3H17A

Crystal structure of este5-pmsf (i)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
292
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of an HSL-homolog EstE5 complex with PMSF reveals a unique configuration that inhibits the nucleophile Ser144 in catalytic triads.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 107
structure length 292
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h17A00
1VA4A 2G5PA 3SK0A 3WI7A 4J7AA 4DSAA 1XZKA 3MUOA 3ANSA 1LPBB 2JGKA 1EINA 1KU6A 2Q0XA 3M81A 3ZLUA 4C4ZA 1VE7A 4B9EA 3FSGA 2OCKA 3FBWA 1UK7A 4FBMA 5FRDA 3WWOA 1QJ4A 2I3DA 4H0CA 2VEOA 2QTBA 3O9VA 5FUMA 4B80A 4BDTA 3QMMA 4G4JA 1XLUA 5EGNA 6YASA 2H7XA 5AOBA 3PUHA 1EH5A 5JARA 1DTEA 1HPLA 1ZD4A 1CUHA 2WTNA 4ZWNA 1O6FA 3WKEA 2O7RA 2ROQA 3DS8A 4AO8A 5AKXA 5JD4A 5BWCA 2W6CX 3DYIA 4Y2YA 4DMHA 5ISMA 4Q1VA 1DQYA 2WG1A 4PW0A 3WLAA 5BOVA 3L1IA 2I03A 1BS9A 5ALYA 1CUWA 5AIAA 5CBKA 4G9GA 5I8PA 1X2BA 2XE4A 3WKAA 3A2NA 4D9JA 2XMZA 3GZJA 3BL8A 2J3DA 1CFJA 4ZRDA 1JU3A 2QJWA 1EB9A 2YYSA 1QONA 4L9AA 4RE5A 4FLFA 5AOCA 4GHWA 1BCRA 1BN6A 2PSFA 4BBZA 3HZOA 2XUAA 2BJHA 1QFSA 4B82A 5D3KA 1SCKA 2Z5GA 4KRXA 2JGLA 5ALFA 4WJLA 2XUDA 1CUZA 3K6KA 2XUJA 4G9EA 5T4HA 4BP8A 4B81A 5AM1A 3IB3A 4X90A 1QLWA 3STWA 1JJFA 3U0VA 3QZUA 4KE7A 1K63A 3HACA 4BYMA 4UBOA 1ZIYA 3STXA 4A5SA 4GECA 1AMNA 1ZJ4A 5ALQA 4UBLA 4OU4A 3NGMA 4PF1A 1CUIA 3C6BA 3WYDA 1CUUA 4CG2A 4DMKA 4X7BA 5K3EA 4Q3LA 4WCVA 1CLEA 3WL5A 5CXXA 3WK8A 1K4YA 4XIIA 3I6ZA 3WWDA 1XZHA 4Y2JA 4E15A 1EX9A 1XKTA 1K5PA 1S8OA 2HRQA 5FLKA 5ESRA 1U2EA 2PSJA 1W1IA 3G9TA 4KYVA 3F98A 3ESDA 3GROA 2WLSA 1UKBA 1L7QA 2VAVA 1CUVA 4J03A 4BTVA 5JD6A 3I2FA 5AI6A 5EI5A 3OURA 2XUIA 2HU8A 4BE9A 2K2QB 1G42A 5AI4A 2PUHA 1X2EA 1E8MA 3JWEA 1EB8A 2HU5A 3H17A 4U2FA 3D2BA 3C8HA 3C5VA 5ALUA 1C7IA 5JAOA 1TAHA 3EBLA 4DSZA 4WDQA 2X76A 2WIJA 1M33A 2VAXA 4E11A 1QZ3A 4P92A 5C7YA 1CUAA 1H2XA 1ZGBA 2XQIA 4EY5A 1ODTC 1A88A 1XQXA 5ALGA 2DSNA 1W75A 3RKSA 4U2BA 4BCCA 3D3NA 3IURA 2WM2A 4CFSA 4ZXFA 3U1TA 5K3BA 3IUNA 5A2GA 5CT8A 4L0CA 3ZI7A 4KAJA 1OCEA 2AJ8A 4BCDA 1QO7A 4TPKA 2B20A 4CCYB 1UFOA 2VJDA 1ODSA 2WJ3A 3QITA 1FSSA 4FFVA 1UXOA 4OCZA 5JANA 3PI6A 4KR0A 4LXIA 5F4ZA 4ARBA 3PUIA 2WJ4A 5HKAA 4AXBA 3QMWA 3G8YA 2JGEA 4N8EA 1LPSA 4Y9SA 2HFKA 2XB6A 3YASA 5J3JA 5K5EA 1MAAA 1DQZA 3N2ZB 4LYEA 4MYSA 3AILA 2EDCA 4X6YA 4NZZA 1UOOA 2QT9A 5CTAA 5I7UA 4N8SA 2QUAA 5AICA 2RI6A 2XMGA 5JATA 2IX9A 5EIEA 4BVJA 1UKAA 3F67A 1YS2X 1WHTA 4U2CA 1IVYA 4MWSA 1OXMA 4ZV9A 3I2IA 4BAUA 2JGFA 1MN6A 2YH2A 3WA6A 3DOHA 1JJBA 2WFMA 3OTQA 1T2NA 2D0DA 4G1FA 3EQ7A 2ORYA 3I28A 4OB6A 5CH3A 2QJRA 4P93A 4EB0A 2QRUA 5DYWA 1AURA 4OSEA 1CUFA 2NW6A 1TCBA 3W2TA 1N8SA 1D07A 5JADA 1XZDA 5AJHA 4DNOA 2XLBA 1SOMA 3LS2A 2C58A 2C4HA 1MO2A 5ALXA 4XWGA 2R8BA 4RNCA 4KE8A 1AUOA 2PSDA 2HDWA 4CG1A 5CH8A 1EI9A 4RPCA 1XLVA 5LZ9A 1BN7A 2PU7A 2JGJA 1UK6A 2RHTA 4PQEA 4BZZA 5FDFA 1P0QA 3NWOA 1W6RA 2P8SA 5AOAA 1EK1A 4Q34A 2OGTA 4KJXA 4UFOA 1FFEA 5AKIA 4UBIA 4EA6A 4HRXA 3R3WA 4UHBA 2V9ZA 5AK5A 3IUJA 1WB5A 4HXGA 5ALVA 3HABA 5ALDA 3H2HA 2Z3WA 3D7RA 1XLWA 2ZSHA 3VXKA 4AN0A 1R9NA 1HKHA 2JGMA 2XMCA 3IBTA 4UHFA 2DHDA 4Y2QA 1AQLA 4AB1A 1BU8A 1SCIA 3AJAA 5HFNA 4EY7A 1P0MA 3HXKA 2OGZA 3HEAA 2DFPA 4B7ZA 1VA5A 2DR0A 2PBLA 3A70A 5HF5A 4OYYA 4IO0A 1WM1A 3V9AA 5C81A 3G0BA 1MNAA 2PPLA 2C0QA 1F8UA 1Q0ZA 3H2IA 3DCNA 4EY6A 5CT4A 1TCAA 2CZQA 2YXPX 3TGLA 5AI5A 4UBJA 3IUQA 2DCMA 5AO9A 4U2EA 1HLGA 4MXDA 1HQDA 5D3ZA 2GYUA 1IZ8A 3I2HA 2XUKA 4C87A 3E0XA 4UBNA 1JU4A 1A8UA 4JEIA 3VISA 3K2IA 4O08A 1CUXA 3QM1A 1BEZA 4N5IX 4H77A 2H7YA 3C8DA 1G4HA 5A7GA 2V96A 3R41A 1UK8A 1LPNA 5KWJA 1XZIA 2H7CA 3D59A 3FLAA 1QTRA 5AI8A 1CUCA 4G5XA 4H7JA 4Y2PA 3LCRA 3ANTA 2GBGA 3VJKA 1CQZA 3HC7A 1GKLA 2ZVDA 1XZAA 3IUMA 1XZGA 3EQ8A 3N0TA 1O6GA 2Y2VA 1YB7A 1H2YA 1DX6A 1J07A 5AKGA 2HADA 3D0KA 3R3ZA 5BWBA 5LZ7A 4C4XA 3STTA 3WL6A 2VJCA 2VT6A 2PUJA 4DIUA 2ONCA 3V1MA 1LPAB 3JYHA 5HF6A 2WG2A 1MJ5A 1QIEA 4EY8A 4QNNA 3C6XA 4QDUA 3VKFA 3E3AA 3W04A 2J4FA 3VJMA 1U4NA 3I1IA 5EHZA 4N8DA 3ICWA 2O2HA 5IVKA 4X6UA 4TGLA 4KAFA 1LPMA 4W1QA 1LPOA 2QUBA 4X6XA 4E46A 2XUHA 2WUFA 4DNPA 3FLEA 5AM4A 1FFAA 1K8QA 2HA0A 2RONA 5DYYA 1BROA 3PFCA 2CMFA 1WPXA 2CB9A 1FJ2A 1JMYA 4HTAA 1E89A 5FPQA 4K6HA 4UBMA 7YASA 2FJPA 1TCCA 1CUYA 1GXSA 2HA6A 3DL4A 4W1RA 5AKKA 2AJDA 3ED1A 4WFIA 2WUGA 3F97A 4X85A 1W76A 1XQWA 4G4IA 5LLSA 3BWXA 4AQDA 4UBKA 5CURA 5AM0A 4QZVA 4EHBA 3DD5A 1XRNA 1AKNA 4BP9A 4Q05A 3H0CA 2BGNA 4LYDA 3B12A 1NX9A 2D5LA 4MYDA 2QR5A 4B0PA 4QLAA 1JT2A 1DT3A 5LZ2A 3AIOA 4Y2VA 1MU0A 4X95A 1QOZA 3BIWA 3KD2A 5AHXA 1MX5A 3R0VA 1GT6A 1ODCA 2X5XA 4WFJA 1I6WA 2XUGA 2XUPA 1N5RA 5LP1A 5HF9A 4CIBA 2OCIA 2DHEA 3QH4A 5D7BA 5K3CA 4INZA 3S2ZA 5A7FA 3AFIA 1B6GA 1ZOIA 5ALKA 2WU3A 1ORVA 5DNVA 4ITVA 3O4GA 2OAGA 3O4IA 1CUEA 4EBBA 3W06A 1HL7A 5BV7A 2IIVA 1Y37A 5T4EA 2WHPB 1GQRA 3T4UA 4WDRA 3AINA 3D2CA 4MWTA 3L1HA 1CRLA 1A8SA 3GUUA 3CCBA 3HI4A 3HYSA 2BKLA 4EZIA 3HRHA 2XQJA 3CN9A 2O7VA 1GPKA 1MNQA 4QLOA 2Z8ZA 4JH0A 4GDMA 3UUFA 2J3QA 1XKLA 4IH4A 1ORWA 3WL7A 1P0PA 4MQLA 1GKKA 4B83A 4YK7A 3QVMA 1TRHA 2WKWA 1MX1A 4CIAA 4AMZA 2W22A 3FVTA 1AC5A 3G9XA 4H7FA 1MX9A 1E3QA 3ILSA 2Y2UA 3ESAA 5JD5A 3WK9A 2PX6A 3AZPA 1VOTA 5IVHA 3BE8A 1R9MA 5ALRA 2PVSA 2PKYX 1WOMA 3AZOA 5LYYA 2XMRA 3JW8A 2EDAA 4X91A 1W4LA 3FYUA 5HK8A 3V1KA 2Z3ZA 3ZLTA 2I3ZA 2ZSIA 4F60A 1UZAA 4CCYA 5K3FB 3FVRA 2XMDA 4GWLA 1MPXA 4UFNA 4M0FA 4X93A 3DOIA 1CEXA 3WKDA 3FSGD 4W9RA 2BFNA 2AJLI 4K2AA 4C4YA 1MAHA 2V98A 1L7RA 2GBIA 3IVMA 4GEGA 4Z49A 2ES4A 4Y2XA 2JEYA 3PE6A 1RWQA 3GA7A 3OM8A 5EIHA 1WPRA 3T52A 1F0NA 1P0IA 3QMVA 3I2GA 3DYVA 1H2ZA 1LNSA 1VLQA 1FFCA 4QWMA 3PFBA 1DT5A 4Q82A 1VZ2A 1N5MA 4W63A 3ZLVA 3RLIA 5DTIA 1UOPA 1XROA 3QYJA 5AH0A 3GFFA 3DJYA 1JJIA 3PF8A 2C5GA 3SC2A 1ACJA 3H2KA 1EA5A 1U65A 4KE9A 3HSSA 1KEZA 2WU4A 2DHCA 4BAGA 5CMLA 2IITA 4X92A 1VZ3A 4ZV7A 3HLKA 3CCCA 2WHPA 5ALMA 4CG3A 4XVCA 1XQVA 3ESBA 2PL5A 4JYPA 4KE6A 4QA9A 3W9UA 4JNCA 2G5TA 1ZIXA 4PNZA 2WUEA 3KOOA 3OC0A 4J3JA 3V1LA 3STYA 3DKKA 3DL7A 5JZSA 5AI0A 3MUNA 4LXGA 4DMFA 3V48A 4MJ3A 4J0GA 5FPPA 5SYMA 2B4KA 3O95A 3LP5A 3D4LA 4W1PA 1H23A 3R3YA 2WFLA 3H1BA 4KACA 4YASA 4X3CA 3UMJA 2X8BA 5E4JA 4Q3KA 2HA5A 3I6MA 3C6ZA 4OB7A 4TVKA 1ZI9A 4H35A 1QIJA 1QTIA 3DQZA 3VVMA 4F21A 3FCYA 5EHQA 4IH1A 3QPAA 2JIDA 3I2KA 4L3WA 1JMKC 1PV1A 5HQ3B 1LBTA 2I78A 2BAGA 4B85A 5DTJA 2QXTA 1XRRA 3BF8A 4FKBA 2C7BA 2XQFA 3WMRA 5ALOA 2DQZA 1YS1X 2O2IA 1ETHA 3AZQA 5HK9A 2FX5A 1LZKA 4J0JA 1YASA 2XMBA 1IMJA 2WFZA 1QO9A 3L1JA 4MQMA 5ALTA 4DGQA 4DNFA 5AI9A 1Y7IA 5JZBA 1EK2A 2OAEA 4WY5A 3E4DA 1XRMA 3M3DA 3FYUC 4Y2SA 1Q0RA 2WFLB 4W1SA 2WUDA 2VJBA 2GYVA 5JASA 1LLFA 2OCGA 1A8QA 4HRYA 3V1NA 3Q0TA 5CH5A 4X71A 2GBCA 4V2IA 1YAJA 3DNMA 1LGYA 4U2GA 4UUQA 1R50A 4M0EA 5DYTA 2Y6UA 1YA4A 3O9MA 3ZPXA 2XUQA 2WIDA 1YR2A 1FFDA 4UHCA 5CT6A 4FOLA 4HZGA 3TRDA 1GZ7A 4FLEA 2QXUA 4KEAA 4XX1A 3RARA 3WWCA 4A16A 2XLCA 2HIHA 3I1YA 4BC0A 4RGYA 3NUZA 2QVBA 5A71A 3P2MA 1J2EA 1E66A 1R3DA 1GPNA 1ZD2P 1DWOA 1XZEA 4RE6A 5AK4A 3IIIA 4JUIA 3WYNA 3O4JA 2YASA 5HKBA 1FFBA 3H1AA 1X70A 5LZ8A 4G4GA 4G8DA 3WZMA 1CUBA 5FP0A 1T4MA 4BDSA 4M0MA 3VVLA 4FNMA 1IUOA 2GYWA 1GQSA 2QKYA 3EIOA 1QGED 5ALNA 4U2DA 3K9BA 3WK5A 2VQ6A 2AXEA 3PDCA 1XQYA 4PSDA 1NU8A 1Z68A 3AUKA 4IHAA 3G9ZA 3W05A 3VJLA 2VJAA 4AMYA 1KU0A 4DTCA 2C0PA 4S0XA 5LKAA 1EDBA 1J06A 1CV2A 1DU4A 3SX4A 4OD0A 4C89A 2VSQA 1ZJ5A 5A6VA 5AKJA 5C8VA 1Y7HA 3UUEA 4F0JA 2VA9A 3CN7A 2VT7A 2CJPA 2RAUA 4BRSA 5AM2A 2HA3A 3DLTA 4BTLA 3STUA 3SWWA 3F8SA 1HDEA 3BDVA 3A2MA 3QBJA 5E4YA 1RYYA 5AP9A 2Y1KA 1F0PA 3BIXA 3RM3A 4BATA 1G66A 1EHYA 4IQ4A 3KWJA 4PSUA 1ZD3A 4I4CA 1UT6A 1L7AA 5AKLA 5AM3A 5LKRA 4AX4A 4GBGA 1CQWA 4B0OA 1SC9A 4GW3A 2H9YA 2QM0A 3FLBA 2OQVA 5LZ4A 2PSHA 1XRLA 1UOQA 1C7JA 2RGUA 2G63A 3BJMA 1W52X 3WIBA 3FYTA 1TKRA 2HRRA 5E4TA 4PO3X 1CUGA 2OG1A 4AO6A 4G8CA 1WCYA 2GZRA 5ALPA 1YB6A 3FOBA 3R3XA 4FWBA 2JBWA 5SYNA 5JAPA 2WQZA 4XJVA 4ZI5A 2HA2A 5LIPA 1CUJA 4FMPA 5JAUA 4NVRA 3BXPA 4X97A 3ZV7A 4NS4A 3G0GA 1G5FA 3R40A 3I6YA 4KRYA 1GGVA 3BF7A 5KREA 3WKBA 1GPLA 5CT5A 1SCQA 2ECFA 1UK9A 2RIPA 1SFRA 1VXRA 1QIIA 4I19A 1BCSA 2WIGA 3WK7A 3WA7A 2WIFA 1CR6A 1MT3A 4ETWA 5EIAA 1DINA 1B41A 1QIHA 3F96A 1IUPA 3C87A 1YA8A 1ISPA 4UPDA 2PU5A 5EHXA 1EVEA 1K6EA 5DJ5A 4CCWA 4AO7A 1THTA 2XQKA 3C6YA 3WWEA 1NU6A 2FUKA 2CEKA 2LIPA 4J0KA 1OILA 5EFZA 2HFJA 3LLCA 4X00A 2BGRA 4B6GA 3WKCA 1LBSA 3IA2A 1XZFA 4DNQA 3I2JA 4J0IA 4A23A 4UFPA 3QPDA 4G8BA 4AN1A 5DWDA 2OGSA 2ZJ6A 4AZ0A 2CUTA 2WG0A 2BUAA 4H7EA 5JALA 3OOSA 5ALEA 1PJAA 4B9AA 1CUDA 2E3JA 3FCXA 1EVQA 4QEKA 1QFMA 2HA4A 3D2AA 3A6ZA 2XMQA 1RP1A 1VE6A 2C5FA 4BE4A 4HXEB 4ARAA 1QIKA 3F9CA 2XUOA 4H7KA 4FBLA 5CXUA 1JKMA 2OXEA 4K6GA 3C45A 5CRIA 4QWWA 4BZWA 4X94A 5A62A 2ZYRA 5AIBA 3VDXA 5E2IA 5HQ3A 3H2JA 4MEAA 1E8DA 5AKEA 4J0CA 4AZ3A 3BJRA 1IUNA 5ALSA 5KBYA 4OPMA 4LXHA 4Y7DA 2WHQA 3O0DA 4Y2UA 3WJ2A 4C6HA 3C5WP 5AKZA 1Q83A 4QDXA 1UWCA 1PFQA 1U8EA 5AK3A 5HZGA 5ALHA 4PSCA 1YAHA 1XRQA 2WSLA 1VJ5A 3DEAA 2WILA 5IKXA 2B61A 2VATA 4BCBA 3OPMA 5ALWA 1E8NA 2ZYIA 3WIOA 4BAZA 4FFWA 4F5ZA 5JAHA 2CBGA 2XDWA 2AJBA 4ROTA 4DM7A 4DLNA 2OCLA 2GZSA 1BRTA 2JEZA 4PV7A 4OYLA 5AKHA 1EXWA 1CUSA 2O2GA 1QIFA 1XRPA 1XZMA 1CIJA 2XI4A 5ALIA 5IVIA 5CT9A 1WB6A 1USWA 1R88A 2B9VA 3EQ9A 3AIMA 3IDAA 5JYCA 4J0HA 4HS9A 3MGAA 3MVEA 4HXFB 4HVTA 4YPVA 3EF3A 3RK4A 1CVLA 5IH7A 2G4LA 1ZD5A 3KXPA 1IZ7A 4EUSA 2JF0A 4LIPD 4BRZA 2DQYA 4KAAA 2H1IA 2VTVA 3A2LA 3H19A 4Q3OA 4H7IA 2UZ0A 2FJ0A 3IULA 2QOEA 1Q84A 3NOXA 4L72A 1XZBA 5YASA 2XUFA 5KWIA 2WIKA 4Y2TA 1R4ZA 3DKRA 2V97A 3FWHA 3LIIA 3S8YA 2OPHA 1LZLA 4OB8A 3G0IA 1H22A 1DWQA 4YX9A 4QDOA 3G9UA 5C8ZA 4C88A 5DNUA 4CI9A 4H7HA 5AKYA 3H2GA 2ZJFA 4DYHA 3TEJA 2OQIA 3HJUA 4BB0A 1ZGCA 3BDIA 3ZWQA 4QE3A 3FNBA 3X3HA 2BCEA 1HBJA 1DWPA 2PM8A 1WB4A 3WWPA 2WTMA 4UHDA 3GBSA 5CW2A 3PICA 3E1GA 3AIKA 3ICVA 2BUBA 1JI3A 1H2WA 2WHRA 3C43A 5T4FA 1YSCA 4ZGBA 1QIMA 1A7UA 4J0DA 4K5QA 3R3UA 1ZICA 3D5EA 3H18A 4P08A 4N5HX 2ACKA 1QIGA 4I3FA 4FLMA 4BC1A 2QMQA 1VXOA 5JIBA 3H04A 2XT0A 1E5TA 4UHEA 1C4XA 2ZYHA 1TK3A 5FOQA 2HM7A 1XZLA 1WHSA 5ALZA 1F6WA 1AGYA 3DDUA 4OUKX 1AX9A 1ZI8A 3WK6A 3TJMA 4FTWA 2HA7A 1MTZA 2QZPA 2Z8XA 5K3FA 5D6OA 4ZREA 4UHHA 4H7DA 2GBFA 2ZJ7A 1YCDA 3FYUB 4GI1A 5AM5A 2R11A 3G0DA 5H3HA 5K3AA 1ACLA 3B3QA 2JGIA 4OU5A 5FV4A 3M82A 5K3DA 3W9BA 3C70A 4FHZA 1EDDA 2XQGA 5DLPA 5IVDA 3LIPA 3WJ1A 2HHAA 4HAIA 5AK6A 2ACEA 5ALLA 2Y6VA 2EEPA 5JZ9A 1ZI6A 3KSRA 5A7HA 2J4CA 4MEBA 4QDTA 5I9IA 2WJ6A 4NMWA 1JFRA 1VKHA 4P9NA 1BE0A 2BUCA 5LZ5A 4LKOA 2CKMA 5HCUA 2RHWA 5ALJA 1XZJA 1BEEA 3WL8A 4WFKA 4GLBA 3O4HA 1CPYA 1EDEA 4IH9A 4B84A 1J1IA 1XZCA 3Q8WA 1XFDA 1N1MA 4K6KA 3KWFA 2PSEA 4WY8A 4JYMA 5EHNA 2ZYSA 5C8XA 5FXMA 4GXNA 4H18A 2HL6A 3G7NA 5T4BA 3KDAA 3WK4A 4BVKA 4LHEA 4E14A 2VF2A 3STVA 4C01A 4DMCA 3R3VA 3WQHA 1AZWA 5DNWA 3QPCA 4BVLA 3G0CA 5HF8A 3G02A 3CXUA 1LPPA 1DX4A 3GELA 2HU7A 4FDMA 3PF9A 2OLEA 3B5EA 5FKJA 4QDZA 3OG9A 2QS9A 1R1DA 4EY4A 5HFAA 2XMSA 3M83A 4Y2RA 2AJCA 1QE3A 1THGA 1QIDA 4FNGA 1TQHA 1TIBA 3FAKA 3ESCA 3WZLA 1UKCA
chains in the Genus database with same CATH superfamily
1MBZA 2O5VA 2P3SA 3WSTA 5I7WA 4LC9A 3OESA 2F4VB 2PL9A 3RBAA 3UWMA 5FV7A 4Z1MA 2QVLA 3WI7A 1SU4A 1NNEA 4JP2A 4YJGA 3AHGA 4DSAA 3I5AA 3MUOA 3TPFA 4RTKA 1LPBB 2WV7A 5EMNA 4MUKA 2GSWA 3LH5A 3H1GA 1EINA 3GVCA 1KU6A 4OHXA 1WSWA 2BGWA 2QA5A 4W9MC 4C4ZA 3ABRB 3G2JA 1EXMA 1W88B 1NXTA 1P75A 3JQAB 3FSGA 3QVOA 5C0OE 4TXHA 4OHVA 2P3QA 4GL4A 3UKOA 2J30A 4N3BA 1FDSA 4FBMA 5AM4A 4LXTA 4MMZB 4Z9YA 1N2IA 2M98A 3D3JA 4LY0A 1CRZA 1OKKA 4B6EA 3U6BA 3T1YB 2A5GA 2JCYA 3CH7A 4DQDA 4BQFA 4AZSA 3JQGB 3GJ0A 4LA4A 4LTDA 2UZ4A 1SVOA 3HL0A 1J8YF 3E6AA 4UATA 5K0GA 1NBEA 1S7GA 1OQAA 1XLUA 2AFHB 3LF1A 1GTG1 4D74A 2VRCD 1NQOA 3NKFA 4KIUA 3V6MA 4NJMA 4PBTA 3PUHA 3TQRA 1VJ0A 3SSMA 1XYVA 1YZNA 1I4WA 2WTNA 3LBIA 3KZCA 3VO9A 4ZWNA 4JLSA 3WKEA 3TVYA 3IUBA 1E92A 3DBLA 1N77A 2FUG1 4IIUA 4ZYUA 2AG1A 1IAQA 2NXEA 4TMTA 1TUGA 3BXGA 4DJ5X 1Z13A 3NT5A 1Z35A 1G21A 1FQWA 3QUCA 1ZWKA 4Q4AB 5EJ4A 1C2YA 3JATB 2YXDA 4Q1VA 2FZLA 1ZLXA 3KLBA 3NBAA 2IODA 1HQYE 3GJQA 3L1IA 3OWOA 1NA5A 2I03A 4JXKA 3WRVA 5KSOA 5LQCA 4MIEA 2P77A 2V6FA 1YRLA 4ABYA 2ZIEA 4V3BA 5ALYA 1CUWA 5AIAA 2VPWA 4Q1DA 4MI6A 4QASA 1PX0A 2UYYA 3KQPA 3LT0A 2OM6A 4YDSA 1D03A 4ZOBA 2HSWA 3F3MA 2Q46A 3C39A 4UAJA 5E6RA 5I8PA 1P1RA 1Z0SA 1XSEA 3TAXA 4WAUA 3U9TA 4F5YA 2GCGA 3UGJA 3T3DA 1UF9A 2WTAA 4OBXA 1OFUA 4FMDB 1VG1A 1SOVA 3JD0A 4HLDA 1LS6A 4XTCS 3NUQA 3KSBC 3HR7A 4YCLA 1NVWQ 1JXQA 2BE9A 2V6MA 2WKRA 3G79A 3BL8A 3GZJA 4TMFA 3LY9A 2WB2A 1IN8A 3OJFA 4TRRA 1N78A 5E9JA 1E2PA 1UQRA 1CFJA 4WCFC 1ONSA 5DHFA 4ZRDA 3X0DA 2YYSA 1QONA 3AVPA 1YVUA 2UZAA 1NPTO 2EAUA 1JHVA 2Z56A 1N3YA 2F3TA 4BBZA 5IT5A 1T0JB 3HKEB 3D6TB 4WK6A 4Z1MD 1VJDA 4QJ4A 4YCNA 1ZISA 1YMQA 2BJHA 2PKXA 4O2BF 2YJ4A 1E7MA 2WKQA 3PHLA 1JFFB 3QNMA 1T3HA 5D3KA 4B82A 5B3KA 3H75A 3AQIA 2NUAB 2J1LA 4KRXA 1EK5A 4LK3A 4LJ4A 3DZCA 2OHGA 2QPOA 2Q50A 1QDEA 3H4MA 5J2TB 4CEIB 1HE8B 3B6MA 2AEMA 2NVUA 4OSOA 4OKNA 3LPAA 2QTCA 4KQGA 1Y1KE 3HHEA 4AS1A 1RI2A 1FUYB 3GLHA 3NNDA 4X24A 2IHZA 2GFIA 1VBNA 5JLJA 4QAQA 1Y6FA 1T9GS 2ZITA 3HNRA 4KSBA 5TIIA 1RLTA 1V35A 3GQVA 3OZVA 1V11B 3JARB 4RZQA 3UTCA 4GRDA 3DL0A 4GX1A 2TYSB 2X0NA 3OX4A 3U0VA 4FGJA 1JDVA 2UUBB 4DDUA 5A5DA 3JZIA 4BYMA 1POWA 3AOEC 3E9QA 4TLAA 2VNAA 3KO8A 1C30B 5CVCA 2RGEA 4UBOA 1UKZA 5SY6A 3K53A 3FOEC 4DDMA 1QPGA 2VO1A 2PTHA 2Y0EA 2AYYA 3CNBA 2JLZA 4M8SA 4Z0HO 1OTHA 1GL3A 1QUEA 4A5SA 5DGDA 5J4LA 5MN5A 1KJZA 3RVLA 4GECA 4YPFA 1PT6A 3M3PA 4JJKA 3A8TA 9ABPA 1AJEA 3ZBQA 3RIHA 2DECA 2X14A 1VCMA 4O25A 3WRXC 3ZTYA 4CQNA 5KOYA 1NKVA 4RH1A 1ECCA 1WZUA 3NHZA 5ALQA 2WT8A 1NMYA 1RKXA 2PZJA 4GI7A 1WXEA 4MCIA 2RG7A 2NXJA 4JXZA 4J1SA 4PF1A 3HO8A 4ZMRA 1F5NA 2QRVB 4TT3A 2IX3A 1FS4A 3EHDA 4EF5A 1KRHA 4XYLA 3NTRA 2BF7A 4ETMA 5K3EA 1XA0A 3AEUA 4JYBA 3GV0A 3C16C 4IG9A 2VDUE 2XYQA 5CXXA 3WL5A 3GP3A 3MTDA 2XR1A 5B7NA 3LDAA 3WK8A 1JKFA 1ZD8A 1E3SA 1TJYA 2IPMA 2WM8A 3I6ZA 3T3IA 5IFLA 4NLLA 2GBPA 4Y2JA 3TEMA 3K8OE 1W19A 4ZVUA 2BEWA 1MR3F 5CD9A 1SD2A 1GG8A 4YV2A 2ASEA 1E6KA 1S8OA 2G0AA 1IRXA 2ZRNA 1XTRA 3ELWA 5FLKA 2DRIA 1JDJA 3A05A 3GYGA 2X0FA 3QEAZ 2PSJA 4OHPA 1WUIS 4DUGA 2W6JA 2IXFA 1MAVA 3K0HA 4R1UA 5DW3A 3LWNA 5LBIA 3I23A 5DI3B 3H0KA 1UKBA 5DSTA 1A8PA 4KYUA 3K4PA 3R76A 4YY3B 3HDJA 4DLRA 1P2TA 1P3DA 3H4VA 4ZU6X 1AK1A 1CUVA 2AFRA 3JQAA 1D3AA 1TYDE 521PA 3TI9A 4ARZA 2V54A 3KLPX 4NNPA 4R2KA 3AR9A 1F20A 4BLRA 1OI2A 1V5EA 1B8OA 3RUFA 4LBYA 3MJTA 3OT4A 3ADOA 3H9BA 2K2QB 1G42A 1KSFX 1UP6A 1NHWA 1QQ6A 1XP5A 2IP1A 2PUHA 2X2EA 3F4KA 3QOWA 2FUG6 2IOFK 2YWRA 1X7WB 4KB5A 4TN1A 3S68A 2IUYA 3LK6A 3ZZUA 4E13A 1M1XB 3LA6A 4FT4A 3DAPA 2CVQA 3ZWOA 2EJCA 3H9CA 5IBCA 2JAWA 4U2FA 5JE8A 3QMPA 4D9CA 1M8JA 5B7QA 1C7IA 4W8OA 3PPYA 3S1SA 5JAOA 2C77A 1TAHA 3ZJUA 2G36A 1OH8A 1T3GA 2EBFX 3OQJA 3TW8A 1KJNA 5JBIA 4CEJA 1NATA 3L8HA 3X1ZA 2PYDA 2C92A 2VP9A 4WDQA 3UK7A 3QVGB 2VBIA 2X76A 1ETUA 1N3BA 5I5EA 1MLDA 5BQOA 1BVUA 1KVSA 4NDAA 4FDLA 2X0EA 2O5CA 3MFQA 3KLNA 3H87A 3OQIA 2FR0A 3CJTA 1DFHA 4YCMA 5K8JB 3G6KA 3W5CA 3ITEA 5DYGA 3ACDA 1BE1A 1ADYA 1J7KA 4ER3A 2DH5A 4PIVA 5F9MA 1TYBE 2VDPB 2CFIA 2YY6A 3BYZA 4YJDA 2X5OA 4Q3CA 4M1QA 5K0TA 4UJ5A 4MLZA 2JB9A 1KH1A 1OPRA 1U2PA 1ZCAA 3C98A 1KJYA 3FCEA 4CCAA 2IYYA 5HUQA 2VK8A 5J43A 4XSHA 4WW0A 1OWNA 1UMDA 1W75A 3L0PA 3HYCA 3EVNA 3RKSA 4PLCA 5SZKB 2H31A 4NE9A 3MSXA 1PJRA 3WYBA 2HK6A 5A4IS 3GLGB 3BGIA 3KQMA 3IDOA 2IVZA 4ND1A 1JEAA 3R6DA 4P5PA 1IN5A 1J21A 2P75A 3QWFA 1Z5VA 4HDMA 3EXFB 4MULA 3T4EA 3HP7A 4FFBB 3U1TA 1DJOA 2YV2A 1T6NA 1IIRA 3CA8A 1NJ8A 2UVDA 2BZ0A 2C9CA 3O0TA 4UU7A 4AXXA 1YE3A 5JYEA 3RUHA 4AMBA 1RQPA 4L0CA 3ZI7A 4B48A 1OCEA 2JCSA 4RZSA 2X0DA 2G1UA 5JS8A 1YFKA 2I1VB 2IYTA 3ISVA 4K6FA 2AJ8A 3SC4A 3H1EA 1DKNA 1SKYE 1VHTA 3PQDA 4JP3A 3DZDA 4UVIA 2W9XA 4NV3A 1TJPB 4X66B 4CCYB 2B20A 2ZSUA 1R6AA 1YZYA 2OPBA 3BMXA 4ZCQA 1EUZA 2QQ0A 3L4BA 2AN4A 1GKIA 4R0VA 4QVKA 4QFDA 5IZ4A 1T6YA 1GWNA 4IFEA 3U60B 1EUQA 2HJVA 3K31A 3I9LA 2BGMA 1Z6TA 3QVWA 1LJ8A 4G26A 5JD3A 3LUFA 2G9QA 1W8IA 1FSSA 1O2DA 3LUPA 4EARA 2FKNA 5A05A 3PDIB 2WQ6A 4K3UA 2M1XA 1BXZA 2EWVA 1PNVA 1F1JA 2OVBA 3ZHUA 4DANA 1TK2A 4TOIA 4XGNA 1S8AA 4YACA 4FYMA 3B5IA 2GD0A 5FWAA 4YRSA 1CDOA 4B3MB 2ZREA 4QL3A 2NU8A 3ZG6A 4EGCB 3BTOA 1PVDA 1K7XB 3A3NA 3NOVA 4XUCA 4TZ6A 1P4AA 1TYZA 4FIDA 5JC8A 4F46A 1VFPA 1AZSC 3IIJA 2AMLA 3OLVA 1ZESA 4NYMQ 3T3MB 3ZHOA 1DAFA 3O38A 4FS3A 1WW2A 3LT5A 3WE7A 4N8EA 4Y9SA 2OCYC 1M2EA 5CX4A 2VK4A 1ZINA 3YASA 3D6VA 4UHJA 4OG2A 1E59A 4CKBB 5FOXA 4L5YA 4DT1A 3FBTA 3TKAA 1U3UA 4XEUA 5J3JA 1CBUA 4ZRNA 2H0RA 4OHZA 3ISTA 3V4PB 5K5EA 1QGOA 4LC0A 3BWVA 4EG0A 2POQX 3BICA 4BLWA 3AOGA 1AKUA 4MVJA 1XP8A 2H5JA 4I36A 1PR0A 1DC3A 4CV2A 1N5OX 1RYBA 3ET4A 4RXMA 3AILA 4C2UA 2EDCA 2WJWA 5JNRA 1IBKB 4JI1B 4OQNA 4OI1A 4NZZA 4YP5A 5J63A 1JYSA 1BEUB 2B8JA 4NZ9A 1N3LA 3DOOA 4O1MA 2IZ0A 3CEAA 3OEHD 1B2RA 1GRVA 1JSCA 4FMBB 4RCZA 5CTAA 5EWMB 5TARA 4EA7A 3CH4B 2IPXA 1QX4A 4OQMA 2RI6A 3A4TA 3RVOA 4Y7CA 4LJAA 2VHUA 3D3WB 5JATA 1PZGA 1I1HA 1RHJA 1ITZA 5EIEA 2O2SA 3KHSA 4COKA 3KKLA 1U7OA 1N7HA 3UMCA 4EM6A 4JODA 5KYUA 2OZLA 1O97D 1SHTX 3H7IA 4NABA 1D1QA 1UKAA 2VJQA 3IP5A 3F67A 1HMYA 1HE2A 1RJ9A 2LDBA 6LDHA 3W6ZA 4EECA 2DU8A 1V5FA 1CJMA 1IVYA 3HKDB 4MVJP 3T5DA 3LW7A 2ID4A 2O3RA 3NHRA 3DDCA 3O8QB 6ABPA 3RTAA 2C8VA 3WAKA 3UBTA 1GZDA 4UNQA 4DR2B 3MAJA 5I3ZA 2ZZKA 2FMTA 2NG1A 2Q2WA 1MN6A 3BZUA 1U8FO 4Y1RA 4H3KB 1K3TA 3BD9A 3GGJA 4R2IA 3BGSA 3LC1O 5ERGB 3GJ8A 4MWOA 8MHTA 2FN9A 5DNEA 1NW5A 3U3OA 1TUIA 3ESXA 3OTQA 1T2NA 2GKSA 1GA4A 5JDIC 1E4EB 4B3SB 4J43A 1UT5A 3H5NA 1EA7A 1NJGA 2ORYA 2J9XB 3KZMA 3QVUA 4EKDA 2PJDA 1T1RA 3I28A 1XD2A 3PNVA 5CH3A 4H6VA 1TX4B 2CFTA 3FTNA 2W93A 1E3EA 2PRZA 4MV8A 1JIJA 3NJRA 4DV4B 2QRUA 3FKSA 1T2DA 4KTVE 5KDLA 2MYPA 2QN9A 3ZD6A 6REQA 2BLNA 2G70A 3AXTA 3BDAA 1NFRA 4PZDA 3CB2A 2BMAA 1ZQ1A 4XDZA 3HEBA 2ATVA 2ZULA 5HMLA 1N8SA 4WNAB 3L8CA 3VH1A 4DLLA 5JADA 3BTSA 5EN4A 3KCQA 4C5CA 1Z56C 1Y4ZA 1XLTC 1K27A 3AH8A 5A1JA 1SOMA 3OIWA 2OYSA 4IJ5A 4F91B 1DRUA 4D97A 1QVVA 4HYEA 4A03A 5I7EA 2ZJ2A 3PC4A 4ZVVA 2E4WA 4ND3A 4O3MA 4IIVA 4Q19A 2ZTLA 4KPEC 3ANLA 1NR5A 3K0CA 3CMCO 4HX5A 2CHUA 3FMIA 1Z8DA 1JSZA 2JBHA 4HEHA 3GFTA 5E9QA 2HDWA 3PKZA 1XCOA 3TR0A 4X1IA 3GD7A 4Z3KA 3T5MA 1JH8A 1EI9A 2PLWA 4L4XA 4RQAA 4CYMA 1XLVA 3AU9A 1X80B 1SVUA 3K0AB 4N7BA 4TWJA 2PU7A 5I4IA 4QXAA 3RFCA 1UK6A 1NYLA 5DM70 1VJ1A 3ML1A 4PQEA 1AUXA 3C7CB 3QOXA 3TW4A 3P9CA 5JNWA 1VHDA 1WUYA 2NUAA 5BVHA 4GKJB 4BNIA 1R66A 3WYFA 2HRCA 1EK1A 1YR1A 4Q34A 1RXSA 1V37A 2MDTA 2P3LA 3GH1A 4MJ7A 4BMPB 2RHBA 3VOTA 3T9CA 3R9WA 2RAVA 4OHCA 3KM0A 1SD5A 2YV1A 1A1SA 1FSGA 3AUYA 3E9DA 3MT7A 5AKIA 4YRJA 5JNTA 3KV3O 3G23A 1XPJA 2HSJA 4BEJA 4EA6A 2YTZA 5DHUA 2V9ZA 3IPLA 4RHTA 4UTVA 1RACA 2IA5A 2NVUB 3GEGA 4HNQA 4D02A 5JH7A 3BGVA 2D3WA 2LIVA 4KXNA 1E6WA 3TZEA 3VR4A 5AW5A 2ZBUA 3GFGA 1GIAA 1P60A 2Q7XA 3RJTA 1JBEA 3RWMB 4DPKA 1UJ5A 3ZW8A 3FTDA 5KYWA 3O3NB 1TJ5A 4DV2B 2QNRA 3HXOA 3MG9A 4ID9A 1LRKA 3BQ9A 4XI9A 4DWJA 1WB9A 2ZSHA 3DGFC 4M98A 3IAEA 4JBGA 5TS2A 5AD1A 3RAEC 1H66A 2ZI6A 1XNQB 5FOVA 3TQTA 5HE9A 1SA0B 1T5OA 2R79A 3KLOA 1KWGA 1KPGA 1K0UA 4BASA 2PR2A 1K6IA 4J29A 2ZTHA 3ZD7A 1WTCA 1AQLA 4EOGA 1U8CB 4AB1A 3IOYA 4MUMA 3CBGA 5GGYA 2W70A 1RLIA 1KEWA 4U5QA 3VZQA 4CVNA 4DCOA 1QG6A 3T9DA 4DCVA 2FU5C 5TXGA 5JFGA 3AJ8A 1JJVA 4OLHA 4YP0A 1C0KA 1WU8A 4KXVA 5HFNA 1D6NA 1E9VA 4BJ1A 1P0MA 1VRVA 2J0UB 5EJ8A 3HXKA 3TAHA 4PU0A 4BNVA 1QCDA 1VA5A 1XDDA 2DR0A 3IP8A 3IT2A 5EC8A 2XIJA 3U39A 4O2AF 1GZ3A 3JQPA 2QVCA 1BZYA 4BJ3A 3QOYA 1PV2A 4F9EA 5IUKC 3CEHA 3O2SB 2FPUA 1R18A 1ZGGA 2HTFA 2V9PA 1Y3IA 3COSA 3GJ4A 3OZTA 4FFRA 3RS4A 1G19A 1WM1A 2O0LA 1JE1A 3TSYA 2IYNA 3H83A 1XK7A 3JQBA 3LUHA 3T7JA 3NBZC 2VYVA 4QYXA 3WQSB 1XR3A 1V9CA 1PNOA 3DWGA 1S2GA 5SY9A 2UZ1A 3QQ5A 3VDQA 2FPWA 4IIJF 4Z0PA 3BE6A 4C2AA 1QHGA 1OH7A 5ILOA 1ZU5A 3A4MA 2Q3EA 5CT4A 5DHRA 1FE8A 4RWZA 1QKJA 1YO6A 2WU8A 2YXPX 3IVCA 5BNFA 3ZE7A 4ENPA 3KT3A 3TUZC 1EUCB 3FE2A 1KDZA 4ARCA 1WCV1 1BE6A 2DCMA 3ASZA 5AO9A 4DR3B 2YS7A 1VGQA 2QTWB 2PH5A 3OP4A 4TV9F 5C5IA 3K0FB 3N2KB 3NIGB 1KZ6A 2CXPA 4PO1A 1HLGA 2FN3A 5D3ZA 4U6SA 2X2OA 2MSLA 3IQFA 5DU2A 3W7AA 3GH3A 1E2MA 4PFQA 3KT6A 4F9FA 1PVOA 3RUAA 1FRZA 2PXCA 3TSZA 4N03A 3WOHA 1WCIA 2OBNA 4Q5IA 3WFJA 4XJXA 1QLHA 3UHFA 4JC5A 2IS1A 1RM5A 1XZNA 5J2UB 2J59A 1NVVR 1MVNA 1X9IA 2H7YA 4H77A 4GKAA 4IKEA 2VBGA 3PFHA 5DW0A 3EPHA 5HKKA 4BCDA 2H7VA 1G4HA 3F5FA 4E12A 3Q8LA 3VPBA 1IHOA 3WYGA 1UK8A 1RAHA 4XPIA 5AUNB 1HRKA 1LPNA 1GSOA 3ZVLA 5KWJA 4HFJA 1NJSA 4LGYA 1XZIA 2H7CA 5D2CA 3D59A 1U7WA 5A3QA 5THQA 1UPCA 2DWUA 3TM4A 3A06A 3Q5EA 4H7JA 5KKNB 3MOGA 1AS3A 4LSWA 1NQ5A 1Z0FA 3H8JA 3IP1A 5G1NA 3ANTA 1RLUA 5KC8A 2V3VA 2F00A 1CQZA 2ZJOA 2OWDA 3BSFA 4KQ6A 1BW9A 3MMNA 4N76A 2VHWA 4HYYA 4PRYA 2I8AA 1J1ZA 3VOSA 1ZH6A 2TMKA 4RH0A 1XD9A 3HN6A 2JFWA 5LDGA 1IEVA 1HDGO 4IGKA 4AK9A 3ROKA 3KDSE 2QP4A 3L4SO 5CB4F 2FWRA 2QAGA 4PE5B 3V7WA 4DV5B 3F9RA 2B25A 1Z7EA 2Y2VA 2FQYA 1FDIA 4NBTA 5K03A 1YB7A 1OLUA 4MDYA 1H2YA 1VCIA 4LX8A 1DX6A 4YJ2B 2W0SA 1D5WA 3GFBA 2QRVA 2OFFA 3TRIA 1Y1QA 2V4UA 4J2HA 5EIBD 5EWLB 1JI0A 2FP3A 1ZUWA 2EV9A 5LZ7A 4DOMA 3ZLJA 2P62A 2R9VA 5F51A 1I1QB 1NF9A 4TVBA 1L9KA 3WL6A 3QOFA 2ZJYA 3ADDA 4JX9A 2W6MA 3GQBB 3HJCA 4XRGA 1XC7A 3V1MA 1LPAB 4KK3A 3JYHA 4YT2A 1OAOA 1G2PA 4QRHA 2PUBA 3UCXA 1QIEA 2EJWA 2B98A 2PKQO 4UUBA 5B30A 1S9HA 5BY2A 2LP4Y 2KBFA 4MV6A 1U0BB 2D62A 3VKFA 2KX7A 3E3AA 2J4FA 2OY0A 3VJMA 1A2KC 1U4NA 3AUFA 4KI0A 3EXHA 3UV7A 4DLPA 2JNWA 5HNKA 4REQA 3ICWA 4CLXA 3KWLA 3KJQA 4YO7A 3GDFA 1CDZA 4MP3A 2C97A 2FFQA 3ND8A 4KUGA 4D0SA 4WXMA 4EATA 2X86A 4OAPA 1XLTA 1NYRA 3KBBA 4W1QA 5EE1A 1UKYA 4ALMA 2IYPA 3A9RA 4ETIA 4JB3A 2W7TA 5CLHA 1E4YA 3JTMA 2EFCB 1Z4JA 2FPOA 2WQ7A 4HVAA 3OQ1A 4ALKA 2BEWB 3KJFA 2X4DA 2XUHA 4JJ4A 4DA4A 2ZJBA 1UPAA 4FEYA 4MB6A 3VAAA 2HUPA 2YVQA 3PFNA 4NAVA 3GUZA 4YROA 2GEBA 3FLEA 5CAEA 2JC3A 5ELLA 3RH0A 4J3FA 3QXSA 3CSDA 2VK2A 2A57A 1XHFA 1J24A 1DC8A 2EP7A 2Q5FA 3QXXA 2R8RA 2R8YA 1HO3A 4HY3A 3EGWA 4MTCA 2RONA 1DKQA 1DQNA 2FPGB 2I4IA 2W8BA 1BROA 1EGQA 2CMFA 4BP1A 1MJGA 2KWIA 2P11A 3LUCA 5BN3B 1R4NA 1U1GA 2CNNA 1WPXA 3H5WA 3JS5A 4JC8A 5BWLA 4XQEA 3P27A 1VSTA 3VTAA 2KQUA 4JLUA 4UM8B 5BSWA 3F3KA 3I64A 3CWZA 5I9TA 2BYTA 4JD5A 5DTEA 4XVRA 5FPQA 5JQWA 2Z3VA 3GEHA 4V02A 3HCWA 2W6PA 3K0SA 2YZ2A 3OPQA 2GESA 1ZOLA 5BVHB 2I2CA 3FNRA 7YASA 4LJRA 1WZ2A 4GGMX 1SKYB 3PX3A 1A4IA 4HAXA 1JG3A 4WN9A 3IBYA 3KSUA 3PWKA 3IODA 3R09A 3LKBA 3TCKA 1QF7A 1D5CA 2KPOA 3A4LA 4W1RA 1PR2A 4PEVA 2HLHA 5AXDA 3UN1A 2QM7A 1S2NA 2I2XB 4JL8A 2IBSA 3F5MA 4W6QA 3MWEB 2HJGA 3P45A 4RIGA 2WUGA 3SYNA 3AR3A 4W82A 5ICCA 4Y6QA 4DXAA 2GZ1A 4FMCB 4DW8A 1PQYA 4A5OA 4AICA 2AOTA 2SCUB 2ZRBA 1W76A 1XQWA 3AY6A 1KIFA 3ZE6A 221PA 4XPZA 4R40A 2IHJA 1NNLA 2IUEA 2Y0PA 2A7QA 4FOPA 5CURA 2GO1A 2NZUG 4G41A 2GLUA 1KJJA 5DRYA 4FONA 2ORVA 1XAGA 1YR8A 4PAWA 1K7SN 2QRKA 4YT5A 2EQBA 1M34B 4UUOA 5E9AA 3B12A 1BFDA 3CUSA 3E61A 1FUEA 2D5LA 3DEHA 2H51A 3B1KA 3HVIA 3P9KA 1R0YA 4N3CA 3B1XA 4QLAA 4XRRA 3WGTA 3ZV6A 1JVBA 3PDWA 3HI6A 2YOHA 1PD0A 4F1KA 2A5LA 4POOA 2QBYB 4BX9A 1U4SA 1E3TA 1SWVA 1YJBA 4PYIA 4ZOCA 4CQLB 2C99A 2I6XA 1C3OA 1OLXB 3AIOA 3KX2A 4Y2VA 3F3YA 1BXGA 2REQB 3KKKA 4BNJA 2C54A 4M83A 2ZUCA 2HMAA 3TR6A 4G23A 2L69A 3OZDA 4I5DA 5TSDA 4BLOA 1C14A 2PGLA 3CTPA 3B3FA 1I6WA 2XUPA 3KUKA 3CG4A 4XWYA 4BBJA 4KYTA 2XHZA 4IUDS 3F6PA 5FOSA 5HF9A 4CIBA 1Z4LA 1TMOA 1JDNA 1B3RA 1SGWA 4HNTA 5AVTA 3S2ZA 1J8VA 3BX1A 3OCCA 4JQSA 2A86A 5J40A 3TE6A 3TZKA 4JJ8A 1B6GA 5A5GA 2P4EA 2YWHA 1JEYB 2W6QA 2ZM5A 1ZOIA 4UM7A 3HYTA 2P6PA 1MKYA 1TE2A 4K9LA 5ALKA 1MZPA 1TU3A 3RT9A 4YYEA 4RA6B 4KQ9A 1NSYA 1F0KA 4UOQA 1XXLA 2H0QA 4EBBA 2FUEA 3IP7A 2A1UA 2VIIA 2R1VB 5JCOA 1BDMA 2FY8A 3D0RA 4HAZA 4CF7A 4MS4A 2WHPB 4OK3A 3JZDA 2CZCA 3IUSA 4GKVA 3T4UA 1TXGA 5JMTA 3BFVA 3NBKA 1IN4A 4G5HA 4KIJA 3AINA 3GGPA 3R7WB 1NTRA 4NK4A 1XDWA 3SIWA 1A9TA 3CCBA 3HYSA 2EFYA 4KR2A 4BNHA 1R64A 3PXBA 1J5EB 1WS6A 2F3PA 2XQJA 1B6SA 3T1TA 3CN9A 3ZGOA 1JHMA 1MA3A 1KY2A 4KQWA 3JYNA 2DEUA 4HEA1 2MYNA 3DOEA 4TLBA 4D79A 1KY5A 2FWJA 1UM8A 3NC0C 2AOWA 1QF6A 4C4PA 2CL7X 1ZEMA 5FA8A 4GR4A 1C7FA 2JA1A 1C1DB 2Q9UA 4UUAA 4PLPA 3IYLW 4O8CA 1KERA 1C81A 1U3DA 3UPTA 2CL5A 4DIBA 6Q21A 1GSIA 4F6LA 5AYVA 4LK2A 4EKNB 3AI3A 4U0KA 3HK2A 2JA2A 2R2AA 3DUFA 4B8ZA 2YFKA 3NIWA 1L7OA 2UXBB 1TRHA 4EMUA 2YJGA 4P7JA 1VYVA 2WKWA 3VHRA 4G1BA 5ICGA 5FNZA 3X1DA 1HYEA 3PXAA 4WKNA 4P82A 2W22A 1P74A 1BKDR 3FPLA 1DI0A 2AG8A 2O3JA 4H7FA 4NQZA 4P3NA 5TS3A 3UPUA 4ZANA 4BMSA 1MX9A 4IY1A 4PYRA 5JLAA 3ZCRA 5DBHX 3EB9A 5TMDA 2GYYA 2GBLC 3E27A 3FDJA 4LNHA 4DIFA 3WR5A 3QF4B 3EC2A 5CDYA 1X7YA 1DZIA 3R9IA 3IUYA 3BE8A 1T0BA 3DUFB 1WBBA 4MYTA 3O1HB 2PVSA 3OCVA 4UZFA 2YDXA 4I14A 4O4HB 2PK3A 1T6ZA 3GJRA 3T34A 1G20B 1BH6A 4N82A 2XWJI 4A6XA 1DIRA 4EHIA 1KQGA 2H1RA 1NOIA 2A7XA 2L2QA 4R05A 3PCTA 4UJ3A 5CIYA 4BUZA 1Z5ZA 1UJNA 1VIAA 3FYUA 4WVFA 4J7CA 1BHQ1 1HUQA 4URUR 2Z3ZA 4EUNA 1MFZA 4PVDA 3TL2A 2I3ZA 1YA6A 1KZ1A 2QTAA 4B79A 5K8LA 3OAAD 3TCNA 1JSLA 3N8IA 1W49A 1GVHA 1CR2A 2XMDA 1UPTA 3AONB 4F2WA 4LF5B 1LCIA 4B6FA 1N6OA 2QN3A 3IR7A 3KB6A 4KXWA 5LDHA 5JSUA 4DLVA 2CLFB 3AI7A 5CDFA 4KFRA 4X93A 1T9KA 2ZJ0A 3A4YA 4W7IA 4TLMB 1CEXA 2RJ3A 5K0CA 1KK0A 3OZBA 4QT0A 3LWBA 1BMFD 1HLPA 2NSJA 2XRZA 3CVXA 4K26A 3IQHX 3MWKA 2H4XA 4QPNA 3LCJA 1EUDB 1H6BA 1XDSA 4K2AA 1YHNA 1MAHA 2VRWA 3J7AC 1L7RA 4Z49A 3FOWA 3I12A 1G5RA 2F3QA 3LX4A 2JEYA 4QRDA 1JQAA 1FXWA 2HRBA 5FO0A 4ASUA 4BFVA 3OM8A 1JL3A 2NTEA 4M1MA 5EIHA 4D7AA 1F0NA 4GICA 4BLVA 1FA9A 1Z5WA 3DB1A 3W4KA 4BQSA 2O19A 3G49A 2EQAA 3QMVA 3NHYA 4NATA 5CW1A 4OI2A 3LUAA 1BS2A 1GDTA 1LNSA 3M7IA 4X1IB 5EIWA 4KHPB 5B58T 1FFCA 2CYCA 1O03A 4J4BA 3PFBA 3ETHA 1T36B 2AUMA 2QE6A 1N5MA 1J22A 3ZLVA 4X20A 4R8LA 1EFPB 4KZKA 4MK4A 3CFYA 4FZ3A 1GAJA 1I3LA 1L1RA 3BG5A 5KTNA 1W36B 1UOPA 1ZCJA 4RVFA 3VPCA 1Q19A 2I22A 2JK0A 3C8UA 5AH0A 4GF5A 3C5CA 1KQ3A 2VRNA 3GFFA 3P52A 5IAGA 5LC1A 5A4MS 2HMTA 5DM2A 4JCCA 2OO7A 1YBFA 3FGNA 3AERB 1RXYA 1KSHA 1OV4A 1TVKA 3AETA 4JUFA 2QD1A 2PGJA 3TKYA 3UXHA 5A06A 3D02A 1BXGB 3MM4A 1I94B 1K86A 1NV8A 2FG6C 4RY0A 2HF7A 3ILVA 1FMFA 4IKPA 1Z6XA 3OH8A 3MJ4A 2C5SA 3R9XB 4EG1A 3S0JA 2P9BA 3WMWA 2FPLA 1KEZA 2VNIA 3CO0S 3DMHA 3HSSA 4IHJF 4XR9A 4CKCA 4RTPA 2I4LA 1ECJA 3O3CA 3ERCA 2LVBA 2IXGA 5JEDA 4X92A 1FF9A 1FLNA 2KW5A 5DNYB 4OQDA 3COJA 2JIQA 1J0AA 3CCCA 1M2VA 1K06A 3L02A 4YRIA 4LV6A 3GDWA 3OJLA 4Q37A 1QC5B 1W0KD 3ZH2A 5KHOC 1ZRSA 3ZU4A 1X77A 3C4VA 4FWIB 5JXGA 3WGNA 1XQVA 3ON5A 1PD1A 1UBEA 2GD6A 1G8SA 3HCEA 3RBVA 3IMEA 1K3FA 2BTQB 2C9ZA 3K1AB 4JYPA 4HSGA 4RF4A 3U7RA 5FFMA 3CWCA 1M54A 3U2QA 2G5TA 1ZIXA 3FIUA 3S81A 1EVYA 3DDNA 3NEJA 4HR7A 2B2CA 2W2OA 3QGMA 3REQB 4GM4A 1USUA 3KOOA 3VI4B 3B2NA 3NG1A 1EYZA 1YZHA 4E08A 4HMPA 1K8XB 1FFXB 3STYA 3TE7A 3MTQA 1HT3A 3GZNA 1TT5A 2EERA 4FNOA 2C57A 5AI0A 2O8CA 3MUNA 3NWPA 4LXGA 4DMFA 1TIKA 4MUFA 3JRWA 3RSCA 4HK4A 4LJYA 3EXIB 4GOMD 4BFYA 5ERXA 4MJ3A 1S3GA 2Q6TA 2XB9A 2TS1A 5FPPA 3U3ZA 2B4KA 4BNZA 1OT3A 3D4LA 4X3PA 1ATIA 3CZRA 3NHFA 2EWMA 4EHLA 1UKEA 3MWLA 1JS1X 1C3XA 1KP2A 4X44A 2H5IA 4YASA 3ZN2A 4ZTZB 2XGGA 3UMJA 4RELA 3FFAA 2I3AA 2PQMA 3H5LA 3GEBA 4V0QA 4O4IA 4Q3KA 2B30A 3ZDEA 3HCFA 4PYNA 1AQJA 4OB7A 2BTEA 5EHGA 4ON9A 3V8PA 4K6CA 4AUNA 4H35A 1QIJA 1RLMA 3W3AA 3TN7A 3RFUA 1ZCBA 2C1EA 4IS2A 2Q1SA 1YFJA 4RFSA 2Q6IA 4D99A 3C0KA 1E0AA 2NO1A 2W8BB 2WAAA 2J85A 3ASVA 3C3MA 5DYNA 1KVRA 1Y5MA 4ERXA 5TQ0A 4JUBA 4RQUA 3Q6MA 3LCMA 2BI8A 4HPWA 4JIMA 4R83A 3VPFA 1UXHA 1UM9B 4E2XA 4X64B 1JMKC 1XWIA 4N6GA 1OW3B 1D2EA 1PV1A 4GZ3A 5JO9A 1OWOA 5HQ3B 2O05A 2I78A 3KPVA 3OAAA 2BM0A 4GPIB 3UWDA 1R8XA 1SVNA 1NVDA 3OTWA 2GCOB 3EGXA 1FYDA 1Q7GA 1OKKD 1QF9A 3F4LA 3PQCA 2YBEA 4V1CA 3QKWA 1N1DA 3UJPA 4MWBA 3EGOA 2AA3A 1LBIA 1XRRA 5IP5A 3QWAA 4NP6A 3BF8A 4D9NA 3SQXA 2QL7A 1RKQA 2PLRA 2XQFA 4UNRA 1M10A 4MRSA 4MIYA 1U9IC 3TIVA 4HRVA 4LVNA 2WMOB 1NBMD 4O8ZA 2DLCX 4DG5A 3RYHA 2E82A 1OIXA 1UODA 1H1DA 3PC8C 2DHQA 8OHMA 5FL3A 1YS1X 5H9WA 3DZHA 4W4TA 2P7HA 1GCUA 3GVPA 1ZJ6A 4GVXA 4C7OB 3RRZA 5IJ0A 4US0R 2JG3A 2MINA 4M1ZA 2EBWA 4WGFA 1P2BA 4H0FA 4J0JA 2X3UA 4Q48A 1TUBA 1HK7A 2XMBA 2X7HA 2OXTA 2IFTA 1KMNA 5D5PA 4JELA 1SVLA 3F6RA 4BO4A 5JRDS 2HI0A 4G0XA 1OHHD 1FNCA 1Y8RB 1UL1X 3D64A 3GT3A 3L1JA 5IJXA 3SR3A 5IZCC 5KQGA 2GFHA 4WL0A 3U4HA 4YLYA 4DNFA 3U3RA 5KQPA 5FI3A 5EJ6A 4WZ6A 3LFTA 4WY2A 1UBHS 3O21A 2XX3A 3G82C 1XG5A 2OLJA 3GA5A 3HJGA 4WK2B 3B2EA 1EK2A 2F48A 4J8PA 5HBRA 2CVFA 3DMGA 2VDRB 4M87A 2ZXEA 2GZ3A 3V97A 3IELA 3DXXA 3QLUC 3QTTA 3EF0A 5A9SA 2G76A 3FI0A 1ZX1A 2X5KO 1Y9DA 1OBCA 3NYIA 3QFFA 3M3DA 2WFLB 4L27A 3TFQA 1J56A 2HGZA 1U0EA 2G4VA 2Z8YM 5HOQA 3ONDA 4M8LA 3TZHA 2OG2A 1I13A 1SCBA 4D4JA 4EMBA 3VNUA 3RUPA 1SBNE 5CGZA 3IERA 4N0DA 3FWZA 2OCGA 3K0BA 4DAEA 1UPBA 1H2HA 3ADKA 3CMMA 3MRVA 2QTVB 3BXHA 3RWOA 1PDVA 4Q1FA 4UKDA 1ESCA 4D4GA 1P1HA 1UANA 2X8JB 2GBCA 2ZE8A 3F71A 4QBFA 4X71A 4DA6A 2CFSA 2VZ0A 5K7SA 5ELXA 3OHSX 1YAJA 4L8VA 2JBAA 1B74A 4OHUA 2ANCA 3ZK8A 4DDHA 2FSVA 4U2GA 4UUQA 1R50A 3OQBA 4MAFA 5JSYA 1RYFA 5C8YF 5K4GA 3VAZA 2QSYA 3EXG2 3L46A 4BMDA 1DAKA 2VFAA 4MWGA 1YFZA 4LRQA 1TO6A 1ECFA 1UMBA 3TW6A 3O9MA 3KYCA 1WPGA 2OR3A 2HJWA 2WIDA 3EGVA 3JAMA 1ZM3A 2ODNA 2EJTA 1VIVA 1FFDA 1E96A 2ZWIA 1L5KA 1H1LB 1EEHA 2A78A 3BORA 4JX8A 5CT6A 1OX6A 4ACBA 4AG6A 2DM6A 4UOZA 3T7TA 5JU6A 3TRDA 5J1SB 4N7RA 4RD6A 3VX3A 1GPYA 4AI6A 4IHQA 1GZ7A 4FLEA 1D4ZA 3FPCA 2QXUA 4LYFA 2VR1A 5HQTA 2P0YA 3DDHA 2M6KA 4ZK2A 4KWTA 3WWCA 1G2IA 5K2MA 5K0BA 5KNBH 4CCSA 2VXBA 4UTOA 3DAYA 3V3TA 4L7VA 4AN4A 5A4FS 2HIHA 3I1YA 1DZ3A 2JPDA 2CNLA 4MA5A 4XSGA 4RGYA 1T1SA 2J9FA 3NUZA 5DLQC 4QOHA 4QOSA 1RSZA 1DIGA 4YQZA 1ZJYA 2AZ4A 4ND8B 3RVSA 1XOIA 1GPWB 2HMYB 2FFAA 2Y05A 5A3JA 4UM5A 4M8IA 3U5TA 1RRPA 4LBVA 3DWFA 1GPNA 2VHQA 3KCNA 4OP2A 4QU0A 2JRCA 4BX8A 4LY6A 3NBQA 2P4UA 4RE6A 2NSHA 4UMVA 1RAFA 3IOBA 5K8UA 5CHYA 3P4YA 2BSXA 3WYNA 4CUJA 1Y5NA 2H1HA 3V2GA 5A3SA 1KTIA 3E7FA 1W0JD 3IE0A 1Z45A 3V34A 3H1AA 1RR6A 5CCEA 3MERA 1SPXA 1NFFA 2W83A 3JVDA 3KOZA 1U9IA 1RFGE 2APJA 2R84A 1CUBA 2FLWA 2GEJA 5JNUA 2PX0A 4BB6A 4HJXA 1U0OC 3Q6NA 4K8OA 3QVJA 3TD6A 2AYZA 4M0MA 4BFWA 2IDKA 3WLMA 3VR3A 3WLQA 4W5OA 1W5BA 4HP8A 4EW2A 5FOTA 4MUNA 4BLQA 4OBEA 3IQDB 1M1NB 4H6PA 2IHNA 4S24A 3ZUGA 4ZYWA 1E2KA 1VPTA 2MHCA 2NO5A 4AL4A 4DS3A 3WK5A 1J2JA 1ZQ9A 2VQ6A 5IUNC 1ISRA 1OWLA 4CT5A 1HZJA 2YVLA 4DZTA 4EW3A 1XQYA 1ENZA 2FV8A 1IDN1 1ORDA 2UZIR 3KUUA 4PSDA 3LYLA 4CEHA 1A04A 2ECQA 4G0YA 3U5ZB 3QA9A 3LPCA 1OLXA 3AUKA 3MXOA 4U3JA 2PX2A 3U49A 1VE5A 4NSNA 2AFIE 4NBVA 3HSKA 2EZTA 4B3RB 3ZCXA 4UASA 2A9OA 1OT5A 4AMYA 1LVUA 1BG6A 4B4WA 5LKAA 3ZDDA 1EDBA 1GGNA 3AKYA 1WDLA 4K9QA 1UBNA 2FXVA 1HDYA 1KH3A 1YULA 3WMFA 3N05A 3V8QA 3RS3A 3CRMA 1LQTA 2RD2A 4K9OA 1XMSA 2BP7A 3TXAA 3WO1A 2GAFA 5FPKA 2IS4A 2GVZC 1PSWA 3ZDAA 2QM8A 1WOYA 5EY5B 3UJ9A 5LLDA 3L84A 1FY2A 1R0WA 1H9CA 2WD7A 2ZRAA 4OY3A 2PUEA 4P7FA 4F0JA 3HY3A 5BUQA 4IDFA 2YWFA 3OIFA 3CN7A 4YMSA 1JXAA 4MKIA 5FI5A 3UMBA 1HTBA 1RQ2A 2MT9A 4TRNA 5IM4F 4MRNA 3AF3A 1A50B 2H06A 1J9EA 3HUFA 3L9XA 4WOCA 3JAKA 1CY7A 1JR3E 1U8ZA 2GNAA 2XOXA 4OXYA 2NTYC 3HDTA 3P20A 5FBWB 5AM2A 1P1BA 5BT9A 2PUVA 1SUAA 3D7MA 16PKA 3DLTA 1WA5A 4BTLA 3AG5A 2RK3A 4JU9A 3H9EO 4ZCMA 4PC3A 4YRTA 3E9RA 4KDCA 1QYDA 4POAA 1A77A 1FS5A 3F8SA 4R9NA 5DGIA 1L5ZA 2IP4A 1I10A 3UZUA 1C9YA 5MN4A 1IOZA 3BDVA 3CKYA 1EZ1A 4F72A 5CJJA 3UOAB 3W1EA 1RXIA 4EJMA 3ZWPA 5E4YA 6REQB 4R8MA 1PYDA 1RYYA 4O2AA 4II7A 5KYXA 4GX5A 3D6JA 3C3DA 3BWCA 4HGPA 3BIXA 1H8EA 3DBIA 4ZCLA 4CMGA 4DQKA 2V1UA 1MO3A 4EQ6A 3BEDA 1NN3A 1MOSA 3K9NA 3PA8A 4KJZA 4AMGA 2RC6A 3RR2A 1UWKA 2CZGA 1QGUB 1W85A 4LDPA 3PEWA 3USZA 5TNXA 1CY2A 4ZHQB 1EWTA 2PFSA 2HUNA 2DUJA 5DI9A 1FOEB 4MZDA 1RI3A 1NWHA 4RBNA 1XNRB 4AVYA 3U6KA 1VMAA 2NAPA 4BE7B 1GCAA 2VF8A 1UIMA 4C0WA 1I0IA 3GJZA 1E2UA 4AX4A 3MGCA 1CQWA 3AKDA 3H5RA 3SJAA 3ZXXA 2UU9B 2E48A 3IHKA 5G53C 4J1QA 3C1TA 3WNQA 1IY1A 1NXOA 1TVCA 2AOUA 2ZBDA 3E0QA 4MQFB 2NSLA 1W4ZA 2BI7A 2PCJA 2VUSA 3SJZA 2PSHA 3DOCA 3EUWA 3HCRA 1XRLA 1BH2A 4F84A 2BM8A 1P6UA 2G04A 2WF5A 3BJMA 4QBIA 5J9FA 1DJNA 4I5EA 3WIBA 3NHJA 4LZAA 4C0SA 3FJOA 3LRXA 1TKRA 1K88A 2IHTA 1E9FA 1JVNA 1N2CE 1T5HX 3OMLA 2X0JA 3AEQA 5E4TA 1CUGA 1O08A 4WD3A 4DL9A 1J0DA 1YQWA 5ARCA 3QW2A 4AM8A 4AO6A 4WECA 1IAVA 4LHXA 2CFRA 2EZ4A 2QTMA 1SCJA 3HN2A 5KTTA 2BMEA 2INGX 1YDMA 3CE6A 3O8OA 3GHYA 4IIJB 4RK7A 3NALA 4NBWA 3FOBA 1NBWB 1IJBA 5ALPA 5KYGA 5ICSA 1A9XA 3KVRA 4ARVA 1P4GA 3ISJA 1RADA 3ZKWA 2JFXA 3TNYA 4J94A 1G21B 5TJHA 2Y1FA 3MELA 1YB1A 5SYNA 2AFIA 4P7KA 4UREA 1EE1A 1SC6A 4QTYA 2VWHA 5B7PA 4RMHA 3SZLA 4PHHA 2B1RA 4GD3Q 2NO4A 3AVXA 1X87A 2M9MA 3R5XA 4P83A 4ZU3A 3R7SA 1BMFA 4OM8A 4H1UA 1CUJA 1YRQA 2YYYA 3PIRA 4FMPA 5JAUA 3BXPA 4X97A 1FMCA 2H4JA 3G0GA 2X7JA 4G2NA 1AD2A 2EC5A 1FPQA 4C21A 1E4EA 4NBLA 3I6YA 1Z74A 5KMGA 2Z04A 5KU1A 4Q3AA 4R8VA 5TV2A 2RBKA 3BF7A 3SEFA 5KREA 4UW9A 2C8JA 2E2WA 2EOAA 1GPLA 2CDNA 5CT5A 4FHEA 1JHZA 3RKRA 4OSPA 3T54A 3UJ7A 4YQFA 3KOXA 1K08A 1SCQA 3DOUA 3FUWA 3OPYB 4E94A 4L50A 3TQHA 3B2QA 2ECFA 1UK9A 4MITA 2PUFA 1I5EA 1G41A 3T9EA 1OWMA 2JGDB 1BXRA 4R54A 3N2GB 3OOEA 2CLMB 1AU9A 1K6MA 5ES4B 1QIIA 4CXMA 2BZ1A 3M70A 2K7ZA 4I19A 4O5OA 5DMXA 3LGXA 1QAMA 5AHRA 2WIFA 5FTWA 1Q95A 2KE5A 1SXGA 4N5MA 2D1FA 3T5AA 1ABEA 3AR8A 2P35A 1Q7BA 2OBFA 4OHKA 1KMQA 1G6KA 2WAOA 1EG2A 1DINA 2WSSA 3IEPA 2IOQA 3F49S 5G4KB 4ETWA 1VLMA 4AULA 2GWHA 1YONA 1B41A 2FCAA 1JTVA 2HK8A 4E5UA 2BVNA 1JEQB 3EZ2A 4TLDA 3MWDA 1A8IA 3EAQA 4ZAFA 3WLEA 1XMXA 4QODA 1IUPA 1ZA1A 5K0EA 1JE0A 2OAP1 3LD9A 1XDBA 4NNJA 3EG9A 4R84A 2CHGA 2CXQA 2OD9A 5H16A 1W581 3DCIA 3PIDA 2BISA 4I3HA 1JU9A 1K6EA 2VAWA 2HXSA 4OK6A 4I1VA 4AO7A 2FDXA 2WJIA 4EIWA 3PC2A 4QUIA 1FNNA 4ZODA 3ZQUA 1AGRA 3R0IA 2QD2A 3RYCA 3IDZA 3TS1A 4NCNA 1SQ0A 1ZPDA 3DBOB 3FFBA 2IH2A 3SR0A 3B1VA 3S7ZA 5LLTA 1OILA 3PD1A 1SHJA 3LLCA 1ZH4A 1V3TA 1E9EA 4CIDA 5IDWA 2IEYA 5B55A 3IA2A 1CG6A 5FYDA 1UJ2A 4FJ0A 1GDHA 4PC6A 3HA2A 1JXOA 2PJRA 1CULC 4AUMA 3HLTA 4MSUA 5AJXA 1O96A 2J6BA 1EQ2A 2KBEA 4HNRA 1DXOA 4J0IA 3WGMA 3TECE 1UPXA 2PPVA 4N0EA 4V03A 1LF0A 2P2CA 1Y7TA 4UFPA 3MJCA 3WOVA 2ZRQA 1J2TA 3B13B 3B52X 1NMXA 3OE7A 4P35A 1DAPA 3PQFA 2DT5A 2VDNB 1Z4KA 3EIQA 4KQ2A 1PR3A 3F5DA 4L8WB 4RCYA 4LF9B 1E1NA 3I34X 4ARIA 1CR1A 1W46A 3ORSA 4H2DA 3AVQA 2C5HA 4DA7A 1JG6A 3AFMA 2I9KA 3OIGA 1EHIA 1A9OA 1KS9A 2HD4A 4BB5A 4B9AA 1A7AA 1O4VA 1V16A 2E3JA 2HJRA 1IQPA 3AHJA 2QJFA 1Q20A 3LT4A 1QFMA 2BHTA 2N3ZA 2AF3C 3D2AA 3MW8A 4KREA 4Y0AA 3A6ZA 1KZGB 2PS0A 1P5RA 3QIAA 1SIWA 3RYTC 4CEJB 3GLGA 2G06A 2MINB 4PAOA 2D5CA 1T8YA 3W6UA 2JLQA 3GLFA 3R2JA 4FR0A 2M6RA 3EEIA 3O7WA 4OXQA 1OZGA 4A7PA 3BRWA 3F9CA 4GI2A 3MUFA 5EKSA 3PYMA 4PLWA 1NVXQ 3L7NA 5CXUA 1KR2A 2WR8A 1PEYA 1KZYC 2Q8PA 3TUIC 1DJLA 1W36D 4QWWA 1OFIA 3HKBB 1TC1A 1I14A 2HCRA 3BE4A 3KT8A 3T06B 4ZT6A 2BMFA 3IPXA 2ZYRA 1DAOA 5JAQA 2WWVD 4L7QA 3SM9A 3AVUA 1AUPA 3KHUA 5KEIA 3VZPA 5AIBA 1VL8A 5U1PA 1ONNA 3BCRA 1GTZA 4MP8A 3EZ7A 1UZNA 2JGAA 1LLDA 3Q7PA 4MEAA 3GW8A 5HS6A 4CQMB 5JJ5A 5EIXA 1S3SA 1P1FA 2OHIA 3RO7A 1TTTA 2C9DA 3QU4A 4HNGA 4RYLA 5TRTA 4C7VA 3TFOA 5TQ0B 1C3LA 1H1LA 3R44A 1A4RA 2AN9A 1NC1A 3EMBA 4M60A 1Z0ZA 4Q6WA 4PCLA 4RHXA 1IUNA 1RYEA 2O1WA 5ALSA 4F4FA 1WQ3A 5KBYA 4AZTA 4LXHA 1DARA 4C4AA 2WHQA 4LZLA 3HJFA 3ZVRA 4F06A 3KQSA 3RAFC 1GTMA 1CE8A 1V7PC 1BDJA 3B1FA 3ITNA 1MTOA 2FMFA 2MYTA 3WJ2A 3C5WP 3GT7A 4W5WA 1MVLA 3H5IA 3SHTA 4JLMA 5HHTA 3TINA 2GK7A 1RZUA 1UWCA 1U8EA 4KVAA 2E4UA 1BX0A 2JJ2D 3OZEA 2H1WA 1XRQA 4WERA 4EJSB 1YIDA 2WSLA 3QVGA 1KI6A 4ICIA 1X80A 5G1PA 2AEJA 1J0BA 2FMUA 2QN8A 1QPBA 2RGGA 2ZJ4A 5IKXA 2B61A 1NI4A 1Z33A 2Y0DA 4O4IF 3Q3HA 2X7XA 2RGWA 4YIKA 4YAIA 2ZRDA 4CQLA 2O5EA 3OU2A 1P7WA 1QAQA 2R1TA 4Z9BA 2I67A 2J3HA 3CLSD 1E8NA 2G25A 2ZE5A 2OM2A 1ZK3A 5AVQA 3L1VA 5DBOA 4P0PB 3KAKA 3WIOA 2FMHA 4RK4A 3SQNA 5BXQC 1MJNA 1Y3AA 1DJPA 2CBGA 4ZYLA 3RSGA 1LU9A 2VKTA 2AJBA 4XB2A 5JHGB 2IHVA 1DQPA 3H84A 3U7IA 4DM7A 2JVIA 3E05A 3UV6A 5FUQA 4PLTA 4EEZA 4BLTA 2I1WA 5TPZA 2B8TA 4F11A 3WLHA 1XMIA 3WBFA 2WICA 3U61B 1WXDA 2YWJA 3HGMA 3N76A 1O7JA 2ZBGA 3OPXA 5AKHA 2WWRA 1XPUA 1FNSA 1V47A 1FJGB 3SN6A 5HDQA 1OLOA 1QIFA 3AVWA 4QUJA 3RADC 1NYQA 2OO5A 3GG9A 3K96A 1RRCA 1CIJA 1WDTA 2VTKA 1IG3A 3NHPA 1QH8A 4RY8A 4NHOA 1Z2EA 2NV0A 1YK0A 1C50A 3MZ0A 5JRZA 1UUFA 2IY8A 4M7WA 3NETA 2M6LA 2IELA 5CT9A 3EEFA 4HX2A 5AW7A 3TL3A 5B6JA 3H5TA 4AFNA 4ZC1A 4I4NA 4DQLA 5IRCD 2VXCA 3GLHB 4BXOB 2FPIA 1J0CA 1GXSB 1X86B 3F3SA 5JYCA 1JEJA 4J4HA 1RBYA 2P0AA 1E6CA 2XWPA 4PBSA 4ZKEA 1BWSA 2XVMA 1XKQA 3GLFE 3DT8A 3UHPA 1X3LA 3FR7A 1C8VB 3DFMA 3ZD9A 4LSGA 4ME6A 4WPGA 5ER9A 2O0KA 3X2FA 4OJQA 1GZUA 3EF3A 2FUCA 3IGFA 4OYHA 4GYYA 4KWEA 4MMYB 5F1YA 3EWAA 2ZRCA 4C4OA 2O0HA 2Z95A 4ZVLA 1JJAA 1IBSA 2BR3A 1H9BA 1AHNA 2WB4A 5G40A 4WZBA 4PLVA 4UU8A 3ZH9B 3VC2A 1UFQA 3L05A 2JFFA 1V4NA 3M4XA 2FP4B 2LUOA 3DVAA 3MRXA 5D87A 3HA3A 1UWLA 3A6KA 1A3CA 1WE2A 4WK4B 1KSJA 2OGUA 2ONYA 4I8IA 4R9UC 4EUSA 5FL7D 3MWEA 1T2FA 2XCQA 2JF0A 5A4JA 4JEHA 4QNRA 3ZXUB 4Z4EA 2XJ9A 4LIPD 3O2JA 5ENDA 3S1AB 5CDUA 4IIYA 2DQYA 4KAAA 3K1JA 4C20A 2BBSA 3R5JA 2E1PA 4C06A 3PQEA 3Q12A 1NASA 1DIAA 4D4IA 3AFOA 1KTVA 4TT3D 1SURA 2VNJA 4WMLA 4C6RA 5J2TA 3RS9A 2X3YA 2YCLA 4H7IA 4DAOA 1ZVVA 1D04A 1L8XA 2XD9A 1Q16A 1KNQA 1NLYA 2FJ0A 4FFMA 1NVGA 4NKRA 4URZR 5T3YA 4BWVA 4Z54A 5EZSA 1DTWB 4H31A 5KTRA 3NOXA 4YRMA 4QM7A 5GJBA 1Q0HA 2WZCA 3WRYA 1QTQA 4L72A 4C2TA 4ESVA 1NRJB 2GEVA 3V7NA 4V0MA 3K9GA 1V1RA 3D7NA 1U3FA 1AN9A 4PPYA 4I2NA 3KC2A 4ZVQA 3FJ1A 3AUUA 5KSZA 5D85A 3ORYA 1Z36A 2RC5A 1GGMA 3QQPA 2VHTA 3HBMA 4KXMA 4HKTA 1FUKA 4CMBA 4HVLA 5G0UA 1GNLA 4QXOA 3EQZA 4M1OA 1N8NA 4NDNE 1WXWA 3SEQA 2AQ8A 5PGMA 3EFBA 4PFJA 4I5IA 4QXMA 1A5SB 4UDNA 3H8VA 3BRSA 1RBZA 3G0IA 3IPCA 4ZVPA 1D6MA 2Q0HA 4YC7A 3GUVA 5IDYA 3RHFA 1M6HA 1QHHB 1FNBA 2VKQA 3AJ9A 2EJBA 4LF8B 5C8ZA 2GB4A 2PKQP 1BVYF 4LNUA 5JJIA 1KFEB 5CIQA 3UB4A 1D0VA 2NZXA 4H7HA 4HAYA 1A7KA 4HAUA 5AKYA 5K09A 4FM9A 2PGIA 2VZEA 1E0DA 1IIBA 2G5GX 2GZDA 2V55B 3H2GA 3QXHA 4MHOA 5TF0A 4TWZA 1OE0A 5JTUA 3TOVA 3V46A 4J0FA 2C8KA 3REQA 3RYIB 2GN6A 3H4TA 3KU4A 5L7WA 3TEJA 1X8XA 4CV1A 1PGQA 2ADFA 1GCGA 4FFBA 2CN1A 5BV2P 3ECAA 5CFRA 1N2EA 2H48A 3N75A 4N0QA 4Y6SA 4UAGA 4A6PA 1EGMB 4OLJA 3U4QB 1HXHA 2HSDA 4QE3A 2FSVC 4NU0A 2R00C 3DKPA 1CB0A 3V8BA 1XL0A 4B7CA 3TQCA 2YJNA 3KFVA 2BCEA 3L82B 5IAEA 1ZMRA 4IWXA 4PQYA 3WMGA 3ZWNA 2A0FA 1ND6A 4MQ6A 5K6RA 4ESEA 3DHEA 1KYXA 3O5AA 2AG0A 3ZXYA 2G5CA 2SKDA 3PZBA 3AIKA 4CKCB 4ZALA 1AQIA 1PT5A 3COZA 2V3CC 1SELA 1MB4A 3GJ3A 4PHCA 3JXEA 5CTJA 4A6DA 2NADA 3IILA 1RIIA 3PDUA 2C5AA 5T4FA 3OTOB 1NR1A 4ZGBA 4O3FA 3CRW1 2GJ4A 3GRYA 5B5SA 4XUGB 2B3TA 2BMDA 4GPZA 2DKNA 3G3EA 2IHKA 4JT8A 4BNTA 2XEXA 3H18A 2B9EA 1R0ZA 1QIGA 2VYND 3PRYA 5J4HA 3MAGA 2NIPA 4JOQA 3GLTA 4B40A 2FW6A 2QMQA 4MRRA 2H1OA 1V25A 1TJ4A 4YJ2F 4MV3A 4MQEB 1FFHA 2XT0A 1N2CB 4JWKA 1VHJA 4Y18A 4ER0A 3HBAA 4G5OA 4FFOA 1N25A 2X9VA 3ZQ4A 1VRCA 4A1FA 1P2GA 1VIDA 3T1NA 4A0SA 2NYUA 4AS3A 1F17A 2R5FA 1C4XA 2X0KA 1VQ1A 4IMPA 1R8JA 1NF3A 2J9FB 4DWOA 3T9AA 4I8XA 2R1VA 1N33B 1TK3A 1DG9A 1Z9BA 2DULA 1YZQA 2F8LA 1YVDA 1G21E 2ZVQX 4IV0A 2OC4A 4NJEB 5FOQA 5M29A 4DCUA 1ZRNA 2B37A 1P5HA 2WDPA 3IRVA 3LUKA 3R0QA 3UOWA 4CT4B 3TXYA 3QYFA 3L4KA 5IBPA 1BDIA 2BH9A 3OLYA 3WGGA 5AVSA 1KY4A 3PC3A 2CUZA 2WVJA 4JLPA 1FUIA 1YB2A 4OXRA 1BJRE 4FDAA 4OUKX 4ZO9A 5JR3A 4CMCA 1T4BA 3UMYA 3L5OA 2QYHA 1I0ZA 2NQ2C 2VUUA 1E7YA 2DTEA 1MVOA 1ZI8A 2IH5A 5CXSA 4RSGA 1A9ZA 3LXUX 2PZFA 1E9DA 3N6VA 4FTWA 2WUVA 4G5RA 4MAMA 5KS2A 4NOJA 4UTRA 2HA7A 2RBEA 3O90A 4ZGGA 4RIIA 3JWPA 1UP7A 1PK7A 1DCKA 4TZTA 5LMZA 3A2KA 2GA8A 2WNIA 4ZREA 4UHHA 4CIYA 5LYJA 4ZFNA 2GBFA 4I1IA 3R9KA 4TMZA 1CR0A 3KZOA 4C2BA 1YCDA 5IWCA 4NHEA 4LMPA 5CFOA 1NBIA 1V16B 3FYUB 4GI1A 1W0JA 2WHXA 3HZRA 5ULLA 5LQRA 3T1OA 2YWEA 2IIBA 2PUTA 3G0DA 4Y9TA 4HEQA 1AUVA 5COAA 3TTVA 2CJXA 4XWOA 2AKEA 4AWAA 3DZBA 2MR6A 1LDGA 4XWTA 5CNJA 5H3HA 2WWTA 5K3AA 4YDHB 4R9VA 2XW6A 5TGZA 2C07A 3F6EX 3E2MA 1Y82A 3L7MA 4P33A 4Y1GA 1WXFA 1VPVA 2A9PA 1AK2A 1KA9H 1KC1A 4M4SA 3W9BA 4HADA 4LY3A 1PTJA 1NX6A 4FHZA 3T3EA 2YHIB 4WH0A 1KI4A 3CNOA 4YAOA 4U6NA 3LIPA 3B5JA 4M7OA 3S27A 3PS9A 1WD5A 1HA3A 2VPIA 3IAM1 3CY6A 1C41A 2YC2C 3WJ1A 3ZCTA 3KU1A 4CNQA 4DB2A 2QX6A 3L8EA 2I6GA 3EQ6A 2JBAB 6CHYA 4CM8B 2A6PA 5JG7A 3TOXA 5EP3A 4NCBA 4JJIA 3SZ3A 4QBGB 1D8TA 3WGOA 5IPFA 2EEPA 1PVVA 1YZGA 1GFSA 4RCVA 5A7HA 2ZIZA 3O75A 5C1PA 1XYYA 3KKZA 4MRVA 1JFRA 2H17A 2TRSB 3RC3A 4S04A 1ZFNA 2I29A 1SUFA 5C7LO 2A14A 4PZLA 4F3RA 2GVNA 3ET5A 4ZI7A 1L5GB 1WNFA 4G4SO 2PH1A 1P62B 3H5VA 1ZJZA 1SKUA 2HLDD 3I05A 5ITZA 3MNFA 3DA8A 3FWNA 4RW0A 3FZGA 4XJSA 4TYYA 4OQEA 1ZH0A 1TW2A 2NX2A 3VU0A 3RC9A 1HDCA 3KYIB 4KQHA 2JJMA 1RWBA 4LOJA 3O4HA 3VU8A 1CPYA 1ORTA 4B84A 2JLXA 2Q2OA 3LDHA 3RW9A 1E2IA 1DOZA 2Z98A 1CD5A 4DQXA 3CVWA 2B8EA 3MTEA 3U1VA 1AOXA 2B5OA 3C24A 1XNGA 2WD9A 4WY8A 1N6KA 1YRWA 2A0KA 2VP6A 2HV8A 1FDUA 3EOZA 4G5YA 4JS0A 4Q1EA 4Y9RA 1N5LA 4BUCA 3OLZA 2BMJA 2NSYA 4AKEA 2EL9A 1PUIA 3TLJA