3OOWA

Octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from francisella tularensis subsp. tularensis schu s4.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
SVQVGVIMGSKSDWSTMKECCDILDNLGIGYECEVVSAHRTPDKMFDYAETAKERGLKVIIAGAGGAAHLPGMVAAKTTLPVLGVPVKSSTLNGQDSLLSIVQMPAGIPVATFAIGMAGAKNAALFAASILQHTDINIAKALAEFRAEQTRFVLENPDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase,catalytic subunit
publication title Octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from Francisella tularensis subsp. tularensis SCHU S4.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 3oowA00
2H31A 2FW9A 4GRDA 3TRHA 5CLIA 3LP6A 2FW7A 1U11A 5CLHA 5CTJA 4ZJYA 4AY4A 2ATEA 4YCBA 3RGGA 4YCCA 3OPQA 2FWAA 4ZMBA 3OOWA 5CLGA 5BOSA 5C5DA 1O4VA 2NSHA 2FW8A 2NSJA 2FWIA 5BORA 1XMPA 2FWJA 2FW6A 2FW1A 4ZK2A 5CLJA 2FWBA 3ORSA 3KUUA 2NSLA 4YCJA 3RG8A 4B4KA 5CLFA 5CVTA 2FWPA 1D7AA 4Z7JA 2YWXA 1QCZA 4AY3A 4JA0A 5BOSB 4ZC8A 4YCDA
chains in the Genus database with same CATH superfamily
4E5NA 3IEKA 1ID1A 2XUKA 3RSOA 5LYJF 4U8GA 5ILQA 4DNOA 2CE7A 1N6RA 4QIHA 4UC0A 1Z7EA 3HSYA 2HRBA 1J7JA 3O4VA 4Q66C 2OHOA 4QG7A 5TMBA 3FNHA 4D4KA 2QRLA 5L7TA 3ADCA 1IQRA 4Q4HB 4LY9A 2X8LA 2RAUA 5BNIA 4Z9YA 4UQOA 4ESEA 1EP1B 3DAGA 5LMZA 3KZ1E 3QE9Y 5EXSA 5MDHA 3H11B 2W4QA 4BIIA 2IT1A 3U16A 4BUJA 3LPCA 5ICFA 3IOYA 3AIKA 4U2KA 3TTWA 3E1GA 3HYNA 4ZN6A 4BLOA 2REQB 1FNNA 3IQDB 1FQKA 2JVIA 3NS7A 3ZV3A 1WDLA 2JKVA 4XSGA 1VYHA 4CQJA 2EERA 4L85A 2DH6A 4V02A 5CFZA 3UBMA 5SY4A 4HDRB 2PRJA 4EGSA 3KQMA 3IEIA 4PYJA 2FF5A 3IP8A 3R5FA 2C0CA 4YROA 3L93A 4OCZA 3UJHA 3PGLA 1SELA 1XN4A 3KB6A 1GQYA 1IEWA 4HDNB 1XAHA 5AK3A 4HB0A 5CLGA 2GGSA 4EW2A 1AUQA 4G0MA 1GFZA 2LGJA 3OP4A 5AR1A 2RGDA 1DJPA 2W4IA 4A0QA 1JPJA 4ZOCA 1IXYA 2WYHA 5A03A 3G79A 1XMOB 2XTMA 3OLZA 3NV9A 2Q6KA 4BPRA 2VUIB 3JCZA 1G9TA 3FBGA 1YOBA 3RVDA 2P79A 3I9MA 1JFRA 4CIVA 3HKDA 1L5MA 4YUWA 5I9LA 2EQAA 2GN0A 2Y0BA 3NQ41 4OP2A 4QOGA 1QDEA 4M98A 1K9SA 3UK1A 3NTQA 1EUQA 5CCEA 1A9XA 4CV0A 2D4HA 3N76A 3R5HA 5JBIA 1A72A 2X19A 3DXZA 5H4GA 5K3BA 1ZU5A 3AQIA 1M2NA 4INZA 1ZM9A 4LRSB 1N92A 1U8YA 4YRPA 3MPOA 5TQJA 1NM5A 5E1BA 4QQKA 4DJDC 2O8DB 3BTSA 2P9TA 1U3GA 2MIIA 3BJMA 3Q2OA 3WLKX 1BIFA 1UPXA 3WLQA 3K5IA 4Q24A 1R64A 1Y1RA 1IN6A 5ERXA 2ZJYA 1W34A 1LTHR 3O8LA 4ZDIA 2YZGA 4D3ZA 3PEVA 1M34B 4TQ9A 1QKIA 1YQTA 3AFGA 3R4CA 1Z4IA 4TUYB 1SVNA 3PJDA 4E14A 1ZNQO 4KQMA 3YASA 3E0XA 3VSEA 3MFQA 2JANA 4FHZA 5KBYA 5F1KA 1SIUA 3ZGOA 4BVBA 1NG1A 2VPZA 1OH6A 1SBZA 3DA8A 3WB0A 2H07A 2Y6VA 4KWHA 3C6YA 2PMFA 4X45A 3EB9A 3LSYA 5L51A 3GLIE 2IELA 4BAZA 5IULC 5KVAA 1MH1A 2QD1A 3K8OE 1UDCA 3K6KA 1QC5A 1NSYA 1YUMA 1U6JA 1PLKA 3AT1A 3DO8A 4LNAA 1C30B 1HZZA 3LCRA 3VR5D 4AMUA 3TE6A 1JNYA 5A4AA 1BEEA 2Z8YM 3F6EX 2YKGA 1A7UA 1UANA 3B1VA 4HMOA 3DCNA 3JV7A 1NUHA 1U1IA 1P4JA 1AQ6A 4H1UA 4EHLA 4B6RA 5H0IA 1FFEA 1NJ2A 4KX3A 1QANA 2BEWA 2VNAA 4YV2A 1E2QA 1SB9A 1DO0A 4U2GA 3RTBA 4HD8A 4O1IA 3RTEA 1E6CA 4CFSA 1TI7A 4J4BA 5IMBA 1E5LA 1E8MA 2J9RA 3P4UA 4JP5A 5BV1A 3NO4A 4FEGA 1ZAYA 4IIBA 3HNOA 5IZCC 2DUJA 3AR3A 1IN4A 2SECE 2DSTA 2AYYA 4UM8B 5CFNA 1WD5A 2WAOA 3HXTA 1FTNA 4BKRA 1NDUA 1E9FA 4RY2A 1OXXK 4F72A 3OLVA 4U9UA 4WGFA 2NSDA 3VMMA 5LQRA 3MG9A 1TQ8A 1SHKA 1DTSA 4C4AA 1Z68A 2PMCA 4JMLA 4F6LA 4UHDA 1PGQA 3ZHTA 4ZCTA 3N1UA 4OKSA 3AFHA 3FZQA 1KARA 4GOOD 5AJXA 4NC9A 3IDAA 4FFPA 3AU8A 5HIIA 5TF0A 2ZJ3A 1A04A 2IXFA 5KNCD 3DG9A 4UUPA 2OV2A 3MWKA 3FWHA 4XJVA 2GM5A 1EIWA 3JW8A 2BKVA 4QJIA 3N05A 1YIAA 4BLTA 3M6FA 4UCWA 4ZTBA 5DN6D 3K6SB 1IG0A 1BRMA 1X8JA 3QKUA 2Q2NA 3PXGA 3B3FA 2NZXA 4I9UA 4PGFA 3GNLA 3M4XA 4TXNA 1C9YA 3ND6A 4G4JA 3NDPA 4CMIB 1HQKA 3H4TA 5DOVA 3Q85A 4RCVA 4QGHA 4CGZA 1I6LA 4P8RA 1O89A 1AKMA 3VU0A 2NYRA 1JMVA 2RK6A 5J5CA 5G1OA 1R15A 1JT9A 4YPOA 2X1LA 3VZQA 3D6NB 3FLEA 4JIMA 4AIIA 3Q6NA 4MS1A 4FMCB 4B7CA 1SVLA 2BKUA 2W2KB 2ZAMA 4P2BA 1OIXA 1U31A 3H8JA 4TXMA 4U7GA 4YFYA 4D9JA 1OYOA 2AXNA 5CM8B 3TLZA 4QTXA 2GPNA 1GA4A 2AOTA 1H3EA 3LY8A 2I8LA 1PKEA 1FNMA 2FFHA 4PAGA 5LB2A 3ZUPA 1VYVA 4DWWA 3LDUA 1N2XA 1LV8A 4IJVA 3KUCA 5AK0A 4XYLA 1X7GA 3KQLA 2F62A 2ZT6A 1OZ0A 1Y37A 2RHGB 4HWKA 3QPWA 1D2NA 2V7VA 3RQSA 1R9JA 4DV6B 3A11A 1O2DA 4M7WA 3KZXA 1VB5A 2AS0A 2H08A 2IE0A 4ESHA 1U4NA 4J91A 4KR9A 1IOWA 3GLGE 5HOEA 1NPTO 2O0LA 1J22A 4Z9FA 3HHEA 1GTVA 4AJNA 4PNZA 4JASB 1G7RA 1VSVA 4HX9A 1NQWA 3UWSA 1V8OA 4NH4A 3ZIDA 3O8OA 2GZMA 3N2IA 1JHZA 5EIOA 1RYZA 3SX2A 1W94A 1D1QA 1EFDN 2XGOA 1VRVA 4HPXB 4MQ6A 3ENQA 3IHWA 1F2VA 2BHLA 1US8A 3MIZA 3Q3HA 1BQ3A 4HAIA 3ELBA 3P9QA 4TWZA 3UOAB 2PEZA 3ESRA 3WWCA 3FTQA 2AD5A 1W9MA 3JVEA 4F04A 5BYJA 4DARA 3KJIA 3CH6A 4BO1A 4TZ0A 221PA 1T8UA 3A9UA 5C5DA 1A0OA 2VDMB 4B82A 2UDPA 2H9YA 5CIYA 1VJCA 3C3WA 5A0FA 3ZJYA 3Q8KA 3UXMA 3UK7A 1BJRE 3AM4A 3SK0A 2Z5GA 4INOA 1JHXA 4MV7A 5KNLA 1G3QA 2CDAA 4K2AA 3W3AH 1PT6A 1WUHS 1QIKA 4P4TA 1CD5A 4KHPB 4AURA 2EFDB 1GUBA 2P5TB 4YH1A 3W1EA 4D9NA 5I7SA 4XD7A 2ONJA 2W2VA 1KK3A 2V7GA 4I9NA 3DLHA 1GRVA 3HEBA 3J7AC 4D98A 1GU1A 5TQ0B 2JIRA 4V0NA 3HBAA 5D3KA 5DWVA 1QRSA 4L2IB 5IK2A 4MV3A 2M6RA 3MWDB 1KRWA 1CUIA 1ZVJA 2JAXA 2L82A 4NABA 3MXTA 5B37A 3RAGA 5CBKA 2LKCA 2V4ZA 4D3FA 1SC3A 2FPUA 3VJKA 3ZXYA 2BJWA 4RVOA 4ERNA 3W4JA 1QHGA 1MVOA 4RPHA 4A6DA 4RD6A 1IXZA 3EF3A 4OP1A 2G8NA 1YC5A 2VJPA 2XCOA 3FKSA 2DR0A 3JS5A 4NPAA 4AO6A 1AQJA 2VP5A 1Y98A 4M53A 4LGYA 4BQOA 5TQVA 1SU7A 2K87A 3MTQA 1NNI1 2R97A 3L7CA 5JAZA 3AY0A 1GLNA 4C4OA 3LA8A 2XT0A 2EKPA 2ZTHA 1KZYC 3RTCA 3WQSB 2C8JA 1T4CA 4DBZA 1DJMA 1G1MA 5BN3B 5HCIA 1C4WA 1P19A 1JVBA 1XDDA 3LK6A 4HNRA 1ANKA 4TYQA 4WOPA 2OD9A 4CV2A 3O2SB 3CVXA 3W4KA 3TWOA 3CVUA 2XQIA 1JG3A 1YTLA 4QEKA 1RAHA 1WCWA 2IEZA 4R5MA 4CM9D 1PR4A 3PEFA 3FWNA 3MJVA 4CU2A 1QONA 1R8QA 1SUBA 3MRTA 1XB2A 3ME5A 2CL0X 3V1YA 4EKEA 1Z4PX 2C9CA 4Q9IA 3NWEA 2JGRA 1V5FA 3KKNA 1XHFA 2I99A 3LZCA 5K0ZA 3I73A 4C01A 2FG6C 2Y68A 1TYEB 1OZFA 4GVPA 2X40A 3E05A 3W05A 4C5BA 4HNVA 2HC9A 3QEMB 1O5IA 1ZP6A 4H7JA 2ZYWX 4ND4A 4OUDB 4U9HS 3T1NA 4Q3LA 4RVDA 1H85A 3T9FA 2FEAA 3W8RA 2PZKA 3UCXA 3WWDA 2EBUA 4KITB 5JVDA 1T8WA 1BXRA 3AQ4A 4QWWA 1M1UA 3EF0A 4G5FA 2ANBA 1YKFA 2VUTA 1LBHA 2D5IA 4RLSA 4XDZA 4GM4A 4H4DA 4DOMA 2DSNA 1OT5A 2PS0A 3FYHA 3KSUA 4I5FA 3Q7PA 4Q1EA 5CW2A 4B80A 2R8XA 3VSCA 9MHTA 1KO4A 4DZTA 2AMJA 1HUQA 4FVTA 1CY7A 3BWDD 4ZT2A 3RRNA 3PNBA 3IVCA 2OPBA 1V1JA 3H6HA 4TT8A 3VGPA 4FGJA 4OJKA 1NQOA 1BEUB 1KDTA 4J16C 2OPHA 2QEQA 8ABPA 4U02A 1MBZA 4OXRA 4IDOA 3RIEA 2KBFA 3KDAA 3PTZA 4TV8A 4GW3A 5JSYA 1GA6A 4YFVA 3GN2A 3WIDA 3IP5A 3K70D 3QNMA 4GM1A 3MLBA 5BV8A 1KFBB 1VBMA 3G5TA 3OSZA 1QGYA 1LC3A 3L7OA 4ENPA 2NYVA 4XVRA 3IL2A 4L22A 4I9GA 4XJTA 5DYYA 1ZK1A 1UJCA 4CMHA 4I1PA 2F8MA 2DERA 4M0KA 3C5HA 2FV8A 5B1DA 1KJYA 3OSUA 4KR0A 2GKOA 1MIOA 3KSZO 4LCBA 5KJ6A 4KLNA 1LKZA 5KC9A 1TMOA 2GMWA 3UB3A 3I2YX 4DXHA 3DE4X 3E84A 3O83A 3AB8A 2A9JA 1T1EA 3H1GA 1Q50A 3TTVA 4QTYA 4ZHSA 1AQUA 4X3CA 2BH9A 4IMIB 1TM3E 1WE2A 2DPHA 1U2EA 1SU4A 4KQ6A 4LY3A 4OHMA 4BKOA 4OHVA 4PHFA 5LNK6 3AFIA 2BR3A 5KNDA 3DYBA 1KVSA 1K5PA 3N3BC 4I4LA 3HEMA 1MH9A 4QXOA 2Q7DA 5DI9A 1ORVA 1QG2A 3OZ7A 2WEKA 5FFNA 4GNRA 1FMLA 1XDWA 3H5WA 4KXUA 1IM2A 2XNHA 3EYWA 2GAFA 2Q3EA 1W36B 3QW4B 1NOJA 1O4WA 3REFA 1TUIA 1PSDA 4X20B 2FN9A 5T64A 3GLHB 2R6HA 2Z6QA 5EHQA 2D8AA 2YYYA 5FL7A 3OQVA 3LT0A 3WMWA 4ZK2A 5IJZA 5HX7A 5BVGA 5K0SA 2WNIA 2ZYTX 4O4JF 2CLSA 3W1VA 3PX7A 3TPFA 1N32B 3FSGA 2WD9A 2BSAA 4XLZA 5ALUA 3DMGA 1AGXA 4R4JA 4AZVA 1GNLA 1E3IA 4M1WA 4MKRA 3PRHA 4URYR 5IJAA 1BWRA 4DR7B 1YZHA 2EGGA 4B7ZA 2CKDA 4O4HF 3V4OA 3HCDA 4U2BA 3ZKWA 3ABZA 3OQ1A 2C78A 4IMPA 3RAPR 1T3LA 1TE2A 2VT2A 5LU9A 1X77A 4AC9A 3S40A 4LMAA 3SIPA 3O74A 2BCEA 4ZC1A 1XZJA 1ULTA 4ATNA 1THGA 1W4ZA 1YVRA 1WEKA 4H7IA 2QJRA 5CB4B 1OU0A 3NKFA 5COAA 5H7XA 1NTRA 3EIQA 3B53X 3RUAA 2QVYX 2F59A 4ZP1A 3H05A 4OHWA 2VVTA 4DLLA 2QGZA 2I3BA 2HF2A 3NHAA 3ZWCA 1N3BA 2H31A 3JD1A 2ZRJA 4ANFA 4EPVA 2QI9F 1BH2A 5C3UA 2GDZA 3ANSA 3OJ0A 4MVJG 5AVQA 2WWGA 1T34A 1B41A 2H1VA 4S1VA 4E07A 2V7BA 1QF7A 2O5RA 3R9XA 1QNFA 2IPNA 3BTOA 1IRIA 2VK2A 5KSYA 4DJTA 3IQWA 2BGLA 3W3AD 1WQ4A 4ITRC 4CIBA 2F3RA 2XXJA 3K9HA 3WRYA 4OMDA 1Z28A 4EUEA 3UENA 2ZWPA 1KU0A 2XX3A 4ND6A 3DDHA 2YICA 1JDZA 2DBQA 1R8YA 1Z37A 3BKXA 2ZYIA 5KWSA 1YRHA 4JVSB 1ISPA 1JBKA 3MQ2A 3R75A 4EGAA 3MS2A 2V7UA 3CF6R 5F23A 4XJSA 1OV4A 1R4NB 3I9KA 1C3JA 2VSQA 5DWDA 3AVPA 5TMDA 5BWLA 4ZYTA 2DQKA 4PRYA 1V1RA 4UULA 4D4MA 1GFIA 1ZUIA 5E2AA 3D7LA 5KSWB 5HEKA 1YRLA 1P9OA 2JHPA 3NHUA 4X6LA 2C77A 2QUKA 2VDQB 2LZ0A 1COZA 3X44A 4MR8A 4JSRA 5K03A 1G1AA 3AKEA 1E2BA 4U3JB 1GPDG 1M6EX 5IN4A 1HY3A 1WB9A 3RU9A 1NR5A 3MJTA 1K3TA 3K9WA 4JLVA 1EK0A 5U1PA 3PXBA 5EIFA 3BMCB 3FOFC 4GXQA 3F3SA 3HDHA 3I4CA 5FOUA 4M6WA 2C7GA 4ZYLA 4X1OA 4I50B 2L0XA 1Z2PX 3QE4A 1TF7A 3QE0A 4DJJA 1I3OA 1HE3A 2X23A 5GM1A 1QLHA 2Z56A 2XMSA 2KHZA 2FR8C 1G5HA 2Q45A 3GGPA 2HBZA 1J2RA 2BMJA 4JJ7A 5EJAA 1B23P 2O8FA 4PF1A 2EEPA 5IC6A 1CRQA 1QGED 3HM2A 2JBWA 2D74A 5IXSA 1W1UA 2GASA 1O94D 3EVAA 4U9IS 4X71A 4CL0A 1S0UA 1SUIA 4V39A 5IDYA 5IKEA 1YCFA 4IIVA 4OGWA 4CLRA 4Z3KA 1G5RA 4KNVA 2CBXA 3G13A 4DLXA 2ONYA 1GADO 2XUIA 5KYXB 2IH5A 1UXIA 4BQNA 5F5XA 1JDVA 1L5VA 5FA8A 1YU6A 1N75A 2WU4A 3SX4A 5JIBA 3M83A 1W48A 4TSFD 2IS4A 1T5IA 2FOXA 4HWRA 1UT5A 4WNAB 5FUWA 1CNEA 3A9CA 4B4OA 1HNWB 3A04A 3H1PA 4ZRNA 2A5JA 3OFJA 4TT3D 5H59A 2PS1A 5SY9A 4ZK6A 1PDVA 4R1LA 1J97A 2G5CA 2VS1A 2C97A 5C5CA 3TINA 2FSHA 3REGA 4JDPA 4PIPA 3NCTA 5IZ4A 1N9GB 3K0FA 4OV6B 5AXDA 3NGMA 4MCHA 2FPGB 3P9NA 4QJ3A 5EESA 2QWXA 3M8KA 2O52A 1M34E 2PPVA 4PPNA 4L73A 3X1ZA 1HFWA 4L6IA 3DYIA 4B44A 3HUUA 2I66A 1HZZC 1YUNA 4AYXA 2FDXA 1S3SA 3GG9A 3KUUA 1UDRA 1MQ9A 5CFOA 4Y0AA 3V7YA 1E66A 2QLFA 4M9ZA 5IHXA 1ZLXA 1W96A 1FFXA 1GTJ1 4BLPA 3A7DA 3AUAA 1X1CA 1VCNA 2PKQO 1P5JA 5JI3E 1MO5A 2IZ1A 3DMTA 1LPOA 2ATVA 4RKEA 4FWTA 2G40A 1P2UA 3CF4A 2OQ2A 4UU0A 4TGLA 4OXIA 5EZSA 2AV6A 2Q5HA 3CH5A 5DX8A 3WLPA 5KQSA 3MM4A 3N8KA 1ZH4A 4A7PA 4AZ3A 1Q21A 3FZYA 2BLNA 5FWNA 2JKYA 3RVMA 2Q5FA 2QPLA 3THYA 3G8BA 3ITDA 4UAUA 2J4FA 3PSHA 4P35A 3WLLA 4LF8B 2WFZA 3L9WA 5FOSA 3RYIB 3TB4A 1KMHB 1Z7GA 2CDRA 2JHFA 5FLXA 2BFDA 2EV9A 1CUSA 2PO7A 3H7AA 4RCYA 4YI3A 4I2VA 4GH5A 3TIFA 1CY6A 4ECEA 1T4GA 3NANA 2FH5B 2XA1A 4QGGA 3R3VA 4Q03A 4D99A 5GZ1A 3W8FA 5LOVF 2Q4DA 4X9XA 1E9VA 1VKOA 2F2TA 4NZPA 3HXPA 4GAEA 4UEWA 4KR6A 1F0NA 2WWYA 3VRHA 1HNNA 4N7JA 3EOBI 3JPWA 5DT2A 1JPUA 2PL1A 2WM9B 4YS6A 3E22B 4CRWB 2BGWA 1Z4JA 2IUTA 1OWPA 4V3BA 1RYNA 2ERCA 3DE1X 3MOSA 4B9AA 3S1SA 2V1XA 5ECDA 1CY1A 3H2SA 4WN3A 4BDTA 2DHDA 3VAZA 4I9HA 3UMSA 5DF1A 4Y6LA 3BL5A 3GEEA 2UVDA 3T5DA 1T0BA 4D42A 4POOA 1B14A 1C9NA 4JP8A 4BP3A 1NXPA 5B4UA 5JH7A 3WAJA 1L9XA 2DUWA 1B1CA 1ECCA 1H1LA 2WAAA 3PL1A 3SZOA 5FEMA 2AVDA 4LYEA 5FQNA 3U40A 4YAUA 1EXDA 4H7HA 4CKEB 2IC5A 2R6CA 2VG8A 5CGZA 2JAHA 2P5UA 3A26A 4FYJA 4UM5A 5LCXA 4C5CA 1JQAA 1AKQA 1V71A 2CY0A 2RB5A 3AR5A 5AKLA 2PZEA 3PIIA 3GQBA 4ZJUA 1HSZA 2XV1A 2GEVA 2XD9A 1X6VA 1OGIA 1W0KD 2Q28A 4I1RA 1X3LA 3OEWA 1OBCA 1JAHA 1RHUA 3DUWA 1N1GA 1XDUA 2ST1A 3N5KA 4YRRA 2Y8EA 4W9NC 4P38A 4KRFA 3GT4A 3IJPA 3PNOA 4MTCA 2BDUA 4FDUA 5FDFA 1V7ZA 1VSBA 1ETUA 9LDTA 4MJ7A 1P3JA 2MSLA 4YJHA 3JQBA 3UCFA 5EJFA 2RIPA 1C0KA 3A0RB 1NGSA 2YOGA 3V1LA 3QH4A 4ILEA 3GGJA 2W2QA 4I55B 4OMFG 2GPTA 1JR2A 4E4TA 2XRFA 4WIAA 3SWWA 2KSQA 1HKHA 1M3SA 4GOND 4KO1S 1XR3A 3G9TA 5AKZA 5LDHA 2H00A 1D2MA 3X1JA 4YJ2A 3ZD9A 1AUVA 1FXWA 2AK3A 1QH0A 3MWLA 4GVLA 4RKFA 4ZT4A 4YWJA 4WA7A 4YAGA 2B6HA 4PEVA 3P52A 3NHWA 1X2BA 5EL0A 2QD3A 4P9NA 4TXHA 4HXGA 1VHTA 3GXOA 4H27A 4QGBA 5HOQA 1TCCA 1RZRA 4G23A 1E96A 2BW0A 1D7OA 2I76A 2AL7A 2VZEA 3G0IA 4IJQA 1L5SA 1RU3A 2V9PA 5D5HA 3U2QA 1P0MA 3OF3A 2LTAA 3KYJB 3UB4A 5MN4A 4U7WA 4G1EB 3UT5B 3WIOA 2J9FB 3BWYA 3OWXA 4Z3OA 2AMFA 5J2UA 2B1JA 2JCYA 4G8BA 2QK4A 2ZZMA 1ESEA 4UBIA 3HABA 2ECPA 3ETDA 3O6VA 2GHTA 5EJ8A 1W36D 1Z5ZA 4RIIA 1VJ5A 4UXIA 1TO6A 5EWJB 3I52A 3VM6A 4O8CA 1VQ1A 2BP7A 1EGMB 3BK1A 4PPFA 1BDBA 2UUCB 2Q5CA 4DLBA 1KWKA 4OQQA 1FLVA 2RCYA 4FK8A 3DPSA 4MP6A 5JTTA 1VFNA 5ES3A 3UZUA 1DJQA 2VPWA 2DKFA 5E8JA 3RI3A 4ZEMA 1G21A 2Q27A 1EXNA 2IITA 3E5MA 1FFWA 2LR0A 4ED9A 1REQA 5J43A 3K9CA 3LY9A 3PHGA 4I1IA 1OTXA 4JROA 4PCUA 1DUSA 4ACAA 4Z1OA 4Z4CA 4DKJA 2FN7A 3B3QA 2VK4A 4DAEA 3RBXA 3ASVA 1VA4A 2XDQB 5HG0A 2V9CA 4HFRA 4BMYA 1EVLA 3DCIA 4XCVA 1TW3A 3NH9A 3GXBA 3DE7X 3V1UA 3W9UA 2DFNA 4RA6A 4LY6A 5TARA 3ED1A 4HLDA 2VDJA 3QWAA 4RKWA 4EX6A 1K68A 2OP1A 1OGJA 4KFSA 1ZLYA 2CL5A 2RDMA 3NYIA 3B8HA 2O2HA 3RSZA 4F7DA 2XIQA 1MABB 2RHDA 3BXFA 4BL5A 4RDHA 1E2IA 1NZDA 4HAOA 4PNHA 3HJUA 1H65A 2XQFA 3TTYA 3WHIA 3MWEB 4V2UA 3UFXB 4NCNA 1Z5UA 3MHPA 1AXRA 1W8DA 2DPMA 4JLOA 5KYKA 3MINB 5I7FA 4Z4EA 4Y1GA 3OP1A 4L75A 2ICAA 3H2GA 4CG3A 4CVNA 5KSOA 3K0HA 4IRUB 3DBHB 5J4HA 3BD7A 4O6VA 1N36B 4JU8A 2NACA 2ZI4A 3L7AA 3BAFA 5IANA 2Y3IA 2O8CB 1E9BA 1GGNA 4ZMBA 2OECA 1I6KA 2G4LA 2V4UA 1B8VA 5K0EA 4JAVC 4FM9A 1A69A 4EYKA 2W2OA 1TPYA 3DS8A 4KDFA 2GD1O 4UBNA 3ZV5A 3IR7A 4W63A 1NG9A 3F97A 4X7MA 3TI7A 4ZOBA 3CX4A 4RD1A 3RYCB 3HBLA 4R2JA 4HADA 4DXDA 5DTIA 1JI3A 2VTBB 2GLTA 1NJ8A 3REQB 1TU3A 2P2YA 4JT4A 5JV5A 3KO8A 3PEEA 3UOGA 3K2EA 2Q4TA 1JKIA 3K9FC 2HRQA 1XU4A 5EYPA 1BKDR 1SO8A 2WWTA 4L07A 4UHKA 5DX0A 4F21A 5LKRA 4HHEA 5E1DA 4R2MA 1QHNA 2EU8A 4Y2SA 3WB9A 2P9JA 4BWVA 2CZCA 2V7QA 3OPMA 4RZ3A 3ZWXA 3HJBA 4N3BA 1YHYA 3AGPA 2AN5A 2BM1A 3AU9A 1R74A 4N7RA 5J59A 4MO2A 5CA1A 2X1VA 3KYCB 3HBMA 5DNEA 3RVKA 3ZU3A 2XMPA 1NI3A 2DTEA 1QR6A 2K6GA 3IILA 1HX7A 1JKMA 1ZD1A 1YL7A 4QM6A 3G2HA 1E62A 4LF5B 1TVKB 3WYNA 4WBNF 4XH9B 2BRUC 3DKPA 4K6CA 4NJEA 2W42A 1S8NA 1X13A 2A57A 3TD2A 3KQKA 4CUZA 3R6DA 4YACA 1KI6B 3LG2A 2VQ3A 4RHXA 5H3CA 2RHHA 3OZEA 4YK7A 5ALZA 3PJRA 3INNA 4AS3A 5EHXA 4NNOA 3B60A 4AZ0B 2PKEA 4NV1A 4FU0A 5ERYA 3BUSA 1WUTA 1RMQA 2BCJQ 3LF1A 4PFQA 1ZGZA 5JZOA 2VDRB 2G67A 1JIUA 1RLMA 4Z53A 4NCKA 5EJGA 2WDPA 3RUEA 1OFTA 4E5MA 3A6PC 4NBKA 1UIRA 3TL3A 3T3PB 1GLVA 4KN5A 3P2YA 2ORIA 4RH1A 4R16A 3TKYA 3OTWA 4JC0A 1BGXT 1SHUX 3H5AA 1VECA 5CLQA 1ORRA 3PF9A 4OQEA 5DLPA 4D3YA 4G8CA 5BSWA 5AHXA 1KIFA 4LQDA 3OZIA 3R76A 2B36A 4Y9DA 1UMBB 1AS2A 4YMUA 5HZKA 1NFFA 1YNSA 1YIOA 3GLHE 4MGIR 4QUIA 3WG9A 1EI9A 4EFKA 1UBNA 4WFIA 5BOSA 4DSNA 5BUSA 1RQXA 5ICMA 2JD2A 4TLCA 4A36A 2CLCX 4HNAB 1K88A 4XR9A 5CTAA 3I2FA 2TMYA 3SI7A 1T8PA 3TSWA 4YAIA 1WBBA 2WSSD 3FRHA 3SYLA 1RPJA 1YFKA 2EJTA 3QPDA 2FW0A 1GZVA 5KNBH 1F2DA 3LX4A 4B3XA 2BL4A 4UZSA 4PPQA 2ZBRA 3CX6A 3H4IA 1E1DA 3KVYA 4ZVMA 5AUPB 3D3WA 1A9QA 1IHOA 2IV2X 1JB9A 2OGTA 3VR2D 3MS7A 1LDYA 5FLKA 3BH6A 3ZV4A 5GINE 4GPD1 1JBQA 3CVYA 3VVCA 1C5KA 2W4MA 2AOXA 2Y05A 3GELA 3BIXA 2QTLA 3ICWA 1UT6A 1C1HA 3HB9A 4CMEC 1YB2A 4F5EA 2QS9A 2VH1A 4R1PA 2DBZA 3QVUA 3EODA 4QYSA 1P7WA 2P3SA 3SEZA 1Y7HA 1NKTA 3K35A 4QYWA 5EY5B 2Z6UA 2PJUA 2GNAA 1M6VB 3EGXA 1VJDA 1Z17A 2IYOA 4OKIA 3P2IA 4YQEA 2PA3A 2VC2B 1I2CA 3W5IA 4G4SP 4KXWA 4IHJF 4IS3A 3ST7A 1A71A 3AJRA 2WT8A 1FW8A 3DO5A 4ZOQI 1QH1A 5E1OA 1IJBA 5JROA 2R1VA 4TRJA 5K8TA 2HX1A 1NW8A 3A70A 2A0KA 4M8KA 3WRYC 4RSMA 5MGBA 4UQLA 2O3JA 1KQGA 2C1XA 2Z43A 2GZHA 2WDZA 1J7KA 1RWQA 3LA6A 3UJAA 4PSKA 2C9BA 2N0SA 5CP8A 1M2JA 2QMUA 2VP4A 4WXPA 5BSUA 4P4LA 1RRGA 4FI3C 4MRVA 2RKBA 4JK3A 2IX9A 1YBFA 3GAMA 3JD3A 2WJPA 4TLDA 4F8JA 1Z5GA 1XA4A 2UUPA 3P0HA 4ETIA 4F3CA 2NQ8A 3CEMA 1NBEA 3IBSA 3F8WA 5EKTA 5KJCA 3HH8A 4B5KA 3AVYA 3S68A 2TMGA 2QQEA 2OLKA 2X22A 3PPIA 2LUOA 3U3RA 3H2KA 3KLNA 2P4UA 4C1BA 3WGJA 4DCPA 2AFIA 3SKXA 3U39A 3NLLA 2HI0A 8MHTA 2PRIA 2P4SA 4BJ5A 1W19A 4O5AA 1ACLA 3THSA 1ITZA 1QIFA 1TD1A 3UPDA 3IOMA 4HQKA 5HKBA 1ACMA 1WU8A 2R86A 2IFTA 1N5RA 4Y2TA 3W04A 2J3HA 3PHIA 5C4MA 5TRTA 3AVUA 1F38A 1MG0A 2JIOA 2IXGA 1DEHA 4ETMA 4YRMA 5KYUB 5J3JA 4JBYA 3WY9A 2WIGA 5CFQA 2GXSA 2RCNA 5EQFA 1WJGA 4F3YA 1G2PA 3STHA 4FBMA 4OGGA 3QXGA 4YMLA 4ENRA 1Z4LA 1CKEA 2K7FA 3IUMA 2IKQA 1GITA 4N9QA 3HZRA 1RE1A 4RANA 4FNOA 2R6DA 2ZCJA 3ERCA 3AHJA 2PRZA 1ZMOA 4ZVKA 1S8OA 1Q1GA 2IE8A 1JDBB 4UE2A 2IUYA 5DTEA 2BBOA 4WPGA 4JXZA 3V00A 1UQTA 3WADA 1VGVA 4JB2A 2N42A 3K2QA 1VG9B 1N7JA 2VXYA 1SKYB 2ZJ0A 4PPYA 2C7VA 5EHGA 2P1RA 1G291 3FWKA 1CV2A 4RSHA 3WK5A 5IFLA 5MF6A 2ZYVX 1OROA 3F4BA 4QXAA 3E5RA 3Q0EA 3V8QA 2BEVB 5TPZD 5DBOA 2ACEA 5KTMA 4FYIA 1B6RA 4BFVA 2W2PA 1H8HA 1RHKA 4IJ5A 4A0FA 1YGYA 3R3XA 1N5LA 4YAOA 2XLCA 1CETA 4DLPA 2O1EA 2EAUA 5ELMA 1Y3FE 4FHDA 2FFAA 1OF1A 4TTQA 1BQEA 1DKRA 3E5HA 4FT4A 4XGRA 4UVHA 2GJ8A 4RH0A 2W48A 4UUQA 2P6NA 3MAGA 4N0PA 5G0WA 4WSOA 4OHOA 1UOQA 2DRIA 3IALA 3OJLA 3G0OA 2IXEA 3CB2A 1GDHA 2G9UA 3LXMA 4G36A 1G2OA 3CLKA 2B69A 3DT6A 4DUZB 5KAPA 2WILA 1T3ZA 3CLSD 1JXOA 2ZB3A 2I80A 4OMUA 2MYPA 2UYOA 3TAUA 3QPVA 2HMUA 4C0HA 1VI2A 5DMHA 1AB6A 2NTEA 3DP9A 1RXEA 3B9QA 2J33A 3NDIA 1UMDA 1AKNA 2O8NA 3MLEA 4JD5A 2YR0A 4L4ZA 5FULA 4CTJA 4PZYA 3W90A 1X1AA 3JQGA 2B98A 1MXHA 1GQFA 4NATA 4ZJPA 5AVVA 1TK3A 4XAQA 4DEVA 2E4AA 3CBQA 1NYLA 4QBGB 3DL2A 3GLIA 2NMVA 2TS1A 5K9ZA 2EX4A 2C83A 3I9JA 2PGNA 5J40A 4BLQA 2HKIA 3PICA 2RB4A 1ZH6A 5MHTA 2O57A 2YVQA 4ES6A 1AHIA 4O2AB 5BMOA 4ZQEA 5FLEX 4E88A 3ZCRA 5B4VA 1L5LA 3D7RA 1R27A 4R9VA 4JOBA 4WDQA 4MWOA 3RIXA 4DQLA 5J47A 4FLFA 4AJ4A 4XWGA 1U3WA 2Z5LA 3WGQA 2YNMA 2JDIA 2WSMA 4AG3A 3R3SA 2GDJA 3IUSA 4M9RA 3T7TA 4AB1A 3I6YA 1PFYA 2Q21A 2NU9A 3LX6A 2RHMA 4F4UA 5HPYB 4LFCB 3DBRA 1RWKA 1HLDA 1UT8A 1L5OA 1DFGA 3TG8A 2DTXA 1QYDA 1S1MA 2PZLA 3TOXA 3PG5A 2D1FA 1DT5A 1WPRA 4HDMB 2XH8A 4LJAA 4CKCB 2W71A 4MSUA 1LW6E 1U11A 2WJIA 1L1QA 1QGUA 1Q3HA 3H19A 3K1AA 5KNBD 3PCTA 2NO0A 1XZEA 3C3XA 4UARA 3SIRA 4QG3A 3GFGA 3ASYA 3I23A 3VPCA 3EXAA 3KHKA 4P7KA 4Z51A 1UJBA 1QPBA 3IIEA 3PRKE 1YBVA 3E35A 4M1TA 4RK1A 1PS9A 5KYVA 3TLEA 2O6LA 3HM9A 2CCJA 4Z54A 3C15C 2NZYA 1CG6A 2GHIA 2H2IA 3L84A 4PFJA 4C4TA 2IHTA 1GXSA 1UMCA 4QOSA 3PNVA 4I2NA 1GCGA 2FA9A 1RRPA 2RK3A 1UMKA 3FPSA 1ZNZA 1TYDE 2V7PA 4HK4A 5AJHA 1CR1A 1R3DA 2P6OA 2YFQA 4XIFA 3QY9A 2NXEA 1PUJA 4D0RA 3CEPB 5TEVA 5H68A 5BYAA 2XA9A 1ZIXA 1O5OA 5HVNA 2JLAA 4AUNA 1SA0B 3HACA 3P2KA 2XB4A 3RVNA 3L4EA 5K0LA 1BSVA 1OJ7A 4RF3A 2XUDA 1Y82A 2BZ0A 4MARA 3S6JA 2OXRA 3AOGA 2WMOB 2ZJ6A 3W5JA 1VHLA 4ZDJA 1L7PA 4R9RA 3RIHA 2W6PA 4LF7B 2IV7A 2CXSA 4G65A 2O07A 4C76A 4NU0A 3C2QA 4YT2A 4R8SA 4MEAA 1FDOA 4CMGA 1QGOA 5SZJA 5IJWA 3P19A 2GN9A 3K7EA 3OQ6A 2QUZA 4I4TB 4KWTA 2G71A 1CEYA 4I1OA 4GZ3A 1SPXA 4IHAA 4FYPA 3ZBPA 2HWUA 3LX8A 1MA3A 3NHSA 1UEJA 1U0EA 4JYPA 4TSRA 4WWHA 1RCFA 3R3ZA 3WNDA 3ZWBA 2INGX 3WLOA 4LKRA 4LV5B 1B6GA 1SVUA 3KALA 4QHSA 1T3SA 3HXKA 4LXQA 4MA4A 3WNCA 3P9XA 1NRJB 2YVAA 3B9PA 3R3WA 3GLGA 4NL4H 2B4RO 3T35A 1DGQA 3DEIA 1TQ2A 4IMJB 3SVTA 2VHJA 1ZK4A 2NN3C 2I8AA 4AJIA 2ZBQA 2IZ6A 4NJOA 1W73A 1C3VA 1EDOA 1ZM4A 4RWZA 5CYFA 2I71A 2V6IA 2QTFA 5CXXA 3MJHA 1SCQA 2XYRA 5FWDA 2WJGA 3NONA 3B13B 4QZVA 4GSYA 2JATA 3NP7A 4MHSA 1SUSA 2W8BA 5GONF 3BFKA 5M7EA 2WWHA 2ZJ1A 2VTKA 3ORHA 4RD4A 4TV9A 2WHRA 4AF7A 1ZJ6A 1Z0JA 5TF4A 3WX0A 4QPCA 4K86A 1PTKA 3UANA 5FV4A 3GMDA 3I4LA 4F93B 1DC5A 3UPTA 3ZDQA 1V16B 2QW1A 5DHSA 1XRRA 3GPCA 1CF9A 1KI8A 3KZNA 1BC5A 3AR4A 4HXYA 1KR5A 2VPXA 2ZGVA 1G8YA 1JKFA 3PVCA 4O2BB 5TSDA 3K0SA 3JASB 1ST3A 4BYMA 4BGVA 4IV5A 1AZTA 3PHCA 2POCA 4C9BA 4UTPA 5C7LO 5TMPA 3A9TA 1RJWA 2DHQA 3AYXB 3BFPA 4FYHA 1PWYE 3G8CA 1B7GO 4JSTA 3QUSA 2UYYA 1FP4A 1FXUA 2RHBA 8AT1A 2CE2X 2C5LA 2GSWA 1QYCA 1USIA 1V2GA 4ZCLA 3CIOA 4EO9A 4XOUA 1KAOA 2ECQA 3KB1A 3VR5A 3ZY3A 2X9QA 5IT9A 3VJRA 4RXMA 5EE5B 1V7PC 5DXJA 5ITWA 5JNSA 3QX8A 1J2UA 4IYRA 1J25A 1I36A 5JFOA 3TW4A 1BX3A 3R8XA 1MQAA 5GV8A 1XAIA 4WXRA 4JXKA 2PVCA 2YQ5A 2A78A 2WVJA 4CI9A 2G9QA 4DGQA 1SEPA 1XWFA 1CTQA 1RTKA 2JI7A 4L7VA 4DEXA 3DE2X 4TLMB 4EI2A 3PXCX 3IT1A 2AR0A 4L4SA 1GT91 4M1KA 5DRYA 5DP1A 1HFEL 2VYVD 2W6NA 4MS4B 1UWVA 1X7WB 5D6NA 3RFXA 4F7WA 1WSDA 4G0OA 1YNOA 4CM4B 4JQSA 2NAPA 4P31A 4FXPA 1VIAA 2V9ZA 3IERA 2D4AA 5EJMA 3IDSA 1E2MA 3UN1A 1L7DA 2I4IA 4WN9A 2RGCA 1HURA 3A10A 4G2NA 5BSHA 3N2KA 2PQ0A 3PJGA 5HE8A 2BBWA 1WUIS 2HJGA 2JA1A 3FM9A 5E4TA 2ZS9A 2YVLA 5ECWA 4A92A 3A1FA 3GRPA 1A5TA 4CTNA 2D0OB 3R6GA 1PL7A 4E5VA 1NVBA 2NXJA 1DHTA 3WLNA 1VJRA 2BI7A 2XZOA 2B99A 2QW0X 3QF4B 3KSBC 1EA7A 2OC4A 4CHGA 3QMMA 4QDOA 1VSUA 5KNCA 1K6IA 4OLFA 1PJ3A 1TJPB 3LPAA 2PRKA 3S4YA 4J7UA 1XIVA 3FPGA 2X4DA 3A9WA 2YC4C 3SR3A 4HH3C 3FN4A 3FPEA 1XL0A 2WUEA 5CVVA 5DN6A 1KOJA 2YFKA 2VWHA 3S3TA 1CR2A 1ENYA 2IHJA 3AFOA 3H87A 4IQ4A 1SXGA 1A8HA 2DY0A 1QFYA 3FCAA 2XODA 3ORQA 2C04A 4M87A 4B6OA 2LNDA 2VPYA 3LQ1A 1W4RA 7ABPA 4BQFA 3L6BA 5DXFA 3LLVA 4DCUA 3TLBA 2R8ZA 3K9GA 2I55A 2K7ZA 4BJ1A 4E13A 1MEEA 3HCRA 3HCBA 2P9CA 1TVCA 2FSUA 4YLEA 1ZUNB 5FADA 3GO4A 3ZBQA 2V3CC 5DXAA 3K0BA 1PO7A 4GP7A 5K20A 1IHXA 2FSVC 2C9MA 3TIGA 4U2FA 5HUQA 2Q5JA 4BFXA 4FC6A 4CU5A 2AZMA 2KE5A 1E4EA 3L8DA 4C6HA 3ZWQA 2B4KA 3JZAA 1SBNE 4F6RB 1JMKC 3HY4A 3P0JA 1UADA 2ZIXB 4FTWA 4YTEA 4F9FA 1NNLA 2C61A 2ZI6A 1F48A 2IYWA 5DEIA 2AG5A 1IOZA 1QO9A 2I7TA 4MV8A 3WGLA 1X19A 4G8JA 2R7AA 1P61B 4FQ8A 4Z0TA 3I32A 3V4VB 5FI1B 3ZHXA 4EKIA 4OU5A 3QYPA 4K9PA 4HNTA 2PBLA 3P9YA 1J33A 1CXZA 1V5IA 3QU9A 4MGZR 3AL2A 4DANA 4EQZA 3OT1A 4KREA 2FCAA 4JEHA 2VK8A 4BP1A 5GJVC 1T6YA 4NV0A 2QLJA 1YBMA 4BEBA 4CKWB 1FJGB 1HQDA 2IIQA 1VBFA 3TQFA 2OFPA 1R9NA 1XMSA 2HA2A 1Q19A 4ZV9A 5C2JB 3BE4A 5K01A 3FPFA 1XD2A 1Q20A 3CLTC 2CXTA 5B58C 3IUBA 2MINA 4IZ6A 3WL4A 5HRAA 2R6AA 1Z73A 4F5WA 4FSXA 1UC5B 4KW7A 3O8BA 4IJKA 1YZQA 4Y1FA 4E6EA 1UJNA 2CCKA 1UFQA 1ZH2A 4P4UA 3NMUF 2D8MA 2YW2A 3KZKA 1TNDA 4LQ4A 2MDTA 1IUNA 1TEXA 3NAQA 4IQFA 2LKDA 2YUIA 4GOLD 4RTMA 3EAFA 3GLFB 1O6CA 2XGGA 3E1KA 3RT9A 3SYKA 1E79D 1AKYA 2VUUA 3A2MA 3UBTA 5FB3A 1D3AA 3A6LA 3B6JA 2BMAA 1EDBA 3FVRA 2VP3A 2VF8A 5J5AA 4I99A 4H1WA 2ONCA 3CW8X 3JQAD 4LMBA 1P74A 1QVZA 4JI0B 4M9CA 1IONA 2D2FA 1WMFA 2A9FA 3BRWD 2MU1A 3CVJA 1M9NA 4MZXA 4FCWA 4CKYA 4DLTA 1B1AA 4ALJA 5EA2A 2FRXA 3LY7A 3PB3A 1G4UR 5EFOA 3ZI0A 5K8JB 4N8DA 4KDCA 4IFEA 1N2GA 1G3RA 5EKSA 4YRQA 5A4KA 1M6NA 5TLSA 3AETB 1IQPA 4GO1A 4Q18A 1AGPA 4YP5A 3QMVA 3T3OA 4WZBE 3H0KA 4XIGS 4N5MA 4BQEA 1JIVA 1Y6RA 2BM8A 1DBSA 3L0YA 4H77A 4YP6A 5HUJA 4CIWA 2WMDA 1KU6A 2VWQA 4NYMQ 4XQGA 1R6AA 4K3VA 4DABA 3GN1A 1KI2A 2IZ0A 2Q3HA 1HYBA 1ABEA 3DE0X 4DCMA 5KWIA 1S2OA 3DWEX 3O8NA 2O2DA 5DGHA 3OD5A 2OBFA 1VE9A 4BASA 3DAOA 1NMSA 2HU8A 4PIVA 5LXTA 2NP7A 1R18A 1RKXA 1M6YA 4J3FA 5CDFA 3O4RA 2R7NA 4YR9A 1FP1D 1LK0A 2PKWA 2X42A 1E6EA 3SY8A 5AWFC 3AL0C 3Q6MA 4ZV4A 2A5FA 3CSSA 3F7NA 2OCDA 3NVAA 3P1JA 3RV4A 2ID4A 4XCXA 1EJBA 2I22A 4O3FA 3UUWA 2X3FA 3GPBA 4Y9TA 4P86A 2W11A 4YCCA 5JBQA 4CLHA 1N78A 3W5AA 1V41E 1E69A 5BR8B 3HFGA 1CCWA 1N33B 1QTRA 5DTRA 3T41A 1YVPA 2AHOA 3L8GA 4MO9A 1EUCA 4QDXA 1F2TB 4RA9B 4NBVA 3I62A 5DOZA 1N0IA 2I4MA 2HTFA 2QRVB 2ZIVB 4R2LA 1WZUA 2YVKA 2PUFA 5F9MA 3FKQA 2XEDA 3ZJUA 1E9RA 2HY7A 1CP3A 1SXJB 1C29B 1JIKA 3WVNA 2PMEA 4XRGA 3H3FA 4OIMA 1I3CA 3BEOA 4RTLA 3I8XA 2H3EA 5BUCA 2YV5A 3IIMA 3KLMX 1IY2A 3SM9A 4Z1MD 5B2EA 5IT4A 2EF1A 2V65A 4UD6A 3Q3JB 3KVOA 1M67A 1NVVR 4WZ6A 2PR7A 4ZGGA 4EDFA 5LVAA 3VBCA 1XNRB 1XOIA 1WM1A 1R66A 2XPCA 3N6RA 4Q05A 3T52A 4LVOA 3TRIA 4W6QA 1FRZA 4OJQA 3FYTA 3VI3B 5KI6A 3SQXA 1QKJA 1XYYA 2Z8YA 2JAQA 3GUHA 1E3JA 2EG5A 4LDQA 3TUIC 3IE1A 3OKCA 3L05A 4FJ1A 2QRHA 4HDNA 1PR3A 1SR8A 2XMDA 3E0QA 3LLSA 4L4UA 1SKYE 4DRZA 3S7ZA 2LDBA 3AJEA 1QH8B 3VZDA 2C2ZA 1BO6A 2PYIA 4GXRA 1TM2A 2G1UA 2OT3B 3D8TA 3DT9A 1IPEA 2AWOA 3OEHD 3UATA 2FF7A 3CRQA 4KXYA 3FNFA 3PC4A 4PQRA 3JARB 3KJEA 5EGNA 2Q50A 3FZNA 4YJFA 3C7AA 4YRTA 2IU0A 4DIEA 5HF5A 3MSXA 5J4KA 2P8JA 4O3MA 3JRNA 1BS1A 1PU2A 3BGWA 4WZAE 1FJXA 1SVKA 2X0JA 4RENA 1KYTA 3Q87B 3KZOA 4HNSA 4RK7A 4Q1FA 1HT0A 2B2NA 2OZPA 2WHYA 4D2IA 1JFFB 5ALTA 3D3QA 4HG2A 4B75A 3NVMB 4UJ3A 3U9TA 1DCFA 1IXKA 1LVHA 1B2RA 3WL8A 1S8FA 2B37A 2FUG1 3HCAA 3IODA 5T3YA 1IBMB 5DYIA 1QS0A 2FG5A 2BELA 1NVMB 5KYWA 1L9KA 3WJ2A 5IAKA 4Z7QB 1KH1A 3D4BA 2V6GA 1EBBA 4FDTA 1XJ5A 1G6OA 3ABOB 3N8IA 4O4IB 7REQB 4PQEA 4V1CA 2JIPA 3G7UA 5ALHA 1E0AA 1BMQA 3T61A 3BL6A 1G3IA 4XFJA 4YAJA 5A6VA 2JD1A 1LWNA 2H1LA 4QVIA 5HFJA 4N3GA 2BM9A 2YV4A 1EK2A 3DZJA 4C7BA 4D43A 1H2XA 1PVVA 1Y1QA 4GX5A 3HKCB 3OX4A 1KFEB 3N2EA 3TR6A 3TS1A 1NL3A 1NVFA 2IS2A 1H94A 1Y1TA 5FFFA 2YNMC 4UASA 3WGIA 1GQSA 3ZY4A 3PGJA 5KQMA 1WHTA 1P1CA 2CVQA 3Q5EA 4JCCA 1VPWA 3BT7A 5CLIA 4YYEA 4MUEA 2FP3A 1BFDA 1FC0A 1ZCJA 4TM8A 5CTJA 3W8NA 3RLIA 3I28A 1DDOA 2HSWA 3DZCA 4B76A 3KJFA 3U26A 2HLHA 4ZCSA 2CMKA 3P5SA 3RNLA 2PS9A 2G5PA 2WQZA 1UPFA 3RYHA 1I0LA 2OOSA 4JKIA 3NJ8A 5CD1A 2R6R1 5JCJD 5AQEA 1M8JA 1VL1A 2B8NA 2BKXA 4XVHA 5KKCA 3P5BA 2ONKA 2PT9A 2JS7A 3GBPA 1H0KA 4XM1A 2PWPA 3PQ8A 1QOZA 1X80B 3KWFA 3HDJA 4YMSA 2VNSA 3Q3CA 1DQSA 2YN2A 4MB6A 3EIXA 4WNCA 3PQ2A 4Q7LA 5TY0A 4BMVA 1SY7A 2R66A 3DZ8A 3I9OA 3GJYA 3W3AA 2X9VA 3GUVA 621PA 1XXHE 1RBMA 1CJVC 1PX0A 2QQGA 2VZLA 2A9PA 3DUFB 5JO0A 4I1UA 1FQJA 2BEKA 3G1TA 4MEBA 1WXWA 3ACBA 2C4TA 4Q3EA 4AI6A 2WIKA 8ADHA 3A05A 1VKHA 2C57A 4M9QA 3EZFA 4F2HA 1L1EA 3FNQA 5K3FA 2WF6A 4KMOA 1TL7C 3TZQA 4BLWA 4KFTA 2VZ9A 4ZU1X 2FMXA 1E2HA 1DQRA 3L43A 4B7XA 3EBPA 2Y71A 1QHHB 3QTLA 3KR1A 3MGKA 4MIKA 4U7PB 2ZDQA 3DXXA 3ETEA 1PR2A 2RGAA 3CNLA 2H7VA 1MDFA 1HQYE 4IDPA 4BZPA 5IS2A 2MJLA 3H6GA 1Q0ZA 1G4AE 4M1ZA 4UJ5A 3I61A 1VJGA 3C7KA 2E48A 4JDUA 4C0SA 2P2LA 3LWBA 5K8UA 4D7AA 2FW9A 3ICPA 1RYDA 4PG4A 4TMFA 1Z5PA 5JVDF 4OBBA 3KL4A 4AW9A 4PZ0A 1I6WA 1Z5WA 2ZSKA 3TMAA 3OIGA 1JWBB 1OYVA 2MMGA 1E2GA 2WFLA 2AR9A 2GK3A 3H5TA 1L4YA 1QIIA 2R4TA 1M0TA 3JQPA 4PONA 1QG6A 1ZSNA 4M76B 4Q9AA 4QUHA 1UKEA 1Z0AA 2ZYAA 3E9QA 2ZPUA 1ZY2A 4ASUD 1XCLA 2AX3A 1TYZA 5DM4A 4XSHA 1O94A 4RM2A 3ORSA 5LP1A 1U7TA 2IHKA 2YFHA 1E63A 1V35A 1ZDMA 4M7OA 3I5UA 3G2NA 4NENB 3V8PA 4EW1A 3B9BA 3HJHA 4N0MA 4NPCA 2BFFB 3BSFA 1PJTA 2VJBA 4TV8F 1BE0A 3WJAA 2R44A 1J42A 4EK9A 2CUTA 4LTNA 5E7JA 2Q3FA 2DFPA 4Q1VA 2UUBB 1ZD3A 1A88A 2ATCA 1W49A 2YHAA 1DV2A 2CNLA 2AB0A 2Q3DA 4TSFA 3S8YA 4W1RA 2J48A 3HFRA 2OHGA 2BISA 3RSSA 2NNLD 2ZTSA 3G8DA 4C7OA 3TSZA 2JRCA 3L8FA 5ECGC 3SN6A 3GY0A 1YRAA 1FNCA 2CXOA 3PNYA 4TT3A 3HUDA 5AHOA 3VO2A 1WBDA 4GWGA 1G4HA 3ABSB 2V98A 3CGGA 3K4PA 3L8HA 2RAPA 2CYCA 1XTRA 4MKIA 4RF5A 4DM7A 2WRZA 2SCUA 3FFTA 4KQCA 1M33A 1CU1A 3D5QA 3HP7A 2Z2ZA 4P7JA 4XTRA 5DHTA 2PT6A 2G88A 2PZAA 2I2FA 4DV0B 1DG9A 3ENKA 3GQVA 4GECA 4HEA1 3DGFC 5EXXA 4GGOA 1FP7A 4R2KA 2R1ZA 2P6RA 1NBHA 1UK7A 4N0QA 1E4YA 3FTDA 1NRXA 1OH8A 4KFUA 4I36A 5T41A 3WKDA 1U1DA 4EJSA 3O2NA 1PI3A 2O7RA 1KXZA 2X5JO 2KBEA 3FR8A 4KJXA 4Q4AA 3MWYW 3AX6A 3MTBA 2R1TB 3PYLA 5H82A 1W30A 4JH0A 3HKBA 5FP0A 3R8FA 3OICA 1LSUA 1LPPA 4GS5A 1O97D 1EM8A 1IBRA 2GKSA 3AP1A 3IJEB 2DFLA 2DUUA 3KR9A 3B7PA 3M6LA 3SZUA 4I19A 2OCGA 1IUOA 3VR6H 1B26A 1PJZA 3IURA 5DTJA 3JAKB 4G25A 2GHQA 5JS2A 3V32A 1U2GA 2I2BA 3WXMA 2X6QA 3PCRB 4FWBA 3ENZA 3RC8A 4FMDB 4X6XA 3ZDZB 1FFCA 4R3NA 4WJZA 3WK4A 3B2EA 4COOA 4PQGA 1E61A 3EOZA 3TSAA 1FUYB 1ZR4A 2PL3A 1CQJA 1FU4A 3BICA 4BECA 3BCRA 4ZYVA 1JEDA 1TCVA 3N59A 2V7EA 2YJ3A 4H1VA 5BN3A 5HKKD 1AM4D 1Z12A 2NSLA 1YB6A 3AEQB 4DILA 3PKZA 3UVEA 1Y5NA 2XE7A 3VYTB 4FOPA 4TSKA 1GKIA 4H3VA 4J1SA 3B82A 3EASA 3N2NA 3DVAB 3VNRA 3WDSA 2RI6A 2NYUA 1SBTA 3UB2A 4UFPA 3U3KA 5BR7A 1ZVMA 2DHCA 2GD0A 1FP6A 2XUPA 3LCUA 4P33A 1E98A 4PVCA 3SIXA 3TBKA 2YY6A 3EVBA 4A2WA 1C9DB 4IY1A 4XGNA 4EHFA 4QHTA 4PYOA 4E1BA 3QI7A 4KFRA 4L8YA 4Q02A 1V39A 4AZSA 2QRKA 2ZT5A 3KOOA 4GP9A 4OJYA 1XDZA 3G59A 1CRLA 4FI3F 4MMZB 1CHNA 2WJJA 5M34A 4E3ZA 1XTBA 2I29A 1T36B 1XN1A 1M8KA 2DEUA 1W88B 1XD8A 2DH5A 3I0ZA 13PKA 2PQ6A 1AE1A 4NSNA 4QOHA 3EW7A 1R0SA 2B3DA 1X7XB 4MUNA 1SXJD 2C5SA 2BDEA 2FMKA 1QK4A 1U7WA 1J70A 1AA9A 2FPIA 3O03A 2YZNA 4FSHA 4GUAA 3SF8B 3LFHA 2XQGA 5T4FA 2BZGA 2OGZA 1JWAB 5KHLB 3DTVD 1G41A 1KP9A 1NP6A 2QTBA 4DLUA 4GI1A 4ZOLB 2PLAA 3B5JA 2QZ9A 3A0UA 3UKOA 4TWJA 2I5PO 2OBXA 4IDBA 3SJCA 2BFBB 4QWMA 1EWRA 2W6ID 4NBSA 4BV3A 2OILA 2BAGA 1RJFA 5ALIA 2PKQP 3DV2A 3EEBA 1YFLA 4IXWA 1Z33A 4PX3A 3ZVRA 1IATA 1YUBA 5C1OA 3GEHA 1T5SA 3I2JA 1P45A 2CYAA 2P2CA 2Q3BA 3EZ2A 4J7AA 1P1IA 2AYZA 3KE8A 4R7ZA 3V1KA 5IU6A 4M99A 4XI9A 4FYWA 2GQ0A 4RFSA 2J7PA 3L6CA 1TF2A 3D02A 1KQPA 2WIFA 4TYMA 1OLUB 4BCDA 1WO8A 3JQCA 3JATB 9LDBA 1DVRA 3F47A 4UMDA 5AM3A 2ZJFA 3SIWA 3EIFA 5IM4A 5LQJA 2Q3CA 3IVGA 2ID9A 2KLBA 2SBTA 3K5WA 4A8PA 4JVMA 3S2YA 1RTTA 2AN1A 1LV7A 4YRZA 3G2IA 4C08A 2ZVPX 1WUKS 3IAAA 1KOLA 3MQFA 3ZHYA 3G82C 3R3HA 1M2KA 2V7TA 4ONEA 1C3XA 1YBHA 3NBKA 4NZZA 4MI1A 1P72A 2PIDA 5G0SA 1PDOA 3NWBA 5F2OA 2DXIA 2Y1XA 5HIJA 3HC7A 3T5BA 4QPZA 3GLFE 2IPOA 1FF9A 1FRFS 2XMZA 4XYGA 1KMMA 3CJQA 4X1YA 3OPVA 1E4VA 3LXRA 4G0QA 2R8PA 3FWZA 5DGTA 5H3HA 1G59A 1WXDA 2XQJA 3GLHA 4WINA 1QPGA 1TM4E 2AN4A 7GPBA 1E9DA 3TEMA 4NHEA 1CVLA 4ZU6X 4RF4A 2NUPB 4US0R 3F9IA 1FE8A 3GZTB 2NGRA 4YLGA 1NVXQ 2FKNA 5ITZB 3C3EA 1MQ8B 1SURA 1VE7A 3H18A 4EF5A 2WV9A 1X42A 2XTZA 1BOOA 4J03A 1G17A 1FS4A 1PWZA 2XGSA 4K9DA 3V1MA 4HNQA 2VHTA 1SG9A 5E7MA 4DB4A 2QV0A 1R8XA 1KVUA 2P5SA 4J1NA 4LJRA 1WABA 1ESMA 2H11A 1O58A 3X1KA 4JQCA 2DQ4A 2JZOA 2V96A 2OXEA 4YO7A 5T4BA 1GNRA 3HKEB 1VLQA 3EG9B 2HA5A 4I66A 4LC0A 4UM9D 1OPXA 1AO0A 3G6WA 1G0OA 1YS9A 5GVSA 3K09C 1CDZA 4BLRA 5LQKA 4JNCA 1T2UA 1CUGA 3BDVA 4MJXA 4ZPJA 4B43A 1D03A 3PA6A 1QRTA 1U2SA 1VIMA 3L4BA 4MI6A 1FUEA 4FFOA 3E4CA 3T8YA 3HUTA 2ZSUA 2BGNA 1FYFA 4Y2JA 2E6UX 2PKRA 4I7EA 2H51A 2XF8A 5SV2A 2JFWA 1P6UA 4EGCB 3I5MA 1CUFA 2QVLA 3LT5A 5F9HA 1JHMA 3MTDA 2C2GA 4LJ5A 1TC1A 2PD3A 4CQNA 4DGSA 3QLUC 4J0CA 1KQ3A 3BIJA 4Y30A 4MGKR 2NU7A 3WYAA 2EBWA 1OE0A 1VRCA 4AJLA 1W46A 4EFLA 2ZBDA 4EVIA 3SFZA 4GX2A 3VU1A 4GRDA 2ZROA 3HJRA 3CO5A 4HQOA 5D51S 5EZYA 2UXDB 3SQLA 2C99A 5IUJC 2PGOA 2ZBGA 1AUXA 2JI9A 3HFJA 2OHVA 1XMQB 3P7MA 5BNTA 2FMFA 2RIRA 1ONPA 1UQRA 1RWVA 1U3UA 5JD3A 2E4XA 4R8VA 3LBFA 1QM5A 1AY0A 1NLZA 2EFGA 3DAHA 3HEAA 4GRIA 4V03A 4DC1A 5CM2Z 3SHQA 5ABPA 1K6EA 3VR6D 2NO4A 3AF5A 1ZGBA 3EGIA 5F7OA 1CFJA 1UOEA 4AJPA 2PX3A 3K32A 1SXJE 1E59A 1KTVA 1NMEA 2JLBA 5JH7F 2E85A 5DLEA 2XCSB 9ABPA 1SK9A 4X24A 3T4XA 4A23A 2HO5A 3A4NA 4XEHA 1PLJA 2HRRA 4XWWA 2E4WA 3A9SA 2WMYA 4I50A 2A2ZA 2O8BA 1D8TA 2L42A 2HT6A 4X41A 5EGSA 3CPHA 3E70C 4IZHA 3QOWA 4DNFA 1JA0A 1NXQA 1HOTA 4Q9KA 3I1FA 4JQOA 3HJTA 1BROA 3LPDA 2BF4A 1O6ZA 4XQ9A 2GUGA 2DLCX 1W1IA 2UUAB 2ZDGA 1DAKA 4IPTA 4P5EA 1RDFA 4QC2A 2FW8A 1BNCA 3WTBA 1XCOA 4D97A 3ZBTA 2UZ4A 4R8LA 3C87A 1FRNA 3WSWA 2ZWVA 3UNXA 3KHUA 3HPRA 3DOJA 1Z75A 4IKEA 1JXAA 2YWRA 3UTDA 1X15A 5E6SB 3WP1B 5KQLA 4MV5A 1ZXXA 3ZXUB 5C51B 1ILWA 1YL5A 4EEZA 4HNHA 3HG7A 4IDHA 4HH0A 2WJWA 4FXOA 4E0BA 3OT5A 1SUWA 2IODA 2D59A 4NG5A 3QVKA 4AJ2A 3ZCVA 4Y2VA 2QTTA 2G9RA 3OTGA 4TKUA 1DWOA 3ROMA 5JSHA 4YJ2F 1ILEA 2GF0A 1FXWF 2Q2WA 2ZCVA 4MV9A 3TR0A 4N8SA 1KYIA 2ATEA 3DJFA 4C3OB 4WNAA 3D6UA 1GUFA 2YVUA 3PQFA 3O4HA 2IDZA 2O1XA 3EX7C 4HAZA 5F52A 4C87A 2CUNA 4RHUA 1OCEA 4WOBA 3ZE7A 3HRKA 5C46F 2YV1A 4YP1A 5BVHB 1IEQA 2BN4A 3BH0A 3KQNA 4BE9A 3RHTA 2GOYA 3OKPA 5T6BA 4DTIA 3EIOA 1MGPA 3QKWA 4AY5A 2CSXA 3QVVA 1J2EA 3GPIA 4K6MA 5J2UF 4ZI7B 4TWIA 1E77A 4HLNA 4OOFA 1L4BA 3C24A 1A5AB 4AKHA 1W0CA 1BCSA 1OLSA 2VPIA 2COKA 2Z2JA 4JLBA 1EJ6A 4LV8B 1UXGA 2IPLA 4X64B 4K1XA 3ZWWA 2QTHA 3QMPA 4IDGA 2CLOB 2WSSA 2BFEB 4RVHA 1XQWA 4DIBA 1T24A 4E6PA 5GIPE 1N7GA 4WXMA 1K63A 1SOMA 2R00C 5BNZA 2IH4A 4TMVA 1XMXA 1RZVA 1J8DA 2WJVA 3HP1A 1GL6A 3FCUB 3SXUA 1NJ5A 4F4IA 5JEDA 5JNVA 2JHCA 4UHBA 4P5PA 2MSKA 3VR2A 1AK2A 1QK3A 4NU5A 1T2CA 2FGKA 4LN1A 1MVNA 3R0ZA 4W5NA 1YMVA 1Y9JA 4N5HX 5AESA 5A06A 4GLLA 5LR6A 2BKLA 3CC8A 4JENA 4K6FA 4Z0HO 4URXR 4B35A 3QPBA 5CG1A 2BYTA 2MWMA 3MC1A 4D80A 4DAOA 2OFXA 4IFTA 3OY7A 4Q34A 3PGMA 2BGMA 1GVNB 1OKKD 1NXVA 3IP6A 4XCQA 2EWVA 3IAM6 2QAGA 3OU7A 3P26A 4UAJA 4XQEA 1CX9B 3SLRA 4LYHA 4V0LA 1KMHA 4BMCA 4M37A 1LVUA 2PBRA 4Z2YA 4DMGA 3X2FA 4KQ9A 1XVIA 1QFSA 1J8YF 1ZJWA 3UGJA 4X92A 1ZNXA 2AUTA 3EY4A 4HRAA 3TXAA 1VCHA 1CPYA 1IXSB 1ZNYA 2Q5QA 5DIFA 5AOBA 1S3GA 4P2GA 3RBAA 3HDGA 4I6GA 4MQ5A 2WR8A 1Z6QA 5K2OA 2VDWB 3QWFA 1PYGA 5REQB 3SHFA 5C3MA 2ODTX 1XEWY 2PZJA 3FGZA 2HHHB 1KJZA 4I5EA 4UCFA 3PWSA 4YPVA 1CJMA 2R6ZA 1OVGA 1YCHA 2OBLA 3R77A 1AV7A 1JIIA 1WNFA 2XKBA 3CW2A 3WDKA 3LBAA 1RYEA 3IUQA 5EE0A 3H8SA 3RKSA 2AQIA 4OQFA 1SVMA 2QRNA 4A5OA 1E5VA 3FHJA 3D5EA 2XVMA 3WHLA 4DYVA 1Z7YA 2ZRLA 4MRSA 4OH1A 1UIMA 5D3MB 5I45A 2WKQA 4Y9UA 5EQDA 2GPSA 3BQ9A 4Q4JA 5AOAA 2JA2A 3WGZA 3L41A 5PNTA 1DCTA 1EFPB 4AJ9A 1A2QA 2L19A 3U62A 4TS3A 5B55A 4KUGA 3RVSA 3MUFA 3N86A 5LYJB 3DHYA 4YXWD 1MOPA 1T5BA 1ZUHA 3ZD6A 1VGRA 4JOQA 3BWEA 3SQDA 1XLUA 2VHZA 1N3LA 3GP5A 3EXG1 4MQ4A 2QTRA 5C37A 2GETA 5F1OA 2R65A 5CA1F 3RC3A 3HN2A 2VP2A 2HK7A 4WE3A 3COPA 4L9WA 1TM7E 1LU9A 1NU8A 3F3KA 2WT9A 1Z6YA 3UJ7A 4CTKA 1U2ZA 1M5TA 4HAXA 5IJXA 2QSJA 1V3UA 1A76A 2QXTA 4LC9A 3VVBA 1XRMA 2B9EA 3KOMA 1R5JA 2CFCA 3M70A 4PC7A 3WHPA 1MUUA 3WLMA 5HSGA 4Z8XA 5JMWA 1E7MA 3DFMA 3E23A 3IP1A 3NHLA 5TPZA 2EZ4A 1Q22A 3U4QA 1ZR2A 1NWCA 4YRCA 4Q9HA 2P5YA 3E3LA 3Q7RA 4KODA 4R8RA 2CFTA 1QOQB 1XALA 2J4CA 2WWRA 3BB3A 1C1DB 3JQFC 4XKJA 1UWLA 5JC1A 2PRYA 4MLCA 5G3ZA 4GI2A 3OTQA 5EP1A 2IX3A 4K1LA 2GEBA 1ZKMA 3C6KA 3PGXA 4BTLA 3PDIB 4MUJA 4A6EA 1RXIA 4N6NA 3FY4A 2VF7A 1DCMA 1PK8A 2O7QA 3KEMA 4Z3DA 1L5KA 3TAXA 3TF5A 2F3QA 3WL7A 4JUBA 4Q1DA 3GVHA 2Q4EA 3MCZA 2P6MA 4BQPA 1W4CA 3OUUA 4I4CA 4N5DA 4GZMA 1S1CA 2O5CA 3BJEA 1CWUA 5J1SB 2OGSA 1QHIA 1OASA 1ZA2A 3FF4A 1D2AA 2XWJI 3KQUA 1S96A 5EWJA 4BB5A 2J3IA 1OC4A 1ODTC 4J0GA 2PCLA 4QRIA 2Q4RA 7MHTA 1KBZA 3ZDDA 2ZB7A 1BS2A 3BMQB 4YAWA 3KPUA 4X94A 2Z3ZA 2D1TA 4RJ2A 3Q3VA 3BBLA 3WLTA 3QG1A 1H2EA 4B71A 1LNSA 3KQQA 2DZDA 5EE1A 4ZIRB 4AKSA 3OCJA 4WT7A 1XZBA 2XNJA 2I9KA 1NP7A 3GJXC 1QO0D 3QLTA 4INAA 3VTFA 1TUBB 2VJCA 3MMNA 1E2NA 4F71A 5DW0A 3ZI4A 2VQFB 5EFZA 4F3RA 4TXJA 1U7DA 3JVDA 3VNAA 2V55B 4KSCA 1HGXA 2B1QA 4G67A 5ULLA 4GF5A 2BMEA 2YS6A 4RUKA 3V97A 2FZLA 3N39C 2G06A 1L6IA 4LGMA 5B7PA 1H3FA 1XWWA 5J1TB 4KL8S 1PGOA 4FFWA 1MABA 1MT3A 4LHXA 2DAPA 4BO8A 1RNLA 2WPDD 3GFTA 5HQJA 1IBKB 1S3FA 1ZD4A 3L0PA 2XNCA 4MH0R 4XD2A 1QF9A 3R7WA 3UFXA 4ZVQA 1QB8A 4BMSA 4NYMR 1R6VA 2OG1A 5TJHA 3QVJA 1PZNA 3IULA 3L01A 2HDWA 2I1QA 3LQ4A 3ZE0B 5AUOB 3W2GA 3SHVA 3KEQA 3L0IB 4O4LA 1WIWA 1OX4B 3NYWA 1UBTS 2FW6A 4GE3A 4OM8A 3BHMA 4ND5A 2ZXUA 4CF7A 4GRAA 5JANA 1PW5A 1XLTC 5KNBA 5EUBA 2FFJA 1ORIA 2E1RA 4OI1A 5GVRA 3WQBA 3ANYB 3NV7A 2QAIA 5LZ4A 1GSAA 2XZPA 2A1UB 3RU2A 1GQRA 3B1ZA 5SZIA 2MSNA 3QP9A 1YDFA 3GROA 1P18A 3B1FA 1YULA 4CKZA 2ADMA 2ZJ5A 3UJDA 3V9AA 2RH5A 4EGQA 3TM4A 3EPKA 2WYUA 1ZAKA 1CYEA 1C0LA 1R0XA 1DG3A 1VPEA 3P9CA 4G5OA 2PA0A 3KZCA 3PD1A 1S01A 3LRPA 3NI2A 4R40A 3REQA 2X2PA 4LHEA 1Z7BA 4KTTE 2LP4Y 5EWMA 1KOFA 1GYPA 4A15A 3N2GB 2FN8A 5IBRA 1JFVA 5C8ZA 2JASA 4KWIA 2AOUB 4AMZA 1WF3A 1D6SA 1G8HA 5KX5F 1UKYA 3PGVA 4TTJA 3L6EA 2O3RA 4LY0A 4WEOA 5TNXA 4PLZA 5AQ1A 1IAVA 3L6UA 3AF6A 3LRTA 3MMSA 5JC8A 3MB8A 3UV3A 3L9XA 5GJCA 2Q1TA 4DA6A 4D9IA 3FVVA 1J8FA 2ZVJA 3CQ9A 1GG9A 4M1QA 4N01A 1GCOA 1Y7LA 1JAIA 2OZLA 1ZI9A 2M1XA 3E3NA 3H3XA 2AEMA 2VJKA 2X0FA 1EAYA 1TLTA 2PH3A 5A1JA 4AJJA 1ZGJA 3I1YA 4BNVA 1JAZA 5ED4A 3NHBA 3N75A 4C0BA 3OQMA 4ENWA 3OIWA 1ZCBA 4YHHB 5JSZB 2Y99A 3H86A 4GLFA 5F2EA 4KGVA 4NDZA 4AKTA 1K7XB 3K20A 4LBWA 2A14A 3ZDRA 4S35A 3EVTA 2WOOA 2N3ZA 3RRBA 1U28A 4AZ0A 4CM8A 4NU8X 1FPMA 4FIDA 5TB5A 4CCAA 4QOJA 1R6XA 2RGEA 1P5HA 3J7TA 4NFHA 4PLFA 4QUBA 4PN7A 1JECA 3INYA 2GESA 2VYCA 3VGJA 3RGWS 3UM9A 4LGVA 1ZL0A 2FW7A 1QZUA 4S04A 4AKGA 1I2AA 3GZ4A 1FP2A 5JAUA 4TXLA 1Y1PA 1GSIA 1RT9A 1XCBA 4IZIA 1K5DA 1R6BX 2CBZA 4FEAA 2QOEA 4YCMA 3U4IA 4RTPA 1DKOA 3CZCA 3GRRA 3NNNA 4IAOA 3HWWA 3H5VA 1RM3A 3IVAA 4GPTA 3ZNQA 1L8XA 5KOIA 2E87A 3U56A 4MQUA 3GJ8A 3GLQA 4G84A 5FNVA 2G70A 5AKIA 1UMBA 2ZVQX 3MOGA 3KZVA 2OGWA 3NKVA 4L57A 3TSOA 2I65A 2VAMA 4WK4B 5LUBA 4DZRA 1PTJC 5JRZA 1EFAA 2XECA 5JS7A 4IIUA 2ZYDA 3CR3C 5EKDA 3U09A 2RBEA 4YQYA 4RK6A 4P0TA 1NYQA 3VOSA 3M4ZA 2GILA 3I2KA 2I62A 4M46A 3GRVA 2ES4A 4OGFA 2I1LA 3Q9SA 1QNLA 5JCOA 3EISA 3VSDA 4R7TA 3WLJA 4C7MA 3GA7A 5A5EA 4CNBA 3I9LA 3NAMA 2XVAA 2F9LA 3KDSE 5K6AC 1LI7A 3KQSA 3AEKA 3LTEA 1PFVA 4P3OA 1ZRMA 3FUUA 1LSOA 1MORA 2W22A 4N03A 5DNDA 3AB7A 1JR6A 4LWQA 1J99A 3ICVA 1J07A 3OETA 3MF4A 1NE7A 2OHFA 1JLHA 3U44B 4DNPA 3UO8B 3CX7A 4UBKA 1ISJA 3UOWA 1Z82A 1C0PA 1PBNA 3FDIA 3FGPA 3FUVA 4WZBA 2NTJA 1UC9A 3SHOA 4RK4A 2HQRA 4ITVA 5EP3A 4ZAXA 3D3NA 4Z8YA 4L6AA 3MJSA 1EQ2A 5CB0A 3OM0A 4XX0A 2GPAA 2IPAB 1U8TA 2EP7A 3C48A 3SYNA 4CR7A 5ELXA 1K7FB 2ZJ4A 4GPBA 1OFUX 2F64A 4TMKA 2J0SA 2PS3A 3RW9A 4Z99A 1Z6ZA 1ZW6A 2HEGA 3FTEA 1XU9A 4LS3A 1LLCA 2YWFA 1UBSB 3WKCA 3HU2A 1KO1A 2B7BA 1C8KA 4HFNA 4U7TB 4NU6A 1YZNA 4L8LA 5I51A 4BHTA 1OBFO 2FWBA 2JL1A 1E2UA 2XA2A 4GPAA 4YASA 2P9GA 1T4DA 4FJ0A 1J2YA 4X8HA 1I33A 1X9IA 5I4BA 1WNTA 3KDPA 3IAEA 3C6MA 1CUEA 2IEYA 2XKKA 1LF0A 5EPUA 2J5RA 1K4KA 4KB5A 3GBVA 3AEUB 3RFVA 3ROZA 5BSFA 4PC2A 4RACA 5JZBA 3M6UA 1E5TA 2Q8NA 2FVXA 4TPKA 3IGFA 4ZQIA 2D62A 2XQVA 2Y77A 3KC2A 3JALA 4BX3A 1PWEA 5D86A 2E82A 4CV1A 4CQMA 2W2NA 1G8FA 3NEJA 3EC7A 2Q0QA 4ZYXA 2B30A 1YDMA 3NG1A 1TX4B 3PNSA 4PFSA 4ENUA 4NI5A 5IT5A 5JEEA 4M0MA 5ED0A 1AJEA 3R4VA 3FMVA 5BQPA 5JE8A 2ZITA 4H17A 3T15A 2XYQA 4QLOA 4GPEA 4WKPA 1JQ3A 2GJ9A 1T2EA 1YJ8A 2H85A 4M8SA 3SYMA 3WNBA 4OB7A 3LUFA 4HL6A 3Q3IA 4MRPA 4TRNA 4ZZ2A 1KAHA 3RJZA 4URVR 3JTEA 2QX6A 2JW5A 1A96A 1DQNA 3EIUA 1BCRA 4LUCA 4MWSA 4B48A 1I1OA 2JGFA 2ZTVA 3E7PA 1XMJA 3HDQA 1HDCA 3N6VA 4MWZA 4YJ3A 3QU7A 2ACWA 4GMGA 1K7EB 1SKBA 4H1HA 4RPKA 3W2EA 5ELLA 3KKQA 1BWPA 3BWXA 2IYTA 2XLBA 2H1WA 2ENUA 3PNMA 4P80A 3S1LA 3N9IA 2P3QA 3AG5A 2FEWB 5EHIA 1L4HA 3DDCA 2P9YA 3JWPA 3OX3A 3T7RA 3SC2B 1GN9A 4CE6A 4DLRA 1TMGE 2V7WA 4NIMA 4DWOA 2JJ1D 3QUAA 5JY6A 1RXUA 4CEIA 2C92A 3HO6A 3PTAA 1YVUA 1XQXA 1YZLA 1DG1G 1QV7A 2RGNA 3K72B 4LDRA 3WGGA 5CDGA 5B1EA 3AI1A 3VHXB 3ZU2A 2BMFA 5HS6A 2QJOA 2QZZA 2V8OA 2DFKB 1E1CB 3KR2A 5CLHA 4U00A 4WZAA 1CERA 1MAVA 1R0CA 1O95D 4G3XA 1MLDA 4KO2S 4OLHA 3B70A 3TIXB 4CTOA 2QNRA 1XVAA 1UXHA 3FAZA 4GBGA 4NBNA 1J56A 3VU8A 1L5RA 3Q12A 4MEJA 4ENVA 2ZRBA 4P6VF 4HDQB 4YJDA 4AZTA 4KMMA 1SCAA 1YZTA 2AQKA 4G81A 3JWIA 5JTUA 1FLAA 1TVMA 4G56A 3P27A 4A2QA 5KYYB 1T9BA 3F9CA 1LF5A 1VHDA 1H22A 2ZIWB 3IHKA 4ILKA 4K88A 4CM1A 4DBLE 2OHHA 2YOFA 3E3OA 3E8XA 1TQ4A 1BE1A 2L69A 3N8GA 4R3WA 4JGBA 4BQQA 3JQAA 1Q0RA 3DEYX 1L0BA 4OB8A 2EKLA 4ME6A 4YUZA 1NONA 2C5AA 3N8NA 1B74A 3BRWA 3KVNA 2DT8A 1DQPA 2X9GA 2QUHA 4Q39A 3CBGA 4IGIA 3FB1A 2C2MA 1CUBA 1TA9A 2AUNA 4LBZA 2GPJA 4RADA 2H1SA 4AJOA 2IYSA 3ZXSA 1NXWA 3B1WA 4WVFA 4O4JB 3O26A 3Q8XB 3I04M 4D8YA 3QA9A 2IS1A 2CHQA 2W6ZA 3P9PA 3FX2A 1CVRA 3HBNA 3GGDA 2ZE5A 2HJRA 4XOIA 4F46A 4RPGA 1OXTA 4BIMA 4B31A 1QX4A 2Z83A 1XGKA 4O4HB 3U0BA 3TDMA 3KQTA 4X6UA 2P2ZA 4EQ6A 1P1BA 5GQSA 3KCNA 3LHKA 3OMXA 3BGIA 3QBEA 1G8SA 1PV2A 1GOTA 1ZN8A 2AQ8A 4GWLA 4H4CA 2F90A 4IO0A 4UU8A 1JRLA 4UHCA 2GK6A 4WDRA 4FGLA 2G4VA 1EQAA 3QV1A 1DOHA 1W52X 2YCBA 4MR9A 2CK3D 1QP8A 3ZUGA 1CY0A 1I1NA 1XHEA 2ZB4A 5JXHA 4BQRA 3EIHA 5EMHA 3OLQA 4RIFA 2CLLB 4YCNA 4D4HA 1XNQB 1VPLA 2BZ1A 2GVZC 2WHXA 4FC7A 4MAAA 4UTXA 4WUVA 4ZU3A 1XXHA 3SXPA 5AVXA 1HV8A 3M5CA 1H4QA 5C81A 5JYDA 1II8B 2Z8XA 3A3PA 3DV9A 1M74A 2FKAA 3KKZA 4KQKA 3B3JA 2HBRA 2YV3A 3COVA 1ZGCA 2HJSA 3DL4A 3OZCA 4MKZA 1MTZA 3EVEA 4OATA 4JEMA 4NP6A 4RMIA 4X7PA 5M5BA 3JAWB 1NAIA 1L7NA 2GM3A 3BDAA 1KY3A 3EZXA 3H9BA 2GD6A 1QORA 2IU6A 2YINC 3FLMA 4HYYA 4Q15A 4REQA 1SAYA 3E61A 3PQ3A 4WTOA 5B3AA 4PN3A 2J87A 2CHFA 1JEJA 1XJWA 4UDOA 3L2OB 1OW3B 3NTRA 1JXMA 5DNVA 1DEKA 2UYQA 2KS6A 3W2HA 1IY8A 2Z2IA 2F3PA 1XVLA 4ZOAA 4P3KA 4L27A 4BATA 2ZRMA 3R3YA 1M72A 2PXHA 1Z29A 4HWTA 3IV7A 1IVNA 2HV8A 4KI7A 3W79A 3KSRA 1ZD5A 1L3CA 1QYWA 2CD7A 3PPXA 4FYVA 5C8YA 5DNAA 1JHPA 3KFXA 3BERA 3T7KA 3CUEF 3GK3A 5FI5A 4Z1MA 3ROEA 5JHGB 4OG2A 4D25A 1I7PA 1U0LA 5K3OA 5CITA 2NV0A 5G53C 1E58A 4HDKB 1DX4A 4NAUA 4NLLA 3VZSA 4IRMA 1WW2A 1GUZA 4M0DA 4BMXA 5JFGA 3B12A 1W87A 1ZOSA 4BO9A 2M2IA 4N54A 1HK7A 2Q3LA 1H1DA 4BNXA 3MT0A 5ARDA 4FCCA 4E5PA 1QV6A 2NIPA 3WGHA 3VR3D 1DXQA 1X92A 2GHRA 2CUZA 4EARA 4JIGA 4X8LA 3WLEA 3F0TA 5C8VA 2IUSA 3LY5A 1Y8QB 2J30A 3OEHA 1OH5A 1W85A 1WY7A 1F2UA 2OESA 1M1YB 5C5EA 1QXSA 1TKAA 3FKJA 5ILGA 3QM1A 3BH7A 1B8PA 3UC9A 1JIQA 2BF7A 1DQYA 1VG8A 3PFNA 5AIBA 3JQ9A 3T0FA 2O8EA 1QQ6A 1W6UA 1VXRA 5JHHB 4MVCA 5JARA 3K2BA 4DNQA 3UJ8A 5D01A 5AM5A 1PR6A 1XEWX 2F1JA 5CH3A 1H8ED 4EB6B 3MB5A 1QQ5A 1A27A 1QAMA 4FNGA 4L3WA 5DBIA 1TOAA 2EZ9A 3N7UA 5L3VA 1C0EA 4OHFA 1ZM2A 1BHJA 2Q1UA 3A3YA 4UREA 2OKGA 4IG4A 4ZAWA 3WWOA 4QPPA 4ARZB 4EHNA 5E6RA 1CZKA 1GG5A 1A5BB 3OJEA 5LA6F 3AHCA 4O2BA 5JNUA 1RYMA 3H3JA 1PFWA 3P4YA 4KFCA 3SAJA 3D0RA 4NICA 6NULA 3VOAA 2WZDA 3BXZA 2P75A 3H1EA 2HSZA 3EYAA 4EKDA 4MVYA 3UQZA 1Z8FA 4OK5A 1WXFA 3G68A 3FFWA 1DC4A 5IBCA 3LGXA 1VJTA 3CKLA 3I8SA 4OAPA 2ERYA 1KSJA 1Q92A 2QTGA 2LE0A 3MMXA 1G5QA 1C80A 1OWLA 3HXOA 3ZD7A 2ZXFA 3H83A 6LDHA 3JRXA 3RHFA 3MTEA 4FR2A 1Q2UA 3LT2A 4OA5A 4U63A 4F9GA 3RUHA 4FGUA 5JALA 1LPMA 3V1NA 1PEYA 1JA9A 2HSDA 1SXIA 2PZ8A 3MRVA 3R24A 5C1DA 1IN1A 1OAAA 4DSZA 1OA0A 5IAJA 3HADA 1WKVA 4EBFA 4OI0A 2VN8A 3Q5DA 1FA9A 2FOLA 5A9RA 1XPRA 1YOVB 2WF5A 1S5PA 3ROKA 3T1QA 4FHCA 3THXB 3J81k 4YAKA 1QDLB 1SG0A 4N0EA 5GIOE 1OIVA 1HI9A 2WINI 1I30A 1CIPA 1O03A 1P29A 1X7WA 1RHMA 2GN4A 4BLVA 5AW2A 2DFVA 4D9EA 1CRPA 4LE2A 4C14A 2HSGA 2IYNA 1A50B 1JZSA 3QKRB 2QB5A 3GJQA 3FYSA 5HR5A 2Y6UA 4XM2A 3GB9A 5A5FA 4EUHA 3D7SA 4EG1A 1YS7A 3RS0A 1OWNA 4F2GA 2NVWA 2ORVA 4CCYB 2ZU6A 3K0AB 3W77A