421PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncogene protein
molecule keywords H-RAS P21 PROTEIN
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 421pA00
5JCPA 2C99A 5EP1A 4JL8A 5B2ZA 2WIAA 1CLUA 1R5NA 4JVSB 1R0YA 3UPUA 3IIKA 1XP8A 1NVUQ 1VHLA 4UXHA 1QHNA 5TY0A 4M1SA 2O0HA 2YOGA 3B1ZA 4JYCA 2R62A 3H84A 1FP7A 1G8HA 2E1RA 2J45A 4V02A 421PA 1P7CA 4F93B 3O8CA 1GIAA 1TUEA 1W47A 5GJBA 3FYHA 2F1HA 5TV2A 2QAGC 2A5GA 1SXJD 3MAAC 1OLOA 2ONJA 3SBDA 1I4TD 3U7GA 4DJTA 4HDCA 4NL4H 4QKQA 2EQBA 2PJZA 4YDSA 4ZV4A 2IX3A 2BWJA 2FWRA 2HJVA 3VHLB 3ZQ6A 2XXAA 3BBPA 1XJCA 4BFTA 5AK0A 5SZKB 2J87A 3QI2A 4FXPA 3D3QA 4YXWD 5L3SB 1K6MA 3C4JA 4HUQB 1ZUHA 4G3XA 1E69A 1ZJ6A 1S3GA 2J5XA 3PUVA 1JR3A 4H9GA 4A0FA 3U4QB 3JVVA 4B3DA 1A2KC 6Q21A 5KUTA 2I1VB 1FL9A 1FX0A 2GK6A 5FOVA 2IT1A 2B8WA 1LTQA 3A4LA 4MKHA 2O8BB 3CF6R 3KJEA 4BZXA 4G0NA 4KYUA 1W2HA 2G9NA 2OFXA 1VCMA 4KI0A 3CRMA 4YMTA 4GOXA 3U7HB 1EK0A 3CH4B 1E1RD 1XD2A 5DN6A 1S2MA 1WXQA 3KDSE 5D3QA 4NTZA 2L0XA 1E2PA 4OHVA 4L9WA 3GJ7A 2WZQA 1YVDA 3IKJA 1XPUA 5GVSA 2D74A 1PV4A 1Z06A 4GMXA 1EFUA 1ZD8A 3RLFA 4JJKA 1SVIA 2XOKA 4C0BA 5KNBA 1G1MA 3J81k 2JATA 4R2IA 1GRQA 4P4UA 5DNYB 3K09A 4ON9A 4YONB 2EVWX 5IK2A 3T34A 2FGJA 1DARA 2DFKB 4ZCLA 3ZS9A 3A58B 4Q48A 4QRHA 1SXJA 1NKSA 2VPPA 5FL7D 1KDRA 5FOUA 4IDNA 4IXNA 1MV5A 5FPSA 2A78A 1QHSA 1VHTA 3IDQA 2IWHA 3T61A 3LLUA 3B5JA 3NEYA 1OF1A 2DWPA 1G3QA 1US8A 3NDBB 4M9QA 1NKTA 1W5SA 4O3MA 2P5TB 2Z83A 1X6VA 2CE2X 1CR2A 1XNJA 1Z6TA 2W6IA 4GMDA 2OV2A 4IEEA 4Q1AA 4YXWA 1VG0B 1LY1A 2JA1A 2O8EB 1CJVC 1SZPA 5CLLA 4JL6A 3WHKA 4B2IA 4BRUA 1G5TA 4KFTA 4D2IA 3GLIE 1OXTA 3P32A 1A7JA 1U9IA 4D4KA 4XVUA 4QM7A 2WBLC 4R2HA 3AV0B 2C8VA 2ZRJA 1AN0A 2HYDA 1N2CE 3NH6A 1E2MA 3GPLA 5UKDA 3EPLA 3FOZA 1GITA 3K9GA 1NF3A 2FFHA 2FFQA 2FZLA 3SNHA 1KHTA 1VKJA 4F7WA 3RS0A 3ZQJA 1P2SA 1ZD1A 4DCSA 1E3MA 3A1WA 4P33A 3R8CA 1OYWA 1HEIA 1OIWA 1RRGA 2FE4A 3CF0A 4M22A 2XZPA 3SDZA 3OZXA 1PUIA 4B3GA 4MDEA 2QP3A 2V7QD 1XEWY 3IHLA 4JT4A 1E1RA 3QXCA 2PMDA 2XEXA 2YZ2A 2ZSFA 3BFKA 2PL3A 3OE7D 4E22A 1NSFA 1ZVQA 4PQYA 4DSTA 3VKGA 5EE3A 3THYB 3FB4A 4Y0VA 3NKVA 2XNDD 3LO5A 1U0LA 4QNMA 2ZJ5A 1ZIOA 4KBFA 4UNPA 1O3YA 4HZUB 2GVZC 4F38A 1IXSB 4EFMA 1KTVA 4AURA 1GRNA 2CNWD 3QVVA 4CEHB 1CBUA 3I5YA 3B13B 5LBIA 1NN1A 4Z1MA 3RRMA 4N0EA 4K81B 1NNEA 2ZJAA 1J7KA 5E7MA 4C0JA 4RZ2A 2P2LA 2WHXA 3GFOA 3IUYA 3K70B 5C18A 1E9RA 3NEJA 1W4AA 2W00A 3EZ6A 3ADKA 3W6OA 4LJ9A 2PT5A 5FL3A 3MG9A 1OW3B 2GILA 4BLTA 3SHWA 3QJYA 2QQ0A 4A9AA 3A1SA 1ZNZA 3WYGA 3REFA 1ETUA 4IEIA 1CU1A 4XSGA 4AK9A 2WTUA 4FCVA 3TVTA 2IS1A 1UAAA 4B73A 4DLWA 3AVXA 4LHZA 1MOZA 1WBDA 3HPQA 2HYIC 1S0UA 1YKSA 2E87A 1YR9A 2XTNA 3F3YA 3TLXA 1Z22A 5FUYA 1OH7A 2IXGA 5KU1A 1XTKA 4UXIA 4XVQA 3C5CA 2OCPA 5DYIA 4GPTA 1XD8A 2ZSAA 3EAQA 1KI4A 4M1OA 3FMPB 1TEXA 4PANA 5FTLA 1KO8A 2GCNA 1U0JA 3TVDA 2QSYA 3PITA 2ZRNA 2VLIA 2I4IA 1Z0KA 2FH5B 2JLVA 4C4PA 4LC1A 1E1QD 1KMHA 3E2IA 4M0LA 3L43A 2VL7A 4IXMA 2VP5A 1Z63A 2V7QA 4B75A 4JLBA 1ZNYA 3KL4A 3O47A 3WNCA 4FCTA 3VR1A 5DHAA 5AJZA 1ESNA 3OE7A 1S9HA 1C9KA 2IYRA 1Z07A 2AX4A 2CK3A 2EFEB 2RMKA 2ZRAA 2ZM5A 4KJZA 1GNPA 1KO4A 3IEVA 1UKEA 2Q21A 2AFIE 4D80A 2XXAB 2XNDA 4AI6A 1YZKA 5JRJA 1HURA 2CMKA 2VSOA 1E0JA 1Z2AA 5ANRB 1ZM4A 2VSFA 3H86A 5J5CA 1MH1A 5JHGB 4MDFA 1YJ5A 2F9LA 1UKZA 2WKPA 4KAXA 4R98A 5KDDA 1VYTA 2KBFA 1XDBA 3QBVA 1UPTA 3RRNA 1V5WA 2IYWA 1N5IA 5AUQA 4D0NA 1OH8A 2NO9A 3KJGA 2J7KA 3IBYA 1SKYB 2IC5A 1FX0B 3BK7A 5FPHA 4A92A 4QFMA 1Q57A 3DEFA 4TT3D 4EPYA 4HLQB 2J0QA 1J70A 1NL3A 1FMLA 2OILA 5FI0B 1GWNA 2YINC 2GAAA 3ADBA 3ICQB 4MGZR 2QRZA 2ZYWX 3TUJC 4FMCB 1COWD 3PEYA 3QXXA 3PQCA 4D26A 2AD5A 2HDNB 3CO5A 3OAAD 2D2FA 2PT7A 3SOPA 3TSZA 1LF5A 1KJYA 4PPGA 2W83A 2WKRA 4P4SA 1XMSA 1GDDA 1F2TB 3LVRE 3T35A 3KQHA 4GOJA 4A2PA 2EYUA 4AG5A 1DS6A 4EQ6A 5C2JB 2JLRA 1U99A 4D4JA 2ZRMA 1ZM9A 3VR5A 4FCWA 1DAEA 1NY6A 1U90A 1G9XA 3P1JA 2DHRA 2ZEJA 2OAQ1 4Z54A 1E1QA 2QL6A 3IO3A 1SKQA 1SXJB 1HYQA 2IYVA 1UDXA 4XWAA 1CR1A 3KUDA 2MSEB 4YQFA 1VCOA 2DFLA 1FUUA 1ZCAA 1E9CA 1N3BA 1E2IA 2BIFA 2PZFA 4TLDA 1G6OA 5C46F 1IAQA 3N5CA 1US8B 4TMKA 2YKGA 3Q85A 2Q3FA 1NBME 3LY5A 1W2GA 5DH9A 4IDQA 3ZZTA 4Q9IA 4MGIR 1Q3TA 4OQXA 3NBZC 4DSNA 2QEQA 1J8MF 5CDFE 2ZREA 3NDPA 1GUAA 2WM9B 4HAWA 1DAMA 4ESVA 1U0HC 3BS4A 4UNQA 5HE9A 3U3RA 5IRCD 2XJ9A 5DI9A 2WKQA 1CS4C 3DO6A 3GD7A 2DB3A 1HA3A 3IQXA 4NYJQ 3DM5A 1E94E 4IVPA 2A9KA 2V6JA 3FMFA 4GBMA 4OK3A 1S8FA 4RKFA 4ZDIA 1RRCA 1ZYUA 2Z0MA 5KNDA 3ZVLA 4CEJA 1OFTA 2P65A 2H1LA 3QSYA 3ZGXA 1G4AE 1R8SA 2D06A 2P5SA 2Q9CA 4X8OA 1GL7A 2WWGA 2X2EA 1G20E 1NN3A 5DIFA 3B60A 2FDCA 3DMNA 3EX7C 3EC1A 4PC6A 1BO6A 4BPBA 1OKKA 2GETA 1COWA 1AS3A 1P60A 2ODBA 1ESMA 4I4LA 4MGKR 4XSHA 2VHUA 2BHRA 4BQSA 3OAAA 2PEZA 4KFUA 3TE6A 1SVWA 1CRQA 4URZR 2DBYA 1KJZA 5CLQA 4EKDA 3KTAA 2OZEA 4JLOA 5JJLA 4CEIA 2YC2C 3I92A 1DADA 2QQEA 4N3NA 1FOEB 1QG2A 1VDZA 4XTRA 3ECCA 4UXJA 4BFWA 4HB4A 2GZHA 1E32A 4L16A 3UIEA 1FW6A 2WV9A 2DR3A 3CWZA 4LHWA 2IXEA 1E79D 4M4SA 1OYYA 4HLUA 3EPHA 1G3IA 1J2JA 2IXFA 2QG6A 5TB5A 4EUNA 3EG5A 1NVWQ 1P2TA 2ANBA 4Q4HA 1II9A 1UJ2A 2QP9X 1AQUA 3H4MA 3K9LA 3NIBA 5CK4A 5A0FA 2IYXA 3BH6A 4EPWA 4Y0AA 5B58C 2V3CC 3ND9A 2YVUA 4IRUB 5JS7A 1N5LA 3HR8A 1XCMA 2CCJA 4NONA 2BCJQ 4OI4A 2QT0A 2HEIA 3WYAA 2GA8A 3MJHA 3VAAA 1DG1G 2PH1A 2QNRA 4QGGA 5IDVA 1Z0FA 1TF7A 1GAJA 1OE0A 2N46A 4YMWA 5CIQA 3RRYA 2C96A 3TGPA 4AYTA 4HAUA 1KMHB 3JVUA 5KOYA 5JJKA 4FI3C 2OHFA 1S1MA 2H7VA 1TF5A 4CT4B 4U7DA 3I5XA 1JXMA 4L15A 4Q01A 4Q4LA 4L5BA 2KE5A 2WPDA 3G0HA 1Q1EA 2V8OA 2ZVQX 1YU9A 2ZSBA 3AM1A 2F7SA 3A36A 1YZGA 3FWYA 2QUZA 4TZ6A 5TARA 4W9MC 1RE0A 1AGRA 4QHSA 1M2OB 3AF1A 3TUZC 1SULA 2B8TA 5BXQC 4M9ZA 3N70A 5FBLB 3UK6A 3TR5A 1B23P 5J4LA 2R6FA 1P9NA 3W5JA 5JWRA 4KFRA 4IDHA 1KJWA 1Z6GA 1Q21A 3FDIA 2YJTD 4Q5IA 4PPQA 3Q5DA 4Q19A 3DM9B 2QAGA 3WNBA 5KNCA 4AY2A 4QBIA 2IK8A 3L0IB 4QNRA 1CTQA 5GJCA 4JKYA 3G5UA 1BIFA 2C5LA 4DT1A 1HQYE 1CIPA 2BBOA 4HDOB 4Q66C 5A4JA 3KKQA 2W0MA 3TUIC 1EG7A 1W1WA 3RABA 1WBBA 1DAIA 1H8ED 4MRSA 4QJ5A 2G83A 1P2VA 4UNRA 2ZJ8A 1IN8A 3ONWA 5HCIA 1RZ3A 1MRSA 2G88A 3CRRA 3VNVA 1GFIA 3QXSA 4NYMQ 5HR5A 1MO5A 2NG1A 2BBWA 3QG1A 2GDJA 2OLJA 1BH2A 2B7CA 1IXZA 1WQ1R 4EQ6B 3SR0A 1N6HA 5DLQC 4KSCA 221PA 3SBEA 1ZM7A 4OHWA 4A2QA 1X3SA 1DEKA 5HKKD 4DDVA 3IGFA 1LNZA 2PX3A 1UKVY 3TSWA 4JLKA 4RVCA 3CB4A 3QBTA 3WMFA 1JEEA 3MSXA 2A3RA 2ZS9A 2RHDA 3AB3A 2IA5A 2QTFA 1YZLA 2BC9A 2XB4A 5JEDA 3GJ6A 3L2OB 4BFYA 1ZM3A 3CR7A 4RD2A 4ARZA 2FNAA 3TH5A 3I4LA 2VSXA 4LJYA 1GP2A 2ODEA 2OM2A 2VF7A 3NBXX 3AVUA 4GSYA 1GOTA 2HUPA 5KDOA 3ND8A 1AS2A 3I61A 2J46A 3UANA 4PC2A 4D0GA 2NOAA 2J0SA 5K8LA 1IXRC 4G5GA 5K8TA 3B82A 1XTRA 1ZNWA 3L0SA 2B92A 4MYUA 4TYPA 2LWIA 5LD2B 3PV0A 4TTQA 1EFRD 3SJAA 3U3KA 3GLIB 3K0FB 1A2BA 5J4YA 1SVOA 3ZS8A 3H1TA 1E2FA 4PHGA 4DCTA 4DHEA 1XWIA 1KKMA 4CEJB 4J0QA 4TLCA 4NCNA 1U94A 4L8GA 4NPHA 2QN6A 3ZVMA 1KI9A 1WB9A 1N0UA 1S9DA 1XJQA 2BMEA 4RCYA 3ZD7A 4C0KA 1P4SA 4HAVA 5G41A 2R65A 2RGNC 5B30A 2A5JA 4Q4AA 1T3LA 3AUXA 1EGAA 2C98A 1G5PA 1KZ7B 2BEJA 4NHOA 4JJZA 3X2SA 4D0LB 1M1YE 2ZJOA 1GKYA 4HUTA 3I32A 4QGFA 1G4UR 5AWFC 4CEIB 2VRWA 3TRFA 3T06B 2UKDA 2V4ZA 1Q44A 4N0DA 3WNDA 1II8A 1IONA 3CBQA 1H8HD 1KY3A 1XMIA 2G0NA 1SHZA 2QTVB 1FPMA 2R6GA 3K0CA 5G40A 3QF4A 2O5VA 1WDTA 4B76A 4PFSA 4M1MA 3DKPA 2ZRCA 1NVVR 4TZ0A 1E2GA 1TAGA 3QKRA 5KTYA 1KI1A 3U3JA 1BMFD 4TYQA 3ZVRA 4NH0A 2QM8A 4TMXA 5FOSA 4BLRA 1H65A 4Q1CA 2JJ1D 4B3CA 2V6IA 2R6DA 2IYQA 1FNNA 4CVNA 4BEJA 3BERA 1ONBA 3CKLA 2VEDA 4GP6A 2VYFA 4A8JC 2LKDA 4B2LA 4C30A 2MMGA 1XF9A 4PZYA 5FPTA 1HQCA 4U02A 1MABA 3EZ7A 1W4BA 2ZSEA 1DPFA 1X86B 4GT1A 3LBHA 1KI6A 2FPLA 2UZ3A 3UATA 3X1ZA 4OI0A 4LUCA 1WMSA 4M1WA 1NJGA 2ZQ5A 4R71A 2H16A 2MSCB 5JWOA 4OQNA 3U5ZB 1UBFA 1VG9B 3SE0A 2GWHA 4EPRA 5JEEA 1NN5A 3UMRA 2J9RA 1QG4A 3KQKA 3RAPR 2PZGA 1NIPA 2WMNB 4M21A 5J4VA 1RKBA 2E9SA 3V9PA 5LDDC 4NU0A 2W58A 4YLGA 1UBCA 4PSAA 4BLSA 3ADCA 3AF0A 4KVGA 5JWHA 1HTWA 4GP7A 4QXAA 4Q9JA 4OK5A 1QVRA 1KSFX 1H8HA 1E2EA 1E9DA 3A1UA 2AHOA 3TW8B 5EXPA 2F55A 2D7CA 3PXGA 4MKIA 5KDLA 3PENA 1KKLA 2X2FA 3NBFA 2VP6A 2ZRKA 4JLNA 4Q1EA 1D2EA 5DGXA 4TLAA 2WWFA 1G7RA 1LFDB 5K8IA 5E95A 2AK3A 1UADA 1OIVA 4WZAE 4DLTA 4DDUA 4LDJA 2EFGA 3KXLA 2JJ8A 4GI7A 3QG5A 1ZCBA 2QE7D 3GMTA 2CLSA 3B8HA 1DTSA 4EPVA 2ZTSA 3THWA 3HWSA 4PR0A 4RD0A 3EPJA 5CK5A 4C0SA 3O8DA 4YDHB 4PO8A 3GJXC 4HDQB 3T1QA 3EW9A 1PZNA 2OBNA 3DL0A 1ZU4A 1GZSA 4LYAA 3AGPA 4IDPA 2R6AA 2XSZD 1E6CA 4Q21A 1GTVA 2OAP1 3C16C 4B3BA 4KITB 5JECA 4WIAA 2JDIA 3GJ5A 1QDEA 3QXHA 1Z6YA 2VHJA 1NLFA 1XPRA 1OB2A 3MGCA 1PVOA 4YMUA 5EE9A 4HSEA 4RD1A 4A0GA 3FMOB 3N2IA 1T0JB 2P3SA 5DYGA 4DSOA 5BWMA 1XCPA 4LJ5A 1SVLA 2C78A 3MWLA 5JI3E 4TL8A 3U61B 3K8YA 5IT5A 4U5XA 2MMCA 1P5ZB 2VIIA 4DCUA 3SZRA 4RKEA 1OHHD 1W0KD 2IEZA 5DISB 3EC2A 3K0AB 1UBEA 2BMDA 5KSYA 4JZKA 1TU4A 5KYKA 2AK2A 4B6EA 4Z8YA 3CNOA 3TMKA 1QHXA 3RS5A 3AGQA 2GJ9A 3R7WA 2QP4A 2A7QA 2ZVPX 4IFEA 4NZYA 5FUXA 3D7MA 2REXB 1RJ9A 3A4NA 4LYJA 4ZDKA 4G1UC 5CB8A 2IUTA 2G1JA 5DI3A 2IYLD 1OV4A 1ZMXA 4Q4JB 1PLLA 2ONKA 2PBRA 1X8LA 4NYIR 3EZFA 4O25A 3ZJYA 4I81A 1IOZA 2C9YA 3WRYC 2QE7A 5JRZA 2ODNA 4OJQA 3UWKA 1SVMA 1TADA 3R8FA 1KK0A 2J59A 4ZDJA 1OXUA 3OEHD 2Z4RA 3AVQA 4OQMA 2OCBA 4BRWA 1R0XA 3MD0A 4MA4A 3W3AA 4KLZA 5FR1A 4HB0A 1IN6A 3SFZA 4CDGA 4EFNA 2KWIA 3FHCB 4JS0A 1P75A 1BKDR 2CDNA 3BD9A 1HUQA 2UZIR 3LFUA 4EJSA 4HAYA 4PPNA 4BFXA 4HYYA 1OXVA 1R4AA 3GLHE 1IN5A 1II8B 5JCZA 3N2EA 2AKAB 3CIOA 4LHVA 4BFSA 3WMGA 4B6FA 2CL6X 4K46A 2WWWA 3HU1A 3LVQE 4NCIA 4A0HA 2FX3A 1GILA 1F6BA 2VP9A 4LHYA 3B1VA 2FFAA 4UQOA 1VYVA 3U44A 4PXAA 1DO0A 1II0A 3RS3A 3TW4A 3W8NA 4ZI3A 3L0OA 3QKRB 3QXJA 1NP6A 2WSSD 3QIAA 5JS8A 1W0KA 3U7FB 2GZDA 4TL9A 3T15A 4F4CA 2A5DA 5E4FA 5FL7A 2D62A 3PEUA 2VF8A 1BS1A 1KO5A 2V1UA 1AJEA 1OB5A 4LBWA 1Y63A 2ZAOA 3CX7A 4CF7A 1E0AA 4BEBA 4PTLA 2IUUA 1ZRHA 1XRJA 1TU3A 1NIJA 3THXB 1CP2A 1MABB 2ZE6A 1DAKA 2FEMA 2QY9A 4PAQA 4ILEA 2ZS8A 3GFPA 1KI6B 2WJIA 1X8KA 2EU8A 4O0MA 4U00A 3TQFA 3GJ3A 3B2EA 2I3BA 4RJLA 3HU3A 1MRNA 2NO0A 4YMVA 1GRRA 2X1VA 4RFVA 1N5KA 4IW3B 2ZJBA 1AA9A 3OIUA 3TAUA 4AWXA 1Z47A 2NZ8A 2B6HA 3AVYA 4KVAA 1VIYA 3AKCA 5CITA 4DIEA 2BKUA 3UMSA 2VO1A 3C7KA 4DC9A 5HZHA 1NJFA 2ZSDA 4ASUD 1AKEA 3KKOA 2JLXA 1W4RA 3K9NA 2P0EA 4HZIA 5FTMA 3HR7A 2AD1A 2FMXA 1QF9A 2OLKA 2WWIA 4QHYA 3I73A 3T1OA 3C15C 3BFVA 4M1TA 3FHTA 2YWHA 2Z4SA 5M04A 2VHCA 2CNWA 1MO4A 2SHKA 5CM8B 4X8LA 2WSSA 2HV8A 5JMTA 1TTTA 3AVWA 3LXRA 2HT6A 4NP6A 2EWWA 3RS7A 1GKIA 4I1UA 3Q9LA 3DMDA 1ZC4A 5HPYB 1JBKA 2OCYC 2UVQA 3VFDA 2ZRFA 3EA5A 4QC2A 3PUXA 4QOSA 1DAGA 1IM2A 2YOHA 4NKRA 2QMEA 1IJFA 4LI0A 4X8HA 1XD2B 4WBSA 3U6BA 1TMKA 3WY9A 4PSKA 1E9FA 1KGDA 4LY6A 2D4HA 1P61B 4RZUA 1YQTA 3BB1A 4TSFD 5JBQA 1KSHA 5JFGA 1QBKC 2AKYA 4RD4A 4CYMA 3RC8A 1DO2A 1T4GA 4PAMA 3X1WA 1UF9A 2ZRIA 5G53C 4LPKA 4ZKEA 3DOFA 1MKYA 3HU2A 2G3YA 4JBWA 3SEAA 3X1YA 4QJ3A 1C4OA 2QGNA 3PEVA 3U7EB 5BN3A 2XZOA 4QM6A 5F9FA 1T6NA 5EP2A 3KQUA 4FW9A 2OXRA 4OBEA 1WA5A 3K9HA 1KYIA 1OSNA 3L8YA 4EFLA 2GAOA 5FTKA 4AKIA 3F5FA 4RZ3A 3W6PA 1JQJC 4IHQA 2AL7A 4ASUA 4BLOA 3R7WB 1DOAA 3A8TA 3BC1A 1OT3A 4KYIB 1N5JA 3EIHA 4WZ6A 5TXGA 1RJ9B 2CHGA 4B43A 1G19A 2OESA 3R9WA 5H8WA 3U3MA 5DI3B 2I1QA 4QL3A 1XZPA 2HXYA 1YHNA 1OJLA 3RSOA 2DFNA 3GEIA 4POAA 4MYCA 1N6KA 2OCAA 121PA 3B1XA 4B2PA 4V0MA 2H8KA 2LCFA 2QA5A 3IIJA 4DLZA 2P6NA 1JXOA 4NYJR 1XTJA 5FUVA 1IBRA 2OT3B 4JLMA 1TEVA 4AC9A 5JLJA 2YNMA 2ZRLA 3D6TB 1U2RA 1NLYA 1KNXA 2FPKA 5KSZA 4P4TA 1U9IC 2W2TA 3T5GA 2DFTA 3OIWA 2QMOA 4PHTA 2FEOA 3T5DA 3PG5A 2XAUA 4TT3A 5AJVB 3E1SA 1G3MA 2Q3MA 5FOTA 3NH9A 1N0WA 2JASA 5H68A 1G64A 2BM1A 2VQSA 1M7BA 1CRPA 1Q3HA 2RGDA 3NC0C 3PUZA 1DAFA 4D6PA 1Z3IX 2FOLA 3TAHA 4EJSB 4GL2A 4D82A 1EFCA 1QHYA 2C9OA 4S2EA 3E5HA 3OIVA 4TSFA 1NMXA 4M2LA 2BM0A 4JSTA 5F3WB 2G6BA 3GLHA 4LWZA 3SN6A 3CRW1 1KO7A 5L3QA 1Q0UA 5J4KA 1VECA 2CHVA 3PEWA 3FKSD 1P73A 3U44B 4TYYA 5JI2E 2WAXA 2NZJA 4BZQA 4KSBA 4G5RA 1EFHA 4LYFA 1FNMA 2HLDD 5GVRA 3UKDA 4BFVA 4ESHA 3DZDA 3EXAA 3TR0A 1VIAA 2PJRA 3GJ4A 4RFSA 4TMTA 4W7SA 1GSIA 2EFHB 3BAFA 3MJRA 3QKUA 3BXZA 4ACBA 4DXAA 2IS4A 621PA 1R2QA 2NQ2C 3KB1A 2O8DA 3FVQA 3AVOA 3V4RA 4JLPA 4S35A 3ZH9B 4C7OA 3ASZA 2JCSA 4MYHA 4EDHA 3MWKA 4LJ8A 3GLFA 5CM9C 4XWKA 3E70C 4PX9A 3AVTA 1EXMA 1F2UA 1WF3A 1YZTA 2VP0A 3GLGE 3PJRA 1JPNA 4R7ZA 2J1LA 4TWZA 1TL7C 2GBLA 1EX7A 1I4LD 2CJWA 3OFND 2VHTA 4LJ4A 5AJWA 3VKHA 3PFIA 4LYHA 4FMDF 2BOVA 2FFBA 4PHFA 2CXXA 4EIWA 1YRBA 4DWJA 1R10A 2C9CA 1HE8B 2BKEA 1Z28A 2VA8A 2YC4C 1XTSA 1HE1C 1ZW6A 2AXPA 3SJBA 4US2R 1SQ5A 1JJ7A 3SQXA 4IOKA 4A8JA 3CH5A 3DVLA 5KSOA 4L4UA 3X1DA 4D4LA 4ZCIA 2AR7A 3B1WA 1XU4A 4KBGA 4FD2A 2ZPTX 1JAIA 2C95A 1D8TA 3SYKA 3I62A 1ZM2A 2REOA 4HAZA 2ERXA 2PZEA 4Z8XA 3SJZA 5JHHB 2B21A 1S96A 2FJUA 3FKSA 1ZBDA 4LX0A 1E2DA 2JJ2D 2ZI5A 4W5HA 1YZUA 2IYZA 5G3YA 3SQWA 1NMZA 5HTKA 1R6BX 2IWRA 2HLDA 3B78A 3WP0A 4O2RA 2OSBA 1LF0A 4LV5B 3IPYA 1G8YA 5D3MA 4MRPA 3KXKA 4IOMA 2XNSA 1ZUIA 1E2NA 1VG8A 1E79A 3KKPA 1IQPA 1X8JA 2AN9A 2O0KA 2ZS7A 4Q18A 2ZRGA 3T1VA 1G8PA 4UKDA 1GL6A 3NVAA 2OEPA 4GZLA 4A6PA 1SVSA 4KU4A 4PHHA 4LC0A 1C1YA 2FU5C 5EQTA 4CZ2A 4F92B 1W5TA 5F9HA 3MWYW 3R20A 4DDWA 1Q1QA 3PR1A 3MMPA 5SZHB 2D2EA 3NBYC 2DWQA 3CF2A 4NYMR 2RHMA 2BBSA 5EZ6B 2GJSA 1ZNXA 3AF3A 5KPDA 5F98A 4ERNA 1OFIA 2LKCA 3OFNA 3THOA 4P4SB 2GJ8A 3SI7A 5FOXA 3RYTC 4FWIB 1VMAA 4JT2A 2V54A 3LRPA 1LVGA 1ZD9A 4HEJA 1QZXA 5CJ2A 4TLBA 3T1TA 4DDTA 4TMZA 1F3OA 1P9WA 4JL5A 2QORA 2R9VA 4C9BA 2QROA 3I72A 2KJQA 5JSZA 1RC8A 4Q1FA 1JNYA 4A4DA 3S1AA 1JAHA 3LW8A 5EXTA 1CR0A 4ZCMA 2ZJZA 5EJEA 1D2NA 4Q02A 2CE7A 1I2DA 2FN4A 2OE2A 1XTQA 1U81A 2ZU0C 3AP3A 2Y8EA 3KJIA 4O2LA 4QG7A 3AUYA 3C5HA 4XH9B 3TQCA 1A82A 4B74A 4EPTA 2JLYA 2O8CA 3ZZUA 2QT1A 3BRWD 1EWQA 1UKYA 2KI5A 4PAOA 5FTNA 1XEWX 4D81A 2ZYVX 1IN4A 2NPFA 1A4RA 1T0HB 2CEAA 1NSTA 2D3WA 5AR1A 3QF7A 4PPFA 2ZRHA 1SVKA 3LNCA 3AH8A 4JLJA 3H0KA 4TQ9A 1K5DA 1Z6XA 2IF0A 2RKOA 2GEDA 1PUJA 2RGGA 4B34A 3RSLA 3I8SA 5LD2C 1XXHA 3SS8A 5FUWA 4DLYA 2Z5FA 1M7HA 3Q72A 1J90A 1YRAA 4P3YA 3V00A 1EESA 4AKEA 3D31A 2ZUCA 4OL0A 3VR3A 2FF7A 4IVQA 1RYFA 2CVHA 3W9YA 3LWNA 3L0PA 1IY2A 2J3EA 1L4YA 3QEJA 4GNKA 4KLNA 1H8EA 4B32A 2WIBA 4A0RA 1DAHA 3RHFA 4LJAA 3WBKA 2QBYA 2N42A 2VHQA 3CM0A 1PLJA 4M1KA 5FBVB 2QSZA 1N6LA 2V9PA 1Z29A 4B3XA 4URVR 3CX8A 2GJAA 4YC7A 1Q1BA 3GLHB 4TTRA 2PCLA 5KSPA 4TL6A 2WOJA 3IBGA 3KTAB 5BYKA 4WAUA 3GJ8A 3SC3A 2GHIA 3VNUA 1KAOA 4DEXA 3NTUA 5DHFA 2GXAA 1XD9A 3W3ZB 5HKKA 5FBRB 5B57C 3B1YA 4MUAA 4TYNA 2GVDC 3NXSA 2IYTA 3CUEF 2J41A 4WW0A 5IHPA 3DDCA 4LBYA 4WXPA 3QOFA 3BFXA 1U8YA 3M0EA 1W36C 2F1JA 2GJKA 2W0SA 1LS6A 3DHWC 1T3HA 4JVNA 1VCIA 5EE1A 5CJPA 3ZIAD 3SYLA 1XCGB 1YZNA 1G291 1R5OA 1Z83A 2CLCX 2H18A 2XTZA 4DZZA 2O8DB 1JR6A 4C7OB 1E2HA 4HLUC 2BCGY 2W2VA 1P72A 4JKIA 1N6OA 5KHOC 2NPIA 4DCVA 4Q4HB 3THYA 4DLXA 4II7A 1MO6A 1TNDA 1G21E 5DO9A 3WP1B 2IYUA 2NMVA 3VX3A 4V0KA 3GLGA 4URWR 1EFRA 4PQFA 3CZQA 1T8UA 4A82A 1ELOA 2ATVA 1OXSC 3EWAA 4IVRA 4QGHA 2FSIA 1NLZA 1NVVQ 4GRAA 4URUR 4GZMA 2ATXA 2YOFA 5SZIA 3TBKA 2FGKA 1DVRA 3BWDD 2ZI4A 2Q9BA 1IHUA 3KKNA 3QQ5A 1RIFA 2XGJA 3KKMA 1BYUA 4FN5A 3CLVA 4OI1A 1Z08A 1JJVA 4C0QC 1XZQA 1ZP6A 2QZ4A 4LOAA 3VU9A 1CR4A 3HPRA 2ZJ2A 4A6XA 5H70A 2JLSA 4EPXA 4RSGA 2CLDX 3DPUA 2RAPA 4G5SA 4LV6A 5AUNB 4D25A 1GVNB 2ZR7A 3JZMA 1XTIA 5H1YA 4LJ7A 5C4MA 4KODA 4WOPA 5CYOA 4F4IA 1P3JA 2IYSA 1L7VC 1RRFA 2YV5A 2R2AA 3GQBA 2XB2A 1GG2A 4CW7A 2XOKD 1CJUC 4UJ3A 3KZ1E 4BLQA 1ZC3A 5D3MB 2QAGB 3HYRA 1OIXA 3FTQA 5DE3A 3P4XA 1KDTA 2WSMA 5IK2D 1D5CA 1HH4A 3FMIA 3ZIAA 4L9SA 2C04A 2WMOB 4DT1B 4NCKA 1P9RA 2YHSA 1ZINA 1AQYA 4H1UA 1BMFA 1Z8FA 2Z6VA 4NCHA 2GK7A 2Q0HA 1N6IA 2JJ1A 5SZJA 3TIFA 3SFVA 2NIPA 3CR8A 2DY1A 1FFHA 4B35A 1G8FA 5EP3A 2ERYA 1KI3A 2FV8A 3MUFA 4JIMA 2W6ID 2REBA 1ZUNB 4DB4A 1JALA 1FTSA 2EYQA 3GEEA 2QU8A 2ZI3A 4A1FA 3M6AA 1I4DD 1I2MA 3QNUA 3WYFA 1Y3AA 2BEKA 2AWOA 1E2JA 2C77A 1ODFA 2NGRA 3KUCA 1M8PA 1QVAA 2QRNA 2RGAA 1LV7A 1IY0A 5BW8A 1WRBA 4LHXA 5JSZB 2ORIA 4UNSA 4FMDB 3RS4A 2IUSA 3C41J 4TLEA 3S1AB 1FUKA 5BN4A 4WZBE 2RGCA 2A5FA 5ELXA 3EIQA 2JEOA 5FOWA 2H17A 2ZUDA 4HLCA 4AIIA 3W5IA 4BFZA 1W0JD 1OFHA 4LZZA 3Q5EA 1XBTA 1NY5A 3NHBA 4Q9KA 3W34A 1KOFA 2P6UA 4DUGD 4EAQA 1E4VA 2K5UA 2TMKA 3CX6A 4OHYA 1G41A 1N0VC 1E9EA 4IDOA 4MITA 4F91B 4ARZB 2O8CB 4BASA 1D6JA 1UEJA 2CL0X 4NMMA 1HY3A 1CEEA 2IS6A 1Q22A 2X19A 1CULC 1OFUX 1S4QA 2C03A 2IS2A 1E96A 1F2TA 2ZR9A 3L8ZA 2QPTA 4CIDA 1EWRA 4G01B 1S1CA 3B9QA 3KJHA 1DE0A 3AF4A 3FFBA 3GJ0A 4JMPA 3CW2A 2WWYA 2ZXUA 2GNOA 4Z1MD 4V0ME 4LK2A 2ZI9A 1XXHB 3F0TA 4XIGS 2BVNA 2FSGA 3MWJA 1T5IA 2HXSA 1V43A 2GF0A 3TKLA 4IJMA 1GM5A 1Q1ZA 3QVUA 1CJTC 3IPXA 2CBZA 3NHAA 1YZQA 3M4YA 4C0LA 4DB2A 4AYWA 4AKGA 1FMJA 2F43A 3QUSA 4M1YA 4JYBA 1E98A 4Q1DA 5EP4A 2CL7X 4DCNA 2DYKA 5J47A 3KQLA 1OXXK 4US0R 2QBYB 4DLRA 2WJHA 4A36A 1FP6A 4GOKA 4E5UA 2ZRDA 3OESA 5FPKA 4Q4AB 4OKSA 4NCJA 4TMVA 1QHHA 5HE8A 4ZPXA 2ZJYA 4KHZA 3TJZA 1T3SA 2XSZA 1F5NA 3AVPA 5FI1B 3A6PC 1Q20A 3BOSA 1KMQA 2QMUA 4KFSA 4M8NE 1KO1A 4LCBA 1N6NA 1WCV1 3P20A 1VYUA 4LPSA 3AVVA 4NYIQ 1M74A 1IN7A 1M34E 4I1SA 2JLUA 4AD8A 4QGAA 5EE0A 2IL1A 5A5GA 2RGXA 4TQUS 1W4CA 3UG7A 3EWSA 1G3RA 1ZAKA 3QF4B 3CPHA 4DSUA 1W0JA 1XJ0A 4PC7A 5LPNA 2IW3A 4DUGA 3FPAA 3IIMA 2B7BA 3K0CC 3W6NA 5KO2A 2ORWA 2CCGA 3KFXA 4ZKDA 3VTKA 1CXZA 1FZQA 2BBTA 1AK2A 1OHHA 3L82B 1W46A 2BJVA 4QBHA 5C1BA 2PX0A 2JLWA 4MRRA 3LQQA 1A1VA 4WXRA 1W48A 3A4MA 4K8OA 3LD9A 2CK3D 2VP4A 1UFQA 1UDWA 3LX5A 1XMJA 1D9XA 5EUMA 3K70C 2FZ4A 4ZDWA 3T12A 2GEVA 4DIDA 3P27A 4AKHA 2GF9A 3GLGB 4BGDA 4V0LA 3GLFE 1JEDA 3EASA 3P4YA 4TN1A 3BGWA 5E7IA 1E9AA 1XFAA 2GTPA 3OIYA 1DG3A 3BE4A 1A5TA 2ZROA 3VMFA 3UWOA 3VHXA 3ETLA 4ABYA 3BH7A 2KSQA 1U8AA 5AJYA 1R7RA 1IY1A 2NTYC 3UG6A 4Q9LA 5KPJA 3QENA 3SJCA 5TMPA 4ITRC 2W2XA 3BIFA 2ASEA 4KXFB 2OO7A 3VU9B 3OEHA 4HI0E 3FKQA 1UEIA 2ORVA 2EFCB 2O52A 3U6KA 1XPOA 1Z0JA 2ZRBA 1M6NA 5AUPB 1TPZA 1G7CA 2RGEA 821PA 3V4FA 1F60A 1EFTA 2FA9A 4MRNA 4BLPA 4C0HA 2GZAA 3AKYA 1NG9A 1AIPA 1VCNA 4JLVA 3CNLA 3QKSA 2VTKA 2OXCA 5L3VA 3EA0A 4OQFA 3DOEA 5CYPA 5J40A 2H92A 2H57A 1Z6AA 3LLMA 1J99A 3QPWA 2EFDB 4CGZA 1UM8A 4AG6A 2O8FA 2Q6TA 3F8TA 3QPUA 2HJGA 1T91A 4GDFA 2ZRPA 1KK3A 2A5YB 3LAWA 2XJ4A 4DLUA 3WHLA 4G5OA 3ADDA 3RDPA 2PCJA 3IO5A 4TMWA 3THWB 1KZGB 2AWNA 2IEYA 1XEFA 2A2ZA 1AKYA 2R8RA 1Z0IA 2PEYA 3IEUA 1T9HA 1Z5ZA 4MUBA 3BH0A 2GCOA 1FTNA 4A15A 1GL9B 721PA 2XZLA 1VG1A 4A2WA 1W7AA 3HP1A 1KDPA 5FBQB 1R5BA 4RCZA 4HAXA 1N25A 2HCBA 5P21A 1PLKA 4H1VA 4CRWB 3CNNA 2EWVA 2VP2A 1GKUB 1U8ZA 1PJRA 3H2YA 3QE0A 1AGPA 1D2MA 2GXUA 4RD3A 4RD6A 3P26A 1G6HA 2OFWA 2P6RA 3MCAA 2IF2A 3KXIA 3U60B 3LW7A 4URXR 1TUIA 5JZVA 5TVKA 2GXQA 2IHYA 3CZPA 3EIEA 3EZ9A 2JAQA 4JVMA 1OKKD 3K09C 1E4YA 1G8GA 3K0SA 5EZ5A 5GJVC 2GESA 2ZR0A 3QPVA 4Q47A 5EUQB 5L8VA 3ZZ0A 1SXJC 2HF9A 2FG5A 2ZIAA 3PCRB 4IOLA 2WJJA 1S3SA 4G5QA 1BOFA 4Q7MB 2JLZA 4LBVA 2YYZA 3LXXA 4M9XA 1WE2A 3SYNA 2YWFA 5F2EA 1E99A 2NO1A 3R9IA 5JJIA 5GJWC 5EE5B 3RC3A 4MGYR 1AZSC 1N6RA 2IBMA 1W36D 3REGA 3CWQA 2F43B 3IHWA 1KY2A 4LV8B 4DRZA 4HLDA 4KV9A 3SU8A 3RWOA 4P32A 2N1BA 2CVFA 1XXHE 2ZETA 1E2KA 1RFLA 1ZIPA 1DBSA 4MRVA 1IJEA 1JI0A 2QENA 4V03A 1KIMA 2Q3HA 4ZO4A 3GFTA 1QHHB 3TNFA 1WP9A 2F3RA 3TSOA 1Z0DA 3ZDQA 1OH5A 2RGBA 5HCNA 4D4MA 4IFBA 4I1OA 1NRJB 2IHBA 1KI7A 1L4UA 1YR6A 1RPZA 2D7DA 1FQJA 1VPLA 1TQ6A 1RYHA 2X8AA 3TK1A 5LB4A 4US1R 1QRAA 2WOOA 2QTHA 4PC1A 3VX4A 2NO6A 3GLIA 3JZAA 4EJSC 3K0FA 4FINA 2WWHA 5CIWA 2PMKA 4P31A 2BJWA 3B9PA 3M1IA 2GKSA 1KK2A 4DLVA 1QHIA 3LQRA 1MR3F 3AKEA 3NG1A 4XTCS 2RGNA 5FBWB 3UMFA 2V1XA 4TYWA 2F1RA 5CB6A 1KI2A 2WPDD 1Q12A 2ZI6A 2XX3A 1O87A 5EXXA 4E03A 3U2QA 3RWMB 1CF4A 2BMJA 4C3ZA 2WJVA 1RW4A 3PUYA 3O8RA 2VBCA 4XJXA 3CRQA 5L3RA 3FE2A 3AP1A 1DELA 4PZZA 8OHMA 1AZTA 4MQBA 3DZ8A 1JECA 2HT1A 4DBLC 3BB3A 1EX6A 3X1XA 4Q7KA 2PLFA 3CRVA 2G0TA 4B47A 4TQAA 1LS1A 2J0VA 1M7GA 3VKWA 4UJ5A 2WWXA 4JBYA 4OYHA 4URYR 4V0OA 2RCNA 2ZITA 4UNNA 3LBIA 3HDTA 1E0KA 4FWTA 3AP2A 4HB3A 5TDHA 3RVBA 1QHGA 1W44A 2WAYA 1G18A 3Q7PA 2YWGA 5FTJA 4CT5A 4DLSA 4C2TA 5IF9A 1XEXA 4X8MA 5FR2A 2AFHE 3LH5A 4Q1BA 3VR6A 2P67A 3ZVNA 1OH6A 3QY0A 3Q7QA 2WJGA 3IQWA 2W6JD 5E7JA 1TQDA 2ZU6A 2C2HA 1SHKA 2DWOA 1P2UA 4IKEA 3W8RA 1W49A 2GEUA 3LV8A 4W5WA 1B0UA 2GXSA 3GEHA 4XOIA 5BYJA 2V55B 3C14C 4TTPA 4B3FX 1K5GA 3OEED 3Q8XB 3SHFA 1LB1B 4V0NA 2ZE5A 4ZIRA 3BB4A 3LDAA 3A1TA 1JQLB 3QKSB 4BE7B 3CPJB 1D9ZA 1CJKC 4W5JA 4B44A 3I3SR 4Q00A 3W90A 2QPAA 2ZYUX 1E2LA 4AYXA 2J0UA 5AJXA 1SGWA 4LSGA 1YR8A 2VH5R 2O8FB 3KX2A 3HYTA 521PA 2FPMA 4B48A 3U3OA 2RB4A 2OBLA 1G5RA 4QBFA 1HT2E 3FFAA 3MFYA 2F6RA 1E9BA 4WVFA 4PSVA 5AUOB 4R9UC 2ODWA 2QAJA 1TQ2A 3HJNA 1RRPA 2QMHA 1G17A 4I99A 4DEYA 3LX8A 2F9MA 2ZE8A 3AEZA 3BORA 4Q7JB 3RRZA 2WJYA 4RZXA 4NBSA 2ZYTX 1JPJA 2ZANA 3VR2A 1NBMD 3GP8A 1P6XA 3C8UA 2ANCA 1GNQA 3OF5A 2OBMA 5LB2A 2GCOB 4QHTA 3EPKA 4JLDA 1VTKA 5E3HA 4Q03A 3PIRA 1X1RA 4FIDA 4C0AC 1L8QA 4P0TA 3ZD6A 1KK1A 2FSHA 4BWYA 1YR7A 2FSFA 4PO9A 3QEOA 4DVGA 5L3SA 1JR3E 4OHZA 4ACAA 2J7PD 4HUQA 1R0ZA 3MLEA 5K8UA 2ZAMA 1KNQA 2W6JA 3K1JA 3MRSA 3U4QA 4C2UA 3K0EA 3Q3JB 1Z2CA 1SKYE 3GCGA 2F3TA 4LBZA 1TQ4A 2JLQA 4NE2A 1XMVA 4BECA 2JIZD 2Q9AA 3KFVA 3OEEA 4QJ4A 4B71A 4XD7D 2DPXA 1N6PA 2O8BA 3B7GA 2F1IA 4WA7A 1NN0A 1U98A 4Q9HA 3O8BA 4GFDA 2R6CA 1KAGA 4N1AA 4PC3A 3RS2A 3I8XA 3PVSA 2H5EA 1MT0A 1TX4B 4NDZA 4OJKA 1UBGA 2MSDB 2OFOA 3RNLA 5DSZA 1KI8A 4MH0R 2JJ2A 1RVDA 5FPYA 4XVRA 4OQLA 4KO8A 1BYIA 1XB2A 3AKDA 1G7SA 3IILA 4RY2A 4LJ6A 1R0WA 2G77B 1J8YF 2IYYA 3KB2A 2DCUA 3VQTA 2BV3A 2OUKA 4M53A 4PO1A 2HF8A 1SXJE 1MO3A 4TL7A 4B33A 1G7TA 5J4HA 1AM4D 1K8RA 4OI2A 4BFUA 2ZUBA 3K0AA 3K70D 5BN5A 1NBMA 2GCPA 2GRJA 3G82C 3ICEA 3LBNA 1E0SA 3QKTA 3RANA 4ZI2A 1E2QA 1G16A 3ASYA 2QI9C 1KSGA 2O0JA 5CDFA 1T5LA 2AXNA 1OPXA 2CCKA 3EARA 5HZKA 4OK6A 1R8QA 2PLRA 2WICA 2QPOA 4Q4JA 2A30A 5L3QB 1XX6A 1Z0AA 4YMSA 5FH9A 2J7PA 4DKXA 2O8EA 2Z43A 4OHXA 2ZI7A 2RH5A 3A37A 4KCGA 3CPEA 3D8BA 4Q7LA 4LRWA 2WVJA 2ECKA 1TF2A 2QGZA 5FFMA 2R44A 2NO7A 1L2TA 3FHOA 4PZLA 1P62B 2JIZA 4RFSB 5C4GB 3NC1C 3ZYCA 4E09A 2BDTA 4JBXA 4XD7A 4I1VA 1CJMA 2ZE7A 2XITA 3OHMA 1NMYA 4JLAA 2BMFA 4MKGA 4MYTA 1AS0A 3WBJA 1X1SA 4LGMA 1GNRA 1NVXQ 2CHQA 3B85A 4JVLA 4Z51A 1G3UA 3GLFB 2YWEA 4HB2A 1CKEA 2G1KA 4HATA 3R9XA 1F2UB 4QBGB 1W36B 3UXMA 3AQ4A 4F4JA 4XWOA 3PUWA 3WXMA 2CJWB 4HZUA 4PQRA 3B6EA 1FQKA 3I1FA 4E07A 4BZPA 1XEXB 4CEHA 2GBLC 2X77A 1KSJA 3EZ2A 3A1VA 1HV8A 3FGNA 3AF2A 5B64A 1JB1A 1JR3D 2EW1A 4MKFA 2KB0A 1F48A 5BQ5A 3LA6A 5EXSA 4BUJA 1HT1E 2QM7A 3VR4A 4A8JB 4JSYA 4M9SA 3DKVA 4IOJA 2OG2A 3NWJA 1ZU5A 4FMCF 4ZIRB 3CONA 3BJIC 1E9SA 1ANKA 1NI3A 3WRXC 1YE8A 1LW7A 5G3ZA 5GADl 4FMBB 2KBEA 3THXA 1NG1A 2JDID 2HCJB 3K53A 2XTMA 3ZLJA 1KDOA 3WMEA 2J0UB 3KQNA 5DN6D 1T8TA 2JGNA
chains in the Genus database with same CATH superfamily
3FZYA 1X77A 2C99A 2VH2A 1P1HA 3AM4A 4GG1A 3X43A 1ZSVA 5B2ZA 4CQLA 3T99A 2AE1A 3OJXA 5DTRA 1USIA 1R5NA 3EGDA 2GFQA 1ULHA 1I4WA 1MIOA 3HXLA 4UXHA 1QHNA 3FNQA 3KLPX 4M1SA 4CG3A 3B1ZA 4JYCA 1V7ZA 3LKBA 3TGLA 3MC1A 4DWOA 1ORHA 2JAXA 3LUJA 1FP7A 1VLHA 2E1RA 3LK6A 4RPKA 4XB6B 4O4IB 4TM8A 1QF7A 1GIAA 4GO1A 4XM1A 5GJBA 3BGSA 2QAGC 2A5GA 2QN8A 5IN4A 1GYPA 2VJNA 2Y6VA 1B76A 1OLOA 2EL9A 1KZ4A 3MAAC 1OD6A 2JCVA 3PNOA 4HDCA 5JNTA 4OO3A 1B15A 1C4XA 4KQXA 1E66A 1EVKA 4FX2A 4ZV4A 1U8UA 3CF4G 3CZMA 1C7FA 4QAQA 2IX3A 2BWJA 3GGOA 2FWRA 2HJVA 3NANA 1TW3A 4GM4A 3FSJX 3IUNA 1V11B 1G8AA 5TMDA 1XJCA 1KRWA 1DMRA 1GYQA 3JQDA 4RVDA 3S1LA 3QI2A 4BQQA 4TYMA 4ZYYA 3EEYA 3C4JA 3A6FA 2DLCX 5D1HA 3JWGA 4JVOA 1EG2A 1ZUHA 2PNFA 4G3XA 4DRXB 3T4XA 2IDMA 1FS5A 2YV2A 3L0ZA 1Y9EA 3MT8A 4H9GA 4A0FA 1R15A 4Q7EA 1HNXB 3IXQA 4J1QA 1EH5A 3JVVA 5LMCA 3BJMA 5EWMB 1T1GA 1WTAA 5EHGA 1R9NA 2HNBA 2GBIA 2D5AA 2PR2A 2F8TA 1JEOA 3GJYA 1FL9A 4Y2HA 4DBVO 2WNHA 2Y6UA 2OQ2A 1I33A 3OECA 5A5EA 4YFVA 3W3AD 3QUBA 3R3ZA 1XNQB 4MKHA 4M9UA 3CF6R 3KJEA 4G0NA 4M87A 4KYUA 5HGXA 4MIYA 4UUNA 2OFXA 1E7RA 4GOXA 1MAVA 3UMCA 3WQRA 2DOKA 5HSGA 1UOEA 1E1RD 1ORTA 2ORED 1T2NA 1WUYA 1XCJA 5HM6A 4G2TA 4X9XA 2BFOA 4D44A 1R6DA 1WXQA 2FW6A 2Z1MA 3KDSE 4FEGA 1JPVA 1U7HA 3F6RA 3GJ7A 4L9WA 5FNVA 5NLLA 4COKA 3GZ4A 5EZYB 4RF5A 3GVIA 1Z06A 4E2WA 1EFUA 3RLFA 1UBJS 2QQGA 1NMEA 4PU0A 4KP7A 5D86A 1G1MA 2Q62A 2JATA 4R2IA 4YRZA 2Y66A 1Z4QA 4YONB 3PCXA 3JQ8B 3KWFA 4ZEXA 2MIIA 5GV8A 2OMKA 1BU5A 1YJAA 1HFJA 4TKUA 2Z2JA 5BN5B 5DLPA 1KDRA 3FCUB 5FPSA 2HA4A 2A78A 2IY7A 3IKVA 3MGGA 5JE8A 2WVAA 2V7XA 3IDQA 2C2MA 2OGWA 3L3BA 4N5NA 3B5JA 2OK7A 3NEYA 1OF1A 2ATEA 4BKOA 5LIRA 1NZFA 4LCEA 3ZE0B 3PTAA 4DR6B 2P5TB 3BZUA 2CBXA 2Z83A 1XNJA 4M0EA 2JGIA 2ZUEA 3IMFA 3DLBA 1EVZA 4RJJA 4WX2B 5JNUA 3S0JA 1VG0B 2FPPA 3RK4A 4GVLA 4B2IA 1EAYA 4LRUA 4JL6A 4BFLA 2EAUA 1X7GA 1UMDB 2NN3C 3IBCA 1KFBB 1OXTA 3P32A 1A7JA 4XVUA 4QM7A 3F90A 2R3SA 4J03A 4BNHA 3RUPA 3E58A 5B4VA 1N2CE 4W5QA 4F92B 5UKDA 3EPLA 4GP9A 3RYIB 2O2SA 1XN1A 2P9GA 4NULA 3JASB 4YWJA 1NX6A 2I29A 1VKJA 3HJTA 3M89A 4MQ6A 3FSRA 4QPNA 5ECYA 2LPMA 2AGVA 1XVLA 1P2SA 3NHFA 1PU2A 5AK5A 1E3MA 1EM8B 3R8CA 5IVHA 1OYWA 3PSAA 1HEIA 1OIWA 1KPHA 2FE4A 4M22A 5AKIA 3GNLA 4JI5B 1NVEA 4CM8B 2CNBA 5JH7F 3OZXA 2V7QD 1K97A 4MW1A 1PEKE 1RI2A 2Q5EA 2PX8A 2B0CA 3QXCA 4W8HA 4FDLA 5DK4A 5KJ1A 1Z7YA 2RC6A 2X0KA 4DFDA 4Y1RB 1ZVQA 3OJEA 1QGUA 3VKGA 5EE3A 5U1PA 3RSQA 2KHZA 4LNUA 1P6QA 1Y1KE 2AQHA 4TOIA 1QWSA 3NKVA 1T9KA 1JT9A 3JY6A 3EBPA 4KBFA 2P5YA 3TTWA 4ZCSA 1ZXBA 2HM7A 3TZKA 1HETA 4EFMA 2PVSA 2IYOA 2Q29A 5B2FA 3Q1KA 5AW7A 2R00C 1CBUA 5C3UA 3Q1LA 3G89A 4UOEA 5LBIA 2QXUA 3DZBA 4K81B 4N0EA 1WNTA 2ZJAA 1J7KA 2XVZA 4QLAA 4BXOB 2P2LA 4G0QA 1DJOA 4KQWA 1RTTA 2HB6A 3JARB 1MX3A 2PXCA 2HO5A 4OM8A 2VCHA 1L3BA 4IR7A 3ORQA 1RI5A 5HKBA 4KK4A 4ZZIA 1OW3B 4JYZA 4L5YA 1JI3A 1XDWA 2QQ0A 4YA6A 1D1QA 1ZNZA 5CCEA 3PXXA 1EE1A 1JG6A 1L4KA 4AJ1A 5KQLA 2IS1A 5K9ZA 1UAAA 3AESB 1WZIA 4XWWA 1NJ2A 3GEGA 5A1TA 1KGSA 1I2ZA 2D5LA 2I55A 3VBCA 5A3RA 3DVQX 4DA6A 4CKWA 4ZMRA 1YR9A 3MTIA 4XKJA 4AP6A 3T7KA 1LRLA 1SD2A 1I5OA 4Y6PA 5FUYA 3T3IA 2Q8QA 3HFJA 4FWBA 4FYJA 4R1OA 3IP5A 1KU6A 3OQIB 2PPLA 5T4BA 4TUYF 4XVQA 3ANSA 2X40A 2DQYA 3ZNOA 3HUUA 1R1DA 3EAQA 3L9WA 1KI4A 1YO6A 2D5IA 4H31A 2Y93A 3LRTA 1AG9A 2Q28A 3BTVA 4OUDA 5IJ9B 3MFQA 4YPVA 2W4MA 2RG7A 3DBVO 4WVLA 2WYIA 1U0JA 2Y1OA 3L77A 1Y4SA 1ADBA 1Z88A 2QSYA 3PITA 4FK8A 1PJ8A 2ATIA 1IATA 2F3QA 3H65A 1Z0KA 1U02A 1VL2A 1IRIA 2HDOA 2PKQO 3D5TA 4IXDA 4LC1A 1E1QD 2IU0A 3K05A 7ADHA 5LMNB 4MP3A 4JC4A 3KWJA 4N40A 2HMWA 1ZNYA 2VYVD 4HQLA 3VR1A 1MEEA 2BGUA 3AI3A 3R74A 1S9HA 1C9KA 1Z5PA 1Z07A 2AX4A 2I2WA 2RMKA 2ZRAA 3LUDA 1YMUA 3PTZA 3CZ9A 5JH7A 2XDYA 3NASA 2Q21A 2XXAB 1LPMA 3K71B 4X6YA 3ZCXA 4QQFA 3EXG1 2HIGA 1E0JA 1MJHA 1NVMB 2FVXA 2QR2A 4GUDA 4HOYA 1X80A 2CYBA 3O4IA 4L2IA 4OSOA 4BQPA 4LRQA 1QRDA 1VBKA 1U1IA 1PYDA 1PDVA 1ZM4A 5C35A 4YP1A 3GA0A 3N2KA 2JEZA 3Q10A 5K3FB 1YJ5A 4AQDA 1CIVA 4Y2YA 4R98A 4BBJA 5C8VA 4UEJA 5BWCA 3X0DA 2DECA 4Y9SA 4F8EA 5CFOA 4B3JA 3QBVA 3RRNA 2FZKA 2INGX 4PYRA 5AUQA 4D0NA 2ZBPA 1F1JA 2OTCA 1AU9A 3KZXA 4ZQFA 3S8YA 3IBYA 1SKYB 3FFXA 1DRVA 2VC2B 2HD4A 4LQCA 2ZWIA 3PXCX 5ERGB 2DEUA 4RADA 2PY6A 1F51E 2RK4A 3NORA 3N8IA 1NL3A 2FW0A 1DXYA 4I4IA 5ALLA 1LKZA 3FHJA 2AEJA 2M6RA 1O1YA 2QRZA 3ZY4A 4FMCB 3EXHC 1KC3A 4DMMA 2MYNA 1ZI6A 4FYWA 3WGUA 3OU2A 1RCUA 2IE8A 4UHEA 1J2RA 2VJOA 3QGMA 2PT7A 4G0YA 4D4IA 1FIUA 4BY9E 1KJYA 3ICOA 3QVMA 2BF7A 2H11A 1CQPA 3QYAA 1FS4A 1QXSA 4FGLA 4MUJA 2HRDA 4DC0A 4F1JA 1MQAA 2JLRA 4HQOA 2IIQA 1U99A 4L8VA 5J63A 2P2DA 5DYWA 3VR5A 4BVLA 1T6YA 5CBPB 3AERB 2C7GA 3VC1A 4YXFA 3QVTA 2QTZA 4Z54A 2H2HA 2OAQ1 2P9YA 1XZMA 1A9YA 3IO3A 4RAOA 1FFBA 1ZH6A 3TAXA 1E6LA 5A71A 4AJJA 1WQ4A 3PCTA 5EEGA 1UDXA 2C8LA 4QPJC 4TVKA 3C6QA 2MSEB 2GVNA 1VCOA 3BEOA 1EFLA 3EOZA 1FUUA 3M4XA 3Q7SA 4TVSA 3AC0A 3FSGD 5C37A 4O33A 5CH8A 3N5CA 4NAHA 1DV1A 1US8B 1MUUA 2PJUA 5DGHA 4YP6A 3VISA 2I91A 3BSFA 2YKGA 3GVHA 3Q85A 3KD2A 3DH0A 3LY5A 3TOXA 2B4KA 5LR6A 5DH9A 4LSZA 3ZZTA 1FYWA 1SC3A 2AE2A 3WA6A 3IPLA 1XR3A 1Q3TA 2VF2A 3L84A 4DSNA 1XU7A 5E1DA 4YAJA 2YMQA 4IX9A 3R5HA 3R24A 1D2CA 3A1CA 3FFTA 1IVSA 2ZKLA 5I7AA 5ESXA 1TYAE 2R5NA 5LBTA 3TEMA 2WF6A 5SV2A 3PGXA 2WKQA 4HDKB 1ZJYA 3H2GA 2DB3A 4U2GA 3IQXA 1CJSA 2KYRA 4O1IA 5BSVA 3PDHA 1IBMB 3DM5A 4Q9AA 4TKZA 1YB7A 2A9KA 1A98A 4GBMA 1N7GA 1S8FA 1O5TA 3QOYA 4P34A 5CXUA 2OUIA 3RIMA 3TX2A 3L0DA 4IS2A 3IDZA 3TG8A 3NC4A 4KRYA 2Y92A 2VPYA 4PFKA 3LKVA 1XA3A 4HMOA 5DIZA 4HBGA 3MYRA 2Q9CA 3QSYA 3R9KA 1ABFA 2Y0DA 4D92A 3SVLA 2WWGA 1XQWA 3M34A 3DMNA 2OHHA 3EC1A 3N58A 4OGKA 3EX7C 2ID7A 4JJ6A 4DDHA 4BX9A 4BPBA 4GLBA 2GETA 2D7JA 2ODBA 1Y33E 4NQRA 4ND8B 4MGKR 2PBZA 1PIWA 4WNCA 4XSHA 3K4QA 4RVGA 4R8SA 1TCCA 1YK0A 2DJ5A 2NXWA 2G9QA 3DHNA 9LDBA 4DR3B 2DBYA 3A4IA 1KJZA 3GHHA 5CLFA 2C57A 3DHEA 3KTAA 3Q98A 4EMSA 2OZEA 4RHEA 4OH1A 3COJA 4HDSB 5JJLA 2P9TA 3HZHA 3NP7A 3C39A 4DJJA 5CFZA 2AS0A 1DADA 4N3NA 1QVZA 2WD7B 1FOEB 1QG2A 1VDZA 2EBHX 3K5PA 4R05A 4BFWA 4HFMA 4YN3A 2GZHA 2IHTA 1E32A 4D5EA 6ADHA 1GY8A 1IWBB 4L16A 3SXUA 2PD4A 2I2FA 3NW9A 5KNCD 1NTRA 2G5TA 1VBMA 5CA1F 3MAGA 4L75A 1WSWA 4XJVA 2IXEA 4UEKA 1ZXLA 1PVDA 3PWSA 5F5LA 4EJMA 2MSWA 2ST1A 1KQFA 1W1IA 2QUJA 4YDRA 3V32A 3HY6A 5KQPA 4IO0A 3EPHA 3COVA 4N5LA 4E2XA 1S8NA 1G3IA 4DGSA 1J2JA 4J90A 4CMCA 1B74A 4J4HA 4EUNA 1EM6A 4C6TA 3QU5A 3EG5A 3LC0A 5TQVA 2W42A 1G0OA 1AQUA 5A0FA 2IEDA 4EPWA 2EZTA 5D51S 2BSXA 3N53A 3IHKA 3PC3A 4B6OA 2X7HA 1N5LA 3HR8A 1AV7A 1XCMA 5DHRA 5BW5A 2G72A 3KPJA 4F2HA 2X0NA 5HFNA 3S2GA 3GNSA 3E15A 3H97A 1DG1G 2PH1A 3Q5GA 1Q17A 4WGFA 3RVOA 1NVKA 1RAGA 1VHWA 2Q5JA 1CRWG 4QU9A 1OE0A 2N46A 5J5AA 3JYOA 3P2MA 2AG8A 3G5MA 4GAEA 1KMHB 3ESCA 3JVUA 1SUFA 1U0RA 2VCYA 1J00A 4DE5A 2YXDA 3AHGA 5FUQA 4CT4B 2Y27A 3I5XA 3SR4A 1ZS9A 1RWNA 4JCOA 4Q4LA 3G0HA 2PGLA 4LECA 4BMPB 2V8OA 3LPLA 2ZVQX 1YU9A 2ZSBA 4MV6A 3AM1A 1YZGA 2QUZA 2WMDA 3WZLA 2J5BA 2C2XA 3MMXA 4X84A 1JKIA 3H13A 2O3UA 2ODPA 3EBLA 2VJQA 1SULA 1OPRA 4HP8A 2HPZA 1B00A 4HNTA 2OXIA 1PGJA 5J4LA 2Z56A 3ZCPA 3QOWA 1DC6A 1HEUA 3UKOA 4IDHA 1WSAA 4F3NA 4O2AF 1E5QA 1JKMA 1NU6A 4LAFA 4PS0A 5IDYA 2PJDA 3FDIA 4ER5A 5DP1A 5IKEA 4AKTA 1PV2A 4Q19A 3I83A 1RJWA 1QS0B 4QYIA 2OD9A 4YAFA 2HLHA 4UAUA 1KEPA 1T0PA 1GA1A 2DP4E 2E18A 3FPBA 2IK8A 1CTQA 4QUEA 5GJCA 1HNWB 8ABPA 2R8BA 1F8GA 2DLDA 4QFDA 4PGGA 4LXQA 1BQEA 2WQZA 3QYPA 2PV0A 1J4AA 3VJKA 4NHEA 2W0MA 3GWZA 1EG7A 1QDLB 4U3JA 3RABA 5CA1A 1D2RA 3HKDB 5L3ZA 1YOVA 2WHQA 1LH0A 3QBEA 1XZIA 1IN8A 1J5PA 5HCIA 4C5CA 1RZ3A 5B2EA 3K9FC 1MRSA 3E7DA 3W4JA 3CRRA 1T4CB 4Q7QA 1FLNA 5IUJC 3QG1A 2GDJA 1TM2A 3AUTA 3HG7A 2ZT8A 5LQDA 2B7CA 1SCNE 2ZJFA 2HY7A 3LDGA 4PLZA 1CB0A 1N6HA 3C6BA 4M8IA 1YJQA 2JZCA 1TEHA 3SBEA 1KVQA 5A3QA 3PQEA 3JQPA 4B31A 1S2IA 2VUTA 4JHXA 4YP7A 4A2QA 1WMEA 1R50A 2JCGA 4KWIA 2IX9A 3BIXA 4UU1A 1DJQA 3NEAA 4IH1A 4R2JA 2I6TA 4TX1A 2C9MA 1VL6A 4CMHA 4QPPA 1SD5A 2PUGA 3VYWA 1Z33A 3OKPA 5HK9A 1THMA 2QLFA 3GAFA 2ZIVB 5ILGA 4E94A 1ECGA 1POXA 5BRAA 3CZ4A 2ZS9A 3ABSB 5AK4A 4G09A 1DRJA 1GTJ1 3O8QB 1FJGB 4M99A 4RE5A 2QTFA 3HUFA 5I4BA 5JEDA 4BFYA 4CIXA 4YJGA 1ORWA 1FP4A 1ZM3A 4GSKA 4HNSA 4N5DA 4UCXA 4XQGA 3D81A 3TH5A 4KYTA 4ARZA 4BVJA 2R87A 1LDGA 2PWBA 3I8OA 3NBQA 2X1LA 4B9AA 2JIDA 3JPWA 3AVUA 1NW6A 2FUNB 1DBIA 3HB5X 3UANA 1C50A 4EWLA 2NVUB 4DV0B 4D0GA 2NOAA 2G1PA 7AT1A 5K8LA 4G5GA 4MYDA 4TYPA 5DLYA 3W5CA 2B92A 3PV0A 1LVHA 1TQHA 2QTAA 4QTXA 4TTQA 3SJAA 2B35A 3GLIB 3WKBA 3HB1A 4L0MA 4ZMBA 2F2TA 4PLVA 4L4XA 1CFZA 3H1TA 1JFFA 1EBUA 4DCTA 5FA6A 2ENUA 4W7HA 4CEJB 1SCDA 1W96A 3B8EA 4K3VA 4NDAA 4BBPA 4ES6A 3G23A 4ZJYA 3NNNA 3SPXA 2ZSKA 4G9GA 4KN8A 5GONA 3H3XA 1S9DA 1TCVA 1JFRA 2YN2A 4ID3A 1W59A 2JJMA 5IAAA 3KYDA 2R65A 4E5YA 5LXTB 1SPBS 3MTJA 2YHIB 4G1EB 4ZAVA 1MPXA 3I0ZA 3MM4A 2A5JA 3I9FA 4QARA 1EGHA 1T5TA 5AW6A 1OX4A 2QZPA 3AUXA 1O0CA 3PC8A 5T57A 1ONSA 4DNXA 2BEJA 3V8BA 3ZV5A 1WY5A 4UTRA 3BVPA 2W90A 3E9DA 4D0LB 1M1YE 1PYGA 5AYVA 1JG2A 1GKYA 4HUTA 4R16A 4N12A 2HBQA 1NDUA 1T2UA 5TY0A 1JYSA 1V2HE 2FPGA 1C3JA 4UPEA 4RACA 1IONA 1H8HD 2G0NA 1UWKA 1ZICA 1SHZA 2Q4EA 4MS1B 2P35A 1JE0A 1M0WA 4WFKA 3KP1A 3EDOA 1SK9A 4NV0A 4PW0A 1RQRA 3RHZA 2PXXA 2RGUA 2ZRCA 1BW9A 2WT9A 2NYUA 2VHEA 3H0EA 5CGZA 2I5PO 5G0TA 3JQAD 2QOEA 3KJXA 2YY6A 3EYWA 3QKRA 5EIHA 5HP4A 4LFCB 3ILYA 1YF3A 3FTDA 1X1BA 3ZVRA 2QM8A 4MWSA 5FOSA 1ISGA 1GG9A 4Q1CA 3GYGA 1YRYE 4H08A 4XYMA 2OO3A 5CVVA 3TZEA 4ZHQF 2C7RA 2JBHA 4NZ9A 5IJZA 3FPLA 3A4YA 1DQNA 3BAZA 5A9SB 1NXWA 4EA7A 2R6DA 1GGKA 1QFZA 3BERA 5G0SA 5CA0F 2V4MA 1FFWA 4B2LA 3RU7A 4RYLA 3P9YA 3WLKX 4A8JC 3CKMA 4C30A 1YIAA 3IVMA 1HQCA 5FPTA 2IV3A 5JSUA 1JN0A 2FF5A 2N47A 3EZ7A 3CX3A 1DBPA 3E7WA 3DEKA 1DPFA 5EOVA 3T0GA 4A10A 1KBZA 5AVRA 3KQMA 2GLTA 1ATZA 2P2CA 4BMZA 2OB2A 3COPA 4HEQA 3LG2A 3DDNA 3MRVA 4JJIA 4LUCA 4QSHA 3T5BA 1WMSA 1QH9A 2P2SA 2Q0SA 4AJNA 2QRHA 3MBIA 4LF8B 1CVRA 1VJDA 4MNTA 4NICA 3DEYX 4X20A 4IFTA 1OILA 4L3VA 4EENA 1RPJA 2MSCB 1P5HA 4IDAA 4OQNA 4BKRA 1N2HA 2QD5A 1AK1A 2GWHA 2CXRA 2WSBA 3M1YA 3UMRA 4EGSA 5J23A 5COBA 5IS2A 1DIAA 1RR6A 3HUDA 4HDNA 4KRFA 3WK4A 5IJAA 2IOYA 2PZGA 1LQUA 2B36A 4LXGA 4D79A 5K09A 4YYEA 5J4VA 5AKJA 2E9SA 5BW6B 5KC8A 3PF8A 1V16B 1LTKA 1GPDG 4L27A 4NATA 4L73A 4W82A 3RFTA 4ARSA 3WO0A 3MIIA 2J08A 3IV6A 3KEQA 2QN2A 4I8XA 3KHKA 3ADCA 3A3NA 3AF0A 4FNAA 4CKEA 1UBSB 1Z4LA 5JWHA 1V4VA 2CLLB 1A9TA 2PH3A 1NATA 4HAIA 2E4UA 3E9MA 1VKHA 1AKUA 1Z5GA 2V98A 3DZJA 4QXAA 4DR1B 2PWPA 4MV4A 3L05A 2PL9A 1JF8A 3IUMA 5B37A 1E2EA 1E9DA 4E21A 3LQFA 1MPTA 5EXPA 1YRQA 3TW8B 2CYCA 3U7QB 4MKIA 4EI2A 3CUVA 3NBFA 3F78A 3EVCA 1FDVA 4JLNA 1D2EA 2EG9A 2YR0A 3WDLA 1LFDB 3NPAA 4GGMX 5E95A 2AK3A 1UADA 3PT9A 4GWLA 4DLTA 5JALA 4QUAA 2WY2D 4EW3A 3KS9A 5ALDA 2HQRA 4B7XA 1EGMB 1DINA 1NRWA 5CHYA 5JW6A 4DMGA 4D45A 1GN9A 3QG5A 2QE7D 1G38A 2PBFA 2ZB4A 3OX3A 4AL4A 2JHAA 5LQAA 3CR3C 5AVQA 4C0SA 1UMBA 4Z9AA 4B5LA 4ZOEA 2XRFA 4GYKA 4I3GA 2PGJA 2P2ZA 3CY6A 1UMKA 3DL0A 5H80A 4PN3A 1ZU4A 5ED4A 1SKUA 4XPZA 4E70A 1EGVB 2IE0A 3W9SA 2HQOA 4FZVA 1T8WA 1W76A 2IP1A 2BW0A 1GTVA 2WU3A 3C16C 3OJCA 4YJHB 5B7GA 3KB8A 5JECA 3FCXA 2JDIA 5LLSA 5HRUA 1C8VB 1Z6YA 3QXHA 5BUQA 1DBRA 1PSZA 1QZUA 5EZSA 3ZKAA 3MGCA 1PVOA 1USVA 2G5PA 4B8WA 1JBQA 2HQ1A 3PQ6A 3JCZA 4HSEA 4Z0TA 5C7IO 3Q7RA 1NR7A 1Z8HA 2C3YA 4RKQA 1VL1A 1OZGA 1TXGA 5DYGA 4PE5B 4DSOA 5EUCA 4UOZA 1XCPA 4LJ5A 3MWLA 2VQEB 3HNPA 3G6KA 5EHQA 3GG2A 2XUJA 3A2KA 3DC2A 2EIHA 4RK1A 5ALKA 3ESZA 1YDFA 1FSFA 3QTBA 3SGLA 4ATNA 1UBEA 1U0OC 2BMDA 1MJGA 2R4QA 2ZYDA 3I4CA 3TZCA 5KYKA 2FMKA 1YULA 3UY4A 4H0CA 4Z8YA 3TMKA 4AF7A 3IYLW 3OKAA 1SBZA 1VP9A 2GJ9A 2Y68A 2YBDA 1PKXA 5F7ZA 3R7WA 3K1YA 3W79A 3DQQA 1P4RA 3D7MA 2NU6B 1MV8A 4DWWA 2YVLA 5I6DA 4ZZ2A 3CEHA 3N07A 4TKMA 4XQ0A 2I65A 3UBTA 2G1JA 1PNOA 4MSUA 3D1VA 4UAJA 4XYBA 5DI3A 1KAMA 4K6FA 1PN3A 4Q4JB 1PLLA 2FE1A 2VT7A 4ZPJA 1GAXA 1JHAA 4JN6B 3FOWA 5I7WA 1A27A 1R4MA 3ISJA 2UUPA 3BHNA 3D02A 4PLHA 4YAGA 4I81A 1BG6A 5ALWA 1IFXA 3U26A 5FWDA 2WG0A 2IEBA 3K2IA 5JRZA 2ODNA 5LFAA 3RVKA 1G2OA 4BGVA 1EWTA 4ISCA 5ALQA 4JI7B 4HGNA 1XZEA 1OROA 4I3FA 4NMHA 2YVQA 4CG0A 3GD5A 1B8VA 4QPDA 1ACLA 1X9IA 3O75A 4FHFA 1UM9A 2B34A 2C29D 2AEFA 4M7RA 4BRWA 5A0VA 1O5OA 2XHEA 3NCTA 4KLZA 2DT5A 4P82A 1IN6A 1SJ9A 4C7KA 4ALKA 1ECJA 4GLFA 1M2GA 2KWIA 3SC4A 4B4WA 2CW5A 1CNFA 2FZ5A 4EJSA 2LNDA 1M1NB 2I4MA 4PPNA 2XWPA 4BFXA 4HYYA 1OXVA 1UAYA 1QRRA 1JDSA 1SELA 2IEAA 2XMCA 3V1KA 5EKSA 2VAXA 1MX9A 1P7YA 1U2SA 3NTXA 3VPBA 4AJLA 4B6FA 4IJWA 3HU1A 1N8TA 2W2QA 4P2BA 3WBFA 4ZVUA 1K9VF 1U0TA 3I01A 4H0FA 2FFAA 5EN4A 1DPGA 3GUVA 1DWPA 3TZQA 4PSDA 2WJZB 1VYVA 4UQOA 4B2YA 1DO0A 3RS3A 3W8NA 4QDKA 3TW4A 5JOQA 1Y8QA 3L0OA 3QXJA 4H6PA 1NP6A 4H6VA 2WSSD 3AFMA 4M7OA 3QIAA 5JS8A 1QIFA 2A1UB 4PWYA 4ZP1A 5JV5A 2GZDA 4TL9A 4F4CA 1E58A 1K98A 3LHFA 1D5WA 1RI1A 1X1CA 1KO5A 5FAXA 3SMVA 1PL7A 1MOSA 2VK1A 1Y63A 1QPGA 1E0AA 3I9LA 4DEVA 2IUUA 2Q6OA 1IQ0A 3RF7A 5LWHA 3AW8A 1J8QA 1MABB 3H9JA 5KQSA 2H1IA 3LT4A 1SOVA 1ULSA 3URMA 2XWBF 1W75A 2ZS8A 1ITZA 2PX4A 4P2GA 3D59A 2EU8A 2YJZA 5EERA 3CZAA 3NDJA 3G5LA 1M83A 3H19A 3OIGA 5BOSA 1A5SB 4DCGA 3JW8A 1H4VB 3FYUA 3OCCA 3EXG2 3W6ZA 2NO0A 2YH2A 4X60A 4KVZA 2V3VA 3KOXA 2X1VA 4IW3B 5AXBA 4L8LA 1AA9A 3TAUA 1N4DA 4O4JB 1GGHA 2J33A 5D7BA 1N2BA 3OZEA 2GAIA 5KYVA 4B40A 1CYEA 4DAEA 1DJLA 1UJCA 3DNMA 2AFVA 3AVYA 1VIYA 4R8RA 3BXXA 4DIEA 1PJZA 1RHUA 2R48A 5CITA 1EFKA 3USZA 3SKYA 3DLPX 1P77A 2A6PA 2OC9A 3C7KA 1D04A 4DC9A 1TEZA 1C3OB 1CEXA 2FZCA 3AHHA 3OHPA 1E4EA 1U8EA 5BSHA 1TVMA 1JSCA 2GFIA 3VV2A 1AKEA 2AXEA 2J9ZB 3LCRA 3SC2A 5MN4A 4GI5A 4HKTA 4MQ5A 4AJ9A 1ADYA 2AD1A 1QF9A 2WWIA 3HFGA 3VR4H 4FLEA 2R86A 5B3AA 4IXWA 3P5SA 3X3HA 3IIEA 1V48A 4LJSA 3FHTA 1ADCA 2QPLA 4P3PA 1WXWA 1GFSA 1H5NA 4CETA 3K5IA 5F3RA 2YWHA 4ZXFA 1JH8A 5FO0A 1MO4A 1SRQA 4P7JA 1C9NA 1G59A 1N2GA 2JFPA 1QPBA 2PS9A 1VLVA 1NPTO 3EODA 4MQLA 2JPDA 4C5BA 3LXRA 4EFDA 1GCAA 1TTTA 1XHFA 3TKAA 2L69A 1NUSA 2YNMD 4I1UA 1JIJA 1HNZB 1G63A 3B53X 4ECEA 2PS0A 3FTCA 1Q16A 1YL5A 2C5EA 2EQAA 2L18A 4ZVTA 2IXAA 3EA5A 4QC2A 3TRHA 4BVEA 1GPJA 3R7BA 4BV8A 5BV8A 3OT5A 1DAGA 1RS0A 4JQOA 2JAHA 1LJ8A 3KPUA 3J81A 3KDPA 3I76A 3H2KA 2ZLBA 2BEUB 4NBVA 4WH0A 3TKYA 1EX1A 2A4KA 4LI0A 1RM3A 2W6CX 3U0VA 1XD2B 1H1DA 1YS9A 3CUTA 2HHCA 4DIKA 3PFHA 2V0NA 4PSKA 1ZJZA 3H1PA 3D4PA 4BVFA 4RNCA 1EWVA 1KSHA 1J09A 3KLMX 4RD4A 3V4ZA 2QBYA 3SG0A 4B6RA 3FCEA 3X1WA 1UF9A 2ZRIA 4AO6A 4GE3A 4FBMA 1QV7A 4R41A 3VM6A 3WWYA 3ZXYA 5KB3A 3A11A 4ZAXA 2V9ZA 2WWTA 1FA9A 3DE0X 2GPBA 3C6XA 4X00A 4MINA 8ATCA 1FXSA 2XZTA 3PGJA 7MHTA 5F9FA 2WHRA 4MB2A 1JX6A 2OXRA 4ZI7A 1WA5A 1NQUA 4YY3B 1WPGA 3DLIA 1KYIA 1Q7EA 2CMDA 3I9V1 3HHPA 4RF3A 3D0QA 3ZK7A 2GAOA 2TRSB 4GVXA 3F5FA 1T2DA 2QMYA 4YCLA 1JQJC 4IHQA 2BZ1A 2FTKE 1AKWA 1O96A 1CQWA 1DOAA 5BSGA 5KHLB 4KYIB 2XNHA 3EIHA 5TXGA 3SHVA 1RJ9B 3VOAA 4B43A 1G19A 1O94A 2CNNA 3PC7A 2MYUA 4MS4A 2RHJA 1S2LA 4DREA 4B3SB 4D02A 3H83A 1XGKA 5B36A 3EYAA 1QO7A 2FXIA 1SO8A 2VH1A 4M6WA 4ZQIA 3W8DA 2HXYA 1OJLA 3L8DA 4QEDA 1GZUA 2DFNA 3N2LA 4CTNA 1UKBA 4PO3X 3FDXA 4MYCA 2OCAA 121PA 3NM4A 4XB2A 1RMTA 1FQWA 4PVCA 5H83A 1USWA 5EMNA 4QJBA 1WUJS 2ZZKA 3OE4A 4XIJA 3BSSA 4KRGA 1CB7A 1XTJA 4YWHA 2OT3B 1JDBB 2RARA 1IHYA 3T6KA 1TEVA 1T9BA 4OKIA 5JLJA 3TLCA 3D6TB 1KNXA 1TYZA 2EHDA 5FWXA 1U9IC 2W2TA 3EHEA 4QUIA 1LSJA 1I9GA 2FFRA 1IY8A 3DFUA 3OJOA 1WUHS 2FEOA 4FFBB 4OD0A 4PHTA 3T5DA 4DKJA 5KNBH 1OWNA 3E1SA 4ZOBA 2XMGA 4DY6A 3NH9A 3AI2A 2JASA 4JA2A 2XA2A 3VTFA 4ER0A 1M7BA 2N0SA 1WHTA 4IG9A 1WVMA 1Z3IX 3A7DA 2FOLA 1T6ZA 3H42B 2YIVX 1Z68A 3OICA 1KZ9A 3TAHA 1KJIA 3MTEA 4X64B 4AZ0A 4RDIA 1YR3A 4D82A 5LQNA 1QHYA 1YCGA 2WFAA 3HJHA 4FILA 4MEAA 1JIIA 1AO3A 2AH5A 4GLLA 1NMXA 1Y3CE 3ZCTA 2AYZA 2G6BA 3FROA 3GLHA 2H0QA 2QDXA 3I9V6 1Q0UA 3ZX5A 2VDVE 3AR3A 1D0VA 1KVRA 1ZH2A 2PWAA 2QSJA 3KYIB 4PFQA 5DM60 3GPCA 4QTYA 5IHXA 4YT2A 3FKSD 4U7JA 5EWLA 4YRMA 1P73A 1X7XA 4GZ3A 2Z08A 3KYCA 2WAXA 4KLRA 1GNTA 2NZJA 2C5HA 5HBGA 1PJTA 1EFHA 3MMZA 1FNMA 1UC8A 1THTA 1QFXA 2HLDD 4PPYA 2ZR8A 3DZDA 4KZKA 1J8FA 4MOWA 3TR0A 4L85A 1Y5LA 3VNBA 1WQ3A 3EOAI 4NK5A 4PGHA 4C78A 3GJ4A 3Q3GE 1QTQA 4HFJA 4F5YA 2YJ3A 2JAOA 1QQAA 4TMTA 3DOUA 4KW7A 5IJWA 2CLOB 3INRA 4Q12A 1BN6A 1MXHA 4ITVA 4KPYA 4CCWA 3BAFA 3IH5A 4IIUA 4QUHA 5HEKA 4G81A 4WMLA 4RHCA 4A7PA 1R8XA 3JSXA 3FVQA 2W48A 3V4RA 3FBGA 4JLPA 1I01A 1K0UA 4S35A 3ASZA 2BRUA 2JCSA 4UCQA 4MA5A 2RH9B 1UOQA 3ZTTA 4MYHA 4EA8A 1FVXA 3MWKA 1ZESA 4LJ8A 1UH5A 3TSAA 1Y9JA 3R40A 4BE4A 4DCCA 3EK2A 3E70C 4PX9A 5KYYA 1ZHHA 2AZTA 2I7VA 1F2UA 4BWVA 1YZTA 2VP0A 3PJRA 1JPNA 2J1LA 4TWZA 1BXRA 1C1XB 2RJOA 1TL7C 2RG1A 4H7DA 1V8ZA 2N1MA 3LQ2A 1I4LD 5DNAA 1GPLA 4EX7A 4AQYB 5JYEA 5EJGA 4LYHA 5KSWB 4FZ5A 5KTOA 2CXXA 1PJ2A 1YRBA 3NHUA 4C06A 2H31A 2HIHA 2NYRA 1PR1A 5BUSA 4RULA 2YC4C 3EQ2A 2XBUA 2V45A 1K89A 1AHNA 1HE1C 1QK4A 1ZW6A 2GEKA 2IU6A 3BEDA 1X7ZA 1P1FA 3EAGA 3LUKA 3NWOA 1IH8A 3OZTA 1NR1A 4D1YA 4US2R 3SQXA 4NH4A 1NUHA 1F9AA 2A86A 4LSWA 2YV4A 2RAFA 4AICA 5KYWA 3DVLA 5KSOA 3GNQA 1NXOA 3OETA 1U3WA 5ICGA 4YLEA 1E0DA 1AV6A 1E6WA 3DCYA 2ZJ4A 4X1KB 2WFMA 4MQEB 4EY4A 4X1OA 4P4LA 4LMRA 2ZPTX 4MVJF 2D4AA 2C95A 5HF9A 3FWNA 1FFCA 1WX1A 3HRKA 3SJZA 3WIVA 1K63A 3CLKA 4I9UA 2Z58A 4ADSG 1NW8A 1DUIA 4G5FA 1W30A 4ND4A 4XD2A 5BSWA 4W5HA 1YZUA 4NFSA 3IPAA 4BMCA 3O9VA 4DNQA 3SQWA 2FDXA 1MQ8B 1N8KA 3B3FA 3AHCA 4PZ9A 4JP3A 5TF0A 4O2RA 2OSBA 2ZT7A 3V8QA 1QP0A 5F9MA 4EYKA 3GRKA 1IUOA 2IZ5A 2XIJA 2XNSA 3HV2A 3JD0A 1ZUIA 3KTFA 4O4IA 4BO0A 1WCIA 2D2VA 1VG8A 1E79A 4MRAA 1IQPA 1FX1A 1MN6A 2AN9A 2OOKA 4Q18A 4X85A 3T1VA 3V4LA 1G8PA 4JXXA 4BNIA 1QC5A 2HWYA 3LOUA 4GZLA 4LC0A 3DEIA 1QCDA 4URHA 2FU5C 4CZ2A 4E2YA 4RPHA 3P52A 1RZUA 4Y1GA 5G4KB 1RT9A 3PR1A 3AL2A 4AZ3A 3OOHA 4KZPA 3TM5A 4XJTA 3ADPA 1STOA 2BBSA 1MVOA 2DKNA 3G2HA 2GJSA 3MJFA 5EZ6B 3UOGA 5JATA 4DR2B 2BYTA 3GT4A 1OFIA 2JAWA 2LKCA 2WAMA 5D6NA 4UQPA 2WTEA 3KCNA 3UTDA 4XX0B 3PNQA 3LQYA 1OMOA 1RMQA 4JT2A 1ZD9A 4S05A 4CTOA 1XK7A 2DSNA 3MOGA 3AJ8A 2AMYA