3H17A

Crystal structure of este5-pmsf (i)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
292
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of an HSL-homolog EstE5 complex with PMSF reveals a unique configuration that inhibits the nucleophile Ser144 in catalytic triads.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 107
structure length 292
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h17A00
2OCIA 3IUJA 4GHWA 1N5MA 4MQLA 3D2AA 1CLEA 1U65A 4DMFA 3QBJA 2WKWA 1EXWA 3ICVA 4N8EA 5AKHA 1QJ4A 2ACEA 1HL7A 3DDUA 1VXRA 3FSGA 1ORVA 5JZ9A 1LBTA 1XZHA 4F0JA 5HZGA 1EDDA 1QIDA 1H22A 2XUHA 4H35A 2B61A 5ALRA 5AI5A 4BE4A 3HLKA 3KWFA 1MPXA 4EBBA 1HDEA 2BKLA 5ALEA 4V2IA 2JEZA 4CI9A 2XQIA 2R11A 4E14A 4G4GA 2BJHA 4I4CA 3O4IA 4BVJA 3KOOA 3LS2A 3LP5A 4B9AA 2K2QB 2VSQA 2XE4A 4ZGBA 1EDBA 3M3DA 3GFFA 3EQ7A 3WKBA 2IX9A 3WK4A 3WK6A 3G9UA 2WU3A 1W76A 3QPCA 1BCSA 4H7IA 2VJDA 4ARAA 3ZI7A 3BDVA 3IDAA 3QMWA 3G8YA 3C6XA 1J07A 1B41A 1ORWA 3DS8A 1VKHA 1CUCA 1XZMA 3I6YA 2Z8XA 4EHBA 2YASA 1U2EA 4UBOA 3CCBA 5C81A 3O9VA 3AZPA 5CH5A 1A7UA 3I2JA 2QOEA 1DX4A 3FLEA 1THGA 2V98A 4X85A 1R9MA 3A70A 1AC5A 5KWJA 2XUQA 1QIMA 3G0DA 4FLEA 4QDUA 5IH7A 3JYHA 4QDOA 1EK2A 1UXOA 1FFEA 3F96A 3ANTA 4DM7A 1QLWA 1R9NA 4FTWA 4BP9A 1CUYA 2VT6A 4NS4A 1KU6A 5FRDA 4JYPA 2RI6A 4Y2RA 2IITA 1WPRA 3BL8A 3IUMA 5T4EA 2QT9A 1PJAA 4KAAA 4WDRA 4XX1A 1W52X 1K6EA 2C58A 4FBMA 1CUAA 5F4ZA 2XMBA 1LZKA 4H7EA 4BZZA 4YK7A 3WWDA 3FVRA 3PUHA 1WPXA 1G42A 5CT9A 3WWCA 1KU0A 1ZI6A 3CN7A 2PUJA 3DNMA 4FNMA 1ODCA 3BJMA 4PSCA 3W9UA 5LYYA 3E1GA 4F21A 1NX9A 4X7BA 5K3AA 2XLBA 5JYCA 1XZLA 5EIAA 1IUOA 4FBLA 2R8BA 3QITA 2WHPB 5AKKA 3W2TA 4X71A 2DHDA 3H2JA 2WIJA 1XLWA 3F9CA 3FYTA 4B84A 1AURA 1GXSA 4AB1A 3FLBA 1MX9A 2HU5A 5JARA 3O4HA 4H0CA 1YA4A 1XZAA 4BAGA 1MX5A 4PV7A 5K3CA 4BYMA 1UK8A 3B3QA 5T4FA 4E15A 3NOXA 3ZLTA 4MEBA 5EFZA 2QS9A 4K5QA 5IVIA 5AM4A 4ZV7A 1R50A 4CIBA 5DTJA 4CG2A 3JW8A 4GXNA 2AJLI 1IUNA 3NGMA 3W06A 2WUDA 1EVQA 2H7XA 2XUDA 4OB8A 1T4MA 4QE3A 5IKXA 2BAGA 2ROQA 4MYSA 2AJBA 2VAXA 4AO8A 5I7UA 2VA9A 3ED1A 3WKDA 2GBIA 1DTEA 4UFNA 1UKAA 1Q0ZA 3O0DA 2HHAA 1H2YA 1CFJA 1OXMA 4H77A 2PSJA 4HXFB 3V1KA 4L9AA 4WFJA 2WTNA 3I2GA 4GECA 2FX5A 2H7CA 3FLAA 3Q8WA 1CUZA 1F0NA 1LGYA 5FUMA 4HAIA 1XRMA 1JU4A 4XVCA 2C5GA 5E4JA 3WA6A 1EHYA 1GQSA 2HA5A 3G02A 4X6UA 4P93A 3WWOA 5IVHA 3EIOA 3STYA 2XUOA 3WL6A 1YAHA 2PSDA 4K6KA 1OCEA 4C87A 1ZI9A 3STTA 1IVYA 1SCKA 5AKYA 1C7JA 3GZJA 2I3DA 4B85A 4E11A 3DOIA 1K63A 5AICA 1CUBA 3UUFA 3OM8A 5EHNA 5LLSA 4DNQA 2Y2VA 3WIOA 4J0DA 3GELA 4JEIA 2FUKA 1BN7A 4MEAA 4QWMA 5ALMA 1UOQA 1SC9A 1VE6A 4AZ0A 1FJ2A 5E2IA 1L7QA 4BP8A 4FDMA 3D0KA 3I2KA 2PL5A 4OU5A 1AUOA 1VZ2A 2QKYA 5IVDA 2WIGA 3M82A 5DYYA 3C8HA 2D0DA 3UMJA 3S2ZA 3VJKA 4PSUA 3KWJA 3M81A 3RKSA 1A8QA 2J4CA 1QONA 2OLEA 4G9GA 4H7HA 3R3UA 4Y2UA 5LZ4A 3MVEA 5ALTA 4Y2XA 2VT7A 4BVKA 1X2EA 2JGIA 2WUFA 5I8PA 6YASA 4Y2TA 2Z3WA 2JGMA 5ALXA 1W6RA 4H7DA 3VJMA 5CRIA 4OSEA 4BTVA 1AX9A 2WTMA 3WYNA 1W4LA 1QIHA 2GYVA 3TGLA 3IUQA 4X97A 2HU7A 3VVLA 2J4FA 3L1JA 4IH9A 5I9IA 2XB6A 4LXIA 5ESRA 4BAZA 1LPNA 1TCBA 3DYVA 1O6FA 1ZD2P 4RPCA 4W9RA 4OUKX 3WK5A 3LCRA 4GBGA 4KE6A 3G0CA 1EX9A 4BRSA 3D5EA 1TRHA 5ALZA 5AM1A 2QR5A 3EQ8A 2ONCA 4IO0A 2UZ0A 3QPAA 5A7FA 1QOZA 1QTIA 5DYWA 1CIJA 1YCDA 2PU7A 1AMNA 1DU4A 5HQ3B 1CUJA 5YASA 1W1IA 2O2GA 1UFOA 4GI1A 1HPLA 1XROA 2XQGA 1CUIA 1LBSA 1U4NA 3IIIA 3SC2A 2X5XA 3WIBA 2HL6A 2OAEA 4IH1A 2AJ8A 3VDXA 4J0GA 2PSEA 1ZD4A 2PPLA 3K6KA 4J7AA 2Q0XA 2Z5GA 3R3VA 4PW0A 5CXXA 1XZJA 3WKCA 1UT6A 3R3XA 4KR0A 2DCMA 2X8BA 1UK9A 3HI4A 4B6GA 4X94A 4EY8A 2ACKA 4CG3A 5BOVA 3F97A 2H1IA 5HF6A 3TJMA 5EIHA 1N8SA 5EIEA 1XKLA 3C43A 1BROA 1LPAB 5JATA 5FP0A 5AKIA 3HC7A 2CBGA 1ODTC 1BS9A 4Q3KA 5K3FB 4C6HA 5JZSA 3G0IA 3F8SA 1CUUA 3VXKA 3QZUA 4C01A 1TIBA 1SCQA 2VJAA 4F60A 4QEKA 1CV2A 1R3DA 1PV1A 2XMRA 3FYUC 1LPMA 1MJ5A 3I1IA 1HLGA 2XMSA 2QUAA 1FFDA 1MN6A 3WJ1A 4U2CA 4L3WA 2WHQA 2HA7A 4UHFA 4P92A 5C8ZA 1JI3A 3PUIA 4ETWA 2OPHA 1HQDA 1Q84A 1UK7A 2PVSA 4UHDA 3MUOA 1R4ZA 5SYNA 2VTVA 5CW2A 5A62A 2JBWA 2QJRA 1CUDA 2H7YA 4QLAA 4ZV9A 1GPLA 1Y37A 3ESCA 1F0PA 2WFZA 4B82A 4W1PA 1XQVA 2HFKA 5EGNA 5FOQA 5A7GA 1H2XA 5LKRA 1XQYA 3HEAA 1R1DA 3HABA 4TVKA 2RGUA 1QIIA 3C6ZA 5AOCA 4W63A 4MXDA 4I3FA 2RONA 4Q82A 1JMYA 5D3KA 1FFCA 1AKNA 1CUGA 2WILA 4OB6A 4WFIA 4GLBA 4P08A 2PU5A 2DQYA 2BCEA 2XUGA 5E4TA 1ZGCA 3PI6A 4HRYA 3GUUA 4WFKA 1RP1A 4B83A 1HKHA 4QNNA 3KXPA 2NW6A 1ZD3A 2ZVDA 3C5WP 2I78A 2XQKA 4AO6A 1QIKA 2XUFA 4GWLA 2WFMA 3D59A 3QMVA 2VQ6A 4G5XA 1XKTA 1THTA 3WKAA 4IQ4A 1YR2A 3DOHA 1AQLA 4LXHA 5AIAA 2XUPA 3IULA 1QIGA 1OILA 2C7BA 3N2ZB 1WM1A 3AIMA 4UFPA 1BEZA 4QLOA 1WB6A 3K2IA 5T4HA 5AI9A 3AIKA 2HA4A 1ODSA 3Q0TA 2OQVA 5EHXA 1E8DA 1A8SA 4X3CA 1SOMA 3G0BA 1JMKC 3T4UA 3O9MA 4BAUA 1DWPA 2Y6UA 3EF3A 3GROA 4OPMA 3CN9A 1XLUA 3MGAA 3C87A 5ALYA 1JFRA 1YSCA 5JAPA 4D9JA 5FDFA 3WL7A 3PICA 2JGKA 5LZ2A 3S8YA 2XI4A 3A2NA 3D7RA 1N5RA 1H2WA 1D07A 1XRRA 2HADA 3WLAA 3I6ZA 3HRHA 2XLCA 2ZYIA 3D2CA 4Y2JA 2XQJA 4KJXA 3WQHA 1E89A 5BWBA 1J2EA 4UBKA 2YH2A 5CMLA 4H7KA 4KE8A 3AFIA 3R3YA 4ZI5A 2HDWA 1ACLA 3C8DA 3V1LA 2GZRA 3O4JA 2C0QA 5AP9A 5DNUA 2XMQA 4X00A 5CBKA 3GA7A 5DTIA 4DTCA 3O95A 1DX6A 3B12A 4A5SA 3R0VA 5AI8A 4DNFA 1JT2A 5DNVA 3H2GA 1WCYA 4EA6A 4NMWA 1P0MA 1F8UA 4LYEA 4GDMA 1K8QA 1S8OA 5JIBA 2HA3A 2HA2A 1LNSA 2BGRA 3H18A 4DNPA 4CIAA 1FFBA 1DT5A 2Y2UA 4FKBA 3HXKA 5KBYA 1BCRA 1ZD5A 3DCNA 3MUNA 1QO9A 3FBWA 1CQZA 5D3ZA 4BC1A 4BTLA 4A16A 5AK4A 4EY4A 4TGLA 3BDIA 5AI6A 4X91A 5A71A 1IZ7A 1JJBA 1UZAA 1G66A 5EHZA 1XRQA 4K2AA 5FPPA 4B80A 2I03A 1GQRA 4AN1A 3D4LA 4O08A 3N0TA 3OOSA 5AM0A 4C4ZA 5LIPA 5DNWA 4QDTA 2W6CX 3G0GA 1EDEA 3G7NA 3C5VA 3WK7A 1XFDA 3R41A 5C8XA 4W1QA 3WI7A 1YA8A 1GPNA 4ITVA 5E4YA 1R88A 3FAKA 4TPKA 5DLPA 2WG2A 4B81A 2OCKA 2XUJA 4UBIA 2WUEA 1T2NA 4J0IA 4CG1A 3AILA 1W75A 5AKEA 3HJUA 5AKLA 2PBLA 3PFBA 1MTZA 3RM3A 3BJRA 4PQEA 1TKRA 4C88A 3TRDA 4UHBA 1DINA 1EA5A 3KDAA 4PSDA 4L72A 2JEYA 4J0HA 4HVTA 5FV4A 2OG1A 4X90A 1A88A 1E3QA 4KACA 4B0OA 2XDWA 5C7YA 2DR0A 3H2KA 4H7JA 5H3HA 2DHEA 2JGFA 5HFNA 5IVKA 5AKZA 2QZPA 1EB8A 5AHXA 2W22A 1CPYA 3AJAA 4Y2YA 3WK8A 4KE7A 3FYUA 4FMPA 4LIPD 3WL8A 3K9BA 2BFNA 3T52A 2GYUA 2AJCA 2HA0A 3G9TA 1X70A 3WK9A 1CUSA 4MWTA 5AI0A 4QDXA 2EDCA 3VKFA 1GKKA 3I2IA 2OGZA 3WA7A 3STWA 2J3DA 3ZLVA 5K3FA 4I19A 4XWGA 1EINA 2JGEA 4BVLA 5ALNA 5C8VA 5ALHA 5ALFA 3YASA 4MYDA 1MAHA 3WKEA 3OG9A 2Y6VA 1XZFA 4EZIA 3ZV7A 2JGJA 1P0QA 2ES4A 3CXUA 5JD4A 1VLQA 2I3ZA 4LXGA 2ZYRA 5AKGA 1MX1A 1J1IA 1Q0RA 3C45A 4JUIA 5CURA 2HIHA 2JF0A 3BIXA 4L0CA 1E8NA 4J0JA 1LPBB 5HF8A 5AOBA 2XQFA 2J3QA 1UOPA 1MNQA 2PSHA 1AZWA 2G4LA 2RIPA 1CVLA 3H19A 2WJ3A 4JH0A 4EUSA 4N8SA 3LIIA 3PDCA 1XZEA 5JD6A 1QFSA 3DKRA 1MT3A 5ALWA 3H1AA 4B7ZA 2CMFA 2ZJFA 3RARA 2GBFA 1VXOA 1YASA 3D2BA 5SYMA 4UBJA 1YB6A 4AZ3A 3A6ZA 5AOAA 5JADA 4OCZA 4HS9A 4Y7DA 2QXTA 5K3DA 5D6OA 2IIVA 1QIEA 4QA9A 5JZBA 3FCXA 1LPPA 4KE9A 4A23A 3ZWQA 1CUXA 4N5HX 3AUKA 2ZYHA 4DGQA 2QMQA 4BDTA 2BUCA 3WWEA 1SFRA 4YASA 1UKBA 3ICWA 1CUHA 1Z68A 4UUQA 2B9VA 4S0XA 5K3BA 1QE3A 4BATA 1MAAA 2PUHA 1Y7HA 3EBLA 3FOBA 1UKCA 5AK3A 1L7RA 5AIBA 5AKXA 3I28A 5LP1A 2PSFA 5AM2A 2H9YA 4ZREA 1Y7IA 1GT6A 1NU8A 3C70A 3HZOA 4FFVA 5LZ8A 3OURA 4PNZA 5AK5A 3E0XA 2XT0A 1BRTA 3A2LA 1VE7A 3LIPA 4ARBA 1L7AA 2GYWA 4ZXFA 3C6YA 3BE8A 3FWHA 1QIJA 1XZCA 2JGLA 1VA5A 2WIDA 4AX4A 4FNGA 4W1SA 4IH4A 5HQ3A 2WJ6A 4INZA 1X2BA 1EK1A 5JAUA 3IB3A 2OAGA 1QGED 5AI4A 5FLKA 3QYJA 5AM3A 3U1TA 1E5TA 1WHSA 4DIUA 1XZGA 1QIFA 2GZSA 4M0EA 1MU0A 4CCYA 5K3EA 3FYUB 5JD5A 4Z49A 3WL5A 3BXPA 4ZRDA 5A6VA 2XMZA 1GGVA 5CH3A 3DL4A 1DWQA 1NU6A 2WHPA 1UWCA 2XUKA 4X6XA 2CUTA 1WHTA 2CB9A 1K4YA 1XLVA 4C89A 5KREA 1BEEA 1IUPA 5DJ5A 5KWIA 3SX4A 3PFCA 1G5FA 5ALJA 1USWA 1VJ5A 2VF2A 3HACA 4P9NA 5CT4A 3H17A 1AGYA 4BRZA 1F6WA 1B6GA 1XQXA 4EY5A 2QM0A 5HCUA 1U8EA 4CFSA 2C4HA 5JALA 4UFOA 5D7BA 2WG0A 3BF7A 4OYLA 4X93A 3SWWA 2D5LA 4MJ3A 4ZWNA 3DLTA 2VJBA 4WJLA 3A2MA 1TAHA 2OCGA 1H23A 4BDSA 3UUEA 2XUIA 1FSSA 4OU4A 1UOOA 4DMHA 2YXPX 2E3JA 1DT3A 4K6HA 3IA2A 4LYDA 1ZJ5A 1JJIA 3R3ZA 3DL7A 1H2ZA 1I6WA 3W04A 4HTAA 1VA4A 3SK0A 1P0PA 4N8DA 1M33A 3H2HA 3NWOA 2DHCA 5ALGA 4FHZA 4U2DA 4WY5A 2OGTA 4U2EA 4DLNA 3HSSA 3LLCA 1O6GA 1BN6A 5EHQA 2HFJA 4KEAA 4XJVA 2OQIA 4OYYA 4Q34A 5ALVA 5ALPA 2EEPA 4N5IX 4C4XA 2XMGA 3ZLUA 4RE6A 4DMCA 2EDAA 5A2GA 3C6BA 3E3AA 3AZOA 5JAHA 1LLFA 4JYMA 4OB7A 1YB7A 2V96A 4Y2SA 2WIFA 2X76A 3WWPA 3WZLA 2Z8ZA 1CUWA 2WIKA 5FXMA 3X3HA 4KYVA 2XUAA 4J3JA 5FKJA 2P8SA 1TCCA 2WUGA 2G5TA 4JNCA 3OC0A 4KRYA 5HF5A 3PF8A 3I6MA 4QZVA 4G8CA 3R3WA 3STXA 1JKMA 4BE9A 1XZDA 2QTBA 4X95A 1VZ3A 2WFLA 4FLMA 3O4GA 4QWWA 3E4DA 5AM5A 2Y1KA 4IHAA 3KD2A 2PM8A 2HU8A 2WG1A 3V1NA 1VOTA 5ALDA 2Z3ZA 2BUAA 4AXBA 1YS1X 2HM7A 2AJDA 3M83A 4YX9A 1XRNA 2B4KA 2CZQA 3JWEA 2WHRA 2GBCA 2VATA 3H1BA 3DKKA 1TQHA 3PF9A 3GBSA 4CCYB 4G1FA 1ZOIA 4X92A 4QDZA 5ALLA 4FWBA 3W9BA 1GPKA 3I2HA 1HBJA 4RE5A 4FOLA 1RYYA 4U2GA 4Q1VA 1QZ3A 4UBLA 4MQMA 1YS2X 1FFAA 2XMCA 3RK4A 4DSZA 5LZ5A 1IMJA 2CKMA 2ZJ7A 2WJ4A 1CEXA 5HK8A 1J06A 3KSRA 2ORYA 3AZQA 4KAFA 5AJHA 1LPOA 5AK6A 2ECFA 1MNAA 3RLIA 3VISA 3FNBA 2VEOA 3FCYA 1EB9A 2CEKA 1E66A 4U2BA 4DNOA 3I2FA 2FJPA 5CT8A 4B0PA 3ILSA 3WJ2A 3VJLA 3ESBA 5HF9A 4BCDA 4J03A 1Q83A 3IURA 5BWCA 3L1IA 2C5FA 5HFAA 4WDQA 4FLFA 4KAJA 2RAUA 7YASA 4UBNA 2RHTA 2WQZA 2WM2A 1CR6A 2OXEA 4Q05A 3HYSA 4KRXA 1WOMA 2VJCA 3IVMA 4ROTA 2AXEA 2CJPA 5JASA 4G9EA 4BCCA 5AKJA 1QFMA 1ZIXA 3F67A 3IUNA 4RGYA 3P2MA 4GW3A 1XQWA 3QH4A 2RHWA 1ZI8A 4UHHA 5K5EA 5BV7A 1ZIYA 2QVBA 1CUVA 5JANA 3ESAA 3QM1A 3V9AA 1EI9A 1WB4A 4UPDA 4U2FA 1CQWA 3H0CA 1CUFA 2QRUA 4AO7A 2ZSHA 3L1HA 1XRLA 3ANSA 2V9ZA 1DQZA 1LZLA 5ALSA 4HZGA 4DYHA 5ALUA 4BCBA 4C4YA 4H7FA 1EH5A 1UK6A 2DFPA 5T4BA 4YPVA 4M0FA 1TCAA 4G8DA 3ZPXA 1ZJ4A 4XIIA 2QUBA 3QMMA 1ISPA 5EI5A 2DQZA 3AIOA 1XRPA 5CTAA 2ZYSA 4LHEA 1QO7A 2JIDA 1IZ8A 1EVEA 3STUA 3G9XA 2LIPA 1GZ7A 5CT6A 3FSGD 4H18A 4HXGA 4EB0A 1ETHA 4BB0A 2G5PA 1YAJA 3PE6A 3AINA 1P0IA 3R40A 1E8MA 2VAVA 4UHEA 4WY8A 4G4IA 1GKLA 5A7HA 4W1RA 4J0KA 1JU3A 3D3NA 1K5PA 4Y2VA 2B20A 2ZSIA 1TK3A 2O2HA 4Y2PA 4E46A 3DYIA 3BIWA 1WB5A 4FFWA 5HKAA 3QVMA 1JJFA 5ALOA 3DEAA 3OTQA 3I1YA 1ACJA 4BBZA 4DMKA 2BGNA 3WZMA 4G4JA 1PFQA 5ALQA 2V97A 4GEGA 4G8BA 4Y2QA 1CUEA 4WCVA 1G4HA 2HA6A 5LZ9A 2PX6A 2BUBA 3BF8A 3H04A 3W05A 3IBTA 4Q3OA 4M0MA 4AMYA 3BWXA 4CCWA 1A8UA 4Q3LA 2O7RA 4J0CA 4Y9SA 4HXEB 5FPQA 2OGSA 5LKAA 1LPSA 2PKYX 4PO3X 1DWOA 2WU4A 1XZIA 4HRXA 4NVRA 3DD5A 1CRLA 1BU8A 2O7VA 1SCIA 5JAOA 5ALKA 4OD0A 2HRQA 4DSAA 1DQYA 1C7IA 5ISMA 3TEJA 5AH0A 1C4XA 4AQDA 2FJ0A 2XMDA 2HRRA 2QXUA 3QPDA 3CCCA 3STVA 3B5EA 4PF1A 3NUZA 5HKBA 5J3JA 1KEZA 1XZKA 2WFLB 2YYSA 5DYTA 5AO9A 3VVMA 3WMRA 4F5ZA 3V48A 3U0VA 3ESDA 3H2IA 1XZBA 5CH8A 4AMZA 4K6GA 4AN0A 2ZJ6A 4X6YA 3G9ZA 4RNCA 5ALIA 2OCLA 3DJYA 4NZZA 2G63A 4UHCA 4EY6A 1QTRA 3DQZA 3V1MA 5CXUA 1ZICA 2GBGA 5CT5A 1BE0A 4MWSA 2QJWA 1RWQA 3FVTA 4BZWA 2C0PA 3EQ9A 1ZGBA 4LKOA 5LZ7A 3OPMA 4UBMA 2O2IA 1MO2A 3WYDA 2DSNA 4EY7A 1N1MA 2WLSA 5DWDA 5HK9A 4BC0A 4B9EA 2WSLA 3F98A
chains in the Genus database with same CATH superfamily
3PPXA 4MKFA 3DULA 3OD1A 3OI7A 1D2CA 4R8RA 4YJHA 2PKQP 3F5SA 1FZQA 4JL8A 4CLDA 2F43B 5E9JA 1G5QA 5F9MA 1XPOA 1PV2A 3D4PA 1BHQ1 1KAGA 4I4TA 4LY9A 5D3QA 3W2FA 1CLEA 4DMFA 1ZVKA 1XE3A 4P7BA 4CQNA 1E7QA 3AO0B 5IBQA 3ZU4A 5JRZA 3DMTA 4UMVA 4CM8A 3FTDA 3D1VA 3MUFA 4N8EA 5AKHA 4ZJPA 2XQVA 1PJSA 3W3AD 3LXMA 2F55A 3F6RA 3PTLA 1HL7A 2QLMA 1QG4A 3DDUA 1ZGHA 4N0PA 4WKNA 5F9HA 3PRYA 1CCWA 4MH0R 1Y5MA 2WWYA 3MJ4A 4DIEA 3QNMA 5D5HA 1MJFA 3W7BA 4CXMA 3O3OB 1PGPA 4RVHA 4HTFA 3U3DA 3DKPA 1WXIA 1JQDA 5A1JA 5HEKA 1IE3A 1THMA 3B36A 3G2MA 4ZIRA 2AKYA 3IR6A 3GRFA 1NW8A 5AI5A 1T0PA 2J9FB 2QQ0A 2WVJA 5BYBA 3KWFA 4IFBA 3RI3A 2Z9CA 1J2RA 2BKLA 3RQIA 2G5GX 1PS8A 2Z04A 3TUZC 4CGZA 2JEZA 1QHXA 4KTTE 2ZBUA 1FYWA 2CF5A 4I2NA 3ZUPA 1EAMA 1XCMA 2R11A 2YY7A 4O4HB 1Z5NA 4KYUA 4E14A 1UH5A 1TZJA 1YR9A 4G4GA 3WGYA 4DZTA 3AU9A 2BJHA 1FDUA 4I4CA 4K6CA 4B7CA 2P79A 4B71A 1KZ4A 1SEPA 5F3WB 4FFSA 4ZTBA 3KYDB 1RXUA 3HCCA 3LP5A 4ND5A 4FUTA 4B2IA 4WNCA 2FPIB 1X92A 2F8LA 4ODIA 2K2QB 1JPVA 2D0OB 3IIEA 2ODBA 1I1HA 4HB0A 4D4HA 4BQOA 4ZQHA 4F38A 4HADA 3W5AA 4DS3A 1M73E 4FONA 4FYJA 3SHVA 3M3DA 3U4GA 2O1EA 3BFJA 3GFFA 4WNIA 3EC7A 1WB9A 2NV0A 3G9UA 3MFQA 4QYIB 4ZKEA 1IHDA 2VK8A 3N1UA 5CXSA 5HIJA 4BLTA 1H2EA 3I62A 1KI9A 3QLJA 3W5UA 3QPCA 4CIDA 1W36C 5F21A 5DK4A 1VCMA 2JBHA 3CLUC 2O2YA 1HLPA 3LQYA 4TM7A 1MB3A 3JVUA 3MOGA 4J75A 2HQOA 2FWMX 3E9YA 1JEOA 4B6FA 1CY8A 4E12A 3KP1A 5B58C 4J0QA 3BMNA 1RRCA 3EY9A 3ISTA 1ORWA 3DS8A 1PTJA 1PJTA 1Z28A 3BGSA 4YBZA 1Y8RB 3BZUA 2Q6LA 2EATA 2WUVA 1SD1A 3CRVA 4IJVA 1S2NA 1W35A 1WLSA 3HDGA 2O54A 5C81A 2GNPA 3HG7A 1P17A 1XDUA 3O9VA 3ZV3A 1D8AA 3GJ5A 3I12A 4EKNB 5I7SA 3U37A 5LQJA 4ARCA 2W6OA 3C2QA 3ASVA 2AZTA 3KOYA 5CH5A 4AS3A 4B3GA 4QOSA 4ZODA 1UQRA 3I09A 3U39A 4YR9A 3I2JA 2IQ5A 1P5JA 1DX4A 1F5SA 1N5IA 2CXUA 1Y5NA 3QENA 3E2MA 4G6ZA 9ABPA 4ZARA 3UAYA 1PJ2A 4GOXA 4TKZA 1G41A 2XDYA 3P2EA 2NPIA 1AC5A 3SR3A 3FW1A 4H2DA 4BJ6A 1FTGA 4D81A 1MEOA 3NG1A 2BKEA 3QXHA 4FLEA 2HK6A 4IJWA 1P2SA 5JNRA 4L9SA 1GGHA 3LE8A 1LTQA 3D7SA 4AICA 1EP1B 1T6BY 3F4BA 4X65B 1UXOA 2G4CA 1XDSA 4EG8A 2ZIVB 4LZAA 3WGGA 1ND5A 3CA8A 3MMPA 3RUFA 5AJZA 1KDYA 4EECA 1MORA 3M4NA 4WEQA 3VKUA 5EP4A 2M6SA 3E9NA 4WIAA 4EVIA 3OJ0A 2VJLA 2PVCA 4ZK2A 3HQ4O 1R9NA 3CB4A 3QE9Y 4EGJA 1AK9A 1A72A 1EGHA 3PC8C 4R51A 4RKYA 4DLVA 3JTEA 4NS4A 1KU6A 3AB3A 3DEZA 3BWVA 2Z83A 1VLMA 2HHLA 2G9ZA 2RI6A 1LNZA 3GRAA 3Q11A 5DBHX 5EP1A 2OLKA 1WPRA 1W87A 3P9QA 4Z3KA 1GIAA 4IIEA 1I14A 1T36B 2QT9A 2DBVO 4JU9A 2X1MA 4C7OB 3H8WA 3GWGA 4KAAA 3KSAC 1ZGAA 4XX1A 3UT6A 2ZOSA 2F3SA 2ZGVA 3A7EA 1DCTA 1FTNA 2RKWA 4MUEA 3TRJA 3FB4A 2REBA 2ZRQA 3ETGA 2VT2A 1GU7A 1P1HA 4TKLA 4KQXA 4FBMA 1CNFA 4REMA 1LVUA 3L0ZA 3MBOA 4LOIA 5FIUA 5I7FA 1PR9A 4PXSA 4MVJA 3FB1A 2B4TO 4QUGA 1XXLA 4ZA2A 4YK7A 2JGDB 4KIJA 1KMNA 3DGEC 3G2OA 1V9LA 3JWHA 3JALB 5FNVF 3WWDA 5MFPA 2BH9A 1UAYA 1KVSA 1WPXA 1XDDA 4GPTA 5JMPA 3ZDDA 2XBMA 4EI2A 1SHZA 3U6BA 1VL1A 3U4QB 3VHQA 2IGBA 3BORA 1P4SA 1VRCA 3NEPX 4GH5A 4AYWA 2EC5A 1Z0SA 3C41J 4UREA 4DG9A 4FC7A 3CLTC 4ZYUA 1K6JA 1KDOA 1JZQA 5DVZA 1WDMA 1LLDA 1U99A 4HLNA 4LJ7A 5ELMA 1XN1A 2FA9A 3I64A 4MV6A 4N3AA 4JLWA 2W2NA 4M1TA 3IRVA 4YDSA 5LYYA 4UVDA 1KS2A 2LCIA 3QY9A 2LW7A 3B6JA 4ZEOA 3BB4A 3VGPA 4ZVSA 3WAKA 2HH9A 2O3QA 3KHKA 1KI1A 1ZSYA 4U6SA 1XMSA 2YBEA 5C1PA 3DZFA 4S24A 3TUJC 2AOVA 1WOYA 1NVWQ 4FBLA 3OTGA 2R8BA 4ESEA 1W36B 3SQXA 3ZHRA 3E9DA 3GUZA 2BEUB 3VZCA 5CIWA 2LP4Y 5CDSA 5KTSA 1NQAO 4L6AA 5EZ6B 1FVHA 4EO9A 1U6KA 2W0MA 3O9ZA 3H42B 1IOLA 1V8ZA 4HNTA 1SVIA 3K35A 3RKRA 2R8PA 2JJMA 3PTAA 3IEIA 2DHDA 2F3QA 2SCUA 5UKDA 2ZT8A 4PX2A 4P4GA 3E9QA 4LRTB 1FQKA 3F9CA 3VSAA 3FYTA 1GGEA 5CBPB 5FPYA 1AURA 3RBZA 2VP9A 2PGJA 1F12A 1RJ9A 3FLBA 2HU5A 2PX2A 3AV3A 5JARA 1YFJA 4X1KB 3O4HA 2R8ZA 3ZS9A 3KKPA 4KCGA 4N1AA 3IOYA 5E9QA 2AYZA 3QE4A 4MVJP 4BAGA 3VSDA 3N8DA 5A02A 4RXUA 4UTZA 4D3SA 1JQKA 8MHTA 4GLFA 4DY4A 3NOQA 2GCIA 4EHKA 3BXXA 1GJRA 5DASA 1P31A 3X1ZA 5JXGA 2IYYA 3A1DA 5K3SA 2VPWA 7YASA 4UHJA 5FWXB 4IUBS 3RFTA 1Q91A 3WLRA 3ICOA 4M9UA 4XCQA 4CR8A 1KO4A 3FCOA 4CN9A 4TT3D 2Z2IA 3NOXA 2Q7XA 4UU7A 2GVNA 4KH1A 3JWPA 2FDXA 4K5QA 5FBQB 1W46A 2P6MA 2QN1A 2W2OA 3CTMA 4IEEA 3ZY3A 4YRNA 5LYJB 4ZV7A 5DTJA 3IHTA 3MJVA 3KUDA 4MCHA 4LK3A 4NZNA 4C5AA 4CG2A 2WI8A 1BQ4A 3JW8A 4ON9A 1IHYA 3G3EA 3HU1A 1DSSG 1OXVA 1FBTA 1NDHA 2GGSA 2IYLD 3PEUA 3A36A 5FBKA 5DM70 3K0EA 1W7AA 1JUDA 3NGMA 4PG7A 5JH7B 2OV8A 2NXWA 3W06A 3H5AA 4FYXA 2WUDA 1C3XA 2FPMA 2XUDA 2H7XA 3B1VA 4NBUA 4OK3A 4UNQA 4QLBA 5CB0A 4Q3EA 4R3WA 5TS2A 3ZCSA 5KJ1A 3S1SA 3V4RA 2ZSEA 2ZYTX 4ICIA 5HOQA 5SICE 3VO1A 1Q16A 3V4LA 4ER5A 2BMFA 2K87A 4JLKA 2GXQA 4MYSA 2AJBA 1MO3A 1ZJZA 1T9ZA 2P68A 2VAXA 4RHTA 2VA9A 4YRQA 1L7BA 3EULA 1C50A 1TC2A 3OUUA 5DX8A 4HPJB 4HN4B 3WHLA 1E1KA 3JAKB 1JE1A 1LX6A 1ZLYA 4TKVA 1DTEA 1V4NA 1G9TA 5IANA 1Q0ZA 5IHPA 2WF8A 2CDNA 5AW9A 5AUPB 4OYRA 1H2YA 1ZL0A 1CFJA 2GESA 2XTJA 3NTUA 3K70B 2XXBA 2D54A 2H2WA 2O3JA 3L9WA 1B6SA 1POXA 3SYMA 3EA4A 1G20E 3GG9A 4HXFB 4C43A 1V8PA 3MAJA 3D4NA 1I0ZA 2CLMB 4LOAA 5LYJF 2D2XA 2RBGA 3Q7PA 3K2QA 2H7CA 1ZM2A 2FPGB 4HNVA 4AI6A 3NJ8A 1EEHA 4L5YA 5AVXA 3WP0A 1SRRA 5SZKB 4H4EA 3K0BA 4L4UA 3LBFA 4QOHA 5FUMA 1UJ4A 2AQIA 5FPSA 5B2FA 1XRMA 1MC4A 3HRKA 4FIZA 3HWSA 5HGJA 3TIGA 2Y1CA 5HCIA 2C5GA 1AZTA 1W96A 2CVFA 1GQSA 2OCDA 3WA6A 5J4HA 2UXBB 1CRQA 4WZAB 1GTZA 3A11A 4HD8A 4NE7A 3HNPA 3UFBA 1RYEA 4P93A 4X6UA 5IVHA 2GN9A 1RWVA 3DEFA 3EIOA 3ZHBA 2CK3D 3VOTA 3STYA 2WYWA 1DBIA 1LCIA 1WSWA 2XYGA 2OHIA 4X84A 3WL6A 2VBGA 4F1KA 2RFLA 3I76A 1N3IA 4K6KA 3VU1A 5IYZA 1IBCA 1ZI9A 5FOSA 3H83A 1XLTC 4YV0A 4ZEVA 5AHKA 4ASUD 1C7JA 4XUCA 5JWRA 2D0PB 1S3SA 1VG1A 4RYDA 3V8RA 4HWPA 2PLAA 2F6RA 3AEXA 1E98A 1GYRA 2ZE6A 3O8BA 4AU1A 4OHMA 1O97D 3H2BA 1CUBA 1NUUA 4TQGA 3C8ZA 5IDVA 3G79A 5LLSA 3DWEX 1A5SB 3S2UA 2UKDA 2Y2VA 5IP5A 1CS0A 3TB4A 3VRHA 4J9VA 2IH2A 1XMIA 1WA5A 2H48A 3WLTA 3P0IA 2OFPA 3HB1A 3OPNA 4CEIB 1LV7A 4FFRA 5IN5A 2ZSAA 1YVUA 4FOOA 4FSHA 4GPAA 3ZE2B 1J42A 4UAJA 3DVAA 3ZYCA 3FG9A 1P73A 4AL4A 3CEMA 5SZHB 4PZ0A 2R96A 2VZ8A 5TQ0B 1G3QA 2VYVA 1SC9A 1VE6A 3QX7A 3HPQA 1W0JA 2J3JA 1IH8A 3JQDA 5K0CA 3ZK7A 1V1JA 3COZA 4FDMA 1WY5A 4Q4AB 3PQ7A 2IV3A 1JEYA 2XXAA 1I94B 1JB1A 4LAFA 4D4GA 1Z17A 3BHJA 4C0HA 2QV0A 2DBQA 2RBKA 3C4QA 3E9RA 3ETCA 1L7DA 1VZ2A 3M82A 4REQB 3FOCA 5JT1A 5DYYA 4BJ3A 1AIPA 2OZLB 2A5FA 4CGYA 2VPZA 2JFOA 1W49A 3DZBA 3NORA 4DR1B 3GF4A 3DUFA 5JEEA 2BMDA 3JATB 1NATA 2BWJA 3S2ZA 1T4CB 3D6FA 4P86A 3I6BA 4PSUA 5JCJA 1ZRNA 3DW1X 1DAMA 3Q3HA 3CPJB 5BOSB 2J4CA 5LOVB 5CHEA 1FU7A 1HEYA 2PGXA 2Q0QA 4Z9BA 4A0HA 1V1RA 3AKCA 5IDWA 1I6KA 2W2LD 3PXAA 3B53X 4G9GA 4LYHA 3RG8A 3EWAA 4HH3C 4X8LA 2KI5A 3R3UA 2II6A 2GLXA 4Y2UA 5FR1A 3WLSA 4RM2A 4C03A 4BNUA 2JA1A 3RRFA 3UAWA 1GGMA 3W7VA 1AU9A 1JU9A 3IRUA 1YOVA 4HBGA 1VYHA 1KEPA 2ZIXA 4QUIA 1QRUA 3NPMA 5LXTF 2VT7A 2Z1DA 3EFOA 1PFUA 4ZYTA 1XMVA 4K26A 5JQWA 1PZGA 2WUFA 1Z34A 3ZIUA 2PIDA 4C7BA 1PLLA 5I8PA 6YASA 2LWIA 1QYDA 2ORIA 3HCFA 1N33B 1O9GA 4C3OB 1R6UA 2VSYA 2ZRCA 4ZV4A 2HJWA 1LFAA 1VCOA 3IP6A 5ERGB 4H7DA 3R0XA 3SU8A 3PGA1 3DWFA 4CF5A 4R0MA 5IJZA 3SYTA 4ZOEA 1Z5VA 3MSXA 3VTFA 2L0XA 3VNUA 2L2QA 3ACDA 4UM9B 5EXDA 4Z1MD 2WJHA 3DMFA 4RQAA 3QBEA 2XB8A 2HBYA 4Y30A 1RPZA 1UPBA 3RS4A 2EF0A 4XRGA 5DLQC 3TGLA 3W8EA 1JHUA 3CF4G 1OZ0A 3K20A 2P1ZA 2HU7A 1RRVA 3N70A 3Q87B 4X97A 5E6SB 5E8JA 2VOEA 4Q9IA 2PQ2A 2AWNA 3VVLA 3L1JA 1W5EA 2H7VA 2HIGA 3ASZA 1VRVA 3MAGA 3OHPA 1VJTA 3LDAA 1Y1KE 4HWTA 2C5AA 3U4IA 5ESRA 1G7TA 4XZ3A 1M2NA 2C77A 3N0WA 5F1PA 1MJNA 1AUXA 1J22A 2XNSA 3W4JA 1DFHA 3T9BA 5KMGB 1QP4A 2AMLA 4CL0A 3T7SA 3T94A 4KR3A 1JSCA 3EGDA 2H11A 1OX4A 2E2WA 2VDVE 2OL4A 3TLAA 2A35A 1HXHA 1T3HA 2IEIA 2QW0X 5KSWB 3PC4A 2JAUA 1KPHA 2C98A 4HNAA 1Q1BA 1D3AA 4YAEA 3ZD8A 3BMCA 4IVQA 1M2HA 4OI4A 4FD3A 4BFVA 1E1MA 3KB1A 3U7HB 3S28A 4XSGA 4MUJA 4XYGA 4C0BA 1ZK4A 5F7OA 1W19A 5CYGA 2JLYA 1EWYA 1F1BA 1UDWA 2I1LA 2EKPA 1R16A 3BH0A 1E1LA 3D54D 1C5KA 3A1WA 1PUJA 3GLGB 4DB2A 1N9KA 3RBAA 1CIJA 2YV2A 3WGOA 1LRLA 1E2HA 2H65A 4OIFA 3H2ZA 3UTDA 5KINB 1AQ6A 1Q7RA 2WKSA 2PU7A 3OHSX 1Z6QA 2GRUA 4OHOA 3EA0A 3HCBA 5YASA 3PDWA 4L15A 1IYZA 1TQ6A 5HIIA 1CDEA 3HVKA 1I2BA 3V7NA 2PKEA 2J6HA 4BPRA 4DJFC 1TM1E 5JAIA 5HRUA 4RTOA 2PUGA 3UMMA 1HR0B 2ODPA 3IX7A 4H9GA 4MVJF 4EO4A 4W99A 1XROA 1NUPA 1GTL1 4PQFA 1ZYUA 3FPJA 1CUIA 3ZV5A 1GL7A 1N2IA 2YRWA 3A6EA 2X5XA 5DEOA 1U7UA 2G9UA 3W5JA 2ZSUA 3R5HA 4YCBA 5FWDA 1K66A 8AT1A 4QGFA 3V4ZA 4FSXA 3MLAA 4HX9A 2HGSA 2BE7A 2P4SA 5DX1A 4L0QA 3WZ2A 2PPLA 1B8NA 3QMPA 4RANA 2OGUA 1Q1GA 1DIRA 2O0KA 4QHSA 1KGSA 4E13A 1WO8A 4BASA 1F6BA 1G3RA 4PG6A 1KI6B 1DPGA 1XZJA 2Z98A 4Y18A 2F1KA 2EXXA 3SAJA 1K3FA 3WKCA 1UT6A 2D59A 3AHEA 2DCMA 4PO9A 2EJBA 2X8BA 2ONZA 3W5DA 4R68A 4O4HF 3OU7A 2C88A 5TV2A 4A8TA 4FJ2A 3OQJA 4S1TA 3V9PA 4BMXA 3MN1A 4MINA 3DHEA 3HI4A 3ZHTA 5KNCH 3WRXC 2O57A 2ZPTX 3Q7RA 4DRXB 2ACKA 1Z7BA 1K4KA 4RCZA 2DHQA 1P9WA 5GIOE 3SI7A 2W2LA 2BTOA 3DHWC 3F97A 4FFBA 2H1IA 5ADVA 4PLFA 3SEQA 1US8A 5EIHA 4EGQA 2WNHA 2C9MA 2UUPA 4NPCA 1S2GA 1BS1A 1XVIA 5FUWA 5EIEA 5BR8B 4XOIA 5A9TA 3VU0A 1O96A 4Z4HA 4FXOA 3BOSA 5C2JB 1ABEA 4CYMA 3D1JA 3HP4A 1E94E 2X58A 2QNRA 5GONA 4BQPA 4LTMA 1ODTC 3DBLA 1X1RA 3E23A 4LYJA 1D4OA 3DFMA 3H7AA 1BS9A 4HAUA 3B1FA 2GDJA 4HFRA 4ND8B 2CVPA 3T7TA 3V2GA 2XBUA 2ZB8A 4DCGA 4PZEA 2NADA 1LKZA 5EJ6A 4KXQA 2JIZA 3S8MA 4CKCA 1ZA1A 2LCFA 1NJFA 3F8SA 4YRZA 1UP7A 4N3GA 4CL2A 3C7AA 3I6IA 1JP7A 4HLDA 1QHSA 4J6EA 2JLVA 5EHGA 3N6XA 3W8NA 1PYOA 3DXFA 4OHKA 2C03A 2C1ZA 2VWHA 1E2BA 1SCQA 2KW5A 2QB5A 2KBFA 3K0CC 4EHIA 2VJAA 3CW9A 2DE0X 1R12A 4LUCA 1DPFA 2YV1A 3F5QA 4LNUA 3TQIA 4MOWA 5HZKA 4JI3B 1XTRA 5LFAA 3I39X 3QFRA 4K1XA 2FV8A 1ZVJA 1PR0A 3OCZA 4PO1A 4WBSA 4JP1A 3ROPA 2ANCA 4G2TA 3TOXA 4PXAA 3PJFA 5CA0B 3JR3A 1TXGA 2Q8QA 4DM4A 4G5GA 1FFDA 1ZK0A 3WJ1A 3RAFC 2C7RA 3ZNQA 2G40A 2CBXA 4P6VF 3OIFA 3N2NA 4DJTA 2WC1A 2G1AA 2WHQA 1XU4A 2HA7A 4WI1A 5EWJA 1U5CA 4E6EA 1E3DA 2VTKA 3QKUA 5FH9A 1AOXA 1QV9A 4LGMA 5E0KB 2VXBA 4N03A 4F4DA 2NUBA 4MA4A 1P6UA 3JQGB 5JRJA 4MVXA 4PGMA 4XDYA 5JSZB 4FT4A 1S2DA 2DY0A 4M89A 2NU9B 3SP1A 3S5JA 5DB4A 4ZT6A 1DHRA 1U3VA 3LU1A 3OQ1A 3BXFA 4DBZA 3WIUA 1TGVA 1YC5A 5G3YA 2F1OA 3K09C 4NNPA 4B40A 4Q24A 2FSGA 2EW2A 4B4VA 4A15A 4BU1A 1T6XA 1NR5A 1HURA 1R4ZA 3PNSA 5SYNA 5BV0A 3JQRA 1GAJA 2V5VA 2EFHB 2ZEJA 4IDGA 4FC6A 5CW2A 1KMCA 5A62A 4LNAA 4CI0B 1HYGA 1VL5A 2JBWA 1TJ5A 2QJRA 2H7YA 3DT6A 3QU9A 1AKUA 3Q3IA 4RPHA 3LSTA 2UV8A 3LX8A 4L4RA 1GPLA 1OXKB 2GBPA 4K2HA 4TL8A 4XWAA 4ZALA 2HR1A 4TRJA 3VMFA 3QXCA 2DFDA 2IP4A 4JQSA 3CONA 3GV0A 2NU7A 4KQEA 5DYIA 5LLDA 2EP8A 5CVEA 4W1PA 1T2EA 2HY7A 3FCAA 4GYJA 4QRDA 2HFKA 1XNRB 4RMIA 2IEYA 3ST7A 5AJTA 3IP3A 2PMCA 4IGKA 3WHIA 1ZSVA 1XQYA 2EV9A 4GL4A 4NYMR 5CDHA 5GZ3A 2I66A 3BM5A 1EZ4A 3LK6A 3OQ6A 1R1DA 3OTHA 4L22A 4AWBA 4ZZ0A 1PKEA 1XXHB 1IK4A 3I45A 2C99A 4IZIA 4EHAA 4BXOB 3GLHA 4MXDA 3PXGA 6LDHA 1H8HD 1H2HA 3K05A 5D3MA 2A1UB 5I6DA 1P81A 1SIOA 2Y68A 3A37A 3COVA 3MWGA 2WTXA 4YAWA 2F1HA 4ZVMA 4I3FA 3NJ4A 3K2EA 4QYIA 3ORFA 2IZZA 2AT1A 5JNLA 3TXXA 3ZZUA 3P97A 2XOEA 4D99A 1DAIA 4KLZA 5GZ1A 4WLUA 1KMIY 3V4PB 1EE2A 1C0KA 1OV6A 1DAOA 2BJVA 2N42A 1QH1B 3RNOA 2O23A 1FFCA 1TLLA 1GA1A 2V7GA 2JAQA 4I66A 4E08A 1SZCA 3UANA 4E2FA 5JRDS 4L0MA 5HE9A 5CLLA 2WILA 1AY0A 2W6IA 1R0SA 3GLVA 3AI7A 1SQGA 2AD1A 3C4VA 4OB6A 3K0CA 2Q3EA 4OF4A 1CVIA 3GCGA 4MJXA 4YO8A 3DBHA 3NHWA 1C4WA 1UBMS 3BMOA 4P08A 4H4CA 5CVJA 2BCEA 1ULTA 2XNKA 2XRMA 3IKMB 1KY4A 1XMPA 2YNMA 3PI6A 4GX0A 2RGGA 3NCTA 3E8XA 4MPJA 4HRYA 3GUUA 1RP1A 1E2JA 1BVRA 1X0VA 4B83A 4KO8A 2OAQ1 2WJIA 3ZU5A 5KNBH 1THZA 5CJJA 3S68A 2AMFA 4EYEA 5JZOA 2G28A 5EZQA 1ZD3A 1RABA 3OAAA 5I7OA 5LQSA 2XQKA 4Q9LA 3OOEA 3SC2B 3RYCA 4TZKA 1K68A 5EKTA 1OLOA 2WW8A 3LBAA 1C4KA 1Q7TA 5AUOB 1DX9A 4GWLA 4R2IA 1NKSA 3DLBA 3D43A 3V46A 4EMSA 3DV0A 2C2WA 1KNQA 1DCFA 1YQTA 3QMVA 4EKIA 4EPXA 3KZKA 4U3JB 5LWQA 1YE3A 2PXXA 3JYQA 1XKTA 3PIDA 2HYDA 4DA8A 3WKAA 4IDHA 3AY6A 4DWJA 2C7OA 3L82B 1U7TA 4C76A 3AEYA 2P9HA 4P82A 4YAUA 1LSOA 4LXHA 1FU8A 5AIAA 4B6RA 4DCPA 4IIJA 4DPMA 2PV7A 1OLUB 3B5JA 3AFGA 4EI7A 5LP6A 3LK7A 1J25A 4WQMA 2DECA 3EEOA 4QVGA 2XRZA 1SXJA 2FPRA 2G0NA 2J7KA 2C7BA 3N2ZB 1RYMA 1WM1A 3PQ4A 2O50A 4P81A 1SCJA 1NT4A 4EG6A 3HJFA 1BEZA 3PEYA 2AR0A 2CJWA 1PCXA 3KKOA 5LU9A 1R4MB 3NIWA 1W44A 3AUFA 5LMCA 2CVOA 3DBIA 4JC5A 4MR7A 4O4IB 1HSOA 4HKTA 5AI9A 3SGLA 4J1TA 2PMBA 3LCCA 5T8KA 3R0QA 2YJGA 3LQ4A 2VZ0A 3MTIA 4L5AA 1RAEA 4E2XA 1IHXA 2UUCB 1CWUA 2MDTA 2G17A 2EQBA 4KFRA 2JFZA 2GTPA 1YONA 4F5WA 5K99A 4X3CA 4NOLA 3I1FA 3HWWA 1JMKC 2QRZA 4B3RB 2FPPA 3OPYA 2G36A 2CVQA 2BGMA 4QXRA 2Y6UA 3EF3A 3GROA 2M1XA 3SY8A 3TBHA 1KI6A 2IE8A 2ODNA 4HDSA 4MWEA 4RQBA 4NR0A 4ZCQA 4QXOA 1NE7A 4JQYA 3IEXA 4EFKA 3C87A 9ATCA 5CAEB 1JFRA 3ZD9A 1OZGA 5JAPA 3VM6A 2QL7A 5FULA 5JS8A 1M2VA 5FDFA 3WYCA 3PICA 4OBEA 4QSHA 2B99A 2O6LA 1ECBA 4IDDA 1WEHA 1A9QA 3CWCA 2XI4A 4GIBA 4NKRA 3UJ7A 1Q19A 2YBDA 2RGAA 3ESXA 2VJKA 1H2WA 1D03A 2W58A 3KFLA 3L43A 3GLFA 1A2KC 3QPWA 1L5HA 1Y8AA 1H3EA 3WLAA 1E3IA 4MR8A 5KI6A 5AT1A 3PCTA 1P77A 4HB4A 4BX2A 1GZUA 2J6IA 2Q9UA 3LBHA 3T5CA 3MRVA 5FNVB 4NDZA 1XRJA 3C3DA 5J5VA 3K9GA 4TLEA 1ID8A 2XQJA 5D5QA 1A76A 1XA0A 3DBLB 3S27A 1TTHA 1J2EA 1BD4A 1WUIS 2ENWA 3DCYA 1N25A 4LJ6A 3U17A 3DVSX 4A1FA 5F5NA 1VGVA 1UBRS 1RI5A 3A0RB 4FUQA 1UBHS 2WZBA 1R6DA 3NM5A 4MP8A 4O8CA 5CMLA 3SXJA 1PT6A 1G8FA 2I67A 1B26A 4AZVA 2FETA 3SVLA 3LUJA 1D4AA 4NTZA 3P0HA 4HF7A 3TVYA 4HEJA 2BJWA 4UULA 4RVOA 3ME5A 2XHEA 3GJXC 2QUIA 2BHRA 3AJ8A 3PNKA 2HDWA 2D1QA 3C3YA 1ACLA 3RFXA 3O8LA 4CM9A 1Z56C 2MSDB 3QJGA 1U8CB 1ZZEA 1A9XB 1NSFA 1E3SA 1XQ1A 2GZRA 1KMHB 3N07A 4KH0A 1QZZA 3CG0A 5ER9A 4FKMA 4AK9A 5TEVA 4XXHA 2CUZA 3U3RA 1SZDA 1S8AA 3FYSA 4X00A 4HVCA 1K7YA 2Z0MA 3GA7A 2O59A 1A27A 2O0MA 5KKAA 3THXB 3AHCA 1N0VC 1WW3A 4BEJA 4HLUC 4HNHA 4D4IA 3IE0A 4DKJA 5FI1B 2YKGA 4GMGA 2GF2A 4NXMB 5J2UB 1SD5A 3SD7A 1DDOA 1P4AA 4HAVA 4LXQA 4HWKA 1WZ2A 3KT3A 3T0GA 3H2SA 3GAZA 1JQ3A 4KSYA 3R0VA 3ZDFA 1I8TA 3KEFA 1BOOA 1FRFS 4JI4B 1Y4DE 2GEVA 1WETA 3F3SA 3NASA 2RGRA 2VPTA 3BGIA 2GETA 4GP9A 2DFLA 4ONEA 3ZX5A 2BPOA 1GVNB 1VE9A 5DI3A 4EA6A 1LDMA 2QX7A 5JIBA 4GDMA 1K8QA 1S8OA 1YF3A 2BGRA 1QVRA 3N6RA 1WXEA 4QATA 5GGXA 1YS9A 1UINA 1G291 3AV0B 1DT5A 4G5FA 3JX9A 4J16C 2VSNA 4PBSA 5BR4A 2CV0A 4B34A 4EVSA 3JQPA 1RKBA 4AJ9A 1ZD5A 3MUNA 2R79A 2V6FA 1E92A 3P71T 4ZAFA 1NNSA 4Q4LA 1QO9A 1XEXB 2O8FB 3FBWA 2CJFA 4KPGA 2X2EA 121PA 2XWSA 2RI0A 4PGFA 2GZHA 4WTOA 4EY4A 4TGLA 1UMBB 2EBFX 4DBVO 1PQWA 4Z2AA 2XITA 2GZDA 1AHIA 4MUIA 2EX0A 3PR2B 1G66A 1GPUA 4LSGA 5AD1A 2V7EA 5EHZA 4YP9A 4EJ6A 3OFKA 5MDHA 2I6SA 4MO9A 3ZDAA 1QV6A 1AXGA 2G80A 2X8JB 1ZOPA 3OMLA 4PX9A 1HE2A 3NHUA 1LF5A 1GRCA 2AUNA 1SHTX 3VKGA 3WLMA 3QKTA 4PIPA 2FR0A 4O08A 1IN6A 4M1WA 5IJ0A 3LDHA 1CZHA 2W2MA 3CSDA 1XMXA 3QF4B 4UASA 5LQUA 1AF4A 2JPDA 2WSYB 2W6CX 1N5JA 3NXKA 1ABBA 4LJ9A 5BN3A 4HQ0A 5J1SB 1F0YA 1S96A 4LMBA 1IOZA 1R2QA 3E9EA 3NYQA 1EDEA 1B2LA 3G7NA 1ETUA 1T0UA 4XVQA 4MVYA 2VHJA 3ROFA 3FFBA 4X6LA 1XFDA 2WM3A 5BQFA 4ACAA 3JVIA 3ONEA 4AT1A 2QMUA 3WI7A 1JNYA 1NVKA 4GOND 2DUMA 2C82A 4HEHA 4FFDA 4IQ0A 3X1KA 4C3VA 5FUQA 4OP3A 5B3JC 2QVCA 2OCAA 3HY6A 3OP4A 3E81A 1KO5A 1AGRA 3AETB 4MMXB 3RQSA 3PQ2A 4XTCS 3K0AA 1SVLA 1ZJYA 3FAKA 1S2OA 1DV1A 4WW0A 4MUAA 3IKVA 2OCKA 5B7NA 1OXSC 3WGVA 3DAGA 3T7CA 4UBIA 3C3EA 2AOUB 1M66A 2QE7D 4PZLA 1CSEE 5DTQA 1T2NA 4YJFA 2XNHA 2HZ7A 1UFRA 4TWAA 3NAMA 2DFKB 4F3CA 2FRDC 1WKCA 3W3AA 4Q9KA 2QR3A 4LCJA 2PA3A 4UDNA 1W9MA 2ATCA 4KVAA 1NHWA 4S1PA 1IPFA 3CXRA 1BWSA 4ANFA 1NA5A 1YQ9A 3N2GB 3OLXA 4RJ2A 5DGHA 4ARZA 5KPJA 1DLIA 3NTXA 2XWJI 4JBGA 2EKDA 3ZDZB 4F4FA 4J1TC 3W8FA 1NRWA 1K8YB 1VE3A 3KV3O 1U1DA 5LBIA 3DAPA 2Q0HA 2EIHA 2FWRA 3KSZO 3UG7A 1WVIA 1RFGE 5CBPA 5AW0A 4CKBA 1IU9A 1ZEMA 1J8QA 1OAOC 1GUZA 2FRXA 2UYQA 3EISA 3NKLA 3OQOA 2EG5A 3HJUA 3OVMA 1IY8A 1IZ9A 1DXQA 1Z75A 4JSYA 4KPYA 1L5WA 1KNXA 3HYTA 1MTZA 3FYCA 3KVNA 4X61A 3WOHA 2Q6TA 3X2SA 2XF2A 3UNXA 4MV4A 2YCBA 3CB2A 5CUQA 3UHPA 1I3KA 3ZTYA 1GADO 4D9CA 1U02A 1V5FA 4DA7A 2JFNA 1RXSA 3H9BA 5K6AA 4IHJF 3H87A 4C5CA 4MIEA 3L8FA 3ZXUB 2HWKA 3SIWA 2FZ4A 2F67A 3RU3A 4M1SA 3MW8A 1O94A 3K6RA 1WQ4A 5ES3A 4WCFC 4Z7NB 3CW2A 2ZTUA 4G07A 1X7WA 3OCCA 2QTVB 4TTRA 4RKFA 3W3ZB 4INAA 4MAMA 5AQ1A 3IQEA 1NXXA 5IJWA 1RMYA 1B76A 3N0XA 3E0QA 1W73A 4M1QA 1MC5A 2ZBFA 5DM1A 4BRWA 5DH9A 3CUWA 4TT8A 1R4NB 3DAFA 1N75A 5MN5A 3K72B 2Q0SA 1G4AE 3OWHA 4II2A 4B33A 4B0OA 5A4AA 2A9QA 2WOJA 3MWKA 3SIXA 4WZ6A 1E1QA 2ZP1A 3VV2A 1NJSA 4OBBA 5B7PA 5F77A 3B51X 4R6WA 4ZVTA 1SIUA 3TG8A 4ZOBA 1BCRB 4BLVA 2J9ZB 2GKOA 3ZDEA 5GM1A 4UEJA 1R6TA 2AOTA 3N59A 5B37A 3GG2A 1FSZA 5ESDA 2JGFA 5AVTA 1NI4B 3RFFA 3TOVA 1V8BA 3BG5A 5JS7A 1VG0B 3IT0A 1O0SA 3VHXB 2IUUA 5AHXA 2QT1A 1CPYA 3AJAA 3IV7A 3DA8A 3KU4A 4JU8A 1E3WA 4K46A 4Y2YA 1JIJA 1Z7GA 2BTEA 1CZKA 2QE6A 2NUTB 1HDGO 1LVGA 1PNTA 2I9PA 3NV9A 1L7VC 3FYUA 4FMPA 3N2KA 4WD3A 3ECAA 3L0IB 2P6RA 4DB4A 2GSWA 3HUEA 3BTOA 4XGIA 3HUUA 1P4GA 1Y81A 2ISCA 2CNOA 4NCJA 4ESVA 1X70A 2MYUA 1JVNA 1J33A 3S7TA 1YKGA 3SBEA 3U62A 1U4SA 1U9IC 3HVHA 4QGBA 4FMCF 2QTWB 4MWTA 4OQZA 3AEQA 5KYVA 4G24A 3MOIA 2ZUVA 5B4VA 2XVZA 4Q00A 3THSA 4L5IA 3I2IA 1RKQA 2OGZA 4KFTA 3OZ7A 1QG2A 2M1ZA 2QPAA 2Z6VA 1N2OA 2HLNA 3ZJ5A 3RS8A 2P90A 3UW3A 4Q15A 1L5SA 1RVV1 5K05A 2OOKA 1EINA 2JGEA 1OYVA 3PI7A 4GNKA 4JGBA 3UPDA 2B98A 2PXCA 3K1TA 1FXWA 3MXTA 1MQSA 3O1IC 5JG7A 1YU6A 1E58A 1PAUA 2I87A 3VMMA 3LX5A 3ULKA 5K0TA 1JHZA 3K7EA 1G3IA 3CZMA 1JH9A 2P8JA 3RVNA 1JX6A 3HZZA 3H9UA 1SB8A 2NOAA 4RTQA 4CMCA 2RJNA 2GWHA 1ADFA 4ALLA 1UJ2A 5C53B 3A1EA 3W2GA 3QVWA 5AVSA 4M0UA 5DLYA 3TPCA 1A3CA 1VIMA 2GHIA 4LWPA 2LRHA 2NZJA 4MVJM 4QT0A 4ZCTA 4UTRA 4RPLA 1KS9A 5JAMA 5BRNA 4LYYA 2C8JA 2ZS9A 3AF5A 1EX7A 2J32A 3OQHA 1SPXA 3U56A 2C7GA 1D2NA 2VP2A 4NFYA 3DMHA 3I9V6 2V7PA 4UEOA 5DHTA 5G1NA 2MCFA 1N2ZA 2JGJA 1KO7A 4XWTA 3X0DA 4E2ZA 4F6LA 1TM2A 3HKBA 5BMVA 3VJRA 2VOJA 4BNGA 2PGNA 3L92A 1GPDG 1AG9A 4LXGA 4TKUB 3FDJA 2PYIA 1RHJA 1UBFA 3NUGA 3AVQA 1MX1A 3O3CA 5L3SB 3W9YA 1DHTA 3DONA 4FU0A 2NP7A 4JUIA 4R81A 4DMGA 4P7KA 5B6JA 4DUZB 1UPXA 1REQB 2E6UX 2YWRA 1U2PA 4M9QA 2J59A 3BIXA 2OORC 2VYNA 4I3HA 2R6AA 2DJIA 3K09A 2PNJA 3KOZA 3TDMA 1DKRA 2PD4A 2UAGA 3IAAA 1OPXA 3JVVA 4RDXA 3OE7A 5GADl 2MWMA 2XE8A 3NYIA 2AS0A 3NDPA 1JLKA 2PL9A 3ILVA 5AOBA 2B8EA 2FJUA 2J3QA 3H99A 2JCBA 3KKEA 5GP1A 3UWSA 1MNQA 1QRAA 1RTTA 2D1TA 2PSHA 4GLOA 3RYIB 4M8IA 3RHSA 4F4IA 3PLAE 1VL2A 4WK4B 5JS1A 3OJWA 3CF6R 4WLNA 5K4AA 3HA3A 3B9QA 3BIJA 4GKAA 3THWA 2JHAA 2PUVA 1NLZA 2QP3A 4JYBA 3H19A 3JQCA 1OIVA 2P62A 3DEKA 2WD7A 3G8BA 2RHMA 3OLWA 2OE2A 2Z2YA 3FKQA 3UGQA 3P96A 3RLFA 4B3XA 5HMMA 3PVZA 5LU8A 2O19A 3PGMA 3OY2A 1CJUC 1XZEA 2A0YA 4MYHA 4RA6B 5E6UB 3VR6A 5JJBA 4UE2A 2ACVA 4LWQA 4PAOA 1OF1A 4AJHA 3LKVA 4V3CA 2CE7A 2WTBA 3QF4A 621PA 3TQRA 2MJLA 3D64A 1Y4UA 2CMFA 4W7SA 1XF1A 5H02A 1ORTA 4B1FA 2V9PA 4ILEA 1AKEA 1EK0A 2PY6A 3RROA 1JFSA 2HWUA 2BZSA 1IM5A 1DKPA 3ZY6A 3L7LA 5LA6A 4B6EA 4UBJA 4LFBB 4NV3A 1M3SA 3NEJA 3OLVA 4CMJA 1L8XA 4F72A 5FI0B 3HLYA 1PS9A 2VHZA 3B1WA 2NAFA 1H6BA 4HS9A 1N6HA 1ZXBA 4OKNA 1TVKA 4G4SP 3CF0A 1S8FA 5B1IA 4IFIA 1TOAA 3UC5A 5D6OA 3NM4A 3NDJA 3FCXA 4U4AA 1EVKA 2X7JA 3K0AB 3H1PA 1XP5A 4Q1FA 5IZCC 5LOVA 2DKFA 3TJRA 5FOVA 2YMPA 3DBVO 3UKJA 3EZ9A 1GCGA 5E9AA 4YT4A 4QM6A 3L2OB 3EVCA 4HX2A 1YQDA 5A4IS 2GJKA 5ADWA 2O4UX 1Y34E 4IDEA 4DGQA 2NWQA 2EKZA 3E5NA 3QWBA 4RU1A 1IB0A 4BDTA 4M86A 4HAWA 1IBKB 4W5JA 2PL1A 1CFZA 3FUTA 3EXAA 3ON5A 4XRRA 4LFCB 1SG0A 5JAQA 1OR8A 3IMGA 5JSZA 4YCNA 3HJAA 4K9RA 5AW8A 4PTLA 4MSUA 1NDQA 4UNSA 1J2UA 3E61A 1Y3HA 4TQUS 5BQXA 2GAJA 2GJ9A 1X1AA 2BEJA 2YJ4A 3E9MA 3PGXA 5IN4A 5IXJA 1PL0A 1YBVA 1YDWA 2MINB 3FOBA 2AR7A 3OBBA 5AK3A 4ZRNA 1IBMB 3PEFA 3WDSA 1GN8A 4CV3A 5AW2A 2SICE 4QU8A 3ECSA 1M1UA 2FW0A 1E2LA 3I28A 4X3PA 4MYUA 5LP1A 1BAPA 5DTRA 4EATA 3TF5A 4M1KA 4N7RA 1PDOA 4R31A 5AJXA 4ZREA 4AY6A 1RWKA 1YI0A 1D1QA 4HAXA 4WA8A 4I1UA 4PYIA 4WKGA 5E6SA 2CV1A 3UJHA 2JAXA 1ZBDA 1GQYA 1N8KA 1PWYE 4R1LA 4ZZ2A 4C08A 1B6RA 5CB4F 1S2IA 3U4MA 3VZBA 3SC3A 3ADBA 4OP1A 4NFLA 4FFVA 3VDMA 2IOHA 1ZDMA 1C7QA 4CM7A 5AK5A 3E0XA 1BFUA 5DCYA 4JIMA 1OJLA 2M32A 2XT0A 4HZUB 1JQJC 2VQDA 1E9BA 2UYYA 3S2GA 1BRTA 1RP7A 3RTBA 1VE7A 3CGGA 3G2NA 2ZUWA 1SZJG 3JQEA 4W7IA 3LIPA 1NC3A 2PFGA 4IAOA 5ESWA 4ARBA 3HSYA 4ZJYA 4ZXFA 5K8VA 3C6YA 3IMFA 3ND7A 3BMNB 3FWHA 3LQ2A 4O02B 4DLPA 1TVEA 2R2GA 4ZOLF 4JVSB 4HYYA 4OA8A 3FM9A 1GKYA 1QH8A 1VA5A 1WL8A 2WIDA 5CDGA 1FNCA 5JXWA 4IH4A 5HQ3A 1MEJA 4EAQA 3LWNA 3PQ5A 1BEUB 4INZA 4MVJD 4WKCA 5HJ2A 4CDGA 5C5EA 1II8A 5ANRB 4WOBA 3VPBA 2O2ZA 3KUCA 5JU6A 3ISJA 3FHTA 1JKXA 1QGED 2HSDA 3E15A 3IQFA 4GICA 4KVFA 5FLKA 2DU8A 4FI3F 3RYIA 5AM3A 3BBPA 1DZ3A 4HEQA 1E79D 3GQBA 1N2BA 4WXRA 2NSJA 4B6SA 1UFKA 5K9ZA 1ND6A 3FNIA 4DIUA 5KO2A 2W42A 4RZHA 2WKQA 4LOJA 2GZSA 4M0EA 4DUYB 3HVIA 3OEWA 2Z8YM 2FPXA 1MU0A 4FEYA 5DE3A 1QVWA 4UPEA 4CCYA 1Y3BE 3WSWA 5K3EA 3EPHA 1AH2A 1CY6A 3FYUB 5EEGA 3VBCA 4EUEA 3EDQA 4Z49A 3WL5A 5FLEX 4D9MA 3BXPA 1WBBA 3PC3A 4N9WA 2QV7A 2XMZA 3DLHA 2H17A 3BXZA 3U19A 3C4JA 5H1YA 3KDSE 4MP6A 3FSRA 4UKDA 5GONF 1DWQA 2XD9A 4M8LA 1N1GA 3BJZA 4JL6A 4X6XA 3KD3A 5DNCA 4W82A 4U7HA 4I9HA 1FB5A 5FBLB 5F7JA 3MGGA 3ONWA 1T0HB 1EVLA 1QC5B 3DG9A 3VPXA 4BBAA 1DEOA 3FDXA 3J81A 1L3CA 5DJ5A 3BKXA 5EMMA 4QU9A 4A0QA 4AMBA 1Z0FA 3TVTA 5KWIA 1EFKA 4Z8YA 4DLLA 4Y1RA 2FDRA 5ALJA 2YZ2A 1VJ5A 3O8QB 1CB7A 3IE1A 3QYPA 1U7PA 4GZMA 3DPSA 1GUFA 4P9NA 5I3CA 3H6GA 4X8OA 2RGXA 1YB5A 4P31A 5EJMA 5M2QA 1CK4A 4HH1A 3QQPA 2NUPB 1USKA 1WZUA 4EY5A 4R41A 1PT5A 5CIQA 3CZPA 2BN4A 1U8EA 2CL0X 2XGGA 1C8LA 5HCUA 4CFSA 4UFOA 2J0EA 3OJLA 4IHQA 3N7TA 2Z43A 4MAAA 2ZZNA 2N0SA 2YICA 2NP6A 5ITSA 1I7NA 4DF3A 3JQ8A 2E5WA 1O96B 1TM7E 4F06A 3GDOA 4V0NA 4JJFA 4I4IA 3SWWA 3PUWA 1FVXA 4LI0A 4DQVA 2XUZA 3DLTA 3PIRA 1OY1A 4OK5A 2VJBA 4WJLA 3A2MA 5GMOA 3CZAA 1OZFA 4B7XA 3U60B 3PUVA 3TH5A 4MRMA 2WJVA 4L74A 1E1QD 4HWSA 3CW8X 2ZR7A 1J56A 1F51E 1NVTA 2MMGA 2UZ1B 4GSYA 1UOOA 3THOA 2PS9A 1TUIA 4W5HA 3IXQA 3G5UA 4K6HA 3W1VA 4F97A 1P3DA 1ADJA 3LKDA 4TX1A 4UCWA 3UJCA 1ZJ5A 1JJIA 1I3MA 1T3SA 3R3ZA 4YJGA 1GO2A 2BFMA 3AF2A 3GGJA 4V0KA 3WRVA 5GZ6A 4EPRA 1H2ZA 2C3MA 1I7DA 3DTVD 4HTAA 4X1OA 3II6X 2EWWA 3L4EA 1VA4A 4M49A 5K8UA 1TU4A 1VBNA 3O3MB 3F0TA 2ZIEA 4IWYA 1P0FA 2WF7A 3R6LA 5IT5A 2C2GA 1KVRA 3AH8A 3EVFA 4GKKB 5SY4A 5IAAA 2R1ZA 4GOLD 4LGCA 2G9QA 4F7WA 5CVTA 1FYEA 3OJCA 1I9CA 3BZBA 3P5SA 4O4LB 3RFCA 4QKQA 1G7SA 1A77A 3OIDA 4WASA 2NT3A 1EJ2A 3PDHA 3ZE1B 3BGVA 1XXHE 2OC4A 5DN9A 3ETLA 1G9SA 1LDNA 1T9KA 3SYLA 2DHCA 4ZANA 4RJJA 4U2DA 1W85B 2OGTA 2QG9A 1YGYA 4KLAA 2ZAGA 4C7KA 5I5GA 1O6GA 3KEGA 1BN6A 4L9WA 3GLFB 3EHDA 3O1JC 2BF7A 4LZLA 2CXQA 1DC7A 5KVCA 3B78A 3A6DA 4OL9A 5CFLA 3W5BA 4A8JC 1UWVA 4X63A 1PZEA 3F5FA 3L0OA 3L6RA 2PUWA 4L4XA 4PC1A 1Q5PA 3U40A 3T3MB 3DTVB 1YZHA 2RKBA 4KP7A 5ALPA 2C31A 3NM6B 1O95C 3SZGA 2Y93A 1IOVA 1UPCA 3BFKA 3L8EA 4P80A 2SCUB 2UUBB 4FWTA 4C4XA 1W0KD 3HCOA 2F17A 3ZLUA 1YJQA 3NAGA 4RE6A 3E1SA 3D31A 3EGCA 4ZRMA 3W7AA 2FHPA 2RK3A 3NP9A 4D96A 3E3AA 1EE9A 1M8KA 4E09A 4F3KA 4BFXA 4LRQA 2AEJA 2E55A 1C7EA 3UYKA 2NZXA 2IP2A 3J7TA 3PENA 1YB7A 3VC3A 1V37A 4O2RA 2D8MA 2Q3JA 1DBVO 4RENA 5IJXA 3RDPA 3KQKA 3C1UA 2WIFA 4FINA 2NO7A 5U1PA 2G4VA 2Q4EA 2QXYA 1R0KA 1SC4A 2XNJA 3IBSA 1WCIB 3OX1A 2RHLA 1OA1A 2IFTA 2P9CA 2ZQ5A 3R0JA 4PHGA 1MEEA 2ZVQX 1H05A 4RF3A 2Q6VA 7REQA 2I7DA 3CKLA 2IH5A 1XTUA 3PQEA 4UE3S 4JITA 5TJ9A 5KJFA 1CUWA 4L27A 3L07A 2FN9A 4IHKA 4JLJA 4R0NA 1XTZA 3HCWA 3PWZA 3V00A 2HSJA 5C8YB 5EUCA 2OUKA 1A98A 3ITDA 4J3JA 3U7QA 3RC2A 1WUJS 2ZITA 3O93A 2FN8A 1SUEA 1GR0A 1H42A 3C14C 3G17A 3N87A 3S7ZA 2IYUA 5LM3A 3PX7A 3GAMA 4P54A 3HR4A 4ND1A 1NYQA 2HBQA 1DG3A 1JDJA 2JIBA 2FH5B 1CNEA 4H1VA 4X7MA 4O2AB 4BWGA 2VJNA 3IPCA 4LMPA 3QEOA 1MB9A 3QLEA 4ITUA 1CS0B 2O52A 5LUAA 4QZVA 3HYRA 3IFSA 1U94A 3R3WA 3STXA 4AP5A 3Q6NA 2H1WA 3GCDA 2QTBA 2NU7B 1VZ3A 2YWCA 3TNDA 1GQFA 1IG0A 1P1FA 4RK1A 1WZEA 1Z2AA 1P75A 5AM5A 4IRXA 1AKRA 1C14A 5BUQA 1T5LA 2JGNA 3EMBA 5FCDA 2VRWA 2V1XA 4BFYA 1ZRMA 4QECA 1OU0A 1NDUA 3CH6A 4EWLA 3OTOB 2PM8A 3IQHX 3PS9A 1Y6GA 2PQ6A 4BX3A 5BMVF 3M6IA 1QF7A 2YXBA 3EASA 3V1NA 3IKTA 5HKKD 2KE5A 1WAMA 2Z3ZA 3L7OA 3HO1A 4J94A 3A32A 1E18A 2YX1A 5E7JA 3S5UA 2HM7A 2AJDA 1AKWA 4EYKA 3CNQS 3H3JA 3Q2KA 1GOTA 4YX9A 4E4RA 3IUSA 1NMZA 2N47A 4RH0A 4UTXA 2GN4A 1TA0A 1EGQA 3LBNA 4OO3A 2CZQA 2IK8A 1E7WA 2WHRA 1DIAA 3I04M 3FWYA 4PR0A 4TMTA 2VF5X 1CZUA 1TQHA 3FPFA 3CLTD 2WT8A 3KQVA 4ALIA 5BWLA 4GX1A 1OXTA 2HLHA 4Y9DA 1DRWA 2PANA 1E0DA 3PXBA 4LYAA 1ONSA 1IN1A 1DELA 3NBUA 3MTJA 2NV2B 1ZMBA 4HI0E 3ANLA 5A4MS 1HE8B 3OEYA 4CLOB 3DMYA 4Q1CA 4LE0A 4RWEA 3RIGA 3NFYA 1YKFA 4QUDA 1Y3FE 2V4ZA 2ZUSA 4CZ2A 5JECA 4UBLA 4MQMA 1AMOA 4I1OA 1YS2X 1F7UA 1FJHA 4I8IA 1F2TA 2O8NA 1GILA 1WHTB 1WJGA 1O4WA 2A84A 3C7KA 3DC2A 5BNWA 3VR3D 2H1SA 2PD3A 1CBUA 1K5GA 3LUPA 2FYTA 4JJZA 1OTXA 1IMJA 2YDXA 4CHGA 1YI1A 2WT4A 4DWOA 2ZJ7A 4RD2A 2WJ4A 2ZPUA 4B6OA 5JEDA 1F60A 4RVGA 4MLCA 5JFOA 1CJSA 5CLGA 1C2TA 1J5XA 2ZB3A 3O1LA 5EIOA 2CLSA 5A5DA 3NTVA 2RH9B 3LRPA 1CJTC 5MGNA 1QAOA 3S8EA 1J06A 5AMXA 2F4NA 2I1VB 4HDAA 1LPOA 3T0IA 4KI7A 4O4IA 4UNPA 1J0XO 1T10A 3FNBA 1X8LA 4M9CA 4XYMA 5DHFA 4F96A 3U9SA 5E1MA 2XCTB 1W93A 2CEKA 2CMDA 2XKBA 3ML1A 3MRXA 1XTTA 3JZMA 1KF0A 1HFJA 4DNOA 2MHCA 3I2FA 1WP4A 5GQSA 5CT8A 4B0PA 2HK9A 3I83A 1TZ2A 1IQUA 2J45A 4I14A 3WJ2A 4C4OA 4RDCA 1PLKA 3ZE6A 3I58A 3AR3A 3NT4A 4F9FA 3L7IA 3K8QA 1Y9EA 5HF9A 4YUVA 4BCDA 2K6GA 4IJ6A 4WLEA 1EG7A 2YW9A 3DMPA 3DEIA 3PGVA 2H2IA 4FZVA 1SKYB 4J03A 4QRIA 4UEKA 5TF0A 4BECA 4PCUA 5HFAA 4DBLC 1X80A 2A9PA 2IPAB 1T8YA 1G0NA 1VPLA 1TCUA 4KAJA 4BKUA 3RSQA 4CL3A 3LUGA 1YB2A 1VB3A 4UUBA 3IS3A 2RHTA 2LZ0A 5H4GA 3KLPX 2AFHB 2VPXA 2OXEA 3LHKA 5K8CA 5C34B 3UHAA 1KVQA 4DQ0A 3BILA 1IBSA 4K9DA 2B3TA 3V4SA 4JKYA 2XXJA 4P7GA 1I7QB 1ADGA 3THRA 5FF9A 4GM1A 4B79A 2WT9A 3L46A 3UV3A 3KSBC 4QOJA 4UM5A 3M1YA 2V3WA 4G9EA 1CY4A 4QICA 3SFZA 2PR2A 3CLUD 5AKJA 4HZIA 1Z0DA 2IHBA 4GYYA 4IVRA 3P27A 3TSCA 1TZKA 1G2QA 1ML4A 2ZIXB 3F67A 1T6YA 3IUNA 2E5FA 1V11B 5FBRB 1ODFA 2BFFA 1R6BX 4RKQA 3RU7A 1H69A 4HB3A 2F4VB 3I9KA 3AJRA 4I1RA 3CZCA 1WSBA 3JZFA 3AT1A 4Y0VA 3WDMA 4MDFA 4XB2A 1CUVA 4GYWA 3QU7A 5JANA 1D04A 3QM1A 4N9QA 2NUAA 5KYUB 2H4HA 3ZDCA 1EI9A 2XE6A 1FCJA 1WZCA 4JHXA 5JQGA 1GZ6A 4FFOA 1MOPA 3L04A 3PD7A 2QQGA 4KK4A 4OHFA 2WWTA 1CQWA 1UBJS 2HC9A 1H4VB 1GGKA 1X1TA 4K05A 3OT4A 4PNHA 5FI5A 5EJEA 4KR7A 1OFVA 4OGLA 5F2NA 5TARA 3TPZA 3MRTA 2QN8A 4EENA 1RM3A 5CYPA 3MWEB 2J7PA 2XCOA 4RK7A 3L1HA 1OVMA 3VPGA 3GEMA 3WIDA 2H85A 3QXGA 1XRLA 3FN4A 2D00A 3P9KA 3QV2A 4N82A 4OXQA 1LZLA 3MA0A 2Q2WA 1KOFA 1MZPA 2DFTA 3PPWA 4K1LA 3ABOB 3DEHA 4C2TA 1B16A 5AVVA 1DDGA 4EGFA 3HR7A 1QTNA 3LOQA 1FXSA 2OXCA 1V2GA 4PHFA 1YB4A 5ALUA 2JAOA 1FA9A 4IY1A 4JEUA 3TS1A 4MHOA 3ZCQA 4C4YA 4H7FA 2NU6A 2P67A 4YDQA 5T4BA 1JFLA 3K73O 4PEVA 4YPVA 5LD2B 3Q8KA 2Y67A 3C5EA 5TVKA 1JIQA 3W5HA 3ZJ4A 2GM3A 3T0FA 2A9VA 3T1YB 1JIKA 3THYA 1OE0A 4FFBB 1XPUA 3EXG2 2WZDA 4JYCA 2IEGA 4DQDA 1XF9A 1U7ZA 2TMKA 3FNGA 1XGKA 2JBAB 1D2GA 4PGHA 2DQZA 5EI5A 3VBEA 4B3HA 4Q02A 3NZEA 2ANBA 2GOYA 1XRPA 2Y1EA 3LA6A 3PHCA 4YAFA 3L4SO 4LHEA 4GXTA 1YJCA 3H5LA 4GBMA 5JSYA 2QX6A 4OQMA 5BSVA 2C5HA 3O94A 2BHNA 4TMYA 3W8DA 1ZJWA 1M34B 3WB9A 1RM0A 2YCLA 4IP0A 3KWMA 3W6NA 4ECEA 1YRWA 3STUA 2MSLA 3G9XA 2LIPA 2LNDA 1KFEB 3K0FB 2G9NA 5CT6A 5F3DA 4H18A 2IUYA 5BQOA 5CLJA 2IHNA 3MT0A 1CJVC 2O0JA 2QZ4A 3SQLA 1DRUA 1ZRHA 5GINE 1SXQA 3ZHZA 1HDZA 1E2EA 3DAOA 4RAOA 1JHAA 1U1GA 1DBWA 2B0JA 1KOJA 1SQFA 1PE0A 1YZLA 3ACBA 4M21A 2LR0A 4AQYB 2C4WA 3JQ9A 1T0BA 3U3ZA 1Z18A 2EGUA 2F9MA 3P4YA 4WSOA 5JSFA 4XLLA 5EAIA 4A6PA 5JDIC 1U1IA 5F2EA 1IONA 2C7PA 4XWOA 4PHTA 1Q1AA 4DCUA 3A1FA 4FFMA 4W1RA 2AXQA 1MABA 2Y71A 4DCTA 1X1SA 4X20B 2H5JA 3CX3A 4YRGA 1JT9A 5JCZA 4D3ZA 3ROTA 1CQPA 3RREA 3EXHC 2GM9A 4Y2VA 2DTDA 3DZGA 3H4MA 1XWWA 1GYPA 5KVQA 4N3NA 3SSAA 3UW1A 1TK3A 2AMJA 3KBOA 4E46A 3U49A 2D7JA 3FFTA 4O2AA 2XE7A 3RVSA 2IEDA 4RA9B 3GD5A 1ID1A 5KYYA 5HKAA 1KWKA 2PXAA 4JT9A 1ANKA 2K5UA 1JHPA 4GPEA 4TRNA 3ZW7A 2QZZA 5F23A 3WNQA 1B14A 4BBZA 2HMVA 2WVHA 3B7GA 2JLXA 3WZMA 4G4JA 4TVSA 5D7NA 1EFVA 1G7CA 5C4GB 3FOEC 1U0LA 3OZCA 4Q3CA 2ZXFA 1CF9A 2GEDA 1QGAA 4FXPA 4Y0AA 1SBNE 3EC2A 2C3YA 1JTFA 3HXMA 3U9TA 1FEZA 4MI6A 4WCVA 2QSUA 2JHGA 4YRDA 5JNVA 1M2OB 2VO1A 5LZ9A 3BF8A 4MNTA 4XM2A 1D2EA 1TZCA 1Z2DA 2DGDA 4BO7A 2ZCJA 3TJZA 4ZO7A 5ICMA 4KVZA 3AM4A 1FQJA 1RQXA 3E6AA 4Q3OA 5G41A 3WB1A 4M0MA 1M5TA 1RWMA 3BWXA 1A8UA 1FYFA 4CCWA 1YTLA 2O7RA 3FRJA 5FPQA 2VSFA 3NONA 2YWJA 3D7KA 4NCAA 5B7GA 4CT0A 3EZLA 3LF2A 1LPSA 4OH7A 4PO3X 5EXPA 4CV2A 3CNBA 5IPFA 1OUMA 1LJLA 3VYSB 3WRYC 2BP7B 2HAEA 2EF1A 2ZDQA 3NT5A 3VYVA 4KHPB 4CEJB 2P2CA 2NU9A 3HDHA 5DNDA 5L4LA 2BFCA 3JQBC 2IUFA 1WWKA 4NVRA 1KKLA 3EZ2A 4QO7A 4YCSA 1ST3A 5EJ8A 1CRLA 1Z6XA 4D44A 3JQFC 3OTWA 2BBTA 1CJMA 3OQPA 4HBZA 4LNUB 2M6KA 2REQA 3GX1A 2YWHA 2VAMA 3U1VA 1ADCA 2CLKB 3AEUA 1DV2A 3CEPB 2Q07A 5DEIA 5EERA 2J9YB 1I1QB 1DQYA 4JMLA 3TBKA 3K0HA 5IK2D 3T4XA 3A6LA 4L07A 4XD2A 3URMA 1HZZC 4NPHA 4K8RB 1C7IA 3EMDA 1V47A 4S3MA 1EXMA 3EGWA 4AQDA 5FI3A 2QL5A 2VLBA 4UUNA 6GPBA 2MR5A 2ON6A 1EDOA 1M2KA 2IUEA 3EPPA 3SYKA 2YY5A 2HEIA 2JI6A 3RIMA 4ZN6A 2VKQA 3AYZB 4X45A 3ZWAA 4GZ3A 4O59O 4OJTA 3S81A 1UKYA 5JBIA 4EUKA 2R68A 1W59A 1KYZA 3ZHSA 1SKYE 2PRJA 3A3NA 3B1YA 3ZNOA 1EFDN 2XW6A 3AKZA 5EP2A 1LI4A 2QA5A 1N5OX 5IKPA 2WD9A 2DEUA 1VP9A 2QTNA 1Q0PA 3A9TA 1DJNA 2DQKA 1YIAA 4IYRA 4YUYA 1VSUA 3IP7A 5KWSA 4PM4A 5J3JA 1CHDA 4EGCB 1XZKA 2YIDA 3CZQA 1ZK3A 4JUFA 4OFXA 5TPZA 4EHBA 4YAGA 4UOQA 1G6KA 3D3WB 3GCWA 5SY9A 4KNYA 3VVMA 4YJ3B 1KEVA 2IZ5A 1HKUA 3DAYA 3GRKA 2ARKA 3T95A 3V48A 5K0FA 1G5PA 2IXBA 1VG9B 1R0BA 3E7WA 3OE7D 3OIYA 4H6VA 4GC9A 3ZDRA 4EQ6B 4ZZ1A 1SKUA 5JMTA 4G86A 4AMZA 2IVZA 3LVQE 4AN0A 1RKVA 1YB1A 1XEFA 4UDOA 2Z8YA 1R7RA 1ARZA 1RRKA 3K6SB 3G9ZA 3CR8A 1C0EA 1OC2A 2EFDB 3JD2A 3TNYA 4NJOA 5KPDA