3H17A

Crystal structure of este5-pmsf (i)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
292
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title The crystal structure of an HSL-homolog EstE5 complex with PMSF reveals a unique configuration that inhibits the nucleophile Ser144 in catalytic triads.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 107
structure length 292
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h17A00
3O95A 1CUWA 2HRQA 5ALWA 1CEXA 4JYMA 4C88A 5CRIA 1YS2X 1CRLA 1ZGCA 2FJPA 4GECA 5JADA 1ZI6A 5YASA 3FLEA 5A7HA 1MAAA 5K3FA 2BKLA 1MN6A 3W05A 3G0BA 3R3VA 3PFBA 4INZA 4BATA 1YB6A 3G8YA 2Z3ZA 5EI5A 3V48A 1A8UA 4CFSA 5AK3A 2FJ0A 3DQZA 2J3DA 2GBGA 4MXDA 1YB7A 4N8EA 3ZLTA 1MTZA 4ARBA 3ESCA 4GHWA 1ZD2P 3ZV7A 1CPYA 4X6YA 4H77A 3H1AA 1ZJ4A 1QO7A 2PSFA 7YASA 4QWMA 4GW3A 4D9JA 3WL6A 1FFEA 3FLAA 5LP1A 4AO8A 3EQ8A 5JANA 1GPKA 4QLOA 4Z49A 2WTMA 3FOBA 3N0TA 2XMDA 4RNCA 3B12A 5FRDA 4DSZA 5FXMA 3O4HA 3FAKA 1EB8A 2CUTA 3IULA 1XRNA 3STWA 4WCVA 2VQ6A 1HDEA 4C4YA 1XKTA 5K3BA 1JT2A 1QZ3A 1GQSA 3TGLA 1QJ4A 3ZLUA 5AM1A 3WYDA 2DCMA 3OPMA 2DHCA 1SC9A 4J0HA 2ACEA 4QE3A 1YS1X 1QONA 1UOPA 4JNCA 4Q34A 3VXKA 3U1TA 2C4HA 1THTA 3A2LA 4Y7DA 3PUIA 1BU8A 5ALRA 2WLSA 1BEEA 4AXBA 2ZSIA 5KREA 5IVKA 3R3WA 1QIGA 3O4JA 1EA5A 4ZREA 4X91A 1CQZA 2D5LA 3G0IA 4WFJA 2AJDA 4BVLA 5CT8A 2JF0A 4HAIA 5AH0A 4GI1A 2BUBA 1TAHA 1VA5A 4H35A 2RAUA 2C58A 4V2IA 4Q3LA 5LZ7A 4F5ZA 3X3HA 1CUUA 1ETHA 2B20A 1LPMA 1Q84A 1ZGBA 1XKLA 1HL7A 4X6XA 3OOSA 2X8BA 5CT9A 4FKBA 1XZDA 2ZYSA 1ODCA 1O6FA 2XMQA 3OM8A 1RYYA 1W6RA 2HA7A 4DNFA 1LBTA 2WUFA 2JGLA 3AUKA 4PSDA 5J3JA 4UBJA 1LZKA 2HFJA 2PPLA 2UZ0A 2ZYRA 3WL7A 3UMJA 4HXGA 4BCCA 3DS8A 4LKOA 4IH1A 4HRYA 2WFMA 3ZWQA 4OB6A 2QTBA 2DR0A 4WFIA 1XQXA 2O7RA 4HXFB 5E4JA 1E8DA 3VVLA 4ETWA 1TQHA 4ZWNA 4GBGA 3AIKA 3L1IA 1ODTC 4ARAA 5E2IA 3C45A 4EUSA 3ZI7A 4J0IA 4JYPA 3VVMA 5JAHA 3H2HA 2VAVA 4MEAA 4AX4A 4AO6A 2OCIA 1GXSA 4MWTA 1JJBA 1AQLA 1MNAA 3C6YA 2XQJA 4FBLA 2JGEA 3IUMA 4X85A 5DYTA 3FYUB 4DSAA 5IVDA 5ALLA 1UKBA 1IZ7A 3ESDA 4H18A 1N5MA 5HCUA 4X97A 5AKKA 5FPPA 4AN0A 3I2IA 2CJPA 2OCGA 5HK9A 1A7UA 3D59A 5ALZA 1WHTA 4L0CA 5JZSA 5AK4A 3WLAA 1QFMA 5FV4A 5D3KA 4MQMA 4A23A 1MO2A 3KWJA 3BF7A 4BDTA 3DDUA 2WJ6A 5HF9A 5LKAA 2JGJA 2PVSA 3BE8A 3BJRA 2WSLA 1LPAB 2PSDA 3VJLA 4XIIA 3W2TA 1K6EA 2PU5A 2PKYX 5CURA 3UUEA 1QLWA 3I1YA 2WIDA 4PF1A 5T4EA 2G5PA 3LCRA 3DOHA 2WIGA 2ZVDA 2WHPA 4ZV7A 3MUOA 3RK4A 2Z8ZA 3Q0TA 1YA8A 4KRXA 3BWXA 4OUKX 1F0PA 2IIVA 1BN7A 4Y2PA 4ZXFA 1R9MA 4CCYB 2HU7A 1EINA 3A2MA 4AN1A 5DYYA 4HVTA 3F98A 2WHRA 1GKKA 2WFLA 4J03A 1CIJA 1YCDA 1XRQA 2GZRA 2VT6A 1ISPA 1JU3A 1WOMA 3VDXA 2DSNA 1Q83A 3BDIA 2PX6A 1E66A 2ZSHA 3SK0A 1IUOA 2QZPA 5JAOA 3S2ZA 3F97A 2XQIA 4FMPA 3D3NA 4XWGA 3HXKA 3HSSA 4H7IA 3U0VA 3KXPA 4DIUA 1QE3A 4WFKA 1I6WA 5IVHA 1XZHA 4CG1A 1QIIA 1E5TA 2Y6VA 5LLSA 4PQEA 4YK7A 1IUNA 3STVA 3D2CA 3C6ZA 5AOAA 4LYDA 5AIBA 2I3DA 4UHBA 4PV7A 1HBJA 5HQ3B 3I2GA 5D3ZA 1ZICA 5ALIA 5AIAA 5A62A 2V97A 3L1HA 1CUIA 3K6KA 4UFNA 2VJAA 4F0JA 4MWSA 4AO7A 2HM7A 3EIOA 2XQFA 4U2CA 3O9VA 3STXA 1AUOA 2HFKA 4B9AA 3G9ZA 1XZLA 3D2AA 2XMCA 2JGIA 4CIAA 5AI4A 4BCBA 3RARA 5LZ8A 4UBNA 2C5FA 1H2WA 5CH5A 1OXMA 3V1LA 3QITA 5ALUA 2Z3WA 5DNVA 4ZI5A 1HKHA 1CR6A 4W63A 3GELA 2XUFA 1EVQA 3AZPA 4HRXA 5AM0A 5FP0A 2H7YA 5AKYA 4RE6A 2XUDA 4X92A 2ES4A 4KRYA 5AJHA 2XUGA 3AIMA 2NW6A 3QM1A 4J0KA 3CN7A 4L72A 4TPKA 4OCZA 1P0QA 4ZGBA 3HZOA 3DJYA 2BFNA 5A71A 2XUHA 5ALGA 5AKHA 4OU5A 6YASA 2DHDA 2XUAA 3FVTA 3AILA 4XJVA 2K2QB 3QBJA 4Y2SA 4EHBA 4K6HA 4UHCA 2Y6UA 1O6GA 4JUIA 3VJMA 4QEKA 2BCEA 1XRMA 2VT7A 4C01A 1MX1A 4ZRDA 4LHEA 2W22A 2EEPA 1GT6A 4M0MA 5HF6A 2AJBA 3R3ZA 1WB5A 5CXXA 4QDXA 1CV2A 3PI6A 5EHNA 5JZ9A 5ALFA 4QNNA 1A8QA 1LPBB 2OLEA 3D2BA 1B41A 4BC0A 4TGLA 2RIPA 3FSGA 4EY8A 3WL8A 5ALOA 5I8PA 4I19A 4C4XA 1JU4A 2QJWA 1AX9A 5I9IA 1YR2A 3F96A 4FNMA 2XLCA 3HABA 4G4JA 1CUZA 3WKDA 3BF8A 3WYNA 1PV1A 1E89A 4YPVA 1CUSA 2XQGA 1K63A 4AZ3A 2CB9A 3OC0A 3RKSA 1XZIA 5JIBA 3STTA 4KYVA 4M0EA 2OGSA 4WY5A 1QOZA 4Y9SA 5AK5A 2Q0XA 4PW0A 2LIPA 3DKRA 3GFFA 4HS9A 3WK5A 1JJFA 1LNSA 3DLTA 2QUAA 5EIHA 2HA5A 3F8SA 3IUNA 1FFBA 1UKAA 3IUJA 4KAFA 1IVYA 3D5EA 2WJ4A 5JD5A 1C4XA 4FFWA 1XLVA 1BROA 2WHQA 4P92A 2H7XA 2ZYIA 4BYMA 2BGNA 3H2JA 5C8ZA 2FUKA 2ZJ6A 4IO0A 3E4DA 4E15A 3OURA 1J1IA 2B61A 3WWOA 3FYTA 1YAHA 4Q05A 2GZSA 4UBOA 4Q3KA 3F67A 1UFOA 4FLEA 3KDAA 2WILA 4L3WA 3WWDA 5HKBA 1R9NA 3I6MA 3HYSA 1Z68A 1T4MA 4KACA 5A7FA 2E3JA 4IH4A 3W04A 4UBIA 3ICVA 4J7AA 3QYJA 3WKCA 2IX9A 4GDMA 4BZZA 4OPMA 1A88A 1ZIXA 1EK2A 3I2KA 2ROQA 2H1IA 5DLPA 1TCAA 5D7BA 1XZJA 1CUAA 3DYVA 4HZGA 5AKZA 1OCEA 1CQWA 1XZKA 3M83A 2OAEA 4PNZA 3QMMA 1H2XA 5ALKA 1UKCA 3EBLA 4BB0A 4B84A 1BS9A 2PSEA 4F21A 1MNQA 1Y7IA 1HPLA 3B3QA 3G0CA 2CKMA 5T4HA 1EX9A 5T4BA 3JYHA 3W9BA 3LP5A 4UFPA 1G42A 5ISMA 1XZGA 3C8DA 5I7UA 2CBGA 1L7AA 3QMWA 4B6GA 4ROTA 1FSSA 3WKBA 4E14A 1BN6A 4I4CA 4PSCA 2AJLI 4G4GA 3C6BA 1DTEA 3E0XA 3JW8A 3O4IA 3M82A 5JAPA 1G5FA 4MQLA 3CCBA 2ACKA 3GZJA 3V1KA 5K3DA 2O2GA 4BAGA 4BVKA 4N5HX 3QZUA 1DX6A 4LXGA 3I28A 5CH8A 2HA0A 4XX1A 1U4NA 4Y2QA 3DKKA 1KU6A 1NX9A 3WWEA 1HLGA 1LGYA 1DT3A 4GEGA 5ALXA 5JAUA 4KJXA 5ALJA 3FCYA 4P93A 4G4IA 1IMJA 2YH2A 5FPQA 3WQHA 4C4ZA 4KEAA 2JGFA 4GWLA 4N8SA 5AKLA 4FNGA 4H7FA 1SCIA 1ORVA 1QIHA 1SCKA 3HLKA 5DTIA 2XUJA 2GBIA 4DNPA 1X2EA 5BOVA 2XI4A 4MEBA 1WHSA 5F4ZA 1AKNA 2HA3A 1LPNA 1WB6A 4BRZA 1ORWA 1R88A 3RLIA 1WPXA 2JEYA 2OAGA 2O2HA 2P8SA 2BJHA 3WI7A 4W1RA 5AI5A 1CVLA 3IURA 4C87A 4EY4A 2WHPB 1DWQA 1AZWA 3R41A 2OGZA 3G02A 3ANTA 2JIDA 3G7NA 4H7EA 1W4LA 5LKRA 1CUHA 5DNUA 2WQZA 3I2JA 3EF3A 5AM3A 1K5PA 1R1DA 3DL4A 4N8DA 4G8CA 1CUXA 1EDDA 5K5EA 3QH4A 2B4KA 4S0XA 1MAHA 1QIJA 3CN9A 4GLBA 4W1SA 4FTWA 2WKWA 1XRPA 1DQYA 4Y2UA 2VA9A 2ORYA 5A2GA 3VJKA 1UK6A 1XFDA 3C5VA 1QTRA 4JEIA 4IHAA 4DGQA 3ESBA 1WB4A 2DQZA 3IBTA 5LZ4A 4U2BA 1D07A 4W1PA 4BTLA 3WZLA 1A8SA 4U2EA 5EIAA 1FFCA 3D7RA 1XQYA 4B82A 3WJ2A 2QKYA 1UK9A 3WIBA 4DNOA 1N8SA 4OU4A 5JARA 1QO9A 3O0DA 2YASA 4WJLA 5BWCA 1MX5A 4H7KA 3MGAA 4N5IX 4QDUA 1ZD4A 5CT4A 3DYIA 1QFSA 4X95A 1CUJA 3FYUA 5FDFA 2BAGA 2DQYA 2QR5A 4DM7A 5ALNA 3C8HA 3IUQA 1GPNA 1W52X 4FWBA 4FOLA 1CUEA 3H17A 4Y2TA 4K6KA 1H2ZA 5C7YA 1EDBA 1XROA 1DWOA 2HU5A 1L7QA 2J4CA 2WU4A 5IVIA 4BE9A 3FCXA 1UXOA 1LLFA 5ALYA 1VLQA 2VSQA 2WM2A 4CIBA 3SC2A 5LZ2A 3DD5A 1W1IA 1TCCA 3ED1A 5CW2A 5AM5A 2H7CA 2JGMA 2XT0A 3Q8WA 2JGKA 4AMYA 1CUCA 3CCCA 4UBLA 1QIMA 4UHDA 2BGRA 3WIOA 3FBWA 4P08A 2XB6A 2DHEA 1SCQA 3AIOA 5BV7A 4G5XA 3I6ZA 5EFZA 5K3EA 2DFPA 3BDVA 4PO3X 4BAZA 2XUPA 3WMRA 2XMZA 1HQDA 1QTIA 1H23A 2RONA 5AM2A 2OCLA 2PU7A 3PFCA 4QLAA 2VEOA 4E46A 2VJDA 3NOXA 1IUPA 2GYUA 1DU4A 2PL5A 1OILA 2WTNA 1F8UA 2G5TA 4IQ4A 4OYLA 1VOTA 3WZMA 1UK8A 4FHZA 2XUOA 1JMYA 5HF5A 1U2EA 4KAAA 4WDRA 5K3AA 1F6WA 4FLFA 3C6XA 4X7BA 4BZWA 1DQZA 4L9AA 1G66A 5EGNA 3BIWA 2WG2A 1FFDA 1TIBA 3STYA 5AOBA 5FLKA 3HJUA 3SWWA 5EHXA 1H2YA 4AZ0A 3LS2A 3PF9A 3QMVA 5FKJA 4J0CA 5ALQA 2RGUA 4QDTA 2WU3A 5CT6A 3TJMA 3WWPA 2WUDA 2XUKA 2OQVA 1DT5A 3H0CA 3EQ9A 4QWWA 5ALMA 2Y2VA 2GBFA 4G9GA 1RWQA 5AM4A 4K6GA 2ECFA 3T52A 4F60A 2XMSA 2QM0A 4IH9A 3BJMA 2QS9A 4J0GA 4QDOA 3YASA 5K3FB 2GYVA 4K2AA 4KE9A 3K9BA 4NMWA 1TCBA 3WKEA 5HQ3A 5HKAA 2D0DA 3WK9A 2QUBA 3ILSA 2OXEA 1C7IA 3A2NA 2Y2UA 5H3HA 3FWHA 1X2BA 1MJ5A 3KWFA 2Y1KA 2ZYHA 2VJBA 3W06A 5ALEA 2X5XA 4KAJA 3FLBA 1AMNA 3VKFA 3CXUA 4EY7A 3H04A 3RM3A 3D4LA 4Q1VA 5ALSA 5C8XA 1MX9A 4HXEB 2Z8XA 2XE4A 4KE8A 5ALDA 1K4YA 5IKXA 5AI8A 2OQIA 4RPCA 1WPRA 1WCYA 4UFOA 1KEZA 1UT6A 4OB7A 1P0MA 4GXNA 5EIEA 1S8OA 1NU6A 3PF8A 1G4HA 5D6OA 5AKEA 2XMRA 1M33A 3QPCA 4AMZA 1VE7A 3WKAA 4PSUA 5E4YA 2ZJ7A 5AO9A 5K3CA 2V98A 2JBWA 4DMKA 2O2IA 2HL6A 4KE7A 4X93A 5AICA 1UOOA 3R3YA 1ZIYA 1ZOIA 3B5EA 1CUYA 2HA2A 3QVMA 2WFZA 3F9CA 4W1QA 4DMCA 3G0DA 5EHQA 5SYNA 1K8QA 2GBCA 2IITA 1Q0ZA 1FJ2A 2XQKA 4OD0A 3BIXA 4X00A 3UUFA 1EVEA 5ESRA 2R8BA 4EY5A 1YA4A 4J0DA 5CXUA 3WL5A 1R4ZA 2AJ8A 4U2DA 1C7JA 3P2MA 2I3ZA 1T2NA 3EQ7A 3I1IA 5FUMA 2WIJA 5LIPA 5KWIA 3GA7A 5DYWA 3FNBA 2QT9A 2XUIA 5HFAA 4WY8A 5JASA 3AZQA 1YAJA 1BCRA 1RP1A 2G4LA 3IB3A 3ANSA 1N5RA 4QZVA 1CUVA 1W75A 5AP9A 2V9ZA 3N2ZB 3FYUC 2HA6A 3C87A 5DJ5A 2WJ3A 5AKGA 1U8EA 1R3DA 1GQRA 5AI6A 1J2EA 5DTJA 2BUAA 4G9EA 1ZI9A 1L7RA 5LZ9A 1CUBA 1MU0A 1EK1A 3WK7A 3I2HA 2QJRA 3R0VA 5JALA 1EB9A 1VXOA 2VTVA 4BTVA 4I3FA 1QIFA 3C43A 3LIPA 2HHAA 5AI9A 4X3CA 4BBZA 3HI4A 1ACLA 1VZ2A 1EH5A 3LLCA 5E4TA 3C70A 1VXRA 2B9VA 2OPHA 4UBKA 5JD6A 1BEZA 2XDWA 4ZV9A 1GPLA 4MYDA 2HRRA 2PSHA 5A7GA 4UHFA 4Q3OA 2RHWA 1ZD3A 4BCDA 1ZI8A 4XVCA 2OGTA 5AK6A 3G0GA 1BCSA 1LBSA 2QXUA 1KU0A 1GGVA 3H2IA 4E11A 3HC7A 1VE6A 2R11A 3WK8A 3DEAA 4UPDA 1BRTA 2XMGA 5IH7A 4QDZA 4UHEA 5JATA 5FOQA 4CCWA 3KSRA 2QOEA 3M3DA 2EDAA 1XQVA 1N1MA 1VA4A 4UUQA 4LXHA 3STUA 1YASA 1JI3A 1EXWA 4NS4A 5HF8A 4FLMA 3WA7A 5CTAA 1VJ5A 2HA4A 1XZFA 4Q82A 4Y2YA 4Y2XA 1LZLA 4RE5A 3M81A 2AJCA 2QMQA 1UZAA 1XLUA 3AZOA 4O08A 2BUCA 2EDCA 2XUQA 4TVKA 3H19A 5C81A 3T4UA 4G8BA 4DMFA 3WK6A 1VZ3A 4BE4A 2I78A 1J07A 1UWCA 3PDCA 4B83A 1PJAA 2CZQA 1Y7HA 3R3XA 3L1JA 3OG9A 3W9UA 1GZ7A 3ICWA 4B85A 3JWEA 4KR0A 2VF2A 3IVMA 1TKRA 3WK4A 5HZGA 1ODSA 1ACJA 2CMFA 3I6YA 3WWCA 4WDQA 2HU8A 1CLEA 1P0IA 1AC5A 2XLBA 4MYSA 5ALPA 5JD4A 1THGA 5ALTA 2HIHA 3QPDA 1BE0A 3S8YA 3WA6A 2WFLB 1QIEA 3A70A 3G9XA 1TK3A 4A5SA 5CMLA 1F0NA 2WIKA 3KOOA 3IDAA 2PUHA 4DMHA 5KBYA 3QPAA 1XLWA 2OG1A 1FFAA 3PICA 1E8MA 1USWA 5ALHA 4A16A 3H1BA 3O4GA 3E3AA 1H22A 2HADA 3H2GA 4HTAA 3HRHA 4FFVA 1CUDA 4B0PA 4B81A 4OYYA 5JZBA 1W76A 3R3UA 1R50A 4U2GA 1UK7A 5SYMA 1XZAA 3D0KA 3GUUA 3HEAA 5HFNA 1JKMA 3TRDA 1MPXA 4LYEA 5EHZA 4B80A 1QGED 1LPOA 1XZEA 1ZJ5A 5AI0A 5LZ5A 1X70A 3SX4A 2ZJFA 5A6VA 2HDWA 3GROA 3V1NA 4EA6A 5CBKA 1ZD5A 4DTCA 4X71A 4AB1A 4DYHA 2CEKA 1PFQA 2H9YA 1Q0RA 1DWPA 1P0PA 1QIDA 4MJ3A 3R40A 4BRSA 1UOQA 3NUZA 4W9RA 4CG2A 4C89A 3A6ZA 2QVBA 4AQDA 4NZZA 4C6HA 2FX5A 5DNWA 2WUEA 3BL8A 4BC1A 4CG3A 4B9EA 2J3QA 2O7VA 2RHTA 3WJ1A 3FSGD 4YASA 5AOCA 5AHXA 3H18A 4KE6A 4BVJA 5DWDA 4B7ZA 5T4FA 3G9UA 3PUHA 2WG0A 3FVRA 2V96A 4FDMA 4ITVA 3V1MA 4U2FA 2C0QA 4B0OA 2AXEA 4DNQA 1LPPA 1Y37A 4G8DA 3DNMA 2VAXA 4EB0A 4CI9A 4BAUA 1DX4A 1CUFA 3LIIA 3IA2A 4H0CA 5HK8A 1U65A 2QRUA 3AJAA 4J0JA 3OTQA 4UBMA 4YX9A 1XRLA 3DCNA 4OSEA 2JEZA 1XZMA 4LXIA 3NWOA 1SFRA 4CCYA 1XZBA 4BP8A 2C0PA 3V9AA 1E3QA 4X90A 4BDSA 1CUGA 3G9TA 5C8VA 5CH3A 3ZLVA 4EBBA 1AURA 3DOIA 1IZ8A 4FBMA 4H7HA 2GYWA 4DLNA 3K2IA 2X76A 1JFRA 1SOMA 1TRHA 5CT5A 4X6UA 4NVRA 3ESAA 1GKLA 3ZPXA 3E1GA 1NU8A 2PUJA 2G63A 2WIFA 4H7DA 5BWBA 4Y2RA 4J3JA 5ALVA 1XQWA 5AKJA 2C7BA 2QXTA 2RI6A 1J06A 4Y2VA 1WM1A 2C5GA 1E8NA 4LIPD 1JMKC 2VATA 2J4FA 4M0FA 4RGYA 3MVEA 3MUNA 4BP9A 1QIKA 3BXPA 3VISA 2WUGA 1CFJA 3AFIA 3KD2A 3IIIA 3C5WP 5KWJA 1MT3A 3HACA 4UHHA 2PBLA 1LPSA 3O9MA 5AKIA 3PE6A 2YYSA 5AKXA 2Z5GA 3H2KA 4EZIA 3AINA 3I2FA 4OB8A 1EDEA 2WG1A 5JYCA 1EHYA 1XRRA 5LYYA 3DL7A 1XZCA 4G1FA 4JH0A 1VKHA 1EI9A 2W6CX 4QA9A 4EY6A 2OCKA 4X94A 2I03A 4K5QA 1AGYA 2VJCA 3GBSA 2PSJA 1B6GA 2YXPX 4Y2JA 1JJIA 1DINA 2PM8A 3TEJA 4H7JA 1YSCA 2XMBA 3NGMA 2ONCA 4P9NA
chains in the Genus database with same CATH superfamily
2Q3JA 2F8SA 2WYVA 4DWWA 1WZEA 2D4HA 1CEXA 1HF3A 1PK8A 2PANA 2WJWA 3IAM6 3IAUA 4HLCA 4LRTB 3D3WB 4C78A 4ZCQA 1UPBA 5JDCC 2M98A 1VP3A 2VHJA 3T1YB 3OLCX 1YS2X 1UOEA 3AR3A 3NV7A 3IIKA 3I01M 3HKDB 4GECA 4I5GA 3CE6A 3BGVA 4GUAA 3AUYA 1ZI6A 3ZHQA 5EINA 5IEJA 5YASA 5LFAA 4BO1A 2BLNA 4JKYA 1E2HA 1SULA 1X9HA 2YZ7A 3FRIA 3EDMA 3VPSA 3FLEA 3B3FA 4JVOA 1HLFA 2QUHA 4KBFA 3WWYA 4EMTA 1MAAA 5DW0A 2JG3A 4ILKA 1M7BA 2BKLA 2CWWA 2VJQA 4X1KB 1G7CA 4UNIA 2VWPA 1U8XX 4MYRA 2Q3CA 1AS3A 2ZXEA 3AR7A 5B4VA 1W47A 2P11A 3PQEA 3AB8A 3PFBA 4G0MA 1KAQA 4BFLA 3R7LA 1JDBC 1KP3A 2G06A 3K2BA 2C4VA 4X60A 3CJRA 2Y4NA 3C8UA 3IV6A 2PS0A 2DFTA 1YJQA 1GPUA 3BMXA 4MVJP 4R84A 4UD2A 1K5DA 5AK3A 1PQUA 2FJ0A 3ZBPA 3QPVA 2Q1UA 1NVXQ 1Q95A 3PXEA 1JVSA 2QBYA 4JLAA 3MOGA 5FTKA 1EIWA 1HZJA 3VU3A 1OE0A 4PG6A 3IQIX 3K09C 1JA1A 1YBVA 2ILTA 1WUTA 4J6EA 3ESCA 4S3MA 1HX7A 1ESNA 1R0KA 3C2QA 4CR8A 2QRGA 4GZ5A 3SEZA 3E22B 2FFJA 1RT9A 3EOZA 3THRA 4COKA 4TZ0A 3F3YA 3AHGA 3JWPA 3HU5A 4JFAA 4KFSA 4NFSA 5D51S 3U61B 2IUEA 1W5BA 2L18A 3AHDA 3VX3A 3D6TB 4PNEA 1O87A 2JD2A 4GP7A 4JNKA 3INGA 4R98A 3QLUA 5TPWB 1XZQA 5DB4A 2GAJA 3TW8A 3TR6A 1QNFA 7YASA 3A4NA 3ECAA 4WOKA 1XWWA 2XW6A 4Q39A 4KQJA 3H16A 3TKLA 1FFEA 3FLAA 4B6RA 4DCGA 5B1EA 1Y89A 3E9RA 3MOSA 1CIVA 4G25A 3IMGA 4AO8A 3AHCA 5LP1A 4ZAZA 1LY1A 3REOA 4KXWA 3HGMA 4QLOA 3L4BC 5IABA 3QVSA 4C7OA 1E9RA 4YVFA 3L6OO 2X0JA 1ANKA 1ZAYA 3LOPA 1MB2A 2XMDA 4FW9A 3B12A 2OM6A 3WRXC 1CXZA 2BM1A 3WGHA 3Q10A 4LGVA 4OEHA 5FOSA 3FAKA 3R4VA 4PXSA 4CL8A 3QEBZ 1FJGB 2EW2A 4OXRA 4G0ZA 5DYIA 1V45E 2NXNA 2P0EA 3IULA 4YO8A 2GPJA 3RJ5A 5LM3A 1XXHA 4Q7EA 2GJ9A 2AC2A 2PEYA 1XKTA 4NZOA 4CLDA 1C4KA 1RPAA 1SBYA 2W4MA 1X7ZA 3DP9A 4IDGA 1Y0BA 3HPRA 4KVFA 4YCJA 1Q7RA 2RHJA 4YCSA 5HM6A 4QVIA 2PVCA 2FZEA 2J6BA 4U3JB 4JWKA 1Q19A 4XQ9A 3AF3A 1E2EA 3D6HA 1A9XA 1NG9A 1GZ6A 4ITRC 1QJ4A 1ZH8A 3ITDA 3ZHVA 4DR4B 3CZMA 1U2TA 1Z2DA 4URUR 2WMNB 1NDHA 4CM1A 2FZ4A 5ULLA 5C4MA 2WUVA 3OPMA 4FEYA 4X1OA 1FBTA 4KKXB 2A0KA 3A7EA 4KFTA 3NHAA 2DHCA 3QVTA 4PTZA 2AOUB 3B13B 1POWA 3QVKA 4XX0B 2V7BA 4PYLA 4LCBA 4GQAA 2VP5A 2GUWA 4ZQGA 1THMA 3VR4H 2WOJA 4HAYA 1YE8A 1LNQA 4O4IF 5JNTA 4J0HA 4DAOA 2VN8A 2C5AA 3BORA 3GVCA 1ECBA 4GICA 4OVKA 3U62A 1LSUA 4A15A 2ZSDA 3ZC3A 3U7HB 3KQPA 2O5RA 4OM7A 2GQ0A 1L5VA 2ZTMA 5REQA 3RUPA 2UYOA 1RYEA 3NH6A 4MB2A 2JHFA 1HG1A 1NVWQ 2XGSA 4NBVA 1G8HA 5FAKA 1CS4C 4Y7DA 1ZVQA 3UWMA 1OA1A 2IYWA 4GPTA 5CCEA 3ASZA 1BU8A 1SVLA 2FXVA 5JV5A 3MCUA 4J94A 5H5JA 4RVGA 4N49A 3TZEA 1BEEA 3PPIA 4IJ5A 2DECA 2WFAA 3J81k 4OL9A 4ZFNA 1UXJA 1QIGA 4ZAXA 3ZTTA 5TS2A 1M66A 1AHNA 6NULA 2C7VA 3AL3A 3QWFA 2ZJYA 3BAFA 1PUIA 5IN5A 1IBSA 1YZQA 2JIZD 4FOSA 1TKAA 1ESDA 4WQMA 3GUYA 2TMKA 2D2VA 4X91A 2HWYA 221PA 2OV6A 1RHUA 2D5LA 2P6MA 4OYRA 5J59A 3BWCA 2AJDA 1A9SA 1OLSB 3HB5X 1PTJA 3G88A 4BVLA 5FPKA 3TTSA 4ZO8A 4HAIA 1JE0A 1IBKB 1A72A 1YVPA 3LRTA 2DOKA 1U99A 2BUBA 3KJGA 4G1EB 4YUAA 4ZVNA 3L6RA 4HOYA 1RWNA 4RA9B 3CUKA 2WZDA 2QVGA 4ZCTA 1G4AE 3DZHA 1FNSA 3KKEA 4FS8A 1UMBA 4H35A 1QC5A 1O97D 4DNXA 1QV9A 1JHVA 1W9HA 5EXXA 5K1ZA 4WOCA 4Q24A 3WB1A 2HR1A 4M53A 2JLYA 5T41A 3EVEA 4XB1A 4Q3LA 1BVYF 2BM9A 5BSUA 5CXQA 3K1YA 4XW2A 1RJWA 5HZHA 3QNMA 4URZR 2PKWA 5FWXB 2B20A 2B4QA 3LBHA 3OZAA 4L8GA 5FX2A 1ZGBA 1K89A 2KYRA 2WJVA 2PJZA 1G64A 2YVLA 3ICPA 2E87A 3MHPA 2C78A 2GERA 4KW7A 4MITA 3AC0A 1HYEA 5TQJA 4E4TA 4X6XA 3F2VA 3IAHA 3K1TA 2ZI7A 1KGDA 2DU8A 1U7TA 2X8BA 4LBWA 5TEVA 3AW8A 1Y5RA 4KRGA 4LXUA 2EATA 2X5JO 4YHHB 2QYHA 1ODCA 4JI6B 721PA 3DBLA 1RE1A 2JFQA 2XMQA 5KTTA 1ZQ1A 1H42A 2D5AA 3ZX5A 5ILOA 3UATA 4EKIA 1VG8A 1E2QA 2PGOA 1NX6A 3OE1A 4LWOA 4DNFA 1WDMA 4CQMD 1PL8A 3DMYA 2HQRA 2PKRA 1NW6A 4IDEA 5J2UB 3ZOKA 1UBTS 1SVMA 1WP4A 4X8MA 3QVLA 5H3CA 4LF5B 2VL7A 5EZSA 4ZCPA 5J3JA 1IDN1 2P79A 1FSPA 4PQGA 2Y0EA 3RAFC 2L19A 2POCA 3WGYA 2GRJA 3RAPR 3LQKA 1PVVA 3NANA 3Q9NA 1UWKA 1VSVA 2PPLA 2YC2C 2QL9A 2ZYRA 3CONA 1DTSA 3DF9A 3NRBA 4WH0A 3GB9A 3DS8A 3WL7A 3T3DA 3TMKA 4IGIA 1JQJC 1E64A 2G5GX 3LAWA 3PQ7A 2TS1A 2WFMA 4JC4A 1U8FO 4ICIA 4OB6A 5JS2A 4A0RA 2QTBA 3K16A 4WFIA 1QHIA 5FCDA 1HWYA 3VDXA 4DL9A 1O95A 2Y8EA 4HXFB 3OBIA 3WLPA 1NUPA 1RPTA 3NV9A 4BNJA 4P31A 4RZHA 4ZCLA 3KQMA 2B2NA 2EZUA 2BISA 3Q9SA 4IDFA 2PUEA 4ZWNA 4ZOAA 5DGIA 1BW9B 1NFFA 2IX3A 4HGQA 3GC6A 3M6LA 4GMDA 2ZIZA 5BSKA 4UNSA 1OUMA 4NCXA 2GXSA 3FPCA 3B2NA 1ZX1A 4EL5A 5LBTA 4ZA2A 1RWOA 3KLPX 4DXHA 1MG0A 1HQCA 2OC4A 2Q28A 5EMHA 1ZM9A 3H2HA 3FMVA 3PD7A 3GZ4A 3PXDA 4MEAA 2Q3BA 4M7WA 4AO6A 4LZWA 3QVXA 1M10A 4I4TF 1F0YA 2OCIA 3EVDA 4CKBA 3OEEA 5ITVA 2W6PA 4MWTA 3IP8A 3TBKA 1MNAA 1TEVA 2BFDA 2CLOB 2ZYDA 3GRPA 5IBRA 3SR3A 4FBLA 2A58A 3GPLA 4JZKA 1H4TA 4FZ3A 1NNUA 2Q2NA 3EZLA 2QHXA 1RMQA 4X85A 4YJ3A 1M6YA 2B6HA 2NPIA 5IJXA 4W5OA 2DWCA 3I9KA 4IDAA 4EVIA 4QEZA 4ESVA 1JDSA 3AHIA 2R84A 4P0TA 4DR6B 4HEHA 3MQFA 4G63A 2CHQA 5CA0A 1YACA 5L4LA 3OU2A 1TQ4A 1RZUA 1XP5A 1OWPA 3ESDA 6PFKA 2JIRA 1Y6ZA 3LLVA 5CU7A 4A6PA 1UJBA 1R0ZA 1YZKA 3QLJA 4MVJF 3VU9A 4Q0MA 4X97A 5HS6A 2I91A 1L5GB 2JFOA 1FSZA 1C9YA 4ERNA 5KNLA 5T5QA 4AN0A 3WXBA 4M0CA 1ODFA 1M2VB 3I2IA 2FK8A 2JDID 4LXYA 4IS3A 2XBUA 4NBUA 2ZTUA 3S2YA 4NCIA 1Q1QA 1ND5A 5BR4A 2XKAA 2D2EA 2OCGA 2XMPA 1AMUA 2EHJA 2FEWB 4J2HA 3W5JA 4DXAA 1WCXA 1JEQB 121PA 3D59A 5IK2D 1P31A 2AN4A 4OI1A 1WHTA 3R75A 2OUIA 3GLQA 4OLFA 4D9KA 3D7SA 4HNAA 4TTAA 4AG5A 1P60A 3FPBA 1Q17A 2CDAA 5K0GA 3I9MA 3O2QB 2V5AA 1K7YA 4A23A 3KSUA 3K8OE 3PGKA 3H0EA 3FN4A 5JS8A 1CFZA 2DFDA 2QENA 4MKIA 4ZU1X 5G0SA 3OPYI 4RTOA 3UN1A 4RHEA 3BF7A 4BHTA 2QTCA 1DADA 3CG0A 3GNSA 4BDTA 1PL6A 2P65A 2PVSA 2VCHA 3ZVMA 5B7NA 2H4HA 3BVPA 5KOJB 2VZ8A 1YQ9A 4ZVOA 1ENZA 1E0AA 5HNKA 4ZC8A 3S1LA 3VJLA 3WLEA 1ABFA 4QG7A 1KDYA 1PQPA 1I32A 1IHUA 2PU5A 1JG4A 4EF5A 3BUSA 4EM6A 1GNLA 1I6KA 1T9HA 1Y7PA 1EUDB 1QLWA 4MP8A 5CURA 1UWLA 3UUEA 4YYZA 4ZJZA 2A1TR 2Z6UA 1O4VA 5KQGA 1ZGZA 5HCIA 3FY4A 1GIAA 5K0ZA 1WUJS 4LC1A 5E8RA 1ZDMA 2G5PA 5BQXA 4NZYA 2OCPA 2Q5HA 3FMGA 4UNRA 4CUJA 1V8BA 2VDUE 3MB8A 2VJNA 1RTKA 3JQAD 3NM5A 3QELA 1JSRA 2EG5A 3KHTA 4KUHA 4M21A 1NKVA 3MUOA 3V4SA 1KVRA 4H3VA 2ZBRA 4P3OA 3AEQA 2AUMA 3H8WA 5HUQA 2R0QC 4ZT5A 1XRJA 4F5DA 1L4BA 3G2HA 2B5VA 4IFTA 3KTDA 1JIKA 2CF5A 2IIVA 2V74B 4EKDA 3JZAA 3IHLA 4DSOA 1GR0A 5F52A 5JJ5A 2RHBA 1QG2A 1EINA 2X0IA 3A2MA 3OU7A 3G7UA 4A92A 3TI9A 1GTVA 4AN1A 2BKUA 4LZAA 2WHRA 3OIGA 2GCIA 4K3UA 5LMNB 1GKKA 1JDTA 4GSLA 2IVZA 4J03A 2R86A 4R54A 5JCJA 3N2GB 4MQ4A 2QEQA 1YJXA 2HO5A 1YDMA 4S1PA 1NVMB 2O07A 2ZVQX 4ND2A 2QL5A 3V32A 5A4JA 2QG6A 3RKRA 2XRFA 1DC8A 2VYVA 3ODPA 3ESYA 1A77A 3EODA 4HAXA 3WOHA 3F4BA 2VT6A 2WABA 4HZUA 5L4NA 2BDEA 2K5UA 4MJXA 1QBKC 2H6EA 3MSXA 1EM8B 1N1EA 2NZJA 2IYOA 3CV3A 4J4TA 3G3EA 4PGAA 4B2IA 2AF4C 1GTMA 2MSWA 2J3HA 1GGHA 2EFEB 4Q1DA 1OVGA 1QKIA 4UHJA 2QE6A 4UVDA 3G89A 4QPJC 3BDIA 2PX6A 1K8YB 3G82C 3ZWCA 3MLBA 3A6FA 2XVXA 3FTNA 2HK8A 2JKVA 3I9NA 3ZDFA 4ENUA 1XDWA 2VF7A 4EX6A 5JAOA 1W87A 3E2IA 5U9CA 5B7QA 4U7WA 4IF4A 1KXZA 1I7PA 4JD5A 3S2ZA 3F97A 1GYPA 2OBLA 4IZHA 4BMNA 3UPTA 1PZFA 3D3NA 1MPTA 1O96A 2GN9A 3DDOA 5KX5B 4TMTA 1P8JA 3RS8A 1A5ZA 1JHAA 1SIUA 4R8SA 3U44A 2H4ZA 4R31A 2I2DA 3TUZC 3HXKA 4H16A 1JPVA 3F6YA 2OZEA 5HKLA 3V6LA 4ARZB 2CL0X 3V3KA 4DIUA 4EBFA 5HOQA 3DBHB 4WFKA 3GVHA 3N76A 3AKEA 1UM8A 3AFGA 2P3LA 4B3DA 3L8ZA 3RYHA 1AOXA 5BSFA 3RS2A 1V48A 4JJ6A 4TLCA 1JWAB 5HP4A 3IT2A 3RSCA 4JYCA 1MJNA 1BQEA 2YMQA 3CLRC 2Y6VA 3IODA 2XXJA 5LLSA 3FZNA 5DHAA 3DMGA 1P1HA 2FWPA 5A05A 1U7DA 2GDZA 1JXQA 3CEAA 4Q3AA 3TH5A 3STVA 3DEYX 4Z3KA 5EUCA 4QOEA 3HCCA 1LKZA 2AUNA 1PX2A 3X2EA 3SC4A 5EZQA 1P80A 2HNKA 3OPQA 2IC5A 3KTAB 5AOAA 4BX0A 4G67A 3EG9B 2PLFA 4OJYA 4WK2B 5FTJA 2DWUA 1NPTO 4AU1A 4LOJA 3RS7A 4D9HA 1DQSA 2IZ7A 3FUWA 2Q5FA 3PA6A 4G5SA 4K1LA 4OGLA 4A2PA 5FLXA 3DTNA 2X77A 4P7GA 2AZMA 1U0HC 1VRCA 4OFWA 3ZY6A 3WS7A 4CQNA 3L6BA 1EFDN 1L5OA 4II7A 3K6KA 2X0DA 1TD9A 4JV5B 1Q2XA 1X42A 1BIFA 3A26A 3G17A 1KWGA 1SUCA 4NAVA 2VJAA 3FR7A 1ZESA 4HTFA 3A9VA 4MWSA 3WYEA 4F2HA 3GQBA 1S96A 1TU4A 3EIOA 3TTYA 2IEGA 2Q4TA 4C6SA 1Z2EA 2P5SA 1O5IA 3IYLW 4WVLA 2VRNA 1M34A 3O84A 4U2CA 3JQCA 1T9GR 1BWPA 2R48A 5HBGA 3MMNA 1KFCB 2J3KA 2OVBA 2ZEJA 4NCHA 5CLLA 1AUOA 1XL1A 2JJ1A 3VO2A 2V4MA 3ZZTA 1DAOA 2C9YA 2HFKA 4RKYA 4B3XA 3D2AA 3QQ5A 5EWMB 2B4RO 2CLFB 4NHOA 2WNHA 4TL9A 4Y98A 3R3SA 4CIAA 5B1IA 2R1ZA 2Y66A 1T9GS 5DRYA 4OQDA 3F6BX 5F4BA 2FP3A 5LZ8A 4KNWA 2YW2A 4M46A 3WX0A 1MOZA 1Z4JA 3GX1A 2V3VA 1CJSA 1RWKA 3CE9A 2O1WA 4QBFA 3QITA 1NR1A 3X1WA 2Z3WA 3E9NA 1M1ZA 4RZQA 1ZVVA 2QSZA 1W0KA 2I6GA 2WAOA 4BMDA 3IMEA 4V0MA 3RADC 1UH5A 5EEHA 4D45A 5KX5F 4QJIA 4JC8A 3GELA 2P2YA 1OX6A 3AIIA 2R7MA 4K40A 2I22A 2WYIA 5KSZA 2ORVA 2PGAA 5IXYA 3FKJA 2DEUA 1LX6A 3DCIA 4CL3A 3HCWA 4R9UC 3INNA 2RH9B 4GGOA 3OY2A 4AUKA 1HL3A 3OKAA 1WBBA 4LZZA 3B20A 1KK3A 4RIFA 4NZ9A 5IVHA 3DO5A 4BBJA 2WF7A 2X41A 1BOOA 3GUHA 1SVUA 3TLKA 3N6RA 3RG2A 1TL7C 3JXEA 5AJHA 1CT9A 2NW6A 2LVBA 3GT0A 5A3SA 1DSSG 1E4VA 3CN7A 1Q3TA 4KLZA 1C0IA 3O73A 4TPKA 3U1VA 1RQXA 1SQFA 3KV3O 5DP2A 1XMQB 3ZJUA 1QZUA 4KXFB 1NM5C 3FNFA 3GVIA 3W3AA 3TRIA 4C05A 1FW8A 4MARA 2EYUA 4JI2B 2IYFA 5CCDA 2YC4C 4GD3Q 4I08A 4Q4JA 3TBHA 2O0HA 5C31A 1FNNA 3G7SA 4DG8A 4NG4A 5CEJA 2XT6A 4S35A 4CLHA 5A71A 4C20A 4HYYA 1HURA 6YASA 1GSIA 2DHDA 4GP6A 4BIMA 1AKYA 2XUAA 5I4CA 3U4HA 3EIXA 5DV9A 4LDZA 2X7JA 3QVVA 4Y2SA 1J49A 1XX6A 4PG4A 4EHBA 3R0XA 1NSFA 1U7OA 5ITZB 4BMZA 5KTSA 3THYB 3U39A 4JUIA 3VJMA 3S2IA 1PS9A 2GI4A 4QEKA 2BCEA 1XRMA 1X1BA 1QJCA 3ZV3A 5EKDA 1KMNA 2JJYA 3I42A 3RASA 5I47A 1C3OB 2HSZA 4E6PA 3VPCA 5KAMA 3NBZC 1H65A 4FM9A 1PT9A 2FETA 3CBGA 1SVSA 2JAPA 4PBSA 4RKWA 4BQEA 1FDVA 1TVKA 2FZ5A 4DJDC 2ZB3A 1K92A 1UADA 3IUPA 5CXXA 4QUDA 3AXTA 4U9HS 5IJZA 1ABBA 2ZYGA 4W7IA 4YMHA 4V0KA 1B7GO 4ODIA 5K4AA 1NRXA 2H16A 1VJCA 1EA7A 2ANCA 2P7IA 4LEIA 5DTRA 3T3EA 4BLSA 5L3QB 3ZD7A 1Z25A 1L3BA 2I7DA 2F8MA 3W78A 2B8NA 4HLQB 2HC9A 5EJ2A 2XYQA 4PX9A 1J8VA 4ZODA 1BKYA 2P3OA 1WULS 3BTUA 1O9GA 4JJGA 8GPBA 1ESEA 2H8GA 5JMOA 4A8JC 5I8PA 1XDSA 4UUOA 4PC7A 1Y6RA 1VBMA 2C2YA 5FF9A 3ZK7A 5IDQA 3G1WA 1ZISA 4XIYA 4AURA 3D7LA 5AHKA 1AX9A 3IOEA 2HYIC 1P7WA 1E3TA 3DAOA 1HDOA 2BFFB 4P86A 4CKWA 4AG6A 1YR2A 1F2UB 2GB4A 4WZBE 1KARA 1WU7A 4HEQA 1US8B 2JK0A 3F96A 4YNBA 2ZB8A 2C2OA 3D8HA 3W2FA 2XLCA 1ODJA 3N2EA 1G5HA 1Q6ZA 2C2BA 3OX4A 4XFKA 1HYQA 1KDPA 4GH5A 1I2CA 1ZEJA 4YT5A 1GLVA 3SLGA 2EFDB 1AM4D 2HD4A 2A9VA 5JLAA 1WWKA 2IZOA 4B5KA 1T5IA 3FKSA 4FYKA 3NORA 4AP5A 3A3NA 4IGFA 3SG0A 4CV2A 1CUSA 2PEZA 3H2BA 2P90A 4KDEA 4UVHA 2FMTA 1L4UA 4HDSB 4AZ3A 1AHPA 2B7CA 2XCOA 2CB9A 3AJDA 1ULSA 2J46A 1MXHA 1GEGA 4KXVA 3CX6A 3TEMA 2N9UA 2ZGVA 4IG4A 3ABSB 1KY4A 3FGPA 3HUTA 3KXLA 4DA0A 4DY4A 4E7OA 3DV0A 4JBXA 5FD8A 3STTA 4CM8A 1W35A 3LHFA 4KYVA 4V24A 3KQTA 1KQFA 4WY5A 5JYBA 1OXVA 1G55A 3PP8A 3FPSA 3MJRA 4PAMA 4U6NA 1NULA 4PW0A 2LIPA 3DKRA 2MYUA 3GFFA 3DMTC 3HBLA 3K4PA 4HS9A 4IIJA 3WK5A 2HNAA 4BVEA 1JJFA 2O0MA 3VVBA 2PMFA 2QUAA 1CF9A 4J9VA 4F93B 2WINI 3T12A 1GDHA 3PEWA 1N0WA 2IYYA 2W2LD 3IERA 3STHA 4U7GA 3HN2A 2COKA 3F8SA 1KFJB 4KNVA 4A82A 1H3NA 1UKAA 1GQYA 2VO1A 1F1BA 5DHPA 5AUOB 5KYXA 3RRYA 4KIWA 1IVYA 4II2A 4ZVRA 5DNCA 3FSEA 1OZAA 4E32A 1ZKDA 4OAOA 5B55A 1C4XA 1SVWA 3ZW9A 1PFYA 1XLVA 4RY8A 2HHCA 2RKWA 3AY7A 3SOZA 4XCVA 1HT2E 4BX8A 4DV7B 5FUQA 5BSRA 2BP7B 1UP6A 3UAZA 2A7XA 2DUWA 2BGNA 3W1EA 4AJEA 2WSIA 4P2BA 4BLTA 3UT5A 1TYEB 4KX3A 5F64A 5JO9A 2A35A 1RXYA 4B3CA 2FUKA 1N0VC 3ZE7A 1NI3A 4XLZA 2ZJ6A 3Q5EA 3L4JA 3BMOA 2Z43A 5F9FA 3B48A 5CX1B 3TPZA 2XCSB 1JEEA 1Y82A 3E4DA 3OURA 2B61A 4RIHA 1L6RA 2NOAA 3FYTA 3OOWA 4Q05A 4GI3A 4FYWA 2UZIR 2GZSA 4R5MA 1IULA 4A0FA 4DJ5X 4UBOA 4BQNA 4BMOB 2PLNA 5I7OA 4XPIA 1DPGA 1YOVA 1S2GA 4KXUA 3Q9UA 5JUWA 2VH1A 2QLFA 4RZXA 2AYYA 1P2SA 3HY6A 3TW4A 1JQLB 3L0ZA 3LOQA 4I9UA 1P18A 3Q3EA 1DAFA 2F67A 3GJ8A 3JRNA 1L5YA 2G72A 3A1EA 3ZVKA 2V9PA 1M8FA 1T4MA 3T34A 3GNLA 2CJWB 3MTBA 2JAHA 2OO3A 5D2CA 4TT3A 3GXBA 3HA7A 4LYFA 4IUDS 3SC3A 3COYA 5CHYA 3VR3A 2OHOA 3B3AA 1FTWA 4M1YA 4UBIA 1UPAA 4GG1A 3V5NA 3RBAA 1KSFX 4M1KA 2XTAA 2IX9A 4FE4A 4PFJA 4JT8A 4YDHB 4GDMA 3ZU4A 3AVVA 1BO6A 3H84A 4C2AA 5JMWA 3BL5A 1T4DA 1IEQA 2H2WA 3K0CC 4B3TB 2H4FA 5EIBD 1A88A 1P1JA 4N0PA 1ZIXA 2LBPA 1NE7A 1EK2A 4C5AA 4XWKA 3H5IA 1M6VB 1DAHA 1V4VA 3HCDA 1A69A 3MK31 5D7NA 2OILA 1T4GA 3ZE0B 2KBFA 1Z07A 1FP6A 3HHEA 4LZPA 1BX3A 2WAYA 3FFWA 2FFBA 3FGZA 1V39A 3JSXA 3ZWWA 1XZJA 4QARA 4UUMA 5LOVB 1FZQA 2W2PA 4MW4A 2HT1A 4J7UA 4MO9A 1U8YA 2V58A 3QMMA 4PNZA 1H2XA 3EPRA 2O2JA 1DKQA 4CT5A 1VJGA 1J8DA 2XIQA 4J4BA 1H8EA 5DK6A 3ZGLA 4FWTA 1MNQA 3LVRE 2Q7DA 4N47A 3L7CA 1JA0A 1Y7IA 3VSAA 5IYZA 3NBUA 1Y34E 3UJ8A 4DIMA 3AVYA 3G0CA 5B37A 3WK4A 2WAMA 2CKMA 3OT5A 3ZDAA 3G1UA 3L84A 2O48X 3ZD9A 3EPLA 4R7GA 5LQAA 1BD4A 4I55B 2Y93A 4D1YA 1I01A 3JAKB 3LMKA 4IXTA 4YEDA 2WSSD 5ISMA 4UASA 1XEXA 2X4DA 4G85A 3QPWA 4IKOA 1Q74A 5CJJA 3I37X 3JZIA 3HBNA 3KYBA 1U1GA 4X84A 5EE9A 3U31A 4BKMA 5I3ZA 5GGYA 5I7UA 5KJ1A 4QJBA 3W5VA 4B6GA 4CQLA 4RA6A 4ROTA 3MM4A 4LMPA 3OMXA 4KFCA 5BOSA 4AG3A 4FFNA 4IIEA 2FV8A 5EJ7A 1AVTA 1BN6A 4KXXA 1PR0A 4PSCA 1ODKA 2AJLI 2WD7B 4V0LA 3HBAA 1DTEA 4M9RA 4XQGA 4FMBB 1L8LA 1DAGA 1A7JA 2J8ZA 1Y9EA 3JATB 4I50A 3JWIA 1AO3A 2AS0A 4YRBA 1RQLA 1EEHA 1GXSB 3O4IA 2QVCA 3EXFA 3TSAA 5IASA 1VKOA 1PL7A 5FWYB 1DJMA 3WHIA 4I66A 3UV3A 4CUKA 1JWLA 4MQLA 4KPUA 1M2OB 3L8YA 3UFXB 1WETA 3ZU2A 3CCBA 1SVIA 3QWBA 3RU7A 3T3MB 2ACKA 3X1DA 4YDSA 1V2GA 2VDWA 3WMWA 4CEIB 2CDCA 4H0FA 1X1SA 4ENVA 3QZUA 5I7AA 4ABYA 1I94B 4RD3A 3TQRA 2OYSA 1WV0A 3H9BA 4LXGA 2BHSA 5CH8A 3OFKA 1FFXB 1YI8A 4R1TA 3N5KA 1TQ6A 4JUCA 5ICSA 1B0ZA 1TI7A 2H29A 3GI1A 1FZTA 3N0RA 3P9NA 1T0PA 1CP3A 3QLEA 1KU6A 1NX9A 2FZKA 3E7PA 4ZCIA 4HEA1 5BVGB 3IDSA 3IO5A 1CZOA 2Y4OA 5LOVF 5ALXA 3OF5A 4PHHA 3DEIA 1DPFA 2GAOA 3E23A 4CMKA 4MQ6A 5IDWA 1V11A 3GGGA 4Z9YA 1Z6AA 4PN7A 5CBPB 5JI2E 3WSTA 3COVA 3C7CB 3OO0A 2X13A 2B4YA 3Q6MA 2OV1A 4GI5A 1RFLA 2QYOA 4DFDA 2IYAA 2JAUA 3LUCA 2ERCA 2YH2A 3ANNA 1P2TA 2V6FA 1JLLA 3EMBA 4JVNA 3V4PB 2IUFA 3ZVLA 3ZZNA 2YVKA 3TX2A 4OA5A 2X2PA 4V0OA 4C4ZA 2GYYA 4GWLA 1M2GA 3ZIUA 4N8SA 1F4LA 4RFVA 5KVSA 4RTNA 3IT1A 1CVRA 4UQOA 2C5EA 5B1DA 4NCJA 3U7JA 3EXHB 2NG1A 3I64A 2X9LA 3FRJA 4MUEA 4EHKA 3RK0A 1X8JA 1KK0A 1PWHA 3KV1A 4PSAA 5DTIA 5KHLB 4DCVA 4PVCA 3I12A 3RHSA 2XUJA 1KZ7B 4NU6A 1Y8RB 2PZJA 2XY4A 2CV2A 4CMIB 2BFOA 1X2EA 2QUIA 2UAGA 1N57A 2YRXA 3WNCA 1O7JA 5BSVA 1YHYA 5ENVA 1VC2A 5F4ZA 4ZEXA 3CNNA 2FDRA 4UARA 1WB6A 3OJ0A 1JEDA 3CT6A 2XYGA 2RB4A 1REQA 1X86B 4LOKA 4P4GA 1ORWA 1R88A 3DO6A 4YJ2A 5AUPB 3CX8A 1IZZA 2BM8A 5A4MS 2CLLB 4FOPA 4E12A 4ZJYA 4S05A 5DHTA 3CIOA 3C1AA 5HZKA 1Z4MA 1HEYA 3AKDA 3EJ6A 5CNJA 4MRMB 4C76A 4EW6A 4W1RA 3O4VA 1CVLA 4FCWA 3OE4A 4Q7JB 4C87A 4YMWA 2PKCA 1HDIA 3BXHA 4XUEA 2CK3A 3BE4A 3ETCA 4Q4HB 1U2GA 3QLTA 1I4EB 4HCJA 1JNXX 2A5YB 3BWBA 3R41A 1XQ9A 3DV2A 4TOIA 2OGZA 5EGSA 2NU8B 4ZEVA 1MVLA 2VQEB 1SPBS 1RIIA 3MT8A 1C14A 3QF7A 1S2DA 2E6KA 5E6SA 4H7EA 4Z6KA 2QW1A 5LKRA 4FYYA 5GOZA 2NU6B 2PH1A 4YIKA 5T6BA 4HX5A 2NYVA 4NIMA 5BXQC 1HY3A 1MX3A 2M2IA 2AI3A 4QHYA 3OQ1A 2NUTA 5AM3A 5BWOA 4YRJA 4AWXA 1BMFD 4RENA 1K5PA 1AKRA 1L4LA 1R1DA 2J08A 4K9MA 4G36A 4TRMA 4QVKA 4B6PA 1RRCA 3IT0A 1KJ9A 2P7HA 2ZPAA 3CNQS 1KE1A 1MAUA 1XQ1A 4LNAA 2AXPA 2HMWA 4N7JA 1OZGA 2BI4A 4Y1FA 1HYBA 1UDRA 1EDDA 2VF5X 4JL6A 5HIMA 5J43A 2IW3A 3TJZA 5GVSA 5GVRA 3KZMA 3FKQA 4Q6BA 4RTPA 3TCNA 2PQ0A 1S9HA 2X9NA 1HFEL 1HDYA 1T5LA 3CN9A 4M37A 1FX0B 1Q3HA 4GLBA 4PPYA 3TW6A 1Z7YA 3PYMA 1G2QA 1XF9A 5EJAA 1K0FA 1Q0UA 2WKWA 1XRPA 1C8VB 1KO7A 1SHUX 3O75A 4HGYA 2WWTA 4KODA 4OHMA 4TRJA 4ZP1A 5JMPA 2ORYA 1YFLA 3H97A 4PY2A 4JR2A 3PCTA 1SHLA 1T36A 4ZV4A 3GT3A 3OOHA 3IJRA 1RACA 2IWRA 3ZU3A 5KO2A 4DM4A 2W4QA 3EFHA 5A2GA 3QTTA 3O8NA 2Q41A 5BRAA 4OGWA 3RIEA 3W9YA 4HNSA 1KC3A 4EG4A 1KO1A 3RVLA 3ETLA 2RKBA 4GC9A 3C5VA 5CK5A 1A98A 4AP6A 3ND5A 2HMVA 1K3UB 2DQSA 5CNIA 4TWIA 2EJVA 3Q98A 1RJ9A 2W6IA 1ZH6A 3K4QA 4KHZA 5GWXA 3ZGXA 1VCIA 2P1DA 4Z3OA 2BFBA 3I9JA 1PD1A 4GMKA 4O8CA 1JQ5A 3R8CA 4DCTA 3PPWA 3U60B 4H0NA 1DO0A 3QUAA 1I2ZA 1A82A 3RS5A 1D07A 2BHTA 3DE5X 3ISJA 4W1PA 1T6YA 2FP4A 2X4GA 2B7LA 3KALA 1JS1X 3ST7A 3WZLA 1A9QA 4U7HA 4BTLA 1Z33A 2OKGA 3VR2D 1PZEA 3L0SA 4U2EA 1V6SA 1L7NA 1LTKA 3DVAB 3QG5A 2WJGA 1SU8A 2B3TA 2QF7A 4IGKA 1FFCA 4YHBA 4YRRA 1XBTA 1XQYA 5GGXA 1C30A 2MINA 1NY6A 1H3EA 1BJTA 3E5RA 1SA0A 4Y1RA 1UK9A 3PC7A 1ENPA 4XEHA 3PWKA 2VSFA 4CZ2A 5CDHA 1NBWB 1DOHA 3D1JA 1H6DA 2I7CA 3GFQA 4KXMA 5DHFA 1OREA 4MV8A 4EHHA 5BQFA 4RDCA 2NWQA 1MX5A 1NNLA 4POOA 2X8WA 2O6HA 4FT4A 1QZTA 2O8DB 3DC2A 1XFAA 1ZD4A 2GN8A 1FQWA 1E1RA 1ZJZA 2CSUA 4DCNA 3IPRA 3NWEA 4Q9KA 3OKFA 4YGXB 3M4NA 2OV8A 4ZVSA 2BAGA 4BMPB 1USVA 2QRVA 3R7SA 3N2KA 5ALNA 3C8HA 4GX2A 4E3ZA 1ATZA 3DOUA 3SI7A 4YT2A 1BD3A 3SNKA 3O21A 4RANA 2GNOA 4YRMA 4JB8A 1ICEA 4FOLA 1CUEA 4GWKA 2X8AA 4JJ4A 1NUUA 3EIHA 4WAUA 3R7BA 3H17A 3NHKA 3S29A 1H2ZA 3MERA 1NXOA 5C7YA 2H5LA 4DLRA 2QW0X 1O08A 3MCZA 3CFYA 3MYRA 1VPLA 1CNMA 1KA9H 2W6MA 3LY5A 4MVJE 5BW6B 1DIRA 2QQFA 1IHYA 2R68A 1J2TA 3I0NA 3C5EA 1LLFA 3UGKA 4AKSA 4EFDA 2VSQA 3WL4A 4EMBA 2HGZA 1Z12A 1JEOA 4DBLC 2JHPA 1W581 3GVXA 3R5SA 1BDMA 4ZQBA 1BDHA 1TO6A 3DD5A 1M1NA 1TCCA 1W1IA 3ED1A 3HR8A 3LO8A 2HIMA 1M5TA 1RPJA 2P2LA 2H7CA 4KO8A 4ZHQB 5JAZA 2VDLB 2G3YA 4GOND 4TV8A 3LUAA 2XT0A 3NVAA 4MDYA 4WLOA 4E2FA 2JGKA 3BRWD 3ESZA 1TEHA 4LBVA 1EJ0A 1MEOA 1L4FA 5HYVA 5K8TA 3RVKA 2AR7A 3QLVC 3DR5A 5E1BA 1NTOA 3RSHA 2Q5OA 4OQMA 4F71A 1XNRB 3W5CA 1Z06A 4RK4A 4ABTA 1SCUA 1T4BA 3BMQB 2PZBA 4CDRA 4RXTA 2FCRA 4GR5A 2R3SA 5EFZA 3ZJ5A 2P9EA 1U4SA 3AM4A 3MTAA 5IKOA 1H0HA 2DFPA 2GEBA 5DPMA 4UEKA 1YJ8A 5IXJA 3ECSA 1X7WA 4JHLA 4R2HA 5CVUA 1AV7A 3BE6A 1NA5A 3AEYA 2Y1EA 1HNXB 4IOKA 4FGWA 2XUPA 4AZTA 1GGJA 4BAZA 4MHOA 1HQDA 1DB3A 4FQ5A 1AK1A 4LY9A 4WWHA 2EKLA 2WTAA 1GPMA 3UMSA 2PU7A 2JH3A 2BGIA 1OAKA 4KSYA 3VX4A 1ZD1A 3G5AA 2VEOA 5TJHA 3FMOB 4N48A 2RH5A 3WDSA 3PR2B 4NCBA 4HUJA 1B15A 4JKIA 4OA8A 2BEWA 2F3UA 2O5CA 2GHQA 5KUTA 3D7KA 5TPZA 4Y1GA 3LC7O 4X7PA 4KOEC 1NI4A 3TSCA 4OYLA 2G5TA 2NO7A 4MGKR 1PYDA 3OA0A 3NOOA 3WZMA 1T43A 1XNJA 3SZMA 3EMVA 4RXUA 4XGRA 4H1UA 2RHDA 3GLSA 5C0OE 4CL0A 4FXOA 1IJFA 3LNTA 5A3QA 1V1MB 2G4CA 3GJXC 1UZMA 4Z0HO 4X3PA 1GRRA 5I7FA 4R51A 4OG2A 4RK7A 1F6WA 1IM8A 1I4TD 4MKFA 1G2IA 4FLFA 2I6TA 3WB2A 3ZLJA 1ZOPA 1D6MA 1E9SA 3F73A 2Q5LA 1UPXA 3W9SA 4MVWA 5TVGA 2DUNA 1E2LA 4A7PA 5AXCA 4FMDB 4M60A 2ZRDA 4HWGA 1KI3A 4R1UA 3U17A 1ZNZA 3I9FA 3VZBA 2E4UA 1WZNA 1NRIA 3HKBA 1HQKA 4XPZA 4L8FA 1LQ2A 2I9PA 5FLKA 3TSYA 3KQYA 3EEIA 3WMEA 1I3MA 4EYEA 3PKIA 2PMKA 4OBBA 4ZHQF 4CMEC 2GPAA 2W2KB 2SKCA 2DUJA 3UAOA 3ANYB 5K6AC 4PCLA 3BD7A 3NHBA 3OUTA 4GIBA 4X61A 5M04A 1OI3A 2BBTA 5FBKA 5JSZB 2ZUTA 4J9UE 4QDTA 3VC1A 4WCDA 4I99A 2WU3A 2ZREA 3I9V1 1XR3A 3WAGA 3ONDA 2AUTA 4HVAA 2Y05A 4IICA 3OY7A 2NTVA 1R6TA 1P72A 4TM7A 1UT5A 1J42A 2VK1A 3LWBA 5SV2A 3ZTWA 2Q3FA 1H4SA 1LLQA 2QK4A 5LBUA 1RQNA 5H9WA 3VKWA 2JLRA 3EQ9A 3N7TA 8OHMA 2Y2VA 2GBFA 2YWFA 4HRVA 1NBIA 1DKLA 3FUTA 4ENQA 3FB4A 5T67A 2ZOSA 4N3AA 2IIQA 4X20A 3IXMA 2FRVA 5D86A 1EEXB 3RT7A 3U5TA 4PYMA 3L0YA 3IP1A 3KYCB 3IPAA 1TFUA 2O2CA 4LYJA 4L5BA 4WINA 3JQ9C 2X14A 3EMDA 3NDJA 1NPYA 4A9AA 3NHPA 1N3LA 2QS9A 1E2PA 3KELA 3UMYA 3AK4A 5K3FB 4B79A 5LDHA 4ZYYA 1Z8DA 3CO5A 1G1MA 3KPVA 2Q49A 2AEFA 5FFFA 3WO1A 2F1RA 3G5UA 2ZIGA 2N1MA 3SU8A 4FR5A 4HEA6 3AP3A 5B57C 5HQ3A 4G41A 1ACMA 4UOEA 2VRWA 3M6IA 1Y4SA 1P7YA 1U5BB 1V1JA 2R1VB 4ZQCB 3MJFA 2UZAA 4X54A 2QUBA 1QDUA 4RK1A 1YVRA 3AUFA 3ILSA 2C9BA 2X22A 3CSSA 1SD2A 1Y1SA 4HDRB 1H66A 2LR0A 3WTCA 2OXEA 1C7IA 2Q4RA 2AN9A 2R66A 2PO5A 3BMNA 3FRHA 2G25A 3M2PA 2ZRAA 1UKVY 3A2NA 1Q1ZA 4HGRA 2QN6A 4M1ZA 2H54A 1NV9A 1TT5A 3H86A 4JYAB 5H3HA 2D0PB 3HKEA 3FWHA 4IILA 4AFNA 1NN5A 1YQGA 3AY0A 1J99A 1ES9A 3A1WA 3WTBA 1K1EA 1MQ9A 2DT8A 3GUVA 4WOJA 2G9UA 1UM9B 4Y30A 2ZULA 4FMDF 1M0EA 1FX1A 4J3FA 4TVOA 4GR9A 2HMTA 4YLYA 4X41A 1V9LA 3FB1A 4KAJA 3FLBA 3VKFA 1K6MA 3CXUA 3OIUA 4JBGA 3LZ6A 3RM3A 5CFNA 3D4LA 4ZQFA 1GZ4A 4Q1VA 4DV0B 4LC0A 5ALSA 1YI0A 1YNSA 3V7FA 2CHEA 3GLIB 2XE4A 4KE8A 4UE6A 3HJBA 3MIIA 1PJSA 4P34A 4UMEA 1UDCA 2QX7A 4TQUS 1AS0A 1W5EA 2JBAA 2W58A 3R24A 1OW3B 2NPOA 2PAFA 5G0WA 1RAFA 1I8TA 4BNKA 4I4NA 3N0VA 4LSZA 4PBTA 1SEPA 2WVJA 1S4MA 5EKTA 4BOYA 3QE4A 1VSUA 1O9HA 3LPNA 4RPHA 4UFOA 5LQUA 1GVNB 2ATCA 2PG3A 3Q3HA 4LF9B 4KQEA 3GGSA 3IE1A 2BGKA 3H3XA 4GXNA 5BRNA 2BLLA 2PBFA 3D4BA 3QYFA 5JSKA 3ACCA 4D5GA 1PR5A 5BWLA 2DUUA 4ND3A 1H8HD 3UH1A 3L0DA 2GZ1A 3QFHA 3TRKA 1ZN8A 4TSKA 2AX4A 2XMRA 4K05A 4MUMA 4C06A 2X9GA 3WKAA 4UXHA 2VTBA 1VIDA 4M54A 1T5BA 2YWJA 2R1UA 4BP1A 2ZJ7A 5K3CA 3VOBA 2V98A 4JLKA 4AROA 3QOXA 2NP7A 3O3NB 4F8YA 4EYOA 2O2IA 3SJ7A 2E4ZA 4KLCA 3ET4A 2HEIA 1UOOA 1NLMA 3L7MA 3VR6A 4Q3EA 1U98A 1JFLA 1ZIYA 2F9LA 3B5EA 5G4KA 4PX5A 4YO7A 1QYWA 3D5TA 2XDAA 1F60A 1YVUA 5BQOA 2B4TO 3HADA 1FK8A 1TU0A 2E6UX 1T5HX 2IZ6A 2Y1OA 2ZR8A 1WW2A 2QGNA 2HAEA 4UEJA 1CJUC 5ECDA 3ZCVA 4E31A 3G0DA 3NEAA 3SS7X 2O8FA 3KKOA 3FZQA 3HZZA 5CHEA 4J3NA 4JDPA 4YBZA 4JP5A 2B21A 3WLFA 2QTRA 1GCUA 2C5HA 2IDMA 2OEPA 2HHJA 3C6QA 2IITA 4KQ9A 1YDGA 3P19A 4HH4A 1TQ2A 1U9ZA 1DXQA 2FZGA 1IJBA 4HDMB 2NYAA 4N65A 3TBFA 3F49S 3CLTC 1J7JA 4BZXA 1SUPA 1TW3A 2J31A 4D3DA 2Q6LA 1HSOA 4L7QA 4Z0NA 3LHDA 4KVGA 3UUFA 1EVEA 1NXSA 1RWBA 1UFQA 5KB3A 2A92A 1FRVA 2JFVA 3VYWA 2CMHA 5AYVA 3JARA 2Z6QA 3WL5A 2XVMA 1L8OA 1R4ZA 1RXWA 1AXGA 1CS0B 1H2HA 5I8ZA 3P2MA 4MS1B 3MHTA 1F7UA 5D01A 2JNWA 3TQCA 1ECJA 4LQDA 3D1VA 4ZYTA 3EQ7A 3RVMA 2WTEA 2J45A 4OF4A 3MWEB 2CV1A 3HL0A 2GZAA 1B16A 1SN7A 2C4TA 2M9MA 4G5GA 1FXUA 1O95D 2AWNA 3L8DA 3KRTA 1Q57A 1N9KA 2JFNA 4P7FA 2VBGA 3OD5A 4DCSA 1IOVA 3HP4A 3WNQA 2EKDA 2ZTLA 2FHSA 1CRWG 1WSBA 2KB0A 3PEEA 4P1ZA 1IN5A 3NTVA 1IHPA 3JCZA 1QP4A 1XO1A 3IELA 3PPVA 1TM5E 4DRXB 4HS4A 2Q6IA 1GUZA 4MWCA 4WXEA 3ZGOA 1MJGM 1LJLA 1RP1A 2DWPA 2G4LA 2IYPA 2A7QA 2X3FA 4G65A 4P22A 5JNLA 1JEYA 3EPPA 2OOSA 3ADOA 1LRKA 3L77A 4NH0A 2Y0CA 3KZOA 4A6EA 3IB3A 4GKKB 3JD0A 4D3SA 2H3HA 5L3ZA 2OGWA 3EQ6A 2IU3A 1YR3A 4RD4A 1YHZA 3GN2A 3OEED 4HDQB 4REQB 4UTZA 1QUFA 1TX4B 3KJEA 2WR8A 3U7IA 4Z4HA 3VYSB 3D3WA 3EOAI 1JSLA 1XE3A 1Z6PA 1JIXA 5AW9A 3BTOA 3N2ZB 1SKUA 2C82A 4FN4A 4GXRA 4ID9A 2DUMA 2B36A 3DE3X 4JLBA 4WESA 1KJNA 2FEOA 3LT5A 1ODLA 1E6CA 3C87A 1ILWA 4RO0A 2WJ3A 1D7OA 3HDHA 1YFJA 3HKDA 3TIXB 3D8UA 3N3AC 2DM6A 3C7KA 4YXWD 2LWIA 3SYMA 3DFMA 3PC2A 3EVAA 5GTDA 4GC5A 3JQ6A 4G9EA 1T5DX 1IM2A 1ZUIA 2FG7C 3COSA 3PC8A 5F78A 4CBVA 5I48A 2EC5A 2IHYA 4DCJA 4DV4B 5EIXA 2PZKA 2EAUA 3EJWA 5BNFA 3RS4A 5CFZA 2JFXA 3QWIA 5IX8A 1LF0A 4FHEA 2AZXA 2QJRA 1NSTA 3MXTA 2MSDB 3RRZA 2IDZA 4REMA 3T5CA 3WLOA 3FVVA 5IBQA 9LDTA 3QFRA 4ARIA 2AD5A 2BTOA 1L8XA 1L7MA 2IIBA 5CM2Z 1RLJA 5TS3A 4QC2A 2QD5A 4BTVA 3LX5A 2F1HA 4JQYA 5FA5A 5H59A 3LH5A 3ZWVA 3KKLA 2HHAA 3KQSA 5H83A 2RG7A 5AI9A 5EJMA 5M29A 5C1IA 4JY7A 1CEYA 4BBZA 1Z6TA 1X3SA 3KQWA 1B3RA 1ZA2A 1TYBE 4O4IA 3HI4A 4HQLA 2ZSFA 3I61A 1DOAA 3PGA1 2GRUA 4RJLA 2H0QA 3LLCA 4DJJA 2R6HA 3NFRA 2ATVA 4DQKA 4GRIA 2CVPA 5CFRA 1J20A 1NAHA 5CG1A 2D1FA 3E15A 4DIKA 3E22A 1BEZA 1Q77A 3KT6A 1YQUA 2FPGB 3DVQX 1GPLA 1DQRA 2BOVA 3VO1A 3HK2A 4AZVA 1PI3A 4E1VA 1B4DA 1UF9A 3TOCA 4ZOCA 4EI8A 1Z75A 4B3GA 4P3PA 5BMVF 2YJTD 4F6LA 4JJAA 2OXFA 5U4XA 1P5ZB 3HRIA 4LJAA 5A7GA 3U09A 1JRLA 1F6BA 4O2BB 3UB2A 4ETNA 4WA8A 1A97A 2GLTA 1Q1BA 3TKYA 1N3BA 1ZI8A 3IS3A 3KOWA 1JR4A 4JMLA 3T0IA 3ILHA 1TIPA 2VUHB 3MTIA 4LK2A 4TQ9A 5THQA 4CMEA 3AVXA 1G17A 1GU1A 4PRLA 4R41A 4MQBA 1BCSA 2Q6TA 1EJ2A 4B31A 4P4LA 3B53X 2YY7A 2ZSAA 4HK4A 3TMAA 3K6SA 1Z62A 1Y1LA 1KU0A 3ONVA 4JUDX 3PU6A 5DM70 3EH2A 4NFLA 4TSRA 2P68A 2Z5VA 3NM6B 2R9VA 4JBIA 3RS3A 2IUTA 4EI2A 3WK8A 2H4XA 2DZDA 3RYFA 5IG2A 1DRVA 4UPDA 1DDIA 3FNRA 4L3OA 2ZUEA 1VKRA 1G5TA 2YJZA 3GR6A 1J6UA 1POXA 2Q9UA 1WPQA 2FRDC 4NE9A 4CCWA 2GM3A 1R5JA 2QOEA 2R8XA 4LUCA 4Q37A 5SICE 3M3DA 4AYXA 1Q7CA 5CDUA 5JCJD 1PN3A 3L8MA 3FPKA 3ULKA 5BW8A 2QP3A 3OM9A 7MDHA 3RD5A 1J8MF 5LWHA 1AGRA 1UC4B 4WNIA 3LO5A 3STUA 1I14A 4F12A 5E6UB 4NYIR 2I2FA 4PICA 3F71A 4PZCA 4XFJA 2UXBB 2VYVD 1SBTA 4NZPA 1VJ5A 1N9GA 5BNIA 1KSHA 4J1TA 3RREA 4BLWA 2ICAA 3NWJA 2AOUA 1V26A 1XZFA 4Y2XA 1WCV1 1J00A 4ER3A 4DOMA 4TWAA 4YAWA 4ZI7B 3M81A 2J9FB 2AJCA 3DNPA 1E6LA 2OZLA 2R8RA 2OSBA 1UZAA 1XLUA 2AE2A 2YINC 3AZOA 3OZUA 4IHQA 3RJ9A 4E5KA 4TVKA 3EF0A 3HFJA 3PEVA 5EUMA 4AY2A 3WK6A 3VSDA 1EQ2A 1XEWY 4HWOA 4LTMA 2Y1LA 4BU1A 4QM7A 3KQUA 1JIIA 3U4IA 3O1HB 1ZCAA 1HDXA 2OXCA 2WU8A 4BE4A 1AKVA 4FGUA 4BMVA 2OYCA 5CFMA 5KNCD 1A9ZA 1W4AA 2CVFA 2UYQA 2I78A 4PYNA 4FNOA 4EH1A 1GFZA 1GNRA 4EA7A 1U9IA 1PR4A 1MIOA 4BVGA 2CUKA 4GWGA 3M49A 5F7XA 2Z98A 3RUDA 5IBPA 2UUOA 2W2MA 4O2BF 5IH3A 5TQ2B 3R3XA 4OO3A 1UJ5A 2Q6OA 4CM9D 4GLLA 3RPEA 3O83A 2P30A 1JTVA 3CH4B 1GZ7A 1WMDA 1R74A 4DUZB 2OT3B 4IIUA 4LC9A 5CVJA 2EKPA 4B3BA 3AF5A 4B85A 1UPFA 3WZ2A 1R6DA 5BUQA 5CB8A 5IUNC 3CGGA 3HHPA 4XCXA 5IEBA 3VZDA 4QXPA 5C7IO 1FOEB 5HZGA 2X4IA 3ZY5A 4R16A 2NXWA 4JT9A 3VDQA 2X86A 3OJCA 5CVVA 3WVNA 1E3WB 4RA9A 1ZONA 4U9IS 4W9NA 4AJIA 4BFVA 1T10A 3UA3A 2CFCA 4OI0A 5GONB 2ZRHA 4FEAA 3S99A 2O3TA 3SYKA 3KKQA 4JUFA 1I4DD 4ZAVA 1KSGA 3II6X 3WWCA 4I4TA 3H11B 1DRWA 3FDFA 3JQDA 1P0IA 3NEJA 3ZBUA 3T15A 1AC5A 2JLUA 1FQKA 2FPXA 3CYFA 4O8ZA 1PR9A 5ALPA 1JPJA 4DPKA 5JD4A 2A2ZA 5ALTA 1WSAA 1BE0A 3UWDA 1NLUA 3O8CA 1U6KA 2X0NA 3BH7A 3QV1A 4A8HA 1HT0A 5IBCA 1NVKA 5JNVA 4K9SA 2WFLB 4AF7A 2RAPA 3AV3A 2VQFB 2OO7A 4PFQA 4QFBA 2JC3A 2F1IA 4K03A 5EERA 1KJ8A 1XB2A 1MQSA 1VGVA 3WAKA 5C1PA 3P26A 1UKEA 3OETA 4KQGA 4A5SA 1YI1A 3L7BA 1Q6YA 4FFOA 1RJFA 1NC3A 2C4MA 1IJEA 2HBZA 4TTSA 2B1IA 2WIKA 3KZ1E 1N36B 2JJ1D 4MVJA 5HIJA 3KOOA 2C5LA 1FUIA 2FSSA 3IDAA 4JC0A 3B7WA 3VFDA 4DMHA 4YRGA 4JJZA 4P4SB 5HM8A 5HWSA 5BORA 4NXNB 2X1HA 4OK5A 3GEGA 4L8LA 1FFAA 3ND8A 3LBYA 1E8MA 3PNKA 1KYZA 5BO5A 2O2ZA 1USWA 2KJQA 5ALHA 4Z2YA 4EJSB 4M1TA 4WV3A 3E3AA 4LQ4A 3G9QA 4M8IA 1FE8A 1GFSA 4JI3B 1NNEA 3DAYA 3EIWA 1VMAA 2B8JA 2FSHA 2HADA 2LZ0A 3HNOA 4HTAA 4O0MA 4FFVA 3MBIA 4PHFA 1G18A 4QU8A 1CUDA 1W0KD 3AYXB 2ATIA 3MTDA 2NTNA 2ZRGA 3GZNA 1A9OA 3GAMA 2XRZA 3FF1A 1SCNE 1E3MA 5JZBA 1E1KA 1TDJA 4XQ0A 2OVFA 3QJ5A 4MV6A 3HJFA 1UK7A 1E2IA 1E2UA 1EQUA 2PZMA 3QMPA 3GUUA 4N41A 3R9XB 2L82A 4RW0A 1DFHA 3CRVA 3GO4A 3P9ZA 2Y68A 1XTRA 3Q1LA 1L5LA 1OVMA 3MJ4A 5LQRA 3K71B 1G59A 3BDAA 4KTTE 1QGED 1XZEA 2WHEA 3O4RA 3PSHA 2YZ2A 3AERA 4H1TA 1KEUA 1O54A 4JXKA 4FC6A 3WLHA 4XB2A 5AI0A 4YQEA 5LZ5A 2ZZKA 3O8OA 4KPFC 2AVDA 1IXYA 2BWJA 3PQCA 1UBSB 3B1XA 4KU4A 3AG5A 3EZXA 3W3AD 4KR6A 2PVPA 1EP1B 1V35A 2ZJFA 2PRKA 3GBPA 1J25A 3KTOA 5GONF 3KEFA 2HDWA 5HMMA 3RUHA 2GZ3A 3GROA 4EA6A 2ARKA 4AI6A 4PNHA 4IF6A 1Z37A 1YZGA 4KZPA 3RT1A 1ZD5A 4CF6A 1OFTA 4UATA 3ON5A 3RVJA 1RCFA 1G9TA 1V3VA 2H4YA 3NS7A 1SH7A 4MWBA 3VR1A 4B6SA 1I3LA 5JLJA 1Y5IA 1ZR2A 3HA5A 3QBEA 2F90A 3SBOA 1BYIA 4LGCA 1X87A 1JR6A 4AZSA 4RTRA 1QIDA 2R751 1P0PA 2Q0HA 5THXA 4HGNA 1UFRA 3R40A 1E1CB 3N2LA 4OHBA 3OH8A 4V0RA 5GP1A 4ND8A 3OICA 4GZ6A 3A4TA 1J22A 3H3JA 4W9RA 1QYCA 4DJEC 5DI9A 1KNXA 4H59A 2W00A 4QULA 1OXUA 3CWZA 4MW6A 2CFSA 1FSGA 3VA7A 2ZI4A 2TECE 3LYAA 3RVDA 5BN5B 4H2DA 1CLUA 1BDIA 4Q7QA 1J23A 5C4IA 3GLRA 3L0OA 4DLSA 2PR2A 3OX1A 1WVIA 4C6HA 3ZG6A 1W1UA 3W5BA 1DZ3A 3WV4A 3ROZA 2QRNA 2VPIA 2XYVA 4D80A 4N82A 7REQA 4CG3A 2RGCA 1IY1A 2IXFA 4OKIA 3AY6A 1GPH1 2QT0A 5C53B 2PWZA 4URYR 3WFIA 4B2YA 5DE3A 4IEEA 3J80A 5A02A 2OHVA 3OPXA 1VFNA 3RKUA 5DNAA 4B4DA 4Y6PA 1DV2A 1JILA 1E7RA 2VZ0A 4NFYA 4BLUA 4EG7A 2W2QA 1T29A 5T4FA 2QIPA 4BO9A 5BSGA 1L9KA 4KKVA 3L43A 3IQDB 3BRQA 4XJXA 3FVRA 4E94A 3ZXUB 4URXR 4OHXA 1P9RA 2VAPA 3EF1A 4ITVA 3L01A 3AEZA 1LI4A 4HADA 1KHHA 2OD9A 1RYNA 3Q8XB 1U6IA 1MQ8B 4HPJB 3AF0A 3BX1A 1LPPA 4P4UA 4OATA 2GM9A 5KIAA 4L15A 3WICA 5CFOA 4WUTA 2IYLD 1EHIA 1R6AA 4CI9A 1IXKA 2WM8A 4C0KA 3CVXA 2GTHA 4HN9A 4N3NA 4MA0A 1V1RB 4YLGA 1EUDA 2GSDA 4G09A 4JB0A 3DL0A 2GHRA 1S4QA 4H17A 2YUIA 2PLRA 2AMLA 3FWNA 2BHNA 3LIIA 1BMTA 3FKSD 2IQIA 5C3MA 4AJ1A 1CDOA 1KI6B 2EJWA 3EZ7A 1U1IA 2I1VB 2NT4A 3IA2A 4WY2A 1M2HA 1WZIA 2PX4A 3CSDA 1S2OA 4RGBA 3AL2A 5TX7A 2O0JA 5AHOA 1XRLA 2HMSA 2P0YA 3GYBA 1E2GA 3N0XA 3NTQA 4R71A 3QUBA 1B74A 1U8AA 4TXLA 3BD8A 4UTVA 1TUBA 1U3UA 4GOJA 2PUAA 2JCXA 3N8IA 1KI7A 3PLNA 3R74A 3U9SA 4G0XA 3EWSA 1MH1A 5AXAA 2HRZA 3NWOA 5BPHA 1SFRA 1SQ6A 2R8ZA 4ISBA 4IYRA 4ZEOA 3IHKA 1EAMA 2CLMB 4RVDA 1MAVA 4QQFA 4YMIA 3PHHA 2DBRA 3L7AA 4X90A 2AV6A 2HGSA 2I4IA 3H5VA 2FRDA 5ELMA 3RFFA 4B8WA 1A2KC 4UTXA 1FDRA 5B58T 2PCLA 3SSOA 2Z4SA 4MS3A 5GJWC 3RIGA 1ESCA 1GL9B 4OQNA 4QRHA 1KO5A 3CU5A 4EBBA 2AFHB 1SZCA 3F5FA 5IJ9B 1W36C 4IVRA 3O2JA 1IIRA 1AB5A 3LUBA 2BRUA 1KAGA 2ZE5A 5FJIA 1KPHA 1G16A 3KT3A 5DOZA 4H7HA 4NABA 5EJIA 2HNBA 3V34A 4BWFB 3OHMA 3PQ4A 3EVBA 3AF1A 3D3JA 2X76A 1JFRA 1M54A 3QSYA 2YHBA 4FN5A 1HNWB 2HPAA 1J1UA 1EVLA 2OSVA 4KZKA 2HUPA 2PKXA 5CT5A 5FULA 4X6UA 5K51A 2FF7A 5JPIA 2A9JA 5AHRA 4ALIA 4F1KA 5IFKA 3RVBA 1NMSA 2D7CA 2WNSA 1NVVR 3R0JA 4G01B 1T1GA 2XYRA 3ESAA 1Y3CE 1NW8A 3G79A 1YU6A 4MWDA 3VHXA 3U4CA 3ZPXA 4PTYA 2PZ8A 3UOGA 1I7NA 2FOLA 1FLDA 2PUFA 1DFGA 4KQ2A 4MYTA 3SDBA 5KX5A 1XMIA 4QRIA 1SKBA 1GA6A 2ZQYA 5KI6A 1QF7A 2WIFA 1GRCA 4ZT4A 2EGUA 3VYTB 5BWBA 3P4UA 4KQHA 2PZFA 2QMHA 3A4YA 5EXSA 4C1NA 4YR7A 3T94A 5JTTA 4YI3A 3LI2A 2QAJA 2PRSA 2LDBA 4KXLA 4WZAB 3Q2OA 3IMCA 2C5GA 1E8NA 2PMDA 1WUYA 1KIFA 5C46F 5HRUA 1PQ4A 2BEUA 2VATA 4RZIA 5HSGA 1OXBB 5KS2A 2DPYA 2FPPB 1Z4OA 3LUHA 1SXQA 2RGNA 4HF7A 4RGYA 2QN7A 3MVEA 3WRWA 4TT3D 2HZ7A 5FOVA 2P5TB 4LOIA 5F2KA 3BXPA 4P8RA 3JWHA 3DCJA 3PDIB 4IY1A 4M1QA 1KH1A 2QJFA 3VR3D 3VISA 4AUMA 3UAWA 1VRWA 2EG9A 4ZVQA 1CFJA 3AFIA 3FYDA 3KD2A 4TYPA 3A9UA 3IIIA 3EG9A 2LE0A 4V03A 4EITA 5KWJA 3C74A 1AA9A 3HJHA 3NHUA 2PMCA 3HACA 4G5OA 4UHHA 3OZEA 2B7BA 5G4LA 5KDDA 4I6EA 1M1UA 2ONKA 4QASA 4ZPJA 3QVGA 3T3PB 3SMQA 1JJVA 2QIOA 4LJRA 1PJ8A 3KQKA 2IE0A 2WVGA 2YHUA 5JXWA 1FQOA 2YYSA 3K7EA 8MHTA 5D3MA 1GGMA 1V2HE 1VIYA 1BWRA 1C9KA 2NNWB 4QBHA 1ISJA 5KEIA 5C8DA 1F8GA 3H2KA 4RK6A 2YV3A 5D1HA 1V0JA 3BL6A 2PBR