3OOWA

Octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from francisella tularensis subsp. tularensis schu s4.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
SVQVGVIMGSKSDWSTMKECCDILDNLGIGYECEVVSAHRTPDKMFDYAETAKERGLKVIIAGAGGAAHLPGMVAAKTTLPVLGVPVKSSTLNGQDSLLSIVQMPAGIPVATFAIGMAGAKNAALFAASILQHTDINIAKALAEFRAEQTRFVLENPDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase,catalytic subunit
publication title Octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from Francisella tularensis subsp. tularensis SCHU S4.
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 47
structure length 160
sequence length 160
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 3oowA00
2FW9A 2FWAA 5CLJA 2FWIA 1O4VA 3OPQA 3OOWA 1XMPA 1U11A 2H31A 2FW1A 5CLHA 1D7AA 2NSLA 2NSHA 5CLFA 5BOSA 3LP6A 2FWBA 5BORA 2FW7A 4Z7JA 5CVTA 4AY3A 3ORSA 4YCCA 3RGGA 2YWXA 5C5DA 4YCJA 3KUUA 4ZK2A 2FW8A 4ZC8A 4AY4A 2NSJA 4GRDA 5BOSB 4YCDA 2ATEA 4ZMBA 5CTJA 3RG8A 4ZJYA 2FW6A 5CLGA 2FWJA 4JA0A 5CLIA 4B4KA 2FWPA 4YCBA 1QCZA 3TRHA
chains in the Genus database with same CATH superfamily
3G5TA 1KZGB 3N8NA 2O9JA 4BXOB 3VTAA 3KB2A 3L1UA 1A71A 1D2AA 3L07A 4ZT6A 2Q21A 3FW1A 1P4GA 1M73E 3EXHA 4FUTA 1NDHA 2X2OA 3DBHA 1XROA 3E22A 3LPDA 3ZK8A 2FUG6 1UPTA 2B5VA 2KHZA 3PQ3A 2NXNA 1ZJYA 2E4UA 5KHLB 2R8EA 4S1VA 3EXEA 1BRMA 2DJIA 3ZIAA 5KTYA 2E37A 5BN3A 1B16A 2CLCX 1GFZA 3HXMA 1Q57A 4P3OA 3KVNA 3FHOA 3QW2A 1USIA 3BBLA 1JEQB 1P9NA 3LQ2A 3PDIA 1LF5A 3ND8A 5HCNA 1SC4A 1T5HX 3RH0A 4G5SA 2NU8A 3UA4A 2BUBA 1A69A 1DELA 2G7MC 2CFTA 3Q15C 4UEJA 3WNQA 4AZ3B 3HCDA 4DLNA 1H6BA 4XSHA 4D57A 4F3KA 3URKA 2P4QA 1F4PA 3ZWMA 4TL6A 1G5QA 3A9UA 1K0UA 4MV9A 2GN8A 1KEEB 5FUYA 1TOAA 1P5FA 2A67A 3GRAA 3PTAA 1E7MA 1R4NA 1ZGAA 2QN6A 4CIWA 2IOFA 1WY5A 1J0AA 4XQ0A 3TLJA 1CUDA 4JK3A 4NBRA 5ALIA 4XD2A 4WK6A 4AWXA 2O5RA 5K8IA 3PFCA 4TMVA 5L51A 3MJDA 4DMKA 3G5LA 4EX7A 3QKSB 5TQ0A 4R4JA 3L40A 4IHJF 4G0UA 5HCIA 3C6MA 3C5WP 2JHGA 1YRAA 4R2MA 5JIBA 3WZ2A 2W4QA 3D9QX 2QA5A 4EVSA 4TXMA 4IUCS 2XZDA 1IDN1 2O1XA 3V4SA 2Q5IA 1JA1A 1BU5A 1WOYA 1FTSA 2QK4A 1RBQA 5E38A 3TSYA 4C7KA 3F3SA 5KOIA 5AW1A 2LCIA 1Y89A 3KWFA 3PGLA 2HK6A 2QVZX 1WXEA 2ZR8A 2HXYA 4NPAA 4C7OB 1LSUA 1UINA 4C43A 4ACBA 3RYCA 1X8LA 4P53A 4AQ7A 1MC1A 1J8MF 1JHVA 1JU3A 2FDXA 1NQAO 2FI1A 2GN0A 3FDFA 1E2IA 4G23A 1QHHA 1VLLA 4IZIA 4XB6B 5JCJA 2IHKA 4BEBA 5JANA 1I7SB 1WPRA 3A1WA 1R4AA 2PR7A 3E9QA 4V0KA 4UMVA 4WINA 5AK6A 3CY6A 5LYYA 4EG3A 1AQNA 3WGIA 3AHIA 3HWX1 4QU9A 5TQ2B 2QZJA 2EHJA 5JJCA 1G7SA 4MQFB 3K2BA 4F5WA 4K6FA 4LX8A 3ZCTA 5GONB 1P5HA 4YNBA 5EJ7A 3LUGA 4AMUA 2ID7A 2HU8A 1I4OA 4UTXA 1CQIB 4N0MA 1RABA 2V58A 3B6KA 1PK9A 4O4LF 2IXEA 3GOHA 3HNRA 3O8DA 1KH1A 1T3LA 1U0OC 2H18A 4JCCA 4P92A 4LECA 5K0LA 4B8ZA 4EVIA 4YYZA 4Q93A 2D7JA 1SEPA 4J1NA 2P69A 2F1KA 2AN5A 4LVCA 5A4IS 2WSYB 1KAQA 3G9XA 1EXMA 3PUHA 3THWB 1DWQA 2YIJA 3GRFA 4UAJA 4KOAA 1KJYA 2WJZB 4ARAA 3WAGA 1BYUA 4R0VA 5AQEA 4CCWA 1E9EA 4DIDA 4JJ4A 5JO9A 4KVAA 1PUJA 1IAQA 1OCEA 1G4UR 3GLIB 1R6DA 3HWWA 2G40A 3TVYA 3WA6A 4J3NA 3RVPA 1Y7IA 2R6JA 2AUTA 4KWEA 1TPZA 5EKDA 2ZIFA 1Z6PA 1FY2A 2HHJA 2NPOA 1DPGA 1U7HA 2INGX 4Q4JA 1LJUA 1MQ9A 1N3IA 2B8EA 1KMHB 2VHVA 2PUWA 2VA8A 4NMMA 3UMSA 4DR6B 1OI3A 2PMKA 5E7JA 1K68A 5HDBB 1QJ4A 1NJ5A 2H48A 1T25A 1ORDA 2VK1A 3ZU6A 1IEVA 1MW9X 5CAEA 4GR9A 4LF8B 1PWHA 2VDOB 1JL3A 2PL3A 2VZLA 3OU7A 1JZTA 4FGUA 5J40A 2E4YA 3S4YA 1OLUB 1A2OA 3C15C 2OBYA 4X7PA 1EEHA 3HCWA 5EPUA 1MH1A 1UDBA 1PJTA 3W3ZB 2ZPUA 5JXJA 5ARBA 5C7IO 4LI0A 3O9ZA 1J70A 1HXHA 3I2JA 5HIMA 5JXWA 1QV7A 1RYYA 1TAGA 1AS0A 1W25A 4NJEB 5C7OO 1QRTA 1NZDA 2AX3A 4C4AA 1TECE 3OJ0A 4FMDF 5EY5B 4IFTA 4M1EA 1TAQA 5LP6A 1GWNA 3D8TA 2CV1A 3D7RA 4DDHA 2J9FA 5HJ7A 1E2DA 3B20A 3PQ6A 3DM9B 2GMWA 3DFKA 1QG4A 5LJLA 2Q4TA 1I94B 4KRYA 2PWZA 2ZJFA 2PMEA 4CKYA 3OIGA 1YQEA 4FMCB 1RC0A 3ZZMA 3FTFA 2H7VA 1DRUA 3A9CA 3LNTA 1B6RA 5H9VA 1PK8A 4ZV7A 2O0LA 6LDHA 1LRLA 4I4TF 4N3GA 2V7WA 4RWZA 4ILKA 4IFIA 3W05A 4YRNA 1RWPA 3AU9A 3FRIA 1N78A 4M38A 4IBOA 3I6MA 2QWXA 5CP8A 2ZAOA 5JC1A 1LQ2A 4XGQA 4E33A 1TM2A 3D5EA 1TF5A 3ACDA 3QKWA 1V0JA 1RTKA 3MK31 1FMFA 1H6CA 1AKNA 4FONA 1TX4B 4M7WA 3Q0IA 2QM8A 4YXFA 4KIJA 2CE7A 1ECLA 1PHRA 1Z82A 4L5YA 4OGFA 5IAAA 3FOFC 3CWZA 1Z0IA 4QUGA 2FZGA 1N2SA 3TGLA 2G71A 4X44A 1T5TA 2HA4A 2VP2A 2JJMA 3TI7A 4YT5A 3RK4A 1KBZA 4WVFA 1NVVQ 1LV7A 3Q87B 4IHQA 5F77A 2R8OA 3MCZA 1DBPA 1DJQA 1HOXA 4WIAA 4GAEA 1IQUA 1QHNA 2HXGA 4LV5B 2QTRA 2D00A 3ZCSA 3ND6A 3GH1A 4BZXA 5HUJA 3GU3A 2A0FA 1T0HB 4BX9A 1FVFA 3G2QA 5L9AA 5DK6A 3EVZA 4AFNA 5DPMA 1AU9A 2OENG 1L5RA 3WGYA 2HJRA 1TTPB 3AJEA 3CBGA 3U4AA 4B75A 2NUBA 4DA8A 5AW4A 3EZFA 3P0JA 4OG2A 1HYEA 3O74A 1XVLA 3F8WA 3RWOA 4EHIA 3WBFA 3GLIE 3U39A 4ETNA 2LTAA 4CTOA 1AQJA 1E64A 5G41A 5JS2A 1HI9A 3QVUA 1JR3D 4TTPA 4AICA 2Q49A 4UNPA 3WJAA 1P2BA 2R60A 2D1SA 3QF7A 3BGWA 3WLRA 3KOZA 4ZYUA 4KRFA 1L3BA 2Q2OA 3I0ZA 4TWZA 3TBHA 1VCMA 6ADHA 1PKXA 4OK5A 4JFRA 3NASA 3TGPA 1QFZA 5M29A 1KHTA 2EAUA 1DTWA 3OU2A 4URVR 1Z07A 5FEUA 4KHZA 4AYXA 4CEHA 3ABSB 2HJGA 1I6KA 3MOSA 2O2XA 2WMYA 3LXUX 2AC4A 3OVMA 4O1MA 4OUKX 5J4HA 3VJLA 4IKPA 1IQPA 1CZUA 5E9JA 4KXNA 4JYZA 3M70A 1X7XA 4YCBA 2WMNB 4DJFC 1JLLA 1LQTA 1A98A 1K7YA 1WMEA 3H16A 4MGEA 3TRKA 1II0A 5AHWA 1TVEA 1R0ZA 2YHSA 5EIOA 3SBXA 4RTJA 4I5EA 1WCXA 5JAIA 1D04A 1ZVJA 3T3HA 3HMQA 1L7EA 5LOVA 1CEQA 4U39A 4EQ6B 2FPIB 3H83A 1W94A 3MLEA 1J6UA 2WD7A 5KCZA 3T5AA 2CZGA 1ST3A 3OJLA 1KGSA 2F4VB 1TAHA 2OZEA 3T5BA 2IJGX 2Q9BA 2VI5A 4BX8A 4Q7JB 2Y4NA 3WP1B 4IO1A 5KAMA 4UBLA 1J99A 2NSJA 3BCUA 4INZA 1WSDA 1XK6A 2QN3A 1RXVA 1MVLA 4CVNA 1W8IA 4X0EA 3M5PA 3CX3A 1NUHA 2XQIA 3MJCA 4HNGA 4I81A 2GETA 4AROA 2XWPA 4KWTA 5CURA 1KWKA 3C5VA 4NNJA 4F6RB 1NP7A 4AN4A 3LHKA 3PJRA 2OFFA 2ADOA 1MLDA 2VCEA 3J81k 4OLAA 3O3NB 3WNVA 1OTHA 1KK1A 2IT1A 4KUEA 5EE9A 5I7AA 2FRDA 2QSYA 3V32A 3WGKA 1RYBA 2W98A 3QG1A 2PGNA 1D2CA 3BSFA 1DO0A 4OFBA 3TLCA 2PSEA 5DN6D 2P9YA 2G1PA 3OTIA 3VTZA 5IYZF 4A82A 3AEUA 1ML4A 1XQVA 4FFSA 5G3YA 3WR5A 3P2IA 1NR7A 4M0MA 5FTJA 1KY3A 3AUJB 2IUYA 4G89A 3HZHA 1R8JA 5L3QB 2MSLA 2WKWA 3I4FA 2C3UA 3QELA 4P6VF 1IAVA 1LU9A 4BE4A 4W6QA 1YVRA 5DBOA 1NATA 3WGJA 5MDHA 1A5SB 2KLBA 3WA7A 2ZI5A 1O7JA 2H9IA 4D02A 3AP3A 1L5OA 3HU3A 2GBLC 1NA5A 3NHBA 2AEEA 4LFCB 5AICA 1REQB 3EE6A 4G86A 3BWBA 2IEGA 3ZZTA 2O4UX 1WKCA 1PD0A 2R00A 2A84A 2GJ8A 1MO4A 3Q7RA 5DHTA 4OB8A 5D8DA 5E3IA 2FZ5A 5JOQA 4MV1A 1ZJZA 1IB6A 3LXRA 4XARA 3E4CA 3CYFA 2ZKIA 4JXJA 4TTQA 2H0RA 1O4WA 1NR1A 2XJ4A 1E92A 3T5CA 1P80A 1V7ZA 1H2ZA 3ZBUA 5DHQA 1BCSB 4LQDA 5FYDA 2G76A 3M6FA 1VGQA 3KT6A 3KB8A 2NO6A 2IHTA 5FNVA 1L5HB 1VXRA 3SYKA 4MRMA 1H1TA 1N8SA 2ZWPA 3OT5A 5DX8A 3SK0A 1EK6A 1H4VB 3WK4A 3OFND 3TX2A 5IFLA 2V7QA 2D0PB 3NXKA 5AI0A 3TDKA 2J3DA 1Z7WA 2FFQA 3HTXA 5B53A 3JZIA 4WESA 2F59A 3KR0A 5AVJA 3HVKA 4C4RA 1UKVY 1V3VA 3DNMA 1UBSB 4H7IA 4WI1A 1QORA 4JGBA 3K8YA 1HSOA 2ISSD 4C88A 2H1FA 5HOQA 4ARCA 1ZUIA 1RCFA 3IT1A 3N8IA 1DS6A 2PKRA 4MUAA 2IL1A 2JRCA 4OXQA 4PEVA 5BV2P 5L6MB 3I9MA 3K6SB 1NW6A 4CMEA 4H3VA 3U1TA 1DT3A 1D3AA 4ADSG 4EUKA 4F8JA 4B6RA 5BUQA 3ECCA 4EFNA 1D4AA 2XUQA 4GOKA 5A5GA 4QLBA 2JGKA 2Z8YA 5CNMA 3CZ9A 5ENDA 3OLWA 4AKIA 2QYTA 1WO8A 4B71A 2C42A 3L02A 3WGVA 3LLVA 5A9RA 1DEOA 3LPMA 1QRSA 3T3IA 4MGZR 3C3AA 5KU1A 1DCKA 3L7OA 3O21A 4BQOA 2FYTA 2ZIEA 2QZ4A 3IMKA 1JFRA 2P9ZA 4C1NA 1PVOA 1V1RB 3G02A 4WE3A 2O3TA 5DOVA 2FSPA 3VDRA 1GSHA 4BCDA 4R2IA 1C0LA 3GMSA 5IBRA 3TI9A 4B7UA 4LZPA 4KX3A 4O3MA 2A30A 3K8OE 4MRSA 1ZITA 5LZ5A 3N86A 2WK1A 4FLFA 5DNDA 2XNSA 4KO4S 3DBRA 2VDKB 8MHTA 3IP5A 3KO8A 4ZHQA 4DR4B 4ZZ3A 3QJYA 3RS4A 4ZOAA 3SD7A 3O03A 2JDIA 4X6UA 1PS8A 5L53A 4HLDA 2P0AA 1ESDA 1WNTA 1AX9A 2J8ZA 2J7KA 3DFMA 4G0OA 2O8FA 4HNSA 1B3BA 1K63A 2VHJA 3DZDA 4QU5A 5ALDA 4US2R 3BRWA 5ICSA 1AHNA 2IHNA 3N8HA 5LC1A 1QS0A 2XCQA 2ODWA 4TTRA 3E3NA 4FHDA 2ZT7A 1W59A 3AVOA 4LF7B 3BGSA 1OV6A 1N9KA 3IAXA 2QLNA 3VAAA 3DEAA 2DTDA 3KYBA 2HQOA 2PKYX 2EP8A 3LBYA 3TTVA 4I19A 4G1CA 1KTIA 2J32A 3OZFA 5A6SA 1SXJC 4PXAA 1VYVA 2FEAA 4FYIA 4IIBA 2D54A 5KNBD 5D1NA 5ADHA 5AVRA 3WC4A 5F21A 2W58A 2CMKA 3AY6A 4IJKA 4INJA 3THSA 1UDAA 1QG2A 1ORRA 2LWIA 3MWJA 5GJVC 3S2FA 4DJ5X 3H87A 3PX3A 4U6SA 1GM5A 3FNQA 4EHNA 1LVUA 1WZ2A 5EJ2A 1SUWA 3B1ZA 4Z54A 1HDEA 2I4MA 2DBRA 3DLAA 2HAEA 3GELA 3T61A 4DY6A 3I5AA 3TDMA 3P71T 1YC2A 3JQAA 1F2UA 4YR7A 3HO8A 4IIJF 2Q4OA 2B99A 3NUGA 2EZUA 1JLRA 1C0EA 2GEJA 1CY2A 2WJ3A 4OMUA 1FNDA 2X8JA 5I7RA 3Q8MA 2QRJA 4R54A 3NWOA 4WA7A 1MZPA 4BP8A 2IYEA 1PSDA 5DHPA 3DVSX 3AKCA 3S2GA 4XJXA 2DPYA 1T36A 3DLBA 2QU8A 4EHJA 4X61A 4R2LA 1RQ2A 5FPYA 1NQTA 3Q3VA 3AK4A 3GFOA 3H2ZA 4RA6B 4RETA 3SJAA 1SCIA 5JDIA 4GKKB 3K5HA 4OOEA 1BVUA 2XVMA 1I3KA 4K6CA 1S9DA 3VO1A 2FCAA 5LLDA 1C7RA 1GRNA 3PRKE 4KN6A 1WW2A 4OSEA 1V37A 4QOSA 3UAXA 3JVUA 4WXHA 5DIZA 2DPLA 4F1KA 1ZOPA 1PNVA 3KEFA 2R1UA 4RGBA 1XRRA 3FTNA 4C0SA 2JB9A 3AR5A 2I7XA 5FAKA 3HPQA 3SHVA 1HQKA 3BHNA 3VKFA 2DAPA 5I9BA 1TC2A 5IJWA 3QYFA 4QWWA 4Q16A 3IKJA 1RKXA 3LLCA 5CXUA 1OH5A 1DAMA 1E2PA 4TV8A 1KOGA 1AVTA 1WCWA 2YVKA 3OX1A 2WWRA 4KZPA 4O4JA 1Y1LA 3ETHA 1H22A 1QLJA 2PXCA 5TVKA 2GCPA 4P3KA 4Z2AA 4YR9A 3L49A 1ZGBA 4B7AA 2C96A 1SUEA 3ZG6A 1ZD2P 5AJHA 2ZJYA 3CFYA 3VDXA 1PWZA 4EX6A 3ZUGA 3EFOB 1KQ3A 1GRVA 3JQRA 3A9WA 3H42B 3PXXA 3WVNA 5BMVA 1V96A 4NYIQ 4RDXA 4QUBA 1U7TA 2VZ8A 5GJWC 1W4CA 1RRMA 1Y0BA 5BPHA 1CJSA 2AA3A 4U5QA 1USVA 2A78A 3DL0A 1G5TA 4MUXA 2NXJA 2OFPA 3JYNA 2NU6A 4BNKA 1GAQA 2MYNA 2ERYA 1E3JA 3GGCA 3HSYA 4TTJA 3WGHA 4KTTE 3Q3HA 4RIFA 4QL3A 3ODGA 4KACA 3U37A 4G4SP 4DYHA 4UCFA 2GRAA 3IXMA 4XD7D 4YUAA 3AQ4A 1KC3A 3DW3X 4FCVA 2EJBA 1M66A 2ZWOA 5FA5A 3RTCA 4E13A 5LXTB 5GTDA 1G9SA 3KQHA 1KVRA 3OTHA 3INTA 2MWMA 4RJIA 3T6KA 4YCAA 4ESOA 1F8XA 3WK9A 2YXNA 4B2IA 2QBYB 2GZ1A 4Z8YA 1BXGB 2UAGA 2Y1LA 2YHIA 2V03A 3KBOA 4EPXA 2IX9A 5JD3A 3RFTA 3W6ZA 4K9LA 3E8SA 4N1AA 4OKNA 4OH7A 5J1SB 1VLQA 4HRXA 2Q6TA 3AKDA 2CFIA 3ISJA 4OLJA 1SU8A 4LTMA 4OSPA 3CZCA 3SS7X 1QFYA 2OORC 3WDSA 3ZW7A 4CI0B 4ENQA 4YAKA 1F14A 1UC8A 2Z5VA 1W85B 5K1ZA 4KJZA 3SC6A 3KT3A 4UJ5A 1SXQA 2WZDA 2JKYA 1RWMA 1LX7A 4IJ6A 2QLTA 3N8KA 5KNCD 1A2KC 4BE9A 2BZSA 3LPAA 2AGVA 3WLAA 1NJ2A 3KPUA 2A1UB 1J24A 2AR7A 4G1UC 2FZKA 4BFCA 1HUQA 4TWIA 1AXGA 1M2GA 1E1RD 1UK8A 2VCHA 2Z2JA 1UAAA 1KMCA 4MUMA 3OFJA 2Z3WA 5LQKA 3EASA 1KEWA 2AV6A 2PEYA 3INGA 4N3CA 1G3QA 1YD7A 3D3KA 4M0PA 3W78A 3PKIA 4F3YA 5A0VA 4X71A 5AW8A 3RRMA 4L28A 4REQB 3CWCA 1A76A 2NZ2A 1FRVA 5BV1A 4NZZA 4HYTA 1O8BA 1JEJA 4DLAA 2FMFA 3L77A 4JD5A 1OOEA 1ABFA 2PKQP 3B2EA 1YOBA 3QXJA 4KXLA 2X2PA 1UFQA 3GRCA 3D4NA 3DUWA 3O47A 2VHQA 4FR2A 4LY3A 4EG0A 5HKKA 5KQLA 4K86A 3F67A 4ZT2A 1DL5A 5K3OA 2YWHA 1ZQ9A 2IEDA 3H9GA 1NF8A 3QA9A 4JJFA 4M9SA 4Z3DA 4YT8A 3HKEA 3T7CA 1WZEA 4UZEA 4EK9A 2BL4A 3N0TA 4FDMA 3C5CA 4PNZA 1S8OA 1F0YA 3HLKA 3T3GA 3R3WA 1MJGM 1QQTA 2YYYA 3C3CA 3ZVKA 4QASA 1LDBA 1NN3A 1ZCZA 3BWXA 4TT8A 4AUMA 2C8KA 2VQFB 1OWMA 3CLTD 3FWHA 4AC9A 1DOZA 1EX9A 3B13B 2HBRA 2BFBB 1GGNA 4QQKA 1WUTA 3IFSA 1HLDA 2EZ4A 3EUFA 5LM3A 1BGXT 1KY5A 4FHZA 2I3GA 2ZJ8A 3OM9A 4WACA 4E2ZA 4EG8A 1FQKA 2H5LA 5JECA 1MH9A 3PVZA 1J09A 3CIOA 4HVTA 1Z3IX 3LRPA 3EIXA 4XSVA 1UF9A 2QQ5A 3W77A 1FDIA 2ZBQA 1CUUA 3ONDA 8GPBA 4GI3A 3HUDA 5ITZB 2XMRA 1ID1A 3DHEA 1COWA 3OETA 4GSKA 4L6IA 2ACWA 4MVJH 1P1JA 4YQYA 3W5CA 5JVDF 4NCXA 4OQXA 3VOAA 3JVVA 2CHQA 3LW7A 4E5NA 1SQ6A 4PHHA 1UMBA 3FOEC 1DKUA 1C1XB 3GP5A 4KN5A 4N5LA 3UK6A 1UOEA 2R6CA 2V7EA 3JALB 4D9BA 5CITA 4I6GA 4JLBA 2J4CA 1QGOA 2NUTB 2O8BA 4Q37A 5CG2A 2OFOA 3N0WA 1KAHA 5MF6A 1T0IA 1SKAA 1CF9A 1UJMA 3ELBA 3F90A 1M76A 2XEDA 3NOOA 4B5KA 5JXIA 3LXXA 1WNFA 1EX7A 1F06A 1DKLA 1NVKA 2P75A 2ILVA 1DAPA 1MX3A 4NULA 5FH9A 2CNLA 5CYPA 4KPUA 4QJ3A 2R8PA 3V9AA 3I01M 4QUDA 2YR0A 4FPXA 1T2CA 1W9MA 5ERXA 2WM2A 2Y1CA 4FGSA 2BGNA 3MFYA 4BFTA 4L4ZA 5FBVB 4GPZA 4ZC1A 2YVQA 5J2TF 4GDMA 5LQCA 3HJRA 1MUUA 2VQ6A 2XMBA 1ODCA 1QZTA 4V02A 4XB1A 1B4DA 2PQMA 5JCXA 2ONJA 1YMUA 3NTOA 1A5ZA 1C9JA 4RTPA 3R5SA 5M04A 3BFPA 1K7EB 3H9JA 2GBLA 3MWFA 4ITVA 3H3XA 3MUEA 3K30A 1HA3A 2OCBA 1Y5NA 4JC5A 1B8UA 3FUCA 3SR0A 1B8OA 2J0VA 3PNVA 4LHXA 5LU8A 1TADA 3A4MA 5CD1A 2ERXA 3N6RA 5EZYF 2G5PA 4ILEA 5JFOA 5T6MA 1C1HA 2WWGA 1EBFA 2FPKA 1O5OA 1KAOA 3BL8A 1WA5A 4OI2A 4HDRB 3UGJA 2H5EA 1XRPA 3K5PA 1EFVA 3LX4A 4AJ9A 3PBKA 1X42A 2UVPA 1FBTA 3R0XA 4BC1A 2AG0A 4E4TA 5I9SA 3G9QA 4R1MA 3WJ7A 3BBPA 3M6WA 3ZBPA 2IH4A 1S3SA 2XWBF 3VH4A 4BTEA 3TW8B 1U81A 1M75A 3CLUC 3OF2A 4LYHA 5CA0B 1FMCA 1MPXA 2MT9A 4E5MA 5A9SB 1Q7BA 2NZUG 1SNYA 2ZRJA 3JZMA 5IBQA 2Z08A 3UF0A 3O4FA 1R3DA 3BYZA 1NSFA 2E89A 4XGKA 5AK5A 5H3LA 4MV8A 4QBFA 4XUCA 1JLHA 5B7PA 2XE4A 5ITWA 5TB5A 4AP9A 1SXPA 5E2IA 3EISA 4ZOLB 2QZPA 4W5JA 1JFSA 4EG7A 3M83A 3O73A 3FPCA 2ICAA 4DCGA 5TXGA 3E9MA 2J5QA 2FOLA 4KBGA 2VUUA 4UE6A 3VU1A 2BEWA 4BGVA 4C4ZA 4E07A 5CVCA 3KUXA 4M1KA 2CJXA 1FRZA 2JATA 3RIMA 2C54A 4NCJA 1UC9A 1L5GB 3L7MA 4HL6A 4M0DA 4NQRA 4ZEWA 4GP6A 4M8IA 1DO2A 3M9XA 3K70C 4YMVA 1NBAA 1NUSA 4HTFB 1C5KA 4W7SA 2RJOA 3IVAA 2YWXA 4MW0A 4QGAA 5JE8A 3W5VA 5LZ9A 5B4VA 3R6WA 3OJXA 4PSUA 3HJTA 3WGLA 4QKQA 1Z8NA 4Y1FA 5LDDC 5F98A 3RADC 1BHQ1 1YKGA 2Z56A 3ABQB 2OGSA 2AXEA 3RUEA 1SWWA 4CIAA 1MCZA 2X3UA 4QO7A 3W9SA 1IULA 1L8XA 1LRJA 1ZOSA 2JASA 3KFXA 1GG5A 4HGYA 2O2IA 4KIGA 4B2LA 1QRDA 2R4TA 3PJEA 3M8KA 1DEHA 2GT1A 5H68A 3KLPX 4DLWA 2W2NA 2H1CA 1TM5E 4OI4A 1C4OA 1G42A 2C4NA 2B8JA 3G2IA 1WHSB 3FSGD 1UZMA 4JT2A 4NFLA 1XVVA 3AR9A 4QPPA 1JN0A 1U5AA 1N5DA 2WVHA 4U0KA 3WYAA 4O4IB 3ZDBA 2IZ1A 2X1HA 3D2LA 3QHAA 3K15A 4B3DA 4UHJA 4YP1A 1OKKD 3KE8A 1J00A 3QRWA 1QGAA 1W36C 4M53A 3COSA 2F62A 2SECE 2C2GA 5FTKA 3S5JA 3Q7TA 2RGAA 1SQ0A 3AOGA 5KJEA 5JZOA 5AK3A 5A4KA 1Q74A 4JH0A 1M1YA 3W1VA 4OI1A 4HEHA 2WNHA 1LI5A 3LS2A 3BDIA 3F4LA 2FHPA 5EIWA 1ZC4A 1B23P 4L5IA 3TSOA 3DQQA 4L4YA 3I2YX 3E35A 5JJKA 1ZWLA 3VM6A 1D4ZA 1BVHA 3V8PA 4CUJA 2QTNA 1N77A 2C82A 1UAGA 3LHDA 4Q4DA 5BWNA 1DDIA 3R7NA 1ZSVA 4KVGA 5FWDA 3EJWA 4BU0A 4O2AB 2IUTA 5KPJA 1ELOA 4F06A 2WF9A 5AHXA 5KREA 2H85A 1W46A 5TMBA 1J0XO 4OV6B 2Q1WA 2W2QA 3RROA 1XX6A 3QXHA 2FPUA 3GUYA 2IPMA 1MGOA 1T3SA 2PGIA 1KKLA 2V65A 1VFNA 1YR3A 3D3EA 4Y18A 2G07A 2OD7A 5G0SA 4CMGA 2Y77A 4UREA 1CE8A 4I1VA 4NQZA 4RVFA 3CPHA 3EFBA 1MFZA 1PWXA 1SU7A 1WY7A 1XQ6A 1Y4ZA 1U2TA 4DZRA 5I4CA 4ZDKA 4GKVA 4YMUA 3EZ6A 4LEIA 1FSGA 4FI3C 3KLOA 3QE9Y 1PCXA 2BI7A 2W2LD 2V8BA 1L8OA 4FOLA 3MHPA 1AQIA 4HATA 2ZCVA 3KQVA 1XCMA 1W93A 4FYKA 4JBHA 4RHEA 4BMSA 3S81A 4JXZA 3RTEA 1E4EB 2V6IA 5E0KB 4ZC8A 3RARA 3ZDQA 5LMZA 1G8SA 1Z2EA 2G4VA 2JIDA 2BZGA 3AP1A 2WWIA 4Q4LA 5D85A 3U4DA 3LX5A 4ZVNA 4EIWA 1PF7E 3PXEA 1RLTA 2CLHB 3BGIA 5HTKA 2Z2IA 1AGNA 1GSIA 2B4RO 5B12A 1Q1NA 2WJ6A 3C8DA 3WG9A 5AVYA 1V48A 2WILA 3RC2A 2OVBA 2Y3IA 1U4OA 3FMVA 2W2XA 1QSGA 1H2YA 1RXYA 1V35A 2BP7A 2UZ0A 2WIGA 4TYQA 1UOOA 3CF2A 4QHTA 2I78A 1YQXA 3V4PB 4IQFA 4BBAA 1XR3A 1X87A 1R0BA 3B3AA 2WAYA 1DCTA 3PDCA 4HOYA 4MHOA 3OZWA 2VYFA 3EXG2 4QBHA 4H3SA 5DBIA 3TS1A 2GCOB 2WVGA 4AYWA 2VOJA 3EEYA 2AOTB 3PDJA 3DF9A 2BV3A 3GRYA 2FPPA 4M88A 1GCGA 3ROPA 3NNNA 4DLZA 3V1YA 4DPKA 2XHZA 2R8XA 5CHEA 1X7YB 3TKAA 4Z86A 2ENWA 1L5ZA 1TB4A 2CNWD 1JJIA 3V8NA 5K6RA 4OXXA 3ROGA 4EPWA 1QP8A 1IONA 2IEZA 3DTVD 1KR5A 4BQFA 3VYSB 1RQPA 3FGZA 1XA4A 2Y0BA 4U2GA 2I80A 3HDHA 4YPOA 3G82C 3QE4A 4M46A 3P2MA 5ISMA 3ME5A 3L6CA 1T1EA 4KXQA 5IHPA 1YS4A 1RHQA 4NENB 3SNHA 2QMOA 3G79A 3Q7EA 4CL0A 1RS0A 5EHNA 5FPTA 2HYDA 5HFJA 4JR1A 4MV4A 4N7BA 3VR3D 5BOSA 5GOTA 2GR9A 2AE2A 1SZDA 1UXIA 3LA6A 2BGKA 2D1QA 1JXOA 2WMDA 1E94E 3GPBA 4NDAA 3ZLVA 1E2MA 3KSZO 1FTQA 3IP7A 5KO2A 1NSTA 1BJTA 5AJVB 2HY7A 2RGWA 5IK2A 4EBBA 1EQ2A 2E6UX 5F5NA 4XLZA 5LQNA 2VBGA 5CB0A 1P39A 4BV9A 5BYAA 5JNLA 5DBEX 4C01A 1D7OA 4LDQA 4OF4A 5EESA 3OAAA 1H3FA 1GILA 1XPJA 4XDZA 1E2EA 3E48A 3LVBA 3VR2A 1JVNA 2B25A 2O5VA 3FLEA 1G3RA 2CBZA 1VP3A 3Q1KA 2VJKA 4HMQA 4K8OA 5BV7A 4UUQA 1DQYA 2Z1DA 1I1OA 1JXQA 4C0KA 1FFWA 2KM1A 2G17A 2PLAA 3F7NA 3RVJA 4DZZA 3C3WA 2I4NA 3AUAA 5IJXA 2UYGA 1DUVG 3EQ7A 2ZJ1A 3SZGA 1BS2A 4UD6A 3KC2A 4ZEOA 2D7DA 1C1YA 3ZCRA 1CUAA 4RD4A 2B1JA 2ORWA 2A0UA 4GZ5A 4Q9HA 2XZLA 3TFQA 2Q3DA 4MNTA 5DYGA 5FNZA 3BPSA 1E6MA 4EJFA 1NC1A 3FFWA 4RMIA 4NMWA 4S2EA 3TG2A 2QDXA 1WUJS 3ZCVA 3EIUA 4J6FA 4EHHA 2GLTA 4OLBA 2RD2A 1CS0A 3C87A 4BCBA 5GINE 4LDZA 3JASA 4YCSA 3SSMA 3SMVA 1L4HA 1C7IA 1W5EA 4LWOA 3RR2A 3W5SA 1G3UA 4HH1A 4FX2A 1I2BA 4PLPA 2VEDA 2R6DA 3BTSA 5JQGF 3TXAA 3H1PA 4PQYA 2V59A 3KLMX 4KI7A 3D59A 4UMFA 3AVVA 3CC8A 1FTGA 4PPFA 1K9SA 3EA0A 5IAGA 1RPJA 2X2FA 4LWPA 3C70A 4Z9FA 2DUMA 4ROTA 5B58T 5J9FA 3WMXA 4YMLA 5LMCA 1B26A 3UOGA 1SHKA 3MMPA 3PTLA 3TPCA 2IEAA 3LT4A 1P81A 2IYVA 1K92A 1IZ9A 2Q2VA 4GFDA 2IW1A 1E5LA 3GVXA 3JW8A 1GLGA 4HAOA 1ONNA 1I13A 2HF2A 2WP8J 4C07A 6CHYA 1K2WA 1GV1A 5BR8B 2QENA 4KE9A 1T24A 5C1IA 3WYNA 5K0GA 1IOWA 4B6SA 3GEGA 2CHFA 2QW1A 4MJ3A 5FPPA 1YR8A 4JSYA 4PONA 2FF7A 3E61A 4ZN6A 3Q8XB 5LQUA 2XTMA 2C29D 4PLZA 3FOWA 4ENPA 2ZU0C 3F1KA 4U5XA 1UDWA 2HL6A 4D8TA 2CB0A 1AURA 1FVOA 1TK2A 2WYWA 4BGUA 1Y5MA 1X1CA 2I65A 5D86A 3ZIUA 1TMYA 1U0HC 1TUBA 2OHVA 4JLAA 4I5FA 4DUPA 2AG1A 2IU6A 3NONA 3VR6A 2C5SA 5A04A 1RAHA 4QVIA 2PJRA 4A5OA 3CKLA 4H7FA 5CIQA 1XPRA 1H05A 1W6RA 4O1IA 4OGGA 1EUQA 1UBGA 1EJBA 1O95C 4NFSA 2ZIVB 3JXEA 3QJGA 3PP8A 1G20A 2B7CA 1DBQA 2EJTA 3JR3A 1Q77A 1RCUA 3GCZA 4OHRA 1SPBS 4IGEA 5DI3A 1RXSA 2ONYA 3ACCA 3IS3A 1CUIA 4KO2S 4PYIA 2GZDA 3GP8A 4QTXA 3VISA 3GJ5A 4E09A 1N8KA 1VIDA 2BGMA 1O9GA 3FDJA 3WYEA 4EDFA 4TMXA 2PSDA 1YZKA 2OLEA 2CLMB 1CK4A 1CRPA 3ZBTA 1M6EX 2JBAA 3E3MA 4YAWA 4GC9A 1Q22A 5FORA 4EI9A 2CBGA 4YJKA 1BHO1 4DG9A 2B20A 3R9WA 4AU1A 3KZNA 1LC0A 1VJCA 4DQUA 4YAUA 4CI9A 3QENA 2VATA 2WFLA 2ZQYA 3S1AB 1CY1A 1W0KD 4BGIA 3R40A 2IPOA 3UA3A 4U6QA 3TEFA 4B9EA 4JUBA 2FUNB 3CISA 3ZTTA 2JLSA 4QYTA 1RADA 1T9DA 2YVLA 4ZVVA 3I04M 1UZUA 3IQIX 2A7XA 2XCIA 3GAMA 1YK1A 2G25A 1ZH6A 3BF8A 1YB2A 3BCRA 3KXPA 3O2QB 5JLAA 3ROEA 1U63A 3KQNA 1E1DA 1HTTA 4TT3D 3TFWA 1TUEA 3U48A 4M9QA 3QP9A 1BWSA 3GJYA 5KYYA 1FTWA 3OZEA 4KXUA 2QE7D 3C7TA 3G13A 3F8SA 5JSYA 4HYEA 2CF5A 3WQRA 3WNCA 2FW6A 3K35A 3BGDA 1N32B 4HWSA 4JB0A 1G8HA 3OIVA 4WZZA 1ODJA 3FSRA 2FN3A 1U1IA 3BG5A 3H04A 2JBHA 1E6WA 1MO3A 3FXAA 3I53A 4U8GA 1EU1A 1VLMA 2HPZA 4YMHA 4G8BA 4Z1OA 4O25A 1UFRA 2IYUA 1NM5A 3D3WB 3GEEA 3O1IC 1EFRD 3S40A 5LDHA 5LP6F 4ER5A 3C1OA 2FZ4A 3FTQA 4EITA 1ZI6A 3L7IA 4YGYA 1E1NA 4JR0A 2QUAA 3R6GA 3R41A 2VFAA 4S1TA 1PJRA 5FUBA 4UM9B 4TGLA 5BYBA 4BN0A 5JH7A 1E1QA 3H2HA 3UAYA 1JFVA 1H2XA 1Y3AA 2Y68A 3KYCA 3P4XA 4XLLA 1B6TA 1JHMA 1YCHA 3DVAB 3HNOA 2C1XA 5GPBA 2XBLA 4OBBA 3IHKA 3QE0A 4DUGD 2I3ZA 5BR7A 2YC2C 5THXA 4TX1A 3TLEA 4LJAA 2XTNA 2VDWA 3MLBA 3HO1A 3MTQA 1YH3A 3C3KA 1Q0ZA 4K9PA 1I4EB 4A2WA 1ZI9A 2F1OA 2PSHA 1U04A 2WKPA 4IDOA 4JJ7A 1W44A 4AUKA 4FBLA 5ES4B 1Z25A 2G8NA 3OLVA 4UASA 1YIDA 2HW8A 4GF5A 3U56A 1DQSA 1SCJA 5IJ0A 5JASA 2DUNA 2R84A 5E0OA 1K8QA 2LE0A 4KSYA 4CLRB 2DXIA 2X3YA 4DLKA 3EIEA 2ZUVA 3QXXA 2BAGA 1WXXA 4KB5A 5J5CA 1E7QA 4RQTA 4GS5A 3CF4A 4YO7A 4FFOA 1U1DA 2ZE6A 1KFKB 3N2NA 5ICFA 1UBOS 3ZY4A 4MXDA 1PUIA 1TPYA 1R6TA 1FB5A 2I7CA 1G5RA 4ZT7A 4Q3BA 1HFKA 5JMPA 3U7QA 1NBMD 1C3VA 1YDGA 3CVVA 1Y6QA 4NCAA 4FFWA 1ND6A 1W0JD 4XTRA 1YONA 3Q0TA 3ZXUB 2W71A 4YAFA 5HWSA 2O2JA 3UM9A 4UCQA 4BPBA 1ZIPA 1NUAA 3ANXA 5EWMA 521PA 5A7FA 5JT1A 3MRTA 1BW9A 2QR3A 3GCWA 4X93A 2YOFA 4XVHA 1FZQA 1NLZA 1Z4PX 2Q2NA 3GEMA 5T4BA 3QLVC 1K3FA 2IY7A 2L69A 1HYBA 3H97A 3BREA 2EJCA 4XVQA 4FMPA 1FZTA 3RS3A 1KPHA 1B1AA 5CFLA 3MT8A 3ZNPA 4U7PB 2QVLA 1VJDA 2LP4Y 2BEUB 3F49S 4C30A 5AKIA 1YE5A 1CY6A 1W6UA 1QANA 4K9DA 4ENVA 1YWGO 1J97A 3JATA 3I3OA 4S24A 2VP9A 4TOIA 4YRMA 3BN3A 1PW5A 2HF9A 2W48A 4MGKR 9ABPA 5LYJB 3B5IA 1KU6A 4XCQA 3M4YA 4RNCA 8AT1A 1DG1G 3SEAA 4CODB 1ZHOA 1NW8A 5KYGA 1HY3A 5LOVF 4KXWA 2D1RA 3OJEA 3CLVA 2GHIA 1TZKA 5CHYA 2FR8A 1MABA 1D5WA 1ZNZA 3G89A 1OYWA 4B4KA 3D8SA 2R5FA 2GS9A 1A97A 2FSSA 2VLBA 3X1YA 4JAVC 2XA9A 4D0NA 1XNQB 4MCJA 3E84A 1N33B 3ZZNA 2PUBA 1U9IC 1M6HA 3ND9A 1EVIA 4KQXA 2IV7A 4D5GA 3A0RB 2AW3A 3QVTA 4GMKA 4ZAZA 4QBTA 1BVYF 1GAEO 1YGPA 3R3YA 2G8LA 3OT1B 2P5SA 2PU7A 4IJWA 5FQNA 4FFPA 1JJFA 1VDMA 2NYAA 3PB3A 3R6LA 4QHYA 2IW3A 1CZLA 2GZHA 3DDSA 4CTNA 5BSTA 1KMNA 2VHYA 1HT2E 2QORA 2R8BA 4PNHA 4E32A 2PXAA 3EFEA 1GJRA 1BDHA 1UJ5A 1LA2A 1ZK2A 4NOJA 1ZVVA 1KO8A 5JCOC 4ZIRA 1KTVA 3C3XA 1IOVA 3UXYA 3B7PA 5G0VA 4G25A 5JYEA 1EUCB 5LL6P 1A7KA 4FMDB 3U1VA 2GHRA 3KEGA 5LZ2A 2CW5A 1E99A 3GBVA 1TYEB 1RHRA 1WBDA 4BLUA 3DNFA 4P4SB 3AF4A 2XVAA 4LZZA 3CR8A 2K4MA 2P35A 1MIHA 4LHYA 1ZISA 1SA0A 3RRNA 4HHEA 1BMTA 3ET4A 1IOLA 2ACEA 3G9UA 3GT3A 2RGNA 3SFTA 4I1IA 3GNQA 1UEJA 2O06A 4X63A 2J9RA 3UT5B 3OZXA 3ZV4A 1BOOA 2ZCJA 2HNKA 4YREA 3VKVA 1HOTA 3DHVA 3ONVA 2P9FA 4BEJA 4MDFA 4GKAA 1YJ8A 4JQZA 1XWIA 4JJEA 1ICEA 5IP5A 4EZIA 2CUKA 4M98A 3V8EA 3ZWBA 1L4EA 1P77A 5AKLA 2ZUDA 2ON6A 3JQ9A 4HBGA 5DYIA 3RVNA 4PWZA 1D0SA 4DA4A 1ORVA 3ICEA 2Q5FA 2C97A 1WQ3A 1W76A 4UBKA 5AOCA 3WLSA 4AS2A 1PL7A 3KOXA 3FYCA 1M2EA 3OO1A 5FNVF 3I61A 3OCZA 3RKSA 5BN5A 3ESDA 5DJ5A 1ACJA 1M1NB 1SOWA 1NT2A 2IOFK 3OPNA 3N07A 4CL2A 5HOEA 4MUJA 4Q5IA 4R9UC 5KOJB 3DZBA 2PIDA 5D1HA 4W5TA 2PZBA 2W6PA 2QMYA 4H6WA 4NBSA 3GLVA 1ZBDA 3LFUA 2HEGA 2J45A 3UUFA 4BFUA 5C7YA 3LOPA 3WYBA 3D7SA 3JX9A 5DNAA 3ICWA 2PAAA 2X5NA 1M54A 4RANA 5BSMA 3KHKA 4CKWA 1GN9A 3D1LA 2XUKA 3HDQA 4M22A 2H1RA 2FHSA 1QNLA 3V5NA 2M32A 1G3MA 2XB4A 1RRKA 4LHVA 1A7UA 2GILA 2X9LA 4MVCA 1QHFA 4AJKA 2P1DA 1L4YA 3KR9A 3KQWA 4BO5A 5IKEA 1SZPA 3OTOB 1DOHA 3MTAA 2IF0A 3B85A 5HILA 3V7YA 2PN1A 4V1CI 2BH2A 4B73A 4PFJA 2J0UB 3QPVA 5ELXA 4CF7A 1SR8A 1T6ZA 3P0HA 4F9TA 5L7WA 1BYIA 4QBKA 4BC0A 1NI4B 4Q3AA 1QG0A 2V9CA 4ENTA 3BRCA 3HCAA 3A6GA 2JD2A 3BD8A 1ZX1A 4ZYVA 5KI6A 2F3TA 5AKYA 1M8PA 1E3TA 5FIUA 3L4SO 5I7WA 1PFGA 3I64A 3IOEA 1R2QA 1RWBA 4ZPXA 4N8DA 4UXHA 5EJGA 4FXPA 2FJPA 1TVCA 3RYFB 4DLSA 1DDGA 1EZZA 5THKA 2AOVA 1D9ZA 4ER7A 1EXDA 3KKPA 1QP0A 1RWKA 2VRWA 4FOPA 2O8EA 1LDEA 4WFJA 1NOJA 3PXCX 3D1VA 1WLSA 1KJ8A 3ZGOA 3M1AA 3OE4A 3OUZA 3ZV5A 4ZHQF 2I87A 1A8UA 2IU0A 4I0WB 5K0TA 3EWAA 5F7OA 1Z2PX 2QY9A 1TJNA 5JR3A 4RW0A 1L6IA 13PKA 4HWOA 5P8WA 4BLVA 2IZ7A 4B46A 1EP2B 4KUGA 4ND8B 3DWFA 3FIJA 4G4GA 3T41A 3FNGA 5KYTA 1HEIA 1KJWA 3IRUA 2P3LA 3UK2A 3R8FA 1QTIA 2GJ9A 3BDAA 1NN5A 3FDZA 5H02A 4HQ6A 3ZTWA 3O31A 1ADBA 1T5IA 4G0QA 3V8BA 4TROA 4KR2A 3OP4A 3OE1A 3LUJA 1THTA 1E1LA 5INTA 4V0NA 1W581 1JT2A 3OIUA 4CUZA 4B82A 5B2EA 1D5CA 2VWGA 1K97A 3MMXA 4C7MA 4M7OA 4C5AA 1PJ4A 2ZRMA 3N2GA 4JQOA 4KLRA 5K3DA 2ENUA 4CKCB 2V74B 5COAA 5E4JA 3LGAA 3I1YA 2V6FA 3UJ6A 2FR0A 4BNUA 4AY4A 2NW6A 4OHUA 2QTAA 3NPMA 1KOLA 2NYRA 1G3IA 2AQIA 2OC9A 2VIIA 4ENRA 2NTEA 3H2BA 4MB6A 1JJAA 4W1PA 4B3JA 1W2GA 2XVYA 4R1OA 7REQB 1LTKA 2H6EA 3NFYA 5HKOA 2IEYA 4TLAA 3LCJA 4IZHA 2YJNA 4J8PA 3C16C 2OAGA 2DT5A 1CCWA 1YULA 4Q4CA 1V2HE 3HYCA 1S02A 1JNYA 1NXWA 2C61A 2Z9CA 5T5QA 1KC1A 1TJ4A 3PK0A 3SU8A 4XWOA 4XZ3A 5AUOB 5EXDA 4ZT4A 5IRCD 1SQGA 1ZJWA 4N3AA 4PC2A 3DMHA 1AH2A 2HWKA 3FZEA 3BGVA 1LVHA 1MT0A 3IBGA 2W37A 1DG3A 4PSDA 1JZSA 2BKLA 1MA3A 3C8ZA 4F6LA 4MV7A 2EHDA 3CF4G 3ENKA 1JB9A 2Q62A 3B8EA 3CSSA 4LYYA 1JR3A 5LZ7A 1S2DA 1NZJA 4E15A 3A7EA 3ILHA 5T64A 2G5GX 5CEJA 1Z8DA 3A4LA 1VIVA 4OQFA 2BR5A 1NGSA 2BSXA 4EVQA 3Q88A 3EOAI 3DMGA 1FNBA 2CC2A 2QJFA 3NKFA 4IJMA 5FR1A 3W7VA 4QXQA 2ZT8A 3OIYA 3A4YA 2X7HA 3JZAA 4TXLA 5LFAA 3K16A 5F2KA 1J1UA 1M5UA 4C3VA 1IXRC 5HE9A 3BZWA 1OX5A 3GWZA 3QPAA 4GPTA 3DCNA 5FP0A 4YXWD 4WKGA 1GKIA 3ZDXB 1ZN9A 4TV8F 4MQ5A 5L3VA 3PNBA 3IODA 4D96A 4O4JF 1PLKA 3E0XA 1C30A 1NZFA 2CZQA 3MWDA 4JLSA 5WRFA 4CT4B 3BMQA 2P6NA 2CSUA 3C6YA 4N0QA 2LR0A 2GHTA 2J6CA 1Z36A 2PJDA 3AETB 3RBVA 1LJLA 4QZVA 2DEUA 1Y1RA 1MF7A 3MGAA 4RK0A 1R66A 2A1IA 2BFMA 2C7VA 1IZZA 2ZRBA 4GR5A 3U9SA 3IAM1 5KWJA 4MS3A 2V96A 2FN8A 2WDZA 1DV2A 3AF0A 5BMVF 1WIWA 3WHIA 1KJJA 1EYZA 1X1AA 2ZVQX 3Q6IA 3FHLA 3FGPA 1M0TA 4Z9BA 5ADUS 2OAP1 2OV6A 3V97A 1Z7YA 5BO5A 4L0DA 3ORSA 1T8SA 1DARA 2CKMA 3K94A 4D9KA 1UBEA 4UVGA 4DMMA 3U17A 2FUCA 4LJSA 4REOA 3RVLA 3LUAA 3RAEC 4BNIA 1VI6A 1H3NA 2DYKA 3O8QA 3KTFA 1ZK4A 4IIGA 4DEYA 3G85A 5GP1A 1N6PA 1U9JA 3UMJA 4GUAA 1DCMA 1M2HA 4JV5B 1XK7A 5AJXA 4RZ2A 4FCWA 4HDAA 3FTPA 1Z0UA 2ODNA 5NLLA 5EZ5A 2FPMA 5DN6A 4GSLA 1HDRA 3VSCA 3BSSA 5ED0A 5K5EA 3RUFA 1JSXA 1Z4OA 3CW8X 1JTVA 1ZUD1 3OD1A 2Z2XA 4G0XA 1HFEL 1K08A 4LMBA 4A6XA 5JCZA 4DV6B 2GF2A 1YE3A 2G88A 3ZV3A 1GZUA 1U5CA 3HCPA 3O92A 1U2DA 3QVLA 1OIXA 4KIFA 2HR1A 3A05A 1JV2B 1K98A 1HDGO 1WSAA 5AHKA 5DTJA 1HRKA 4FFLA 1TA9A 3PUWA 1VL0A 1AUVA 1CJUC 2I34A 1QH8B 2KB0A 2QX6A 2V7GA 1DIGA 5KWIA 2PZLA 1AGPA 2B8WA 1VBFA 4BYMA 4ZK6A 4F4FA 2O0MA 4UUAA 3EXFA 5LU9A 2WHPB 2DCMA 5CB4A 4MCAA 2B4TO 1NW9B 3ZDEA 4YH1A 1M2OA 2OUIA 3F47A 3LDUA 1AC5A 5JU6A 2PMBA 3JV7A 3MWYW 2V5UA 4QOGA 4C6SA 2NV0A 3E5HA 1N6KA 2YX1A 2W4IA 1F6WA 2L82A 3H4VA 3JQ7A 1LNSA 4JYCA 3D8UA 3F5SA 4Q47A 1SCNE 2DY0A 2UZ1B 5JPIA 3AF6A 2Q4BA 3NM4A 4KLZA 1ULZA 2REQA 3IP1A 5I5GA 3T0IA 1OFUA 3UOWA 5DSZA 1SO8A 1UMDB 3VZCA 3QJ5A 3HLYA 1HEUA 5JV5A 4WOPA 3PHIA 1K0FA 4MLZA 3I42A 3OFNA 3UK0A 3GGSA 5G0TA 3GA0A 3CZRA 3IVCA 4GMHA 4GZ6A 4LIPD 3WRXA 1SXJB 4TYMA 1N7IA 3FCUB 4GZLA 1LTQA 4IM7A 4YP7A 3ADBA 2B83A 3H7IA 2RAPA 4QREA 5F1OA 1QIJA 3PHHA 2GK3A 2JC3A 4JP2A 4HPXB 3LVFO 4X00A 3PGJA 1QOPB 1T5DX 3JYLA 2WD9A 3FDIA 3W4KA 5IKPA 4HLCA 5BUCA 5LA6A 5JBQA 1MXHA 2OHIA 2SKDA 4HF7A 5G4KA 2I5PO 4NZYA 1K9VF 3DQPA 4FJ0A 4OFWA 2B7BA 5IAJA 4EKDA 5ES3A 4NAHA 4TQ9A 5EIFA 1AKWA 5FXMA 1XHLA 1JLMA 2QM3A 1MOZA 2XMSA 4TKVA 2FG7C 1ZVKA 1UP4A 5IN5A 3S2IA 4ND4A 3T7EA 3BWMA 1HH4A 3E7FA 5TX7A 5AKEA 3F9IA 5LB4A 4BRWA 3IUSA 1L8AA 3EQ6A 3WYDA 1WMFA 4U6NA 2F3RA 1MT3A 2Y99A 2BZ1A 1NHGA 3EZ2A 4FYHA 3SYMA 2AC2A 4JA2A 1SQSA 2IH5A 1UBUS 2NUPA 3L6EA 4G5YA 1OB2A 3II6X 2HDWA 3L4BC 3X1KA 2XECA 1E5XA 4UOEA 2XWJI 3LP6A 2ZB8A 1DJLA 4MVJD 2FSUA 2ZQ5A 1LEHA 1W0CA 2XV1A 3MWEB 5E4FA 4YP5A 1YVUA 4EG1A 2Y66A 1XQWA 1T13A 1TMKA 2A57A 5IF3A 2EQAA 4OAPA 4URXR 3RGWS 4D3XA 5L45A 1E32A 3W34A 3KZXA 4MQMA 3S99A 1TCAA 1PQUA 1ECFA 1OWOA 4EY5A 3BA1A 1RVV1 2C31A 5TS3A 4D45A 4ZU6X 3P9NA 2W8BA 3ESCA 1VKOA 3FPJA 4G4JA 5J4YA 1YZUA 2PLFA 4EO9A 4JENA 3ITNA 2RHTA 1E9FA 4REMA 5IJ9B 1Q1EA 1E9DA 5HUHA 1IZ8A 1NW3A 2HRDA 4RULA 3KDAA 2WA1A 5FHQA 1NXTA 3B89A 3PL5A 4Y6OA 3P32A 4DSNA 2PRKA 1K88A 1BE1A 1VPEA 1ZM3A 1TO1E 2REBA 2V0CA 5MFPA 3KOMA 4MIKA 5ALHA 3MINB 2IV3A 4CCYA 5CA1A 4U3JB 5KMGB 2HYIC 1OVGA 3AEYA 4RKQA 3QU5A 3I1FA 4MWBA 4Y1RA 4QX6A 3CUEF 4EHBA 4MQ4A 2GZMA 4L5AA 2JFGA 5KNBA 3HCBA 5LZ8A 3TIFA 4CRWB 3KEQA 4Z4EA 2WJ4A 1SH7A 1K4MA 2WINI 1RKUA 2IS2A 4E0BA 2ZVJA 2EKQA 4HDKA 3DEHA 3PFIA 4M1QA 2CVFA 2SNIE 5BWBA 3HVJA 1KAGA 1VA5A 5J63A 1VE7A 1DADA 1SXJE 2ID9A 4YJFB 3KJGA 3N0RA 3T94A 2J3KA 2WW8A 1FDWA 2ZLBA 3AIMA 1QR6A 4G5QA 4QATA 4X5OA 2R8YA 4KX5A 4UM5A 3JS5A 2AZ4A 4LJ7A 4DKJA 1VHWA 1AF7A 1DKNA 1Z6QA 3LUBA 4A1OA 1A4XA 4NCBA 4IQ4A 4PLVA 4YALA 1BKYA 1ULBA 2C2BA 4GDFA 2FPLA 4F96A 1PDVA 2Q3HA 3TIIA 4GQAA 1N5JA 1WXDA 5JMOA 4JBIA 1HKUA 1A5TA 3A6FA 4KG7A 2PM8A 4IJQA 3CNEA 3UAGA 3WV4A 1AG9A 1SFRA 1MG5A 1NXQA 3KFVA 1I1NA 1W4AA 3HCFA 5D5QA 2XA2A 4GR4A 2OV2A 3UJHA 3V1NA 5DGXA 3X2FA 1FYEA 5C9ZA 4LNUB 1PJSA 2CL0X 4KQKA 5A2QA 3QTBA 4ZALA 4BEWA 4PYKA 3IEXA 3UAOA 2F1IA 4KC0A 3J80A 1JU4A 1P3DA 2OWEA 1YFZA 2XAUA 2C99A 1KP3A 2D0OB 5G0UA 4J3FA 1K5GA 3FZYA 3ZHYA 5EWLB 2JZNA 4QXRA 5CVEA 4D9NA 2LIVA 1P61B 2B21A 3DDZX 3M1LA 4HN4B 4JKIA 4CQMD 3K9FC 2ZIXB 4HQNA 2DTXA 2H3HA 5FTWA 1D1SA 1ZK0A 2Q41A 4W9RA 3WX0A 1Q1ZA 2HIHA 3OWOA 4FFNA 1ZD8A 1RM0A 4OREX 1CY8A 1I24A 2IFTA 1TC1A 2PRZA 3OUUA 3CVUA 4ERXA 1XD9A 2YNMD 5IEJA 4TQAA 4R1SA 2ORIA 4G1VA 3C1AA 1FQOA 4XQCA 5DASA 1OR8A 1UWCA 1VL5A 4TS4A 4E6EA 2HZBA 3W6NA 1XDDA 2CXQA 1U7PA 4WN9A 1C3OB 4X91A 4PC6A 2RONA 2J7PD 4FFBB 1UXJA 3ZHQA 2XIJA 2JFZA 5BNIA 5BP7A 1B7GO 3K0SA 4Y7CA 5I51A 3SQNA 3B6IA 1VIMA 3T3NA 4GLBA 4DILA 4C4YA 3E23A 4AQDA 3SJUA 5E8RA 1G18A 4H7DA 3KYDA 1PX0A 4N18A 1VMEA 2VJPA 3DKIA 1J0EA 2FF5A 4TKUB 2ZJ7A 3WDKA 1TCUA 3ZI0A 3TX6A 1CUSA 5IDQA 2GGSA 5TMDA 1I7QB 2JI9A 2XLBA 3HHEA 3EUAA 4RESA 3MZ0A 4ESHA 1CP3A 1SXIA 4X6LA 4ASUD 4C0HA 4DMLA 1C4XA 4ME6A 3ZNNA 3ZGZA 5KNDH 4GKJB 3LPNA 1R0SA 4PANA 4QLAA 3RAGA 4U9HS 4DMFA 121PA 2HLDD 3QTLA 1GO2A 3GLKA 4ID9A 2KI5A 4IILA 3WQBA 5JVDB 4EL5A 1T0JB 3JQBC 4OQDA 3NVKI 1QAOA 2ASEA 2OXRA 3D5TA 1M0WA 4LXYA 4BNMA 2G9ZA 2PNJA 1YR2A 4HDMB 2P5TB 1TYZA 2A3RA 3VOSA 3VZBA 4KEAA 2SKEA 3LUDA 1GZ6A 3B6ZA 4ACAA 1E79D 1WB4A 4B7ZA 5MN4A 1T8YA 3IP6A 1UCFA 2H59A 3DPIA 3L84A 3BSWA 3HACA 3QKTA 1K86A 1ZGGA 5JHHB 2JIPA 3OLYA 4R2WA 1XZFA 2PUDA 1U8TA 1XKLA 3OKAA 2YFYA 1WW8A 1PZMA 4HDSA 3D7NA 1Q7TA 2B6NA 5HZMA 1HZJA 3DDOA 8ABPA 1RRVA 2QLFA 4EMBA 4ZYLA 4J7UA 1YOVA 1RI4A 2CLFB 2EQ5A 3DAYA 1A7AA 4I3GA 1I14A 4HUQA 4D98A 2I29A 5EKUA 2JARA 4FVTA 4J94A 3ZDFA 2Q9UA 4V1CB 4FJ1A 4H6PA 7AT1A 4YT4A 3ILXA 4L0QA 4EPTA 3WB9A 4DM7A 1ISIA 3T7JA 3DSRA 1V9LA 4HEQA 4EL0A 3QKUA 3WKDA 2X22A 3VYWA 4Z3KA 2QD4A 3R7WB 3OOSA 4W5QA 4QXAA 1QQ6A 1OH8A 4V0RA 1E1RA 2KPOA 2UUOA 5D3QA 2PO7A 1FYXA 4X1YA 1X80A 1BMFD 2IYQA 3N2ZB 1QWOA 4XYEA 1E8NA 1GOTA 2GH1A 1IN8A 5BXYA 5F3RA 3R3UA 2JAXA 1G2OA 1YE8A 4N03A 2ZJ0A 3VC7A 2NU7B 2ZULA 5AUPB 1FMJA 2QF7A 1X77A 2WJVA 3W5AA 3A14A 1JECA 4D3ZA 4GNRA 2NTNA 1PX2A 4W9NA 4YB8A 1OFUX 1EUDB 1S3IA 3WL4A 3UWOA 3FCYA 2ODEA 3BB1A 4Q4AB 1KVQA 2GNOA 3PGA1 1L4KA 1BE0A 3DFIA 4P38A 4FWTA 1IXSB 2D6FA 1H0SA 1YU6A 3P27A 1Z83A 3VPSA 2ZS9A 5HX7A 2Q6OA 1XRNA 2VRCD 4PYQA 5D3ZA 3RT1A 3PPYA 4HVCA 3ED5A 5DHRA 3R5XA 5DTIA 5K3FB 4WJLA 4FR0A 1U7DA 2CXNA 2WM8A 3A1UA 2QI9F 4JI6B 3BIOA 4F4UA 1BMDA 1YB5A 3ANMA 3D6AA 2AJTA 2XQVA 3N2YA 3LHFA 3RJ9A 3VXKA 4M9UA 1Z45A 3R3JA 2ECKA 3AX6A 3KKMA 1ATZA 2TMKA 2V7UA 1AGXA 1JYFA 2VWHA 4IH9A 3S2UA 3UHAA 4ALIA 1DAOA 3WLFA 4W1QA 3QBJA 4DSZA 5KC9A 1JIJA 2PQ0A 1N4DA 4KODA 4XW2A 2OB1A 3CGWA 3GV0A 3L7AA 1SY7A 3QX8A 5AUQA 2C04A 4FHGA 4M55A 4KFTA 4MUBA 1P1HA 1TU0A 4NCKA 3HN2A 4X85A 1N2CA 3OJFA 1NC3A 4EYSA 4B2YA 2NP7A 4JB8A 4DIKA 3HEAA 4PC3A 5E7QA 3NAZA 2P79A 3M5WA 4CETA 1CY4A 4TYWA 2YJ5A 4AJ4A 2MINA 5JWOA 3HP1A 1WCV1 2FE1A 1CRWG 1M2WA 1MJGA 2J4FA 4KSBA 1QYIA 3F0TA 4BMXA 4ZZ1A 4H7EA 4LHWA 1IHOA 2FSGA 4LS3A 3FLMA 1L2TA 2RBEA 3CRW1 3SZMA 1GQRA 2R1VB 3WKCA 5CFRA 5GGYA 1AKEA 2SBTA 1FJXA 4J0IA 2FZCA 1I7DA 1F2TA 2IDKA 3K70B 3AH8A 3DMTA 5DOZA 4F1WA 1MAVA 4KU4A 1JPNA 1G1AA 4QC2A 4NVRA 3RVRA 4D0RA 4ZEXA 2GQ0A 4D0SA 2WWHA 2EQBA 2OSBA 3OM0A 1CJCA 1VJ5A 5EP3A 4IHAA 1P4SA 2EKLA 2OZPA 1Y9EA 1H2HA 2C1EA 2ZSFA 4C5BA 2Z1MA 4LXTA 5I48A 4UXIA 4RPLA 5CNIA 2ORED 1SHTX 1X39A 2HK9A 3H0KA 1I2AA 3VZRA 2D5CA 4MW5A 4Z4HA 1L4GA 5DIFA 2CD9A 2C2OA 3EXAA 5J58A 3F6YA 4GICA 1OAOC 4RKYA 1M34B 3E9YA 3GC6A 4XIFA 3KTAA 4BLSA 1LPSA 4I6EA 1D4FA 5GMOA 4AXXA 2BEKA 4BNWA 2CFSA 2O2SA 3I2KA 4I50B 5D6OA 5EZSA 4WK2B 5K3BA 1GA1A 2Z5FA 3LL4A 3T06B 4B3CA 2WUGA 3OEEA 3MQ4A 4O4HB 4TTAA 4YRCA 4EECA 3CH6A 2AKAB 3F7MA 1Z28A 2V45A 1EGAA 2YXLA 4IDPA 4HQKA 4QUKA 1V9SA 2O1EA 3CPSA 2ZCUA 3EMDA 3AEKA 4JVOA 3L1HA 1W36B 3U9LA 3MCUA 1FL9A 5ILQA 1E0SA 4WBNA 1TRHA 1NNUA 4PW0A 1A9SA 3AILA 3EA5A 2HSJA 3MFQA 1JQDA 1AE1A 2Q99A 3I01A 5G4LA 3RU3A 4EF4A 1AN0A 3D64A 1FUUA 3QHPA 1FPQA 3HCRA 4L27A 3AM3A 5HQTA 3MWGA 4QYMA 2UXBB 3QI2A 1U0FA 3P0FA 4F2PA 2HGZA 4XQ9A 2OXFA 4B8YA 4FQ5A 4RH1A 1PJAA 3ZGNA 1OFTA 3WJ1A 3WICA 1VSTA 2JCSA 2XUAA 2CLKB 2ZIWB 1RZVA 1U3UA 2ACKA 1Q3HA 1V3UA 4M8KA 1HL7A 4X1IB 3UXHA 5IM4A 4W99A 4Y67A 3B6EA 5EE1A 3GCDA 2EIXA 1THGA 5PNTA 4MA4A 1TFUA 3HI4A 3IDFA 1P3Y1 4WDRA 1JHYA 1YZQA 2EFYA 5KX5B 3NKVA 5K8JB 2PCLA 2EP7A 3PI6A 4U2KA 3B51X 1XMVA 4D82A 1R18A 1RTTA 1A9XB 3RC8A 1NV8A 1O6FA 4II3A 4QU8A 2M6KA 3WP0A 3UMMA 4YRLA 3IA2A 1BDIA 1G98A 4UEQA 1M5TA 1QKJA 3BJZA 4DYDA 1DFIA 3KB1A 1QGED 1GUFA 2YVAA 1QGDA 2OCLA 3R7LA 1Z6YA 4TRMA 4KQ2A 1J8YF 2RGXA 3TTSA 4KDFA 4CM4B 3Q5EA 1DE0A 1VLHA 1ZL0A 1V11B 1IB0A 3DB2A 1ACMA 2E1PA 4XH9B 5JPCA 2BFNA 4EUHA 5AKHA 3RYIB 3OQMA 2XPCA 3L82B 5IN4A 3KKKA 2DWUA 1Z0FA 2Z5GA 3EG5A 3L4BA 4OIFA 4QECA 2QM0A 5H82A 4GEGA 1KARA 4E5UA 3HM9A 3WO1A 5I8WA 4Q0MA 2AJBA 1J9EA 3JRWA 4GGMX 2FETA 5EMHA 1FTNA 3GAZA 1TLTA 4RA9A 1QGUA 4DC0A 1ONSA 2I54A 3FSGA 5L7TA 1YFLA 4G0YA 4F2WA 3SAJA 3UV6A 5LNK6 5AYVA 3K1AA 4NV1A 4AJIA 1H42A 2C57A 3HBMA 4PCAA 4PXSA 3RRZA 1DDOA 5JCPA 2DHEA 3ML1A 1M34E 5BMOA 1OKKA 2BFEA 3O82A 5FWXA 2LKDA 4YAIA 1N5IA 2HU2A 2X6RA 3U44A 5U4XA 4HDQB 3EC1A 4C0LA 2IODA 2MU1A 4HX2A 4UMEA 2Q45A 3BMOB 4C14A 4DCPA 1VTKA 3IERA 3S2YA 3SOZA 3UH1A 3GX1A 3OE7D 2ZDGA 3MUFA 1WD5A 2GPJA 3GDHA 3R1IA 4R9SA 4TL9A 2G77B 2B94A 4FGLA 4BX3A 1EHYA 1JHPA 2XRFA 1H1LA 4JBNA 3GFGA 1H6AA 3T1TA 1CFZA 1P6QA 3WLPA 2VNSA 4M36A 1Z4LA 3TW0A 5CLHA 5M7EA 2R86A 1C9EA 3T5DA 1KS2A 3A1CA 3PRJA 2PT9A 4PNPA 2YV2A 3QLUC 4O29A 1YDFA 4KQHA 5KOYA 4NU8X 2RKWA 1C8LA 1I7LA 2BDEA 2CHGA 2YS7A 5DRTA 3AO0B 5I9MA 4RTRA 8ATCA 4R6XA 2PTGA 3NHZA 3H5LA 2BN4A 3AC0A 4CM5A 5BSGA 1TM1E 3H99A 3ID6C 1WEHA 1EZ1A 3C45A 3FLAA 3GT0A 4IXTA 3OQPA 3OSUA 1IY0A 4LKRA 4OQMA 4A8PA 4CR6A 1L4FA 2ZPTX 2AQKA 3I9V6 3TPZA 4X3OA 3UJDA 2I7DA 3TVDA 3Q8LA 2JGEA 4WZAB 5JAPA 2P3OA 2QAGB 4RTNA 4DJTA 2BEJA 2IZOA 1MW8X 3LWDA 1PGQA 3ANTA 3M89A 3EXEB 2W2LA 1JEOA 2XGJA 1WSWA 3CNLA 1E4VA 5JH7F 3U3XA 4D8XA 3PITA 3CVYA 3GJ6A 2YOGA 2C77A 4V24A 3EGXB 1UBHS 2FX5A 2ORYA 5A6VA 3I4CA 4GI5A 4TS9A 4YRPA 4DNOA 5HJ5A 3S8EA 3GOQA 3B6MA 4DG5A 4OD0A 4EB3A 4RELA 5TEWA 1RHUA 2J9ZB 4LW8A 4AYTA 4JL8A 5BOVA 1WXQA 4CXMA 1HKHA 4OPMA 4ZAFA 2RH4A 1YZLA 5CCDA 3ER9A 3MQFA 1R4NB 1V45E 3DT8A 3ILSA 2AXNA 3TLGB 3V8MA 1JYEA 3VOTA 2FSVC 2QN1A 1Z0DA 4HZGA 3IOMA 4DCTA 4PCUA 2DP4E 2XTJA 4UAUA 4WK0B 4DB4A 5DTRA 3DTNA 1D2EA 4MYHA 1UC4B 4MWSA 3TTXA 4ARZB 4D9EA 2B9VA 1Z5PA 2FK8A 2G67A 1LPPA 1GU1A 3FROA 4IQ0A 4JEHA 2F48A 1KBQA 4NEGA 4LG1A 3DXFA 1L5WA 3CJQA 2WTXA 3ZKWA 4JIGA 3NBKA 4MUHA 3DVRX 3E58A 4J7AA 4Y2JA 4RC9A 3UB4A 3ZE9A 4L2IA 2G6TA 3A6LA 2C7PA 1XALA 3ESBA 1Z63A 4HMPA 2Q5LA 1OQAA 2ZOSA 4WKOA 3EUEA 1P0CA 1RFLA 1QHSA 4WUVA 4P54A 3GH3A 3VR3A 3TW4A 5FLYA 1NY5A 2ZUWA 3H19A 9GPBA 3DZKA 4JJZA 4L8YA 1VL1A 2I1LA 1K5HA 3AESA 3SX4A 4MSUA 3MYRA 5TPZA 3V55A 4CDGA 5KSZA 1EJ2A 1KSGA 1Y7PA 1Z2AA 1HNZB 1X9HA 2SCUB 4JOSA 5DT9A 3BE6A 4JI3B 1D1QA 1DKRA 4N01A 1EDOA 4UBJA 4BQNA 1FDOA 4DWJA 3RS8A 5LIPA 3VKHA 2VVTA 2BKVA 1ISJA 2V4MA 3WGGA 4AW9A 4GBGA 3ZWVA 5B6PA 1BTOA 1JHRA 3Q3IA 4GX2A 5DBGA 1JPVA 2R66A 1UM9B 1J9ZA 3H7AA 5CX4A 4DA7A 4JYAB 2AF3C 2PS0A 2QT0A 5CXXA 3JQBA 5ECGC 1GVNB 4MS4B 2G09A 5KB3A 4QPJC 4U9IS 1P1IA 4LSZA 3L7YA 3U3OA 3ZD6A 2A4MA 4JI7B 1UKBA 2VZEA 4TTIA 3T99A 3VX3A 3IPLA 1GPJA 4WZAE 1UBLS 4XCVA 4CQLB 2HHHB 4PLGA 5BW6B 3VR5H 5IUKC 3PFKA 4GIBA 1PLLA 2OGZA 4XTCS 4M6WB 2C92A 4XDHA 5CFZA 1LCIA 5EL0A 1U2GA 1UJNA 4GUDA 4J7XA 1UXGA 1Z0AA 2PVPA 4E2XA 4P80A 4BMCA 3NLLA 2XY4A 4OJYA 1JDVA 3K9NA 1ILWA 1IFXA 5AHRA 1RI3A 3NGLA 4FSDA 1BD4A 2G9RA 2OFWA 5KHOC 5KVVA 4XIGS 2B1IA 2DR2A 4TYNA 5HMMA 3UY4A 1R5BA 1W34A 4MWCA 4NBUA 3H2IA 4CM8B 3FTDA 5AM0A 3WWCA 3E27A 4DJEC 3HWRA 1NRJB 5DT2A 5K4HA 2J9GA 3BWYA 2WZQA 4PRZA 5E6RB 5FULA 3G2HA 1FU8A 4QDXA 1Q1QA 4HLUC 3NGXA 1N0IA 5LWHA 2WKRA 3LWNA 4DV3B 1PFYA 1X9IA 1E98A 3FPHA 3PDHA 5B37A 2DPXA 1J0BA 5CNJA 1OLOA 3WHLA 1E77A 2VTKA 3RJMA 1SC1A 4J03A 1K8ZB 4P8RA 1VECA 3DTYA 2W6JA 5HQ3B 4HJRA 2VJMA 4Z53A 2ZXFA 3JSXA 3PE3A 4TN5A 2HB6A 2J4DA 1MV5A 5TJ9A 4DN6A 4AQYB 3WIVA 2HRZA 3MTGA 3CLHA 4HH3C 1EHCA 2WNIA 2Y6UA 2R1TA 1A27A 2XE7A 1NVVR 1QRRA 2J08A 1WKVA 3MGGA 2JA1A 3LGSA 4EYOA 4JODA 2IC5A 4QYIB 2BFDB 1OILA 3ETDA 3MUNA 1CZOA 4P7GA 1JKIA 1EIWA 1Z4NA 2H0QA 5FR2A 2JFXA 3DQZA 3L0YA 3KJIA 4QJ4A 2FK7A 3TM4A 1QFSA 3UFXA 4PLCA 5MN5A 2VDJA 2E85A 3D6VA 1EFCA 2GVZC 2QXYA 4K1LA 1I3LA 4MKRA 4CMJA 2R62A 1RXUA 4MV5A 1XJ5A 1ZZEA 2QW8A 2F64A 5EJIA 1SAYA 4N48A 1X1SA 4ALNA 2IXTA 3K0AA 1L7QA 1FXUA 2GEKA 3L7JA 5LUBA 3RDPA 1LH0A 1VBNA 3S1LA 1ABEA 5AW0A 1NVWQ 3AR8A 1Z33A 2IYAA 2P7IA 5AW5A 3RKRA 4E08A 4HNHA 4NMHA 2AB0A 2LDBA 5DM0A 2WHRA 5AKZA 2X8AA 4C3UA 5LLTA 3OLCX 1CNEA 4TS1A 4XQGA 4DSOA 4HAZA 4MEBA 4DSAA 4C2TA 3O8OA 5ELMA 1KQFA 2BHRA 4QYSA 4CKBA 5MGBA 3IQZA 4Q39A 1TL7C 1W0KA 3OQIA 3C0KA 3FRHA 1P9OA 3PE6A 4ZAGA 3NIWA 4KTVE 1WDLA 3ZCPA 1R6UA 3LBHA 1EXVA 3SYRA 2YQ4A 3FKJA 4YP6A 3SYNA 4DLTA 1HURA 3G2KA 4RTKA 4BV8A 1CUYA 4AJNA 1E1CA 2J6IA 2OOKA 2ROQA 2WF8A 2DCUA 3BTVA 1AV7A 3NHMA 4I9NA 2FE4A 3UMFA 1Y6FA 2VKQA 4TT3A 2JFWA 1B0PA 1FYVA 4F2DA 4M8SA 3EPRA 2COEA 5CEEA 1NLUA 2C3YA 1Y82A 5DGTA 2QE7A 4MWEA 3DZ8A 3VMMA 4D26A 1V16B 2OO3A 3G68A 4IHKA 4OMDA 1C0PA 3KLBA 4FIDA 3TIGA 1K66A 1EE2A 3NAQA 1Z12A 5FWYB 1R64A 2IIQA 5NULA 3LLMA 4JHLA 2BTQA 4WRRA 3TM5A 2W6QA 1KDVA 1OAOA 3WZLA 4YCDA 5AVZA 4KR0A 4UHCA 3LAWA 4P86A 4W1RA 2WI8A 2Z9BA 4P31A 1ZZGA 1PW7A 5CLIA 1Q95A 2F00A 3GEIA 1U0LA 2FWMX 4WLNA 3QK7A 4JI0B 4C6HA 3GN2A 4WNYA 2FSIA 4BHTA 4YUYA 5J4VA 3V7NA 3FVWA 3I04A 1HLFA 1Q44A 3BH0A 1TCVA 1YQQA 3C41J 2BMAA 3ZCUA 4V3CA 5JRJA 1UZLA 1E2UA 5DTQA 2DOKA 2ZRFA 5JQGA 2G1AA 4CQJA 1YO6A 5JAOA 1FLDA 1Q11A 1FF9A 2B3DA 2C4MA 2VF7A 2YH2A 2J3HA 4ZYWA 4XOUA 1VIAA 3P9QA 3BHJA 4CLOB 4RD1A 4KITB 3RSSA 1P4AA 4B34A 1T5SA 1W47A 3GQBA 3DKVA 1DBIA 1SBHA 2YFKA 2O1SA 4OXNA 1XFDA 4DUGA 3E2PA 5IWAB 2NXEA 4BCCA 1YDEA 1P7VA 3SMQA 2EW8A 5DKFA 3TCKA 1NBOA 1Z6ZA 5AH0A 1M6NA 1OU0A 1VG9B 3SE0A 3ZY2A 1NW5A 4BIMA 1FSFA 4IO0A 1NX9A 4OHZA 3PXDA 1AN9A 1IG0A 3E9NA 5JNVA 3V2UA 2QB5A 3WL3A 4DLBA 4U7WA 4PS1A 3AHFA 4NNPA 3G2OA 1BHSA 2CDNA 1IE3A 1UAYA 3SQLA 4D74A 3WNBA 2VYNA 3A6PC 1IXZA 1H1DA 1I1QB 2R25B 1PVDA 3B3FA 1FLAA 5IH3A 3DMRA 3CN7A 3CHYA 4JJGA 4KQJA 4Q19A 4W63A 1JEDA 1WX1A 4JUIA 1A50B 2WDPA 3CUKA 3QLJA 1EQUA 4YJHA 2XUFA 3ZC3A 5L3RA 1X2EA 3MWKA 5EKXA 2CE2X 2R11A 4OU4A 5G53C 2PHZA 1Z6TA 4OBWA 1GQFA 4HVLA 1UXKA 2HA6A 2VRNA 5HM8A 3AXTA 4DV1B 1YKFA 3RAFC 2QUZA 3VHLB 2F3PA 2NM0A 2WF6A 2NYUA 1M83A 2OV8A 3HSSA 2XUGA 2CYCA 3GJSA 3O93A 4II7A 1I80A 2CN1A 4GO1A 4GRIA 2GZ2A 2I2CA 4Q00A 3A3NA 4QFBA 4JEUA 1OY1A 2B69A 4XM2A 5ALEA 3LWBA 3QG5A 3TOZA 4NJMA 1ORIA 1W0JA 3T9CA 5C2JB 1T3TA 4RS3A 2VHUA 3DLHA 1SD1A 5FPQA 4G37A 4S1WA 3TL6A 1JEYA 3W90A 1TQ2A 3PC6A 4QXMA 1XZIA 4OHOA 4LJKA 2QMQA 4B3MB 4MW7A 5T41A 3WJ2A 2H3EA 2ZP1A 1EWKA 3NP7A 5DGDA 2OZLA 3NOXA 2KYRA 1BA3A 4YYEA 2ISCA 4TVSA 5CPBA 3ODPA 3VR1A 4AF6A 1PJLA 1EZ4A 3STHA 2RBGA 4WESB 4MARA 2A86A 4NARA 1TIPA 1S2OA 5DISB 4YRKA 2X0NA 3LZ6A 4TRJA 3SX0A 2BGJA 2YWBA 1CJTC 1Q0HA 2CMHA 2JAHA 4YLGA 1Q12A 2ZRIA 2WWVD 4CG3A 2FGKA 2EBFX 3K5WA 4KDRA 2R0QC 4RQUA 2A88A 3DEJA 3NH9A 4I2VA 4U8HA 4AWBA 2VA9A 2OBBA 3ROFA 4KI0A 4NG5A 3ICCA 4BP3A 2JLAA 4JLPA 4OJMX 1IJEA 1CULC 1E6KA 1ACLA 4XB2A 1G9TA 3AJRA 2C2KA 2D4HA 3H8VA 3KSRA 1KO7A 2X1MA 2G82A 2B4AA 1M2VB 3P9PA 4RSMA 5CU7A 3CLSD 3FMPB 1KI6A 3ANNA 3MMSA 2VXCA 3UXEA 5JADA 5HHTA 2YY6A 4D0GA 1NFRA 2IF2A 4NONA 3EMKA 3SJBA 3VR0A 5BNTA 4WQMA 3DCYA 3QEMA 1P91A 1JHAA 2WU4A 2YBEA 3DE6X 2P4SA 2WBLC 4L9RA 4LYJA 2A92A 5FI1B 5FKJA 5TR9A 4TXHA 4B33A 1CERA 3PYLA 1U2EA 3BFKA 1GVHA 2XDQB 1HNXB 1O96A 3SXUA 1DLJA 3JCZA 4IIDA 4DABA 5C4MA 1PZHA 3EQZA 3UMBA 3ZS8A 1Q3TA 4EEZA 1O03A 1BEEA 1G7TA 3RJTA 5DGIA 3VPXA 1EE9A 2JCBA 3U7GA 1E6EA 1KMMA 4Q24A 1JI3A 1DJPA 4ZQIA 2UYQA 5LBIA 3UJAA 4BBPA 4E1VA 3ICQB 1AQYA 4RQBA 5M5BA 1RR6A 3G3EA 2PXXA 4AY6A 4MDHA 1W4RA 1UPUA 1Y5LA 1B42A 1CPYA 4H60A 3HB1A 3T52A 1L3IA 2PYDA 2GO7A 2XGGA 3D4IA 3TR0A 1RW4A 1ZUWA 2RARA 1FIUA 3IIEA 4HXYA 2IYFA 3KG2A 2HEIA 1GIAA 1V1MB 2I55A 4ND2A 4DR1B 2QLJA 3EEFA 3SHOA 2CXXA 1XLTC 1Y4DE 3LY7A 4WCFC 5H3CA 4I55B 2CL5A 2E4AA 4FB4A 4DIMA 4B74A 5CB4F 1GNQA 1WBJB 2BM1A 4JOCA 4YJ2B 2ZJ3A 4JLOA 1SOMA 3TNFA 1Z4MA 3K9BA 4JUDX 1NWHA 1H8HD 1Q17A 4BRUA 4P5PA 1OHHA 4EWLA 4GVLA 1JKMA 3VTFA 3THXA 4EB6A 5DN9A 2B4YA 1Y3CE 4D6PA 4MP3A 3VDQA 2H5IA 2JKVA 3BICA 3THOA 4MQBA 2UDPA 4A6EA 4YRZA 3GPCA 1NG1A 4HAXA 5CGZA 1KP9A 4HGZA 2HMUA 1FRFS 2GF0A 2P1RA 3ONEA 5T6BA 1G41A 3OPYA 5EJEA 1Q0LA 4MX8A 3PNLA 1I0LA 3R0QA 3U40A 4H9GA 4F8EA 2W8ZA 5BORA 4HGRA 5HNKA 4URWR 2EG5A 2WQZA 3KKOA 4GG1A 2NWQA 1TA4A 3I6ZA 4NCNA 2E4ZA 2BHTA 1Z5UA 3QEBZ 5F9MA 2V5AA 2EJVA 4CMIA 1QTQA 3NBQA 1LF0A 2BFAA 3ABIA 2WJGA 4A16A 1W4LA 3GLHB 2C5GA 2J9XB 4B3XA 3AOEC 4R2KA 1JKFA 1UOQA 2QR2A 4J07A 3FVQA 3PKJA 5DTEA 3PJFA 1PYGA 2AHRA 1XCGB 1QO0D 4DA0A 1ZHFA 1KYZA 4V3BA 1EBBA 3D0QA 4PR0A 4L9WA 4HZUA 2YNMC 2YVUA 4OL0A 4QBGB 3CKYA 2BJWA 4R5MA 1CNMA 3KPVA 3AEQB 1K6MA 5TQVA 3RC3A 1QHGA 3TH5A 1NVTA 1U11A 3KXIA 4EATA 4DREA 2P2SA 2Q8QA 4BO2A 3GYGA 3I0NA 4R5HA 4JBWA 1WV1A 4IVPA 1EWRA 3ZVLA 1NQ5A 1NJ8A 4DLUA 3X1DA 3L6BA 1T5BA 2NP6A 2GVNA 4I8IA 2HQRA 1MQSA 1P4RA 3L1JA 4NYIR 1XZMA 3VDMA 3CX7A 1IPEA 1HT0A 5E6SB 5A4FS 5C5DA 1BXRA 1KZ6A 4ZKEA 2AUNA 3ADKA 1SOUA 1S2IA 4GRDA 1DVRA 3LYLA 4YI5A 2DKFA 3H9QA 1I1HA 3D3JA 4MB2A 3FZNA 3L8HA 4UATA 4MO2A 4A03A 4YV0A 2HZ7A 3A70A 5CFPA 3LKVA 1JFLA 3DAPA 4HRYA 1VE5A 4HEA6 1EB8A 1XIVA 1WKBA 3F3KA 3JPWA 2VTBA 2XBUA 4L3WA 5TDHA 1TD9A 4BNYA 5L3SB 2EWMA 2L2QA 1V95A 1XTRA 4B6JA 1VCOA 3JYOA 3TKYA 5T4EA 2C2ZA 2JGAA 2HIGA 1VMAA 3NV9A 4GX1A 3A28A 3TRJA 3VGJA 1EDDA 4C6TA 3O4GA 4KE7A 2AE1A 1M7BA 1RI1A 2XDAA 3DJFA 3O4IA 5DNEA 4TYYA 4ITUA 1Y34E 4UU0A 2V6MA 4LRXA 4N12A 2C9ZA 1P2GA 1R3UA 1RHJA 1UK7A 1NF3A 3N74A 4F60A 1QB7A 3RG8A 2X41A 3NBFA 4CCSA 3KZ1E 4Z4FA 1GP2A 1JWBB 1LUAA 3BERA 3IBTA 4ND3A 3VPAA 5CA1F 1GAWA 3OOHA 4RVGA 4I6JA 4B4WA 3RT7A 1PAUA 2E55A 3BJEA 1I4LD 1L0BA 4C0QC 3Q3GE 1S2GA 4K6HA 1HC7A 1SU6A 2JFVA 3H5RA 5A2GA 4L22A 1SUAA 3HY4A 2HSDA 4KXMA 4J76A 6YASA 2EGGA 4A8JB 2VT2A 1QFJA 1RAGA 3LC0A 1D6NA 3AVPA 3LQ4A 2Z98A