3OOWA

Octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from francisella tularensis subsp. tularensis schu s4.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
SVQVGVIMGSKSDWSTMKECCDILDNLGIGYECEVVSAHRTPDKMFDYAETAKERGLKVIIAGAGGAAHLPGMVAAKTTLPVLGVPVKSSTLNGQDSLLSIVQMPAGIPVATFAIGMAGAKNAALFAASILQHTDINIAKALAEFRAEQTRFVLENPDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase,catalytic subunit
publication title Octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from Francisella tularensis subsp. tularensis SCHU S4.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 3oowA00
5CLHA 4AY3A 2FW8A 2FWAA 4YCDA 1U11A 4ZK2A 2FW1A 2FW6A 5C5DA 3ORSA 1QCZA 5CVTA 3KUUA 4ZJYA 1D7AA 4YCBA 3RG8A 3RGGA 2YWXA 4YCJA 4GRDA 4JA0A 4B4KA 5CLGA 2FW9A 5CLJA 2NSHA 5CLFA 3OOWA 3LP6A 2H31A 5CLIA 3OPQA 2FW7A 2ATEA 5BOSB 1O4VA 4Z7JA 2NSJA 4ZMBA 4ZC8A 2FWIA 2FWPA 2NSLA 4AY4A 2FWBA 4YCCA 3TRHA 5BORA 5BOSA 2FWJA 5CTJA 1XMPA
chains in the Genus database with same CATH superfamily
3PEFA 4DQUA 1XRRA 2EWWA 3DWGA 3IEXA 1NN3A 2X5OA 1Z4JA 1DADA 1FK8A 3FE2A 1ZL0A 2NYAA 5H4HA 3I52A 3LT2A 3UCXA 4R83A 1SUAA 1I9GA 3EQZA 4NXNB 4K88A 3NHMA 2RHCA 4UM7A 4KE7A 1P6XA 1UMCA 2VP3A 3L8EA 1NW8A 2ICAA 1ZCAA 4O2AA 3UK6A 1II9A 2ARKA 1BMFD 1U9JA 3AI1A 5AVVA 5K4HA 4JBIA 5C7LO 3MG9A 2TYSB 3T0GA 3O1HB 5D00A 4PHFA 4EFKA 6NULA 5GJWC 4KQ9A 1P81A 3TNJA 1U9CA 2VT7A 1A5AB 2GESA 1P31A 1L1EA 5TPZD 1I4TD 5C32A 3VDXA 3PKJA 2Q3DA 1RYMA 1NG1A 1R6DA 1UXIA 4MKHA 1SXIA 4CT4B 3SICE 3MQ2A 2IA5A 2DP4E 3N0XA 1NLYA 4L3WA 2OCBA 2P3SA 1DC5A 3DMTC 3WMWA 5I6DA 1FDUA 1MO2A 2NVBA 5CYFA 4D97A 4YAKA 4M89A 2D5IA 1DRJA 1USUA 1XD8A 1E63A 4J0HA 4M6WA 1E9AA 5A2GA 3G82C 1GNLA 5CCEA 1N4AA 2QQGA 1IUNA 2C00A 4IQ4A 1R0WA 3P45A 4YJ3B 5JARA 1E5DA 4CEHA 3KAPA 3T15A 2XMZA 1W2HA 1FUKA 4OAOA 4BNDA 2IUYA 1T9CA 2XDQB 2YFYA 3FGPA 1C3JA 2CYAA 3GCDA 2A9RA 2Z6VA 4PYLA 3NCHA 4Y9TA 1BN7A 1JG1A 2NO9A 5KHLB 1WDKA 2DOKA 3DLPX 5IS2A 1MX5A 1MX3A 2OHOA 3IPLA 4YMIA 4F2PA 1C4OA 1BXRA 1F6WA 1J8QA 2ZULA 3L4BA 3L92A 5JQGA 2PVCA 1IHYA 2YJNA 3KNZA 3ECSA 1F8FA 2BWJA 2VDJA 1ECJA 4BO8A 5LKAA 3U4CA 3P2JA 3G2OA 3A3NA 4O4LB 1AZTA 4HGRA 1U0OC 3O4JA 1R37A 1G6KA 3NH6A 2X5NA 4A73A 5A4JA 3L6BA 3RFUA 3QUSA 3VU1A 1FPMA 1E8DA 2WIAA 1TO1E 3QXCA 4HC4A 5LVAA 1TOAA 5B1EA 4YRGA 4RLSA 3CH5A 1LPBB 2R65A 1RLJA 3RYIA 4IEIA 4ZT7A 3X1KA 4D2IA 1NXXA 1UDBA 1UC9A 2YWHA 3O7MA 5H3CA 3PWSA 5CT8A 1T6ZA 4BNHA 1G3MA 2BOVA 4R1TA 3PDIA 1K4YA 5FH9A 1R64A 1TFUA 3MIIA 3UK2A 2NGRA 4H2DA 2P2CA 3IR5A 2Q1SA 1AS0A 3ICOA 4FFDA 3VU0A 1P77A 1ZINA 4MIKA 3EVAA 3GRKA 1OOEA 2CMKA 2VUUA 4UHHA 3H05A 1NQAO 2NTVA 3E05A 2BY4A 3CRMA 3BH7A 3HYCA 2C78A 2IK8A 3IB6A 2HMTA 5D8DA 1YL5A 4Y6RA 2H4YA 5AW5A 4EG8A 5ADHA 3KQYA 3LZCA 1C1DB 3DZIA 2Q9UA 4WY2A 3MWEA 4ETNA 4B6JA 4A23A 4WXHA 1E92A 2BCEA 4KRXA 4V38A 4AUEA 3EVBA 4JP3A 4QUBA 5KVQA 2LGJA 2ZSIA 3IILA 3LY7A 4RIFA 4Q16A 3P2MA 3KJFA 3I4CA 4I3FA 3D1JA 3RVRA 5KYXB 2ZJFA 5FPPA 1SXJA 2PGAA 1A8IA 2I7TA 3V4FA 5CH8A 1NPYA 2EQBA 4AJ2A 4TN5A 1NASA 2COKA 3ET5A 1GU0A 2TRSB 4BMZA 5I9BA 5HSGA 5M29A 2C04A 2J8ZA 4RMGA 2B3TA 2V0CA 3QU5A 2FX3A 5FYQA 1CSEE 5IAEA 2PBZA 5CXUA 1QMGA 1O87A 5HJ5A 1N3LA 2DVMA 1BXKA 1G5IA 4NFYA 1JALA 1QFXA 5ILGA 3RSZA 4AG3A 1OE0A 1P0IA 4RJ2A 2ZSJA 3LHSA 1SCDA 3OU7A 5BV1A 2CJFA 3OP4A 2OMEA 4E4YA 3P9PA 1U04A 4BFXA 1O1YA 4HNAB 4ID3A 2XLCA 4GS5A 3IVMA 4IH9A 5FR2A 5F4BA 3M1IA 1TYBE 4BEWA 4EJSC 5JZ9A 2YWFA 4UPDA 4Z7QB 4KQ1A 4ON9A 3RC2A 1C4KA 1U6KA 1NMEA 2XOKA 2J9YB 1BHJA 1U2TA 2FSUA 2IWHA 3GLVA 4DIDA 2HV8A 1WXFA 5FBWB 1N5RA 2OYCA 1RP7A 1EDBA 5CX4A 1JDNA 5CJPA 2C7QA 3FHTA 1YA4A 2V59A 3FRIA 1Z33A 2DBYA 2JFPA 2JRLA 4IDDA 4AICA 1Y3DE 1NOKA 2X6QA 2CHGA 5AJTA 3OD5A 4WBNA 3D7NA 3A9SA 4JJ6A 5DGXA 2QF7A 3HUTA 3WNQA 2WTUA 3RBXA 1PLJA 3RK0A 1YZUA 2C5LA 4R71A 1W48A 2X0IA 1II0A 2WFAA 3BFKA 1Z0JA 3IT0A 4LKOA 2PTGA 4RANA 4F38A 4ZK2A 1OREA 3W34A 4HYQA 4URFA 2WFMA 4ISCA 2G0TA 3DZGA 2BN4A 2OILA 5JC8A 1M73E 1O6GA 2GXQA 3E5RA 2JLRA 3FF1A 3LC2O 5G4KA 3SHWA 3WMXA 1X0XA 5A1TA 3QXJA 3R9XA 4KXMA 2B1GA 3QEKA 1P73A 3U7QB 1FTSA 1MNAA 2AE1A 4F21A 1YJ8A 2PV0A 4PO1A 3HY4A 4JI2B 1IZ9A 3JWIA 1U8ZA 3ND5A 2O8EA 4Q3KA 1SHJA 1Z9BA 4L15A 2PSJA 1AURA 3K0CC 4A5SA 2CVHA 3H3FA 4QJIA 3SK0A 3N0TA 5GPBA 1XL1A 1XMJA 1PFGA 4P9NA 1H6AA 4ZWNA 1QH8B 4LTMA 5LWHA 1X14A 3PJGA 2JLUA 3PUWA 1KH2A 1A04A 4DV4B 1GNQA 2XUJA 4C7JA 3EQ2A 1QG2A 4JBWA 1L4LA 5LWQA 5CT6A 5BQ3A 5C8XA 3VR3A 1Q15A 3WK5A 2ZBDA 1YJCA 4J0IA 3NDIA 4LE0A 3VDNB 2YFQA 3WOVA 4AM8A 5KTKA 3TJMA 3V8VA 4O4JB 5K8UA 2C9BA 2ZB3A 1N5LA 4CR6A 1L5VA 1YASA 4MGIR 3W6ZA 2V58A 1VHDA 2XRYA 2FFAA 3RYHB 2AGVA 3I04A 2FUCA 3EF0A 1N1MA 4L0CA 4I6EA 5J2TF 1E2FA 4L8YA 3G0GA 4D45A 1EQUA 4B4UA 3C3YA 4FFVA 4ZI2A 4Q4AA 4XYMA 3DW3X 1A1SA 2HJWA 2CMDA 2O06A 1ZUIA 3C6QA 2BFDB 4D9IA 2A0YA 1I01A 1A4IA 1KMNA 4UHKA 3V4LA 4XD7D 5U9CA 3I37X 5EGSA 4OHUA 1AB5A 1PDWA 3GVPA 3LO5A 3PNMA 4QFBA 5CP8A 4QUJA 5K8LA 4MYDA 4B74A 1MC5A 1X94A 3FPEA 1FFXA 3VKGA 2LV8A 2ZI4A 5L4SA 3C5HA 3GRAA 4YRTA 2ZXUA 3TR6A 3MPUA 2GN9A 4Y3UA 4B73A 5EZ6B 1PNTA 2ZSBA 2DH5A 3COYA 3OP1A 1AMUA 1IY1A 3B60A 1TA4A 4P7FA 4DLXA 1XHEA 4CI9A 5TT0A 4ZT5A 5KX5A 4HN2A 4COKA 5IARA 4WFKA 4E32A 5EHNA 4EF5A 5I7UA 5DLPA 3OT4A 2XRMA 4BFUA 1XCMA 3M82A 3RHZA 4AC9A 3PUXA 1T6YA 4E14A 5BWOA 4GVPA 3Q0IA 1TYDE 3QZUA 1GUZA 1P8JA 5E9AA 1ULZA 3FX2A 4HAUA 4QBHA 3RVQA 1ENPA 3V2HA 1SXGA 1HC7A 1PQWA 2O3UA 5DLYA 1FNCA 2VNAA 4YMVA 3HP4A 3SQDA 4FS3A 2MU1A 4URYR 1ADJA 2HBRA 5DNCA 2RI0A 2W71A 3IV9A 1PEKE 2EBFX 5AVOA 3RAEC 1K7SN 4PS0A 1MO4A 1H4SA 5MFPA 1MJHA 2LW7A 3LHIA 3JSAA 4WFJA 1H9BA 2P9JA 4K03A 1XFDA 2OLKA 2PL3A 1XXLA 3A06A 1Z17A 3QGMA 1OHHA 1Y5LA 3E4CA 3N7TA 1M1YA 2IOQA 4G8JA 2I6UA 3SJCA 5F1YA 3PWZA 2O2JA 2XCQA 4YCDA 3T3GA 1P7WA 1QE0A 2UUPA 2CBXA 4HPWA 1PFYA 4QE3A 3F74A 1O8CA 2RAPA 1F2UB 1ECBA 3K5IA 2NM0A 4XFJA 3CKLA 4AX8A 1N0UA 1XCLA 1OLSB 4EIWA 5K7SA 2XTMA 1T2FA 3DONA 1B0PA 3FTCA 3D8HA 3GO4A 1VHWA 1U3CA 1U8TA 2WKSA 4M7OA 3MLBA 2WSSA 1QK4A 3OPQA 4TS9A 1O96B 1IVYA 1K8QA 3GDOA 4P4GA 5C1IA 4AZVA 4DTIA 3ZU6A 5BR4A 3BB1A 5HK8A 3AVWA 5IH3A 3GJ4A 1I2AA 4FYKA 3VUEA 1PWZA 4AECA 1OKKD 4OMFG 2LKCA 5DE3A 1H66A 2P0EA 1SQFA 5LYYA 1ZMOA 1BQ3A 4M1KA 4RKQA 1Y9AA 2E49A 2HADA 4IUDS 5EWLA 4KXNA 1NBAA 3KVNA 1NWCA 2JAHA 3F9IA 3OWHA 4UPVA 5I5GA 4EPWA 1CUWA 4I4TA 2PZ8A 5E6RA 4E6PA 1A8HA 4DMRA 5KTPA 1JMYA 1C7IA 3QPVA 4XM1A 5D84A 5JDIA 5DP1A 4IDQA 1M1UA 3C74A 2W2VA 5EIBC 5HGXA 1EDOA 3R7AA 2BHRA 1SXPA 2AMFA 3AIOA 5E4FA 1JG7A 4J6FA 2BEWB 3GGGA 2W2LD 3QWFA 3QLVA 2ZIGA 1UKYA 2QE6A 3OZXA 4NFLA 5EYPB 5NULA 5AQEA 5JD3A 3GH3A 2IV2X 1M8FA 1KOLA 3COVA 3NHZA 5KIAA 3SVTA 1LTQA 2J3KA 3QFTA 4GP9A 1YBHA 2N75A 1ADGA 5TR9A 4EEKA 4CKBB 2IH5A 3KWJA 3BOSA 3Q6MA 4A82A 5DM70 3HHEA 2WWHA 2HF9A 3N75A 4A16A 5JNVA 2NVOA 3GLHA 3NI2A 1UP7A 2QSZA 4G2NA 2PSSA 4D56A 2MT9A 3Q15C 2X15A 3JXEA 5FPQA 2KWIA 1U3FA 2R8ZA 3A1EA 3STUA 3WL3A 2HYIC 4W82A 2JKZA 1EPUA 1I5RA 2FFQA 3MJSA 4DWVA 3CKMA 2GLTA 1L5RA 1RTKA 3VX4A 4EHBA 3TJRA 3SC2B 2OY0A 3AW9A 3NIWA 4XEUA 3HUEA 2FZGA 4Z8XA 4IWYA 5ERXA 2D0OB 3ZI7A 2VUHB 3NUZA 3I05A 1JE0A 1NIJA 4EG6A 5E4YA 4R8MA 1V4VA 2P9EA 5KKCA 4M1MA 4Q3EA 3O8NA 1YA8A 3GLIA 1GZ3A 4CKCA 5M2QA 2I9PA 5KPJA 1Q2XA 3CRVA 5D86A 1DQZA 2I29A 3O2JA 4W7SA 4FGLA 3T7KA 3IPXA 3LGAA 3VU8A 2OESA 1KZ6A 3UMJA 4K7JA 5IJAA 2C2OA 3FUTA 4YJHB 3E5HA 2IEDA 4P3PA 1LRLA 4U5QA 3CY6A 4JLKA 4BQSA 3V3KA 3CN7A 2I6TA 2H4XA 5J4HA 4KX5A 2OV3A 3GEIA 1LD3A 3T4EA 2G63A 5FCDA 3U3XA 3WB2A 3DWIA 1VG8A 1JKMA 1HE3A 3PHCA 5ELXA 3A6PC 3S44A 3R8FA 3NHRA 1I3NA 3I5YA 4M8IA 3LKVA 5JXJA 5AIBA 3GFRA 1OZAA 3CLRC 2HQRA 2NO4A 5DASA 3FCCA 5LBIA 4S2UA 1JMVA 4OGFA 1GFWA 1N6HA 4BLVA 2IP1A 1LJUA 2AHRA 2BM8A 3E35A 2O7SA 2D1SA 2IYXA 2VQ6A 5I7AA 1E2EA 2QDKA 2IZ1A 4DCOA 4UQOA 2VH2A 4UOQA 1Z6ZA 2R84A 2JGNA 3EUAA 4ARIA 5ENVA 4UNNA 1G5PA 5DTRA 5BSHA 2C5SA 1YDEA 4YQYA 2V7VA 1FUYB 5AUNB 1LS1A 2CLSA 1WSDA 1DKRA 4UMVA 5PNTA 1FNBA 1KSGA 3MGGA 2NQ8A 2YH2A 3JRWA 1JWAB 3O83A 5GVSA 4YLYA 1A9OA 3O0DA 3X3HA 3LCMA 3I9LA 4JZKA 3TD6A 1UDAA 1VA5A 1Y3BE 4FSHA 1A5SB 5KJFA 4YBZA 3WLOA 3MJ4A 1NQOA 2ZRNA 2A0FA 3NHPA 4LF7B 3S27A 3G1WA 1HLFA 1Z6XA 4ARCA 3QPCA 4OI2A 2HJHA 3TW0A 2FWPA 1Z5NA 1IJBA 1NDQA 2VHTA 2XWPA 4QC2A 4QBKA 5ICFA 4EF4A 4L4SA 3ELYA 1UZNA 4RS3A 1UEIA 5EUMA 4C0WA 4LDPA 3BDVA 6ABPA 4W5OA 1Y4SA 2L2QA 3HBLA 1QE5A 4RF3A 3TW8A 5C8DA 1XROA 3ZZUA 5JASA 3DT6A 1THTA 1JTFA 4D98A 2NVUB 3FROA 2NG1A 3SSAA 2D1QA 3LCJA 3MW8A 4ND8A 3RRNA 1NQUA 4U9HS 3RJZA 1QPZA 3QBJA 3JYPA 4B5KA 4RK5A 1Y8ZA 4G3XA 1NF3A 3GG9A 3Q7TA 2OA0A 4C06A 1TKAA 2NXWA 4ISBA 2FB9A 2VS1A 3ZV6A 4XWWA 5AI4A 2GSDA 2FZKA 4XAQA 2BGMA 3EAQA 5REQB 4E15A 2IV7A 1COWA 1BW9A 4TQUS 2OCLA 4BXOA 5EWMB 1ZGCA 4QWWA 5TMDA 1MOQA 2Z5VA 5CDGA 2ZUVA 1FC0A 1U4SA 3TOSA 1U8UA 1QF7A 5GOZA 4LRYA 3TEJA 3AQIA 2O8NA 1RXYA 4Y2UA 5JYBA 1VQ1A 4JJ7A 1S2IA 1YCGA 4YECA 4N9QA 3DL7A 1QLWA 1BQ4A 4Y2VA 4L4YA 3TDNA 5JZMA 3L7YA 5FF9A 4OA5A 5AW9A 2OBFA 1GWNA 1RE0A 4DLWA 2NUPA 3QA3E 2FDXA 1GPJA 4R8RA 1DAHA 1R0RE 3ZD9A 5CW1A 1WXQA 4JI4B 3QVMA 2RONA 2G4VA 5IM4F 4DY4A 4XGKA 2DB3A 2WE8A 4INOA 2AEFA 3RVBA 1XTVA 1Z5VA 2EP7A 3RJ5A 3TQSA 2D00A 2XRFA 1EK0A 4NAUA 1NVUQ 3GJSA 2CVZA 3R20A 3RHFA 3SYLA 4HWTA 3WO1A 4ZJUA 1Q7EA 1D2CA 2HA5A 1WD5A 3P9NA 2JFBA 1RWQA 2Z3WA 4POOA 4DV0B 2BM1A 4G2TA 4ZI7B 3N7AA 1YL6A 2ZIVB 3CPJB 5JQGB 2WKWA 2WVAA 3RBVA 1SBZA 2HIAA 2LIPA 4MV4A 4WTOA 1AKWA 1FRZA 3N7UA 4Q03A 3TZQA 1NXPA 2GEBA 3R3JA 4AZ3B 5ADUS 2BLLA 3KRTA 4JI7B 5F9FA 4F4UA 1DC6A 4JFRA 4UHJA 2R9VA 1V3UA 5TGTA 3U61B 1BROA 2M6LA 2GYWA 3OJFA 3AIKA 1GUDA 4P4UA 1RYBA 3AZPA 1Q74A 1YQGA 3KDAA 4P4LA 5JBNA 5GIPE 1RI5A 2ZYVX 5EEGA 3VUFA 5D51S 4B34A 3TG2A 2C8KA 4FCTA 2FHPA 1TD1A 2IQ5A 5MGNA 1PP4A 4PPNA 5DIFA 1DAKA 1WMDA 4MHTA 3CRQA 3KHTA 4LOHA 2VHVA 4TWZA 3E18A 1G3IA 2QIOA 1M2OB 1KO5A 4PQRA 5ES3A 2BTQB 4I1OA 1AHPA 2AJLI 3PD1A 3G8CA 4LXYA 4QT0A 4TMXA 3DTNA 4B09A 4X8HA 4HGNA 1PZGA 1EFPA 5IJXA 1VYTA 3CX4A 1SJ9A 2X23A 3WQBA 3VNBA 2QUAA 3RUHA 3WGQA 1SNYA 2P8SA 1YTLA 2RGCA 3A1FA 2QOEA 3HWSA 4GWLA 3AVXA 1MQAA 2CY0A 4CL2A 4QDUA 2QVXX 1FDTA 3RJ9A 1X9HA 3S2EA 1ZMRA 3PVZA 4RJLA 1VLHA 2QW0X 2H5LA 3RFTA 1ZD3A 1MJGA 2DUUA 3BIWA 4AY3A 5AW7A 2AF3C 4Q15A 2V3CC 2VZ0A 4L74A 4MS3A 3QU2A 3EYWA 3UMYA 3I34X 1XTTA 1KEZA 3MNFA 1LC3A 2P2DA 3EY4A 3KQMA 3VJMA 2AN9A 3X1XA 4C0HA 4UOEA 1VC2A 3AUYA 4E5MA 3G2KA 2UVPB 3AZOA 3GFSA 3C7AA 2FQXA 3PF9A 3NPAA 4AMZA 2HCFA 4MV7A 2FYTA 4WKBA 1ZH0A 3SU8A 1GKUB 1LLFA 1RHRA 2ZUEA 4ZARA 3VVLA 3CV3A 2XYGA 4UBOA 3BHNA 2VBGA 4DNOA 1OXSC 4XDYA 2ERYA 3LA8A 3QMMA 4NMXB 5IAJA 4BPBA 2KLBA 4RJJA 3I5AA 4KHPB 1R3DA 2PKYX 3OESA 1E1YA 1AKQA 4FDLA 3KSRA 4ZU1X 4FT4A 4ODIA 1RYDA 4P7BA 4WJKB 5BMVB 3TLGB 4TMVA 4EUSA 2Q3JA 4ETMA 4YPVA 3UWDA 3BXPA 4NI5A 1CVLA 4OMDA 2GEFA 4JVSB 3NFRA 1VYUA 4ZZ2A 3AY0A 3ZY3A 1Z6PA 3PXBA 4ZDWA 1EX9A 4K6FA 1AU9A 4DCVA 1K5PA 2J33A 2IUFA 3OTQA 4BIIA 1V8DA 2XJ9A 5AUOB 5JE8A 5EZQA 4RZXA 2H48A 2Q2QA 3D7MA 4AQDA 4KXQA 4TL9A 5BVGB 4ZU3A 4R84A 2H0RA 2FRDA 1GZUA 4PAMA 1DDGA 2QRUA 4EYGA 5CB4F 3U7EB 1FP1D 3MERA 1XWFA 2BCJQ 1AK9A 4B32A 3CMCO 1VLJA 3BPSA 4XCQA 1LTHR 1AQUA 3BFVA 1P0CA 3O2QB 1GKIA 4PU0A 4YRBA 4L78A 3LOUA 3SVZA 5LN1A 1NSYA 1OLXB 2H1IA 4EPRA 1EE1A 1ZR2A 1K8XB 4TTQA 1WPRA 1FW8A 5JMPA 4Q21A 4GKJB 4EDFA 4HRYA 1SIWA 1JEEA 2EQ5A 2WV9A 3FNQA 3PC8C 4G0OA 4YCSA 1V48A 4XIGS 5J2TA 3ZDEA 4YAUA 3M9LA 3VDQA 2FF7A 1E2DA 2IHKA 2IS6A 3KZVA 1W6RA 2BGRA 4IIBA 3NUGA 3FLEA 5AR1A 1N36B 1O4VA 3ZDBA 4UARA 1Z34A 2PU7A 1JKFA 1VHJA 4LK3A 4OGGA 1RW4A 1W93A 2KHZA 2VSXA 3DZKA 4YCLA 1G2OA 1XZNA 1DEOA 4UFPA 3OJ0A 4BKQA 3NHKA 3O9MA 3EFBA 4AUMA 3QKTA 3B1FA 2QBYB 1C1XA 3BXOA 1YBFA 3D31A 4U9IS 1L2TA 4YACA 1JLLA 1OB2A 4LJRA 2YYZA 2AG6A 3D4IA 3D5QA 3LOPA 4TLMB 2MSEB 2JJQA 1KEKA 2FN4A 3MJDA 2B9EA 2V7PA 2EZ4A 4YRZA 2XZOA 3OPMA 2YQZA 4AQ7A 1J9GA 3WLNA 4IICA 1YNOA 5BYKA 2WZCA 4B6SA 1S9DA 2CK3A 1LSOA 2NIPA 1X0VA 2V7GA 1Y1SA 2CUNA 1YFLA 5L53A 2J6CA 2V9CA 1XMSA 2Y76A 3PNQA 3DAPA 3PUZA 1IM2A 4QVGA 5EESA 2VDLB 2FUG1 4K9QA 5I8ZA 3FKJA 3PRYA 5HX7A 2J41A 1XMOB 4N0EA 5EWJB 2WF5A 2PX4A 3UCEA 1TM3E 4QAQA 3HB5X 2XBUA 3FNFA 2AZMA 2O14A 3EJWA 4LZLA 4EP1A 2BGGA 1CUXA 5JJKA 2J7PD 4M7RA 3QK7A 1P62B 1KIFA 4KGDA 3I2YX 2NTJA 4HS9A 4F9EA 1HT0A 2R62A 4P98A 5AM5A 3H8VA 4CMEC 5IANA 1AKUA 3TTWA 1EGMB 4JNKA 2C57A 2FPGB 2AI3A 4IFEA 4MK4A 4HZUA 1UQRA 4FE3A 1PV1A 3K0FB 5INTA 3HKCB 3L18A 2CYCA 4M0PA 3GNTA 3C2QA 3KT3A 4NWIA 2OPHA 4C9BA 1RAGA 1UM8A 2BFFA 2DYKA 1DIRA 2Z2IA 5E9JA 3MGKA 2GM4A 2Z5LA 1RYEA 3KQNA 1F3OA 3JQ7B 1RJ9A 3ZJTA 4D81A 3L7BA 5AKZA 1PZMA 2KSQA 4Q5IA 1KJNA 2ST1A 1RVV1 4R8SA 1T8TA 4UAJA 5DN6A 3N2GA 5FA5A 3R7WB 2RH8A 3SGLA 3PNLA 1GZ6A 3W04A 3TGPA 3AP2A 4WY8A 4FNMA 4YAJA 1K4MA 2O7QA 3OSUA 1J6UA 1JFVA 4FINA 5AJXA 3UFXB 1WP4A 3HCAA 2CWWA 4INPA 1I3OA 2WUFA 3W2TA 5A9SB 2IYTA 3SF8A 2IPLA 1EK2A 1XU7A 2R6JA 1M34B 1PQUA 3BK2A 4NU6A 4BCDA 3C3KA 4NPCA 1YE8A 5I7VA 1NMQA 1PGQA 3I83A 2OK8A 2Z95A 4LFAB 1SQ0A 1UDCA 4KUGA 3TCXB 3BWDD 1PDVA 4FLFA 3CX7A 2GK6A 2HIHA 2NXEA 3VXKA 2VRBA 3ZE9A 3TRDA 6ADHA 1F0KA 3IDQA 4NBLA 2CF6A 2I8AA 2OG1A 4QUAA 4LSGA 5H02A 1LK7A 1LBIA 3DPSA 4TTIA 1A0OA 5FUWA 2Q0XA 4QLOA 5DBOA 1LXCA 2ZJ3A 4DRXA 1N6IA 1ULHA 2H1LA 5BO5A 1K2WA 2W2KB 5DHQA 1OI7A 3LF1A 3MOIA 1JHYA 4AF7A 2RIPA 3LQ2A 2FPIB 4M9SA 3RIMA 1JH9A 5I7HA 1CUBA 2ZU0C 3P9RA 3KTAB 3VV3A 4NEQA 3DFMA 4P0TA 2GRAA 3GLGA 1HZJA 2OO3A 3RU2A 1I3KA 4G89A 4XUGB 2RD2A 4LG1A 3W9SA 1B6SA 4BP8A 5JDCA 3DDHA 3B8EA 4M9CA 4MCIA 5B6IA 2O8DB 4W7IA 1UZMA 4NOMA 5BQXA 3TSWA 1VGRA 1C2TA 3ZD8A 1U8XX 4RHFA 1JSZA 1T25A 4F56A 4GDFA 4WZZA 5EJ7A 1P6QA 4QGFA 1NVAA 2OQ2A 1IXYA 4WBXC 2Z08A 5JPIA 2HHAA 3RG8A 3RYCA 1S6YA 2ZTHA 1EGVB 1G59A 4CM3A 3AH8A 1EDDA 3UJPA 4DR7B 3UBTA 1E64A 3RE1A 1FJ2A 1ADFA 1QIIA 3T4UA 5LMCA 4ZRMA 4GO1A 3KKOA 4LJAA 5LP6C 4LXGA 3CJRA 3AERA 1CJCA 1XCBA 3C5EA 1UEXC 4L8VA 3OCJA 1TI7A 3OZCA 2WDPA 3WNBA 1PS8A 2J5XA 5BSFA 1M6EX 1UMDB 2FLWA 1H2HA 3QLUA 1W0CA 4WK2B 1HMYA 1HRKA 1MAWA 2B0CA 2VBFA 2Z4SA 3CO5A 4B3JA 1U0SY 1JSLA 1CDOA 1W5EA 4UBMA 9LDBA 1GADO 2C9CA 1SEVA 1TLTA 2YZMA 1WKBA 3ZN2A 4A1OA 1G8PA 3RVOA 2GBGA 2IEIA 3HJNA 3AT1A 4LV5B 4Z54A 3HCWA 4B4VA 4DWOA 1IJFA 4H7IA 2Q0QA 4RMHA 4WKGA 1E4YA 9LDTA 4ROSA 3R8CA 2BDTA 2IY8A 4GBED 3W8EA 1KFEB 3PQDA 4GW3A 2WR8A 2JLXA 4JVMA 2ZRLA 1NXTA 1S8NA 3OJOA 4QWMA 1V6CA 4HXGA 3TQIA 4B9EA 4RTLA 3IAS1 3GB9A 1QVRA 1L7BA 2Q5LA 4AJJA 4AW9A 4UTPA 4ZMSA 2O2YA 3E7XA 3PC7A 4TT8A 5ERGB 2YMPA 2OHVA 2VP6A 2WDZA 4MR9A 5HCUA 1U0JA 2DWUA 3MBOA 2GLUA 3KKNA 5BV0A 1M3SA 3QTTA 4G81A 4Z3KA 1C30B 1T5TA 1XRSB 5BMOA 5JSFA 3ZWAA 3NJRA 4BGVA 1UPAA 4EB6A 1U1GA 3F7TA 2QM8A 3TZ6A 3BMOB 2AUMA 2WWWA 4KQCA 1RI1A 1JQLB 2XKBA 4CLRA 2VPYA 3E3NA 3SXPA 3QVVA 1FP2A 5C80A 4WCDA 4M1WA 3OEHA 1G6OA 4QO8A 2FEKA 1TYEB 4XYGA 1ISJA 1GPYA 1QTRA 5C31A 4BBJA 2OMKA 5C4MA 4ZVRA 1QWSA 4B3XA 3GVIA 3VNRA 1OLUA 2BHLA 2HLDD 5E7JA 1L5YA 4HG2A 2H1VA 1P18A 2MHCA 4E88A 4Q39A 5KEIA 2X3YA 2F1HA 2HWWA 5EZSA 2QR3A 1MB2A 4XQCA 1VB5A 4EFNA 4N01A 1TM7E 4LSWA 2Q50A 4TRRA 2A5GA 2WAYA 2PX2A 4RJIA 1FU8A 2ASEA 2PY6A 2PJDA 4YP0A 4UD2A 5EE3A 4J29A 5HPYB 3K94A 3IAM6 4C0BA 1PJ8A 2G5CA 3DCNA 3SLGA 5KC9A 5LP6F 1RRCA 2FU5C 4H0NA 3VZPA 3ZGYA 5LIRA 2H7CA 4JA0A 1XF9A 2W9XA 1Y6QA 2PX5A 2LCIA 3LW7A 4EW1A 1Y7IA 1YCFA 3GP8A 4EG0A 3UMRA 1PWEA 4NOJA 4L28A 3GJ0A 4EHFA 1CRPA 1ID1A 1RLUA 5E8JA 4OYRA 2ZIZA 3E48A 1MG0A 3A6ZA 2WTBA 1EIWA 2ZJ1A 3HU1A 3NHWA 4FR0A 1J2UA 2OV8A 3NV7A 5JCOA 1PL8A 2IH2A 4KR3A 2BKUA 4EW3A 5F2KA 1EP1B 4WK0B 2I7XA 1AT1A 4FYVA 5TQVA 1Z16A 4ER5A 1DPGA 5CCDA 1NVGA 4IDHA 4BNMA 5KWIA 2Y71A 4LNAA 1UT6A 4BKOA 1EUQA 5KDOA 4OPMA 1ZRMA 3GFVA 2IEYA 5C37A 5HUHA 2RK4A 3B3FA 4L72A 5DHSA 1ZCBA 3L8HA 4B3DA 1OGYA 2OORC 2QNBA 2BGTA 1TUBB 2JJ8A 1TKCA 3IE2A 4OFZA 1B7GO 1L5MA 2BDEA 3GLKA 4KV7A 2V6JA 4ZO9A 3JQ8A 5FEMA 4A8JB 4HBZA 4MWOA 1HEUA 1WNFA 4GPTA 4WINA 2DFNA 4GOXA 3GEGA 4LEIA 1Z0UA 1Y7PA 2ZR9A 3E1GA 2BR4A 3N8HA 2GZRA 3BMNB 4W7HA 1O97C 4QXPA 3RS2A 1DXOA 3JR7A 3KU1A 4FDAA 2G1KA 1S2DA 2DPMA 3P9SA 4IG9A 4AZTA 4RSHA 2X6TA 4UNSA 2VWPA 2EJCA 3CRRA 3DCIA 1GR0A 4WVLA 4DABA 5IC5A 4BEBA 3KUXA 4NEHB 4Z4HA 1P5FA 1YHYA 5AKGA 4RH1A 1XDDA 1G55A 4KPEC 3EXHB 3G7UA 2VDRB 4X7RA 4NDZA 4BMSA 4IW3B 4MI1A 2E9SA 4JBNA 4OLHA 1KVUA 1YJQA 5JVDA 3I32A 1AKNA 2XKJE 4ZOBA 5HE9A 4HFMA 5IM4A 3TKAA 2Y1GA 4JBXA 4MINA 1Z15A 2HXYA 2W0SA 1ATZA 1G9XA 3BCRA 3ZHOA 3ZKAA 3U1BA 4B6OA 1YR2A 1LLUA 1OGIA 2E4YA 2FMKA 1I1HA 3A32A 4MARA 2J3MA 3HVHA 4YWJA 3VV2A 5ADWA 5DKFA 1LU9A 3HR7A 1DBQA 2NAPA 5BSMA 3ICVA 5J59A 4KQWA 3G8BA 4HP8A 3WB9A 3WBFA 2AXEA 3IEUA 1KDOA 1IN6A 3WRYC 3T99A 3K6JA 4DMLA 2H8KA 4DA0A 3GA0A 3B3QA 3EZGA 3QBDA 2A4KA 4DLVA 4HEJA 1JPUA 1WL8A 3LWDA 4G5QA 2VTVA 3T3DA 4MHOA 2CL7X 1WV0A 2JFZA 4IJMA 5A0FA 2NU6B 3V4ZA 3F46A 4KFRA 1PYOA 4MTLA 3EIFA 1P3DA 4RIGA 4P5DA 1NBME 4L5AA 5CCXA 4EAAA 4K9SA 4RFSA 5F98A 2C61A 4DXHA 2ISQA 3I61A 1U2SA 3N2IA 1E6CA 3LT5A 5CDTA 4MWTA 1S5PA 2B4KA 1YIAA 1GT6A 3GD5A 4DJTA 2GS9A 3PI6A 3K31A 4WCFA 1DARA 1DAOA 1K4KA 2AZ4A 2WG2A 4BV2A 1XTSA 1NI5A 1HLGA 2BEUB 4IVRA 4WIAA 3FGOA 4WPGA 5U1PA 2VO1A 4CCWA 3PGA1 4GPZA 4MV5A 5AVSA 5FI5A 4L5JA 2IZZA 2CZCA 3H2GA 3IX7A 3W4KA 1VCMA 4RHCA 3PUHA 1M2VB 4MPJA 1PLLA 2AHOA 4I4IA 2DHDA 3AXTA 4G0QA 1CZHA 2YQ5A 4OUDB 5DNUA 2BF4A 2ODTX 1LSSA 2CUZA 3OJEA 3OURA 4KTTE 2R68A 5CITA 1YS2X 1RQLA 3EVDA 1QV9A 1A4UA 2EP8A 4XX0B 4KE9A 4S2EA 3R76A 1IFXA 1J8MF 3CZQA 2LDXA 2YX1A 2AN3A 1M74A 4GLBA 3UK7A 3FZYA 1IIRA 2JFQA 3E3LA 1OD6A 4IOLA 1UDWA 5A3RA 3IHKA 5A7GA 1RVDA 4IIHA 2BH9A 1HX7A 5BWBA 4JC5A 2ECPA 4IVQA 2YUIA 4V0MA 1U0FA 3F8WA 1G63A 1EEHA 1TDJA 3LDUA 3OZGA 4XR9A 4OM8A 1TVEA 3JD2A 4A0FA 1QZTA 1SAYA 2PX0A 1NP6A 4X1KB 2ZRJA 1OU0A 1XZCA 3A9CA 4HVCA 4JASB 1DKNA 3CT4A 2A0UA 3FFWA 3BHIA 3EODA 3JQ6A 3NP9A 5BV2P 3PXXA 3NEPX 5TARA 1J0CA 3W1EA 1NFRA 4MMZB 5JG7A 3MS7A 1AF4A 5K4GA 1T1IA 5G0UA 3TAXA 1XQWA 1V9LA 1PRYA 5GM2A 5CM8B 2W98A 1PJCA 3HU5A 5DULA 4MUGA 4Q9DA 5FPSA 5TNXA 1CETA 2EBHX 4DCGA 1RXWA 4JQZA 3G59A 4MVJI 5KOYA 3AHGA 4C29A 2HDWA 2JZCA 5DX1A 4LNUA 3SDBA 4QG3A 4UTZA 3Q85A 1WRBA 1DINA 2XY4A 2BMJA 1OTHA 1QAQA 4N4AA 5CB4A 1YBVA 1XEXB 2PWZA 4IIYA 4IO0A 5CVUA 1MIHA 1XALA 1K2VN 2DPGA 2V03A 3DLIA 1XDUA 3D6FA 2MCFA 4CT0A 1ZW6A 5FP0A 3REFA 3NDRA 1P75A 1CEQA 2X5KO 4CF5A 2BFEA 1QKIA 1BS9A 1YQXA 5FULA 3SPXA 1KSFX 4H1TA 4WKPA 4W8GA 3EIEA 4RM3A 4DCMA 2BMEA 2R8BA 1JBQA 5TGDA 4YMTA 5F5LA 1G8KA 3U3KA 4PNPA 4E2FA 2P0AA 3CWCA 4BUJA 1ZESA 2ZT5A 2AG5A 2FMTA 2UYOA 2G9ZA 5E95A 2J85A 1YR7A 2Q3MA 5H1YA 1H1TA 3W3AA 3VGPA 3V7UA 1H5QA 1Z0AA 3THRA 5DBGA 5DBHX 1Z83A 3MCWA 2WTMA 1KYTA 1V5GA 4RLQA 1BJTA 1O4WA 1TTQB 4JT8A 1E3MA 2CXUA 2YJ5A 2WF9A 5TY0A 3V6MA 4LGYA 3GRZA 1JDPA 1NW7A 3P26A 1SVLA 1LX7A 3UJ6A 1J0AA 2E87A 3WE7A 4EFMA 4L27A 2AVNA 3RSGA 5JS1A 5B1HA 4PHCA 3L7IA 2R6DA 3Q2KA 4HUTA 3NANA 4UE2A 4DIOA 2AFVA 4EKNB 1V8ZA 3ABSB 2WHPB 3H86A 4UEOA 2GBLA 1OWMA 3CH6A 1EUDA 3UUEA 5B4UA 1D4ZA 1BVYF 1U65A 1Z3CA 2G25A 1CEXA 3ESBA 4TMWA 4YT2A 1NVVR 4FZ5A 4G56A 2HHHB 2WD7B 4KQJA 3EEIA 1PR9A 1L5NA 2DKNA 3OEWA 2AYXA 3AFIA 1PZNA 2QAIA 3NVAA 1QIEA 1HYQA 2G5PA 4CMKA 1ARZA 4I5DA 4KEAA 3V00A 4CHTA 5TMPA 4RQUA 1FFHA 5EAIA 2VYNA 4M0UA 4MJ3A 3V97A 3U09A 4H6PA 5CTJA 1J8DA 1KARA 1ODIA 1FB5A 5HRAA 3HI4A 2YJZA 3T9CA 2FY8A 5HF8A 2DXIA 5ALOA 3L7JA 2EZTA 2C4TA 2WU4A 4RE6A 4P7GA 3FNIA 5JSHA 3I53A 4BN5A 5AW2A 1UODA 4QU9A 2PWYA 3L6UA 2FZEA 4YYEA 5GZ3A 2PUAA 2KX7A 1KDZA 4DMMA 2VP4A 5GTDA 1JR3D 5KSWB 1AV6A 1K0UA 3GJ6A 4C78A 4JSRA 3PEUA 4XCVA 4D25A 4PGFA 3PNKA 2HMSA 3K4QA 2JIRA 3F3SA 1EDZA 4HSEA 1RXCA 3P0EA 4IIJB 5ICGA 1XJCA 3C15C 1ZXLA 4ZU6X 3VR0A 4EY4A 1T1GA 1M1NB 4O0MA 3HVRA 2C1ZA 2I67A 1U2DA 2WPDA 2QVZX 4FN4A 4II2A 4WNCA 1NU6A 2HWYA 5EXEA 3A9RA 3PNOA 3EA4A 3L6OO 4N6GA 4YN3A 1NZFA 5ESXA 2R8XA 3ETEA 4X1OA 1A9QA 4B33A 2PRSA 1I0IA 6GPBA 3QHPA 4NP6A 2HMVA 4XIIA 4KNYA 5ECYA 2PLNA 5D1HA 2BJWA 1KBOA 4OH7A 2B99A 1SA0B 4Q48A 2RHDA 5M5BA 4CKEA 1ZD5A 3H7AA 2IEAA 1OU4A 4MZXA 3BWCA 4OOFA 4K9LA 4GWGA 5CYPA 4DQVA 3EDOA 1DX4A 5MN6A 3OJWA 2IXGA 4P4SA 4P82A 1FFAA 1H8HA 3ID6C 2XQGA 4D79A 3OTIA 2Y1DA 3AF0A 2GM9A 3VNUA 4C05A 1GTRA 1YONA 4MQFA 4WX2B 2IE0A 1GIAA 2JAOA 1YH3A 2B0JA 1YR3A 2ZRDA 3C8ZA 3IBTA 3IIKA 1ZZGA 2NT4A 4EVRA 1L7NA 3B1KA 1I6WA 2WYHA 4LVNA 3EWNA 5EVCA 5BV8A 1X80A 2WQZA 3ED1A 5K20A 1U0LA 1KI4A 3COJA 4MI9A 4PHGA 3RTCA 4L6CA 3EPJA 2JLWA 2FH5B 1II8A 1ZM3A 1I2BA 3L8GA 1C0KA 3PC3A 4NYIR 5HVNA 4DCUA 1QQ7A 2GM3A 1W1UA 2ATCA 4LYHA 3DE5X 3E58A 4WZAA 2VYFA 5JANA 5KB3A 4X44A 3HP1A 1G3UA 4TMKA 4ILEA 5DM0A 4BU1A 2ZBUA 3M6FA 4RW0A 1G66A 4TSRA 3AHCA 3MD9A 4AVYA 4BVBA 1UFKA 5CDYA 2D1TA 5TS2A 4G01B 2OCGA 1PZXA 2X2OA 4J3JA 4BQPA 4C21A 5BN3A 1EX6A 1NVBA 1UQUA 4R6WA 1O3YA 3IOEA 5EKSA 3SMVA 3QEAZ 4KGXA 2ORVA 5E6SA 1NAHA 5LB4A 3AWDA 1FFYA 3H5IA 1W59A 4MJLA 4QNRA 4UZEA 2IXFA 4C7OA 5A4MS 2YL2A 4KW7A 1ZP6A 3PHBE 2E85A 4Z7NB 2P9BA 2JIZA 1MTZA 2DULA 2PKXA 4P4TA 3TTXA 3N70A 4KLCA 1WE2A 3ASZA 4HRVA 4TV9B 4H60A 5IVIA 5IN5A 4A2QA 2QYHA 1PFQA 5IAGA 3DP7A 4GYKA 5BUCA 3CO0S 4K9DA 1ZH8A 5COQA 1Z6GA 1MLDA 1Q21A 3GDFA 4FEEA 4I8XA 4OQLA 3TFQA 1RCUA 5A06A 3QIAA 1VJ1A 1T36A 1CUYA 4AT1A 3NPMA 4HWRA 3GZ4A 1TIKA 2YXPX 2Q3FA 2ZUWA 4HO1X 1CR4A 3L8ZA 1GXSB 1EP3B 3OJCA 1U6JA 1TUEA 2YYAA 3O47A 3QF4A 1KP3A 4XJTA 5EFZA 1E3WB 4D0GA 4RZ2A 5IEBA 3MRVA 1YMUA 1P1KA 2X1HA 4FX2A 3A2KA 3I42A 4W9NC 4D9FA 4OUKX 4RVHA 5LLDA 3W8FA 4ML3A 1KC3A 4R01A 2HJRA 1UMBB 1VTKA 1DB3A 2PQMA 2XE4A 4KH0A 1U2QA 4DNXA 3OE5A 1BDBA 2UUAB 3PFFA 3L9WA 1Y3CE 2F2TA 4YJFA 5FLKA 3ZKWA 1ADCA 4N8SA 1KK3A 3GD7A 2FXVA 1K68A 5EJ6A 4WXPA 2D54A 3JALA 4NBRA 3RQSA 1A77A 5DM1A 4ZEXA 1SG9A 5FI3A 4FFLA 4AY2A 1B2LA 3ZIDA 4Q05A 1YB1A 4HWPA 3JZMA 3II6X 3NYIA 3E1SA 4J49A 4J16A 3OD1A 1E62A 4MR7A 2K6GA 4UMDA 3GQBB 4YXWA 2O3RA 1LI7A 2ONCA 1JDBB 3NTLA 1MEEA 1X7YB 4HDRA 3LX4A 4E21A 5JAHA 3R5XA 4YS6A 1E9CA 1H3FA 1ZA2A 1WW2A 2F8TA 1OQAA 3I9KA 1NXOA 2ZFUA 3H3XA 3ZHUA 1HZZC 5FXMA 3PFBA 5IKPA 1UUFA 2CJWA 4EGCB 5T4EA 1Z4OA 4HDNA 2XGMA 1O5TA 2Q8QA 3GHHA 1IXZA 1PR2A 4V1CA 2AA3A 2Q5EA 2A9KA 4CIVA 2R7NA 5KNDH 1E0KA 2AFIE 3IP5A 2Q8NA 1SZDA 4HADA 3A7DA 3QLJA 2QJWA 3GELA 4EPXA 2GEVA 4C3VA 3PDCA 2E5FA 3P9XA 3LPNA 3M33A 3H9UA 4M8SA 4U02A 4PSKA 4A36A 4KYVA 5CFPA 2FEAA 1AS2A 2ZE6A 1ML3A 2ZT6A 5D87A 3SDZA 4WLVA 5LMNB 3CLTC 2XEDA 4CIDA 2VRWA 1FVFA 1MAHA 2WU1A 2FMXA 3OIDA 3BMQB 1Z6YA 1B0AA 4WXEA 3WIVA 2VHQA 4HUJA 3D8UA 1IHXA 3GW8A 2BJVA 4ZHSA 4KDFA 4ZJZA 5ALVA 1RWXA 2P7HA 3H1EA 4TXHA 3DHVA 4DNFA 4ZA2A 1VXOA 3BXZA 4PW0A 1DJQA 1BHO1 2X22A 3HE3A 5G02A 3TL2A 1OBCA 4HLQB 3CU5A 4Z4QA 2V7BA 1R50A 4I50B 1RWWA 3RNOA 3T9AA 3BIXA 3VOBA 3HA5A 1IAVA 1AQ6A 3QEMB 3I3SR 4F3KA 4K3UA 1TF7A 1VMAA 1QXSA 1MV5A 2QD3A 5DBEX 4BX3A 1UJNA 1VBKA 2FFRA 3C8UA 1CQZA 2J9FB 2QLNA 1N2BA 3IDOA 2BC9A 1LB1B 2YZ7A 3I6ZA 4ZN6A 1P1BA 2Y99A 3ZW9A 4D4GA 2PD4A 1UL1X 3DNMA 3G68A 4Y6LA 2HMWA 4QYTA 3PV0A 4GI2A 1M72A 1S0UA 4XEHA 3SJBA 4BB5A 4B80A 3D3QA 4KP7A 3TB6A 4LAFA 2NYVA 3KYCB 4Z9AA 4QNNA 1CHNA 2IUUA 5CD1A 1IN5A 2AOXA 3L1UA 4IIEA 4ZC8A 2IS1A 2AZTA 1DEAA 1EWYA 4NDAA 4NK5A 4PIPA 1UPXA 2O8VA 3CNEA 5K3EA 2XE7A 3NYWA 3O8QB 1V4NA 3BGDA 3I58A 3URMA 4U63A 4YPFA 1X1RA 1M7BA 3D2LA 3H11A 5ERYA 4G5GA 4GBMA 2RAVA 3F97A 1EVLA 1QYDA 3L8CA 3L0DA 3LQ4A 2B7LA 3L3BA 4TLLB 2C4MA 1MIOB 3S29A 1EK5A 5DSXA 4GH5A 2WA1A 3CCFA 2RGGA 2NO0A 4NC9A 5LOVB 3AR6A 1G9SA 3D3WA 5H59A 1MRNA 1VJGA 1DWUA 2XUHA 2V7QD 4JC0A 4QPNA 2B21A 5K0CA 1U63A 2PWPA 4CEHB 4RTSA 3SQOA 2AXNA 2IPOA 3PP8A 1MXHA 5A4DA 2GASA 3KE9A 1YHZA 1ECLA 3NHSA 4FN5A 5JRDS 1ZK4A 4B76A 4DCNA 5ALGA 3O9VA 1QK5A 4FQ8A 2VZ9A 5B36A 1QQBA 3VI3B 4Q82A 3AGQA 2YNMA 3K0AA 4V0LA 4ESEA 3JZDA 1ESCA 4YJ3F 1P80A 3I62A 2JH8A 2C3UA 2YV4A 1A2KC 1E2QA 3CB2A 3GT0A 1BXRB 2QMOA 4YA6A 3VVMA 2C7RA 2MYPA 1S3IA 3ETNA 4NS4A 5CUQA 4Q7QA 1YKFA 4F5WA 3C6MA 2JJ2A 4DRZA 1JXMA 1GPBA 1Z47A 5BN4B 2I4RA 2YHIA 2R7MA 3LY5A 3LCCA 2NTNA 3QU9A 1U9YA 3PTZA 2JJ1D 2MDTA 3DVAB 4M0CA 4WACA 2CHEA 5DRTA 2IBSA 3R9IA 1JHMA 1AQLA 2IDZA 5ALWA 3T52A 4O4HF 4DR1B 2QTRA 4HY3A 2AL7A 4JVOA 5CGQB 4LKRA 5FBVB 1PGNA 2NSJA 4B83A 3H5TA 2VYCA 1RSZA 1ZHHA 2OFXA 1JJ7A 3VTZA 3Q9LA 3FWPA 2B35A 3CT6A 2GSWA 5KYYB 4YRNA 1GLNA 2VHJA 1VB3A 1LSJA 1YR1A 3EIQA 3K3PA 5FKJA 4XCXA 4TUYB 5FFNA 3I0MA 2LKDA 2I2FA 3LCRA 2D5CA 4UAUA 3A0UA 6Q21A 3D6NB 1X1EA 3TG8A 5CVVA 1THMA 2PZJA 4ZO7A 2CXPA 2GBPA 3KYDB 3TRFA 2Q21A 4B75A 1BU5A 3KB2A 4ND6A 1C9DB 4TQ9A 2FSHA 4W1RA 2B98A 3IUNA 5G0VA 4EVQA 5BXQC 1HGXA 1MQSA 1PYGA 1B74A 1NMSA 7AT1A 4LPKA 3D0RA 2X9GA 3QLEA 3WGVA 2TS1A 4JV5B 1UBHS 1X9GA 1LPMA 1S1MA 1ENOA 4N3BA 5GZ6A 2H2IA 5DW3A 2W90A 1NYRA 3MT9A 4F1KA 3R74A 4HN4B 2V54A 2YXDA 1L5ZA 4PZYA 1J0EA 1EVZA 2C31A 2JGDB 3BGVA 1XF1A 1V35A 3FKSD 3OIGA 1E8MA 3SC4A 4EA6A 3IAUA 3AF6A 1Z0IA 4WVFA 4YMUA 3KS9A 3TMYA 4LFBB 5LQJA 4JU9A 1XJQA 2RHGB 3DM9B 3VHXA 4JY7A 3CSDA 1JWBB 3QP9A 1QUEA 3N0RA 5HZKA 3O0TA 1OILA 3ANLA 4YJ2B 4ZEOA 1Z6AA 3OLCX 4REMA 4DQDA 2HA6A 3SIRA 2QTAA 1JZTA 4X3OA 3G0DA 2GZSA 3WADA 1SCJA 2G3YA 3B3JA 3FNEA 1WPQA 1R3UA 2HGSA 2P4EA 4PEVA 4S1VA 3SQNA 4BFLA 5JAUA 5HCNA 1C3LA 4HLUA 1PJ2A 2JKYA 3O4GA 1IU9A 1TQDA 1JIVA 1JHAA 2IPAB 4IJ5A 4N12A 2QMEA 3A0RB 1AQIA 4L9AA 5EJGA 4ILKA 2ZM6B 3AETB 3Q5EA 1DFHA 2AQ8A 2IIQA 4CVNA 3VR5D 4IRUB 3CJQA 5KDLA 2ZE5A 3T3EA 4FEYA 2DC1A 4TL6A 4TL7A 3P5BA 3VHRA 4KAJA 3H4TA 4NK4A 5CFNA 2SECE 3DYBA 1D7OA 3HR4A 4MEBA 4RVUA 1US8A 1XYGA 5DYIA 3D43A 2P78A 4MUEA 4ND4A 4WBNB 3DKVA 3EUEA 4DSUA 2QGFA 5JCJA 3DQQA 3D54D 5A5FA 1F0YA 4XI9A 4FW8A 1KPGA 2L19A 2WTAA 1GAJA 2VN8A 3O95A 3R3HA 1NA5A 1F1BA 1UPTA 5ALXA 1D1PA 3OLWA 3NBFA 4GKVA 3U0VA 2ZUDA 2OD2A 3D2AA 3M1YA 4TLAA 5BOSA 4PYKA 2H16A 2OSBA 5HUJA 4ZCIA 3V1KA 3UIEA 4P92A 1OASA 1O95C 2Q2WA 4PWZA 4RQBA 4URXR 3CVVA 1XELA 5BW6B 3N2KB 2AUNA 5A71A 2YVKA 3BDAA 1OZ0A 3R7NA 4YUVA 5DHPA 3BBLA 2F3TA 3MRTA 4EHIA 1YQUA 2HO5A 3JQQA 4IV0A 5FUMA 1FE8A 2IUTA 1YZFA 3C3DA 1ODJA 4DBLE 5BRAA 1WXHA 3KR2A 5LZ2A 1QRSA 2D13A 2X2PA 1WP9A 1PJTA 3U9SA 4TV8B 1MDBA 2X4LA 1USKA 3C3WA 3SDSA 1Q11A 3PS9A 5CG1A 2G88A 1Z5UA 2QN7A 1SVSA 2L69A 3C24A 3FMFA 3GFPA 2ASVA 4OHWA 1H8EA 4QM6A 2Z8XA 3G2PA 3UG7A 1MC8A 3CNOA 1IXRC 2DBRA 4FYXA 2OUIA 3MMSA 5G4LA 2WP8J 3WSVA 2WWVD 1RBZA 4BE9A 4OXKA 5AW4A 2J9RA 3P0FA 5BNIA 4UUOA 3AMVA 3ICQB 4GD3Q 2DEUA 4G0WA 1G3QA 1DTSA 5JO9A 3TRKA 1Z37A 2WMNB 5EJ8A 3U4DA 4QXAA 2W6NA 4Q34A 1P2UA 4UEJA 3QOYA 1TZCA 4LIPD 2TMYA 3VPSA 2G04A 4C01A 2YUTA 5KNBD 4P7KA 1NOIA 2BM9A 1FXUA 5KPDA 1L5OA 3NLLA 4FD2A 4B8ZA 1TNDA 4N5IX 3K6SA 1WSWA 4INJA 3RVJA 3T34A 4MDHA 4H27A 4ZCLA 1CYDA 1K89A 3FMOB 1EUCB 1DIGA 3L40A 4IBOA 4KBFA 4Y98A 3T7JA 5A3QA 1IY2A 1YQWA 3EJ6A 1RJGA 3NW9A 1KDRA 4Z1MA 1SOUA 3A7EA 2IWRA 3R5FA 1I5OA 3DBHB 4BFVA 3PHGA 3FD8A 1HYGA 4AMGA 1SKBA 3F73A 1RRKA 1PT5A 2XMBA 1KE2A 3V4PB 2ZRGA 1W5FA 1HUQA 3I2KA 4OJYA 2E37A 2PZBA 1YFZA 2R25B 4KI0A 4R0VA 5AJHA 3VZCA 2W6JA 5DHUA 2I4NA 1IUOA 3OTHA 1C9JA 1X7ZA 4NCHA 2AE2A 4G0UA 4DMKA 3R5HA 3TOVA 2W6OA 1AGXA 4X6YA 1ODLA 4LF4B 5BT8A 2FWIA 3INYA 4BB9A 3AV0B 4HF7A 1NULA 1ISRA 4MX8A 1W34A 4N7JA 3NALA 2QX7A 4OMUA 1CP2A 2ZI5A 4IZHA 4JIGA 2BHTA 3VC1A 4BOYA 1CFJA 1K8RA 1XEWX 4GE0A 1FBNA 3NT2A 5JSZA 4YREA 2QR2A 2BF7A 5ENDA 5JS2A 5KTOA 1JFTA 4KWIA 2C9ZA 4XWAA 2O0HA 3WLQA 3OM0A 3IXMA 3WMEA 1Y4DE 4LWQA 1ETUA 3LQYA 2GXAA 3HBJA 2HJ9A 2YC4C 1PFKA 3N07A 1Y42X 2DFKB 1XN4A 1XRLA 5DSTA 1KK0A 3U4QB 2AEEA 3V1TC 2PD6A 2GFIA 3D4BA 1Q0PA 3FPKA 1YRYE 3WTBA 2H9YA 4KHZA 5C1DA 3GJQA 2OOSA 3ESAA 1WD7A 2XE8A 4NV1A 4OQXA 1GITA 4R2MA 4EO7A 2WM8A 5AI9A 3UWMA 5E9QA 4F3TA 1KP9A 2XADA 1JNXX 2JGLA 4JGIA 2VXOA 2VI5A 3QE4A 4MS1B 1TCCA 3FUCA 4MVJG 4OP1A 4OQ4A 3ZDYB 3LDHA 2QA5A 4X5OA 3T5GA 1T2CA 1D4FA 2NW6A 4RQAA 4DCPA 5KQMA 1M76A 3IVCA 5DX8A 5JXIA 5TLSA 1A5ZA 2QRVA 1KP2A 4H7KA 3H3JA 4XJXA 3THYB 3A28A 2X1MA 1NRIA 2V6IA 2KE5A 3KT6A 4LWOA 3PFHA 1XVAA 3AR5A 2YJ6A 3GBPA 4EYOA 4DA9A 1A7JA 4JXZA 4BV9A 3M4JA 3AVQA 3U5ZB 3MMZA 1RU3A 4RV9A 2GCOA 5LD2B 3GLTA 2FJPA 3RSLA 1DWQA 2IZ5A 4J0DA 1CY1A 1EAMA 3AFOA 3R2JA 4RVFA 2ZWAA 4H7DA 3RVLA 3UENA 5EP2A 4ERXA 1EFLA 3H84A 5J9FA 1BA3A 2OUKA 3KFXA 3EHEA 4TWBA 1FYVA 3KLPX 3IT1A 1JAXA 3OE4A 3QKRB 3UJ8A 2YXBA 3COPA 2B61A 1CRZA 3UHAA 2CVPA 3RVKA 1JFFB 3PWKA 4K6KA 2W6ZA 1TE2A 2EL7A 3CG0A 3HMKA 4BFCA 1WF6A 2VJOA 4N0MA 3O84A 1JAZA 1WA5A 2QYOA 3F5DA 1BOOA 5CIQA 5BT9A 3OUUA 4TT3D 3LPAA 3H0CA 3DLBA 5H8WA 2ZUFA 2V4MA 1LFAA 1F2TB 5KUTA 3EIUA 2CZQA 1GV0A 1KAQA 1P4GA 1ZL2A 2FN3A 3HKEB 4K1LA 5AHOA 5T41A 1Q7RA 2QXYA 3INRA 2DY0A 3I5UA 4IM7A 1E4EA 3RC7A 1SHTX 2FJUA 3ITNA 3URKA 4QJ3A 3LXRA 3ESXA 4V2IA 1RT9A 1P1IA 4HH0A 3JV7A 1WIWA 3TIFA 4AIIA 5IHXA 4E22A 1T4BA 2ZJZA 3GXOA 3O3CA 4KXFB 1YK0A 2O48X 3G9UA 1KETA 2JW5A 1W8IA 2OYSA 1WAMA 1RWVA 2Q4BA 1GRRA 1WKVA 2QN6A 3OZTA 4YMWA 3JCZA 1H8ED 2J45A 4MB2A 3KPUA 4G84A 4IKEA 1N5OX 4G0XA 3L7NA 1ZJYA 1JQDA 2JBAB 3NEAA 4M4SA 3VJLA 1T34A 4NIMA 3ZXYA 4F6RA 4NU0A 4UQLA 2YVAA 4L95C 3FTQA 4GSKA 1KJZA 2ILTA 3WLSA 3HXKA 1V3VA 3NHBA 5JSUA 2O8CA 3VR4A 3FRHA 4UBIA 3GLIB 3RU7A 4K1XA 6REQB 3D1VA 2E5WA 1UIRA 2X1LA 1NR5A 1FX1A 3KLOA 4NESA 4NZPA 5BN5B 5M3BA 3VDMA 1M0EA 1JPVA 2PT9A 2VUTA 3IQFA 2QAGA 4I2NA 1HDGO 3V8RA 4D74A 4CQMA 3QJGA 5TRTA 4KBYA 3MWLA 1NNLA 5FA8A 1F4PA 3ASUA 2WWXA 3MM4A 4U3JB 1RJFA 2A3RA 1F14A 4OHBA 4RDHA 4GEGA 3JWJA 2OBNA 4OLJA 4PSCA 4WDRA 1TGYA 1V37A 3PL1A 1D09A 2CB0A 3AR2A 3F78A 2HT6A 4PPYA 2QTGA 2UKDA 2QRHA 4C30A 1JECA 1PAUA 3ZR4B 4A6PA 4B84A 5L6LB 3Q8MA 1EIZA 4BQOA 1QYVA 1W49A 1G21B 1MQ9A 4ZYLA 1ZHOA 2JZOA 1G8JA 1VRVA 2ZAMA 3UPDA 4C14A 2HPAA 2WF8A 3DFFA 1PEYA 1UC4B 3D9QX 1TTHA 2QT0A 2ZI6A 3GCGA 1FOEB 4YGYA 1JN0A 4KIJA 1IK6A 3F4KA 4YRIA 2ZRCA 3D1LA 4XPIB 3BX1A 4GVLA 1U5CA 2CHUA 2HU5A 2JB9A 3A6DA 4HCJA 4KIUA 4ENTA 1U8CB 1RLIA 2R7AA 4EPYA 3T1OA 2VAMA 1WSAA 5CBPA 3A4NA 3H9CA 1VM6A 4TGLA 3UVEA 5LQMA 5TV2A 1V45E 5HCIA 5CLHA 3VNAA 5L4LA 3EPRA 3JQAD 1HQKA 4KPGA 4MCAA 5KTRA 2BI7A 2EJBA 3NG1A 2BLNA 4BEJA 3UC9A 5K3OA 3TTYA 2C59A 3RF6A 3HQ4O 5ITZB 1ZMBA 2G82A 2W4IA 3H2IA 3RYFB 4JLUA 4BKMA 4ZIRB 1DCTA 4R1LA 3HWWA 3UJNA 1P1JA 4FJ1A 3A2MA 4WFIA 3IP3A 1MA3A 4AXBA 3GZNB 5EEHA 1TZMA 1N7JA 3C7DB 4RESA 4ZREA 1CJVC 2H3HA 2ODWA 4URHA 5JZVA 2FKNA 3LBIA 3L04A 3MRSA 1YCHA 2RGNA 4Q7LA 1EB8A 3R6LA 5ICMA 1PT7A 1QX3A 2ZAIA 5KOJB 3R41A 1UDXA 5FWNA 1PF7E 3TW8B 1XQVA 3DMDA 2WAAA 3ZHZA 3M1AA 4C4OA 5BP7A 1M2JA 2C2HA 2ID8A 2EFHB 3EF3A 2XD9A 3QUAA 1TMYA 3K9HA 5HDBB 3WGKA 4HT3B 2Q2NA 5I7FA 3WYBA 2LE0A 2VK1A 5AD1A 4D8XA 5K8TA 4DBZA 3FPGA 2N3ZA 1GL3A 2OBLA 3PFCA 4N0PA 1K86A 1XLUA 4MGKR 2VLBA 3QYPA 2VZ8A 1XP5A 1HLPA 2P4SA 2PFKA 3N0WA 4IH4A 2O3JA 2YYSA 3L4SO 5AXDA 4BU0A 3KP1A 3C87A 3E61A 3C6XA 4NZYA 3ZTWA 2XBLA 2YINC 3CVJA 3AVOA 1E2JA 2Y66A 4Z0NA 1VE9A 2NXNA 1NC1A 4YJ3A 2CV2A 1QG6A 3NVKI 3MT8A 4H1UA 5YASA 3LPMA 4P5EA 5AJWA 4JMLA 4B44A 2XDQA 1QYIA 3WOHA 3M6VA 1QG4A 4LC0A 4RA6B 2QPTA 3O75A 4O5OA 4PXAA 4X1YB 3GJYA 3NAQA 1TW3A 1Q84A 1RXEA 1WCYA 1E1QD 2F43A 4LRTB 4AKTA 2ZUTA 4J1TC 1LQ2A 4G25A 4DJFC 3NMUF 3DEIA 1RQGA 5DCUA 4TWRA 2QYSA 4GPD1 4JJGA 2BFCB 3UTCA 1XN1A 3FBTA 3Q3CA 1YZYA 5BUQA 5ABPA 5DB4A 4ZD6A 2RSLA 2NUPB 2X8LA 3R5KA 5GQSA 2CXXA 4O4LA 4XARA 2ATEA 1LZLA 5AKEA 1BQEA 1P5JA 3CBQA 2OAP1 2B5OA 4HK4A 1YWGO 1YVEI 1OA1A 5CT4A 2WPNA 1J56A 3HYTA 1VRCA 4GLLA 1IC6A 4MULA 3T5PA 1SRQA 4MKXA 3P1JA 2PD3A 5BN1A 3WLFA 5BW8A 2XB2A 2YMLA 1O0SA 3M4YA 2OQRA 1U2RA 4MP6A 1VL1A 1NN0A 2XSZD 4J1SA 3F2IA 4UNPA 4W6QA 1IBCA 4ZRDA 3EVCA 2CLIB 1QQ6A 1TKRA 2H6EA 4E5VA 1IQ0A 3GYGA 3BJIC 1Z29A 3PNBA 4RLHA 4HH3C 1P3Y1 4PSVA 1M33A 5TEWA 2ZRBA 5JXHA 1GTZA 1UBFA 3AF4A 3OOWA 4HOYA 1YRBA 1WY5A 4IGFA 1D0VA 3TVDA 4C2UA 4TS4A 2O8BB 1YQ9A 3C8MA 2ZWIA 2R85A 1VSQA 1WB4A 1Z5WA 2ZYSA 3ANYB 1G4AE 2C58A 3FYUC 2B37A 4BFTA 4G9BA 1T6XA 5EIBD 1GCIA 4GC9A 1VL0A 1DL5A 1JB1A 1G9TA 1DKMA 1SZJG 4NICA 4ZTZB 4KRFA 4JU8A 1QZUA 1S3SA 3ELDA 4LDNA 5FWYB 4DSZA 3RG2A 3AJAA 3KB8A 1GYRA 1VIMA 5KYXA 4DJDC 1RBMA 2J4DA 5EXPA 2QW8A 5HA5A 5A3JA 3LKZA 4RKFA 3KLNA 3WV5A 4C0LA 2Z1DA 2P65A 1EEXB 1LF5A 3E82A 2RGRA 2RGDA 5AOBA 5SYMA 4UVHA 1PJBA 3T3OA 4Y2YA 5FRDA 4PN3A 2CXNA 1LPAB 4MJ7A 1AUPA 3K0HA 4CEIB 3A26A 4AWXA 1DBPA 2IHVA 3GRYA 3O91A 4MS3B 3VX3A 5BYAA 2HU7A 4YRMA 8OHMA 2CNWA 2VJLA 3H17A 2CEAA 3D8SA 1S96A 4YAOA 1SD2A 2BGJA 4RPHA 3DXYA 4HNAA 1IHOA 3DT9A 3DZCA 3G8AA 2BZ0A 5LQKA 1NYTA 3EGVA 4F84A 4AWAA 3C16C 3KSDO 1FLVA 2XAUA 3PGKA 2N1BA 3ZXSA 5JFGA 1LK0A 2H4FA 2Y1KA 4GIBA 4B7ZA 3EGEA 3PITA 1C0EA 1KVSA 2FCAA 3CNHA 3PUKA 4O25A 4YRDA 1RYFA 3TVYA 1SUIA 2B1RA 2P68A 5AICA 5IRCD 4GMFA 3DO5A 4IS2A 1R5BA 4DLBA 4US2R 2JFWA 2JIMA 4QOFA 2G5TA 1NV9A 1GU7A 1GSAA 1QYCA 3EUFA 4B6RA 4BE7B 4I3GA 1K75A 3LSTA 4MYSA 4RY0A 1XDZA 1RPNA 4M36A 4EG4A 1L9KA 1RJDA 3KKEA 5I45A 2GDZA 4HB3A 4TVSA 1GPLA 1AC5A 5JLJA 3FDFA 2BFNA 2QRJA 1B8UA 4BL5A 3ZZ1A 4BV8A 1V7CA 5GONF 3ORSA 3EGDB 1ZRNA 3OI7A 4PBTA 5EPUA 5KU1A 3WP1B 3MINB 4RKEA 5JI3E 3TECE 2B2NA 4OK3A 5F7JA 1FVOA 3ABZA 3LP5A 4OU5A 3STWA 5E8RA 4E08A 3ED5A 5IJ9B 1I2DA 2CSUA 5I5EA 3K70C 2QSJA 4EM6A 3NM5A 4L07A 3AF3A 1L7QA 3OF2A 4FWBA 4P36A 4PO8A 3U7QA 5ALPA 3FXAA 4D5GA 4WK6A 4ASUD 2JZNA 3ZE2B 1BVRA 3DNFA 3S2UA 2YRXA 1MPXA 4XWYA 2W6CX 4I9HA 1WVGA 3NB0A 4WESB 2ET6A 3ZU4A 5K8VA 4IJ6A 3FUXA 3HCNA 2AD1A 1SUWA 4EHHA 3CGGA 1HL7A 2XX3A 1A9TA 1SFRA 2NVWA 2P62A 5LQDA 3W9BA 2B83A 4MDFA 3N0VA 2ZBGA 1Z07A 4NARA 5L6MB 3R5JA 4R7ZA 4P3XA 2QTWB 4HAWA 1XJ5A 4U8GA 5KAMA 4Q3DA 2GF2A 4TKMA 2ROQA 3D4NA 2FZ4A 4CG3A 4IX1A 2C98A 2HNAA 1N77A 4ZEVA 3HV0A 4O4JA 3TLMA 2MTBA 2UDPA 1YVRA 4B8WA 4DLSA 3FPJA 1U0TA 3CLVA 4ZGWA 5JR3A 1JYFA 1RC1A 2ORWA 3BRSA 1D5CA 1UT5A 4MQUA 2VAXA 1D2RA 1UAGA 4FDVA 3RYHA 4WJLA 3OE7A 2QUBA 1CR6A 2AB0A 3LBYA 5CIWA 3VPGA 4E2WA 4E33A 1U28A 5ES4B 1WO8A 2BMWA 3R23A 2P3OA 1YDHA 4TTVA 5F1OA 2ZBPA 4PRLA 5KJCA 4N3NA 4D57A 1S1CA 2BFDA 2R00A 4MH0R 4Q3LA 2ZRFA 1AO0A 1UPCA 1MABB 3I6IA 4FYHA 5DI3B 4CKWA 4MR8B 4MV9A 1DCMA 1SBYA 2JK1A 5F7XA 4EG3A 4JC4A 2PSDA 2F67A 2HUPA 2E4ZA 3GA5A 4NZNA 4U7GA 2QTFA 5FPYA 2PRYA 3WYCA 2ALJA 2ATXA 4OQPA 1AHHA 4WKOA 3I5MA 2NPFA 4UU0A 2JL1A 3UJAA 1COZA 3F4LA 4LE2A 1CIPA 3EWIA 4G5YA 3PJRA 5K2OA 1YZLA 4EJMA 1NVVQ 3VR6A 3GU3A 5JISA 1K6MA 3ROXA 2O4CA 3A70A 1HYEA 1W30A 1TCVA 2CUTA 2WSIA 3JWHA 2QLLA 3PC8A 3LFHA 4F60A 3GWGA 2I03A 4CM9A 1ZIOA 4QFMA 3B7WA 2X2FA 4QTTB 4MWGA 4J43A 3OBBA 1P44A 1IHDA 2XF2A 4OAQA 2V65A 3RR2A 4ZPXA 4LF6B 3JAKB 7GPBA 3MRXA 1YOVB 3ZVLA 1LX6A 2JHPA 2VPPA 1P39A 2Y0EA 4GR5A 4I99A 3W5SA 4BO9A 5FPKA 4P31A 5CLGA 4GLFA 4PLPA 2JDIA 4B40A 4B3MB 2YZ2A 3A1UA 4LXIA 4PVCA 1YF3A 4DV2B 3CH7A 4WJZA 1LPOA 4OYLA 4IFTA 4LSMA 2ISCA 1DBRA 1N2IA 2ZYHA 1U0RA 1UJ2A 3HZOA 5TSDA 4C5BA 1WLYA 3WB1A 4H4CA 2BBSA 3NIBA 1WX1A 3DZFA 3WHLA 4YHHB 1IQRA 4ALJA 4Q9JA 2CLHB 3X1WA 2Q7XA 3C1AA 2CDCA 3MZ0A 1KVTA 2XUOA 2E89A 2ZRPA 3OX2A 3ZWYA 1XL0A 4DSAA 5IFKA 1F3LA 1OXVA 4H7FA 4IOMA 5ESRA 5EJ9A 3EXIA 4Y2RA 1TZJA 3F6RA 1YB6A 2BKXA 5BYBA 4H18A 4XRGA 1SB9A 1RM3A 1AKVA 1P4HA 5IF3A 2P1RA 3DTVD 3TI9A 1PHPA 4JENA 1F2UA 2FSVA 1T8WA 2HKIA 2PGIA 4DMUB 4DVGA 4Y18A 3T1YB 3PLRA 1QG0A 1AKEA 1L6IA 1OLSA 3EE6A 2QG9A 5SYNA 3HCEA 1OZHA 3NAZA 1Q57A 4PZUA 2ADMA 2FOLA 1OGJA 5FOWA 5FWXB 2F3RA 3ON5A 4R1NA 3PNYA 2IYPA 1Y80A 3HY3A 1O96A 1WDWB 3C39A 4RZUA 2O50A 4IO1A 1W76A 2BP7B 4MWBA 1TJYA 1LLQA 3GL9A 3HEBA 3PNVA 1TM1E 4FYYA 2Z98A 4KZPA 1K0FA 1MJNA 4TKUB 1GCUA 4UEKA 4ALLA 1RYYA 5EOVA 4IY1A 3GJRA 3A4MA 1NXWA 3B1WA 5EZ5A 5DTQA 3EQ8A 4DRXB 3G89A 4BNIA 4N47A 3AUSA 3BERA 3UWSA 3FUVA 3HN7A 1E3TA 4WW0A 2RJNA 4G5HA 1ND5A 4BE4A 2Z8YA 4GX1A 3JQBA 4JUFA 1YU6A 2I7VA 3FDZB 2IYFA 4OX9Y 2L0XA 1PW5A 3LGSA 4F2HA 3HI6A 3GDGA 1QO9A 3A8TA 2BFMA 1SOVA 2OLJA 2PLRA 1PNVA 3KPVA 2QLJA 1ORTA 5HOEA 2RH4A 4YP9A 3VO2A 4CR7A 1ZICA 1G16A 1KAOA 1W4ZA 2F1KA 2Q3CA 4J3FA 2PRIA 3LUGA 4N3GA 4YIHA 2JCYA 2BEWA 1PVVA 4RMJA 5JNTA 4X41A 1XVLA 2INGX 5AVTA 1ATIA 4UNIA 5GM1A 3BQMB 2BSQA 3SHOA 5M04A 3QOWA 2XCOA 3LOQA 3QI7A 5NLLA 1Z63A 2HWUA 1XCPA 3AIIA 4CKBA 2FP3A 2R5FA 4A1FA 4GP6A 4E7OA 1CJTC 3K1ZA 5BWLA 2I0FA 3L43A 1GDDA 3R0JA 3TSOA 4QTYA 2P5YA 5KVVA 3A9UA 1F6DA 1OWOA 3VKVA 3K2EA 3KKPA 4WECA 3BRWA 1PZFA 1ABFA 2ETVA 1QQ5A 4KR2A 2CL5A 1G8MA 3KQWA 1XVIA 2JI7A 2NO5A 1MB9A 2VDUE 5KQLA 1XTIA 3I6BA 3D3EA 4ADSG 1J4AA 1F9AA 1PVDA 1EM8B 1ZUNB 4ZOLF 1JEQB 1VOTA 1C7FA 3A36A 1VI2A 1SG6A 1Z7EA 3HEAA 1RE1A 1A8PA 4BZZA 1GT91 1C1HA 1DHRA 2HF7A 3VR2D 2R87A 5BSTA 4X65B 4BNJA 3IUYA 4YY3B 1R1DA 1DRVA 1HDEA 2QG6A 1MP0A 3T7AA 5CFMA 1KQGA 1M6YA 4G67A 5DV9A 3P2EA 3SLKA 3W5JA 1KY3A 1OB5A 3HL4A 4ETIA 1JYEA 1ZGJA 1EDEA 3SYRA 1QVZA 2FGJA 2I5PO 5FO1A 1V8FA 3BK7A 3KPJA 4DJ5X 1ADBA 2XV1A 4YJHA 5FL7D 2XDAA 4UVDA 2H4JA 2QIPA 1NNI1 1JIQA 4I19A 1H4VB 1G8SA 2RMKA 3ETGA 1AF7A 3CF4A 5HF6A 3TUZC 1C0PA 1AKRA 3FUWA 4YJDA 4AJ9A 1KSHA 3KZMA 4PF1A 1NQWA 2X8AA 5HBGA 4YHBA 3O26A 3SSNA 2B3DA 5JD5A 5IKXA 3U6KA 1PKXA 2YZGA 2D7DA 2GZ2A 3VU3A 4YLGA 3IRVA 2GF0A 3MCVA 1GQQA 2GK7A 2DUJA 2O4UX 1W9MA 4HB0A 4RUKA 1LPNA 1SIOA 1P33A 3H42B 1RZRA 3LKDA 3IEVA 4UCQA 4LZJA 5JNRA 4O6VA 4D8YA 3J81A 2CV1A 1SXHA 2JHGA 2ZTMA 1BFUA 3FYHA 2BHNA 3NQ41 4GWKA 2QI9C 1FP7A 3A6EA 4Q9AA 5EXSA 3ND6A 4DDHA 5B12A 1P60A 3CR3C 4LRWA 1OTXA 2O6HA 3K05A 3LBAA 3PC2A 2Q5OA 1YR6A 3PE3A 4M8KA 5HF5A 1QR2A 4OGLA 1TPZA 3CH4B 4CM4B 3BDIA 1OF1A 1XKTA 1OYYA 2ECKA 2FVXA 5AJYA 3OTOB 3MAGA 3SX2A 4BGUA 2P2ZA 3KWFA 1KDTA 4RGBA 4Y2XA 3RUDA 4MGEA 4RTPA 3QKSB 1U2ZA 4YROA 3T0IA 3UOGA 3SR4A 3WL4A 5BWCA 3GUUA 5JTTA 1UQTA 2FZLA 5CNMA 1ZHFA 1M6WA 1SCAA 4MUAA 3G2NA 3WIUA 5LA6B 1O94A 3PGLA 2I8LA 1B8NA 2GAFA 3DAFA 3UAXA 4DDTA 4PZEA 4XB1A 4BDSA 4FYWA 2OZKA 3H5VA 5DP2A 3CONA 1K6IA 1O6ZA 1ICEA 2PNFA 1NBIA 2ZPUA 4TM7A 3S4YA 3EPPA 1M2HA 4JR0A 2CJYA 1H69A 5AH0A 2KJQA 2B92A 3S55A 3ZTTA 5I51A 3DHYA 1KYZA 2EVWX 2JI6A 1BGWA 1CF9A 1LTKA 2NVUA 1WCIA 3CGWA 3ONVA 1T0PA 3NTUA 1AZLA 3O38A 4RK4A 5CLFA 3SQWA 1B0ZA 2PX8A 4JI6B 1OXUA 1TQ8A 1ZAKA 3BQNB 1E6MA 3FW1A 1XZAA 2H52A 3HCFA 1N5IA 3WB0A 1XMXA 3PT9A 3UQZA 4NMHA 3EQ6A 3E8MA 5B2FA 1N57A 2OHGA 4UMFA 5REQA 1TECE 4CHGA 3K09C 5JJCA 5DCLA 2G36A 2R1TB 1LPSA 4D9GA 1W0JA 1NRXA 5F2EA 4JP8A 4MVCA 2EIXA 2R79A 4DADA 2CCGA 5C5DA 3KJIA 1LBQA 2SCUB 4P58A 2GHRA 2JFGA 1L3CA 2H3EA 1DJNA 2F9FA 1SC1A 4RVNA 1U3TA 4RHTA 1SG0A 2WU0A 2ZEJA 2FMHA 5LQUA 1Z08A 3UV3A 1U1CA 2E4UA 3R77A 1ZJ5A 5DLDA 4KKVA 2V8BA 4GL2A 3NOXA 4ZEMA 5CFLA 3GNLA 4NS1A 3RFFA 2GN4A 4N7RA 3U81A 2OXTA 3UH0A 3V8QA 1E5TA 3VOAA 3CZPA 1CB7A 2D2VA 1IY0A 4E09A 5EC8A 2JF0A 3TAUA 1X3SA 2VYQA 2BJHA 1A7KA 4MAMA 1YXMA 4IJWA 3LYLA 4JKOA 3PI7A 5T6MA 1Q77A 4AP9A 3IVXA 2Q9CA 1EVIA 1ND6A 2XEXA 3KLMX 2J0SA 2A94A 1CNFA 2R1UA 3EDMA 2BT4A 4IDCA 4BMCA 3B82A 4WA7A 3QYAA 5KYWB 2JLVA 1CUDA 1NOJA 1Z7YA 3HADA 4E1VA 3JAMA 4FD3A 2O2HA 2AW3A 3PVSA 2C20A 4ZI7A 3U4MA 1YQDA 1UKEA 5CDFA 2CSXA 4FEAA 4AZ3A 3HSKA 3FCAA 3DOOA 4FFBA 2C7VA 3OO1A 4DWWA 2GWHA 1L8OA 1T8RA 5GV7A 2OCDA 1PCXA 2Z5GA 3OFSA 3ENZA 1KYYA 1YD7A 1BS1A 5EXTA 3WAJA 2ZB2A 4PPQA 2RB5A 1Z0ZA 3R0VA 4JR2A 1WOMA 3OG9A 4RLFA 1DC8A 1GDHA 4C0QC 4CIYA 3LIIA 4OB7A 4WCFB 4RACA 1AA6A 4B46A 1OFTA 5I4IA 1M2OA 1VYHA 2NSYA 9ATCA 2BTQA 4ZZ3A 1AZSC 1C7EA 1TU4A 3LZDA 4WHMA 3C3MA 1UK9A 2P67A 5HILA 1B43A 4BVLA 1Z5PA 4FSDA 1IN8A 1AQYA 2QORA 1EP9A 3A3PA 3GAAA 3QG5A 4QPDA 4OKIA 4E31A 1L7PA 4UAGA 2SKDA 1R18A 2M6SA 2CLCX 3SBXA 1ZH4A 3E27A 4X8LA 5CVEA 5GV8A 5ALFA 2GGSA 1KAHA 1FMFA 3GP5A 5JZSA 2J5RA 1N7HA 2E21A 2OP1A 4NJOA 4OV6B 3U37A 3QFCA 1ES9A 3ZE0B 2DPYA 4BVGA 2CFOA 1T3SA 1C8LA 2HK8A 3SWWA 4K6MA 3TDKA 1T2AA 3UW1A 2XKAA 2JAXA 5LFAA 2PMKA 2XF8A 2ZYIA 5AKXA 4ONEA 1JHZA 4F9FA 4M9ZA 1VYVA 3G7NA 4Q9NA 5K0TA 2OVBA 1J25A 3DJYA 2VNSA 1AK1A 4L0DA 4V03A 2WJ3A 1JJFA 5CH5A 4WLUA 2UVPA 1F51E 1R0KA 3W5BA 1N2GA 4WNYA 4XGQA 5ITWA 1V2HE 2VOJA 2J08A 3E7WA 4PQGA 4TTPA 5KYUB 2IVZA 3ECAA 4MVJE 5EIOA 2FW7A 3B2QA 2QN9A 3F6SA 2O3SA 3G5UA 3QPDA 4UUMA 4WADA 3UMCA 3BKWA 2PQ0A 2B4YA 1T5BA 1FEZA 2CC2A 2Z56A 3RLFA 5ALZA 1C0LA 5CRIA 3CLSD 1N9GB 5HE8A 5HIJA 1TUGA 4LMBA 5GONA 4A3SA 5HMMA 1U90A 2BKEA 3CWQA 3NHLA 4LI0A 4EDHA 3OAAA 4XH9B 1ZK2A 1Y1RA 2JVJA 4KFUA 4CCYA 2D0PB 1QYRA 3F6BX 4HTAA 1QU2A 3TLGA 4XLTA 3RGGA 4EI7A 3EDRA 2PGLA 2PYZA 2QX9A 3FJYA 4EI2A 1MX9A 2GN2A 1XQ9A 5ALIA 3Q9SA 5L7YA 3O4FA 3F1KA 4A6DA 1FDIA 1X7DA 2AH5A 4O4IF 4RMNA 1R0ZA 1KBQA 4HEA6 1WU8A 3ES9A 4ZV7A 2J3IA 1ZH2A 2WA2A 1M2WA 5LQAA 1G5HA 1VGQA 2DBQA 5FA6A 4CFSA 2XQVA 5BVGA 5CDUA 2FZ5A 2IPMA 3A10A 2P6MA 3MUNA 3OCWA 5AW6A 1EFDN 3QSGA 2NP7A 4OJMX 1T3TA 1V43A 3DULA 5KYKA 2G40A 2BGIA 3R6WA 3EMVA 4EENA 4F4FA 3GMDA 4JT4A 4JYBA 3SE0A 1AX9A 4XJSA 3WWCA 5BR7A 1OTYA 3CVYA 3ZGZA 4NNJA 1R16A 1CK4A 1GG2A 2VDMB 4RK7A 5HK9A 3MAJA 5ALRA 4CMIB 2V1XA 4KK4A 3YASA 4FHFA 1YZNA 3PC4A 3WI7A 4RV5A 1A27A 1OLXA 1U8FO 1J2EA 3FJ1A 4DDVA 1LVGA 4RZSA 3ZJUA 4ZO4A 3RJMA 1KQFA 1DLIA 3U5TA 2J0VA 2IGBA 1O5IA 3GUHA 1XAHA 1M2NA 4OIMA 3DL0A 5LZ5A 3T3IA 4EG1A 4KXUA 4IFBA 1NFQA 4DSTA 4UVEA 1T1SA 1HE5A 2ZVPX 1T3HA 1NUSA 1CUGA 2OXCA 3RROA 3OLZA 2FN8A 1PJRA 3MJRA 5J1SB 4CIXA 3GLFB 1DJPA 1I1OA 1Q0ZA 3IEIA 2NYRA 5CMLA 1W0JD 2XUIA 4R16A 2ZDGA 5C5CA 2ZZMA 2QROA 1BEZA 1K27A 3V33A 4ALKA 3GRVA 3ZGVA 2BSAA 3ZOKA 4QEKA 3ZHRA 3E9NA 2RHWA 1CNEA 1JHUA 3LWZA 2W37A 4MWSA 4QOIA 5AOAA 1CJUC 4C3OB 1I7PA 3DEJA 1ELOA 5CB8A 2AR7A 4I66A 3WMFA 1JA9A 3ZCRA 1EXDA 5T4HA 5EJEA 5EUBA 2AWNA 4B2PA 3DV2A 4OXYA 1X1DA 2E55A 2C8LA 1FYXA 4A2PA 2ZSEA 2HW8A 3K53A 4UC0A 1ABEA 2A86A 2IXBA 3IYLW 1XMIA 1VIYA 4LW8A 4YLEA