421PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-RAS P21 PROTEIN
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
total genus 53
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 421pA00
2WSSD 4P4SB 3I4LA 2OBMA 3EZFA 2OESA 1QHSA 2IYLD 3IPYA 3EZ7A 4KLZA 4LK2A 2BJWA 1UBGA 1WP9A 721PA 1R6BX 4WW0A 3IQWA 5DYGA 3W3ZB 1Z29A 4XSHA 3SJZA 4Z54A 2JLXA 2WTUA 4B3CA 3LQRA 3W5IA 5FOVA 1ZUIA 5AWFC 4GP6A 1R0YA 3GLFB 2QMOA 2IF0A 1QHNA 2PT5A 1AKEA 4LHXA 4TQ9A 3DKVA 1YHNA 3GFOA 1ZU5A 2X19A 3K53A 2QN6A 3IO3A 4Q1FA 3LO5A 4B73A 4C0QC 4F91B 1WMSA 1Z6AA 2A30A 4TT3D 4MKFA 1ZM2A 3ZVNA 2FEOA 1RKBA 4DB4A 4BWYA 1E9AA 1KAGA 3IIJA 4HLUC 1EK0A 3U6KA 3RC3A 5GJVC 3ZVMA 2QP3A 3FMFA 2OCAA 4O2LA 1N6NA 4D4LA 3OAAD 3GD7A 1NY5A 1P5ZB 2QA5A 4UNRA 3L82B 1E9BA 4JKIA 3CX7A 4DLSA 1Z08A 3BK7A 3PR1A 4JMPA 2ZI4A 4YC7A 3WNDA 3U7HB 1HYQA 4TYNA 3LW8A 2C96A 1XD2A 5EUMA 4TLCA 4DRZA 1JQLB 4Q66C 4TMWA 5FPHA 4EUNA 2R6DA 4L9WA 3P4YA 1UF9A 1ZCAA 2F6RA 1KNXA 2HXSA 3LXXA 4FINA 4LPKA 5IDVA 2IWHA 621PA 2GCOA 1F6BA 1XTJA 1B0UA 3KL4A 4Q7MB 2FV8A 4S2EA 1YVDA 2ZQ5A 1G18A 2BWJA 1ZW6A 4TTQA 5FL3A 2LWIA 1BMFA 5SZJA 1U8ZA 2NO6A 3A1TA 4M1TA 2Z4SA 1CRQA 3AF3A 3AF1A 1A5TA 1FOEB 3B5JA 4RZ2A 4MH0R 1NJGA 2EYUA 4DB2A 1J99A 1RJ9B 4OL0A 2ZTSA 3T15A 1WXQA 5FI0B 2ZJOA 2C2HA 4URUR 5FFMA 3VKWA 3AGPA 2C98A 3NEJA 1G6HA 2WMNB 2EWVA 4GOKA 4LZZA 2H18A 1N0WA 3ICQB 2AHOA 1W48A 2AR7A 2FFBA 2MSEB 2WSMA 2GBLC 2JIZA 1OLOA 3EWAA 4MRSA 2ZRKA 1W0JD 5CK5A 1U98A 4KBGA 4TLEA 1J70A 2P6RA 5J4VA 3TVTA 2ONKA 2ZJ8A 1YR8A 4Q9IA 2AL7A 4QBFA 4BLRA 2W0SA 2VA8A 4E5UA 4LGMA 2CCJA 3DM5A 1OYWA 3C5CA 4J0QA 1WBBA 3K9GA 3P32A 2H1LA 4UNQA 3TSWA 1WB9A 1N0VC 1P73A 3FWYA 2PMKA 4GSYA 4IVQA 1N6RA 2R62A 1G8FA 1E3MA 3KUDA 3P4XA 1NVXQ 3KFVA 4HI0E 2AD1A 1TUIA 2ORWA 4UNSA 4BLOA 1KY2A 2KI5A 3BERA 4QOSA 5KSZA 3AVXA 1MRSA 3Q8XB 4JLDA 4Q02A 1G4AE 3A58B 1LS6A 3F5FA 5JLJA 2FZLA 3BJIC 2BCGY 4CEJB 2GCPA 2J0UA 3U3MA 2OCPA 2YWGA 4JVLA 4MGYR 4NCKA 2ZROA 4DZZA 2JJ2D 2EFGA 1PLLA 3CPJB 5JSZA 1P60A 3BB3A 2F1RA 3KX2A 1V5WA 2X2EA 4XIGS 4KAXA 1P9NA 4QBIA 3GLIB 3KKQA 2AD5A 5C18A 1OSNA 4MKGA 4BUJA 1DAFA 1IJFA 2G3YA 4CVNA 2XTZA 4DLVA 1E9SA 2RKOA 3MAAC 3CRRA 5JWHA 2W2VA 4C3ZA 3K0FA 1A2BA 5AUOB 5AJYA 2FX3A 4GOJA 2NO0A 5BN5A 8OHMA 3W6OA 1FNNA 2LKDA 1GILA 1G7SA 5IRCD 4QJ5A 3W34A 2R2AA 3DZ8A 4HLCA 3WBJA 4B43A 1G1MA 2ODWA 1DO2A 3QY0A 4JL5A 1M34E 2A9KA 1NI3A 3PQCA 1KO8A 4MRNA 2ZU0C 4DVGA 2C9CA 4EFLA 4AKGA 1NL3A 2IS4A 4WZBE 4P3YA 3K70C 3THYB 3MJHA 3PEYA 3PEUA 3HU1A 4RFSB 4L5BA 3IEVA 4YDHB 3MWJA 1G7CA 3IBYA 1TPZA 4HATA 3JZAA 1KYIA 3AKDA 5BYKA 1G8GA 2GEVA 1ZIOA 4MYTA 2CJWA 4JZKA 2A5YB 1VCIA 1XMJA 4XD7A 1VHTA 5C2JB 1EWQA 3SQXA 4LY6A 3GEHA 4A8JB 3ADKA 4EPWA 2A2ZA 2GTPA 3BIFA 4TSFD 4CZ2A 2FNAA 4FMDF 3RS7A 4BRUA 2ZSFA 5AR1A 2J46A 3CRMA 3B13B 4N1AA 4NMMA 3L8ZA 4M9XA 1BYUA 4C0KA 1CR2A 5E7JA 5TMPA 3R7WB 3SI7A 2ZJ2A 2HLDA 2ZYUX 4AD8A 5L3SA 1KI6A 3NIBA 1J90A 1KI9A 4M21A 4U00A 1AM4D 4GZLA 4HLUA 3FGNA 2I1VB 4GT1A 1OXSC 5CITA 3DDCA 5JZVA 4TQUS 2FPKA 4ZDKA 2GK7A 1N6LA 4FXPA 3J81k 2CCGA 3UWKA 4TYYA 4IDHA 5DI9A 4HLQB 2PT7A 2WKRA 4QJ3A 2EVWX 1YZUA 4PFSA 4LRWA 1S3SA 1ZAKA 1VHLA 2RGAA 1DAKA 2ZUDA 4RD1A 1NLZA 1N3BA 2QG6A 3MSXA 3X2SA 3PJRA 2CCKA 4C0HA 2ZR9A 2SHKA 4Q4LA 4DCUA 4BLTA 1W36C 2C99A 2RGEA 2CNWD 3N5CA 1OW3B 4RCYA 3RRMA 4BGDA 1FP7A 1E1QD 3THXB 3RRYA 2VP4A 1FX0B 2DPXA 3PEWA 2IYYA 3MLEA 1F48A 1NF3A 4MITA 2P2LA 2EFCB 4KYIB 3OE7D 5EE0A 3CZPA 4LBWA 2PEZA 2F55A 1KJWA 4LYJA 4W5HA 1G291 1R5OA 2GAAA 3U3KA 4OHYA 4CT4B 3UPUA 4RZUA 2Q0HA 4C0AC 1NNEA 1G17A 1IBRA 1KOFA 5HZKA 4WZ6A 1L2TA 1DADA 1E1RD 2V6JA 4WOPA 3V9PA 3Q85A 4WXPA 1UBEA 3SE0A 1AN0A 3SZRA 5TV2A 2OCBA 5E95A 2ZRIA 4XVRA 1NP6A 5GJBA 3T61A 3CPHA 2OILA 1OIVA 3UATA 1AS0A 4HAXA 4I1VA 3WNBA 4PPGA 2VSOA 1IN5A 1CJVC 5AUQA 1XEWX 1DAGA 2JASA 5FR1A 2HYIC 3OIUA 1FL9A 2YKGA 1OPXA 2ZRFA 2RHMA 4HZUA 4OYHA 1N5KA 4P31A 2N46A 1AGRA 2PLFA 3JVUA 4UNPA 5SZIA 3QXXA 4Q03A 5FPKA 3Q5EA 4QHYA 4BFSA 4MYHA 3ZS9A 1ZM9A 2XNDA 4QG7A 4WVFA 4ZPXA 1E2QA 5FTNA 2ODNA 2BBTA 1GNPA 4L16A 1IXZA 3SYNA 1BOFA 3I8XA 3BWDD 3FFBA 1XP8A 4OQNA 1FW6A 2X1VA 4TYPA 1NG1A 5EJEA 1G7TA 4GMDA 3RDPA 2FSFA 4ARZB 2WJIA 1H8HD 4A0GA 1KAOA 2D62A 3MD0A 3KQNA 4CIDA 2CL7X 3U7FB 1S8FA 3WNCA 2JLSA 4C2TA 3HU2A 1T3LA 4A6PA 2WHXA 1FPMA 4ZI3A 4AURA 5LD2B 5L3QB 4F7WA 3RWMB 1E2LA 2FG5A 1XBTA 1UM8A 3U60B 1H65A 4B2PA 2IA5A 4A0HA 2O8DA 1RW4A 4JBXA 4BEBA 4H9GA 5GADl 1II8A 2H17A 3Q3JB 3RRZA 3LV8A 2FN4A 2LKCA 4YXWA 3TW8B 4LV8B 4P0TA 3SN6A 2DWPA 1DELA 1KZ7B 2ASEA 2WWGA 2JLYA 1TF7A 3UG7A 1JI0A 2GJKA 5EXPA 3K0AA 1Q57A 2Q9AA 2GXQA 1JR3D 3CR7A 2XOKA 1NBMD 2RGDA 3IEUA 1ZRHA 3QKUA 3LA6A 3THWA 4LHYA 4HB4A 4QFMA 5L8VA 1A1VA 2HXYA 4B76A 3ASZA 2IEYA 3FTQA 4BLPA 2BHRA 2MSCB 2VPPA 5E7MA 1OXVA 2ZETA 1WRBA 2G0TA 3AP2A 3X1YA 2ZREA 1XEFA 1G7RA 1EFRA 2L0XA 2W0MA 4MUBA 4UQOA 4ERNA 4G1UC 1E79D 1U9IC 2E9SA 2NPIA 2ZSDA 3QIAA 3U6BA 1KK3A 2MSDB 5P21A 4UNNA 1G21E 3S1AA 3VQTA 3GEIA 1KSGA 2QORA 3GP8A 2Q9BA 4DWJA 1E98A 3FPAA 4Q1DA 4A6XA 2ZUBA 2QE7D 3AP1A 2ECKA 2DFLA 4DDWA 1G5RA 5CM9C 1E2IA 2J0SA 4GP7A 1KI7A 2ZJZA 4G5SA 4M1KA 4Q4AA 1MABB 2JJ1D 1NSTA 2QPTA 5AUNB 3NH9A 4Q7KA 3B1WA 4OK5A 4DDTA 5JMTA 4LBZA 3R8FA 3IHLA 3AF2A 1XCGB 2GXUA 2HCJB 2VL7A 3Q7QA 1D5CA 1OH6A 1Z6YA 2ZIAA 2W2TA 3KTAA 4C9BA 3U44A 3MMPA 4G5QA 3WHKA 4M1SA 2P67A 2DCUA 2G6BA 2D3WA 2MMGA 2V7QA 3B78A 4RZXA 3CM0A 4CYMA 4E22A 3X1ZA 5FH9A 4WA7A 3W90A 3RS4A 3TQFA 3CZQA 4NONA 3VHXA 3F3YA 4JJZA 3TIFA 3WRYC 1KO1A 5JHHB 2PEYA 2RGGA 3VMFA 4TT3A 2X2FA 2ZRLA 4B71A 3B1ZA 2O52A 2PL3A 3R9XA 3QBTA 1NN3A 1P2SA 2Q6TA 5LPNA 1DO0A 5JJIA 2VSXA 2ZI5A 3LDAA 2C9YA 2VP6A 1IONA 2O0JA 2P5TB 3OAAA 1WE2A 4LC1A 2BEKA 3U3OA 3WRXC 4AYTA 2PZEA 3B8HA 2W6ID 3ND8A 2J9RA 3RWOA 1OF1A 2ATVA 4RCZA 5CM8B 2FDCA 4FWIB 2VP5A 1T5IA 2DB3A 2WMOB 3C4JA 4W5WA 1WDTA 1TU4A 2OLKA 2W00A 5BW8A 1XFAA 1UAAA 3AVYA 2UVQA 4Q00A 2J7PD 3C8UA 5KTYA 4KHZA 2DFKB 3EC1A 3DPUA 1R7RA 3B1YA 1E99A 3WY9A 5IT5A 5J4YA 3GPLA 2GK6A 5BQ5A 4EPTA 3RSLA 1GL6A 3QF4B 4WBSA 1XWIA 4JLAA 3QPVA 4BFZA 5C4MA 2H7VA 5FUWA 1F2TB 3ZH9B 4QNMA 4DKXA 2YNMA 5CB6A 4QBGB 1OH8A 1Q1BA 1RRGA 2BDTA 1D9XA 4KV9A 5EZ5A 1FQKA 1W0JA 1NRJB 4C2UA 1XD9A 1KSHA 1EGAA 1BKDR 4R2IA 5EE1A 1GG2A 4DSNA 3QKSA 4R98A 2N42A 2OAP1 4B6FA 1Y3AA 3PITA 2DFTA 3D6TB 3QQ5A 1F2UA 1GP2A 1H8ED 3LBNA 3D3QA 3GEEA 3NBFA 3T35A 1EXMA 2QI9C 1P75A 1ZC4A 5HCIA 5B58C 5KOYA 1UADA 2YWFA 1W0KA 3QKRA 1BIFA 1E2DA 4JLOA 2IYWA 4XVUA 3LLMA 3LBHA 4CT5A 3B6EA 5HKKD 5LBIA 2F7SA 3ADCA 2WM9B 1OV4A 4ZIRB 2VF7A 1P7CA 2QAJA 3F8TA 3V00A 5D3QA 4P4SA 1V43A 2WWWA 2QBYA 4QL3A 4DT1B 2E87A 1SZPA 3F0TA 1UJ2A 1LVGA 3EIHA 2ZE5A 3GMTA 3IO5A 2EQBA 2ZU6A 3WHLA 1QRAA 1QHHA 4O3MA 4NTZA 3TR0A 3BH6A 5KSOA 1GAJA 4TYQA 4B2LA 4NH0A 1G5TA 1EESA 3KJEA 1NN1A 1YRAA 1SVLA 5DLQC 1ZD9A 2GA8A 1XXHA 1SXJC 2ZS8A 4A4DA 4BQSA 3RABA 5UKDA 2BVNA 5K8UA 5EXSA 4M22A 3HU3A 2GJAA 2CLSA 4TTPA 4BECA 3CUEF 3QI2A 4PO8A 2R8RA 3RHFA 1ZM7A 4GMXA 3V4RA 4NE2A 2JLVA 1GIAA 1XTIA 4M1WA 1U9IA 5HTKA 1EFTA 3SBDA 3PUZA 1IN7A 3TSZA 3X1DA 1KTVA 1S9HA 4UXIA 1EFCA 1W47A 4YMSA 3KUCA 1LF0A 3DVLA 5JI2E 3JZMA 1Q1EA 2QPAA 4Q1CA 4UXHA 4D4MA 1UKZA 3QOFA 4E09A 2QROA 3ETLA 2GF9A 4Q19A 1XDBA 1XMIA 5G40A 3VR2A 4DDUA 4DHEA 3SBEA 1K5DA 1FQJA 3CBQA 4M4SA 2H5EA 2RH5A 1T5LA 2EU8A 4MA4A 4HYYA 2XXAB 1X1RA 2FZ4A 2CL0X 1E4YA 1VKJA 2XTNA 3BH0A 2IXEA 4MYUA 2V6IA 4DIDA 5FUYA 4CDGA 4FCTA 4B2IA 4TSFA 2AKYA 2V3CC 4DSUA 2QY9A 2WICA 1JJ7A 2O8FB 5TVKA 2B8TA 3NBYC 4JSYA 4NKRA 2XTMA 3SQWA 3T06B 2O8CA 1RJ9A 1N6OA 1E2EA 1II9A 1P2VA 2HV8A 1YJ5A 3I3SR 2RGXA 1EFHA 1SVIA 2YWEA 4JT4A 1HE1C 5EXTA 4PQFA 1C9KA 4BFVA 1Z06A 4F92B 2JLZA 4OJKA 3PUWA 2YOGA 5CYOA 4C0LA 1G3UA 1Q12A 2HYDA 2PX0A 4X8MA 4RD6A 1VYTA 3TQCA 1PUIA 1M1YE 4DIEA 1Q21A 2IF2A 3FFAA 4EJSB 3A8TA 3WYAA 4PQYA 1JBKA 1FUKA 2F1JA 2I3BA 4XH9B 3PG5A 3K09A 3LFUA 4M1YA 2BBSA 4D26A 4BPBA 2C9OA 1WF3A 4OJQA 3SYLA 4TLDA 3CF2A 4IVRA 1OXUA 1SKQA 3QVVA 1TAGA 1E1QA 2BM0A 4M9SA 4NHOA 4D25A 3I5XA 4TMXA 2ZM5A 5HCNA 4U5XA 1Z63A 3EZ6A 1CP2A 1G6OA 5EXXA 3VR4A 2N1BA 4CEIB 3EXAA 3OE7A 4BRWA 5EP3A 2KE5A 1E0SA 3A37A 3FKSD 1F3OA 4ILEA 1RE0A 2JA1A 4IOJA 2IL1A 2RB4A 3CWQA 1Z6TA 3X1XA 5IHPA 4XWOA 4CEJA 1A4RA 1IY0A 2YC4C 1NVWQ 1CR0A 4MGIR 3CPEA 4MGKR 4BFYA 1E1RA 2XSZD 2IT1A 3OIVA 4RD4A 2A78A 2OHFA 4LV5B 1XTQA 1QZXA 3NC0C 3LW7A 5FR2A 4OK3A 4NYJR 4D6PA 1LNZA 1CJTC 2QU8A 1OT3A 2JATA 3TLXA 4V02A 4JJKA 4EDHA 4QKQA 3NC1C 2GJ9A 1XXHE 1ZNWA 1VG9B 2QNRA 5DN6D 1E69A 4PPFA 1IAQA 1DAMA 1P62B 4DEYA 2QMEA 1OB2A 2OUKA 3T1OA 4DLTA 2QAGC 2F9LA 3A4NA 5J4HA 1MO3A 1IN4A 3W8NA 3GJ5A 2O0HA 4YMTA 4MDFA 4OBEA 2NTYC 2ZYWX 1CU1A 2X8AA 5EP4A 1AQYA 3THYA 3EPHA 1OHHD 1R4AA 3NXSA 4I1UA 4RFSA 4B3BA 3NKVA 1XD8A 5DHFA 2NZJA 2FSGA 3C5HA 2V9PA 1CF4A 4B44A 4C7OB 3AP3A 4KCGA 4KFRA 3ONWA 1H8HA 2P5SA 1U0HC 4LJ6A 1CEEA 1MH1A 5SZKB 1E2HA 4G01B 3NHAA 4DLRA 2EWWA 2FWRA 2VIIA 3T1TA 4QM6A 1N6PA 1LY1A 2ZS9A 4EPXA 2AFIE 3NDPA 5IK2D 3QPUA 2WJGA 2ZAMA 5AJWA 1SXJA 3KKNA 4A8JA 5J4LA 4WAUA 1NVUQ 3HJNA 2OT3B 3UIEA 3UG6A 1E94E 1JXOA 2RCNA 1G64A 1OFTA 1Q1ZA 4DLUA 1KMHB 1JXMA 4NYMQ 1GOTA 1G8YA 6Q21A 5HR5A 3R7WA 5EE3A 3VR1A 1VCOA 4TMTA 2ZSEA 5TXGA 4FD2A 4RD3A 1KKLA 4JLNA 2NO7A 2DBYA 2DHRA 4RVCA 2O8BA 1GRNA 1JR3A 4KI0A 4TMZA 1QHGA 1NBMA 1N6HA 1NN0A 3AKCA 4PQRA 1IJEA 2DR3A 3TE6A 1ZMXA 2XITA 1NMZA 5FBWB 3JVVA 4RSGA 4HAVA 1E2KA 2IEZA 1CJUC 3AKYA 3HDTA 4OI0A 3WXMA 4B48A 3DMNA 3K8YA 1BYIA 1LTQA 1TX4B 3ZVLA 5JWRA 3E70C 1FUUA 1HURA 3L0PA 4OQXA 3FDIA 2GEUA 4M1MA 1DAHA 1E79A 2YJTD 4LHZA 4B74A 1GM5A 4PZLA 1K5GA 1Y63A 4IVPA 2GVDC 1MO4A 5DIFA 1EFUA 3NH6A 1GKUB 1L4YA 3ZZUA 4RFVA 5KNBA 3K0SA 1ZINA 2H16A 3A4MA 1P61B 4YLGA 3I61A 3KXIA 1G41A 1Q1QA 1XNJA 1Z0AA 4TL8A 3KKOA 2QE7A 3TH5A 5FPSA 2OSBA 1N5JA 4MRRA 4RD0A 1XF9A 5SZHB 5TB5A 2VO1A 1M2OB 1YZGA 3NEYA 1X3SA 1VCMA 4PC2A 1VIYA 2REBA 2GJSA 1G8PA 1XCPA 4D82A 5C46F 1PZNA 1UEJA 1G3RA 1CTQA 4BFUA 4O0MA 2QRZA 4A36A 4GDFA 4I99A 2C77A 5TY0A 2PCLA 1YZLA 3IILA 4AG6A 4D81A 2J1LA 5D3MB 2GCOB 2A7QA 4B3DA 2C78A 4NCHA 4JIMA 2WBLC 3K9NA 2IYRA 3QSYA 2XZPA 3IGFA 2OEPA 4FW9A 2WIAA 3LY5A 3MUFA 1J2JA 3TGPA 1W44A 3VFDA 1E9DA 1OYYA 1WQ1R 1XEWY 5GJCA 4EPVA 1W2GA 2WV9A 4BASA 3IHWA 1NJFA 3U2QA 2BKUA 3T12A 3BD9A 5DI3B 2W6IA 2JEOA 3A6PC 1MV5A 2BM1A 1U0LA 4GZMA 2CL6X 2WJVA 4A0FA 2IW3A 2B21A 3CRQA 3QBVA 4JS0A 2OCYC 3LX8A 3ZQJA 2H92A 1DEKA 1N5IA 3UXMA 1Z0KA 2AWNA 4IXNA 4ARZA 4D0LB 4GFDA 4A2QA 4CEHB 5JJLA 1W46A 5H68A 3AKEA 3OHMA 1OXTA 4F4CA 3NWJA 4R2HA 4RJLA 1PV4A 2J87A 2J7PA 4V0LA 2RHDA 3N2EA 5L3RA 5L3QA 4C0JA 4OHZA 4IDPA 1C4OA 3ZGXA 1ZU4A 2ZRMA 4CRWB 4Q5IA 1SXJE 3NBZC 3BOSA 1QG4A 3AVPA 1E9CA 1PLKA 1GL7A 4ZDJA 3TUZC 4MRPA 4BEJA 2UKDA 2EW1A 2QAGA 2F9MA 2XJ9A 4Q48A 3REFA 1VG1A 4QGHA 2J45A 4TTRA 1WCV1 3QENA 3M1IA 5EE9A 4YMWA 2B7BA 4DBLC 3UANA 1DARA 5JCZA 1JR3E 5J4KA 3U61B 2EFEB 1GITA 2NGRA 3CF0A 2QTFA 1NBME 4LYAA 3C7KA 3IKJA 2IK8A 4EIWA 1US8B 1R0XA 2WOOA 1W49A 2FJUA 1GL9B 2GETA 4OQMA 2ATXA 1E2PA 4QHTA 2Y8EA 4XJXA 1RIFA 2QM7A 2QZ4A 4DC9A 1X86B 1R5BA 2ZRHA 1IM2A 2D7CA 5CLLA 3ADBA 2VEDA 2DY1A 3DOEA 3TAUA 3K0FB 1EX6A 4OQFA 1HQCA 2R65A 2ERYA 5JRJA 3QE0A 1CBUA 2NQ2C 3SJCA 1OE0A 1S0UA 2WWYA 5HKKA 4N0DA 3WMEA 2GJ8A 2BV3A 3T5DA 4LJ7A 4EQ6B 1YU9A 4W5JA 4K8OA 2NIPA 1T0HB 2ANBA 2R6CA 2ZJBA 1W7AA 4PC1A 2D2EA 4OHXA 3OEED 1ZD8A 3I62A 3RVBA 3KB2A 1KO5A 1G3MA 3HYTA 2G9NA 4AI6A 5FBRB 5JS8A 4Y0VA 3GLGA 1MABA 3BS4A 1L8QA 4IOMA 2IYSA 1E32A 3X1WA 1QHYA 4A0RA 4G5OA 5FI1B 1UBCA 1D6JA 4Q4HB 3O47A 3E2IA 2IXFA 5FPTA 5CDFA 3BC1A 4KYUA 3GLFA 1KKMA 3CNNA 4OQLA 1M6NA 2OE2A 3Q72A 3C14C 4M0LA 4Q4JB 2OV2A 5FTLA 1NLFA 1AS3A 2QPOA 2FA9A 1R8QA 2REXB 1QVAA 4US0R 4UXJA 2OZEA 1X8JA 5EE5B 4HUQB 3LBIA 1E2GA 2V55B 2D7DA 4HDOB 2W6JA 1AQUA 4JT2A 3W6NA 2Z6VA 3R20A 2BMJA 1GRRA 3NHBA 4B3XA 1JQJC 2WZQA 4B33A 2OAQ1 4I1SA 2WJJA 3R8CA 3TW4A 421PA 5JBQA 1ZUHA 3BAFA 3RLFA 5KDDA 1UPTA 4FMCF 5FBQB 4PAOA 1VPLA 2OXCA 3O8DA 3TBKA 1T6NA 2VF8A 3M0EA 1T4GA 4P4TA 2OXRA 2ZI9A 1HT2E 1FNMA 1IY2A 1GNRA 3AF0A 4IOLA 4LX0A 1KNQA 4PAQA 3D8BA 3H84A 1F5NA 2PCJA 5JFGA 2NG1A 3BFKA 1Z6XA 4HEJA 2VH5R 4F93B 2WPDD 4OHVA 2QEQA 3G0HA 1JB1A 4PX9A 3AUYA 4JLVA 3TUJC 1OFHA 3OIWA 3CX8A 2R6GA 3RANA 1GKIA 3U4QB 2JLWA 3UWOA 4S35A 3EZ9A 4EPRA 3NVAA 4M8NE 4OHWA 4XSGA 2E1RA 2J59A 3PFIA 2FOLA 2W83A 1M8PA 5KHOC 2P6UA 4KVAA 3AVOA 2GF0A 3DO6A 3RS5A 3AVTA 5B2ZA 4Z51A 3RS3A 1HUQA 1F2TA 2GRJA 1DTSA 1I2MA 1VYUA 4LWZA 4V0MA 3DZDA 4Q1AA 2PZFA 4TMVA 2WSSA 5JEEA 4FMDB 4W9MC 3LD9A 5LB4A 1RYFA 3FKQA 3FYHA 2KBEA 3C41J 4NP6A 1ZC3A 2ZI3A 4A92A 2IYQA 1KDPA 2JJ8A 1G5PA 4A2PA 4BZPA 2QUZA 3CW2A 1IN8A 4PO9A 1IXSB 1NLYA 2PLRA 1GDDA 1N6KA 2VHUA 4PXAA 3RYTC 1LF5A 1W4BA 1RZ3A 3AUXA 2YVUA 3A1WA 1ZP6A 4C0SA 1PUJA 4HZUB 2XB2A 4ZIRA 4B3FX 3FKSA 4HAYA 1E96A 2V1UA 3HYRA 5C4GB 4V0OA 1LW7A 2QTVB 4ESHA 3QXJA 1AJEA 2AFHE 5EUQB 4IDOA 1AKYA 3M6AA 5KYKA 2C03A 5ELXA 2XSZA 2MMCA 3VR3A 1QHXA 2FMXA 3GJ6A 1IOZA 2BEJA 4IOKA 3REGA 2CLDX 4US2R 2GCNA 2VP2A 5KSYA 3EA0A 3GLGE 2XZOA 3FHCB 3K09C 1RPZA 5TDHA 4MRVA 4OK6A 2IS2A 2C8VA 2ZJAA 5F9HA 2QSYA 1W1WA 5DSZA 1DPFA 2G83A 5DN6A 3CONA 4I1OA 1UDWA 2Z43A 5FL7D 1E9EA 2OFXA 3L0SA 3FHTA 1BS1A 1DOAA 3L2OB 4PC6A 3AVWA 3PUXA 4QXAA 2IBMA 5DNYB 1JJVA 1TUEA 5A4JA 1ZM3A 4KBFA 2A3RA 1OFUX 1YRBA 3H0KA 1KMQA 1TEVA 3K0AB 3FMOB 2DWQA 4LV6A 1KO4A 1SKYB 1G4UR 4I4LA 5JECA 4URXR 2RAPA 4GI7A 3MWYW 5A5GA 3ND9A 2PJRA 1XEXB 3LQQA 1IHUA 2BIFA 2QMUA 3CRW1 4QGAA 1I2DA 2XNSA 3B7GA 4DCSA 5HZHA 3K70B 2XXAA 4AY2A 3TKLA 3EIEA 1AS2A 2C95A 5BN4A 4JSTA 4IFEA 2CHGA 1Z8FA 4MKIA 1JEDA 3GJ4A 3K0EA 4AYWA 5IK2A 4LUCA 4DJTA 1IN6A 4Q7JB 2UZ3A 3CF6R 4YDSA 1NVVQ 5DHAA 2ZVQX 1Q20A 2AK2A 3UKDA 3LRPA 3P26A 4LI0A 3TJZA 2BC9A 1PJRA 2ZSAA 4JBYA 4PHGA 2O8FA 4QGFA 4B3GA 1KK1A 2LCFA 3CLVA 3GLHA 1SHZA 4IDNA 3T1VA 1MOZA 1P2TA 1YR6A 1ZD1A 2GZHA 4W7SA 2WWIA 1KJYA 2EFDB 2F43B 3ZJYA 4ZCIA 3OZXA 1T8UA 5HPYB 2BBWA 2CVFA 1AIPA 1X1SA 3A36A 5DISB 4KO8A 4TWZA 3DM9B 2JLQA 1HV8A 3QF7A 1TQDA 3B9QA 4DLXA 4KFTA 4LCBA 2PMDA 1E9RA 1JALA 4IDQA 1XCMA 4XTRA 3VTKA 4OI1A 2QSZA 2JJ2A 5DH9A 1Z07A 3ZD6A 1B23P 3KTAB 4AIIA 3VNVA 3U44B 1T9HA 2OFOA 3CH5A 1U94A 3KQHA 3AVQA 3EA5A 3GJ8A 5KUTA 4PANA 2G1JA 4MKHA 4A8JC 4HZIA 4H1UA 2DYKA 1ZJ6A 1JAIA 1P2UA 4HDCA 1W36B 3EX7C 2G88A 1RRCA 3PUVA 3DKPA 2HCBA 1NKTA 2NO9A 2IHBA 2A5JA 1DE0A 1TQ2A 1KK2A 3GFTA 2XNDD 4D2IA 3B60A 3ADDA 2WJHA 4DUGD 1HQYE 1HH4A 2AKAB 2C04A 4RD2A 1XTRA 2QRNA 1FTNA 4B35A 2IC5A 3EPKA 2CLCX 4PC3A 2BKEA 2IYVA 4X8OA 2IYTA 3HPQA 1SVKA 2C5LA 4QBHA 2IS1A 1KI8A 1ETUA 2RGCA 2F3TA 4CW7A 4NBSA 1Q0UA 2ZE6A 2QTHA 4LJAA 3OESA 2OFWA 4L15A 3KJGA 2FF7A 3A1SA 2JCSA 2QGZA 2ZUCA 1HT1E 4Q1BA 5DO9A 4EFNA 4DDVA 4JBWA 3SDZA 2YWHA 1R10A 2HT6A 2KWIA 3MGCA 3PCRB 2ZJYA 3KXLA 2IS6A 4A2WA 3U3JA 4TYWA 5G41A 1T3SA 2NZ8A 4DSTA 3ZZ0A 1ELOA 2ODBA 1UEIA 2HDNB 4ABYA 5DGXA 5BYJA 4YXWD 1ZIPA 4M1OA 2YC2C 3TNFA 4LJYA 2IXGA 1U8AA 4KODA 4RKFA 4P33A 1KI1A 4MDEA 2V8OA 4IEEA 1TTTA 2HT1A 4K46A 2KB0A 2F1IA 3EZ2A 1JR6A 3QJYA 1Z0JA 2HF8A 3ZIAD 3AF4A 4AK9A 3ZDQA 4ASUD 4HUTA 3A1VA 1W5TA 1QF9A 3K70D 4CGZA 4C7OA 1P6XA 4L4UA 3CO5A 4ZDIA 3L8YA 1CR4A 3CIOA 5KNCA 2ZSBA 3QEJA 4FN5A 2BMEA 5FOSA 2NO1A 1I4TD 4HAUA 2HJVA 4NCJA 4QHSA 2IX3A 2OG2A 4IW3B 1EFRD 1SVWA 3UK6A 3UMFA 1FZQA 3QPWA 3V4FA 2VHCA 2IYZA 5J47A 3H86A 2GWHA 1YR7A 4L8GA 3VAAA 1YE8A 4Q21A 3QKTA 2CNWA 3BFVA 4BLQA 3VNUA 3MJRA 1EG7A 2OM2A 4PR0A 2Z0MA 3GLHE 3G82C 4DLWA 1CXZA 4YMVA 1XX6A 2Q3HA 2WAYA 3KJHA 4Z8YA 3KXKA 1XJCA 1NY6A 4Q18A 2QBYB 1A7JA 5K8LA 1DBSA 5LDDC 1CULC 4LJ9A 2O8EB 1WBDA 4ZKDA 1QHHB 2AWOA 3TK1A 4FMBB 5K8IA 1AGPA 1Z0FA 3TMKA 1GWNA 1R0WA 3I8SA 2AK3A 2IYXA 1XXHB 2QQ0A 3RS2A 1MO6A 4X8LA 1D9ZA 1Z0IA 1VDZA 2V7QD 3WMFA 3GLIA 2PZGA 1O87A 1Z5ZA 3VU9B 3I32A 5LD2C 4TN1A 3HP1A 5AUPB 2EFHB 3EC2A 3W6PA 2P0EA 2P6NA 4GPTA 1S1MA 5KDLA 4E03A 4PTLA 4TL6A 5EP2A 4JL6A 1ODFA 3VX4A 2YOFA 1W36D 1OKKD 3OEEA 5A0FA 3T5GA 1VTKA 3IPXA 1LB1B 3KKMA 1TMKA 5CJ2A 3SNHA 4PSAA 1CJMA 821PA 3W3AA 1COWD 1FTSA 3R9IA 2TMKA 2RGNA 3WBKA 4B32A 2WKPA 2J3EA 1XZQA 1TF2A 2WOJA 1R8SA 2W2XA 4FWTA 3U5ZB 5JHGB 3M4YA 5FTMA 2F1HA 3EPJA 4M9ZA 4V0NA 3P27A 2ORIA 5B57C 4OKSA 4FCWA 5J5CA 3B1VA 2WKQA 3PVSA 5D3MA 2O5VA 1G9XA 1T8TA 1MR3F 1ZNYA 1II0A 4US1R 5AJVB 3G5UA 4M53A 1WA5A 2Z4RA 4DEXA 4NCNA 4HLDA 4R71A 2D4HA 2G77B 3T34A 221PA 3KJIA 1C1YA 4UJ3A 4BLSA 1KDRA 4PHFA 3BB1A 1FFHA 2O8CB 1X6VA 1X8LA 3Q5DA 4ZDWA 4JL8A 4V03A 1KI3A 2WVJA 3WYGA 4DLZA 1J7KA 4JVSB 1XJQA 2ZRPA 1JEEA 2WWXA 2ZPTX 5DI3A 4DCTA 3VKHA 4BZXA 2IUUA 1OFIA 4X8HA 3MCAA 2FSIA 3BB4A 1Q44A 2ZR0A 1KI4A 2R6AA 1Z47A 2CMKA 5JRZA 3OFND 2NPFA 5JEDA 1VG0B 1ZNZA 1X8KA 3I72A 3SS8A 4MGZR 4KLNA 2D06A 3KDSE 4CEHA 4RKEA 3FMPB 4BE7B 2WPDA 1D2EA 4KITB 5KSPA 4PO1A 1HA3A 2ZYTX 4HB0A 3U7GA 1GTVA 4O2RA 3MWKA 2ZVPX 3EARA 3IDQA 1W0KD 2PH1A 2AN9A 3KQKA 4JYCA 4MQBA 3WMGA 1KJZA 4URVR 4GL2A 1RRPA 3CNOA 1NVVR 1MKYA 5AK0A 3PUYA 4N0EA 3THXA 4M2LA 3U7EB 4PC7A 2CBZA 1FX0A 4IEIA 4POAA 1TQ4A 5DE3A 4D0GA 4BFXA 4NYIQ 2AXNA 5IF9A 2A5DA 2GKSA 4LHWA 4PSVA 2VBCA 1N6IA 1Z22A 3CNLA 1TEXA 3LAWA 3NDBB 1D2NA 3W5JA 1US8A 1ANKA 2QT1A 2ZE8A 2VP0A 1KDOA 2JJ1A 3BH7A 3RSOA 1ZUNB 2GDJA 3D7MA 3O8RA 3NTUA 3VR5A 1FMJA 3GCGA 2I4IA 3DOFA 1F60A 1GKYA 1DS6A 1QBKC 3PIRA 4HAZA 1G3IA 1XD2B 5FOXA 4BFWA 5LB2A 1YZNA 1JECA 3K9LA 1KO7A 1BO6A 1CKEA 5EZ6B 4HDQB 4TL7A 1DAEA 3GLIE 3CB4A 1VECA 1W2HA 4EQ6A 1SQ5A 3EAQA 3N2IA 5E7IA 1NIPA 4OI2A 3QEOA 3KB1A 1CIPA 1E2FA 1W4AA 4ACBA 4QM7A 1N2CE 2JAQA 3UMSA 4B6EA 1KHTA 1DVRA 1E4VA 3IIMA 3FHOA 3K0CA 3AVVA 1P9WA 2QL6A 4AG5A 1U8YA 1KGDA 3AH8A 4C0BA 3LH5A 3RAPR 4DCVA 1R0ZA 1Q3TA 1GRQA 1R2QA 4Q4HA 3I5YA 2G0NA 1P3JA 1NSFA 3IBGA 3IUYA 4Z1MD 2B92A 2CK3D 4IKEA 2QMHA 2JDID 4V0KA 1AK2A 5FL7A 3T1QA 3VKGA 1XPOA 1SXJB 4Q4JA 1CJKC 1PVOA 1KSFX 4JLMA 5FPYA 1GUAA 2H8KA 2QT0A 2IHYA 2ZRNA 4HUQA 1P9RA 4NDZA 1G20E 2WJYA 3OEHD 2WWHA 3NBXX 3L43A 5B64A 5M04A 2Q3FA 4A1FA 2Z5FA 4LHVA 4WXRA 2PX3A 5GVSA 4XWAA 2O8BB 1S2MA 2AXPA 2R44A 1S3GA 4AYXA 3AVUA 5F2EA 2OBLA 2ZS7A 4NU0A 2ZRBA 4DCNA 4EPYA 4YQFA 1KI2A 4D4JA 2HUPA 4LDJA 4PHHA 3SHFA 1IY1A 3I73A 2G1KA 1ZNXA 3L0OA 3ICEA 2KBFA 3MRSA 1XTSA 1HEIA 3B82A 1L4UA 1PLJA 2J0UB 2ZRDA 4ZI2A 4AKEA 3LX5A 2NOAA 3MFYA 1M7HA 5JSZB 2I1QA 2VTKA 5JWOA 3LWNA 4AWXA 1NN5A 4TMKA 3FVQA 1XMVA 1H8EA 5F3WB 1OIWA 3HWSA 5J40A 4GOXA 3U4QA 5JI3E 3BXZA 2ZANA 4Z8XA 3VHLB 4A9AA 5AJZA 2QP9X 1YKSA 3B1XA 2R9VA 4UKDA 5EQTA 4B47A 2XZLA 4ZO4A 2CE2X 1GFIA 3QNUA 1ONBA 3MG9A 1Z28A 5TARA 3KKPA 2CVHA 4F38A 1UKVY 4ITRC 5KPDA 4PSKA 3GJ3A 2ZI6A 3Q9LA 2RMKA 3QVUA 1GVNB 3CR8A 5FOUA 3H1TA 5BWMA 4P4UA 3FB4A 1S4QA 4ZCLA 2GBLA 4MYCA 3C15C 1MT0A 4EKDA 1NKSA 2FGJA 4ACAA 2YINC 3BRWD 2BMFA 1EWRA 1AZSC 3GQBA 5FBLB 2QENA 3GJ0A 4WZAE 1TU3A 3ZQ6A 3IIKA 5E3HA 2YOHA 4IHQA 2CJWB 5CJPA 2BOVA 5E4FA 2GEDA 2K5UA 4URYR 5H1YA 4KSBA 4R9UC 1SGWA 1U0JA 2GVZC 4P32A 4U02A 3LNCA 1QHIA 3PV0A 4G5RA 2EYQA 4LSGA 1K8RA 3OIYA 1TQ6A 4ZV4A 2GESA 1N5LA 1YZKA 4Q47A 1BMFD 4CF7A 2FPMA 1LV7A 4JKYA 1HTWA 4LJ4A 4C30A 3BBPA 1OXXK 2J0QA 4DUGA 2V1XA 3QG1A 2YZ2A 1A82A 3QXHA 1M74A 5FTJA 5HE9A 3UMRA 4XOIA 3AM1A 2ZJ5A 1UDXA 2IUSA 2WAXA 5L3SB 2BCJQ 1KI6B 4LYFA 2CE7A 1SULA 3W9YA 4BFTA 4FI3C 1XTKA 5EP1A 4EJSC 4UJ5A 2CHQA 4IFBA 3LLUA 1RFLA 3SFVA 2VLIA 1NMYA 2CXXA 2PJZA 1JPNA 1M7BA 4JYBA 2KJQA 5H8WA 1Z83A 2JIZD 1SVOA 1A2KC 3VR6A 1W4RA 1XZPA 5DYIA 3BE4A 4I81A 4ESVA 1TL7C 2ANCA 4LC0A 4A82A 4QJ4A 3TUIC 1UBFA 2ZRGA 2HJGA 5FUVA 3WP0A 1SXJD 3DL0A 2Q3MA 2XX3A 3H2YA 4Q01A 4PZYA 1RVDA 1QVRA 1ZBDA 1KSJA 2BJVA 2GNOA 2ERXA 3W8RA 3AV0B 2ZRCA 3SEAA 5L3VA 3B9PA 2GILA 2GHIA 3LVRE 2DFNA 5KU1A 5K8TA 1VIAA 4JLKA 3PEVA 1OH5A 3QXCA 1P72A 2Q9CA 2QAGB 4HAWA 4JVNA 3VX3A 4K81B 4B34A 3RNLA 2Z83A 2YYZA 2XB4A 1RC8A 1VYVA 3QF4A 2QM8A 1RRFA 3OF5A 1NIJA 1W5SA 2D2FA 2VRWA 1JPJA 1ZYUA 3BFXA 3ZIAA 4ASUA 1ZCBA 1XEXA 2VSFA 4NYMR 1XMSA 4QC2A 2BMDA 3PENA 4XWKA 4Y0AA 3SJAA 3SR0A 5FUXA 2B8WA 2CEAA 2FFQA 1Q3HA 2XEXA 1N25A 3I92A 1HE8B 4XTCS 2VP9A 3CH4B 1QG2A 5G53C 4FCVA 3EPLA 1OH7A 2P3SA 4B75A 2QGNA 1T0JB 4II7A 5FBVB 1DAIA 3CWZA 3SOPA 4M9QA 1D8TA 1TNDA 4LYHA 2YHSA 1VMAA 1KIMA 3CKLA 1TADA 2YV5A 4Q9KA 3O8CA 4YONB 1GNQA 1J8MF 1Z6GA 4KXFB 2J41A 2V4ZA 4LPSA 3ASYA 5KPJA 2X77A 1KY3A 1T91A 4RY2A 1U99A 2P65A 1N0UA 2F43A 4PPQA 1NMXA 4GRAA 1LS1A 3TRFA 5B30A 1U90A 5C1BA 4KFSA 4C4PA 4DLYA 1LFDB 2UZIR 3AB3A 3DHWC 1XRJA 4PPNA 3TSOA 3AEZA 4NYJQ 2ZR7A 1CS4C 2FE4A 4L9SA 3GLGB 1OB5A 4GNKA 3HPRA 2XJ4A 4KVGA 5JJKA 4NYIR 2VHTA 1KK0A 4DT1A 2AX4A 1S96A 4Q9HA 2ONJA 1IQPA 1G16A 3A4LA 521PA 2FH5B 2IWRA 3EIQA 1E2NA 3TR5A 4BZQA 2CDNA 4LBVA 2B7CA 4TZ0A 3BORA 5KNDA 5AJXA 3NG1A 1CR1A 3E1SA 3SC3A 1I4LD 4XD7D 2FPLA 1NG9A 5CDFE 3GJXC 3GLFE 2WIBA 1OKKA 3R9WA 1OIXA 1XJ0A 2O8DB 2QQEA 5FOWA 1FP6A 1VG8A 1II8B 1AA9A 1COWA 1DG3A 4A15A 4RZ3A 1ZM4A 2BBOA 2ZEJA 1CLUA 1GSIA 1J8YF 3ZS8A 2HLDD 121PA 4NZYA 4KFUA 3TAHA 4LBYA 5CLQA 3RS0A 1AZTA 1JAHA 4G3XA 1OHHA 4IXMA 3D31A 2IUTA 3SU8A 2JLUA 3GJ7A 3FOZA 1XPRA 4Q7LA 4QNRA 3THWB 1IXRC 4WIAA 2J0VA 3B2EA 4KU4A 3SHWA 4DSOA 4JVMA 1Z2CA 2XAUA 3PXGA 3KZ1E 4OI4A 4JLPA 4YMUA 3ZD7A 1DG1G 5JCPA 2FSHA 1JNYA 5CB8A 3ZZTA 1E6CA 1YZTA 5GJWC 5KDOA 3Q7PA 1YR9A 3ZVRA 4IJMA 2GZDA 1XPUA 1D2MA 4KSCA 4XVQA 3SFZA 3S1AB 4MUAA 5CIWA 4AKHA 4TL9A 5HE8A 4TLAA 3TVDA 1E2JA 1MRNA 1TF5A 4E07A 3FE2A 2RGNC 3H4MA 5BN3A 2VYFA 1Q22A 4EAQA 3OFNA 4LJ5A 2CHVA 2XGJA 1SKYE 1VCNA 4ZKEA 4Q9JA 1EX7A 1SVSA 3IQXA 2HF9A 2FGKA 4Q4AB 4EJSA 4KJZA 4DXAA 2ZAOA 4QGGA 3KQLA 4V0ME 2F3RA 2ZRJA 2JLRA 1UKEA 5CYPA 2QP4A 2ZI7A 1KDTA 1W4CA 1K6MA 1R5NA 3P20A 3QXSA 1U81A 4G0NA 3K9HA 2OO7A 4NCIA 3WP1B 4FMCB 4LOAA 2FEMA 5H70A 4D4KA 2H57A 3CRVA 4R7ZA 1S1CA 1BH2A 1E9FA 2A5GA 3HR8A 2ZRAA 3ZLJA 4N3NA 2A5FA 3DMDA 5F9FA 3U3RA 4CEIA 4NPHA 4URZR 5JS7A 4JLBA 3ECCA 3FMIA 4U7DA 4D80A 2PBRA 1E0JA 5BXQC 2O8EA 4IRUB 4PZZA 4HSEA 4O25A 3WYFA 3AQ4A 2ZXUA 4URWR 3LXRA 2J5XA 1GZSA 1SVMA 2ZE7A 3MWLA 4GBMA 2B6HA 4HB2A 5FOTA 3RRNA 2ODEA 3EW9A 3C16C 1G3QA 5CIQA 4FIDA 4Q1EA 2VHQA 5CK4A 2DWOA 2JGNA 2ZITA 3BGWA 3LVQE 1O3YA 3HR7A 2FU5C 3VU9A 3K1JA 1T3HA 1HY3A 2GXAA 4H1VA 2RGBA 2WWFA 2VQSA 2OLJA 2OBNA 3EASA 3EWSA 3I1FA 4JLJA 1XB2A 3A1UA 1QDEA 3N70A 5F98A 5GVRA 2ZYVX 1ESNA 4LJ8A 1E2MA 5ANRB 1UFQA 2FFHA 2W6JD 4AC9A 1I4DD 4F4IA 1S9DA 5G3YA 2FFAA 3CX6A 3L0IB 3AGQA 4TQAA 1E0KA 2V54A 1RYHA 3B85A 2VHJA 1ZVQA 1G19A 1P4SA 2HEIA 3EG5A 2ORVA 2O0KA 1UKYA 1M7GA 3QG5A 3SYKA 3O8BA 1KZGB 2J7KA 5G3ZA 1MO5A 4NL4H 2NMVA 2GAOA 3THOA 5FTKA 2XOKD 4D0NA 4Z1MA 1E0AA 4F4JA 2CK3A 2GZAA 3QKSB 3GFPA 2JDIA 3E5HA 3RC8A 3KQUA 1G8HA 4QRHA 1ESMA 4ZCMA 2R6FA 1XU4A 4PHTA 2IYUA 3DEFA 1F2UB 1Z0DA 3P1JA 4PAMA 2W58A 3KFXA 1CRPA 3GLHB 1L7VC 3OEHA 3SJBA 3QKRB 1SHKA 2KSQA 1Z3IX 4ON9A 3QUSA 1YQTA 4AKIA 1OJLA 1KMHA 1Z2AA 2D74A 4Q9LA 5KO2A 4TZ6A 2Q21A 3ZYCA 1YZQA 4TLBA 1FMLA 4G5GA 2GXSA 4EFMA 3K0CC 1U2RA 2REOA 4HB3A
chains in the Genus database with same CATH superfamily
4U7GA 2YXLA 3LYLA 1PR2A 1ZN2A 4GQBA 4JNCA 2A33A 3S8EA 3LHKA 1ODIA 3IV6A 4KLZA 4WLNA 4MV4A 4E94A 2BJWA 1E1NA 1X94A 4C5CA 2VBGA 3R6WA 3W3ZB 4DM3A 4L22A 1FJXA 4XW2A 3FKJA 3G2PA 3GVIA 5JYBA 2JIDA 2JLXA 4B3CA 2WTUA 2OV3A 3OZUA 2HK7A 1CJBA 4QVIA 4EJ6A 1NF8A 2DFPA 2JIBA 4M60A 4MDYA 4ZHSA 5B4VA 4TTTS 3KYDB 4F6LA 2QMOA 2Q5QA 4NPAA 1WJGA 1QHNA 2CVQA 2PT5A 4LHXA 4OHOA 5EN4A 2PRKA 3L7OA 2PRSA 3GFOA 3CE9A 1IVYA 4RPLA 3K53A 3VYSB 2QX8A 4HDSA 3T7RA 2ZPAA 4RXUA 1WMSA 3SC6A 3GVCA 3BT7A 4TT3D 4MXDA 2WP8J 3WHIA 4BVFA 2V7XA 3AR7A 5GZ6A 3KOOA 3WGJA 3WJ1A 4HVLA 2EHJA 3FSEA 2QXTA 2XADA 2P9YA 2YBEA 2X1HA 3B3GA 4QUAA 4D4LA 1Z2DA 3M6UA 3HJBA 4HNQA 1P5ZB 2BHSA 2QA5A 4Q82A 2R68A 4OTZA 5FLXA 3L82B 2GPAA 2XECA 4JKIA 3CX7A 5I48A 3PR1A 2G9RA 1V4BA 4JMPA 1QQ7A 3WNDA 1QFZA 1U8CB 2Q28A 2C96A 2RGWA 2HF7A 1NW5A 2NUBA 3FY4A 4RFLA 3VPAA 3L05A 3RRXA 1MORA 1JQLB 4TMWA 5FPHA 3U1VA 2AFIB 1NJ8A 1TIPA 4WEQA 2I29A 3P4YA 4D92A 1Z26A 3B70A 2AIRA 3GL9A 2G9VA 5DT2A 1NASA 3WKDA 4DJAA 1A96A 4EZBA 1FNSA 2GCOA 2Z2XA 3H13A 3A2NA 1GJRA 3T5TA 3KL4A 2X9NA 1Y6GA 4B3MB 4Q7MB 4S2EA 4MJ3A 2ZQ5A 3S2UA 1VL0A 4B4WA 2BWJA 1ZW6A 3DMGA 2JCGA 1I9GA 4ND2A 5FBHA 3A1TA 5K6AA 1E7WA 2GERA 2VZ9A 4MVCA 1GT6A 5IWCA 1BN6A 2A6PA 3P9IA 1WG8A 1A5TA 3B5JA 4ZVQA 2ZULA 3JYLA 4RZ2A 3LCJA 2ZSKA 2EYUA 4I5GA 3FDJA 1B00A 1DJNA 3LBYA 3FUUA 5L7WA 4N0QA 3ONNA 4L8YA 2XQGA 3AUUA 3VBEA 5EXDA 1XZEA 1WDKA 3AGPA 4MS3B 2YFQA 2WMNB 3NV9A 1N0WA 3N7UA 4Z0HO 1SC9A 2MSEB 4FBGA 1RMYA 4MRSA 1W0JD 1E1LA 3MD9A 3NASA 2E4VA 3I5MA 3TCXB 4NQRA 1NW6A 4TLEA 2X42A 4CF5A 3BWEA 3PWZA 2GM3A 1FU4A 2O2HA 2ZJ8A 3RRFA 1Q19A 3T52A 1VB3A 2DKOA 1Y1KE 3TL6A 5U4QA 3VA7A 1V6SA 1EKXA 1L5HB 1K2WA 1O58A 3BXEA 4Q12A 2OZLB 4RS4A 4AX4A 1ARZA 4E5UA 5M29A 3M89A 4LSMA 5HS6A 2Q3BA 3TGLA 1U7OA 4LXXA 4BNYA 3FGZA 4J0QA 4S1NA 3K2EA 4CR7A 5BSGA 5JANA 1WBBA 4JXZA 2ZWPA 5EJAA 4YUWA 3N8HA 1ADFA 2H1LA 4UNQA 3QFRA 1RCUA 2NU8A 1F06A 3TSWA 4I3GA 4EVIA 2PMKA 1GGFA 2R62A 5HRCA 2HWYA 1P7YA 1TYDE 3M6MD 4HI0E 3TINA 2FZ5A 1CUWA 3SQDA 1FS5A 4UDNA 1CQJB 2IYAA 2NWQA 3DBHB 2KI5A 3AVXA 3F90A 1TVKB 3ICOA 4ZRMA 3RIEA 1ZJ4A 1T9BA 3ZU2A 1LLCA 4Q02A 4AMZA 1G4AE 1MU0A 5FFNA 4DA6A 5JLJA 1M6EX 3BJIC 2BCGY 1TQHA 2GCPA 4ES6A 3LJKA 1XVIA 1KTIA 2PFGA 2GPJA 2Y0EA 4UEOA 1GAXA 2EFGA 1PLLA 3ESXA 5J58A 2CDCA 3S2IA 4GMKA 3LWZA 4KPGA 2F1RA 1I3NA 4U9UA 3WGYA 4B4KA 1RAAA 3PQ7A 1MAWA 4BMPB 1JKFA 4BV2A 3HJCA 4R8RA 4WJLA 1OSNA 4PQEA 4WY2A 4BUJA 3F96A 4E46A 4UATA 4MWSA 2X0DA 1YBAA 1FJ2A 2QXUA 2QIOA 2P91A 4D9MA 3R1IA 2PFSA 1MOSA 2RKOA 2W2VA 5DOVA 4TS3A 1A2BA 2JFXA 3TO5A 2FPXA 4GOJA 3UCXA 1AB5A 4EHJA 5AUOB 3ADBA 1PO7A 1DINA 3OF2A 4FR0A 5DBGA 8OHMA 5LM3A 1UMCA 4XLLA 3OLYA 1RKUA 3OIGA 2LKDA 1D0VA 4NF2A 4NJEA 1MPXA 4TWIA 1O03A 2BJHA 5TS3A 7YASA 1JEOA 2GN8A 1ZOOA 3NHFA 1AXRA 1VBNA 1JR2A 3TGWA 2ZTLA 4E88A 2NQTA 3PQCA 5KCMA 1KO8A 2ZAGA 1SURA 2ZU0C 3KUKA 4G25A 5D86A 1TGVA 5ALYA 1J33A 3LGAA 1LWNA 5ULLA 3FOEC 2OGWA 3TDMA 4DTCA 5CGQB 2Q6OA 1P8JA 4OLBA 4I4TB 3MWJA 2NZVG 4J0JA 4K6GA 1DXQA 2OCLA 3EGDB 4OFWA 2D5BA 3JRXA 3NM6B 3JZAA 2WU8A 2DHDA 3PVZA 1JSLA 2CKMA 5BYKA 2C4TA 3UJCA 1M6YA 2GEVA 4OXKA 1FDUA 2QVCA 5LQSA 4XD7A 5LYJA 1IDN1 1YMVA 2VDQB 3HBLA 4MVYA 1ZBQA 2ODQA 5C2JB 1NAHA 3K6SB 5IEBA 5CH5A 2HHCA 2XNKA 3SQXA 4U6SA 1TLTA 2Q3JA 4ZRNA 5E0KB 4A8JB 3LP5A 1PEYA 2GTPA 1K98A 2VJDA 3RS7A 1L5FA 2ZSFA 4LVNA 2PX4A 2J46A 4RHEA 1DXHA 1C7IA 4M9XA 3G5MA 5AKGA 4C0KA 4J9VA 4WUTA 3THRA 1Q0SA 2ZUWA 1TMGE 2ZYUX 2O50A 4AD8A 4BTLA 1WTCA 1RQRA 5L3SA 4KO2S 1KI9A 1PGOA 5AXAA 3L4SO 4IZHA 4U00A 3WFZA 1LXCA 2EF0A 3KL2A 2VG8A 1ISMA 3ENKA 3OM9A 4IGFA 1EDDA 4JOBA 10MHA 1NVGA 2J4FA 2K2QB 2GK7A 2Q1XA 5J23A 5JMWA 1B0AA 5D87A 4MLCA 1P29A 3U40A 2BT4A 2Z9BA 5H3CA 3RFCA 2DQYA 5DI9A 1U2SA 1GRVA 2PT7A 3EISA 1V6AA 2EVWX 3PFCA 3R0VA 4IIFA 4NIMA 4OQQA 4OHKA 1VHLA 3MMZA 2ZUDA 3O91A 4RD1A 5LOVF 3MSXA 4FWBA 2XKKA 2CCKA 2QX4A 4H4DA 3K72B 3FM9A 1W36C 2FHSA 2RGEA 1L8XA 4W8OA 2Y1KA 4O4LA 2CXRA 1E1QD 2IXTA 2FQQA 2P3QA 1Q0HA 2HMSA 3JQ7A 4FFBA 4LDNA 5DBIA 1ADJA 3RVNA 1OI7A 3D5QA 4KBYA 1U2EA 4KVZA 2HIHA 2JBWA 2Q1YA 4GECA 1WPRA 1F48A 1TJNA 4NENA 3VR4D 1CCWA 1XI2A 2EFCB 4RTKA 1GPUA 5EE0A 3ZE6A 1LPMA 1Y3BE 3R5FA 4LBWA 3IIIA 3DAFA 4Q3CA 2VJLA 4X20A 4YQYA 2GAAA 1NULA 1WD7A 5IVIA 1UXHA 3S1LA 1A8PA 3EXEA 4RZUA 1PK9A 3HSKA 4BB5A 1DV2A 1RI2A 5A05A 1G17A 1P91A 2ATEA 4HUJA 4PHCA 4GI5A 3HDQA 4DR7B 5HZKA 3L02A 2Y1WA 1DADA 1E1RD 4WZAB 3W8FA 1QIGA 3PC7A 4C3OB 3R3YA 4N6GA 3T99A 3U26A 3V3KA 1YBHA 4IIYA 1PZFA 1OWNA 1WW8A 2AJBA 4RHXA 5BR1A 5DK6A 1OVGA 3U17A 3O4VA 1NP6A 1RZVA 3T61A 1A5ZA 3D3WB 3TNLA 5AVZA 2YZ7A 2GK3A 4MUXA 1XEWX 1DAGA 1IY8A 1DTEA 2IPMA 3DBIA 3EAGA 3FZNA 2BDUA 4IQFA 4ZT5A 2F67A 1DKMA 5H7XA 1WDLA 2G09A 1D07A 2MDTA 3OIUA 3R74A 2P9HA 4LOKA 1ML4A 1QO9A 4GXRA 3EQ7A 5EKUA 5F33A 3LSYA 4P31A 3L7MA 2SICE 4Z3KA 5KNBH 4LWQA 3GGCA 4Q03A 2P77A 3NQ41 3I9FA 4BFSA 2AC4A 2F4VB 5AI4A 3WICA 1WDMA 4DGSA 2EKZA 4PGGA 4WCVA 3IBTA 2BCEA 1VGVA 1ZLYA 2ZTUA 3BG5A 3K32A 4ZPXA 3ER8A 4H7PA 1H22A 3AM3A 4L16A 1IXZA 3SYNA 1EYZA 4MS4B 3CNHA 2CB0A 3KR0A 3BWDD 3DNFA 3M3PA 4OQNA 4WFJA 1AQNA 4TYPA 4P93A 1ZIXA 4IQ8A 4BLUA 4UNIA 3IUSA 2OORC 1RI3A 4ZVSA 4KR0A 4QWWA 3KQNA 2FLVA 1QOPB 3U7FB 4Z4EA 5IUJC 1S8FA 1E77A 5CHEA 1IL0A 3QU9A 4F7WA 3RWMB 2BD0A 1E2LA 2CXQA 2H1IA 4IHJA 3U60B 1H65A 2H7YA 2IA5A 1CZHA 1BE6A 2IIVA 3BTOA 2ZVJA 5D7BA 1HG1A 5I5EA 4BEBA 2WE8A 2DPHA 1GSOA 3B5EA 3FNRA 4H9GA 3AONB 3LV8A 1VRVA 2FN4A 3RRZA 1ISIA 1XQXA 5SY6A 4ER6A 3N2YA 5K8JB 3C43A 5ADVA 1T2DA 1W5BA 1DELA 1XAIA 3OUUA 1H93A 1Z5PA 2BR4A 4EO4A 1TF7A 3UG7A 4LDQA 1JI0A 2GM5A 4NS4A 5EXPA 3K0AA 5CD9A 1SUFA 1V26A 4JELA 3EDCA 2GXQA 2B1RA 5U9CA 1JR3D 3KE8A 3QOYA 4X1OA 3LLCA 2FPRA 2JBAB 3R76A 1K6JA 1ZOLA 2UVDA 3D6FA 4R2JA 6PFKA 3THWA 5L8VA 3KAKA 4YBZA 1MPTA 2HSGA 3BMNB 3IAM1 3C1AA 7GPBA 4LXYA 3HP4A 2VRCD 1E2BA 2I22A 2QVXX 1ZPDA 1K7SN 2G0TA 2W6ZA 1RBZA 2JCXA 1JKXA 4M3NA 2GCIA 1IHXA 2D1YA 3JALA 3KYJB 2IQIA 1U9IC 3KLOA 2ZSDA 3QIAA 1N2EA 5GM2A 2QDXA 4H6XA 1NONA 1YRLA 2MSDB 4UNNA 3ZDEA 3ZGZA 2MTBA 3OBIA 1WY5A 2G71A 3W78A 5KQLA 5TX7A 1KSGA 3UF0A 5B7NA 3FUWA 2Q9BA 5DBHX 2PMCA 5CB4A 4J1NA 3NWPA 5F4BA 4BN5A 1QYWA 3EGOA 3MWEB 4XYMA 5KYVA 3IUQA 3OSZA 5G0SA 3KALA 4QYXA 2I7VA 1Q92A 2BPOA 1GEGA 4G4SP 2YZGA 1OA1A 3GMDA 3G2QA 2DFLA 4LG1A 1G5RA 4Q16A 1UK6A 3F7NA 1C8KA 4GP7A 4LGVA 4G5SA 4HDMB 1ZD2P 3ILSA 1MABB 5EI5A 5ESWA 3D6VA 2DTXA 3GD5A 3LCUA 3NH9A 1WNTA 2PS9A 4INZA 4UUOA 1FRZA 2YVAA 4LBZA 1FRNA 3R8FA 1UWKA 1U1EA 1L6IA 1XTVA 2GXUA 2Z8XA 3Q7QA 4ZOBA 4CM9A 1D5CA 5J2TA 1Z6YA 1EZZA 2X1MA 5LZ4A 2W2TA 1MX3A 3N76A 3E15A 4LXTA 1RC1A 1YQ9A 1D7OA 3D3EA 3KTAA 1IAVA 1WMBA 1RWOA 3BQMB 4TV9A 5L9AA 2P67A 1Y1QA 2D3WA 2IV2X 4E22A 3CM0A 1D2GA 1O95A 2XUJA 4G56A 3VZSA 3PX3A 5IVHA 3AL2A 3F3YA 3HI6A 5KTSA 2V5UA 3B52X 1PZXA 4Y30A 4K7JA 4Y3UA 5K0FA 1YONA 1FSPA 1F12A 2FKNA 2YVLA 3VMFA 1RHQA 1EIZA 1U5BA 2X2FA 2W4IA 2ZRLA 5IBRA 4B71A 2OSVA 1UFRA 1XDSA 2EBHX 1J0AA 2O52A 2X9LA 2W6NA 5AHKA 3TR6A 3V80A 4GSKA 4YRMA 1C7QA 5EYPB 4INJA 5MDHA 1XMOB 2NXNA 4H3SA 1BC5A 2JAXA 3BL6A 1RQNA 4IJUA 4LC1A 3OAAA 1K7FB 2YDYA 4KE7A 3UFBA 3WS7A 3M82A 3AJAA 3CMCO 1V8FA 4LN1A 4Y6PA 3RKRA 3H6KA 2AN4A 2W6ID 1CQXA 2J9RA 2NVOA 3E7DA 2I8LA 3MAGA 4Q9NA 4BJ3A 1ZJYA 4O4HA 3QLTA 3UMBA 1XKQA 2FDCA 2DB3A 1FLVA 1OT5A 5JSUA 1HDZA 3DMTA 1SCKA 3OZRA 3D43A 4BKMA 4D8XA 1FE8A 1ZRMA 5TT1A 1INLA 1I3CA 3OI7A 3AVYA 3FZQA 3C8UA 4YK7A 1OROA 3SSMA 5KTYA 3DT8A 3UHFA 1VP9A 4G0WA 3DFZA 3CF4G 5IT5A 1BU8A 2K4MA 1HDRA 1KS2A 4TKLA 3RSLA 4XUGB 1Y3CE 1M83A 1X7YB 1XWIA 5L6LB 4JLAA 1T8SA 4QEKA 3G02A 4HFRA 4BFZA 3UKJA 3AL0C 4QNMA 4DKXA 4QBGB 4BLWA 1QHEA 5FJIA 1E3WB 1NW7A 1JIKA 1IYZA 1QZZA 3V5NA 4RM3A 1UEXC 1NRJB 1OTXA 4HGZA 4UBNA 3CUYA 3QUCA 1XD9A 5D01A 5EE1A 3MUNA 3WZ2A 2N42A 1Y3AA 4DUYB 1HYBA 3D6TB 3H5AA 3R44A 3FCOA 1CC1S 2VOEA 4DFDA 4ENSA 3LBNA 3FLMA 3D3QA 4KXNA 5I51A 4N82A 2A94A 3T35A 4CE6A 1I6WA 1E64A 1ZC4A 5HCIA 4L3WA 1WDWB 1C1XB 3ZW7A 3P9CA 3ZPXA 4ETIA 3SQNA 1O7JA 3QKRA 4LECA 2WQ6A 3HFRA 4CFZA 5LZ7A 1W29A 1B1CA 1TM2A 1UT5A 2UYHA 4IDEA 1JN0A 3E9YA 3TWOA 4C1NA 4CT5A 1MZVA 2NVWA 1T29A 1Z88A 2O5CA 1QP8A 2FRVA 2F7SA 3O8OA 1XZDA 3N1UA 4MNTA 5G4KB 2YW2A 3TZHA 3U1TA 2GAIA 4JBHA 1RRMA 5KQPA 1YHZA 2FR1A 2HDOA 3F8TA 3BMQB 1D3AA 1PBNA 5JVDB 4KOEC 4EUEA 4B4VA 2OK7A 3IP9A 4RULA 4PLWA 5HF5A 4ZVKA 4QL3A 4K0KB 2NM0A 4BKQA 2PMFA 5KTOA 3DZFA 1FXSA 2JI6A 2RSLA 4FP9A 3T1NA 1SBYA 1VRCA 2VYVA 3EIHA 3IO5A 3A3KA 3UA4A 1QHHA 3BH6A 4BKRA 5KSOA 1T2UA 1GAJA 2XI4A 2YASA 1MIHA 1Z18A 2PPLA 3PUIA 5EHGA 2R5FA 4I19A 1DOHA 1EESA 4BU1A 5K09A 3D6JA 2CF5A 1ZD9A 1SXJC 3U81A 3ABZA 4CCYB 1SIUA 5KWJA 4KO4S 5EHXA 4XARA 1UT8A 2BUAA 4AQYB 4BGVA 3B53X 5EXSA 4M22A 3IUEA 4FC6A 4MCJA 5GGYA 5KOJB 1ZD4A 4OSEA 1H0SA 4KWCA 4TTPA 4D3YA 3OPVA 4RPGA 1AUVA 1IEVA 1YBVA 3QI2A 4BECA 5K0LA 1I0ZA 1ZM7A 3TQHA 4NE2A 1DX6A 3O92A 1U9IA 4CCWA 1H0KA 2EJVA 4YRTA 1IN7A 4IIBA 1JDBC 1Z45A 2PMBA 2X9QA 3T7SA 5BSRA 3HN2A 1S9HA 3D1VA 2FUEA 3M70A 4YMSA 5AM4A 5LZ9A 2PSEA 1M10A 3DVLA 4OHFA 3D7RA 1YZ3A 2R8OA 3IHTA 5EKXA 3QPAA 3WISA 4JEHA 1PTJA 3GNTA 5BW6B 1UKZA 4E09A 3G2HA 1E1DA 2DBVO 2AHRA 2WTEA 3EVCA 4Q19A 3QTLA 5G40A 3Q2KA 3H5VA 4Q37A 4RIIA 3VR2A 1K5DA 1O96B 3GA7A 1F0KA 2H5EA 2RH5A 1A2QA 1NUSA 2JD0A 4FZ5A 4G84A 1BWSA 1XRRA 3EGEA 3KVNA 4EUHA 1C9JA 3KDAA 1ZRNA 3LWBA 4F8EA 3DR3A 3JCZA 4H77A 2EBUA 2NYRA 2V6IA 4GM0A 3O90A 4XCQA 4B2IA 2F8TA 4MLPA 3IC5A 4UZFA 5I6DA 3DD5A 4X0EA 4ALNA 4U7FA 2B1JA 5KYUB 1J5EB 5CXXA 4HF7A 1HTBA 5D5QA 1WXDA 1EBBA 3FX2A 1Y5MA 1BE8A 1JJ7A 1LUAA 1SRRA 1Z2EA 2NW6A 3NOVA 4IUCS 5FFFA 4HGPA 1D4FA 5TVKA 4IS2A 3RU2A 4BN4A 2NT4A 4R7GA 3Q8MA 3SQWA 1PJ8A 3T06B 1TVEA 1TJ3A 1YO6A 4EK9A 4H7FA 2WFLA 1P2VA 2HV8A 3PNPA 3AM4A 4MQMA 3OC6A 3IAS6 4PQFA 2RJ3A 1B6TA 4AUNA 4X6YA 1F0NA 4F3YA 3L4EA 3H5TA 1EP2B 1QGZA 3OZIA 4IXDA 1WV1A 2CXOA 1QYIA 1Q12A 2PX0A 3NXKA 3OJXA 3L0DA 2WNSA 3QK7A 1N1DA 1PUIA 4UVEA 2DZDA 3G8AA 1VRWA 2EL9A 2MSKA 2WFMA 3FFAA 4EJSB 5FH9A 1SBIA 3D8HA 3EXHB 1FUKA 1RWMA 2F1JA 3MB5A 4I55B 3U4MA 3ELUA 3JASB 4WCFB 2XT6A 3DULA 4C3VA 4FUQA 4B31A 4CIVA 1AH2A 3MS7A 4D26A 4K2HA 3RADC 4R16A 1IVSA 1WF3A 2IW1A 5ERXA 2C7BA 5CG1A 3DMYA 2EL7A 4K28A 4AXBA 3WIOA 3FOWA 1S7GA 1V2GA 4QSMA 5C0OE 1RS0A 3L84A 1NJSA 3OLQA 3I5XA 1W8IA 4GE3A 3O26A 5H81A 4U5XA 4ND4A 4JBLA 4CV1A 2PGLA 5EXXA 1G6OA 1TVCA 2N1BA 3OE7A 1DJLA 4BRWA 5JZSA 2KE5A 2XYPA 3BA6A 4G8BA 1W30A 5JZMA 1WQ4A 4NAVA 4ILEA 5DTQA 2DWCA 4RTJA 1R15A 3RVOA 5JARA 2R1UA 2AQHA 2Z5GA 2RB4A 4P54A 1TJ4A 2ZQYA 3WFJA 1EVEA 1TK2A 2EDAA 2J09A 2JLCA 3EW7A 1RQ2A 3X1XA 3NS7A 5IHPA 3INGA 2PV7A 3IERA 4WA8A 2ZBFA 4BFYA 4MGKR 3AR6A 1RBMA 2DJIA 3WGUA 3IXQA 4LV5B 3ZDBA 4YV7A 2VUIB 1XTQA 2VJMA 3CH6A 4XOUA 1C8BA 1QZXA 1VL2A 2W37A 1XCJA 3DEJA 3LW7A 5I9LA 3DAOA 1X1CA 3MS2A 4LMPA 1LNZA 2QU8A 4O08A 3EH1A 4RK6A 1OR8A 3PGVA 4GBED 3NO4A 4RMGA 4YJ3F 5K03A 4MIOA 4YP1A 2TMYA 4RNCA 4QKQA 1PN3A 1EE9A 3NGMA 4OG2A 3UV6A 4DC1A 2M6LA 2GJ9A 4NBVA 3VJRA 4I2NA 2WUEA 2YHIA 1VZ3A 4H7HA 1E69A 3DQQA 1S5PA 2V0CA 1KMCA 4PPFA 5C8YF 2LGJA 1B7GO 2QMEA 4XWTA 4IJ5A 4Z9YA 1U3DA 3WGMA 4DLTA 1OB2A 4LF9B 3GH3A 1LTHR 4L9AA 1QH9A 2UUPA 5EG5A 2J9FA 3W8NA 1XZCA 4FM9A 3U13A 4KGXA 4YMTA 4FE7A 4J7CA 2QJTA 3G85A 5JXWA 3JD4A 2HCRA 3L6EA 3SEQA 1ZZGA 1U7ZA 4C4RA 5LXTF 1RJGA 3THYA 1OHHD 4IWYA 2HTEA 1YDMA 4I1UA 3EXIA 4HWPA 2O5RA 4PLZA 1OLXA 1ULTA 3C3EA 1AZWA 1JAXA 1PEKE 1VKHA 3GPBA 2FSGA 1ZN8A 3IQFA 3M81A 2V9PA 3O1IC 4RLQA 3AI2A 4AJ9A 4DXHA 1CF4A 3F6SA 4C7OB 3AP3A 2QGFA 1H8HA 1KP2A 4LJ6A 2WP0A 1MH1A 2DVMA 2P6OA 3C5EA 4EY4A 2DLDA 2EWWA 2WDPA 1P5HA 3NNDA 1QIFA 4YMIA 1V3VA 3PJDA 4ZGBA 3T1TA 3TFQA 1QFJA 4EPXA 2CMHA 3ABRB 3OQIB 4DDVA 4E0BA 4MUMA 1XZAA 3GNQA 2BYTA 5AJWA 3OCYA 1NBIA 1RXCA 1SXJA 5HTOA 3KK0A 3QELB 4JT9A 4WAUA 2CD9A 3E3OA 2B5OA 4UD2A 1G64A 2CVOA 5KVQA 4MV7A 5JASA 2DHQA 4HNVA 4OD0A 4RSMA 1G8YA 1KEEB 3DFFA 2RGYA 4P2GA 2EKLA 5EE3A 1OXKB 2X15A 5KQSA 2G67A 3EUFA 3GG2A 3FFWA 2Q99A 5F2OA 5KVCA 2YQ5A 4FD2A 2XYQA 4R6XA 4KN5A 4NV3A 4RVCA 4ROSA 2VBFA 5ILOA 4BU0A 1HRKA 1I4EB 4X65B 4D8VA 4Z0NA 4JYZA 2P35A 3AKCA 2JCVA 3L4JA 2DR3A 3QI7A 1SBQA 1T13A 5FBWB 4KC0A 2DF8A 5F3DA 5C8YA 2EJTA 5KOHB 1TB4A 3AR8A 1DDIA 4MWEA 3D2BA 3AKYA 3K8YA 1BYIA 2QWXA 3GGSA 3SVZA 3N2KB 4IDBA 4P3XA 3E70C 3W1VA 3E7WA 3KBBA 2WUGA 2JKYA 3FDIA 1Q5PA 5SY9A 4JX9A 1K89A 1HKHA 4V0SA 2YJTD 4GO1A 3R0ZA 4AMVA 3M9LA 4TTVA 1TIKA 5LXTA 1GKUB 3SC2A 3ZZUA 2CLEB 2R1TB 4J7AA 2XWBF 3LF2A 3LK6A 4TVBA 4F4HA 1O89A 4RENA 1KA9H 3VO8A 2H16A 1QYRA 1P61B 4J3NA 1AGXA 3P0EA 1G8KA 2FE1A 1M34B 1T26A 3I61A 3ZWQA 2XRZA 1JFVA 1KARA 1VHWA 4OUDA 2ZYDA 2BTQB 2FSVA 4PM4A 1FK8A 4ND7A 3S27A 3KKOA 2QE7A 4WGFA 5JMOA 3BA1A 3O9ZA 4D3FA 2FMKA 8MHTA 1U02A 1V9LA 4BO6A 1N5JA 1IQ0A 3EDOA 3EUAA 1JFTA 1CV2A 1SIBE 3VR4H 4KR9A 1M2OB 1YZGA 1CLEA 1ABFA 2OHXA 1VCMA 4IYRA 2REBA 1G8PA 3RSCA 3C3KA 3PYLA 4MAAA 4UVIA 1CTQA 3KOYA 1CEQA 1EPUA 1SQFA 3H9QA 3K1YA 1MAVA 4KPFC 5JD3A 3AHDA 2VK2A 5D3MB 3Q7RA 1XSEA 5JADA 1GAQA 3W9BA 1QE5A 4C08A 5C35A 1A97A 2GAFA 2ORED 2NZUG 3VPGA 2GZSA 2W8ZA 2H3HA 3MTEA 3IGFA 4FW9A 2WIAA 1J2JA 1W44A 2C0QA 3LT2A 1WQ1R 1XEWY 2Q62A 3ENNA 4WOJA 3NT5A 5GJCA 1YQWA 1W19A 3F2VA 2XDAA 1NUHA 4GKBA 4LTDA 5SYMA 3W5HA 5DI3B 1IIBA 1TO2E 1PU2A 2G80A 3NTOA 2Q3DA 1U3WA 2J3IA 2W93A 1U0LA 4GZMA 2O3JA 1BW9B 3DS8A 4YX9A 2WJVA 2IW3A 4E2ZA 4OBWA 2OCYC 4MR9A 5LQAA 1OV6A 2PUEA 1N5IA 1ENYA 3FYUA 1I2AA 3NM5A 1F5SA 1Z0KA 2AWNA 2ZIFA 1ABBA 5E6UB 4GFDA 4TS4A 1EFPA 5JJLA 1IEQA 1W46A 5H68A 1GKLA 3OHMA 1OXTA 3MPOA 1UZAA 1U3TA 1R0KA 2EX0A 4R2HA 1YC2A 3JRNA 5C1DA 3A4YA 2RHDA 3N2EA 3NPAA 1AF4A 4YAWA 1VFNA 4OXRA 1UJ4A 3QBJA 3PK0A 1C4OA 1NNSA 4Z3OA 4MQFB 1JW9B 4CRWB 2ZRMA 3PQ8A 4Q5IA 4KGZA 3NBZC 1SELA 4UEJA 4Y2XA 4YJ3B 5E1DA 1WUKS 3S1SA 3KFLA 4PG8A 2WKSA 4ZDJA 3TUZC 4MRPA 2UKDA 4AB1A 4ZVVA 4Q48A 3ITEA 3NVKI 3L8EA 4EY6A 4QGHA 4TTRA 4UHJA 1VPTA 3EYAA 4FMPA 3EVFA 1QB8A 5AI8A 2AN1A 1NQ5A 2PO5A 3IPAA 1XZBA 2DSTA 2ZUUA 1ZD3A 4YMWA 5JCZA 1DARA 3H8VA 1JR3E 3U61B 1JNXX 2NGRA 3C7KA 4ER5A 1XCLA 1R0XA 4HNRA 4KMSA 1GSHA 4OSOA 1Q14A 4UCXA 2GETA 4OQMA 1E2PA 3EY4A 4QHTA 2IGBA 2ZB8A 1X7WB 1ZN9A 5U4XA 1JRLA 2WVHA 3B5IA 4MV6A 1KH2A 4OGKA 5EWJB 3JQPA 5HZMA 1IM2A 3AU8A 2J33A 1T0IA 2FUG1 2WHPA 1WV0A 2H07A 3ZJVA 5JXHA 4FT4A 1QB7A 3GPIA 3PIDA 3G5LA 4L3OA 4X84A 2VDOB 4IMIB 5C9ZA 1CBUA 4EHLA 1OE0A 1S0UA 5A4FS 4FX2A 4WDRA 2WWYA 4P7FA 4NEHB 3WMEA 1FIUA 4CKYA 1SZCA 1YU9A 3R41A 4YP6A 4D9KA 3T1HB 2J30A 3RKUA 1E63A 2ZJBA 3IKMB 3JQQA 2D2EA 5DEIA 3I01A 4BCDA 3OEED 2C2XA 4OAQA 4RLHA 1QWSA 3EF0A 1E62A 3HYTA 3GNLA 1WTAA 2JB9A 3WNVA 2YNMC 1YOVA 1LA2A 4R2KA 5JS8A 1TT5B 4IJWA 4ZYYA 5JAQA 2IE0A 1FFWA 3VKHA 3NOXA 1Z12A 1U5AA 4NMWA 3AK4A 2ZUVA 4LSZA 3UWPA 4WK2B 1UBCA 2G07A 4G2TA 4F97A 4H1HA 4NS1A 1XRQA 5CNIA 4NLLA 1OU0A 4IGAA 1L5GB 4YI5A 3BC1A 2Y76A 5CDFA 3CVWA 5IAKA 3GLFA 1FYWA 3HKEB 4UHKA 4Y2PA 1KKMA 2ZCJA 4KQ9A 1C1DA 2VXCA 4R8MA 1U6KA 2V6FA 3HCAA 2OE2A 2WHRA 2YV2A 5EJ6A 1NFQA 3ESRA 3Q72A 4FFMA 3C14C 4KRGA 3GVXA 3A1EA 3DEYX 4Q4JB 2L69A 1IATA 1QOZA 2OV2A 4B40A 2DY0A 2QPOA 3BE5A 2C82A 2HHLA 3VHRA 3VDRA 4D9GA 2OZEA 4KQ1A 2BZ0A 2F90A 3BEOA 4HUQB 5EE5B 3ZWPA 5FULA 2D7DA 1JDPA 3RTCA 2Z6VA 5EFOA 2DETA 3A1NA 3R20A 1XQVA 3KAPA 4BP8A 4B3XA 2J5BA 4D99A 3ADOA 5DHSA 4J9UE 2JHGA 3OZGA 5FCDA 4CMJA 3ESYA 4MW7A 2WJJA 3R8CA 2BFFA 1TZMA 3BAFA 1XKLA 1YK0A 2BP7B 3GJRA 4I7EA 5FBQB 5BO5A 3O8DA 4F1WA 3HVKA 5IVDA 2H4HA 6ABPA 1UP7A 2SKCA 2GLXA 4I14A 4RA9B 3E61A 1T4GA 4P4TA 3AF0A 5ESRA 1GNRA 1QUFA 3JQGB 1KNQA 1GPYA 1CQWA 2WF8A 2RHJA 3RREA 3MJCA 3S99A 4WOCA 2NG1A 2HUNA 1Z6XA 4ISCA 3RH0A 4B0PA 3IT2A 5DWDA 3RVLA 5ICEA 3TLGA 3EGWA 4RIHA 5ENDA 1KXJA 2P41A 3HE3A 3O0DA 4YS6A 4JLVA 4BNTA 1K9VF 4HDNB 2AFVA 2XDWA 1DLIA 4KQJA 1L1FA 1XMXA 1MEOA 2ST1A 3HUUA 3GQVA 3RANA 4EHHA 2OXEA 3E9QA 4R2WA 3UWOA 2BI4A 3JWIA 3NVAA 2QR5A 2I1LA 4ZQIA 1U6IA 5DTMA 3VDNB 1YGYA 1YK1A 1FP4A 2W83A 1XLVA 3RFXA 9ABPA 3EZYA 3ESQA 2HU2A 4XFJA 2G9UA 1DIHA 4MVJP 1PJQA 4QXRA 2W11A 1UC5B 4UEKA 1T1IA 5LMCA 3K9BA 1UXGA 2GRJA 4TZTA 2XKJE 3GRYA 2BY4A 1I2MA 1V9SA 5H9VA 4F5EA 4LWZA 1TDJA 2P69A 5TIIA 1YTUA 2PLAA 4MYDA 2GJ4A 4KR6A 1VLZA 2IXBA 2WSSA 1B4DA 1ORWA 2CJXA 2OKGA 2QXYA 3PB3A 2R6R1 2JF0A 4OJMX 2WE7A 1P17A 1PJSA 3LD9A 3ABSB 1XLUA 3E81A 1FNDA 3FKQA 1LDEA 1THMA 1CY4A 2VF2A 3AJ9A 1GXSB 3WO0A 3SY8A 5LQUA 2A4KA 5FWDA 4MV1A 1I3MA 4A92A 1M8FA 3JAWA 3BCRA 3BUSA 2CY0A 1G5PA 4M8IA 4A2PA 2DC1A 2QUZA 1JJFA 2ID9A 2DJ5A 1Z35A 4IKPA 5JJBA 4BFLA 1N6KA 5HNKA 2QX7A 5KJ1A 1N3IA 1XAJA 3D81A 3FTDA 3ISTA 1GTL1 1W4BA 3OCXA 1RZ3A 3ZR4B 1G55A 4IH1A 1N2XA 2C4NA 1ZP6A 1ZSVA 3BRSA 4XPIB 2GUWA 5ICFA 3MJSA 2WRZA 2JHCA 1JYSA 1EEHA 3ZNOA 3D0KA 4ITUA 2VTBA 4KH0A 4YCNA 4X66B 2Z9DA 1N7IA 4QQKA 1LW7A 1IDOA 3QXJA 2WJZB 1AKYA 3I0ZA 5JIBA 1M72A 1V6CA 4Y1FA 5KYKA 1LFAA 3C7CB 2I2AA 3SBXA 5JBIA 1KOGA 4OU4A 1T4CA 4QD3A 3VR3A 1TOAA 3D9QX 1T9ZA 5ITSA 2J0EA 5ALGA 2BEJA 3REGA 3X2FA 2CLDX 3IVCA 3FUCA 1YR3A 1LRJA 1R0RE 2HX1A 4PRKA 4X1YB 3RBXA 5KSYA 3SF0A 3TI9A 2XNHA 3GLGE 3K09C 1O08A 1PYDA 3DMRA 1UBKS 1OJ7A 5TDHA 1CY7A 2NVUA 5JS1A 2WT8A 4X7BA 3T5BA 2BFBB 4IIEA 4EFKA 4ZYTA 1EQUA 1ZGZA 2H5JA 1ORRA 4U3JB 1NPTO 3BSSA 2QSYA 4AJHA 3FNFA 2D0DA 3OF3A 1HE2A 1AKTA 1GUZA 5DSZA 5AVOA 3TLYA 3TRKA 3S5JA 3V8RA 4B7AA 4OLAA 3NHYA 2HPHA 5EIFA 4AJJA 4FYIA 4YQZA 4DCGA 9LDBA 2H7CA 4C4YA 3DOJA 3FHTA 3GGGA 1F2DA 3L2OB 4H16A 3ECSA 4QXAA 4HGRA 3IVRA 5JMPA 3K96A 4EUFA 4QTZA 1JJVA 3JSAA 4B8ZA 5EJ7A 1TI7A 1P2GA 2RBKA 3Q6NA 1JG4A 4RJ2A 2A3RA 1OFUX 1YRBA 1V7CA 3H0KA 3JYQA 5LZ2A 1ZEJA 2DWQA 2PH7A 3BIWA 4LVOA 2F3QA 1YIDA 2RONA 1HLDA 1SKYB 1G4UR 1EHIA 2ZTMA 1H5NA 1K8XB 1XNHA 3G2JA 4OIFA 3STVA 3UJDA 4F85A 4YRKA 3D7SA 1H4QA 2Y1XA 1XEXB 3LQQA 1IHUA 1NPDA 1J8QA 1ORDA 1VPVA 1I2DA 2BIFA 3F4LA 4LYYA 2A88A 2R2GA 4PWYA 5GWXA 2JJQA 1VA4A 1EK6A 3QHPA 2ZB7A 2C95A 4GU5A 2VKQA 1T6XA 1JG2A 3FPFA 3UWDA 3K9CA 4MKIA 5FWYB 1NQOA 1PNQA 4DJTA 2R0QC 1FTQA 4AN0A 1IN6A 2CDAA 3IMFA 4Q7JB 2UZ3A 3AEQB 3CF6R 3R5TA 5IZ4A 1R12A 2ZVQX 1Q20A 4JI3B 1ODCA 1NMSA 1TEHA 3SIWA 1WCIA 1PJRA 1T43A