421PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
molecule keywords H-RAS P21 PROTEIN
total genus 53
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 421pA00
2I4IA 2IS1A 1D5CA 3AUXA 3MJHA 1YE8A 1KIMA 4QNRA 3AVUA 3ZJYA 1KI4A 3I61A 2F43B 3X2SA 1NMZA 2C9OA 4MGZR 5BN5A 1N0UA 1E2NA 1U2RA 1GITA 1KKLA 1OLOA 3BH6A 1GAJA 1CR1A 1P2TA 2OESA 2W0MA 4LOAA 4P0TA 5FBRB 2PT5A 2XOKA 3GLIE 1U0LA 5H1YA 3QI2A 4KFUA 2WJGA 1ZUIA 2OBMA 1KGDA 4HAXA 1W36D 4B2LA 3GFTA 4NZYA 4FCTA 2KI5A 2H16A 2O8DB 1Z5ZA 3CH4B 3NIBA 4IFEA 2AN9A 3T1OA 2UVQA 2BDTA 2BKUA 2WZQA 2KBFA 1Q1EA 4HAYA 1IXSB 4H1UA 1FX0A 2RAPA 4XD7A 1G19A 2GCOB 2IYVA 2ZSBA 5J4VA 3U4QB 2VHUA 2W6JA 2JDIA 4PQRA 1TEVA 5TXGA 2G0TA 4JZKA 3U7EB 2FGKA 5FTNA 1NG1A 2BKEA 4YMUA 2QMHA 2GXUA 5BXQC 1I2MA 1ZIOA 2IF0A 3RHFA 3KJHA 1UEIA 2WJVA 1KI8A 5DO9A 5FI0B 2QA5A 4NYMQ 3THXB 3KKNA 2GKSA 2V54A 2ZXUA 2GTPA 2GDJA 3KFVA 3QKRB 3W8NA 3KJGA 2B92A 2W6JD 1OF1A 3GLGB 3S1AA 4DJTA 4XD7D 5JS7A 1R5NA 4KHZA 1U0JA 1MT0A 1G7SA 2IYYA 1PLKA 5IK2D 1MOZA 4UXIA 5LDDC 3I62A 2J7KA 4YDHB 2B6HA 2ODNA 1SHZA 3Q5EA 2WWXA 821PA 4XVQA 2ORIA 1G3QA 1AZSC 1BOFA 3KJEA 4YXWD 4Q4LA 4GZMA 4C3ZA 3OFNA 1JPJA 2O5VA 4OQLA 3VAAA 4GP6A 4RJLA 2ZRGA 2BM0A 3P1JA 4X8LA 2G77B 4RZ2A 2ZVPX 3KZ1E 4IEIA 4ZV4A 2NO6A 4LZZA 1RW4A 1XD2A 3BGWA 2ODBA 1KSJA 1SQ5A 1VYVA 3OAAD 1T5LA 4MGYR 4D4MA 1JAHA 1EFTA 4Q4AB 2ZUCA 1NN0A 2J45A 5GJVC 2GCNA 1OHHA 1PUJA 1G4AE 4HAVA 4OHXA 2B8TA 2IC5A 3E70C 3PEVA 4C0LA 4I1OA 5JSZB 4RVCA 2KE5A 1WXQA 2HLDD 2YC4C 1EG7A 4BUJA 3TW8B 1LS1A 4B73A 2WICA 5F3WB 2XNSA 1GNPA 1G3IA 3DZ8A 3D3QA 3EWAA 4V0LA 3GFOA 4WZ6A 5G3YA 3I8SA 4L9SA 5FFMA 5E3HA 1OXXK 2CE2X 2ZU6A 1HUQA 3CX7A 5CB6A 4Q48A 1GILA 2QMEA 3GFPA 4P4SA 2C9CA 4V0ME 1E2FA 2OHFA 4AY2A 1KK2A 2VHTA 3Q8XB 3Q7PA 1NN3A 3OIUA 2OE2A 4ARZA 1FTSA 3DMNA 4IDQA 4CEHB 2ZI3A 4HI0E 4FWIB 4QGHA 1E3MA 3SYLA 2D4HA 5AUPB 4YQFA 1L4UA 2EQBA 5JRZA 2C99A 3ZGXA 1MH1A 1ANKA 1A5TA 1DELA 1F2TA 1T6NA 2FF7A 4US0R 3UMSA 4A8JC 4ARZB 2F55A 2V7QA 3TR0A 3WHKA 3HPRA 4ITRC 2HYDA 3EW9A 2NO0A 2CL6X 4A36A 5EP3A 5IT5A 5FOVA 2GESA 4KODA 2QP3A 2GZDA 4L4UA 1TUEA 3Q3JB 3TAUA 2JIZD 1H8HD 4BFTA 1P62B 1GRRA 2OLKA 2VP0A 5FOSA 3O8CA 5LPNA 3CRW1 4GL2A 4A6XA 2J0SA 3ZD6A 4Q7KA 4B3BA 2O8BA 4M1YA 4GT1A 4R9UC 3U4QA 2OAQ1 3F5FA 2ZTSA 5FPHA 1ZUNB 2CCKA 3B1ZA 1E2IA 4WAUA 3I92A 1JPNA 3SJZA 4JVSB 4NCHA 3KB1A 2OFXA 4URWR 1DVRA 2D2EA 4QOSA 1JJVA 1G18A 1XWIA 2FZ4A 3GLHA 3U2QA 1XCGB 5BYKA 4AKIA 1EFUA 1NKTA 3LH5A 2IT1A 5C46F 1XP8A 4RKEA 3RLFA 3ZVNA 3HR7A 4LHYA 2A5YB 1FQKA 4MDEA 1OFTA 2IXGA 3W3AA 1S96A 3ETLA 3OIYA 4KFSA 4QJ3A 1E9DA 2QQEA 4QM7A 3A1UA 4XIGS 4DLRA 2HUPA 1CBUA 1NY5A 4YC7A 1RJ9A 3TJZA 2CVHA 4P4SB 3GJXC 1E94E 3PG5A 4BEBA 2GJSA 2AFIE 2AX4A 5AJXA 5EXTA 3THYA 3IO5A 2QGZA 3IPYA 5D3MA 2VSOA 3DHWC 1AM4D 3OESA 3LVRE 4CEIA 1LVGA 2XSZD 3NEYA 3GLGA 1GVNB 4Q21A 2WJHA 1AN0A 1SKYE 1KY2A 2CLDX 3N5CA 3T34A 3L0IB 1XXHE 4DLXA 3EIEA 1XXHB 1TAGA 5CM9C 3I32A 1NVWQ 1BIFA 3THOA 5CB8A 4JYCA 2A3RA 3M4YA 3B1VA 1H8EA 3B13B 1RRPA 4FMDF 5LD2B 4RFSB 1XPOA 3I73A 1SXJA 3I72A 8OHMA 3K0CA 2JEOA 2OCAA 1ZM3A 5DNYB 3NTUA 1OV4A 4Q9HA 3EPLA 4BPBA 4Q1DA 5JLJA 2H8KA 3KDSE 1ZM9A 3TVDA 1KK1A 3SEAA 1R4AA 1OXTA 2NIPA 4HB4A 4F7WA 1T0JB 5KHOC 2Q0HA 3W34A 1NRJB 4MYUA 1D9XA 3REFA 4Z1MA 1XD2B 1RYHA 3N2EA 2IEYA 2GRJA 1DAFA 1W49A 5DI3A 4IKEA 2FX3A 4IDNA 2ZE7A 3F8TA 3JVUA 3QIAA 1Z2CA 1DE0A 3LY5A 4LSGA 4PO9A 4EIWA 2P0EA 4X8HA 1YR6A 3WY9A 1AS0A 1IONA 3X1DA 4E09A 4PC3A 2AL7A 2GAAA 1LV7A 2VQSA 3LQRA 3NDPA 1UAAA 4PSKA 5JWOA 3RYTC 1EFRA 5FR1A 2RGAA 4URVR 2GXQA 4IW3B 1GL6A 3U3KA 1H8ED 4Q9JA 4LJ6A 1W36C 1IY0A 1TQ2A 2ZE8A 1TQ4A 4U02A 1Z29A 1N0WA 2PT7A 3HU1A 1WBDA 3K0EA 3FYHA 2IS4A 2FWRA 2GAOA 1IOZA 1HQCA 5JSZA 2XGJA 3SDZA 1D6JA 1N6NA 3IEVA 5KSZA 3THYB 1J90A 3EZ6A 2CHGA 4DSUA 1SGWA 2YOHA 1M7GA 5JZVA 3EZ2A 1M2OB 2JATA 3OE7A 4AYXA 5C18A 4ZKEA 2E9SA 1W0KA 2WAYA 3AF2A 2G83A 4Q01A 2FFQA 4TSFD 3CX8A 4LJ7A 2QAGB 4DCNA 4QM6A 4BFSA 4UJ5A 3W6OA 4FMCB 4PO1A 3OHMA 3W6PA 1EK0A 2DHRA 2ZREA 4LC0A 4LDJA 3WRXC 4RSGA 1T4GA 4QBGB 3BH7A 5CDFA 1E2HA 2RKOA 1FMJA 2C78A 3GLHB 2W83A 1JECA 2ZR7A 3LBIA 1VG9B 1B0UA 1UBFA 3TSZA 621PA 4IOMA 1R7RA 1KI2A 1SXJC 1KJWA 4LYFA 2WSSA 1R0ZA 1L8QA 3G82C 3RS3A 2OXRA 3VR6A 4ZCMA 4YMSA 1XTJA 1U8AA 2WWWA 4EJSC 5L3SA 3EWSA 1FP7A 4LJ5A 1SKQA 2CVFA 2W6ID 2ODEA 4JLKA 4NMMA 3UKDA 1N0VC 4BFUA 1X3SA 2WJJA 3NBYC 2VP2A 4E03A 4WBSA 4KO8A 1NSFA 2TMKA 3QVUA 1E9CA 4AC9A 1E6CA 3A8TA 4DWJA 2IA5A 3AV0B 4NHOA 2BOVA 1YR8A 1XTSA 1Q22A 3K0FA 2I1VB 3LVQE 3AVPA 3MAAC 4LWZA 4MRPA 4NYIQ 5EUMA 4F38A 3WYGA 3PEUA 1HURA 3RNLA 1NKSA 1DAKA 4HZIA 2YV5A 4US1R 3CBQA 2V7QD 5AJYA 4ZKDA 2GCOA 5JS8A 1CRPA 3PITA 2NMVA 2JLSA 4O0MA 3QEOA 4G3XA 1NN5A 2VYFA 3X1YA 1S8FA 2QUZA 4JKYA 2X1VA 4A15A 4C0JA 3R8CA 3R9XA 1P9RA 4IRUB 1KY3A 3RANA 4FXPA 4Z8XA 1QF9A 4IVRA 4EPTA 4M9XA 2QTVB 1YRAA 2AWNA 2ZJBA 3GP8A 1GNQA 3MWKA 4DDUA 2ERYA 4FCVA 4DVGA 3VNUA 2CHVA 4AKHA 4YONB 4MRVA 2Y8EA 2FDCA 1ZNYA 4HDCA 4TMZA 1G20E 3DO6A 4OJQA 4QFMA 2RGEA 2G0NA 4GP7A 1JB1A 1GL9B 3CZPA 2BJWA 2IEZA 3LRPA 4W9MC 3GEEA 2XJ4A 3ZIAD 1WBBA 1Z47A 5G53C 3GPLA 4W5WA 4H9GA 2KB0A 4GBMA 1K6MA 4IXMA 4JLJA 4B3CA 1Z6AA 2YNMA 4WIAA 5FUYA 3AF4A 4Q7JB 4AWXA 2DFKB 3F3YA 5EE3A 2BEJA 4RFVA 1X8LA 1E69A 2F9MA 4TLCA 3DPUA 1P9NA 3QENA 3NBFA 3ICQB 1S1MA 1M7HA 1RRFA 3NDBB 2J0QA 3SBEA 1A4RA 3TNFA 2VLIA 5DH9A 3HYRA 3A1WA 2ZRFA 1A7JA 3PUZA 4PTLA 5AJZA 3T15A 4DXAA 1QHXA 3JVVA 3LO5A 5FTKA 4YXWA 3NHBA 3WP0A 2GVDC 3VR2A 5KSYA 3W3ZB 3W6NA 2ZJ5A 3AVOA 2Z4RA 4D82A 5E7JA 2QTFA 2C2HA 3KQLA 2RH5A 1KZ7B 5A0FA 1P60A 3T1QA 4GOXA 3K70C 1S0UA 1AJEA 5EP2A 5FPTA 4CIDA 1LF0A 4D0LB 2IL1A 3GEIA 4NCJA 3T1TA 3R20A 4HB0A 1OJLA 1EWQA 4YLGA 4CW7A 3EPKA 2Z83A 4KLNA 3RS4A 3CONA 1EFCA 5L3QA 2RB4A 1G17A 3GEHA 4A8JA 2X8AA 1G3MA 4LHXA 1GDDA 2C03A 4MYTA 1CKEA 1EX6A 4FMCF 1G7RA 1QG4A 3LV8A 1X1RA 1IN4A 1QDEA 2WWFA 4LJ9A 2G3YA 1FP6A 3SYNA 2FEMA 3GLGE 2GXSA 3VU9A 2WSMA 5GADl 1A2BA 2NO1A 2OFWA 3OEED 3VTKA 4D4LA 1GWNA 1X8JA 2EFEB 2W00A 3QBTA 4OI2A 2ZU0C 3LBHA 2D7CA 3T06B 4O3MA 2ZANA 4PSVA 2FSHA 4IOKA 2QAJA 1YHNA 4ZCIA 4BECA 1OB5A 2FFBA 3PUWA 5SZJA 2JA1A 3AP2A 1Z0DA 4OI4A 4PPGA 4OK3A 1JQLB 4X8OA 1JI0A 2OFOA 4CVNA 1KO4A 3IGFA 3UATA 2P6UA 5HCNA 4L16A 4G01B 4OK5A 3TSOA 4XSGA 2P5SA 2IBMA 5J4LA 4GOKA 1W4AA 4J0QA 3UMRA 1NN1A 2EFDB 3AGPA 4JSYA 2BWJA 3FHOA 4Q4JB 2CNWD 3LXXA 3THWB 3EIQA 1JBKA 1II8A 2CMKA 2GF0A 1AKYA 1CJTC 1UFQA 2DWQA 3VKGA 2G1JA 3IKJA 2WTUA 3FE2A 3U3OA 2J3EA 4QJ5A 2XJ9A 2ZS8A 1PJRA 2MMGA 3ADDA 1SVOA 4IOJA 1MO6A 4G5RA 1GRQA 3IILA 2ZYWX 1E0JA 3FMOB 4GMXA 3RAPR 2X2EA 3QG1A 4P4TA 3B1YA 4TMWA 1G7CA 3C5CA 5IDVA 1Z63A 1UADA 4PX9A 2W2VA 5G40A 1LNZA 4A0HA 1TQDA 1P2VA 4MUBA 1YRBA 4KSBA 3WYFA 3BB4A 4Q1CA 2PJZA 1P7CA 5JMTA 5GJWC 3MWJA 1XEFA 1ZCAA 4DLUA 2O0HA 2D7DA 4M1TA 2IUUA 1BMFA 4AD8A 3W9YA 4BZPA 3B1WA 4JL8A 1N5KA 1G64A 1QVRA 3UANA 2R65A 4BFZA 1R0WA 1RKBA 3ASYA 1KMQA 2VF8A 1QHSA 5EP4A 4UKDA 3TUZC 4PO8A 3U7GA 2ZRLA 2RCNA 2DB3A 3A1VA 2JIZA 1E9SA 4B2PA 3VHXA 1Q3TA 5FTLA 3IDQA 3HP1A 3M6AA 4M9ZA 2QM7A 4OI1A 1VIAA 4PANA 1CRQA 2P5TB 1Q1BA 4D4JA 1MR3F 1VYTA 2OXCA 3BIFA 1CJMA 2HCBA 3ND9A 1E0SA 4A4DA 1E2DA 3U44A 2Q9BA 3WRYC 2A5GA 4AIIA 2QORA 5TVKA 2HJVA 2ZSAA 2BMJA 4AI6A 4MYCA 1II8B 3ZLJA 2NZ8A 4A9AA 4NCKA 3QJYA 2CE7A 1NVVR 4RZXA 2J59A 5CIQA 5TB5A 4DIEA 1GZSA 1VG0B 2XITA 3A4NA 4AYTA 2F3TA 3QKUA 5F9FA 2OBLA 4B47A 3AF3A 3AKYA 1C9KA 2LCFA 2BEKA 3QF7A 4L5BA 5HPYB 3FMFA 2BMDA 2XTNA 2A9KA 3TVTA 2GJAA 2JJ2A 3L8ZA 1COWD 1UPTA 2J5XA 5EXPA 4TYPA 4EPRA 4CGZA 2REBA 4QGGA 4DBLC 2JLQA 4B35A 3UG7A 4TLEA 4E07A 3SNHA 1VMAA 1EFHA 4RD6A 3EAQA 3ADCA 4EJSA 2WJYA 2DR3A 3QPVA 3SI7A 1SVSA 2AKYA 3U3RA 2O0JA 3TSWA 2A7QA 4AG5A 2OUKA 2V6JA 4A92A 1P72A 1Q21A 3QXXA 3VX3A 4JVNA 4TYWA 5JCZA 2GF9A 3L2OB 3F0TA 3NC1C 4WOPA 2H1LA 3BFVA 1E2PA 2ZRIA 2FJUA 4DEXA 2CJWB 5HCIA 4OKSA 1N6RA 5FUWA 4OBEA 3OIVA 4KVGA 3GCGA 4RZ3A 1N5IA 4PAOA 2EFCB 3B9PA 1TTTA 4LHZA 3AUYA 4O25A 1KHTA 1SVKA 2D06A 2QN6A 3A36A 5L3QB 4QC2A 1KAOA 4EPVA 4FW9A 3SYKA 3CRVA 4P33A 2WJIA 1KO8A 4MGKR 4D6PA 3AH8A 4JLAA 4Q4JA 1NVUQ 4QNMA 1ZMXA 5AK0A 1G291 2GHIA 2MSCB 4CT5A 2V3CC 1JNYA 2GXAA 3CIOA 4MUAA 1TF7A 2MSDB 4UNRA 1ZU5A 3CPJB 2JJ1A 5KSOA 5FL3A 3VFDA 1YKSA 2IYSA 2JLYA 4ERNA 2FEOA 5K8LA 4TMKA 1W4RA 3MFYA 5FBWB 4B6EA 2PBRA 1PLJA 1RIFA 4ZI2A 1UBCA 3OIWA 5FR2A 5FL7A 1ONBA 2A30A 4ON9A 3W90A 3MD0A 1DS6A 2FSFA 3RWOA 4D26A 3DM5A 2ATXA 1CEEA 4M0LA 1T91A 2YWGA 1KSGA 1MRNA 4BE7B 5JWHA 2WWHA 3W8RA 3GLFE 1TU3A 2QNRA 2QP9X 4LHVA 4N0DA 1NNEA 1CIPA 4I1UA 4ZPXA 2YWFA 4AG6A 2O8EB 2PH1A 2IUTA 3FKSD 4NCIA 4QGAA 1NIJA 2XEXA 3IIKA 2HXYA 1D8TA 4S35A 1DAGA 2X77A 5EP1A 2ANBA 2IYLD 3GJ5A 4LY6A 4B43A 3U7HB 4IFBA 2D3WA 2H18A 3BXZA 2ZI5A 3SN6A 2ZITA 4V0OA 2VP4A 5GVSA 3FHCB 4OQXA 2QI9C 2ZRHA 5LB4A 4XWOA 2CHQA 2DFTA 1RVDA 2XOKD 4U7DA 4P31A 3FFBA 1A1VA 3BERA 4RCYA 5JJKA 3U60B 3UMFA 2A5JA 2WM9B 3AGQA 2HXSA 4TWZA 1E9BA 3IUYA 3SJCA 3IHLA 4NPHA 2A5DA 2GZHA 2VSXA 3ZH9B 5IRCD 1GIAA 1KNQA 2ZRNA 1S3SA 4TLAA 1J70A 1EESA 2FMXA 4C0KA 5DYIA 3IBGA 2PX0A 5HTKA 3ADKA 2XXAA 4FMDB 4PPQA 2WVJA 4M1MA 1PLLA 5HKKD 5DGXA 1S3GA 1LW7A 1UKYA 1IAQA 2H17A 2OILA 1W2GA 2MMCA 1CXZA 3LD9A 3C8UA 1TF5A 2SHKA 1EX7A 3KFXA 1HV8A 3C16C 4WA7A 1KAGA 5CLQA 4DLSA 1G8FA 2YINC 1XTIA 3QNUA 3CRRA 3FMPB 1JAIA 1VG1A 2PMKA 1LY1A 3RS0A 4NTZA 1P75A 2H57A 3AVYA 2XZOA 4DLTA 4LHWA 4B34A 1Q3HA 2CLSA 4PQFA 5DN6A 4M22A 1Q44A 1JR3E 5JFGA 1KOFA 4LI0A 3MMPA 4YMTA 1CULC 4B33A 1SULA 2OEPA 3K9GA 5KDLA 2GA8A 2C5LA 2C96A 1IN5A 5CLLA 3EXAA 4EPXA 1W0KD 2AD5A 5EZ6B 3W5IA 5DSZA 4TYNA 5J4KA 4DRZA 3GJ6A 1DARA 3QUSA 4B32A 1IQPA 5AJVB 2F1RA 1XRJA 2GZAA 2YZ2A 4L8GA 4B6FA 2O8DA 3KJIA 1RE0A 4NKRA 1CP2A 1XZQA 4M21A 4OJKA 4Q9LA 4F4IA 4US2R 3TK1A 3P27A 2ZPTX 4PR0A 1G41A 1VDZA 4UNNA 4IDOA 4CEHA 1XEWX 2XSZA 3WBKA 1G8HA 4KVAA 3QG5A 3C15C 1UKVY 4Y0AA 2A78A 1OFUX 1CJVC 3DZDA 2PZEA 3L82B 1DBSA 1P9WA 2RGNA 5DE3A 4EFNA 4LCBA 3CLVA 2EVWX 2CL0X 3V4FA 1Z0AA 1EFRD 1BMFD 3TQCA 2CCGA 1XDBA 1NY6A 4EAQA 4LPSA 2DFLA 2VH5R 3C14C 3M0EA 4X8MA 1FPMA 4G1UC 3K9LA 2GK6A 1TQ6A 1W5TA 5BYJA 2GEUA 4G0NA 3RABA 1AGPA 1X6VA 5CYOA 2PCJA 2RHDA 5FOTA 5D3MB 4GDFA 4LBVA 3EPHA 1IY1A 2XX3A 2O8FB 2BIFA 4R7ZA 1IN7A 2B21A 4QG7A 4PC1A 3SJAA 2EW1A 3RWMB 3HYTA 2OG2A 2W2TA 2H92A 2E1RA 5J5CA 2V1UA 3KUCA 1XJQA 2ZR9A 4D25A 1SZPA 1QZXA 2WMOB 1MV5A 4URXR 1E2GA 3HDTA 2DYKA 2EU8A 2H7VA 2J7PD 3VR4A 1E0AA 2QTHA 3U6BA 1NI3A 2WPDD 4U00A 1LTQA 2QZ4A 2CNWA 4MRRA 5E7IA 1H8HA 1ZM2A 2QRNA 4ESVA 1RC8A 2IS6A 2REOA 3ADBA 1OIWA 1XNJA 2BV3A 1MKYA 2QU8A 1XU4A 3ZVLA 4JLNA 1NVVQ 4D80A 1NL3A 4C0QC 1OIXA 1JXMA 1EGAA 3HR8A 3LX5A 4LPKA 2V55B 4CZ2A 3U7FB 2J7PA 3EIHA 3E5HA 4AURA 1W7AA 1KI3A 1R6BX 5JBQA 4R2HA 3TR5A 1KO1A 1P73A 3EG5A 3MSXA 1T8UA 2NO7A 4Q9IA 5KSPA 4U5XA 2FSIA 2ZJ8A 1MO3A 3MWYW 2PLFA 4Q4HA 1YZKA 3OEEA 1P2SA 5TY0A 2IYXA 2ZVQX 4N3NA 4TL9A 2QE7D 1OFIA 3MUFA 4G5QA 1XXHA 2EWWA 2J9RA 5AUOB 3X1XA 2ZSFA 3J81k 1VTKA 5J47A 1U94A 2GJKA 4JYBA 4BEJA 4Q1FA 3GJ0A 1KK0A 2NG1A 3LW8A 2ZYTX 1U98A 2ZQ5A 1R10A 4ZO4A 5BWMA 1Z6YA 3CWZA 3KQHA 2ZYUX 3KQNA 3D31A 2G9NA 4H1VA 2GK7A 2WOOA 1WQ1R 1CU1A 1OKKD 4BFWA 2Z43A 2HCJB 721PA 1J2JA 5B64A 2ZE6A 1NBMA 5J40A 1P61B 3K9NA 3NVAA 3K53A 2J46A 4UNPA 5JRJA 3EZFA 4XSHA 4V02A 2YC2C 1DO0A 3VHLB 3D7MA 2OCPA 5K8IA 1DAMA 2PCLA 3LNCA 2HJGA 3ICEA 3CF2A 2ECKA 2IK8A 2IWRA 4UNSA 2ZRPA 4PC2A 5L3SB 1VPLA 2FN4A 2VL7A 1E1QA 1DG1G 3MLEA 3MWLA 2JLVA 4LJ4A 3TLXA 1SKYB 2VSFA 3QF4B 4Q18A 2CXXA 1G8PA 1XMIA 2AXPA 1Z28A 1PV4A 3UXMA 2N1BA 4Q4AA 4ESHA 1WP9A 4PHFA 1G5TA 4M9QA 4XOIA 2IYQA 5CJPA 1TL7C 1OH5A 1C1YA 1KI6A 1XJCA 1NG9A 2GILA 4FCWA 1GG2A 2ASEA 4GI7A 1K5GA 3KL4A 2VP5A 4N1AA 3H4MA 2FE4A 4PQYA 3LWNA 2AFHE 4M9SA 5L3VA 1IHUA 3T5DA 1QHYA 4QGFA 1Z6XA 1X8KA 1U9IC 4ZDJA 1ELOA 2QBYA 3KKPA 1QHHB 2Q3MA 3AP1A 5P21A 3RS5A 3N2IA 3WMGA 4K8OA 2ZS9A 3I1FA 4HUQB 1ETUA 5KTYA 3IHWA 1HE8B 1N5JA 2GBLA 3BD9A 2WHXA 4F91B 2D74A 4LJ8A 3W5JA 1YR7A 2IHYA 3RRZA 1VG8A 4Q7MB 3P4YA 2F6RA 2YVUA 1KDOA 2JAQA 3CPHA 1OH7A 2IWHA 2OT3B 2JCSA 3FHTA 5KDOA 2CDNA 4NCNA 1VKJA 1HA3A 4PHGA 1N6PA 1T3HA 4ZIRB 5FTMA 2ZS7A 3TUIC 4A2WA 3O8DA 2A2ZA 2XB4A 3SU8A 2QENA 1IJFA 2EWVA 4NH0A 2CBZA 4G5SA 2LKCA 4OL0A 2VPPA 3CUEF 4KU4A 4Y0VA 1E79A 3IIMA 5GJBA 3H86A 4DSOA 2QT1A 5B58C 1E79D 5E4FA 4A0GA 3TW4A 4YDSA 3R8FA 2O8EA 3Q85A 1WF3A 2OCBA 2WBLC 3K09A 2DBYA 1VCMA 2WKRA 3AKCA 4LRWA 3EZ7A 2ZRKA 3B8HA 3X1WA 4Q1EA 1OE0A 1SHKA 3AVQA 4A0FA 1GP2A 2NO9A 3K0AB 4AK9A 3B1XA 4BRUA 4C7OB 3FKQA 1FX0B 4WXRA 3REGA 2ZRAA 1CTQA 2ATVA 4KV9A 3X1ZA 1TPZA 2W6IA 2ZJAA 1XMVA 1TMKA 4TMXA 1ZAKA 4PFSA 3FFAA 1XBTA 1KMHB 3IO3A 2G1KA 4LYAA 3ZIAA 5KYKA 2CK3D 5FUXA 4C2TA 1JQJC 3T12A 4EFMA 2IUSA 2QM8A 3VR1A 4HAUA 4KXFB 3P32A 4HAZA 2Q3HA 3WMFA 2Z5FA 4QBIA 1XCPA 3GLFB 4XTCS 4NBSA 4TSFA 2XTZA 4Q9KA 4DT1B 2AWOA 4HZUA 3AP3A 3L0SA 1N5LA 1R8SA 2DY1A 2QE7A 3HWSA 1G9XA 2B8WA 2JDID 4PZZA 3SQXA 4CEIB 2ZJOA 5FI1B 4C30A 1KDPA 2R8RA 1T8TA 4ZCLA 3PXGA 2WKQA 1V5WA 3GLFA 2ZJZA 4A8JB 4B48A 3U6KA 1Z0FA 3B7GA 1FOEB 3VR5A 2FPLA 4TL6A 4IHQA 1ZD8A 1T9HA 2ZI9A 3L8YA 2J1LA 4PSAA 2C9YA 2JASA 4JIMA 3HJNA 3OE7D 2OZEA 3QKSB 1F5NA 3VQTA 1WE2A 1AIPA 3AF1A 4BASA 3THWA 2QG6A 1VCOA 2B7BA 1F3OA 3G0HA 4JBYA 1VYUA 2JLUA 5KUTA 1J7KA 1NVXQ 2FOLA 1VCNA 3KKOA 4N0EA 4DUGA 1KSFX 3P20A 1BH2A 1E4YA 3UG6A 4QRHA 1P5ZB 2ZRBA 1NBMD 2WIAA 4BZXA 2F3RA 4PZLA 5AUQA 3TBKA 3VMFA 5F98A 3QXHA 1R0YA 4JJKA 2D62A 3CF6R 3GQBA 1KSHA 3H2YA 1DTSA 3VNVA 1VCIA 4HB3A 2Q9CA 4CDGA 4C7OA 1QRAA 4I1SA 1MABB 3NH9A 3H1TA 4NYMR 2WSSD 1R0XA 1UM8A 4XJXA 4TT3D 4IOLA 3B85A 4PZYA 4RD2A 1SVLA 3A1TA 4E22A 1H65A 1L7VC 1COWA 1UF9A 4FN5A 3QKSA 4KJZA 3K0CC 1E98A 4JLMA 3NC0C 4BRWA 4GMDA 4XVUA 4Z51A 1II0A 3MJRA 3PUVA 1KKMA 1XMSA 3FB4A 5TARA 2HDNB 4OQFA 1G16A 3CR8A 3ZYCA 5EE9A 3CRMA 1R8QA 2IXEA 4NONA 3AVVA 2LKDA 4JT2A 1D2EA 1ZC3A 2NOAA 1TU4A 2BHRA 3U3MA 3NG1A 1GL7A 4OYHA 3CWQA 1OT3A 3BB1A 2YKGA 2PZFA 1OSNA 4OK6A 1GNRA 2JJ8A 3EA5A 2UZ3A 1LS6A 1ZYUA 3LLUA 1K5DA 2R6FA 4F4JA 4AKEA 5KO2A 2GJ8A 4ABYA 4JSTA 1II9A 5DI9A 2CLCX 5DI3B 1KI1A 1E4VA 1ZW6A 2HF8A 2REXB 4JL5A 1UKZA 4A2QA 2FZLA 4JVMA 5JWRA 5TV2A 2FU5C 3GLIB 1Z0KA 3NEJA 3PCRB 3CO5A 1W48A 2G6BA 1NBME 1KI9A 4PHHA 2WPDA 1MO4A 5LB2A 4HLDA 3VX4A 4HUTA 4Q5IA 1D2MA 1NSTA 1QHNA 1XTQA 3PUXA 1T5IA 3QQ5A 4RKFA 3BK7A 3V9PA 1GRNA 4XWKA 4TL7A 2XXAB 4JBWA 4C0AC 5FTJA 2PLRA 1SVIA 1D2NA 4EFLA 4DDTA 2VP6A 421PA 4B76A 1SVMA 1XPRA 4EQ6B 3I3SR 4GSYA 3SJBA 4M4SA 4ILEA 4V0MA 3IBYA 3GJ4A 3CH5A 1ZNWA 4A6PA 3KXLA 1N6HA 1FL9A 2OCYC 2VRWA 2UZIR 3HPQA 1IXRC 4P32A 1E1RD 4ZDIA 3ZZTA 1RFLA 2ONKA 4PC7A 1AA9A 1G6HA 1Q20A 2ZETA 2ZRJA 4I99A 3O8RA 1F60A 3CB4A 4MYHA 2P3SA 1KDRA 3KKQA 3KXIA 3NHAA 4TMTA 3RS7A 4MKGA 4BFXA 3EASA 1E99A 1GFIA 4BZQA 4G5GA 5JJLA 3I4LA 4A2PA 4DDWA 4JLOA 2WWGA 4MKFA 1JALA 1Z6GA 4ACAA 1N6LA 2R6GA 1AS3A 4DIDA 2ZROA 3ZZUA 4KCGA 4KYUA 2GJ9A 4DKXA 1V43A 5SZIA 4OI0A 1UDWA 3O8BA 4XH9B 2QY9A 3EARA 3TQFA 4JBXA 1AGRA 2Z6VA 4MRNA 2ANCA 4TZ0A 4LV8B 4B3DA 2ZM5A 4TZ6A 1U8YA 3BFXA 4C4PA 1U8ZA 1HT1E 4CYMA 2VIIA 4YMWA 5IHPA 5AJWA 4IJMA 2VA8A 2HEIA 2N46A 2QBYB 4FINA 4DHEA 4KBFA 1RYFA 1XX6A 2BCGY 3EC2A 4TMVA 2O8CB 4I4LA 4D0GA 1T0HB 3JZAA 3AVXA 4M1KA 2NPFA 4EDHA 5DN6D 2FFHA 2JLZA 1LFDB 3IPXA 3Q7QA 4RD4A 2P2LA 3VU9B 1X1SA 3QOFA 4QXAA 2ZRCA 1SVWA 4PHTA 2CCJA 1GKIA 1OW3B 3BBPA 3K70D 2KBEA 2QMOA 2J87A 4HDOB 2ERXA 1I4LD 3NBXX 1CJUC 2HLDA 5FBVB 2VHQA 2QPAA 5KNCA 4ASUA 2JGNA 1KDTA 4LBWA 3QF4A 3WMEA 3K1JA 4EKDA 1OHHD 1U99A 1YVDA 1XTKA 1G6OA 2KJQA 4QBFA 5CYPA 1UBEA 4KLZA 3PQCA 4EQ6A 4BFVA 5FPKA 3C4JA 2QPOA 1E2LA 1ZNXA 1N25A 4PAQA 1AKEA 1TX4B 4QHTA 3T1VA 3WYAA 3CW2A 4KSCA 5A5GA 3ZS8A 3BC1A 1RPZA 5JEEA 5DISB 1YZUA 3CNOA 1VHLA 3VKWA 2Q6TA 3HU2A 5C4GB 4G5OA 5CJ2A 1YQTA 4OHVA 4NDZA 4DUGD 1KNXA 1WRBA 3DL0A 1G8YA 4TQAA 2ZI7A 4XWAA 4HLUC 3KTAB 5FBLB 5JHHB 3RRMA 3PENA 3QVVA 4B2IA 2WKPA 3CM0A 2NQ2C 3A6PC 3L43A 4HB2A 3CF0A 2J0VA 3U61B 1F2UB 2RGNC 4JKIA 4MGIR 4PPFA 1KI7A 2L0XA 4LBYA 4HAWA 1NLZA 4XTRA 2GBLC 3CPEA 3P26A 4C0HA 5E95A 1QHIA 4Q03A 3DKVA 4RCZA 3AQ4A 3QBVA 3SS8A 4JLDA 1Z08A 4GRAA 2VO1A 3PVSA 5EZ5A 4B44A 3KTAA 1MABA 3ZVRA 1BKDR 4DT1A 1ZM4A 4HSEA 3QE0A 5AR1A 2OM2A 1E9EA 1NMXA 2XNDD 4DCSA 4WZAE 4S2EA 1G8GA 2R6CA 4UXHA 5ANRB 1A82A 1MRSA 1NJFA 3O47A 1LB1B 5JCPA 2CK3A 3B82A 4A0RA 3QXCA 4BWYA 3LLMA 2XZPA 1KJZA 2HV8A 5FL7D 2QROA 2FPKA 2ZYVX 2D2FA 2PZGA 5HZHA 4B71A 1OXSC 3K0AA 1ZD9A 2NTYC 3DDCA 4Z54A 2AD1A 2QAGC 3SZRA 5CM8B 5H68A 2QGNA 3CZQA 3RVBA 4MDFA 1E2JA 5TDHA 1RRCA 3UWKA 4K81B 5DYGA 1GSIA 4C2UA 5KNDA 1IN8A 2ZUBA 4CT4B 2ZE5A 3BS4A 1S1CA 1FNNA 2AKAB 5CDFE 2BMFA 1HH4A 2FNAA 5B57C 4IVPA 5K8UA 4BLPA 3C41J 1NLYA 5EXSA 5C2JB 1CLUA 1E1QD 1FFHA 4HYYA 5JEDA 4CEJB 3LFUA 2EYUA 1ZIPA 4FMBB 4RFSA 5B30A 5JJIA 4MRSA 2JLXA 1YZNA 3K70B 4KAXA 5JHGB 1G3UA 1IBRA 1T3SA 1F2UA 4Q4HB 2XZLA 2VEDA 5KPDA 2BMEA 1VHTA 3RRYA 3ZVMA 2RGDA 1Y63A 3D8BA 4FWTA 1KTVA 1W47A 4Q1AA 1MO5A 2ORVA 1OXUA 3IIJA 1N3BA 3UWOA 2R6DA 1R2QA 1ZC4A 2W0SA 4TLDA 1OKKA 2PMDA 2WAXA 5EUQB 5JI3E 2RGXA 5FBQB 1Z3IX 3TMKA 3I5XA 3R9WA 1CR4A 3DOEA 3KXKA 1F6BA 4DC9A 3LA6A 4RD0A 4D0NA 1AZTA 5AWFC 3PFIA 1E2KA 5FPSA 3ZQJA 1QBKC 2GCPA 3AF0A 5EJEA 3MG9A 4JVLA 1JR6A 4YMVA 5H70A 3H84A 2GWHA 1L4YA 1AQUA 2IYZA 2KWIA 3A37A 3OEHD 5JI2E 4R98A 3K09C 4ACBA 1GTVA 5FUVA 2E87A 3ZDQA 5KPJA 1EWRA 1TUIA 1DG3A 1I2DA 1XEXA 5KNBA 3SR0A 3A1SA 2V4ZA 3PEYA 2F1JA 4WZBE 3TE6A 4F92B 2IYRA 4I1VA 3LBNA 4DB2A 3UIEA 2YWHA 2ZIAA 1BS1A 2QQ0A 2P65A 3UPUA 1FW6A 4Q47A 1N6KA 1WB9A 2O8BB 3DOFA 1XMJA 3SHWA 2P6NA 3WBJA 4GPTA 4AYWA 2O8CA 3ZZ0A 4V03A 4M8NE 2YYZA 1FMLA 1ZVQA 2VBCA 4JLPA 4TL8A 4NL4H 2DWPA 1Z06A 3B78A 3DKPA 4O2LA 1US8A 5FOWA 3QSYA 2O52A 2WWYA 4ZIRA 1P6XA 1ZM7A 1YZQA 1NJGA 4TQ9A 1ZU4A 5L3RA 1RJ9B 4WVFA 3BJIC 1CF4A 2FA9A 2VHJA 1Y3AA 1OXVA 4NYJQ 3WP1B 2BC9A 1XTRA 4DSTA 2FG5A 1SXJE 1G5RA 3OZXA 3C5HA 5ELXA 1XEWY 3MCAA 5FH9A 3AVWA 3LDAA 2V9PA 5IF9A 1Z0JA 2HYIC 4A82A 4MITA 2QSYA 3B2EA 4Q02A 4I81A 1E96A 3EX7C 2BCJQ 1OH6A 1E1RA 1S9HA 1XZPA 2QPTA 4IXNA 1G4UR 3OEHA 2NZJA 3Q5DA 3FDIA 1UDXA 3KB2A 1YZGA 2ZAOA 1US8B 3GJ8A 1W2HA 5HZKA 5CK4A 2V1XA 1DAEA 1AQYA 1I4TD 3NWJA 2ZR0A 4FIDA 2GEDA 1J8MF 4NE2A 1FQJA 2QRZA 3Q9LA 2R6AA 4L9WA 1BO6A 1SXJD 4PC6A 4TYYA 2EFHB 4OQMA 4LYHA 1OB2A 1Z8FA 3SFZA 3KKMA 2IYUA 1E2MA 1OIVA 1CJKC 3D6TB 4KFRA 4MH0R 4DDVA 2XAUA 3I8XA 4L15A 3BWDD 4LJYA 2AK3A 5BN3A 2FFAA 3FMIA 3ZS9A 2HT1A 521PA 4TTRA 1E9AA 1NP6A 1UEJA 4LYJA 1F2TB 1XEXB 4QJ4A 2YOFA 4RD3A 4LBZA 3WNDA 4LV6A 3AVTA 2F9LA 2IW3A 2WV9A 2IYTA 5GVRA 2AXNA 1DPFA 4DLZA 1JEDA 1GKUB 4P3YA 1DADA 5FOXA 1W0JA 4QBHA 3H0KA 5CITA 3DMDA 2J41A 3CNNA 4GFDA 2PX3A 1U90A 1KK3A 1TF2A 1WDTA 2RMKA 1HYQA 121PA 3A4MA 4URYR 3QKRA 3FTQA 1DOAA 4LK2A 4C0SA 3FPAA 1IXZA 4UQOA 1Z6TA 2B7CA 1ZNZA 3E2IA 1G3RA 4HLUA 1OPXA 2CL7X 2V6IA 4GNKA 3AB3A 3IQXA 4C0BA 2RGBA 4LC1A 3PJRA 2Q21A 4HLQB 3GD7A 4POAA 1FUUA 2YJTD 3K9HA 2HF9A 3K0FB 2W2XA 3KUDA 5BN4A 5E7MA 2IYWA 1ESNA 4GOJA 1ZP6A 4UXJA 3ECCA 2Q3FA 2GEVA 4V0NA 1AS2A 2C98A 3ASZA 1ZUHA 2CJWA 3ND8A 4EUNA 5KDDA 4CEJA 1M34E 4BLSA 4IEEA 2ZI4A 2OV2A 2ZRMA 3R7WA 5BQ5A 2DPXA 4MQBA 1NF3A 2OLJA 2C77A 4BLTA 2UKDA 3FWYA 1NLFA 3RSOA 3G5UA 221PA 3PUYA 1YU9A 1P2UA 4P4UA 1HE1C 3GLIA 2BJVA 3L0PA 1XCMA 4Z8YA 4PXAA 1A2KC 1J8YF 4DCVA 4KI0A 1HTWA 2PL3A 2LWIA 5L8VA 1Q57A 1XFAA 3LXRA 3R9IA 3SC3A 3T61A 3BH0A 1HT2E 4JL6A 4DSNA 5F9HA 2C8VA 4DZZA 1PZNA 2GNOA 5SZHB 3BOSA 2V8OA 3SQWA 2KSQA 4UNQA 1IY2A 1KYIA 4B75A 1E2QA 1OYYA 4MKHA 3S1AB 2QP4A 2F43A 4V0KA 2J0UA 5IK2A 2O0KA 4WXPA 3THXA 4R71A 2F7SA 3FKSA 4JMPA 1O3YA 3LW7A 1HEIA 4NP6A 5CK5A 3HU3A 1Q1QA 3QEJA 4TTPA 1JEEA 5HE9A 2VHCA 4DB4A 2O8FA 4HEJA 4LJAA 2ZSDA 5KOYA 4JLVA 4B3GA 2X2FA 1L2TA 2ZRDA 1W1WA 2W58A 4TTQA 4KFTA 2HT6A 1RRGA 1FUKA 1Q12A 4D4KA 1XD8A 4QKQA 1C4OA 1TNDA 4RZUA 4II7A 2WMNB 4PAMA 2GVZC 1YJ5A 1N6OA 2YOGA 1G1MA 3OF5A 3NKVA 2ZAMA 1P3JA 2XNDA 3NXSA 3TRFA 3V00A 3EZ9A 5SZKB 3MRSA 2PJRA 4RD1A 1K8RA 1P4SA 5KU1A 3AM1A 2EYQA 4MKIA 2YHSA 3EC1A 1X86B 1NIPA 4WW0A 1N2CE 2ZI6A 1YR9A 3PR1A 4OHWA 1CR2A 2MSEB 2NGRA 3IQWA 6Q21A 4BGDA 1XPUA 1KO5A 1B23P 3K0SA 1VECA 3GJ7A 4FD2A 3M1IA 4EPYA 5H8WA 3R7WB 5J4YA 3RC8A 1WA5A 4ZI3A 1OFHA 2WWIA 2DCUA 2YWEA 1WMSA 4TN1A 1E9FA 2Z0MA 2P6RA 4M53A 3OFND 1G5PA 3P4XA 1W4BA 1GKYA 3B6EA 1QHGA 1J99A 1DO2A 3RSLA 3ZQ6A 3LQQA 2PEYA 1IM2A 2R9VA 4HDQB 4A1FA 1S4QA 1BYUA 4OHYA 3RDPA 2I1QA 3TH5A 3CNLA 3BRWD 3NH6A 3KQUA 1HY3A 4M1OA 4JLBA 3KQKA 2BBWA 3WNBA 5G41A 4IDHA 3DVLA 2FGJA 5A4JA 1I4DD 2DFNA 1ODFA 1R5OA 2QL6A 1R5BA 1ZCBA 5EE5B 3RS2A 3BB3A 5J4HA 1DAIA 5EQTA 3K8YA 4DLYA 2J0UB 4M2LA 1M1YE 4DLVA 1IN6A 1ESMA 2VP9A 3PEWA 2R2AA 3I5YA 1M8PA 2RGGA 1W44A 2I3BA 3RRNA 2JJ2D 4PPNA 4URZR 3MGCA 4ASUD 4B3FX 1VIYA 1UJ2A 1W36B 3U44B 1PUIA 2X19A 4HATA 2ONJA 2WOJA 3NBZC 1YZTA 3U5ZB 2F1IA 1FNMA 1XB2A 4BQSA 4QL3A 4NYJR 2JJ1D 4Q19A 4D81A 4EPWA 1IJEA 3ZD7A 1KMHA 1KZGB 1TEXA 4DEYA 4AKGA 3SFVA 4CF7A 5FOUA 1PVOA 1KJYA 1M74A 3CX6A 3CR7A 3QXJA 2PEZA 2VF7A 5UKDA 4M1SA 1HQYE 4GZLA 4MA4A 3PIRA 4JS0A 3L0OA 3VR3A 1GOTA 2N42A 4TLBA 1N6IA 3TAHA 2XB2A 4LX0A 2AK2A 2DWOA 4BLQA 5EXXA 4BFYA 5AUNB 1W0JD 1RZ3A 4CRWB 3QPWA 3FOZA 2WIBA 4E5UA 5LD2C 2IXFA 2ZJ2A 1M7BA 1XD9A 5G3ZA 2G88A 5CIWA 1BYIA 3WNCA 1Z2AA 4W7SA 1ZJ6A 3AEZA 3QPUA 3TUJC 4BLOA 1ZD1A 5EE0A 5HKKA 1QVAA 2A5FA 4NU0A 3TIFA 3DM9B 4HZUB 1WCV1 4D2IA 2ZEJA 1G21E 4TYQA 1E0KA 3T35A 2IX3A 3Q72A 5C1BA 4EJSB 1LF5A 4NYIR 1Z83A 2JLRA 4HUQA 3ONWA 5DHFA 2QT0A 4B74A 3A58B 1Q1ZA 3SHFA 2QSZA 2RGCA 1QHHA 1T3LA 1ZBDA 1CS4C 4O2RA 5FPYA 1E2EA 5EE1A 3U3JA 2OO7A 5DLQC 1W5SA 5F2EA 3BE4A 4JJZA 1GM5A 1FTNA 4FI3C 1DEKA 3B5JA 1AK2A 4Z1MD 1O87A 1TADA 1D9ZA 3GJ3A 4LGMA 1JR3A 3BORA 4OHZA 1OH8A 2CEAA 2NPIA 4KBGA 3T5GA 5TMPA 2ZUDA 2F1HA 4UJ3A 1OYWA 4XVRA 4ZDKA 2ZSEA 5BW8A 4IDPA 4Q1BA 2JLWA 3BFKA 4C9BA 2ODWA 2IF2A 1ZINA 3QKTA 1JXOA 3QXSA 5K8TA 4RY2A 2P67A 4QHSA 1KI6B 3SBDA 2QEQA 2VTKA 2ORWA 5GJCA 1QG2A 1G7TA 3C7KA 1CR0A 5B2ZA 2OBNA 3FVQA 2FSGA 4KITB 1DAHA 1Z07A 1ZRHA 2QMUA 2BVNA 2XTMA 3N70A 1E9RA 4BLRA 1YZLA 4B3XA 1W46A 3QY0A 2QAGA 4TQUS 2RHMA 1XF9A 2Z4SA 5JECA 4W5JA 2AHOA 2BBTA 4Q7LA 3CRQA 4K46A 1S2MA 2EFGA 1NMYA 1U0HC 5M04A 4Q00A 5DHAA 4LUCA 1U9IA 2R44A 1UKEA 1Z22A 3IEUA 4OQNA 1Q0UA 1XJ0A 3GLHE 3LX8A 3WXMA 3RC3A 2BBSA 1E32A 1JR3D 1KO7A 2C04A 2OAP1 3GMTA 4HLCA 4JT4A 4QHYA 1U81A 4W5HA 4ZDWA 4IVQA 5LBIA 3V4RA 1SXJB 3DEFA 2FPMA 1S9DA 4LV5B 4F4CA 4DCTA 2H5EA 1F48A 2FV8A 3LAWA 1UBGA 2R62A 5HE8A 2ZJYA 2FH5B 3VKHA 1W4CA 1FZQA 4DCUA 3B9QA 2AR7A 5D3QA 4URUR 2BBOA 3UK6A 3E1SA 3SE0A 1M6NA 3FGNA 3JZMA 2C95A 3PV0A 3AKDA 2Q9AA 3AKEA 2IS2A 1Z0IA 2GETA 3CKLA 3KX2A 4TT3A 3TKLA 4F93B 3A4LA 4DLWA 4Q66C 2OSBA 3SOPA 3TGPA 4M1WA 3EA0A 4R2IA 3B60A 3WHLA 2K5UA 4KYIB 5HR5A 3EPJA 1GUAA 3OAAA 1EXMA 2BM1A 1JJ7A 3BAFA 2IHBA 5C4MA 5DIFA
chains in the Genus database with same CATH superfamily
3SYRA 3O74A 2I4IA 3QFSA 1E0DA 1KEUA 2BEUB 3JZDA 3MJHA 4Y2TA 3ROQA 2V5AA 4QNRA 4JWKA 4BMVA 3ZJYA 3HB1A 3I61A 4G23A 2UDPA 2R6R1 1G8JA 2H5IA 2AG0A 1RD4A 4XQEA 4GVXA 5JTUA 2O7RA 4O6VA 2JGIA 3OZCA 1KKLA 2XUIA 3BH6A 4I2NA 1CR1A 1DC5A 4HWSA 5FBRB 2ZZMA 2XOKA 3HA3A 1UH5A 1KOLA 4Y7DA 2D1FA 3QOXA 1EFVA 3QI2A 4HG2A 5H1YA 2ZRQA 4KFUA 3X43A 2XQIA 2OBMA 1KGDA 2UAGA 4IH9A 4KE6A 4Y67A 3T94A 5K6RA 1QNFA 1W36D 1WOYA 1ZN9A 4CG3A 2X8JA 5BUQA 3V4ZA 4U4AA 1SUCA 3ET4A 3TD6A 2ZIXA 3SSOA 5LLDA 3VHRA 2R1VB 3CH4B 3JTMA 3NIBA 4JR0A 4EG3A 2WZQA 2QUHA 1SRQA 3M1YA 1UDRA 4KJXA 4M60A 1JR2A 1IXSB 1L1RA 1ZO8A 5REQA 4H1UA 3WZLA 4MQ5A 4CKXA 4DADA 2ACWA 2X22A 4NMXB 1IOWA 2CKDA 2RAPA 1DJOA 2GCOB 2P9BA 3G9XA 5DGHA 4BX8A 1P7WA 2W6JA 2WF7A 2YIDA 1TEVA 1WO8A 4UBIA 5SY6A 3V4SA 2OUIA 2JH9A 4RIIA 1M0SA 1HEUA 1PT5A 1V3QE 1KYXA 2MTBA 3ZK8A 5FAKA 1J8VA 5IAJA 3HE3A 1MJHA 1XKLA 2JFXA 1EJ0A 1UEIA 1M5UA 2DKNA 5FI0B 2QA5A 4E6PA 4HWGA 1APBA 2V54A 1BDBA 1WXXA 3CB2A 1TK9A 3AFNA 1HE3A 3JARB 4OPMA 5H02A 5U4XA 4DJTA 3SXUA 2HPVA 2B1IA 4ZCSA 4PNZA 1JSLA 2Q4TA 3CUWA 3G2LA 1G7SA 4MR7B 2BGLA 1VLLA 3RU3A 5IK2D 3BZBA 3ZWKA 1EX9A 2X1HA 4UXIA 1K6JA 4B4WA 3MA0A 1H85A 2ZYGA 4O4HA 1J07A 4S1PA 5AHWA 2A0KA 4U7WA 1SHZA 3RJ5A 4DHWA 4Q39A 2WWXA 2P69A 4UM7A 3RFUA 3RVPA 4F2DA 4LKRA 2XV1A 4D8UA 1AZSC 1KS9A 4KV7A 1Z17A 3QELB 2FR8A 1ESCA 4RKWA 4J0JA 1QPZA 1EZZA 4ILKA 1WAMA 3SG0A 4C3ZA 1JPJA 1GKKA 1YK1A 2O5VA 2Q5QA 2WYIA 4GP6A 4IDDA 2HBRA 3NONA 2G77B 4Y1GA 3KZ1E 3Q5GA 4RESA 4KE9A 3E48A 4MSUA 3UEOA 2AIRA 4LZZA 1XD2A 3AEXA 3TZEA 1PGPA 4XIYA 1KSJA 1Z6PA 1SAYA 4NVRA 4OXRA 5ALJA 3FF1A 4TSKA 4WKBA 1WB5A 1VMKA 4WECA 3ABOB 5KOJB 1I4OA 4B6RA 5KJCA 2O2EA 2VZLA 2J45A 5GJVC 4Y2SA 3TOXA 1PUJA 2OXFA 2PJUA 3CQ9A 2B8TA 2IC5A 4HAVA 2NV2B 1CUJA 1MBZA 3F98A 4GVPA 1T43A 2ZKLA 5G0TA 1NZFA 3I8OA 3S55A 3IPAA 1DXOA 3NM5A 5T4EA 2O23A 3SWWA 1B00A 2YC4C 3LWZA 3NS7A 4WDQA 5JNWA 3FJYA 2PO7A 2OV8A 2WICA 3FPEA 3IKMB 4RK1A 1GNPA 4WZ6A 3EWAA 4BNWA 1UT6A 4V0LA 1X15A 3I8SA 4GOOD 3UGQA 1T3GA 2ZU6A 3OLWA 4G67A 1SXPA 3Q7EA 4U2FA 4GDMA 4YO8A 1PZGA 1NUTA 4GF5A 2QJOA 2VHTA 3Q8XB 3Q7PA 1AQJA 2P68A 5I5GA 3R9KA 4DV7B 1NN3A 1RYDA 3OIUA 3O4GA 4ID9A 6ABPA 1GA6A 4O2BA 3DMNA 2P9ZA 1JAYA 2XHEA 3IT1A 1GPKA 4NCBA 2ZI3A 2VHVA 1M34A 4XX1A 3TLGA 4QGHA 1E3MA 3H7AA 1DX4A 2D4HA 4Y18A 3R7SA 1OX4A 3KV1A 1Y9EA 4M36A 1GT6A 4O4LB 5K4GA 1W5FA 1W6RA 4NZOA 3ZGXA 1N0IA 1NUSA 4US0R 3ND6A 1K8YB 2AG5A 5LC1A 1JHQA 1Z2PX 3I58A 3KT0A 1K8ZB 2V7QA 5HKLA 3WHKA 5KQMA 1FFDA 2H4ZA 2HHCA 2HYDA 3EW9A 2NO0A 2NYVA 5B1YA 1LX6A 4LY9A 2YFYA 3RKUA 2QP3A 2GZDA 4JHLA 4EL5A 2XZTA 4F1WA 3PNMA 1H8HD 3EN0A 3UOGA 1MAAA 1N2BA 4TKMA 2VP0A 1ABFA 3HY4A 1R4ZA 3KEFA 3PTLA 5TMDA 4A6XA 3DTVA 4K28A 1ORTA 3C74A 3LPNA 4Q7KA 5EERA 4YRZA 6PFKA 3F5FA 1TLTA 4PYKA 2BZGA 4JLWA 1ZUNB 4QGSA 4WY8A 4LF9B 4R1MA 3NRCA 2B1RA 2HA2A 1BAPA 3KB1A 2VXBA 1JJVA 5DX0A 1G18A 3MJSA 1XWIA 4TV9F 2QF7A 1KIFA 2Z8YM 4IGAA 4AKIA 4F21A 3I9V1 3HCCA 3A4YA 1GR1A 4ZC8A 2PUAA 2R7LA 2O06A 2OCIA 2ZYRA 4IG4A 4LDRA 2A5YB 1T36B 5HYVA 2IXGA 1S96A 3OIYA 3EVCA 1FX1A 1E9DA 2I99A 4EZIA 3NU1A 1QU3A 5EKUA 1CBUA 1NY5A 1QFMA 2IYAA 2PZ8A 2C7PA 2YXNA 3RTAA 5LZ7A 4QEKA 4LDPA 1JKFA 2GN1A 3R77A 4FJ0A 3PG5A 4BEBA 1U6JA 1U8CB 3ON5A 4D9JA 1A9PA 3AU8A 3I28A 4OXKA 5AKZA 1M2HA 4IGEA 2QGZA 3IPYA 4JX8A 5D3MA 1GUDA 1AM4D 3G0CA 2ZWOA 2XNHA 3TZKA 4OH7A 5LN1A 1T2UA 4CLHA 1LVGA 3NEYA 1HDGO 3CO0S 1A8QA 2WJHA 2BI8A 3CMMA 2BSXA 2CLDX 3F5MA 3FCEA 4KXQA 5DT2A 4DQUA 3UMGA 3JQ8B 1JHXA 4DLXA 1GADO 3HCRA 1XXHB 1GA1A 1TAGA 3A6DA 4DCGA 2EHDA 4EI7A 4O33A 4UHEA 4N3BA 2B82A 5LQKA 3B6IA 1PZMA 3FZQA 1DV2A 4KSYA 5CXXA 3B13B 4CG0A 4DWWA 1RRPA 3JQAB 3N2LA 1S7CA 1WEKA 3TSCA 3OM9A 2IZOA 3I72A 2I2BA 5DNYB 5JCJA 1ZM3A 3OZWA 4HNUA 2FZKA 3UHJA 2PSDA 3AO0B 2H8KA 3FOWA 4KN5A 3OLZA 3TVDA 1JHDA 4EDFA 2I91A 3V8NA 4N48A 3HBMA 1SELA 2Y27A 1CQXA 1EUDA 1T0JB 3HRHA 3IUQA 2Q0HA 3W34A 1G9SA 1QLHA 2XCLA 1RYHA 3BCUA 2GRJA 3F97A 4JI3B 4KLCA 1FE8A 1R15A 2FX3A 3JQGA 3GDHA 4IKEA 4KQJA 4LSGA 2FKNA 1DE0A 4RWEA 4EIWA 2R7NA 3A1EA 4ZOLB 5JUWA 1B8VA 4AQ7A 4MK4A 3DS8A 4FOSA 2PZJA 4WKNA 1YKFA 2RARA 4X8HA 3WY9A 1AS0A 2E5LB 3NUZA 4G5FA 3ZJ5A 2ONZA 3GJTA 2VT7A 3HN7A 3DBIA 1T4CB 5GP1A 4X71A 3VR5H 5JSYA 3QX3A 2BMWA 2OWEA 1U6IA 4PEVA 4N6NA 3W04A 4BV9A 2G5TA 1IB0A 2VYCA 3B51X 4UREA 3VGPA 3KEOA 5JWOA 1T2FA 2BGRA 5K6AC 4XW2A 1IC6A 4KGZA 3WX0A 1IN1A 2GXQA 3L5KA 3ETGA 1EHYA 5JXJA 5JE8A 1H8ED 1U9ZA 3KO8A 4Q9JA 4ZVMA 1NV8A 3WK7A 2CFOA 1TQ2A 4PW0A 3WQQA 3H2SA 1P1FA 4JJ8A 1U7TA 2FI1A 1V2GA 2BFFA 2JLBA 2NXCA 3CNHA 1Y3BE 3HYLA 2PT7A 4B0OA 5K45A 1HYEA 2O2GA 3HU1A 4PGAA 4ZYTA 2RGRA 3K0EA 2FWRA 5TPWA 4II3A 2JBAB 3UGJA 4KMMA 1CLEA 3SDZA 3T41A 5JAHA 1FDOA 1NQTA 5DNVA 2GN2A 2OZLA 3WLTA 1RXUA 1YMQA 1J90A 5KSZA 1JMKC 1PGNA 2XUHA 3EZ6A 4FX2A 1OLSA 3S5JA 3T95A 4DSUA 4YAUA 1V4VA 4YAWA 4MPDA 1Y3HA 2KYRA 5JZVA 1TJ3A 3ZXSA 4EGCB 1S8OA 5AW7A 1GSAA 2B3DA 4ZKEA 3QI7A 3IUMA 3ER6A 5KTOA 5TQ2B 2I2DA 4L8YA 4N40A 1E8MA 2E9SA 4NFYA 4FR0A 2FN9A 4QUKA 1DXQA 4TSFD 3SF8B 4N03A 2QAGB 3P8ZA 1NQWA 4BFSA 4UJ5A 3IT3A 3K96A 3H8VA 3W6PA 2GX6A 4QDJA 3C8DA 5CDYA 3WIUA 2DHRA 4LC0A 2JCXA 3O6VA 4RSGA 1QIHA 4IX9A 3LG2A 3DFZA 3Q7RA 5D01A 3MSCA 4YS6A 4NMWA 3GGCA 1L4GA 4YN3A 2YCLA 3LBIA 2VPWA 5LQJA 1B0UA 4BTEA 2ZDQA 1O03A 3I37X 5FNZA 2J6BA 2GPYA 2QUJA 3DA8A 4OSEA 4XVCA 1HNXB 2VK8A 3GRPA 3GPBA 4MI6A 1R0ZA 4L4XA 1U8AA 4FGUA 4KDCA 3OC0A 4FONA 3EWSA 4DYVA 3GELA 1NPYA 5K4HA 3WAJA 2CVFA 3DBLA 2W6ID 4JLKA 3UKDA 1SH7A 1H05A 3OOJA 2ADFA 1IQ0A 3ZYZA 3WKBA 2OOSA 2G5CA 2ZBFA 4FDVA 1D7AA 3DAFA 4HJRA 1NSFA 3MJDA 4WBSA 1Z6QA 4WZBA 4DZRA 1J1UA 1T8PA 4EW6A 1TCAA 2DY0A 2BOVA 5FQNA 5EUMA 2P9CA 4YCJA 3D3WA 4DGSA 4NYIQ 2FWJA 4YRLA 3GAMA 1FFCA 3BEOA 4DC1A 3DYIA 3PEUA 1HURA 2Q7XA 3HY3A 1DAKA 1PTJC 1QH8A 3CBQA 2PANA 4ZKDA 1V35A 4BOYA 4GPZA 4UHBA 1T1RA 5DM1A 2FOXA 1O95A 4G26A 1M2FA 2N75A 1QAMA 1S8FA 2A1TR 2RAFA 2A35A 4C0JA 4CIAA 3R8CA 2QGFA 3DQZA 3VMMA 4FXPA 1QF9A 1QM5A 3T3MB 5KTTA 1GFSA 1ZOIA 1H22A 2B78A 4TKLA 4TRMA 4AKHA 3SLGA 3VNUA 2R25B 4FCVA 3H04A 4DVGA 3HCWA 3VNSA 2Z8XA 5D3KA 2Y8EA 3VTZA 3T3IA 5KYYB 4AKSA 4OVKA 4YRGA 4MNTA 5IZ4A 2FDCA 2QW0X 4DJ5X 1JG6A 2CNOA 2Y9PB 3DJFA 5FWNA 4F46A 1DZIA 3DLHA 2G0NA 2RGEA 3LOUA 3MTDA 4HDNA 1WKCA 3TTYA 4J6EA 2PE5A 4PRYA 2PRKA 3O0DA 4BNMA 1N5MA 1Z39A 4PQEA 4KAAA 2I9PA 1Q0TA 5KX5A 2GK3A 3HI4A 4W5WA 3ABSB 4ZGGA 4H9GA 1K6MA 4X45A 5CB0A 2FN3A 3CNEA 2ZUFA 4IXMA 5ALMA 2XWQA 4W5NA 2X1LA 2OHXA 1UWCA 3EW7A 2VJOA 1Z6AA 3PQ6A 5H4HA 2YNMA 4RHXA 3TLYA 5HOQA 1A9TA 1QRSA 1VKRA 2H8GA 1AKQA 4MVJD 4RFVA 3UB4A 4F97A 3DPUA 3QENA 3HKEB 5A7FA 3EWNA 1S1MA 4CLOA 2J3DA 1NFQA 2ZP1A 3ETNA 5LP6B 5K4AA 5FXMA 3SBEA 2FE1A 2NO5A 3ME5A 3PPYA 4WDRA 4ZT2A 4V2IA 3VC1A 4ZMRA 3SX2A 3P96A 3K32A 3A1WA 3PUZA 1JFRA 3FG9A 3NV9A 4DXAA 1L5MA 2XODA 1ZA1A 3VUEA 3OQIB 3GFRA 2DC1A 2FWBA 2GVDC 1VPTA 3B7PA 3T4XA 2HMSA 5KSYA 3V1NA 2WHPB 1UAGA 2QRLA 3W3AH 1J0XO 4N8DA 3SQOA 4WNAA 2GYYA 5BT9A 4CMCA 2RH5A 1H1LB 5A0FA 1I32A 5TGZA 1SBYA 4F1JA 4CETA 1OZHA 3DB2A 3T54A 4ALKA 4KUGA 4HL6A 4BP3A 4HH1A 3KXPA 5FPTA 1LF0A 5E6RB 2IL1A 3GEIA 4RL6A 1E5DA 5HFAA 1LRLA 3CTPA 3R20A 3T1TA 1NXOA 2NXJA 4HB0A 4B6PA 2RHWA 3V8EA 3GLRA 3EPKA 1LA2A 3RS4A 1UBUS 3CONA 2VNSA 2X3YA 4C5AA 4RDHA 1U2GC 2RB4A 4D0SA 5L3QA 3GEHA 4X1YA 4EKIA 2GZRA 2XXBA 1U7XA 3GVCA 1K4MA 3TQQA 2DU8A 3LHKA 4JBHA 3M6IA 4HT3B 3U49A 2VDLB 3FW1A 4B17A 1EX6A 3AONB 3FR8A 2BFDA 3D5EA 3AF5A 1JFTA 2QZSA 4IHJB 4G0PA 2P2DA 4LJ9A 1N1DA 2FQYA 3CMCO 1RWWA 1IULA 3I2HA 1N5OX 2ZBEA 4PFJA 3VU9A 5LOVA 3I2FA 5E6UA 3PWSA 1ISPA 2PH3A 1BVUA 1ULSA 4D4LA 5AVRA 1RQLA 1DRKA 1NBIA 1NUUA 2O07A 3M9XA 4Y1RB 1GWNA 5EFOA 4JLUA 1X8JA 4PO3X 2EL9A 2W00A 5AVZA 1YF3A 2PU7A 2NU7A 3LBHA 5LU8A 3DFMA 4BFCA 1KU6A 1QO7A 4ZYLA 4HDRB 3JASB 4IOKA 3VZBA 3SEQA 1BCSB 1YHNA 4ZRNA 5TT0A 3K2EA 3ZWAA 3OD5A 1JU4A 3TTWA 2RHCA 3PUWA 5HKAA 5M3BA 4PLFA 2RHBA 2X76A 4BFLA 4KR9A 2IEGA 3F3MA 4EA6A 3RIXA 5C34B 3R1IA 3TLBA 3JQAA 4I66A 1D6MA 4CVNA 3FB1A 4BE4A 4FFWA 4RH1A 3UATA 4DA9A 1PR3A 2EIXA 2VRCD 3AEYA 1VSTA 2I4RA 4OK5A 4LF6B 2VDOB 4EMTA 4XSGA 5EHZA 1T1GA 4X20A 2FQ1A 1P19A 1PNQA 1R0SA 1W4AA 2P7HA 5DOVA 1NN1A 1KGSA 4ND6A 4XE5A 3THWB 2H1FA 2DWQA 4D8XA 1IUKA 5I4KA 5M5BA 1Y4ZA 4E12A 1KAQA 5EESA 1XZMA 5G0VA 3ZXXA 3FE2A 4R8SA 1BGVA 3U3OA 1YRQA 5T41A 3IMFA 5F78A 4E5VA 4YMIA 3SS7X 1FYDA 1XQXA 3PLNA 3KLNA 4O1MA 4DCCA 2ESRA 2XJ9A 3Q10A 1RXCA 2W4IA 2I22A 2MMGA 2ZS8A 4ZVTA 4CMJA 2FSSA 1O77A 3NTOA 1TB4A 2QTGA 1L5KA 4AZ3B 3NHUA 4M8SA 4G5YA 2QZPA 2ZYWX 5I7WA 1T9ZA 2B8NA 1NWHA 2PRZA 3IELA 4TTSA 3FMOB 1DUVG 1SKAA 2Y92A 3D8UA 3AR6A 1H3EA 3C5VA 4GOMD 3D3NA 4MW2A 3C5CA 5EPEA 5IDVA 3O4VA 3QYPA 4PY2A 5AVXA 2E3JA 4JX9A 3UUFA 4A0HA 1TQDA 4MUBA 4KSBA 2IDMA 3WYFA 4ZXFA 4RLSA 1X8XA 1V8PA 2CVOA 5E38A 3KQOA 1TA4A 4EUKA 2DWCA 3MWJA 1QWSA 1ZCAA 2AFIB 2IHUA 1MJ5A 1P8AA 2M2IA 3OOSA 4ZODA 3X2EA 1BMFA 1K75A 3D0RA 2BEWB 3Q1KA 4D8VA 4BZPA 3BCRA 1DWUA 1WMAA 2WDPA 3AL2A 3UGKA 1QRTA 1LBQA 3OZFA 4FNMA 3IHKA 3KB6A 1XTTA 3ASYA 2C9BA 2Q1XA 1H5QA 2PZLA 1ISGA 3FNEA 2G63A 2W6MA 2W8BB 3GRRA 3HJCA 3MCZA 2XGMA 4C4RA 1R8YA 1FDIA 2DB3A 3A1VA 2JIZA 3VHXA 3PFHA 4DILA 1RAEA 2D8AA 4IXTA 1ZJ5A 1WQ4A 1I24A 2I7CA 2EEZA 3HP1A 3M6AA 2QM7A 4M38A 1Y80A 4RXTA 4WOJA 4OI1A 3M2TA 4YRKA 2RD2A 3A2LA 4OHPA 2LCQA 4BO6A 1HPLA 3FBTA 4Q15A 1Q1BA 3PDIA 2D59A 3BIFA 3E5MA 1R9NA 2G9ZA 1CJMA 4A3SA 4E1VA 3ND9A 1BFKA 1UMKA 4B9EA 1WULS 2NAFA 4RHFA 2VSNA 4PBRA 3FOEC 4AIIA 4F72A 1F9EA 3N6VA 5FBKA 5TVKA 2HJVA 1K3TA 2A8YA 2BMJA 2ID4A 1II8B 2WTEA 4IFIA 3NUQA 4MYCA 5IYZB 4AI6A 4CG1A 4ATNA 4ISBA 4WFKA 5IJZA 4AY6A 3O31A 2B9EA 4RZXA 2P6PA 2TYSB 5TB5A 4GBJA 2KQUA 4QOHA 4TYMA 5ECGC 1PFUA 1GNVA 1CERA 2YV4A 4ZT7A 1QIJA 4J6FA 2IX9A 1GKLA 1XSEA 1W4ZA 1A4XA 2I2AA 2OBLA 1UINA 2VDWB 2X0KA 4UC0A 4B47A 4DXDA 4L5BA 5JPCA 4PRZA 2IHKA 2JI4A 2BMDA 3UENA 4BHTA 5A9RA 4K2AA 4HV4A 3KT8A 4GX1A 2I6SA 2JJ2A 3CISA 3G5LA 1EBBA 1CS0B 2XMQA 1UPTA 2J5XA 4EVSA 3CNQS 4UEKA 2Q62A 1P2GA 2H31A 1JYSA 3RC7A 4CGZA 2FF5A 3A32A 1GV1A 3KE8A 4N7MA 4DIFA 1BXZA 1EE2A 2JLQA 3UG7A 4E07A 2YHIB 1VMAA 1EFHA 2P77A 4QOJA 1XHEA 2QD5A 3TG8A 1KEKA 5F5XA 4MR9B 1TLFA 1U0FA 2PWPA 3P5BA 4FC6A 2OQIA 3DD1A 5AM5A 1XALA 1JNXX 1GQYA 2A6PA 4MICA 2JVKA 1W6UA 4TYWA 3GFBA 1WVIA 4E4TA 3VSDA 2NSDA 4WOPA 4QU9A 5HRUA 3JAWA 4IIFA 2ZRIA 4EX6A 3EIUA 7MHTA 1TA9A 1YE3A 1KVRA 3OETA 1ZIYA 4Z2YA 5ECWA 3ZLTA 3EEBA 2W2MA 2KMLA 1C1XA 1ZI6A 3I5AA 5J59A 2B4QA 4KVGA 3CKYA 1Z5OA 3COZA 5IKEA 2DM6A 1O95D 4PAOA 2J08A 4YAKA 1ZBQA 3H1FA 3ZHCA 1NAIA 3EISA 1OZGA 1KHTA 1U2ZA 2Z2IA 4FU0A 4XB2A 5EOVA 3P52A 4QO8A 3PDUA 3CR3C 4YQEA 3REQB 2X0FA 1T5HX 4RTSA 3IERA 4ZPJA 1OI3A 2H07A 2J31A 2X42A 3SYKA 3NLLA 2DKFA 1SIUA 4P33A 4MGKR 5I48A 1DTWA 4HRVA 1NVUQ 2A88A 3ZZNA 3EF1A 2MSCB 4E2YA 1XNRB 2V0GA 3L01A 2QTCA 4MUAA 1E2UA 4R1OA 2ZFUA 1IBSA 1NV9A 5CFZA 4DQXA 4OQZA 3GOHA 3MQFA 3VFDA 3DUWA 5JARA 1KYYA 1JIUA 9LDBA 2L42A 1KP2A 2Z3VA 1CDDA 4J91A 1CUHA 3K9QO 3SBOA 4TMKA 1L3CA 2YNMD 3U19A 3A3OA 2QD4A 3C97A 4XCXA 3QPDA 4ZI2A 3LLVA 3NYRA 1UBCA 3OIWA 1ZRSA 4LYYA 5FL7A 4PS0A 4AX8A 3W90A 1HNZB 1DS6A 2FSFA 2P9JA 1MEEA 2ATXA 2A0WA 2ECOA 3SICE 1T91A 2QUBA 2ZDGA 4PGGA 5ELMA 2YWGA 1V37A 1KSGA 2OTCA 2H1RA 1Z33A 5JWHA 2CFSA 4K6KA 4ROTA 3GHYA 1JDZA 3TNJA 3W8RA 3F2IA 3PJFA 2QP9X 4LHVA 1PR2A 2GN4A 1NNEA 3KYBA 4I1UA 2YWFA 2O8EB 5IX8A 2J0EA 2IUTA 3FKSD 1TA0A 2V4UA 4B7ZA 1CX9B 2IZ5A 2XEXA 1SKMA 4POOA 2Q1SA 4OU4A 2IYLD 4YBRA 3GVIA 3U7HB 1VLJA 3DLCA 4AUMA 4FHGA 3FNBA 2WFAA 3FHCB 4FKBA 4Z0TA 4BJHB 3GUZA 3FPFA 5KVAA 2COKA 2B2XA 2QWXA 3L1VA 4RS3A 4E3ZA 4ENVA 2VA9A 3GT3A 1RVDA 4U7DA 1NJ8A 2VHWA 3PC3A 5CVJA 1A1VA 3DWIA 3PNYA 4ZALA 1KEEB 3H3JA 1RBQA 3AGQA 4K9MA 1YMVA 3IUYA 5IBRA 3VVCA 4I4IA 4BWFB 2YS6A 2A5DA 1H2BA 2X7JA 4HD8A 3ZH9B 2H11A 4GPEA 1PJLA 4X91A 2VSYA 4TLAA 4NZPA 1EESA 3N2ZB 2JLCA 3IBGA 1ISHA 1L4KA 2LIVA 5K0LA 4LGCA 4MQ4A 1PLLA 4HP8A 3DWGA 1RM5A 3MJTA 4DIUA 1LW7A 3VM6A 1IAQA 4A2CA 1UBRS 3DEKA 5CH8A 2Y66A 1QKIA 2Q0QA 1XKQA 1NUAA 1XTBA 5CA0A 3KFXA 1TKCA 1KAHA 1U2QA 4J03A 1B76A 1JQ3A 1KAGA 2DQYA 2RI0A 2YZMA 4R5MA 3UA4A 4DNOA 5C80A 2P7IA 1ZVVA 3FMPB 2A33A 2LRHA 4JCOA 3W77A 3MLBA 1GZDA 4L0DA 4MW1A 1SCKA 1O0BA 1SKUA 3HMKA 5G0WA 2XZOA 4YJGB 4DLTA 4LHWA 1Q3HA 1W59A 2AOWA 4KIUA 3M70A 1N2IA 2DHEA 3LPCA 4N8SA 4UTXA 1NDUA 2ZB4A 1OTYA 3KL2A 4LI0A 4RSRA 3PI7A 1H2EA 3QMPA 3HABA 3K9GA 4H18A 3OCWA 1A5SB 3M6LA 4KMRA 3RS9A 1RT9A 2J5RA 4IF6A 2EWMA 4NOKA 3HB0A 1LDYA 4AM8A 4CM4A 2ASVA 4EPXA 1Q14A 3BSYA 4R16A 1W0KD 1QTRA 3HBFA 4MVYA 5TVGA 4UTNA 1DARA 3HQ4O 3QUSA 4B32A 2W6CX 2W6NA 4R5HA 3IEKA 2F1RA 2GZAA 4MQ6A 1OCEA 2ALJA 3MOIA 4RTKA 5DP2A 1ISIA 1Y5IA 4KQXA 1W0CA 3ITKA 4UDXX 4X61A 1ACLA 4US2R 2FMKA 2P9TA 1PG2A 3JYOA 3TK1A 3PFWO 4JOCA 1YOVA 1WUKS 2ZPTX 4FWBA 2CB0A 1G41A 3D6UA 2DUUA 3G7NA 4JJEA 4KVAA 1EA5A 4XWTA 1H2WA 1UKVY 1RAGA 4P8RA 1OFUX 4WFJA 5F73A 3PA6A 4JDPA 4FEEA 3IDFA 1DBSA 4O3FA 4AP9A 5LQSA 1G8MA 1WHSA 1UPCA 4TVKA 1G5HA 5HBGA 3PRJA 4KH1A 3CLVA 2IXTA 3E2PA 3I53A 1WCWA 2RAVA 3K2BA 5HMMA 4JB3A 3CTMA 3HO8A 1Z0AA 3RJ9A 2W4MA 1I6WA 4LRXA 4XPIB 2DBZA 3D0QA 2OO5A 4LPSA 2DFLA 3DLTA 4DMGA 3G2OA 1PCXA 4G1UC 1LTKA 1TQ6A 4HCJA 3VPAA 3DDZX 2GEUA 4MQEA 1QB7A 2QRGA 4FNOA 1X6VA 2I4NA 4TWIA 4OUDB 2QLTA 5EMJA 4K1XA 1QH1B 4PLTA 1PSDA 2CJPA 3B9RA 3SMQA 4GDFA 5EVCA 2IV2X 2XX3A 3PT5A 2O8FB 1IN7A 4UU1A 2B21A 4QG7A 4Z0NA 3CRNA 3DE2X 2UV8A 4KL8S 1KQ3A 1HDEA 3QP9A 4UCQA 4C1NA 3V42A 3IVMA 4PC1A 3A9RA 5JR3A 3HYTA 4NESA 2NTNA 4PONA 1MA0A 2W2TA 1RXIA 2H92A 4S0XA 1NVMB 2B6NA 5BRNA 3LO8A 1SG6A 1TKAA 1VXRA 3G2HA 4N54A 3FYUA 3NPAA 4M83A 4R1NA 4EGAA 1Y7PA 4CF3A 3BWEA 3OCCA 2HA4A 4HNSA 1RWNA 3W8FA 1VBFA 3QWHA 1MV5A 1AQNA 4URXR 2Q49A 5DU2A 1FP4B 1O9GA 2CWDA 4XQ0A 4U00A 1LTQA 2C2GA 3T9DA 3UT5A 2QZ4A 1DKLA 2NU7B 1PX0A 2O2HA 2ZWVA 1H8HA 2IS6A 2QRNA 3OQJA 4E2WA 4ESVA 1U7UA 1GZUA 1FVXA 2FDXA 2W42A 1MKYA 4HQOA 4K86A 1EXNA 1NL3A 5CX1A 3U56A 4WKPA 1YL5A 1V1MA 3G2NA 3RSSA 4AUEA 5KQPA 3RUEA 3WGIA 1R6AA 1EGAA 2Y1XA 5CVDA 3LX5A 3BQ9A 3VI4B 2GN8A 3VR4D 2X4DA 3EIHA 4DNQA 3JWPA 1P0MA 3E9EA 2MYTA 4HKTA 1V9LA 3SDSA 1FRVA 1NVKA 5JS2A 4BMSA 3TR5A 3SYMA 5C5DA 3GNQA 3EG5A 3RG2A 1RRMA 2HF2A 4EAAA 1C30B 5B3JA 1VE9A 3GA5A 5KSPA 3GH3A 3MWYW 4U5XA 1IAVA 3FSRA 1P6UA 5HFNA 1J7JA 1YZKA 2WWTA 3HGQA 4BGEA 4FYWA 1XZNA 1SCJA 4BMZA 4BLWA 1OFIA 3R74A 4UUBA 3UJDA 2CDBA 4BRZA 2ZSFA 3O2QB 4JI5B 3QIVA 3J7AC 1BXKA 1QKJA 1R1DA 4K9QA 4DDMA 5C7OO 1J0EA 1NRXA 1CUBA 3N0TA 4AW9A 4F6RA 1U98A 4R41A 2FCAA 1Z6YA 3CWZA 3SX0A 5FJIA 4ZT4A 3O3OB 2G9NA 2EBFX 2J3QA 3JD2A 3VPSA 4CMIB 2GK7A 4PSUA 1WQ1R 2MSKA 1B2LA 1IB6A 1VQ1A 1FEZA 5IN4A 1X70A 2HCJB 2O9JA 3MAJA 4IQGA 2O7QA 1NBMA 3IUJA 1YHZA 4UVGA 1P61B 3K9NA 5L3ZA 3ZZ1A 4UFPA 1GTL1 1YBFA 3K53A 4RGBA 3EXIA 5F21A 4XSHA 2OKCA 4V02A 4O4LF 5EUBA 1DHTA 3JALA 2J9FA 5AYVA 3SZLA 3A6EA 4BMXA 2O6LA 3HUTA 3UAXA 1BE6A 1TYBE 4OQQA 2AJLI 5UKDA 4P6VF 2SKCA 2PCLA 3WWOA 2WHEA 5K8IA 3ICEA 1XAJA 2EDCA 2V97A 3H2BA 2IK8A 4NJEB 1UJMA 5DBOA 5CCEA 2P4HX 1C7IA 3RO7A 2N47A 1NYQA 4Z86A 2VRNA 2GZ2A 4KK4A 5EWMA 4PC2A 1EWKA 1H9BA 1Z5WA 5KZMB 3C3PA 3MLEA 2PV0A 1QCYA 3L6DA 2H06A 1R0RE 3MWLA 2H2DA 2OV4A 3B53X 3M9WA 5G1NA 2P2CA 1X92A 4D42A 3WNQA 4YAOA 3RFXA 1QGZA 2CXXA 2DGDA 2YXLA 3PEEA 4LRSB 1Z28A 3ZV3A 4XEUA 1PV4A 2N1BA 4ESHA 1HSOA 2ZWMA 2ZUEA 2I1LA 3A7DA 1G5TA 4M9QA 4O8CA 1M2EA 2IYQA 1U9JA 3PEFA 2PWAA 1BKSB 4XOIA 2HSZA 4EABA 1TL7C 1VFPA 2C58A 4WX2B 1CUZA 1MB4A 2R1TA 3IT0A 4ESEA 3M6MD 1K7FB 4P7FA 1TDJA 3EXEA 4JXXA 4NNJA 5AOCA 3WV5A 1NG9A 3I30X 2C5BA 2RGYA 1ORWA 4M3NA 4J3NA 1TM1E 2VP5A 3GJQA 3IEIA 3H4MA 2FE4A 3I9V6 3HEAA 2HPZA 1UKAA 3EZLA 3KQPA 1Q0HA 3LWNA 3MRTA 1YS4A 4X7BA 3V8VA 2QTLA 5JADA 4F3TA 2DFVA 1X87A 2EARA 2G76A 1QHYA 1VA5A 3DP7A 1PR4A 1X8KA 4FVTA 4QGFA 3G85A 2Z8ZA 3KKPA 1SBHA 4Q7EA 5P21A 1OQAA 5EHQA 3N2IA 3E9YA 2W6ZA 1EK2A 4WBNB 2ZS9A 4UZSA 3PL1A 5HK9A 4LZPA 2P4EA 4BNYA 5LXTF 1RTTA 2PY6A 2Z2ZA 1HE8B 3BD9A 3O8OA 3PA8A 1IDN1 3JY6A 3W5JA 1YR7A 3D0KA 2QKYA 4N6GA 2F6RA 1KDOA 2JAQA 4LDZA 4LSZA 2OHJA 4HPJB 4KACA 3FHTA 3D6NB 5D51S 5KDOA 3OKFA 1JHPA 3FUVA 1VKJA 2H1SA 1HA3A 4G37A 2QD2A 4KBYA 3EC7A 2ZUWA 2B30A 3G49A 4JXZA 4QOIA 1B1AA 3TRHA 3OLQA 3T4EA 2GBGA 4ZIRB 2AOXA 1QCZA 2OORA 3JSAA 4A2WA 3OU2A 4FILA 5C1DA 4DNPA 5LIRA 4G5SA 3GJSA 4FDMA 4EVIA 1DT5A 1NMQA 2DHQA 3NJ4A 1BS9A 4UVHA 2VWQA 2VI5A 5J5AA 4G4SO 5FF9A 1OVMA 1WXGA 2HSJA 5GJBA 3GOQA 4RZHA 4DWVA 4NPCA 4EYKA 3D1JA 4JMLA 3GXOA 3PXEA 4OA8A 4ZAWA 3HYNA 4EELA 2GT1A 2QTMA 2ZB8A 2W2OA 1PVVA 3CW8X 5D84A 3UAYA 5IC4A 2BN4A 2G9RA 3N2KB 2ZBGA 5J2TA 3K09A 3NOVA 3P0HA 5JECA 3NHMA 4JUAA 1W88B 3PDWA 3EZ7A 2NV6A 3GFGA 1G21B 3TOVA 1OE0A 2GUWA 4ER7A 4RF3A 3AVQA 4A0FA 1P7YA 2WUEA 2GHQA 3AR8A 4OHCA 5E9JA 3REGA 3ZPXA 1L7XA 3H42B 3RTEA 2JGEA 7REQA 5AKEA 3WB0A 3MGBA 1Z5GA 4J0GA 5EZYF 3EVFA 4JVOA 1SKBA 4OX9B 2YZGA 4PFSA 1D4FA 1T25A 1KMHB 2DTDA 4GO1A 2G1KA 1I5RA 4I8IA 5KOHB 2CK3D 5FUXA 2PFKA 2BDUA 5FDFA 3T12A 2R79A 4IS2A 4ZVVA 4PG7A 3VR1A 2P3QA 3P32A 1A97A 1NXVA 1RNLA 1ZRMA 3HKCA 4B4UA 3OG9A 5BXYA 1XCPA 3RVOA 4XTCS 5BPHA 2XTZA 3UHOA 2X0JA 4DT1B 3LPAA 4HZUA 3AR3A 1X7HA 1TUBA 2P1DA 2DY1A 2QE7A 3HWSA 3T7AA 3FCXA 1G9XA 5JFTA 5KU7A 4H27A 4CEIB 4C30A 1GCAA 2XIQA 1M0WA 2R8RA 4ZCLA 4HR7A 5A04A 2P9HA 3P71T 5JDCA 1U0BB 1X94A 3C3BA 3OZEA 1PG0A 1X1TA 3HNRA 3B7GA 1FOEB 3G3EA 4TL6A 2CMFA 4PSAA 3CN7A 3NXKA 4LMAA 3G0DA 2DPHA 2YVLA 3FPCA 4QJBA 3NGLA 2VN8A 1AIPA 2NX2A 3VQTA 2QRJA 3O4HA 4HDMA 2W8BA 4FE4A 1ECJA 2AZMA 2VAWA 5IT4A 3G0HA 4C0WA 1U1CA 1IVYA 4B5LA 4DC0A 1J5EB 4DIMA 1V1RA 1WLSA 3SXPA 2IEAA 1C8VB 3TTSA 1M6VA 2VPXA 3TWOA 1VYHA 3WRYA 3IHTA 4DUGA 4RULA 5BW5A 2J33A 3HY6A 4RVNA 2C7QA 1GZVA 4CKBB 1VGRA 4KWCA 1Z26A 2ZRBA 2Z4TA 1U9CA 1NBMD 3DD5A 5ALFA 2F3RA 3L84A 3VMFA 4C4TA 4CDRA 5F98A 1WNFA 4L72A 4MV7A 4LSWA 3K4QA 4PYJA 1BTOA 1J0DA 1EIZA 4OG2A 4EW2A 3HP7A 4HB3A 4TRJA 3SPXA 3GC6A 3S8EA 1QC5B 2N9UA 4NZMA 1MABB 1A27A 2JZNA 2OQ2A 4S3MA 3TCNA 2OZPA 3VV2A 1Q7GA 4N5MA 4AB1A 1BWPA 3COSA 4IOLA 5C8ZA 3B85A 5CFNA 1SVLA 2QRUA 5AVQA 2IZ1A 1L7VC 2V3WA 3JYHA