3H17A

Crystal structure of este5-pmsf (i)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
292
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase/lipase
publication title The crystal structure of an HSL-homolog EstE5 complex with PMSF reveals a unique configuration that inhibits the nucleophile Ser144 in catalytic triads.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 107
structure length 292
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h17A00
4G9GA 4MJ3A 5DWDA 3B3QA 2WJ3A 4RGYA 2XQGA 3KDAA 1YB6A 3R0VA 2WIDA 4DSAA 3H19A 2AJ8A 3IIIA 4EZIA 3FVRA 5AKHA 1S8OA 4B0OA 3EIOA 2CKMA 2HDWA 3HRHA 1ETHA 4J03A 5AKLA 5ALKA 1EVEA 1XZLA 3L1JA 5H3HA 5AM3A 1ZGCA 5EIAA 1CUSA 2PU7A 3OG9A 1F0PA 2FJ0A 2HADA 2Y6UA 4X6XA 2IX9A 2J3QA 3JWEA 1Q0RA 3DYVA 5AI0A 2HA5A 3WLAA 1CUAA 4OD0A 1LZKA 1BCRA 1XQXA 3BF8A 2CZQA 1K5PA 5JIBA 1E8DA 3WKAA 4UBJA 5ALSA 4X6UA 5ALYA 2WFZA 3HI4A 2Y6VA 1DWPA 1XRMA 1X2BA 2XLCA 1A8UA 3DDUA 3VJMA 2HA4A 4LHEA 2WM2A 5I7UA 2JGKA 3A70A 4DYHA 4J0KA 1H23A 1RP1A 4GXNA 1ZIYA 2P8SA 2BFNA 2OGTA 1B6GA 1XLUA 4H7DA 5I9IA 4IH4A 3UUEA 3FYTA 3U0VA 5IVKA 5LLSA 3ZLVA 2RONA 4BE9A 4DTCA 3O9MA 4ZI5A 5FOQA 3SC2A 1AGYA 4NMWA 5JAUA 1WB4A 2H1IA 5ALWA 4Q3KA 1VA5A 4Y2XA 3VVMA 3WA7A 1F8UA 2VQ6A 1IUNA 3O95A 2JGMA 4G4GA 4DM7A 1ZGBA 3BIWA 3EF3A 1DQZA 2HA6A 2C58A 3SWWA 2BJHA 1ODSA 1AQLA 2JBWA 3FYUA 4H7EA 3W04A 4LKOA 5K3EA 5DNWA 2QUAA 2XUPA 2JEZA 3C8HA 3WJ2A 4CCYB 3D2CA 4QDTA 3PE6A 2GBCA 1FJ2A 3WIOA 1Y7HA 1UKAA 2WIKA 3V1KA 4B84A 3QPCA 4J7AA 3FVTA 2QXUA 2JEYA 3R40A 3R3ZA 3HXKA 4C89A 5AK5A 3AFIA 2CEKA 4I19A 3C6YA 5ALMA 4KE7A 2DCMA 2O2HA 3LCRA 5JANA 4D9JA 1WOMA 1XQYA 3WWEA 3JW8A 1JKMA 4Y7DA 3I2GA 2H7YA 1XQWA 3AILA 1BRTA 2XQIA 1CUIA 2QJRA 1VXRA 4H7IA 2Q0XA 1U2EA 2J4CA 3A2NA 4UBIA 3R3UA 5AICA 4C87A 1DINA 4FFVA 1EINA 3X3HA 2WUGA 1FFEA 4BZWA 4B6GA 1U65A 3WK6A 5FDFA 1LBTA 1HL7A 4ZRDA 4DIUA 2QUBA 1C7JA 5HQ3B 2E3JA 2XMZA 5E4JA 4BB0A 1XZKA 4ARBA 5EHXA 3VJKA 1QO9A 3H2JA 2QXTA 4FNMA 2VAVA 4IH9A 2IITA 1U4NA 2WIJA 1RYYA 5LKRA 4Y2QA 2WHPA 3WK5A 3LLCA 2WG2A 1XZJA 2HU5A 2PSHA 4BP8A 1CQZA 3E4DA 4QWWA 1CVLA 4YK7A 3A2MA 4ZGBA 2BKLA 4H7KA 2AJCA 1XRNA 2UZ0A 2XUGA 3S8YA 1CUXA 1GQSA 3DOHA 3UUFA 2OCKA 3IVMA 4HTAA 4QDUA 3FSGD 3G0IA 4G5XA 5HFNA 4CCWA 1ORVA 1EVQA 4CG1A 3KSRA 2PVSA 2W6CX 1YAJA 4JYPA 3C43A 3I2JA 3IURA 5K3CA 5YASA 2O2IA 1XRPA 3GUUA 1OXMA 5CH5A 1K6EA 2XUFA 3T4UA 4DMKA 3VXKA 4DMHA 1JI3A 3M82A 5DJ5A 4WJLA 2HA2A 3AUKA 4BDSA 4Y2RA 1XROA 5BOVA 3L1HA 4DSZA 5ISMA 1LPAB 3ICWA 4HZGA 3F9CA 1YAHA 4G9EA 4HVTA 3EBLA 3T52A 2B4KA 3R3VA 4AN1A 1H2ZA 4Q34A 3I6YA 4G4JA 5DNVA 5K5EA 2D0DA 1QONA 1EH5A 2X8BA 2XDWA 1QTRA 3HEAA 5JADA 3F98A 4GW3A 1DTEA 4H77A 4OYYA 4FHZA 3VKFA 3B12A 1MT3A 1CPYA 3ESAA 1O6FA 5AKEA 3STYA 2I78A 1QGED 4BYMA 2HRRA 3WZMA 3WK9A 3KXPA 2JGJA 4NS4A 1MO2A 1VZ3A 4QWMA 3F8SA 4GLBA 1UOQA 1FFAA 4JH0A 1Y7IA 5D3KA 4BATA 2QTBA 2PL5A 3V9AA 3H0CA 4RNCA 4QLAA 5K3FB 2ES4A 1VLQA 5K3BA 4UHHA 2ECFA 2WKWA 2WU4A 3S2ZA 4MWTA 3IA2A 3BF7A 5CMLA 4J0DA 2OG1A 5IVHA 5AKKA 1D07A 4Q82A 3WK4A 3DL7A 4FOLA 1QJ4A 4BRSA 4W63A 1IUOA 4OSEA 3O4HA 4H0CA 1G5FA 4MYSA 5CW2A 1A88A 4OCZA 4MQMA 1YS1X 3LIPA 1G42A 2H7XA 2WHQA 5LP1A 3WA6A 4EHBA 5HK8A 5IKXA 2XMRA 1YA8A 2WU3A 4PV7A 3IULA 4U2CA 5ALRA 5AOBA 1GPLA 3QVMA 4X93A 4M0MA 1T2NA 4AO7A 5JD5A 2EDAA 4PNZA 3R3XA 4C88A 3QITA 3LS2A 5EHNA 4HAIA 1GPNA 2XMDA 3WYDA 2H7CA 1GXSA 3IUNA 5EIHA 4I3FA 5AI8A 4GI1A 4S0XA 5AM0A 1E89A 2WJ4A 4DGQA 3W06A 1ZJ5A 2VA9A 1DX4A 5KWJA 4IQ4A 4X3CA 3WJ1A 2FX5A 4WCVA 1EDBA 5ALJA 1T4MA 5FPQA 3PDCA 3O4IA 1DWOA 1SFRA 3OOSA 4UBOA 4KE8A 4N8DA 3H18A 1UK7A 4FLFA 2C0PA 1FFCA 5HF6A 1UWCA 3TJMA 1J07A 5ALXA 4FFWA 2Y2UA 1EHYA 2WILA 4EY8A 1XZAA 2RHTA 2WUFA 4U2GA 2LIPA 2QM0A 1BE0A 1ACLA 3TGLA 1EA5A 3DNMA 4LYDA 4C4ZA 1XZBA 7YASA 4MYDA 3M3DA 4CIBA 3WKCA 1XRLA 1MAHA 2JGLA 5LZ9A 5FRDA 3OPMA 1LPPA 2Z8ZA 1QOZA 3FLEA 2I3ZA 4JEIA 5ALOA 2PSDA 1JU4A 5EFZA 5AM2A 4PSCA 1TRHA 4H35A 5AK4A 4XWGA 5AK3A 4V2IA 1Z68A 4HXGA 5A7HA 5DYWA 3ZWQA 3WWDA 4IHAA 4AO8A 1H2XA 3CN9A 1CFJA 1OILA 3FSGA 3ESCA 3AZPA 3QYJA 5AM5A 1QIDA 1DT5A 5LZ8A 4QNNA 3YASA 5AI9A 2V98A 1ZI9A 2QKYA 4X94A 2BGNA 4OU4A 4BAGA 3D3NA 1BN6A 3A6ZA 4UBKA 4GECA 1VE7A 1UK6A 1PV1A 3C45A 1AMNA 5AIAA 5T4EA 4NVRA 3F67A 4MEAA 4DLNA 3EQ8A 3WIBA 2FUKA 2WFLB 3ILSA 5HF5A 5ALVA 3H2GA 5EGNA 3ICVA 3BL8A 3MUNA 2Y2VA 3V1NA 1SCIA 2HFJA 2XUKA 2HA3A 4H18A 4JYMA 5ALQA 5D3ZA 4FWBA 4EB0A 3IUQA 3WWCA 5ALUA 1THTA 5ALLA 3WKDA 3AINA 2PPLA 1P0IA 2BUCA 3FNBA 2WHRA 1EXWA 2Z3ZA 3IBTA 4K5QA 5ALHA 4BCCA 1LPSA 4Y2JA 1CUYA 3HJUA 1A8QA 4KRYA 4H7JA 1UOOA 2HIHA 3R3YA 3E3AA 3V48A 4XVCA 3WL6A 1WB6A 2YYSA 1UFOA 1Y37A 1WCYA 1VA4A 4LXHA 1MNQA 3DYIA 3ZLUA 5DYYA 3O0DA 3NGMA 4N5HX 2V9ZA 3KOOA 4Y9SA 2EEPA 2XMBA 1AURA 4RE6A 2WIGA 3QH4A 4ZWNA 1VJ5A 1XQVA 2WIFA 1OCEA 4CCYA 2CBGA 4IH1A 2ACKA 4FDMA 2PM8A 4J0JA 2XMCA 2XE4A 2QS9A 3I2HA 5JATA 4UFOA 1DWQA 4M0FA 2ZJFA 3C6BA 1GKKA 4ZREA 4GWLA 3I2KA 2ZYSA 5JASA 3STWA 1XRRA 1YSCA 1HPLA 5LZ2A 1GGVA 3JYHA 2O7RA 5CT5A 3DJYA 4GHWA 1Q84A 2VT6A 3C87A 5SYMA 4EA6A 1VZ2A 4UBLA 1CUDA 2OQVA 3M83A 1YA4A 1IZ7A 2GYVA 2ROQA 4RPCA 1XLVA 1BEZA 4AN0A 1QIEA 2R8BA 5HQ3A 3ZLTA 2HFKA 2HA0A 2WSLA 5LZ7A 2RHWA 2GYWA 4TGLA 1L7RA 1L7QA 2PX6A 1CUJA 1H22A 2HL6A 5AM4A 5DTJA 2HM7A 1QTIA 1ZI8A 4G8DA 3PFBA 3G0CA 3ED1A 3I1YA 3EQ7A 3R3WA 2VATA 5K3DA 2Y1KA 1XLWA 3OM8A 4E11A 5C81A 4B9EA 3WZLA 2XUJA 3WL7A 2Z8XA 4X92A 1ZOIA 1XZIA 4WFJA 1N1MA 3PUIA 5JZ9A 5BV7A 2JIDA 4EY6A 1NU8A 3W05A 1ISPA 5AK6A 3WMRA 5AO9A 4B81A 5CT9A 2GZRA 1UOPA 2DR0A 3HYSA 1MTZA 1BN7A 5DNUA 2OPHA 4C4YA 4B0PA 3DOIA 3W9UA 3F96A 5LIPA 1LPBB 3D0KA 4J0GA 5ALFA 5A62A 1HDEA 4H7HA 1DU4A 3QMMA 1ZJ4A 3EQ9A 3WKEA 4WFIA 2JF0A 2XT0A 1E8NA 3ZV7A 3W2TA 3G8YA 5ALIA 3PF9A 5DTIA 1R9NA 4MXDA 4G8CA 5J3JA 5DYTA 4B7ZA 3DD5A 1KEZA 4Y2YA 2BCEA 4TVKA 1A8SA 2NW6A 4AB1A 4AMYA 4AZ3A 1UZAA 3MGAA 4L72A 1GPKA 3SX4A 5ALNA 1IVYA 5CT4A 3D5EA 3GBSA 2PUHA 1EK1A 3HC7A 1CLEA 1LLFA 3KD2A 3RKSA 3WK7A 5CXUA 4L3WA 3OURA 4FBMA 2JGEA 5ALDA 2I3DA 5JAPA 3DKKA 3VISA 5FP0A 1QE3A 1ZI6A 3D7RA 4IO0A 1TCCA 4QLOA 2G4LA 4G4IA 3D4LA 4UUQA 4HXEB 2XQFA 3UMJA 1XZMA 2JGFA 2XUIA 5FUMA 5JALA 5C8VA 5K3FA 4BAZA 3DCNA 1K63A 4HRXA 3STTA 2J3DA 1X2EA 2QR5A 4W1QA 4FKBA 1RWQA 2RI6A 4YX9A 3FBWA 3STVA 4EBBA 4F0JA 1WM1A 1Q0ZA 1XKLA 2OCLA 2ONCA 4PSUA 1TCAA 1ODCA 1BEEA 3C8DA 1UKBA 4J3JA 1NU6A 3FWHA 5KREA 3R41A 5HF8A 4B85A 3A2LA 3Q0TA 2XLBA 1BS9A 5K3AA 2CMFA 4PW0A 4F5ZA 3STUA 4BTLA 2R11A 4KAJA 3WYNA 1EK2A 3NWOA 4MQLA 1R1DA 5HKBA 5CT8A 3AIKA 1TKRA 2XMQA 3G9TA 2FJPA 1G4HA 3STXA 2G5PA 1YS2X 5CXXA 4OYLA 5ALGA 1SOMA 4DMFA 4X7BA 3AIOA 4FMPA 4ROTA 5IH7A 3HACA 2VJBA 4FLMA 4YPVA 1MN6A 3DS8A 2HA7A 1CUVA 3CCBA 1Q83A 4N8SA 4U2BA 3RM3A 1QLWA 5LKAA 1J1IA 3ZPXA 1UT6A 4PO3X 3BWXA 4LXGA 5AIBA 3N0TA 4KR0A 1JMKC 1UK8A 3H2HA 5AKIA 4P93A 2DSNA 1XZEA 2HRQA 3W9BA 1QIIA 5AOAA 4H7FA 4TPKA 2ACEA 1GT6A 1BCSA 4DNOA 2O7VA 4X97A 2WUDA 3GZJA 3HLKA 3QMVA 2OGSA 2GBIA 3VJLA 4ITVA 2VF2A 4CIAA 1CUBA 4ZV7A 3G7NA 1W4LA 4INZA 3E0XA 2XQKA 5F4ZA 2VJCA 4W1RA 5JZSA 4BAUA 1LBSA 1IMJA 4AZ0A 1J2EA 5FPPA 2ZYHA 3FLBA 4QE3A 5KBYA 3NUZA 3CN7A 4B83A 3CXUA 3H1BA 4EUSA 1JJIA 2HHAA 3QPAA 4MWSA 5LYYA 3D2BA 2HU7A 2VSQA 4A23A 1KU0A 1HQDA 4F60A 1X70A 1R3DA 4N5IX 2VJDA 5HKAA 1L7AA 2XUQA 1J06A 5E4YA 1YB7A 1SCKA 1SC9A 1R9MA 1W76A 5IVIA 4UFPA 1LPMA 5AM1A 1CUUA 4A5SA 3PICA 4ARAA 1LNSA 4X71A 1MX9A 2GZSA 3PFCA 2BGRA 3SK0A 2WFLA 3G0DA 2DHCA 1WHSA 1W1IA 1CUWA 4BP9A 2XMGA 1LZLA 1ZICA 2O2GA 1R88A 1VXOA 3K9BA 3IB3A 4G8BA 1CUHA 3PF8A 1AZWA 1DQYA 1LGYA 5CH8A 3AZOA 1USWA 1XZCA 4GEGA 2XMSA 2XB6A 5KWIA 5EIEA 2OXEA 4N8EA 2RGUA 3QBJA 2AJBA 1MJ5A 1IUPA 1N8SA 2AXEA 4FNGA 1F0NA 4F21A 3LP5A 2WTNA 1CUCA 1E66A 1ODTC 4UBMA 4E46A 4QDXA 5CH3A 2QJWA 1ZD2P 2HU8A 2CUTA 4OB7A 1F6WA 1VKHA 5AI6A 1EB8A 5E4TA 1FFBA 1LPOA 2OCIA 4E14A 2OQIA 3GA7A 5A6VA 2VT7A 1TCBA 1GKLA 3H17A 3IDAA 3G02A 2DFPA 5EHZA 4BVKA 4XX1A 2PKYX 2QRUA 2EDCA 3MVEA 4W9RA 2VEOA 1THGA 3PI6A 2K2QB 4BC0A 3ZI7A 4Q3LA 5AI5A 5A7FA 2VAXA 2DHDA 3LIIA 3PUHA 3OC0A 5ALZA 3L1IA 2XUHA 4AMZA 3TEJA 4L9AA 4Y2SA 3HABA 1HKHA 4OB8A 3I1IA 1QZ3A 3WK8A 5LZ4A 2BUBA 1W6RA 2DQZA 4WY5A 3KWJA 1P0MA 1MPXA 2VTVA 1E3QA 2V96A 1UXOA 3H2IA 3I2IA 4YASA 1HLGA 4WFKA 1LPNA 4LXIA 3QMWA 1ZIXA 5T4FA 2OAGA 3FCXA 4DNQA 4C6HA 3FYUC 4UHBA 3G0BA 4X6YA 4KACA 1CEXA 5AKZA 4U2DA 1E5TA 2J4FA 4UHCA 4UHFA 3E1GA 3I28A 2WTMA 4BBZA 3G0GA 3ANSA 5CURA 2ZYIA 5T4HA 3IUMA 3VVLA 4EY7A 2WG1A 2ZSHA 3I2FA 4ZV9A 3AIMA 5HZGA 1W75A 2PSJA 3H04A 1BROA 4PQEA 5EHQA 2OAEA 2XUAA 3O9VA 4QEKA 2X5XA 4AX4A 4P9NA 3I6MA 5BWBA 1EDDA 4KAFA 4Y2PA 4QDZA 4UFNA 3QPDA 1CUZA 1QIFA 1ZD3A 4BE4A 1BU8A 3GROA 4AO6A 2PUJA 2RIPA 2ZJ6A 3FLAA 3FYUB 1W52X 4K2AA 4KE6A 1I6WA 4OUKX 4AXBA 3BJRA 3K2IA 4X00A 3FCYA 4L0CA 4LYEA 4EY4A 4BZZA 4CFSA 4WDQA 4J0HA 4B80A 5CBKA 2JGIA 1JFRA 5JAOA 4BCBA 5JARA 4EY5A 1P0QA 1XFDA 1FSSA 3NOXA 3AJAA 1TIBA 4G1FA 4DNFA 1QIJA 1C4XA 3WL8A 3H2KA 4CG3A 4DMCA 2XQJA 2BAGA 3ANTA 1E8MA 3VDXA 4K6KA 4BVJA 1PJAA 1QFMA 2PBLA 5HK9A 3BE8A 4GBGA 1FFDA 4UHEA 5HF9A 2GYUA 1K4YA 1GQRA 4A16A 2XI4A 1N5MA 5ALTA 2XUDA 4BTVA 4X85A 5AI4A 1CUFA 1JJFA 2QOEA 3IUJA 4FTWA 2G5TA 2RAUA 4KAAA 3RARA 2YH2A 1JJBA 5FLKA 2CB9A 5CT6A 1JU3A 4JUIA 2DQYA 4B9AA 2OCGA 2WJ6A 1EB9A 1MNAA 1TAHA 2WG0A 3QZUA 1AX9A 2WHPB 2Z5GA 1AKNA 3V1MA 3DL4A 4X91A 5E2IA 2AJDA 2I03A 4KJXA 2XUOA 1DT3A 1K8QA 1UK9A 3G9XA 5ALPA 1CIJA 2H9YA 2QZPA 4XIIA 4UHDA 4HRYA 3DKRA 5AOCA 2ZSIA 3BDVA 3BJMA 2PSFA 5FXMA 1MU0A 2B20A 5AKGA 4QZVA 3WI7A 3BIXA 3ESDA 5A71A 1ZD5A 1A7UA 2C7BA 2ZVDA 1WPXA 4Q3OA 1WB5A 3BXPA 5EI5A 5A7GA 4B82A 1DX6A 2WFMA 4O08A 2ZJ7A 1YR2A 5C8ZA 4BVLA 4HXFB 3WWPA 4DNPA 1R4ZA 4XJVA 4KYVA 5JD4A 1UKCA 3HSSA 5HFAA 1QIKA 4W1SA 4HS9A 3ESBA 1GZ7A 1SCQA 2D5LA 3BDIA 2W22A 4C4XA 1AUOA 3DQZA 3D2AA 2QT9A 2WUEA 5T4BA 1B41A 5IVDA 2PSEA 3TRDA 5I8PA 4AQDA 3N2ZB 1TQHA 3O4JA 5ESRA 2WLSA 2ZYRA 1YASA 4X90A 3D59A 4BC1A 1MAAA 3DEAA 1ACJA 4MEBA 1P0PA 1XZFA 5SYNA 3OTQA 4KRXA 2IIVA 3Q8WA 4PSDA 1H2YA 3MUOA 1M33A 4Q05A 1XZDA 2PU5A 1PFQA 1R50A 1CR6A 1ORWA 1EDEA 2QVBA 3G9ZA 1QIHA 2X76A 3FOBA 4M0EA 4QA9A 3F97A 3P2MA 1XKTA 4K6GA 3K6KA 3C5VA 5AKXA 4OB6A 4J0IA 1IZ8A 3GFFA 5D6OA 5JAHA 5AKYA 2GBFA 3V1LA 3U1TA 4CG2A 2YASA 1G66A 4Y2VA 4P08A 2B61A 4OPMA 3RLIA 4ZXFA 2V97A 4W1PA 2YXPX 2VJAA 3AZQA 1QIGA 4BCDA 5JD6A 3RK4A 1CUGA 4BDTA 4ETWA 1EI9A 3WL5A 3B5EA 3WQHA 5JZBA 4Y2UA 4BRZA 4C01A 1CUEA 3QM1A 1QFSA 2GBGA 4FBLA 3WKBA 1XRQA 4RE5A 1QIMA 4KEAA 5C8XA 1TK3A 1MX1A 1JT2A 4X95A 4KE9A 4QDOA 4U2EA 1CV2A 2C5FA 4WY8A 5CTAA 3I6ZA 1O6GA 5AJHA 3WWOA 4FLEA 5AHXA 3O4GA 5ALEA 4P92A 4E15A 3C70A 5A2GA 1WPRA 3C6XA 1QO7A 2B9VA 1MX5A 3KWFA 1YCDA 4I4CA 4GDMA 5FKJA 4Y2TA 1XZGA 2ORYA 3GELA 5AKJA 3C5WP 4U2FA 4LIPD 5AP9A 1HBJA 1CRLA 4JNCA 4PF1A 4UPDA 5FV4A 4K6HA 5C7YA 1CQWA 2C5GA 4NZZA 1H2WA 2C4HA 3FAKA 4UBNA 5JYCA 2OLEA 3C6ZA 3H1AA 4Z49A 1ZD4A 2DHEA 5AH0A 5CRIA 1XZHA 3M81A 5HCUA 5LZ5A 4J0CA 2BUAA 1VE6A 1NX9A 1N5RA 4WDRA 5D7BA 2OGZA 4Q1VA 3HZOA 6YASA 2C0QA 2Z3WA 1KU6A 1C7IA 1WHTA 2CJPA 5BWCA 3DLTA 1AC5A 1EX9A 1U8EA 1JMYA 4OU5A 3G9UA 2WQZA 4CI9A 3CCCA 1VOTA 5DLPA 2G63A 2AJLI 2QMQA
chains in the Genus database with same CATH superfamily
4G9GA 3LCUA 4AJIA 4EGAA 4R2JA 2F8LA 1ECCA 2PL9A 4MJ3A 4GPBA 4PFSA 4ECAA 2QD5A 3H4TA 4R51A 2CNKA 1NN1A 2PKWA 5AW3A 4N5LA 1S9DA 1J33A 1CZOA 3ORYA 3QXGA 4RGYA 1VL6A 3KDAA 3HB0A 4R2MA 4D26A 3HCPA 3PPYA 3DONA 4MMXB 4RKRA 1YB6A 3R0VA 1ZNZA 1P45A 1WZEA 2NXEA 2C1ZA 2P4UA 3CRVA 3PD7A 1M2EA 3G8BA 3VI4B 3KJQA 1CRPA 4XWKA 4JOSA 1TU3A 2WDPA 2X7XA 3KVNA 3FDZA 1L5FA 2Y05A 4IXMA 5CFNA 5K8UA 5L4LA 3AUYA 3TVYA 1TECE 2O6LA 5AKHA 1S8OA 3PPXA 2H4JA 1B8UA 1NONA 2H5JA 4OSPA 2OR3A 2IH5A 2BEVB 4WZBE 3M9LA 4NK4A 2AFHE 3LBIA 221PA 4YO7A 521PA 2HDWA 4LBZA 4AWAA 2PTGA 1LLDA 3RRJA 2ZE8A 1IEWA 3QF4B 4KQFA 2ZT5A 4OQMA 1T6BY 2DBVO 4J03A 4PO1A 4ZOAA 2JJQA 4LNUB 3ZHCA 3GQVA 1EVEA 1D1QA 2YJ3A 2FR1A 3A1TA 3G2HA 3PQ8A 2OZLB 1J22A 1XZLA 3P8ZA 1DEKA 1JLLA 5H3HA 1JAXA 4EJSC 3K35A 1ZGCA 4HYEA 4JJ7A 3EZNA 5EJFA 4RHEA 4OI2A 3OG9A 1F0PA 1IY9A 2VAPA 2FJ0A 1M34A 4FOPA 1GL3A 3V4OA 3QBVA 4KBYA 1Y1SA 2Y6UA 4X6XA 3B1VA 1OOEA 3JWEA 5LQKA 1OHHA 2AXQA 4MWZA 1LS1A 5ANRB 1Y1TA 3V97A 1Q0RA 1Q3TA 2ZIWB 5DK4A 4IR7A 3DYVA 5JYEA 1CVRA 3L41A 3QW4B 3B1KA 2F3TA 3BB3A 3DWFA 1MJFA 2AYZA 3PQ4A 4TTIA 5H59A 3RC7A 4N0PA 3H9CA 5J40A 1OBCA 3UWOA 4FD2A 4OD0A 1WAMA 4N48A 5FUQA 1L4GA 2R1VA 5COAA 1XQXA 4G89A 3WISA 5ELXA 4IZOA 1MABA 2P9JA 4OM8A 1LLUA 3OE7A 4BNIA 4ER6A 5SY9A 3NXKA 3DT9A 3KQQA 1PN3A 5BYKA 4LY0A 3TOVA 1DQNA 3QY0A 3CB4A 4UBJA 4US1R 5ALSA 4WESA 3HUEA 4X6UA 5ALYA 3KSAC 5K3OA 1O03A 4DEYA 5CA0A 4LZAA 1UC9A 2OZEA 4N40A 3K8YA 2QG6A 3CU5A 4ONEA 2FEXA 5EKDA 4F2PA 1DWPA 4JI0B 2ZI4A 2P78A 4BV3A 1XRMA 1G7SA 4OHUA 5CNMA 2P67A 2P91A 2Q6LA 3AXTA 3PQ2A 3X2SA 4FFNA 2FW0A 1X2BA 2W6ID 3O8BA 5CDGA 4G1VA 2BGTA 3ETLA 2AFIE 4AQ7A 2YFHA 4E31A 3MFQA 1GNPA 4OHPA 1O95C 5I7UA 5IUKC 4LJ5A 3ZZMA 5HBGA 4FPXA 3A70A 1FC0A 1NRWA 3MLAA 4WCFC 5JISA 1H23A 2EW8A 2CWDA 5TXGA 4WINA 4E07A 5NULA 4FONA 3ZKWB 2AYYA 4UEKA 1E1MA 1XZPA 4BKOA 1QX3A 1RTKA 2FA9A 2H4WA 4R1TA 4XARA 4B6FA 4UE3S 1DOAA 1OXVA 3RHZA 2CXSA 3T0FA 4LFBB 3CUWA 1L2TA 4E6PA 1QHXA 2BE7A 3X43A 2BFNA 1XLUA 3TIFA 4JLPA 4DOMA 4DA4A 5BSEA 5H7XA 2Y27A 1IY8A 3UO8B 5JT1A 5HIJA 2FQQA 1U0LA 4N41A 1WVMA 4BN5A 2IZ1A 1L5ZA 1D2AA 2QWXA 2VBIA 2PO7A 3NNSA 3ORFA 4WLNA 3ZLVA 4QODA 4C5AA 2J6BA 4UXIA 4YJHA 2RONA 4JEHA 4DTCA 4XE5A 4WOPA 3O9MA 2FW8A 1QYRA 1R0ZA 4LRXA 3IA7A 2ZUCA 4LYGA 5IM4A 2AMVA 3FDFA 4BNTA 1KPHA 1VI6A 2ZROA 4QREA 5FOQA 3LC1O 1XXHA 1AHHA 3WFIA 4QEDA 1NV8A 3PR3A 4JIMA 4F1KA 2O8BB 5EEHA 1ZOLA 2RCYA 1AGYA 2G3YA 3NTLA 4R1SA 1J5PA 2H1IA 2OC4A 5BYJA 4E1AA 1NDQA 1AT1A 4JLUA 2GAIA 4AJPA 1B6TA 1VA5A 3OTWA 1MC4A 2QN8A 4Y2XA 5TMEA 3ZJYA 5JSFA 1YJ5A 4WNYA 3WA7A 3CLHA 5FUVA 2QPAA 3WBBA 5IAJA 4MPTA 2PKEA 2Q8PA 4TSFD 1NJFA 3CGWA 2XWPA 3O95A 2J87A 4LMPA 5IH3A 4DMMA 2BD0A 2PZJA 4N5MA 1H0KA 2OGWA 4G4GA 2XKBA 1ECLA 1Q14A 4BIIA 4L4ZA 4FXPA 4Q9HA 5K6TA 2HMYB 3QEJA 1G3IA 5E1OA 5J59A 3VHXB 5BR8B 3DG9A 4J91A 4QUJA 4C2BA 3H5IA 4XQCA 4D6XA 3I5XA 2ZKIA 4RU1A 3AF6A 2H1CA 2I4NA 3LG2A 4AROA 5LOVB 4NCBA 4FFMA 1LSSA 3A4LA 3R5TA 3B2QA 2FW1A 3WJ2A 2J3EA 3GAMA 2HJHA 3K9WA 3P0JA 2I0FA 1I3OA 3MTJA 4AKSA 2GBCA 1R15A 3A1FA 3E6AA 3MIIA 5B1SA 3V4SA 3AEXA 3WIOA 5I4IA 1X74A 3ZHVA 4B5KA 2WV7A 3KKMA 2CLMB 1T9ZA 4NCXA 2D4HA 3EIEA 4TOIA 1V11B 3Q7IA 3QHPA 2LCQA 4B84A 3QPCA 4BEBA 2CNDA 4OVKA 3I45A 1KFEB 4K87A 4L9WA 3WLNA 2JEYA 1C1YA 4X8HA 4Z2YA 4WXHA 2PBZA 5HEKA 3IP3A 1PFYA 1ZQ9A 1L1QA 2PWAA 3CZ9A 1W88B 3K9FC 2ZBPA 3L6BA 3QKIA 4H59A 2YFYA 4CTNA 3GHHA 3IEMA 1OXUA 1N77A 1HYBA 4H0NA 1T0BA 3W6OA 5J5CA 3ZXUB 2DRIA 1AS2A 3AF0A 4IF6A 4GYYA 4AN4A 3BKWA 4KE7A 4WE3A 4BVFA 2R00C 1ZR2A 4F46A 4ACBA 4YV2A 4CKXA 1SU8A 5KX5B 3AY6A 3C1OA 3C48A 4D9JA 3TQHA 2G9VA 2VH1A 1WXXA 2GBLA 2CVOA 3GRZA 2ZLBA 5FR2A 4MNTA 3SC4A 2HMAA 4E2YA 4Q0MA 1JSLA 4GF5A 4JKYA 4L28A 4C4RA 2Z98A 1J21A 1XQWA 3FVWA 4FFLA 1P4HA 1BRTA 5ESWA 1ODFA 1OY1A 2IV7A 1JHZA 4FI3F 3QUSA 2HGSA 2QJRA 5MN5A 4RVGA 2GD6A 2HW8A 3HBJA 4R8RA 2EG9A 5CG2A 1EM8B 1LRKA 4G0OA 4RMIA 4YCMA 1FZTA 2OFFA 5IJ9B 2B4TO 1I4TD 2ZBGA 3A9VA 1T5OA 3EZXA 3NBXX 4TT8A 5EP1A 3A2NA 5LQNA 4B6QA 3DHWC 2QRMA 4UBIA 1SCUA 5AICA 3W5UA 3VZPA 1DRWA 1YCGA 4C87A 4DIDA 4E2ZA 1G5TA 1XYVA 2WTEA 1YJXA 5ERXA 3MOIA 3I9V1 5AUQA 3HJGA 1QO0A 3QJGA 5HNKA 1WXFA 2VPTA 2WBLC 1RZRD 4F9FA 4ZZIA 4JX9A 1LBTA 2ZSKA 2X1LA 1ZK0A 5HZKA 4B3RB 1XZNA 3EWIA 4DLRA 3IPXA 3FHTA 3O8OA 2RMKA 2RDMA 1R27A 3KCQA 5F35A 3DOOA 4UC0A 1Y1PA 3PFIA 1F4LA 1DC5A 3NBFA 3FPAA 4MVJI 5CVVA 4M9SA 4MW1A 2C4NA 4JQOA 4YCAA 4E5DA 1HORA 3KOXA 4R31A 4HMPA 3FRIA 1N25A 5L3VA 5EHXA 2OD9A 1B93A 4KX3A 1IZYA 2I62A 2QTNA 1QO9A 2I29A 2JH3A 2V7XA 3PJFA 4W4TA 4DWVA 5DXFA 2V7PA 5KNCD 3MBIA 1TAUA 1TZ2A 3IQDB 2IITA 3NALA 3L8MA 3I2YX 1J99A 2VHZA 2HCBA 3MJSA 3RFUA 3WK5A 1Y82A 4Q18A 1VPEA 3K5WA 1XCOA 2XVMA 4Y7CA 3KOUA 3CRZA 1RHMA 2QQFA 2WG2A 2SBTA 2FSGA 3BD8A 4KKXB 4J94A 3KYCA 1E61A 1T8PA 1K3UB 2QNRA 3GJ0A 3I64A 1KKLA 4O4HF 1RI1A 4RZQA 2FPWA 1ZEMA 1XDBA 5BV0A 1R37A 1W8IA 2D3WA 3E4DA 2H5IA 1YRQA 1C7RA 1PTJA 1YJCA 2Q50A 1J2UA 3PXDA 3GMTA 5JCPA 3WLHA 4B79A 2W42A 4DUGA 2FEMA 1QG6A 3O7MA 3I83A 1F17A 1EFRD 2YDYA 4RMNA 3DC7A 3DOJA 4OHBA 3UCFA 2RI1A 2HCJB 1GQSA 1QE0A 3B6EA 2RGXA 4R3WA 5BPFA 3T3PB 4B4VA 4HNRA 3NM6B 1KP2A 2C1EA 3C6KA 2O1SA 3EW7A 3KTAA 4AJKA 1WX1A 3G89A 2PAAA 3DAHA 5FTKA 3UAZA 1RWPA 3FSGD 1E0DA 1GR0A 1X86B 4G5XA 2G4CA 4IO1A 1RM5A 3F7TA 5AXCA 1DJMA 3HJBA 4YYEA 5I45A 1SVKA 2IYLD 2Z4TA 4P83A 2XWQA 3NFRA 3IURA 1N6PA 3CVYA 4AKHA 2DKOA 1O9BA 1OFVA 1XPJA 2X4LA 4FYYA 1Z74A 4LHXA 1NF9A 2F67A 1XRPA 3AKEA 4MS3B 3HCAA 2OCDA 2E37A 5G40A 5K0ZA 1Z62A 3SSAA 2HHJA 4DLLA 1V37A 5LQJA 3L79A 1SUPA 3BGSA 4LRWA 3DBHB 3L5OA 5C0OE 5KQMA 1RYFA 4EHFA 1YU9A 1L4EA 1SC4A 3BMOA 4DMKA 1JAHA 4P54A 2EATA 2SECE 4AZSA 2X9LA 3ZGLA 4A92A 3ZHSA 2UUAB 2CFCA 4HVAA 1V4BA 4PFQA 3BXFA 4NOKA 1JH9A 4WQMA 2Y1XA 3NAGA 2OHOA 2HA2A 4L5JA 3ASYA 5TIIA 1PL0A 2G5CA 1MO6A 2NP6A 4RHUA 4JIGA 4LF6B 1JDBC 4UJ5A 3ZCPA 1CS4C 3B2NA 5A4JA 1MFZA 1TVMA 1WD7A 1ZN9A 3AI7A 4HZGA 1GFIA 4G9EA 4HVTA 3N39C 3TM5A 5LMZA 1DRJA 2XEXA 1M2VA 4GOLD 2C98A 5J2UB 3NNNA 2B4KA 1H2ZA 3LDHA 3L1UA 1D0SA 4LMRA 4O2AF 1GA1A 5DNVA 8MHTA 3FDJA 3F6SA 4IJQA 2JJ2A 3WYCA 4ZVOA 2Z30A 3ISTA 4ZTBA 3UW3A 3M5PA 1E79D 4EEZA 4MPPA 2D0DA 4GVXA 3L7BA 4PS0A 2JJYA 1O9GA 2H1VA 1QTRA 4YRDA 3BCHA 1T1SA 3N53A 4YRZA 5KTRA 2R60A 2YZKA 4KSBA 4RO0A 1UF9A 1WTAA 4FHZA 3VKFA 2I7DA 1FTNA 1CRZA 1G19A 1OLSA 1T8WA 2VFAA 3BGVA 3BXXA 4YP1A 1KSGA 3RVMA 3EIFA 4BO8A 4D3SA 3RBZA 4QARA 1G8GA 3CG0A 4DWWA 3IOBA 3ZE0B 1II8B 3HK2A 1QGUA 4IMRA 1E62A 1OROA 2HSZA 3I9JA 4JBNA 1JB9A 1PLJA 1O6FA 2Q5QA 4TT3D 3QUAA 4RWZA 1JQ5A 2PYIA 5CHEA 3EMDA 1ZA1A 5HOEA 2I78A 1QGED 2VHCA 3K53A 5BN5A 3TW8A 1B74A 3BH6A 3WK9A 1RIIA 3KXPA 1V7ZA 3TPFA 2YWDA 5IYZA 4NV0A 5JTTA 1MO2A 1VZ3A 1M9NA 1V8BA 1XVIA 2DY0A 2VJKA 2J48A 5FI3A 2WWVD 4GLBA 3TQTA 4ROSA 4GRDA 4X1IA 4XIFA 3NBKA 4E5VA 1ZESA 4LJ9A 5L45A 4MYUA 3G1TA 3FNGA 1NC1A 2VWPA 2WVHA 3NOVA 4CF5A 2QTBA 3RRXA 3BRWD 3Q8MA 4WKPA 4JKOA 4OBXA 2CN1A 2B1QA 3A1NA 4LC0A 4MJXA 4BRWA 1IYZA 2HRDA 2WWXA 4ZHQF 1T2DA 2ZTLA 2PL5A 4UUPA 4D9KA 3PNYA 4HYTA 4EG3A 1HTBA 3UWDA 1F2UA 2PRYA 5B12A 2C2MA 2NZUG 3DULA 4C0BA 2JGDA 3G2NA 4CLXA 4ENUA 5E0KB 1U2GC 3M6AA 2EERA 1OVMA 2XNHA 3LE8A 5HDQA 2JIZA 3EZ2A 3KBOA 2ECFA 1XPRA 3IPAA 4JB8A 1G16A 1AK1A 1EWTA 1M83A 3PNPA 5CDYA 4JU8A 4MP3A 1TMYA 4MWTA 4F3KA 1Z2DA 4Z7JA 3BZWA 4BY9E 2XIJA 4FS3A 2DEUA 4P3XA 3J7TA 5KWVA 2J1LA 3T3EA 5AKKA 1RWVA 1MQSA 1VCNA 4O5AA 4MRNA 1W1WA 4PSVA 3I8XA 4NEQA 4GKKB 3ZJ4A 3DL7A 3JZFA 1NGSA 3ZX5A 2Z6VA 4R5HA 4Z53A 1IUKA 1SCNE 4BRSA 1YI8A 1JWBB 5HQTA 1BX1A 1JH8A 1WABA 2Z2IA 1PV2A 3SC3A 1DADA 5DEIA 3OLXA 4H0CA 4HATA 1C3OA 2QTLA 1ZU5A 3GPIA 2AZMA 4NNOA 4MPRA 4JBLA 4PC3A 4UULA 3UGTA 3VAAA 3WXMA 1KERA 3I6IA 2JAQA 4OCZA 4QBGB 5DW0A 5KYWA 1ZN2A 1T6YA 1FXUA 2AN5A 2EX0A 2YNMD 3E7FA 3PB3A 1KQPA 3TSZA 5THXA 1X7DA 5DIZA 3A9TA 3C85A 3PU6A 3UT0A 3ZLBA 3H1TA 5DRTA 4A26A 4ESOA 3IERA 1DZIA 4Y8VA 3LWDA 4E5KA 1IMOA 2CC2A 5ALRA 1W5EA 2VJLA 2D2IA 3GGCA 4HDAA 5EMHA 3PR2B 1ISJA 5KOIA 3L7IA 4XSVA 1F8YA 1COZA 3KDPA 3U1VA 4JQCA 4XDHA 4YP5A 1JEYB 3R3XA 3E23A 3IP8A 2P3OA 4INPA 3EXFA 1MZPA 1LF0A 4WW0A 2IGTA 1BX0A 2DCUA 3QITA 3SXPA 3VVBA 2UVPA 3LS2A 5C4IA 5K8TA 4W9MC 4LOIA 3AY7A 1PWHA 4PLPA 1ECBA 1G8FA 1KK3A 2XMDA 2VI5A 4DBLC 2H7CA 4IOJA 3IX7A 2VYVA 4GI2A 3IUNA 4ODIA 3DMFA 3TSYA 1EFKA 3Q9SA 3PFHA 1T15A 4FFBA 3L0BA 3H5LA 1IXRC 5AM0A 1FYEA 3P2EA 4MH0R 1JSRA 1XDDA 2V0NA 4KP7A 4ZAZA 1ZJ5A 1J0BA 2VA9A 4TM8A 4Y6OA 4MVJA 2BEUB 1PEKE 2FZVA 2ZYWX 3MRXA 4IQ4A 2GILA 4R9SA 4A5OA 4BWGA 3WJ1A 2JJMA 3L40A 4D4HA 2FX5A 4CKEB 1EDBA 1G55A 3EARA 4DLPA 5KQSA 5KYYA 4D56A 4EUKA 1Z4KA 2XOKD 1MDFA 3D0OA 1Q91A 1B76A 1K08A 4Q48A 5FPQA 1HGXA 4UJ3A 1XAIA 2C4UA 2WSSA 1M8KA 4B35A 1SFRA 4MROA 3KM0A 4N8DA 4CQJA 1UAAA 1I6MA 2Z5VA 3BX1A 3GUHA 3U62A 5GAJA 7AT1A 1NJSA 1W87A 3P0RA 1IXKA 4DYVA 1SXIA 1H2AS 1STOA 1C9YA 2C4WA 3GOHA 3L7MA 4XJTA 3FFXA 1E3LA 4RCZA 5B30A 3E27A 4LZOA 4O4LB 2XCLA 3CUVA 2ZBUA 5JBQA 3F9RA 1LDNA 5HF6A 4KGXA 5DE3A 5EIOA 1CJVC 3LOPA 4Q7QA 5JROA 4HGQA 1R6VA 1L4HA 3B6ZA 1OFUA 3H0EA 2UV8A 4I8XA 2DH5A 4NC9A 5T64A 1YBFA 4EQ6B 2A6PA 4O4JF 2NU6B 3D6JA 2R7NA 3G85A 3HR7A 4PBTA 4WUVA 1J07A 1R4AA 4HJRA 1HDZA 1TO2E 3K9QO 2I34A 4CETA 4MJ7A 3HJTA 2QBYA 4YACA 3DVAB 2WILA 5T7BA 3H84A 3PXUA 1RWBA 3DTVD 4EY8A 4A36A 1E4EB 4XM0A 4BMZA 1LC0A 2LIPA 3QWBA 4RD0A 1DCFA 1NE7A 2Z43A 1O94A 3GNSA 4M0KA 3RUEA 3UC9A 2VK2A 4BGVA 3TGLA 1EA5A 2I54A 5K0EA 3DNMA 3HB5X 3BN3A 3N5KA 2NUPA 2E4XA 4U7HA 1H05A 4N3AA 5IT4A 3O3NB 1ISIA 1Z5OA 1MPTA 3G5UA 4IJUA 3VKHA 1RYHA 3FZNA 3X0DA 1NN0A 5ECGC 4CTMA 4LZZA 4JI2B 3LA6A 2XNDA 4P5PA 2HMUA 4WXPA 3K6RA 5I9LA 3MTGA 2CT8A 2GK3A 2HSDA 2VHVA 4CIBA 4HVCA 2ZYTX 1TD1A 1LCIA 4KQWA 2ODQA 2B0JA 4CDGA 1TQ6A 3H99A 1JDPA 1XRLA 1MAHA 2JGLA 2P69A 1ITZA 2Z3VA 4LISA 1JN0A 1PQUA 5I9SA 1G8JA 1K5HA 3LPDA 4NBKA 4ERXA 5COQA 1AQIA 1KAEA 3ETJA 2BDTA 4PYQA 1JW9B 2I3ZA 1L5RA 2PA3A 1MA0A 3NC4A 4JEIA 4XYEA 5GZ6A 3U44B 5DF1A 1J9EA 2OCYC 1AB6A 1J0CA 1PSWA 5AXDA 5AW0A 1QMPA 5CPBA 4FNOA 5EFZA 4PSCA 4IX1A 2BGLA 3CJTA 5AW6A 4AZ0B 2IZ5A 5JRDS 3SFVA 5KO2A 1HXHA 2AZXA 3ERCA 1OB5A 4XWGA 2FPKA 2IHKA 3MK31 1O57A 2HJVA 5AK3A 5K6AC 2BEVA 2Z2YA 4M38A 4NMXB 4V2IA 4LJLA 2NPFA 5K45A 4F3YA 1B00A 4LNHA 2CDNA 1JLHA 4JUBA 3F5DA 3W6ZA 3SICE 3QF4A 4FMCB 1H2XA 4MWGA 2BMDA 3DH0A 4YI5A 3S2IA 3SSMA 3VSBA 4BMSA 1ZH0A 3E1SA 4LNUA 4MW9A 3TQSA 2B21A 4C0HA 1HNZB 1VMKA 2QW1A 4JL8A 4YWJA 2OZLA 2O2EA 3ZVMA 4HZIA 1QK5A 1R0WA 4AJ2A 4DA0A 4DC9A 3W6PA 4CKZA 3P0HA 4MUNA 1MB4A 3KAKA 3W7BA 3DOCA 2H0AA 3T1OA 3VSCA 2EXXA 1TXGA 4BHTA 4YCSA 2H85A 5LZ8A 1Y5LA 1OBOA 3M5DA 2GOYA 3NOOA 2O14A 1FUUA 1G8SA 1PDWA 1VBMA 4M0PA 2JIPA 3ZDDA 4OU4A 1KH2A 1ZH2A 2ZRHA 4W99A 1EGHA 1GQFA 5J2TA 2X5JO 3FMVA 2K7ZA 3KX2A 3KRTA 4PQRA 4DR5B 4WOJA 3QBTA 3GVXA 1Z2NX 2YWRA 4Z9AA 3N2IA 5E0OA 4ZVTA 2XT6A 4QOEA 3AL0C 4YAFA 3L4SO 4LWZA 2YC4C 1N57A 2FF5A 4OQNA 2XOXA 2RI0A 4Y3UA 4D8VA 3CUKA 3NTVA 3B6MA 2POCA 5FO1A 5T4EA 2GR9A 3O6VA 4NJEB 4C5CA 1X0VA 3HS3A 5L3QB 3OLYA 2Y77A 5L7TA 2PKQO 4ZRMA 2DT5A 1P80A 1EUDB 4GR4A 3TLJA 3PNMA 3WIBA 2YVKA 2PUVA 2WI8A 2FUKA 3JD1A 3QWIA 1PR2A 3WYGA 3FW1A 4HS4A 2C7PA 5EGNA 3TNFA 4INJA 1DDIA 1EBBA 1XAGA 2ICAA 2OV2A 4K6OA 3SEQA 1K6XA 4C0LA 5BYAA 3A8TA 3QUQA 4RW0A 1I0ZA 3GEEA 3H9QA 1U2TA 4IDCA 3BB1A 3VTKA 4N7MA 2GXUA 5IBQA 3EZLA 4HLNA 4K3UA 3L2OB 3ZWWA 4H18A 4DUYB 1FUIA 3NW9A 3PSHA 4POAA 2FUG1 3EVCA 3HL0A 1PD1A 1R3UA 3IUQA 3PL1A 1AUQA 2WHYA 3QPVA 4XQ0A 3ZKWA 4DY6A 3O2QB 1U0BB 3TQRA 3RREA 3H86A 3LQYA 4AS1A 3PHCA 1T2EA 3WKDA 3OIVA 4XGNA 1RVDA 1SJ9A 3EB9A 4RKFA 3ROPA 1YF3A 1VKNA 3RYIB 2NQTA 3FNBA 5A3RA 3VR5H 4YN3A 2WHRA 1EXWA 4MLPA 1XWFA 2Z3ZA 5DO9A 4GE3A 1US8B 1JHQA 1OYYA 4JX8A 3ZWXA 1PYOA 3KUXA 4MRSA 4LVUA 3QLJA 4DQDA 4NCAA 1H1LA 4Y2JA 4CFYA 1WTCA 5TGTA 2B7BA 3TJRA 3WWYA 3FRHA 5L7WA 1OIVA 1HDOA 3FB1A 3AIIA 4QAQA 2IOQA 1RP7A 2JLBA 2VYFA 4RF5A 3SYMA 1YFJA 4IKPA 2NUAB 3JZMA 1B6RA 4CKWB 3COJA 3R3YA 3EUEA 1NW7A 3HA7A 4OSOA 1PNVA 1J7KA 5IKMA 1KI7A 1ZM3A 1NP3A 2CDAA 4PTYA 3WL6A 1E6WA 1ZU4A 5IABA 4R4JA 2O8BA 1WB6A 2PD4A 1Z0FA 1SXJB 3PQ5A 1HV8A 1BJKA 1NT2A 4KPUB 2IJGX 2YFQA 3RUFA 3GP8A 3ADCA 2H2DA 3ENVA 3B8HA 1YZUA 3DYIA 4L8FA 4JP2A 2EQBA 2H1WA 3AW9A 1RFGE 2QROA 3E61A 4NU6A 2Z2JA 3QI7A 5FHQA 3O0DA 2ODNA 3ER8A 4J2TA 1IOVA 2OKGA 5AUOB 4B71A 4E1VA 1XEAA 4KITB 3AR3A 1RRMA 1HOXA 2QENA 2FPLA 3AP1A 2V9ZA 2MTBA 4D8YA 2OV3A 2EEPA 1JA0A 2GKSA 2YNMC 2ABWA 3EC1A 3P0EA 2XMBA 4FDLA 4M1QA 4EJSB 5FEMA 4G84A 1Y5MA 3VHXA 1INLA 2WIGA 3FNRA 3VVCA 3CUEF 4ZWNA 3I52A 3HN2A 4FIZA 1XQVA 2NXCA 5LOVA 1AO3A 1KZYC 3T0GA 5K20A 2AHRA 3N28A 4I36A 1NASA 2CBGA 3LU1A 4KIFA 1NY5A 1BKDR 4P22A 2PM8A 5C7IO 4IIGA 3SS7X 4I99A 5KVAA 3I5YA 4C1BA 3GVCA 1EP2B 4C4PA 4Y0NA 4QUEA 1HEYA 5AUPB 4WNCA 1M6YA 3WY9A 4ZOQI 4KV9A 4FINA 4KSYA 5H16A 1WLSA 1V11A 2QQ5A 3P27A 5JATA 2PWBA 1IXYA 4UFOA 4OHCA 3JATB 1DWQA 2AB0A 2FETA 3NH6A 1Q74A 4M0FA 4YAGA 2VSFA 4GMGA 1DJQA 3RSFA 4DMGA 5GGXA 2IXAA 2P9GA 3JYPA 3FUWA 4DIKA 4Q66C 4ZQFA 3UJ9A 2W00A 4NX2A 3DEHA 4BQNA 4ZIRA 3VX3A 4WLUA 5C34B 3A7DA 2QNBA 4DQLA 4X64B 5IUNC 1XVAA 4F38A 1LKZA 1U7ZA 2ZYSA 4F3TA 4KXVA 5JASA 1NHWA 5CM2Z 3VO2A 3QXCA 5TR9A 5ENZA 1X7YB 5KX5A 1HPLA 3EYAA 1XHLA 1NZJA 4YIKA 1FRNA 4LGMA 3RVKA 1PAUA 2R1ZA 2O3SA 3AR7A 4FR0A 3VYVA 3IESA 5LZ2A 3K6SA 4B3TB 3HKCB 1ZOOA 4MMYB 3CZMA 4ZI7A 2XZDA 2O7RA 3EVGA 5E8JA 4OAOA 1SK8A 2AMFA 2TECE 4WCFB 5LM3A 1E9FA 4MUIA 1M74A 3GMDA 1EM8A 3TLGA 4IUYA 1A2QA 3PJDA 5IJ9A 1TVCA 4QNMA 5M2QA 1ZUWA 2VP0A 1GA6A 3U60B 2PEZA 4U7FA 2HV9A 5B53A 4YGYA 3WTCA 1UPAA 2OQVA 1GTJ1 1NUAA 2FRDA 2HPVA 2AG8A 5CK4A 3EZGA 2DF8A 4DR2B 1UFVA 1IZ7A 2IYEA 2ZJZA 2GYVA 2EWMA 3SDZA 1P4SA 2P2YA 2JI4A 2PL3A 4KQ9A 5CA0F 2IS1A 3DNFA 3QOWA 1WEHA 5DLQC 1NR1A 3A4IA 4BGEA 3SC2B 1XU7A 1YONA 3LQRA 4D5GA 1L8LA 1FQOA 1QC5A 2QYOA 4NHOA 4P2GA 1QIEA 4RPLA 5JZVA 5B2FA 2R8BA 2NSLA 1D03A 3AEUB 3JQFA 4K28A 3RJTA 4DIFA 2HQ1A 1O9HA 2HFKA 3WMFA 2KWIA 2YY5A 1F12A 4MV3A 3WLQA 3RTDA 2C9MA 1C8VB 1D3AA 3D3WB 2HCTA 1CQPA 4EATA 2PUWA 4LBYA 4PLCA 4GUDA 5HKKA 2O8EB 1RQNA 1HT0A 1VPTA 1ZPDA 3W2IA 5F9FA 1N2ZA 1QF7A 3HA3A 4ZJUA 5AM4A 2P9TA 1WZUA 5DTJA 2IEZA 4N3BA 5FV7A 5TY0A 1EDOA 1D5CA 3RG2A 2DETA 2H08A 5U4QA 3RB8A 1I5RA 2BR3A 4OXRA 4PG7A 1QUFA 1HFKA 1D2NA 4Q3DA 2MYNA 2BBOA 5IJ0B 2M98A 4HWPA 3ED1A 3R3WA 4TLAA 2NZ8A 1EBUA 2O50A 2VATA 2WV9A 2Y1KA 1E9CA 2NIPA 4DAEA 2D8AA 1YRYE 2QLLA 3OQIA 2M9MA 5A5FA 3OM8A 4EEXA 4ADSG 4JLKA 3EHDA 3IEUA 3WZLA 1OI7A 3NIBA 3CEHA 2X0NA 4A0FA 5BR1A 2YJZA 5K8JB 3MM4A 4ZVKA 5IM4F 3WL7A 3KQKA 1NHGA 2IIQA 2Q7XA 3DV9A 1OTHA 1ZOIA 3JWHA 4HADA 4AS3A 3V55A 2VJPA 5BV7A 5KOYA 1RQ2A 3V32A 3G2OA 3TZKA 3W05A 2Z2ZA 4CI0B 1KDPA 3HPRA 1YL7A 5JFTA 3DLHA 1YBAA 4HNQA 1WW2A 5D3MA 2J5RA 5AO9A 4ALNA 4GS5A 2GZRA 3I34X 2CXUA 4X1YA 3K71B 2XODA 1Y3DE 4H6XA 4JJ4A 1QK3A 1WV1A 3ZLJA 1IOZA 2PH7A 4MIYA 1CZHA 4U7JA 4C5BA 4IDNA 3KWLA 3THYB 2GM4A 2VNAA 4MGIR 1Z08A 3ZGYA 1VRWA 3FPKA 1PU2A 2VDOB 3T7KA 3WNQA 3WBJA 3GJ4A 3E9DA 1KOGA 5AK0A 5IC6A 2O7NA 3HVKA 5JWOA 3U09A 3GEGA 1XTRA 3LDGA 5EXDA 5LIPA 3BXHA 4B8YA 2I9KA 4J0GA 2ID9A 4M8LA 3DBHA 4YB8A 3WYBA 5ITZB 4H7HA 1X1SA 1YVEI 4L1KA 3C5CA 1FNDA 3ZCTA 2ZU0C 3M1YA 2BIFA 3AR9A 1ZD1A 3TI7A 1OGYA 2QV7A 3H16A 5JFGA 2WSYB 2WFAA 3EVTA 1NMSA 2A4MA 3HU2A 4WI1A 4ZPXA 1C9EA 3HSKA 3T94A 4AXXA 1V1MB 4G0NA 3W8DA 1U9IA 1R9NA 3B52X 4Z8XA 2E87A 1OAOC 3KU1A 2MINB 2NGRA 2ZWMA 4IQ0A 5G0SA 5GJCA 1J8VA 3TAUA 1DBVO 4B7ZA 1XTSA 4EGCB 3ZXYA 2BCEA 1BOFA 3GWGA 2RJNA 1OX4B 1NUUA 2J41A 3IMFA 5J2UA 3UB2A 4I5DA 2YN2A 4YRBA 2PGXA 1LQ2A 4YP0A 1VG1A 2ZE7A 3L6DA 3ONFA 3MS7A 4AMYA 4EF4A 2JCXA 1AY0A 3TD9A 2JNWA 4C7KA 2PX5A 2Q4BA 1GFWA 3VU1A 1JR3A 3BXZA 4DPLA 3MD9A 1LY1A 4K88A 4R69A 4COOA 5JH7F 1GZHB 3GLGE 2F2TA 1GV1A 3GVHA 1FMJA 5A3JA 2JRLA 5L9AA 1P2FA 4CEHA 2ZT7A 4K9KA 1EVLA 3QWHA 4GOOD 4HDMB 1ZUD1 3KUUA 4J2HA 4UATA 4QUBA 5MGBA 1XTIA 1U63A 5BUQA 3UJ7A 5LU9A 1LLFA 3OZVA 4L3WA 1VMEA 3N75A 2IUTA 3HYLA 4FBMA 2IPLA 2J9GA 3PWSA 5HJ7A 1JVBA 1IWPB 1II8A 1PYGA 3DKVA 2D6FA 1MRSA 1WRBA 3ABIA 3CUUA 3ZD8A 2FU5C 1KO4A 2C2HA 1DCMA 1QE3A 1EK0A 1ZW1A 3GLTA 3CC8A 3MCZA 5A3QA 2HN9A 1ZI6A 3G2PA 2HCFA 2AF4C 1JLRA 3CNHA 4GWKA 4Z4QA 1E6EA 1W48A 1RQXA 4CTJA 2XYGA 5EE3A 4CCSA 4X60A 1ZK3A 1NT4A 2G4LA 1EE1A 3QKRA 4L4YA 4XLZA 3RC8A 1L5OA 3DZKA 3BTVA 3D4LA 1A50B 3E05A 1SGWA 2F1IA 2HO5A 4HXEB 1R5OA 1YS9A 2VG8A 3IP6A 5KQRA 4HDCA 1SIBE 5AD1A 3V7WA 3CPHA 1XDUA 1WKBA 3GQBA 1UANA 3BTOA 2W2LD 5BSUA 1PDVA 1ZVQA 3BHNA 4KVFA 2I6SA 2B69A 1J97A 1AQUA 1VGVA 2DBYA 2BBTA 4YFYA 1Y0BA 2HTEA 1AM4D 3PC4A 2X8AA 3S5JA 4WKGA 4RYDA 4HRXA 1GUYA 4OBBA 4TX1A 2QN9A 2WJZB 4A91A 3OLZA 5LB2A 1R6UA 3K1TA 3BPSA 3BXGA 1NW8A 5AVSA 3EX7C 1M10A 3WLEA 2R8ZA 4LS3A 2GCNA 3JYNA 3RVSA 3LLUA 4W6QA 3WLIA 1WZ2A 2FFRA 2GLTA 3OJWA 1L3CA 1RWQA 1U0GA 3W3AA 4EA7A 2YMPA 3EFHA 1QV7A 2ZS8A 5LQRA 1VP3A 1B8OA 5SZJA 2IKQA 1Z0KA 4YMGA 1UJCA 1NKSA 3TDMA 1IPFA 3IODA 4BBJA 5LP6B 3SIWA 2BHNA 5KTNA 1NIPA 1YE3A 3I04A 4MWCA 4M37A 2OCLA 3MGKA 4JBYA 4GO1A 2IZ7A 5G0WA 4BO1A 1OYOA 1ISHA 2IEAA 3RYCA 1A95A 1I10A 2X1MA 2VQSA 4J3JA 2YS6A 4GXRA 3NHLA 5DM1A 4FE7A 1XTUA 5DM70 4B7UA 4E7OA 1R6TA 4HJXA 4JLBA 4QOSA 4ZVQA 1QP0A 3SSOA 3B5JA 4RDXA 3A2LA 3PDUA 3RRFA 4IRUB 5BSHA 4K8OA 5H81A 4BU1A 5CX4A 4DEVA 1JDBB 1Q0TA 2VP4A 1WBJB 3O47A 3AQIA 2R11A 3STUA 2DUJA 4QXPA 1SC6A 4ZA2A 4ENSA 4V0ME 3KVOA 3LCJA 4NFYA 3WYNA 2YYZA 4XA8A 1NDHA 4YXFA 3P71T 4M7OA 3GRAA 5L51A 3WLPA 1GRQA 2DLDA 5CT8A 2D3TA 1IN5A 1I2BA 3OT1B 3GUCA 1SEVA 3L4JA 2DWPA 1TKRA 1IEVA 1Z07A 4BU0A 4DBLE 4KZPA 2G5PA 3CG4A 3LUKA 1T5SA 2BWJA 3T12A 2F1OA 3MAJA 3DDNA 5BRNA 1YDEA 1GPYA 1Z33A 4GZ6A 4ND8B 4JGIA 1KS2A 4CF4A 4CKCB 3AIOA 1KOFA 5LB4A 3AFMA 2FVXA 4UVGA 2IUFA 2BEUA 4RA6B 4EUHA 3HXTA 2OO3A 2EP7A 4L7QA 4CKEA 3FOCA 4DXHA 1Z3IX 1VGQA 2OM6A 3VR0A 1NYRA 3GT4A 4K46A 1LX6A 1XYYA 1YFKA 3K9HA 1EJ2A 2AN1A 1YXMA 1SUCA 4J16C 4JXJA 3VO8A 4B6SA 4JI4B 2AKAB 2F1JA 4NPCA 2ILTA 1N9KA 1OZFA 2I3BA 1TW2A 3U39A 3B9PA 3WGOA 1KHTA 2HF9A 1EXMA 3HWSA 5JW6A 3I04M 5FH9A 1E3IA 1MOSA 2Q49A 2HA7A 5DTRA 5EXEA 3ADOA 5C3MA 4WBXC 1Q83A 2FW7A 3JQ9A 4CFZA 3IILA 5GV7A 4OL9A 1KZHA 1HZJA 2VKTA 4H6PA 4MULA 3MJHA 2W8ZA 3MOGA 3VDMA 4O4LA 3B78A 1DAHA 2VSYA 3MINB 5A9RA 2UZ4A 2HBQA 2JFGA 3EA5A 4E4RA 1FXSA 2FPMA 3PNSA 3SR4A 3M6MD 2JLSA 1D4ZA 3UNXA 1YIDA 4EQ6A 2H52A 3OEWA 2IBMA 4G23A 1YDHA 4YJDA 5KDLA 3TR5A 1JBQA 1F51E 1WEKA 1Z2PX 1K27A 2NU6A 4M86A 4UNQA 4XPZA 2BH9A 1XMPA 3IDZA 3OZUA 4UNNA 1G5IA 2YMMA 3P20A 4TV8B 5CD9A 3EGXB 3NHRA 1QE5A 3E8SA 1SBQA 4JT9A 3L43A 3H2HA 4IFEA 5AKIA 3PENA 3GEMA 2Y4NA 4P86A 5TF4A 3ZV5A 4C0XA 2EWVA 3A10A 4CLHA 2DE0X 1G64A 4OUDB 3O90A 1DJNA 3U13A 1CHDA 1G20B 2XECA 1WETA 2WD7B 5AOAA 1L5VA 3D7NA 2AE1A 4PYNA 3BFXA 5IYZF 2ORWA 3ZY3A 2ACEA 4JVMA 2AQIA 1UZMA 1GT6A 2XYPA 3UBTA 4KOAA 1KBOA 2EARA 4F4HA 4OMCA 3V4LA 5CIWA 2X42A 1G0OA 1Y1RA 2O7VA 4XKJA 5GP1A 4XOIA 3T3GA 3SVTA 1LI4A 5TEWA 4ASUA 3AVYA 1DTWB 5BQPA 2QM3A 1I4WA 2IS2A 1GY8A 2HLDD 3FOAA 2G5GX 1IWBB 3LZDA 2Q1WA 2ZVPX 2FY8A 4V38A 4Y1FA 2VXYA 4LVNA 3VUEA 2F3RA 4CIAA 4HX9A 2FW6A 3NV7A 3QE9Y 4I1PA 1ZRSA 5JXJA 1QHIA 3G7NA 1W4LA 4V0KA 5EP4A 3H6HA 5CFRA 3U44A 3K96A 2XQKA 1UP7A 4QFBA 1FW8A 1AKUA 5FAXA 2F1HA 4MW5A 3I9FA 4IIEA 4BMOB 4BAUA 1LBSA 4BNMA 1IMJA 1YFLA 2I3AA 4AZ0A 4IXTA 5EZYA 2WOJA 1S4MA 4I1VA 4D4KA 4OJYA 3Q3CA 3QNMA 2HOQA 2XHEA 1FFGA 4JLAA 5FPSA 4OFWA 3P9YA 5JDIC 2JFOA 2QDXA 4NU0A 3QVGB 2NMVA 2XE6A 2CJYA 3E9NA 2R25B 2CBZA 3IPCA 1PZNA 4D99A 2IF0A 4GZMA 3H1BA 1QRTA 1P4RA 4MPDA 2ERCA 1AGRA 1ZO8A 2B2XA 3GFBA 3TO5A 2B34A 3RBAA 3TBFA 3FY4A 3R5XA 1R6BX 4OMDA 4EUSA 3AL2A 1XD2A 4MYRA 3FWYA 3L49A 2C5AA 4UD6A 2HHAA 2G1JA 2J33A 1VG8A 4OXXA 1KC1A 1DEAA 1NZDA 1VL5A 2HXSA 3ICOA 3JD4A 4F60A 5DGCA 5J4YA 5B57C 3QIAA 1HA3A 4HNHA 3VFDA 1XNJA 4GBJA 1ZG3A 2ZWIA 3RSHA 3UW1A 1R8JA 4JUFA 1TUBB 5HZMA 3GLFE 1F8FA 4KBGA 2VJDA 2PIAA 2EJWA 1FA9A 3PRHA 3OZ7A 3QQPA 4GSKA 3W5HA 4GFDA 4F11A 1GSHA 3IAEA 5AW9A 3TPZA 1SC9A 4BQRA 2VTEA 3OEHA 4PLTA 4PTZA 2HIAA 3S2YA 5IVIA 3Q88A 3G2MA 1MG5A 1PX0A 2YFKA 3DBLA 4AP9A 1IAVA 4E2WA 5LWHA 4DV5B 1QP4A 4LXUA 3COZA 2EV9A 2E21A 2P3LA 3ZQKA 1AH2A 4MLDA 2GK7A 4QATA 2A0XA 5BV8A 1LNSA 1E1YA 2GERA 1HL3A 1UXJA 1YKFA 2P4EA 2VXOA 3AX6A 4JBWA 4MTLA 4TXMA 3A6EA 4ENPA 5JXGA 1SIWA 1MV8A 5L3QA 3TZLA 1AF4A 4U5XA 1EUDA 2XHZA 3PFCA 2QQGA 1D7OA 3RS7A 3UOAB 5JS8A 1E2UA 1DELA 1R0CA 3SK0A 4C3OB 2FEAA 3GPDG 2J3MA 2Y0CA 1WV0A 4KC0A 3G0DA 3D3EA 4LXXA 4MVJF 4R7GA 4DQKA 4PINA 5A4FS 1KDOA 1V47A 1EXDA 4RZUA 1P5FA 1XVTA 4ALMA 2XMGA 2WM3A 1BNCA 3K1ZA 2IS4A 7ABPA 2CF6A 5EMNA 1K98A 4AP6A 3AM1A 1VXOA 4RV4A 3K9BA 3E5RA 4KQXA 4G8BA 2OV8A 5IVPA 5L4NA 4WK4B 1CUHA 3TIGA 1ADJA 3UY4A 1GQQA 3WLFA 3E81A 1AZWA 3CONA 1DQYA 3SQDA 4H31A 3KKZA 1E5VA 1I2AA 1GYRA 2X58A 1X1AA 4QXMA 4QASA 5DT2A 3O73A 2F9LA 5KWIA 2W2VA 1XRSB 2CXNA 2A7QA 1XEWX 1XTPA 3RYIA 1K9VF 3QBJA 4PPNA 2ODTX 4JR2A 4HGZA 1GNVA 2BFEB 3W8RA 3S55A 4AIIA 2HT1A 1EWVA 1XYGA 2YVQA 4M9RA 1N9GA 1IBCA 1US8A 4M98A 3FHLA 3BFVA 4M53A 1R0YA 3RQIA 1DIAA 1MVOA 3QNUA 1S8NA 1OU0A 2Q0QA 2R7MA 3G7UA 3VTAA 2HDNB 4TWJA 1Y4SA 5BT9A 4BFZA 2RC5A 1VJCA 3AR4A 5JNWA 1CUCA 1UC8A 5IM5A 3WP0A 3OPQA 2D1TA 3ELYA 4DA8A 3IIMA 1KYQA 2NUAA 4QDXA 4WCDA 1FMTA 4IMPA 1HMPA 1GARA 1UXGA 5ELLA 1FP7A 2HU8A 1F6WA 2HUPA 1VB3A 1PS0A 1VKHA 3AEKB 3C3XA 4HGNA 1UBUS 4RH3A 4B75A 1UBLS 2FSSA 3FYDA 3QKTA 3DB2A 1X87A 1YJAA 2ZU6A 3QWFA 1JQBA 4G6ZA 5L95A 2VQFB 4UTVA 2VT7A 1TCBA 2A3RA 3MZ0A 1F9EA 3CO0S 4KPUA 5DN9A 4F56A 2B8TA 1E60A 3H17A 3I6QA 4X1KB 2DFPA 2I2XB 3CRMA 1TVKB 1OWOA 3FJOA 3DZBA 1DUSA 4HYYA 4EJ6A 1A4IA 3GPLA 5AHOA 3IP9A 4HBZA 2ZIGA 3N6XA 4CW7A 3QY9A 4C7OB 1E1NA 4BVKA 1T9CA 5SYAA 2HNBA 1EG7A 2PKYX 1NJ8A 5D51S 4TTQA 4EJSA 3F73A 1YR8A 4FS8A 4TKVA 1PJ2A 1T1IA 4RDCA 5JPIA 1THGA 4CF3A 3HWWA 5D5PA 1XXLA 3K0FB 4TQ9A 3DT8A 1YKSA 1RXWA 5EMLA 3LBFA 1OE0A 4X3OA 1XG5A 4BC0A 1NA5A 3HUUA 3ZVKA 2ZSEA 3GIDA 2AKYA 2QF7A 3PNBA 5A7FA 5I9NA 3CRRA 1SHUX 3TGPA 3LL7A 2DHDA 3PEVA 4I0WB 1Q2XA 3PUHA 4HTFB 3BEDA 3ZHXA 1MIHA 1RKXA 5DGTA 1IE3A 3OC0A 1J42A 2XUHA 4AMZA 2Q5CA 3AETB 3KPWA 4Q12A 5IAKA 3TTWA 3EPLA 2BM0A 3JATA 3BEOA 2J0EA 3ONNA 4G1BA 4MIKA 4DDMA 2FCRA 2HLPA 1HC7A 5LXTA 5HJEA 4CLEA 1IXSB 1HKHA 1XLTC 2NTJA 4CTOA 1PWEA 1QZ3A 3BM5A 3HDQA 5HM6A 3N6RA 4JXXA 4LY3A 5KB3A 4E51A 2DQZA 5F3DA 3SQNA 4WY5A 3CYFA 1MPXA 1ZONA 2AZTA 1CETA 1EWQA 2I22A 1YVDA 2PS1A 1UXOA 2OEPA 3H2IA 4FFDA 2GKOA 3SKVA 2ZIAA 4OOFA 1X7YA 3V3KA 4J4HA 4UREA 3NVKI 5IHXA 3C6QA 3HZHA 5BVHB 5J47A 3S27A 4RK5A 4EHHA 5TARA 1LPNA 3HKCA 4JDUA 1O95A 4CV0A 4DADA 4D46A 4MK4A 4D4MA 1XTZA 3A9UA 1L5HB 5J2TF 4BUCA 4WCFA 2GPTA 3BD9A 3JR3A 5LQUA 3CH4B 3FSJX 1PP4A 3BC1A 3PC7A 4WN9A 3IBCA 4MRVA 5T4FA 3PQEA 1SKMA 1VJRA 4C6HA 3VPGA 3FYUC 2FDXA 2HRZA 3ZQ4A 1MG0A 3ZYZA 1KJYA 3KUKA 4KXFB 4MW6A 3CY6A 4Z1OA 1N0VC 1TUGA 1YDGA 2WWWA 2NUTB 4QHSA 3KJZA 4WEQA 5AKZA 4HV4A 3FOZA 3QVUA 4R9NA 4WBNB 4DBVO 4RS4A 2J4FA 2PJUA 3QTTA 4QFMA 4TLCA 1ZGHA 4U7PB 3TLAA 2WNIA 5BNTA 5IJZA 1AMUA 5BYBA 3LP6A 3SP1A 3QEBZ 3DMNA 2EJTA 3E1GA 1GL6A 2ZIZA 4AY4A 3G2IA 3D4OA 2Q1XA 4MCHA 1KZ9A 3AEUA 3AUAA 2WJJA 1P5ZB 4NAHA 1U7PA 5CITA 4WHMA 2O05A 5B7QA 5LQMA 3F7OA 1A9ZA 1E9DA 5T4HA 1QZZA 3IUMA 1PKXA 2IPOA 3PR1A 2FG6C 4N12A 1CR2A 3D3WA 3MN1A 1HG1A 1PGNA 2P6RA 5I9MA 2HYIC 2O8NA 2WG1A 1GPMA 3NHPA 3K7EA 5JCZA 1UDAA 5AVKA 4KR3A 1KRWA 5FORA 1X39A 2YBDA 4YTEA 4GX2A 3Q6IA 4R54A 2YBEA 4ZAXA 3E9ZA 1N2HA 4JP1A 1DFIA 1FDIA 4G0WA 3IVCA 3I4LA 3AY3A 4BMDA 2JH9A 5ULLA 2PQ0A 4D96A 1X19A 3P2JA 1GRRA 4PQGA 1J23A 4EHNA 3INRA 4L85A 2ZWOA 4O8ZA 1SQ6A 5B7NA 2QYTA 4A7PA 2CXRA 1OAKA 1T8YA 2X5XA 3DW1X 5J63A 3LLMA 4EHLA 4M1TA 1QTQA 1DUIA 4UNPA 1Q3HA 5KSWB 4V0OA 1ZA2A 5C18A 4OAPA 1M8PA 2QD4A 1I1NA 3WHKA 1JDJA 4Y2PA 4ZOLB 4QDZA 2DUUA 2YV2A 2FN7A 3TMKA 2NO5A 3IHLA 3IHWA 1VE1A 1M66A 1QIFA 3WMXA 4A27A 2E2WA 2FLKA 3H1EA 2H54A 2OD7A 3ADKA 3OLQA 1QX4A 4U00A 4FXOA 1AN9A 1ZKDA 1BU8A 3GROA 3KQVA 3QLVC 4JWKA 2DFVA 4TS1A 1SBHA 1LFAA 3UT6A 4DV0B 2RIPA 2A92A 2PH1A 4O5OA 2CEAA 3BUSA 3C7AA 1Y7PA 2EF1A 3IE0A 3JQDA 4XFJA 3A3NA 1A5AB 3FLAA 4ZJZA 1N34B 4B3MB 3OICA 2BHSA 4ZICA 4WVLA 2E55A 1SB8A 4YJKA 3RT9A 4LHYA 4AAYA 3R9XB 2DTXA 2G1KA 3B2EA 4K2AA 2QL9A 4QYXA 3R8XA 1ZVVA 1E6CA 1M5UA 3KK0A 4AXBA 5BQ3A 4QOGA 3THYA 5BORA 4HEA1 1VCMA 3O8DA 4X00A 1FVHA 1YVUA 3FCYA 1B15A 2JB9A 3OEED 1VL8A 4JI6B 5KNDH 1NL3A 2HKIA 3DP7A 3MAAC 2AH5A 3PC2A 8LDHA 3KPYA 3I92A 2CFRA 1HZZC 2PZGA 2IBTA 3B3GA 3GDHA 1H6CA 4DZTA 4EB8A 2O1XA 3L7KA 5LOVF 2G04A 5ITZA 4J0HA 2C20A 4M7RA 1OI2A 2JGIA 3G49A 1D4AA 2A7XA 5JAOA 5IF3A 2QP3A 5JS2A 3VH1A 4OEHA 3VU8A 1E7YA 1P0QA 1ZINA 3U49A 1KQ3A 2H1HA 4MB6A 5DHFA 3JD0A 1V1MA 2YTZA 4B87A 2BE9A 2QL5A 1XCMA 3I01A 1WF3A 2OHIA 3AJAA 3CH6A 3D7MA 3DDHA 4XDZA 4C07A 1AKVA 2MINA 3OAAA 1OI3A 2ZJBA 3RWMB 3PUZA 2UXBB 1HX7A 4G1FA 1QIJA 4I08A 1YK0A 1MVNA 1CNEA 1OX4A 5BW4A 4QG3A 3A4NA 1HNNA 2GTPA 2C5EA 3AFOA 3P96A 2QLMA 3OIDA 4URHA 1E8MA 3WHIA 5CYGA 3DMPA 4G65A 2C94A 2DOKA 4K6KA 3O74A 1F5SA 4J43A 3HADA 3HY3A 1IM8A 2CVFA 3TAHA 3KPJA 4N9WA 1IY1A 4KPFC 4E94A 3W5JA 5HK9A 4RTJA 2HSEA 2PZMA 4HDMA 3WRYC 3DTVB 2QG9A 5ED4A 1FS5A 1LBHA 2IU4A 4ZC1A 4XDGA 2QPLA 2V7WA 4S04A 2ZRDA 5FWXB 4E4YA 3L77A 2PT5A 4ZI7F 2C2BA 3ER9A 4C4OA 1Y3BE 2A35A 4A16A 4Q1DA 3B3AA 3T35A 1ENOA 1YIOA 4NZMA 4QUGA 5COBA 3RBVA 2BM9A 1NF8A 3BWEA 2RGRA 4YCBA 5AW8A 5TQ0A 4EVQA 1RSZA 2ZYGA 1FBNA 4ZZ2A 4X85A 1DBPA 1CUFA 2A57A 1A7JA 5F2KA 2QOEA 3KQSA 2FE1A 2KJQA 3IUJA 3JQQA 3E8MA 1AA9A 2G5TA 1Y3AA 4IXDA 1W47A 4CMKA 4KAAA 3RVQA 1Z0JA 7MHTA 2VP3A 1B2RA 4XGKA 1JJBA 5KTMA 3JWGA 1IY0A 1Y42X 1GR1A 1TMGE 1T3GA 1NLUA 2H9IA 3DPSA 3K4HA 3MSXA 4QQKA 5CT6A 4Z9FA 5EKTA 2GRJA 1Z63A 4JAVC 4YMIA 4TTTS 4JUIA 1LNZA 3JYQA 4D8TA 1EB9A 3X1WA 4CIDA 1L6RA 4JP3A 1V5IA 3K5PA 1PJZA 1E1LA 4L4RA 3RVBA 3P9CA 2ZKLA 3KQOA 1AKNA 1E5XA 4XYMA 3TJZA 4OGGA 3V1MA 1LVGA 4FCTA 2AI2A 2OECA 4WA8A 2AJDA 2R84A 3AF2A 3ODPA 1FFHA 3EIUA 3OPNA 4MRMB 2J3IA 3CNNA 2QX8A 1UAYA 3JZAA 4XDYA 3U48A 2OXIA 1A9XA 3ESZA 5LMNB 5IAEA 4DM4A 5E6RA 1FQJA 1FX0A 1Y6JA 3II6X 4X66B 3PHGA 1Z7BA 4GOND 1OT3A 1K8QA 1VHWA 2DPMA 1YQTA 2H6EA 2QG4A 1C9KA 2W2KB 2Y3IA 3ABZA 1P7YA 3CTPA 2H9YA 3CNEA 4CNBA 3IJRA 3GCZA 5AUNB 5LP6A 1QU3A 4FGSA 3BDVA 4KWHA 3BJMA 3CA8A 3K73O 3ZD7A 4K9OA 4HCJA 2F00A 5KHOC 1ZM2A 3GBVA 1Q1NA 4EDHA 2I6UA 3T7IA 2CXPA 3VAYA 1G2QA 3JYLA 1QPBA 1VTKA 2B20A 2EIHA 2PTHA 2QN2A 2X6QA 3AL3A 3MMPA 3SYKA 1P74A 2ZI9A 5F3RA 4DRZA 1TJ3A 4KVZA 2NWQA 4COKA 5D00A 3RTGA 3QJYA 5KYXB 1V16A 3C8ZA 2J6CA 1CYEA 1MRZA 1ZD5A 1BWRA 2ZI6A 3ZE7A 1S3FA 3VNVA 4DMUB 2ZAOA 3EC7A 5LLTA 5K2OA 3PEEA 1N3YA 2AT1A 2C7BA 1A7UA 1OA0A 2P2SA 3ZHYA 2ATXA 3QX9A 4EW6A 4ARIA 3F8TA 3KEGA 2OP1A 2ZS7A 1KS9A 3W4IA 1Q16A 2IPMA 5CJJA 4CR6A 3U4GA 2EFHB 1U7WA 3OTOB 1PR0A 4FSXA 1YJ8A 5CA1A 3O94A 5JCOC 2ZJ7A 3RHSA 5CD1A 3NU1A 4BVLA 3NT4A 4I9UA 4HXFB 3ABSB 3ECSA 3U17A 1DG9A 3LY7A 2PQ2A 1XTQA 2HZ7A 1KKUA 4BN4A 4DNPA 1R4ZA 1MT0A 3CLSD 2FQ1A 3IKLA 3OT1A 1GNQA 4PU0A 2O19A 3PKZA 3HSSA 4DANA 1EWRA 2JL1A 4YLGA 1A8PA 4P3OA 5TS2A 3GVIA 2VTKA 5SZIA 1EZ4A 1HUQA 3BWMA 3EG9B 1UKZA 2ZI5A 5F1YA 2W6IA 1SCQA 2XAAA 4ND8A 2V6FA 1TQ4A 2Q5LA 5KYGA 2HF8A 3OC6A 4ENTA 3UAWA 3FWPA 1V6SA 2ZR8A 4RA6A 5B3AA 1TPZA 3ZHRA 3EA0A 3VBEA 3D2AA 3B9QA 2EKQA 4GKVA 4C2AA 4QPPA 4E5SA 4H3SA 2GAFA 4YT8A 2FHSA 4PAOA 4UQOA 3W2HA 3VYSB 5E1MA 4JVSB 3RIMA 4H9GA 2EFEB 2FOLA 1MAWA 2O2ZA 3CRQA 1X7XB 4WLOA 1PR1A 1GN9A 1PJ8A 3UC5A 1AKEA 2AX4A 3KQMA 4JCCA 4BQEA 3L82B 5H68A 2C42A 4TTPA 3MC1A 4B3FX 2AA3A 3HBNA 5F4BA 4CU5A 3R75A 1CP2A 3FNFA 3IRUA 4G41A 3EIXA 4AJ1A 1YZGA 4Y6SA 2ZBQA 5D87A 3TQCA 3D59A 4EBFA 3ENZA 1MAAA 2FV8A 3DEAA 3LX4A 4M21A 5K9ZA 1NNSA 1I3LA 2RHLA 3JAKB 3R6LA 4M1ZA 4KRXA 2IIVA 3NORA 4PGFA 2R97A 2D62A 4XAQA 5DX8A 3SF8B 3IEVA 4QRIA 5G0UA 1X1BA 2ZE6A 4DV2B 5DI3B 4XCXA 2GF2A 1U2GA 2PU5A 4TV8A 1VMAA 3EGXA 1PFQA 2PFKA 4KWCA 4W5JA 5LUBA 5I7RA 2JK1A 3ZIUA 2Z1MA 4E03A 1E1QD 1VLLA 1ZP6A 1EDEA 2CJXA 3NFYA 3NKFA 1L5KA 4BNNA 2IT1A 2QE7D 3BH7A 3EPPA 2GPSA 4OUDA 3ZHTA 3ZY6A 3ACCA 4ZYVA 1QIHA 3HYRA 5K0LA 1XCBA 1E4YA 2WD7A 1GFSA 3KE9A 3P2MA 1OD6A 3ZEAA 6LDHA 4YY3B 4JJ8A 3F6PA 3HUTA 2ZTSA 5AMXA 2PV7A 4FYPA 3T7DA 4HWRA 4MHTA 3JQGA 3K6KA 1QGAA 1P33A 1OXBB 1U2QA 4KXXA 2ZULA 4OB6A 4NY1A 4O1IA 3WLJA 3LGAA 3AQ4A 4TV9B 4ZVNA 2PXHA 2P2ZA 4GQAA 5FBVB 3PZBA 3QPWA 2RGGA 4RY0A 1Z6TA 4QQRA 1S7CA 3LPCA 5DHTA 4TYYA 3QPUA 4HGYA 4RTNA 4OP3A 3V1LA 3SXUB 3IVAA 4DJDC 3HXQA 2C7QA 4NOJA 1JIUA 1QQ6A 1PG0A 1WZCA 2M2IA 1HOTA 3U3DA 3U3ZA 2XB2A 1MBZA 1YQ9A 2G40A 2LNDA 1OFTA 2QAIA 2B61A 3TW4A 4NL4H 4L57A 4OPMA 3WG9A 4ZXFA 4D0GA 2GBPA 3TKYA 4RK6A 3WRWA 1V5FA 3HZRA 4W1PA 1NM5A 5DVZA 1GVHA 1QIGA 4IBOA 1QK4A 1D2HA 3DPUA 2DPHA 3V7NA 3Q85A 1NXTA 2O2CA 1L8XA 2P0AA 3PRYA 5SZKB 4BDTA 1EHCA 1ZQ1A 3X1JA 1EI9A 4OX9B 5JZBA 4G5HA 4BRZA 4FZJA 1TU4A 2B2CA 5I9BA 1QKJA 1V3UA 2YWBA 5DKFA 4DSUA 5IN4A 1QFSA 2QE6A 4FBLA 1YB4A 4AYXA 2G6BA 3P9ZA 1Z0DA 2IP4A 2G82A 3K2BA 4ZYZA 4KFTA 3O1IC 5TMBA 3H6GA 4ZDKA 1XRQA 1B3RA 4ZGGA 4QHYA 1BH2A 3EAQA 4XYGA 4CKYA 4QJIA 1PJRA 2GT1A 5K6RA 3C3YA 1K6IA 1J8FA 4B2LA 1JT2A 1SIUA 2G36A 2QTTA 2FZGA 2QUJA 2W6PA 1IIRA 3K1AB 5EPUA 1DKOA 1VM6A 2XW6A 3NS7A 3BMXA 3G68A 1TC1A 1UBCA 3M6UA 3N7UA 3D6AA 2RARA 3GH3A 3ZBPA 3W6UA 1A97A 4B7XA 3E35A 4XQ9A 2G28A 5F5NA 4L0MA 3OD5A 1TZKA 1ZOSA 3D64A 1KYTA 2BF4A 3TS1A 2E7ZA 5ICGA 1EFUA 4NOMA 4RJTA 1TUBA 4E88A 1WA5A 2OHVA 3NYRA 1ETUA 1M7BA 4FLEA 4N3NA 4ZT3A 4ZCMA 1PF7E 1W0KA 3JQAD 3V6MA 3VBCA 4CV2A 1VDZA 3HI6A 5JSQA 4YCNA 3P9PA 4E15A 4RUKA 4P82A 4DJTA 1F48A 1WPRA 2PFSA 2RK4A 1W6UA 2DKNA 1NBME 5AJUA 4TWZA 3WMEA 1C8LA 1CT9A 4D8UA 3M9XA 1ZLXA 1B16A 1MX5A 3KWFA 1YCDA 1RZRA 3DZIA 1JLMA 1GGFA 5KC8A 4GDMA 4B74A 3FGPA 1V7CA 2G6TA 2I6TA 1NYTA 3EW9A 3OLVA 1HRDA 3DM5A 1XZGA 3OZGA 2OO5A 4UMVA 4YQEA 2VCEA 3ZNNA 4AW9A 4G4SO 3NEPX 4JV5B 3FNHA 3C8MA 3VHRA 3IKTA 1X80B 3AHDA 4ZVVA 3K70C 3B9BA 2CF5A 3PHBE 3HFJA 2ORED 4FR2A 3H4VA 4LMAA 3VR1A 4ACAA 4XRRA 4MQEB 2D1RA 3HL4A 4GMFA 4RKYA 1KY4A 4PWZA 3K5HA