AA 4UTVA 3FFTA 1G17A 2CNBA 5ELLA 3W05A 4DQDA 4B4UA 2OV1A 3EGDA 4Z4CA 1COWD 4JENA 2RK6A 3C7DB 1O6GA 3IJRA 3NBYC 3L7DA 4IHQA 1C9KA 3W7AA 5J63A 1K89A 1N2EA 4MB0A 4Q4JA 5FLYA 3U7JA 3ITNA 2JLZA 1JHQA 1KQNA 4KXFB 3AY7A 5I7RA 4H7DA 2QWXA 2EYUA 2BBWA 1EFPB 3FHOA 1X3LA 3L5KA 4PYLA 2IGBA 2HPHA 2OCXA 4N18A 1XTVA 3FCOA 3ML1A 4D96A 1K2VN 1L1QA 3H19A 3LDFA 2CK3D 4QRDA 1TKCA 5CMLA 2P40A 4YJKA 5D7BA 1PGQA 2MINA 4GSKA 1K6XA 1SUEA 2C20A 2ZWPA 4NFLA 4OHBA 1E2MA 4PINA 1DWOA 4DDVA 5B5SA 3TS1A 5NLLA 4LTMA 2X5OA 4QAJA 3RS3A 1EAMA 2AFHA 3KT6A 2IUEA 4FGWA 3QVVA 4ISBA 4EL5A 4D6XA 4DTIA 3WS7A 4BEWA 3E2MA 4Q3NA 4TTVA 1W96A 4XW2A 3T9BA 1RD4A 4X7BA 1E62A 2IYRA 5KNBH 1NVBA 2GXUA 4UBIA 1QH1A 1N33B 3U39A 3PJEA 1JBEA 4JJ7A 2G40A 4QPZA 4YACA 4ZCSA 2OYRA 5L3VA 3ME5A 3OOEA 1T9KA 4PSUA 3EG5A 1FS6A 5JAOA 3UPTA 1LDNA 5EQFA 1YS2X 3PL1A 4RJLA 3FWZA 1EHYA 4BJ6A 3LCRA 2V74B 3FROA 3ZNPA 2XXJA 4O1IA 4KXVA 2A9FA 2PAAA 2WIDA 1DFHA 1X74A 3N2GB 3F3SA 1UBJS 1VI2A 1Y48E 3W3AA 3FMVA 3H6KA 4PX2A 3NYQA 4QLOA 2A1UB 1G2QA 5DYNA 3QX3A 4PYJA 4B2IA 2NZUG 2EP7A 4EI2A 2FR0A 1V45E 3ZKAA 3CUTA 2UZ4A 4XR4A 3EXG2 4NR0A 1T35A 3O0TA 2IZ1A 2BPOA 4MV7A 4NG4A 4B76A 4DLAA 1QF7A 4V03A 4C0JA 5A0TA 5EJ8A 1DGQA 2CF6A 2OG2A 3ZHZA 4TKVA 1H8HA 1CJCA 2Z8YA 3G1WA 4GKAA 4KE8A 4U3JB 1YJCA 3OZFA 5IF3A 1MUUA 1P9RA 2ZROA 4YEDA 1RAFA 2ON6A 4A8JB 4RZHA 1NYLA 1K8RA 1EK5A 1FX0B 1I7PA 5ESXA 1PTJC 2I34A 4QBGB 1Z4QA 2C4VA 3IERA 3GJ7A 3SICE 3BT7A 3QKRA 3Q7SA 4BVFA 5CXXA 1T5BA 2HBRA 4TMVA 2V7EA 4J49A 5F5XA 2H9IA 4WBNB 3QMVA 2BONA 4GM0A 1IZ8A 1I2BA 1OLOA 2O7VA 3AU8A 4INPA 2OAEA 3DMFA 3N07A 4WVLA 3QU2A 1SRRA 3ONEA 5FB3A 1L5HA 3ZE0B 1AKNA 1IXSB 2EATA 2R6R1 5LFAA 1YZFA 3DP7A 1E9CA 2PE5A 3PXEA 2RKOA 1Y0BA 2AE2A 4AS2A 2DETA 3GCGA 4QJ3A 3BN3A 1Z5WA 4LWOA 3Q72A 3GVXA 3PQDA 2W70A 5AW1A 2W58A 4JLPA 5BVHB 2WRZA 3I1FA 1ZMRA 4S1TA 3UK1A 3OT5A 4QDOA 4QECA 5BUCA 1G21A 1U1EA 1FC0A 1ZOIA 1L4NA 2GUGA 3DONA 2I6TA 4RKEA 1L3CA 1PO7A 2ZS7A 4W1RA 2YINC 4WKBA 1KDVA 4EO7A 1O8CA 3T4PA 1M2OA 2PS0A 2ZXUA 1RJFA 4ABTA 5CAEA 2WU4A 1N25A 4LYHA 1T36B 3FVWA 2XNDA 4G9BA 2ZUTA 2FJUA 3QLVC 4GPIB 4HMPA 2E6KA 4I9FA 1E6LA 4Y6QA 3ZBTA 3NRJA 1A5AB 2VF2A 3FKQA 3GEBA 3GRUA 4FC7A 4BFZA 2O8FB 3FFBA 2VZEA 5HCNA 1QP0A 4C4PA 4TZ0A 1JG4A 4NMWA 1CY4A 1HMPA 4QUEA 3WMGA 1GZ4A 3AEQB 4ZVQA 4E09A 2IIPA 3WADA 3EGDB 2O8EA 3KZNA 1PFQA 1ADJA 1ZGBA 4KSYA 5KNCH 2GZ3A 4WUTA 7GPBA 5K8CA 4R9SA 2PZMA 1G8FA 2BTOA 3KEQA 4XAQA 4G2TA 3WICA 1F9EA 1ILWA 1AY0A 4R1OA 4QT4A 1DIRA 3O26A 2ZUSA 2IUUA 4BNFA 2BM9A 1M2EA 1DCTA 2DRIA 2FUG1 1CJTC 2ZRAA 3PEYA 3W4IA 3R7DA 1BVHA 2VG8A 1S7CA 1H6BA 5KINB 3QVXA 1CUWA 4RMHA 4BX2A 1UBCA 5DLDA 4WA7A 3KHTA 4F6RA 4R31A 2VKTA 2X41A 4D0GA 2C92A 1FW8A 4TV8B 3WLHA 3E5HA 4FIDA 4XJSA 2GF2A 1H23A 2FUNB 2HHLA 2V0GA 2YV5A 4EPWA 3IAS1 1ZUNA 2NV2B 3PD7A 4PCVA 2OV6A 3MELA 4BKRA 5TRTA 2P77A 3NH9A 2EZUA 3L92A 3AK4A 1J2TA 2QR3A 3FAKA 2X6RA 1EVQA 2IK8A 3BPSA 3GFGA 3I6QA 4EG0A 2O23A 3SLRA 4HV4A 2XA9A 1N2ZA 1AO3A 3KL4A 3GBSA 3WIOA 3V97A 3R9WA 1U7HA 1C50A 3OTIA 3DWFA 3JYOA 4X20B 3LH5A 4YUAA 5KX5F 3OZWA 2YBEA 4E46A 4AY2A 2Q9BA 4MB6A 4ZEOA 4M0CA 2X2OA 4KDEA 1OH8A 4AF6A 4AKTA 4LJ7A 2CD7A 2IYWA 3H1TA 1YB4A 1MPXA 3LO5A 3I8SA 3FCUB 3USCS 1F8UA 2G0NA 3H9CA 5CM9C 2DHDA 3II6X 1M74A 5CXSA 2GN0A 4DNFA 5CJPA 2XT9A 4CL2A 4YBRA 1PUJA 2J1LA 5FL7A 5J59A 2AT1A 3TTVA 2PD3A 4YJFB 4YBZA 1P29A 2WM3A 2CXQA 1Q91A 1A1SA 1R0RE 1E5XA 3IUEA 3TIVA 4CV3A 2EFYA 2QTFA 1HFJA 2IC5A 5IKPA 1BCRB 2CLFB 3NHZA 4P31A 1OUMA 3IP3A 4TN1A 1G60A 1IBCA 2H4ZA 3KPJA 2PIDA 5FBKA 5KNLA 4QFDA 5B37A 4WKGA 5J47A 1BH2A 3LI2A 1FYWA 1DX4A 3L05A 3TR6A 3IP9A 3LCVB 4RIHA 1EFRA 1GGVA 2R6ZA 4MTCA 2O8EB 1VGVA 4KQEA 1G8JA 3PX3A 4YN3A 4LPSA 2YC4C 2HSZA 2BOVA 2FH5B 3WZMA 2ZCUA 3TOSA 1R5OA 4U7JA 1A9XA 1NUPA 2WIGA 3U17A 4WZBE 4KHZA 2KSQA 2R79A 5HMMA 5A9SA 2CB9A 4RDCA 3AL0C 1IC6A 2FW7A 2GQ0A 1A04A 1SKYE 1POXA 2CXSA 3FRIA 3V1MA 4BQNA 5CG1A 4CKZA 2FEMA 4CTMA 5HK9A 2CNNA 2JIBA 2AEMA 4H4EA 4MX8A 2L18A 1PJ4A 4JL6A 1SBNE 3IKLA 2NZYA 2O2DA 5KYGA 4MPDA 1MQ8B 3ID6C 1V3VA 5LA6A 4BDSA 1CVLA 4HDRB 2QE6A 1E8MA 1OSNA 1IUOA 1DBSA 1EVEA 2J5QA 3ZNOA 3CONA 2O57A 1XYYA 2V4UA 1JEDA 2PNJA 4XUEA 1NJGA 1K68A 5IF9A 4JP8A 1U2DA 4AMBA 4I2VA 2OXIA 1NU6A 1FFXA 1L5ZA 3HCRA 3N8DA 4DYVA 4MDEA 3ZBUA 3DV2A 2BD0A 1M6HA 1YR7A 1S7GA 5IAJA 3SY8A 4QEDA 2E4YA 1ZN2A 1FMLA 1I32A 1TUIA 2X15A 1PR6A 3OKAA 4MI6A 1RLIA 1SEVA 3AOEA 3PXDA 2HBZA 3KEGA 3RV3A 4B44A 3SSOA 4BGEA 4EI7A 1VIDA 4MWDA 2WIKA 2PSHA 1H8EA 1KYWA 2HPVA 2VTEA 3DPSA 4RHXA 5FBZA 2V3WA 4YMUA 1M66A 5DK6A 1OH5A 5EUCA 3L04A 1UBGA 4UM5A 4ZO7A 2UZ3A 3TMKA 1LDMA 1APBA 3LLCA 2I99A 3CG0A 2HCFA 3K32A 4WEOA 3VOBA 2VDWA 1NLZA 1YHYA 1SXIA 2PKYX 4BNWA 1USVA 2E4WA 2ZAIA 3T5DA 4LYJA 1MC4A 2GCOB 4B7ZA 1GU1A 4X6LA 3D5TA 1M8PA 1VHJA 4IWXA 4JEIA 4JHXA 3AF6A 3V2GA 4PVDA 4FW9A 1L7EA 1QV6A 4M9XA 2F59A 3LGXA 3MMZA 4YAOA 5K5EA 4RM2A 1Z5ZA 5EHQA 1P2UA 1EFVA 2QZ4A 4DV0B 1TJNA 3KCNA 3PQ7A 5DM4A 5AVOA 5C1IA 3CN7A 4GZ6A 5K8UA 1DPFA 2EW8A 4MYHA 3WQRA 3M6AA 4ZI7B 1D2AA 4AKHA 1KDTA 3TLBA 3H6HA 4OGKA 3MJCA 4HNAB 3DBHA 3KUKA 5LB2A 3W9YA 1J8QA 1GGNA 4ALIA 2FEPA 2WJHA 1U98A 2I4RA 1P81A 1WOMA 3IAUA 4L74A 3PKJA 3WJ2A 2XGJA 4QYSA 1XTQA 5T8KA 1DTWB 3K15A 1T2EA 3FMFA 4ID3A 4TV8F 1T2FA 4DR1B 4LI0A 3C16C 1MO6A 2V7QD 2QX6A 2QRHA 2Q50A 1XDWA 4W5JA 2QXYA 3WV5A 1BKYA 2GCEA 2ZI5A 4O0MA 1J24A 3F7NA 5CM2Z 2BFEB 3PD0A 1Z63A 1PNTA 4AECA 5B1EA 1BDBA 3OHSX 4CMCA 1L4YA 3JRXA 4OA5A 2VEOA 2IE0A 2BFDA 2H17A 2D0OB 4DL9A 2FWMX 4GZMA 2BGIA 1R4NB 3AIOA 2UZ1B 4Z4QA 1SVKA 1GO2A 4S2UA 1WXFA 4S35A 4P9NA 3VISA 5JRDS 3J80A 4QYWA 3QM1A 3NEJA 1WCYA 3T41A 1HSZA 1B0AA 2M9MA 1BGXT 3SEQA 1BJRE 3U7QB 2YZMA 1RHMA 2W2KB 3W6NA 2OXRA 2ZIUB 5EXSA 3W5SA 1AKTA 2A84A 5F9MA 5CAEB 1U8XX 4RXMA 2R5FA 1PIWA 1WMEA 3EVZA 4ZYXA 4IG4A 3TZEA 5HJ7A 4URUR 1C14A 4JU8A 2HLDD 3H42B 3HADA 1B8NA 2FPPB 1T26A 5I4IA 3K2EA 1SCJA 2WD7A 4FFSA 3OTGA 4BNTA 3CTMA 3FBWA 4L07A 4II2A 4US1R 4ASUA 2H54A 3MOSA 2HGZA 2A78A 2YJZA 3H17A 3KYDA 3R3VA 5EIAA 3V4LA 1BWRA 4Q19A 2JRCA 3VYTB 5A6SA 1WV0A 2GUWA 4MQ5A 4DCUA 5E6SA 1M1ZA 2IE8A 4JYCA 5AKHA 4Z4FA 2XJ4A 4FD2A 3M34A 4CQMD 3O92A 4ZIRB 1TVKA 1BDIA 3X2FA 3E4CA 3G2PA 1CQZA 2MT9A 5YASA 1STOA 2H9AA 2J6IA 4PF1A 2WZCA 1OFUX 4JVOA 2JBWA 5HKLA 2QPOA 4RA6B 5E1DA 4OHVA 1RDFA 1EU1A 2ZS8A 1U11A 5H1YA 2IW3A 5DGXA 3Q8MA 4ENUA 1WCV1 4A16A 5HZHA 1GCGA 4G5QA 5JY1A 4GU5A 1CUZA 2G7ZA 5FFFA 3CY6A 2WMNB 2XB4A 5KO2A 2B20A 2QTLA 4DILA 4GFDA 3AB3A 3HA2A 2ECKA