3OOWA

Octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from francisella tularensis subsp. tularensis schu s4.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
SVQVGVIMGSKSDWSTMKECCDILDNLGIGYECEVVSAHRTPDKMFDYAETAKERGLKVIIAGAGGAAHLPGMVAAKTTLPVLGVPVKSSTLNGQDSLLSIVQMPAGIPVATFAIGMAGAKNAALFAASILQHTDINIAKALAEFRAEQTRFVLENPDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from Francisella tularensis subsp. tularensis SCHU S4.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase,catalytic subunit
total genus 47
structure length 160
sequence length 160
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 3oowA00
4JA0A 4YCJA 1U11A 3ORSA 3RGGA 3TRHA 5CLFA 4YCBA 5CTJA 2FWAA 4ZC8A 2H31A 3OPQA 2NSHA 5CLIA 2FWBA 1QCZA 2NSJA 2FW8A 3RG8A 2FWIA 4AY3A 5BOSA 5CVTA 4Z7JA 5CLHA 4ZJYA 5BORA 5BOSB 2FWJA 5CLGA 2FW1A 2FW6A 1O4VA 1D7AA 3KUUA 4ZK2A 4YCDA 3OOWA 4AY4A 4ZMBA 2ATEA 4YCCA 2YWXA 2FW7A 1XMPA 2FWPA 5C5DA 4GRDA 4B4KA 5CLJA 2NSLA 3LP6A 2FW9A
chains in the Genus database with same CATH superfamily
2OGSA 4KXMA 1YZNA 5BVHA 3BRCA 4PN7A 3G9UA 2YWDA 3A10A 1H2BA 1URPA 5B58T 4Y7CA 5DX1A 9ABPA 5KC9A 3QGMA 1J20A 3G9XA 4DKXA 3GJ6A 1J2RA 1OWLA 4X3OA 4ZXFA 1C0PA 5K0CA 4FYHA 1D4FA 3FPBA 3N75A 2ZRQA 3UOAB 4NZMA 3FMIA 4F84A 2HEGA 2JFVA 1TUGA 2NYUA 3NZEA 3JYLA 1WF6A 1P4GA 2RHDA 3Q98A 2NTNA 4HLDA 4LRQA 3AVTA 3HBFA 4F5EA 2Y8EA 3H5TA 1R3UA 5G0TA 2WSSD 1Y1PA 1AN0A 2FPPA 3M9WA 5F77A 1BRMA 2EGUA 4N39A 3CEAA 4Z9BA 4DABA 1R9NA 4FFMA 4ZMSA 3AJ8A 4NAUA 2QRPA 2CMHA 4K9MA 2NXCA 5EWLB 3E4CA 3U3OA 4BMYA 4RVUA 5ICFA 1OVMA 2RBKA 5AK3A 3MAJA 5ADVA 4N0PA 3UHPA 1INLA 2CNWD 1XNGA 1FSGA 2A5LA 1T29A 3MIZA 4CQJA 2G7MC 1R66A 4GRAA 1F0KA 4TLCA 2GWRA 5L3SB 1P9NA 2HDOA 4EP1A 4B0PA 1NI5A 3OZSA 2OFXA 3TZQA 4BO0A 5GVRA 4ROTA 3C15C 3TYXA 4LOAA 3DZKA 3WE7A 4E1AA 1D2GA 1I1QB 4GC5A 4XH9B 3Q87B 1DAHA 2FLVA 4M2LA 3M9LA 4R8RA 1XA0A 4TS1A 5LKRA 1WD5A 4WCDA 1CRLA 3B1YA 3K2IA 3HVUA 4RF2A 3M3DA 2G6TA 2HUPA 3QE2A 5K8TA 1Z35A 1E8NA 4WL0A 2O7VA 4DPLA 1SEPA 3FCXA 4FWBA 1MHTA 2WSIA 5DN6D 4F6CA 1I9CA 1ZD5A 2QF7A 1V11B 2EDCA 2GEJA 1GAWA 3P9QA 1HL3A 4MV0A 3UPDA 4KRYA 3B70A 2X9GA 1D09A 3NBXX 1UF9A 5DX8A 3GLFE 4GYJA 4BX0A 3V4FA 2IP1A 1F38A 2HXGA 5ALVA 2Q5EA 3LBIA 3M1LA 3NTUA 1PQWA 4PX5A 3VPDA 3WMRA 1B3BA 1ZJ5A 3SYKA 2HQBA 1DL5A 2QUIA 4IDDA 2QZSA 2I33A 4C4RA 3K9GA 4CKBB 1NKSA 4WGGA 2XMGA 4HAIA 4ND8A 3TEMA 1XD2B 4MSUA 3AP3A 4DNFA 3EDYA 2VQSA 4IQFA 3DCYA 5ICEA 2Z1NA 3KSDO 3OKCA 1JLKA 5I9TA 1ZOSA 1O2DA 5CVDA 2A5GA 2BMWA 1NP6A 4MCAA 1XMVA 3OCWA 2Q2VA 1EFPA 3OPNA 1OYYA 3KHUA 1N5JA 1W96A 2QXUA 1P7WA 3C3YA 4AS2A 4HTFB 2YXDA 4FEEA 4PHCA 3P0JA 4PAMA 2IKQA 1E4EB 4OQZA 4Q4HB 1JKIA 2R7KA 5F9HA 1CR0A 1V5IA 3GGSA 3PXXA 4KTVE 5CB4B 3OTOB 1OB2A 2Q41A 1GFSA 1TD1A 3HCCA 3QFSA 4PX9A 3ZIDA 2K6GA 4KVGA 4LW8A 4YMIA 1SCKA 3ZNOA 2OEPA 3L4SO 2J6HA 1YL6A 2QZZA 2OORA 3OJCA 4Q9LA 5B3KA 5JSZA 1V3UA 1FP1D 3BXEA 3WB9A 2I34A 2Y1OA 4HFJA 4NKRA 4N3AA 4LDNA 2OD7A 3Q6MA 2YWJA 1QIDA 2OCIA 3H13A 1FYWA 2ALJA 3OPYA 4PGMA 4PXSA 3WWOA 1DCFA 4EO7A 1WHSA 2IUYA 4WA7A 3W5HA 4MB0A 1E1QA 4MVJG 1PTKA 1E3LA 3BMOB 4MR7A 4QQKA 4XX0A 2D2VA 2H7XA 4UU1A 4ZAYA 2XMBA 1KI2A 5C3UA 3O4JA 1UBMS 4KPGA 4NJOA 4ZO9A 2GPYA 5CW2A 1RYYA 1CY6A 1DWQA 1KXJA 1VIAA 2JJYA 3QX7A 3T9FA 3WHIA 2XNDD 2R0QC 4V0NA 4WGFA 1NI4B 1U65A 4F60A 3HABA 2XNKA 1V6CA 1GD1O 2KBFA 3V4SA 4AN1A 1XP5A 2VWGA 1K2WA 1RHRA 1RI5A 1IK4A 5CFQA 2P40A 1B41A 3OZIA 1C3LA 2HIMA 4B5LA 2FN4A 2NO5A 5UKDA 3ZNNA 1WSBA 2PHZA 3EHDA 3ONVA 2B8TA 4EVRA 1LPPA 4LVCA 2IW3A 5IW8A 3KLOA 3RUIA 1FDTA 2LKDA 1I51A 1KC1A 1U8XX 5EMKA 3TAXA 4BLUA 3FHTA 3OJOA 3IPAA 3BWYA 1QF7A 2FE4A 2WAXA 4BQIA 2XXJA 4PRZA 2OCLA 4CIBA 3U9LA 4PG4A 4WIAA 4Y6PA 3DE1X 3GCWA 2DBRA 2Y6UA 1YZ3A 3C6MA 1AQJA 1DUSA 3B9BA 3DMRA 1HRDA 3FDIA 4D5EA 1RQ2A 2ZJ0A 2UZIR 1DGQA 4OXRA 3UOGA 4WBNA 2BLNA 3IALA 1B93A 3DL2A 1ZM2A 2NT3A 1Q19A 3W8RA 4B85A 2O7RA 1OI2A 3B1KA 3WGOA 4TLEA 1DKUA 4L2IA 1G7RA 4TVBA 1QB8A 4LF4B 3BS4A 3V2UA 2DHCA 4CLDA 3L8YA 1YK0A 2VAXA 4B9EA 2QBYB 5I3CA 5J4LA 3F8WA 5HEKA 5IEJA 3IT0A 3ABSB 2V6JA 4C07A 4RSMA 2XUGA 4J49A 4QO8A 5A3SA 1T5SA 3WQQA 3PXCX 1EFVB 3H9JA 4WDQA 5FA8A 2PKRA 3NHRA 3PCXA 3SQLA 2JIRA 2WD7A 4A92A 1LLDA 3OE4A 1C9MA 3W8FA 4R0MA 4GL2A 4HY3A 3LCCA 2GBLC 2C7VA 3L6DA 1VJGA 3O21A 3WMGA 2EF1A 4YUYA 2ZBRA 2JFZA 2BGJA 3OQ1A 4IIVA 4ZPXA 1Z6XA 1P18A 3L79A 1OW3B 2JA2A 3WICA 3FG9A 4IRMA 5BUQA 1G7SA 1EPUA 2WM8A 4JDPA 1PF7E 4JEHA 2QAGA 5I7AA 4BMZA 4CCYB 4QXOA 1QYIA 1DRWA 4BECA 1D4OA 2ACEA 3C45A 3NV7A 1OXBB 3OSUA 1YB7A 2TMDA 5LQCA 3R4VA 1M34B 1E5TA 1H4VB 1J0EA 1TQHA 1K6XA 4AMBA 1ZAYA 4WLOA 3FJ1A 4PTLA 4ZOLB 2YJ3A 1KO7A 1SHKA 1LC3A 1VMDA 2IHTA 4UKDA 3ORRA 4B9AA 3C85A 5JC8A 3SQNA 1K8RA 3BCRA 3O9MA 4NC9A 1EXWA 2P5UA 3HR4A 4LGCA 3R4CA 4GOXA 3FW1A 1HH4A 2QU8A 2YV4A 1P2GA 1T10A 1E1YA 3W9SA 1AKVA 1A7AA 2VYVA 2UZAA 3BD7A 3NOOA 4HAWA 2X3UA 4RY9A 2CYCA 2XVZA 4K2HA 1QQ5A 1P5HA 3OE5A 4HRAA 1XDZA 2JAQA 7MDHA 5HRAA 4LYAA 3WLQA 2H7YA 1YBAA 1QO9A 2FVXA 2ROQA 1E92A 4O8CA 4HUJA 1ZFNA 3ETHA 2AZDA 1Y63A 2B4RO 1VYHA 3C7CB 4XJVA 2YINC 4ZJUA 2NN3C 4S1VA 2C4HA 2FLWA 3LT1A 3PRKE 3ENZA 2J0VA 3UT5A 1OT3A 2OY0A 2ZRCA 3WX0A 2REBA 2XNSA 3K72B 3KIPA 2CXHA 2H9YA 2JFNA 3KUUA 5KOHA 1FVHA 3LCMA 3WKEA 3UC9A 3JRNA 3O3MB 4AB1A 1VFPA 1VKZA 1PVVA 3REQA 3L93A 2REQB 1CNFA 4JI5B 1G3QA 3A9WA 3MCUA 4OFWA 4B3CA 3FYUC 2X0DA 2JGFA 2OP0A 4U8HA 1YHNA 1T6YA 5COBA 3UG7A 4LV5B 4RC9A 3R5HA 1U11A 3VO9A 4M1WA 3CVWA 2GQ0A 1OIXA 2E2WA 3RWOA 4DILA 3CX6A 2WWTA 3WNVA 5CT5A 2BSQA 1YIOA 3LUBA 1WHTA 4ZGBA 3G6KA 1AU9A 5JMWA 4KYVA 4F2HA 3QVMA 8GPBA 4RH0A 3CPEA 1TF5A 3LUGA 4PCAA 1PNOA 2QRHA 3NTOA 3VPGA 4E11A 1Y6JA 3GLFB 1I6WA 5K3BA 3WGZA 3SYLA 5LQUA 1M67A 3WB1A 3WTCA 1C1HA 1C9DB 3IO5A 2IYRA 3ZZTA 4BY9E 4V2IA 5A71A 1DFGA 1IN4A 1GRRA 2G76A 3KD2A 3HRHA 1TM1E 2GZHA 1D04A 3EEYA 1U2QA 1DP4A 3IVXA 2HWUA 3UK2A 1NJSA 5KSOA 1KJJA 4FFRA 3DKKA 3EFHA 3T1TA 3S2ZA 2YN0A 4L8FA 2DWCA 3NAGA 3T61A 2G06A 4BZXA 3DVRX 4B3GA 1O97C 2OO5C 2C78A 5C5IA 4F38A 2HO5A 2IS1A 5C4GB 2IXAA 3FMFA 4FM9A 2LCQA 4D3XA 2Q3HA 5C1PA 2Q6KA 1Z4MA 1X19A 1Y3HA 1FX0B 3NEYA 3IP9A 2QGNA 4V3CA 5EPOA 4EW2A 3ZIAA 4XYLA 2Z8XA 3CF4A 1MDBA 1L8OA 4CLOA 1PVDA 2DHEA 1ILEA 4KLZA 4UC0A 4I4CA 4K6MA 3VZCA 1JJAA 1T0IA 1Z28A 2J0UB 4J16A 1KJWA 1VI2A 4JFRA 1M6NA 4IJ5A 4AROA 5E6RB 5EP1A 2GPJA 2QROA 4NENB 2BGIA 4YN3A 4K7JA 2BFCB 4B31A 3UATA 4CLHA 4RX1A 5C7LO 3SE7A 3OQJA 1WPRA 4YQFA 2OD2A 2OORC 1NVBA 1CS4C 1XBTA 4ND8B 3FJOA 1G8SA 4MKGA 4TVKA 4CL3A 1F2UB 3H6HA 3I9V6 4C1BA 4DLWA 2JLUA 4RJLA 1Z8HA 2Z58A 1NXWA 3IB6A 3DOCA 1SULA 3K1AA 1YR1A 3BXOA 3HI6A 5SYAA 3G8DA 1KZHA 4N76A 3O4GA 1OT5A 4J91A 4RMIA 3U7IA 3WRVA 5I8WA 3PDCA 4QFCA 4D82A 1B0AA 4JIMA 4UXIA 3FOAA 1GLNA 2PT7A 4TKMA 2Q2QA 3T7JA 3UB3A 2BL4A 3NIGB 2O2YA 2IYEA 4HEA6 3ZHYA 2QRVA 1V4BA 4OXYA 4DARA 4FONA 4JLBA 4M3NA 5DEIA 5BVHB 4WERA 1EUCA 3TFQA 2VJKA 1Q22A 3K70C 1M6VB 4RPLA 5DYTA 5EXEA 1TIPA 4WCFB 1SWVA 1X3SA 1RHUA 4Z9FA 4AFNA 4OEHA 4B8ZA 1Z88A 3OAAD 2P9QA 2BE7A 2UYGA 1C2YA 5LZ5A 4XM1A 4RPIA 5AW2A 1EFUA 2AWNA 4BC0A 2O5VA 5BNTA 1D7AA 3KEQA 4P3XA 3OICA 4K46A 2RIPA 4W8HA 1U31A 1UJMA 1PBTA 3BJEA 2XCIA 3BL6A 3F78A 4CG0A 1AOXA 2VHUA 4FOLA 2SKEA 5IF3A 2JCVA 5ARDA 5JCJA 4DV5B 2Q3MA 3BZUA 5TNXA 1TCVA 5B7NA 1U7TA 2GD2A 2NV2B 4N49A 1BGXT 3RC1A 5HZKA 1N77A 5DSXA 1YTUA 1U94A 1IY0A 2GEUA 2Q6VA 2OM6A 3LBFA 1WPQA 4IJQA 2QQFA 2XT6A 4JX9A 4N8EA 3SLGA 5ALPA 1MMFB 1M5TA 3K0CA 1VCOA 4UBOA 4OSEA 4ZV9A 4C0QC 1OKKD 4HDNB 4E07A 3OLXA 2ONZA 5B5SA 1L4NA 2Q4DA 1GKYA 1TKCA 3WNBA 2V3VA 4LX0A 4TS9A 1KJIA 3U9SA 4U02A 1SUPA 3MS2A 3CUEF 4YRGA 1NN1A 3C8UA 2FPOA 1L4YA 4IDHA 1T5DX 2V7QD 5G1OA 4QHSA 3PDIB 1PG5A 2I9PA 4LISA 4MEJA 3R7BA 4DRXA 4YRPA 2ZTHA 3AYXB 1L5VA 1DQNA 5AW7A 2NV0A 1M8JA 1FBNA 5TMPA 1DIAA 2Z9DA 3MWDA 3RUAA 5JZSA 1Y37A 3K5IA 4RTPA 4MQFB 1C0IA 1MJGA 5FBKA 4ZDIA 1QQAA 4QKQA 1EP2B 2YWBA 4TS4A 3WOHA 1GR1A 1NNUA 2FW8A 3NHZA 2VHYA 5CVCA 1PZMA 4C30A 4XIIA 3NDPA 3UHFA 3CGGA 2YQ4A 3RH0A 3HBAA 3LECA 3D9QX 3QEMB 1Y6QA 1JQKA 4BLTA 1XVAA 4WSOA 4TV8F 1JH8A 4YFVA 3C98A 1LK7A 2IHBA 2XE6A 2ZDQA 1PUJA 1M6YA 4LMBA 4F45A 2LD4A 4O2AA 2K5UA 3V2GA 3GEHA 4Q3DA 3UUEA 4FB5A 5I7FA 3PEWA 3BL5A 1HLPA 3EAGA 3OEHD 4TUYB 5JYBA 3EPLA 3ORSA 2VH5R 4NBRA 5KPJA 2V7UA 4HKTA 1H1LA 4HXGA 3T7KA 2QMEA 1IM5A 4A8JA 3JWJA 3P5BA 3PC8A 2NQ8A 2WG0A 4MS1B 4X60A 4OIFA 3TQQA 3ZWYA 1XVTA 1K8QA 1KH3A 1OZAA 1P5RA 2BZSA 1VCMA 3GFQA 4AMYA 2LDBA 3HQ4O 4FMCB 3VAAA 1BG6A 2H11A 1UEIA 2C9OA 3M4JA 1KHHA 2E89A 2XAAA 3INGA 3CX4A 1RXUA 3B5EA 3SS7X 2DVMA 5G1NA 2OZVA 2ZJFA 3D8RA 1J1UA 2GTPA 3E18A 2GCIA 1J2UA 1LEHA 1T5TA 3UJ6A 1VLZA 4EG0A 2C2ZA 1UODA 3WB0A 1KEVA 3CZ5A 4PPGA 1NGSA 5HFJA 1NYTA 4DV2B 3QE9Y 2JGEA 5JSZB 2BHNA 4FCWA 1F17A 2RSLA 2OA0A 2R4UA 4XLZA 4CMKA 1ELOA 1Y5MA 2W71A 2XECA 4GR4A 3UIEA 2N0SA 3FOEC 2VT6A 1CRWG 1V9CA 3ZLJA 3GRRA 1E2BA 3T3PB 3GBSA 4MQ4A 2YY6A 2M6KA 3ZEAA 1Z17A 4QM6A 5IKOA 1J9ZA 5EIXA 3FPFA 2JFPA 3L0IB 3N86A 4RQUA 4QYXA 2UYHA 4QNNA 3E3MA 3RBVA 4D3YA 4QBIA 3O47A 2C9ZA 1XQVA 4GGOA 3V48A 1KY4A 3I6MA 1W5BA 3OA2A 2WF9A 5LJIA 1JG3A 3S8MA 4Y2PA 1PYDA 2BEWA 4ZPJA 3C7DB 3I0MA 3EMKA 2D7JA 3OX1A 4BNYA 4XYEA 1KEWA 4ZCQA 3MG9A 4XE5A 1Y98A 3V8MA 2OBMA 1ISSA 3L77A 4P83A 1N7IA 2VP5A 3SJZA 3FCOA 3K6SB 3G7UA 4C21A 2C2MA 3MCZA 3IP8A 5CEFA 5HKAA 1BCSB 3KJFA 1IHXA 1R64A 2C88A 2V03A 2C96A 1E62A 2VL7A 1S01A 2XF8A 3SEZA 2E4UA 5BMVF 2PSHA 5EFZA 4AZ0B 4C2BA 4LBVA 4U7PB 4L7QA 3F3KA 3GN2A 5EJ9A 4I5IA 3PENA 4LV6A 3PJEA 1GPMA 3PF8A 4EB8A 1QC5B 3L7OA 3E27A 3VPHA 3W3AH 1YJ5A 3G5TA 4H35A 2E85A 3V7UA 2BTQB 4HO1X 1PZNA 4ER5A 5ALYA 3WGMA 2D2XA 1LQUA 3QV1A 4ZTUB 3MTAA 1QG6A 3NDRA 2H52A 1FNNA 3ZD9A 3QUBA 1X1AA 1YQXA 2JD1A 2EAUA 3QFFA 1KZGB 1VLHA 3FH0A 4H6XA 4KOEC 4KR0A 1JNXX 1WLSA 1NW8A 2BELA 2G72A 2P1ZA 3BA6A 3D5EA 2OQ2A 3HZRA 1YB2A 4ZCSA 1TDJA 4FR5A 4G1EB 3FWPA 2H4YA 5AMXA 5FLKA 1GZ7A 3G2QA 5HGJA 1K0UA 1IZYA 3INRA 5KWVA 1IVSA 2FK7A 1UBTS 3T5GA 1KRWA 4LNUA 4TL7A 3LGAA 1JHMA 1T9ZA 3DBOB 2Y0DA 3P4YA 1CX9B 1PR1A 1JQDA 1RJ9A 2ZBQA 3ECAA 4JT8A 4KRXA 5I8ZA 3P9ZA 2QQ5A 1C50A 3TEJA 3G5UA 4AL4A 4FQ5A 1XJ0A 3TVDA 2QX4A 1WCIB 4TYMA 1UDWA 5H70A 3T3HA 3ZWNA 2ZYVX 1G38A 5HUJA 5KHAA 3OMWA 5DN9A 1Z5ZA 2XYQA 4YX9A 3MUNA 3QEKA 1C1XA 1H93A 4DCCA 2QJFA 2QPAA 1C7JA 5BW4A 2J5BA 3PIIA 1L8LA 4OUDA 4MGHA 4PZAA 1FYVA 4FK8A 1K6EA 3QQ5A 1NMYA 3H2BA 4MGIR 2EIHA 3LPLA 1CUUA 5TQ2A 3BK2A 3T3NA 5HKKD 4H3KB 2QRGA 3OWXA 1FDIA 3DE4X 2WWYA 3R3YA 5BRNA 3MW8A 4UVHA 2XEDA 3ZBUA 1SRQA 5BQOA 1MB2A 2BM1A 4URYR 5LA6B 3BZWA 4OO3A 3LRXA 3QOYA 3W2HA 1G59A 3DLHA 4KNYA 4XWYA 1ZAKA 5MFPA 3BSFA 1R18A 2JI6A 3OFSA 4MI1A 2E49A 4JB3A 5KIAA 4XWKA 3ZI4A 3L3BA 1ZHHA 3IQGX 4E31A 5B1IA 3F47A 5ALIA 2C7RA 2F3SA 4LDAA 5A4MS 3LY8A 4RJKA 2ZU0C 4I6EA 3TUJC 4XW2A 3Q3HA 1LGYA 1XN1A 1IH8A 4R6WA 4NABA 3T52A 4D0RA 4ZQIA 2ARKA 3X44A 4PVCA 1WW2A 1LZLA 2BFDB 4HQFA 4UTVA 3Q5DA 2Q8PA 4G09A 2PL1A 4TZKA 3SHFA 2V65A 3FAKA 3PFGA 3ZU2A 1JEYA 1U80A 2WYVA 3IV7A 4TTTS 3Q2OA 1U63A 3FR7A 1W1UA 2MMCA 4C6SA 4R83A 1YA6A 3HCBA 2JIPA 1PS9A 1RWVA 2ASVA 3DZHA 3DVSX 3K2EA 5BSTA 3THSA 4LQ4A 2F6RA 5BSEA 2H48A 2E21A 1AGXA 3I09A 3Q88A 4OLHA 2AQHA 2UUAB 3ZK9A 3R0IA 3TS1A 2YMQA 2PBLA 4MX8A 4OJQA 4RTNA 3PVCA 1B76A 4LYHA 1EZ1A 1T2AA 2DC1A 4RFSB 2AUNA 5B3JA 4CDMA 5BWCA 4RK5A 5CAEA 5IAKA 1ZNYA 1ZEMA 3OOYA 4GSKA 5DBEX 1NYLA 1DV1A 1D9ZA 3OOHA 4GC9A 4M8SA 4B4UA 2C82A 2Q2WA 4HNUA 1PHPA 2YCLA 5IH3A 5A4DA 3MWKA 5FLXA 1RZVA 1G19A 1NMXA 2L0XA 1T1JA 2XA9A 1RFLA 2CBXA 3MF4A 1KYZA 1U1FA 1JILA 2PGJA 4L1KA 2ZETA 3T7RA 1I0LA 1WQ3A 4RF4A 2HM7A 5HILA 1YDFA 1YVUA 3DBHA 3AZPA 1QUEA 3H84A 5FAXA 3ROPA 3SIXA 4B46A 5JNTA 2AVDA 1M8FA 3NC4A 2WQ6A 1E1DA 5BNWA 3MWDB 3L6CA 3IP3A 3F8TA 3IVRA 5ALZA 4NLLA 5J9FA 5BYBA 1W5TA 3AOGA 3KKEA 4DY6A 4FCTA 3PTAA 3KQPA 4BMVA 2C94A 4XDZA 3UAZA 5THXA 4FYVA 5JATA 2DAPA 3GPBA 3GAZA 2QVBA 5C1BA 4QUIA 1L5LA 1RC8A 2EIXA 4K9RA 2WP8J 4BP8A 3D7LA 3PC2A 4KW7A 1DAGA 2ZSAA 1U3FA 5HQ3B 2ZVQX 1FCJA 1D5WA 2XZTA 4WY5A 5SYNA 1XKTA 4LOLA 2BBTA 1RCUA 2H1WA 1JHXA 4QXMA 3CF2A 3J81A 2MDTA 1O77A 1TI7A 1G291 1OXXK 3WL7A 3B82A 4RNCA 1XALA 1XNQB 4EPWA 2BD0A 3RTGA 4BLSA 2HRZA 4ZOLF 1JKJA 4G0YA 4O4JB 3R09A 3H87A 2R6GA 5AHKA 2ZBFA 5DF1A 4DCOA 1CEXA 3DTNA 3REOA 2Q5JA 5HOQA 2C4WA 4INPA 2Q46A 4W5JA 4CLRB 3DDUA 3ZGXA 3F8SA 1G98A 1E2PA 1RPTA 4HFMA 5F21A 5LB2A 4DWWA 1W0JA 1GEEA 2DY0A 4ZQGA 3CX8A 2XD4A 1E98A 4OKSA 4MK4A 3JW8A 2DECA 5EHIA 1NDUA 4HRXA 2D62A 2VT3A 4IIJF 4JZKA 4KLCA 4OI4A 4PCLA 3D81A 4QULA 5ABPA 1U4NA 2WIBA 4B34A 3F0TA 3EIXA 3EFOB 2V5AA 5CG1A 3A70A 3OQIB 3GC6A 2CLSA 1IEWA 4UHFA 4CR8A 5KREA 3RJZA 4R68A 4M7RA 4WXMA 5DULA 1G2PA 5IM4F 3MWYW 4KU4A 4PBRA 1QCZA 2Q6LA 5A9TA 3KOOA 5PNTA 1GG2A 3C5VA 1PKXA 3EUFA 2FKAA 2C5LA 1ECCA 1JPUA 2ZIUB 1E1NA 3PVZA 1EQAA 2VBIA 3HVRA 4L07A 2BKUA 2VJDA 4P7KA 5HKLA 1UXGA 1QP8A 3JVIA 1E79D 1FDRA 1HQYE 4RE6A 2C9BA 2QOEA 2WU4A 1NPTO 5T4EA 4HV4A 3EPHA 3U0BA 4A8PA 1OILA 4S3MA 1C29B 2PX0A 3RRJA 5A6VA 2IE8A 1QSGA 5DHSA 3TXAA 5BW6B 3OI7A 1Y6ZA 4GR9A 4MIYA 3NVAA 5DE3A 2GM9A 3E7FA 1TYBE 2Y1KA 4YAEA 4F93B 3LIIA 4G97A 4JYBA 3E9MA 2JJMA 1N57A 4PLPA 2CN1A 3G5MA 4Y2VA 2P2YA 2QGZA 1MTZA 3DVAB 2PUBA 2QSZA 3IOBA 4D9JA 3M2PA 2X1HA 1DQSA 1GG5A 2C9DA 4LWOA 2O0JA 2ODNA 2W2LA 3DT8A 3EA0A 3WWZA 3AF6A 2EU8A 1Q1GA 1R0LA 1W1IA 3TFOA 1AQIA 2HWYA 1ISJA 1SU4A 4KIFA 1JA9A 1NKVA 2WFLB 3U09A 5I45A 2AXPA 4MZDA 3VMFA 4ZQFA 5KYNA 4LXYA 4JSYA 1QRUA 1YS4A 1SCBA 4X1YB 2QQEA 1Q12A 4N03A 2X7XA 1K7XB 1G8FA 3CJQA 3LQKA 3P9RA 1QLHA 2D0DA 2IL1A 4HF7A 5BQ5A 3UV6A 4JJ7A 4JZYA 1UMBB 5DTRA 3CLRC 4PEVA 3QKSA 5HM6A 3Q7TA 3UMSA 1PZHA 3LPAA 4LRWA 3C87A 4HN2A 1RADA 5HPYB 1MW9X 4GKKB 2RAFA 5TPWA 4RQTA 2YHIB 1DBVO 3AO0B 4X7MA 2CE2X 1KDVA 1N1DA 2EGHA 2FKNA 3BREA 4O2BA 4LUCA 2OZLB 5EAIA 2X2OA 1L5HA 4IZ6A 3SOZA 2AG1A 1KI4A 2IXDA 5JBQA 3HK2A 1NDHA 3JARA 5HHTA 4J03A 3KXLA 3GNSA 4D0SA 5KNBD 4YRKA 1BXRA 3UMBA 4D9HA 5F33A 1JNYA 4FBGA 3D2CA 2IZ6A 1PK8A 1SUIA 1H5QA 1ZMXA 4Z53A 2WYIA 3HN2A 2J7KA 1Q1BA 3CRW1 5CITA 1EVJA 2EKPA 2O23A 4G5YA 3BXHA 4LSZA 5JJCA 3I64A 3QG1A 2IBMA 3KQVA 4M6WA 3IJRA 3K1TA 2VZEA 2IS2A 1MXFA 3IQFA 2JVJA 3WRYA 1P33A 2MMGA 5J2TB 5DYNA 3W4IA 4M7OA 5CBKA 3BX1A 2JBAA 1O0SA 4DIKA 3C1OA 4GX5A 1N1EA 5AR1A 2XCSB 1HDEA 3M4XA 2GI4A 2DG2A 2PUDA 1EJ6A 3NBYC 4LDPA 3BSYA 4GW3A 4MWCA 3VH2A 3S7TA 2P2ZA 2VK8A 1NAIA 2AH5A 2QX6A 2AZMA 4HNSA 4K6HA 2VF5X 4RDCA 1ZOPA 1LF0A 5D3MA 3PDJA 4RV4A 5AVKA 5GGYA 1DI0A 2KJQA 3HVJA 3TNDA 4CF3A 4LRTB 2YKGA 3DS8A 2QN8A 1JLSA 3QF7A 2VUSA 5B3JC 1P61B 3TIFA 4Q4AA 2UVPB 3KZXA 3FHLA 2ZYDA 1O57A 5K4GA 1QVZA 2XNDA 1N9KA 2WBLC 3WWYA 3P0RA 4W1SA 2R7AA 2YN2A 4MXDA 4URFA 4XYMA 2HRDA 1XSEA 5JPCA 2ZIAA 4CDRA 1EFTA 4LC1A 2G4CA 4MRRA 3S2UA 5DYWA 3GA0A 3DCNA 1FS5A 3L02A 5HDQA 2XAUA 3IEIA 1RIIA 1H2HA 3LGSA 3PNYA 1AHHA 4YRBA 1IDN1 3QVOA 1B1CA 3EODA 1YRHA 2HJSA 2OHXA 3EGDA 3LDFA 4I99A 2GRUA 2X9QA 4Q7LA 2YVLA 2GXQA 3H9CA 1E2KA 2OT3B 1EGVB 2QN1A 2Y0CA 3MM4A 4ICIA 4JGBA 5D3KA 4AKEA 5K3FA 2DKNA 1SN7A 2PUTA 2XKKA 3K0FA 1MT0A 3W2IA 4O2LA 3TIIA 5GZ1A 1E1RA 3FVTA 4L50A 1N6OA 4KCGA 2A9PA 2P79A 4JVMA 1U4SA 1GPKA 2P9ZA 1G8KA 5FULA 5IAAA 3QLVC 4LXQA 1N7HA 4PAOA 5DNEA 4HXFB 4N9QA 2H2HA 4XFDA 2NUAB 3ILSA 1XRJA 3VBEA 1VXRA 4YUVA 1JQ3A 3V1KA 3VSCA 4DXAA 5IKEA 2QN6A 4BOYA 2EP7A 1E1MA 2V97A 3D54D 2PD4A 1KDRA 3KPWA 3MJFA 2YX1A 1TYEB 4LDJA 3TQCA 1EDOA 1QGOA 3AJRA 3JSXA 5DK4A 5J2UB 3G59A 3I01A 2F64A 1WOYA 1CV2A 4U9HS 5EIOA 2CXQA 1Q83A 1P9LA 2WE8A 2IX3A 4QQRA 3WBKA 4Y30A 2EWMA 2PAAA 2YXPX 3FVVA 1SCUB 1PNRA 1COWA 1KY3A 3KQSA 2CJYA 1QYXA 3B2EA 1TC2A 3TAHA 3O74A 1SXPA 1GNPA 1HDOA 3WRXA 1ODTC 3U3JA 2BGUA 2CLKB 5CK4A 4XCQA 3DQZA 2A7QA 1PWZA 2F3RA 1WJGA 3L8DA 1QKIA 3AILA 1E3WB 2EW1A 3EHEA 3FR8A 4EK9A 3EUAA 3KKOA 2Q0QA 2CL0X 2FWPA 4IOLA 4J4BA 5CXQA 4RTJA 1HNXB 2BDTA 1GUZA 2HF8A 1V39A 1V5FA 4M83A 3ENVA 4MJXA 1KK0A 2D1FA 3R7LA 1PG2A 2VQDA 2O8CA 3FHCB 3QWFA 1CEYA 1FFEA 1T15A 2X3FA 4HH4A 3D8NA 1J23A 4AXBA 1FVOA 1CDDA 2JGMA 2QIOA 4B8WA 3R3ZA 2PTHA 1UPTA 2P3SA 3FMPB 4ECAA 4AECA 1T2DA 4QFMA 4QPDA 4R1TA 1RP7A 5D8DA 3RUFA 3P0HA 1IATA 1XWIA 5B1HA 4KWCA 4ID9A 1E3DA 1UBJS 2F3QA 3HDVA 1MB4A 4UCXA 4C7XA 3FFTA 4ZRMA 1SXJE 3KAPA 1SQGA 2CXUA 2F67A 2FPGA 2R4QA 3LQ4A 4OPMA 2BE9A 2FRVA 2J5XA 2ST1A 3BCUA 4MZXA 3CPHA 5H3HA 2WWFA 3M5DA 5FNVF 3ZUGA 4K81B 4YJ3B 1ORDA 3Q11A 4TVSA 2R5NA 1QFZA 1TIKA 2C84A 4QYIB 3DYVA 3RIHA 4A5OA 2DKFA 1XLVA 3VKHA 1WE2A 4YUAA 3MQFA 3SZUA 4RULA 1RMQA 4ARZB 3CNOA 1JXMA 5GJBA 2GCGA 4EKNB 1AHNA 3K8ZA 3KPUA 3WFJA 2O5CA 2FF5A 4XKJA 4HLNA 3NBZC 4RS4A 4MINA 1JKFA 1KMQA 1QO7A 3BFJA 1DC8A 1WABA 1VGQA 3AXSA 3BWMA 3OQIA 4LWQA 4AJPA 4NK5A 3PNQA 4CR6A 3FGNA 2POCA 2QNIA 3MXTA 3JQ6A 1NOJA 3E5MA 3RIEA 3JAWB 1HORA 4BNJA 1Q0QA 1H1TA 4JA2A 2Y71A 1WV1A 3F98A 2VAWA 3SSAA 1UBGA 1ZX1A 2C2OA 4RA9B 4J3NA 1R8QA 3GLIA 3R6WA 1ZHOA 4DV3B 3PB3A 2ZR8A 4ZVUA 5A1JA 4ZO6A 5FBQB 5KNBH 4S1OA 5KNDD 5TLSA 2J5RA 3MMXA 3JWGA 2X1MA 4DMUB 1A0OA 3SX0A 4X65B 1KZ7B 3RUHA 4RWZA 5A3RA 3UGKA 3MGBA 1CZLA 821PA 4K6KA 2PZJA 4L4SA 2YBEA 4IDCA 1W2WB 4LE1A 4CM7A 1GGMA 2QK4A 2WWXA 4C4XA 3FUVA 1PZEA 3EC1A 1X7DA 1GUYA 1YB4A 1T25A 2YIVX 3B6MA 3SR4A 4FN5A 2A86A 4X1OA 4WV3A 4F97A 3INTA 4MYSA 2OCKA 1PR6A 4KXXA 4AP5A 1OBHA 3L6UA 4GDFA 4L9SA 1EVQA 1AE1A 3KYJB 3CUUA 1P4SA 4XUEA 1E3MA 3L1HA 2OK7A 2J30A 1LDMA 1AKQA 3EVEA 4N7JA 3CRQA 4UXHA 2ZIWB 4CUKA 4F1KA 3PT9A 2F48A 4QU9A 3N07A 2OAQ1 3K3PA 1YTLA 4HBZA 1PJCA 5JYEA 3RFCA 1MAWA 4YMTA 1RWPA 2VRCD 4D26A 3WQHA 4CGZA 4L4RA 1P2UA 4A0RA 2PUFA 4HDSB 4KQCA 4MQFA 5CXSA 5DLEA 4ER3A 1P3DA 2VUTA 3TLKA 5HIMA 1I5OA 2KSQA 5T3YA 5JECA 2QD4A 2TMYA 2QM0A 3VVMA 4U5QA 1VKNA 4BRWA 3WDKA 4NS4A 1E60A 3ZY6A 4KWEA 2O3TA 3LHKA 3DYIA 1H6CA 2D74A 3AT1A 4BZPA 4HUTA 1U0LA 2FXIA 5FPTA 4TV8A 3I2GA 5IC5A 1TTTA 5E6RA 4AIIA 1XL0A 2OAEA 5A0FA 4YRZA 4XPIB 1K7FB 3MGAA 1QP0A 4D25A 3X1ZA 1Z7WA 4DDVA 5K3EA 1E7WA 4UHHA 2O2JA 3WLOA 1SG9A 2FEPA 2PVPA 4Q18A 2JAUA 1ESEA 1GPUA 3H05A 1OJLA 2IV3A 1DO0A 4HQ6A 2OYSA 1L7RA 3S99A 3STTA 4I1SA 3SN6A 3WGVA 2B3DA 2IHUA 5EWLA 4D9BA 4X7PA 4JUCA 2FSVA 3FYTA 4YHHB 1GM5A 5EZQA 2XGSA 1Z5VA 2JBAB 4NU0A 2UUCB 1GY8A 4KMOA 3D02A 4PHGA 4RE5A 4ZTBA 4HX5A 1FFBA 4MUKA 5F1KA 3O0DA 2BTOA 2HKIA 4MQBA 4P33A 2WIGA 4GM4A 4B76A 2HK9A 5B4VA 4N7MA 2V58A 3GRFA 4V3BA 5EZYA 4MOWA 1XQ1A 2HT6A 4W5HA 1N0VC 4P32A 4HDRA 3ILXA 1KFEB 1JIVA 2OXFA 1JQEA 3WBBA 2QR3A 5FOVA 4B8YA 4F1WA 4IJWA 4FDLA 5BPHA 4DVGA 1H85A 1X1BA 3ITEA 2X15A 1N9ZA 3CG0A 5ISMA 1HX7A 1SBIA 1DEAA 2ABWA 4E5YA 2INGX 1Z47A 2W2MA 5KWEA 1MAUA 1WXIA 2Q9BA 2YHBA 1TLFA 1Y4DE 4I2VA 1LF5A 3DOUA 4MKFA 1Z36A 4MTLA 2X5OA 1RHMA 2B94A 3IOEA 4HUQB 3ZDYB 4LDRA 1DZ3A 1G4HA 1IAVA 2AFIB 2PT5A 4JI2B 1JKMA 2ZAGA 2ON6A 1PZGA 4O3FA 4KPYA 1C7QA 3HYLA 4CGYA 4CEIB 4BVAA 1JV2B 3A1CA 3UCFA 3CV3A 2AE2A 3CLSD 4EECA 3UW1A 5AO9A 2H4XA 3AVYA 2G4LA 2W11A 4O1IA 2EERA 3AKZA 1PT9A 1PL7A 1TRKA 2G9RA 3FNEA 3IS3A 4Z4QA 4WN3A 4NU5A 2UZ1B 1EWVA 3OTIA 5ECGC 5EWJA 4ZU3A 3AESA 1JIXA 3FDZA 2IXGA 3B7WA 4C6TA 4E5DA 4GPTA 3I37X 1UUFA 4IW3B 4MR8A 3V7WA 4N48A 1M8GA 1TJYA 1H6DA 5L4NA 5KDOA 2QP4A 3GROA 5FYQA 1PQPA 4UUMA 1VJ0A 5FLEX 1MB9A 2DSTA 1KP9A 3MHPA 2HAEA 1NC1A 2IYFA 1XZEA 5HW0A 1V8DA 3IGFA 3ROKA 3ANTA 3Q8XB 4I1YA 4UFNA 4Y3UA 4D9GA 1OB5A 4FOSA 1ANKA 1SA0A 4GICA 1YFKA 1GZVA 1NSYA 2IOQA 2G5PA 4YJHB 4G86A 3N2KA 3GLGB 3JD3A 2D4AA 4UNSA 2J3LA 1Q92A 4KFCA 4GHWA 5I7OA 4FWTA 1OWOA 3I6ZA 4P4GA 2UUPA 1QHFA 3GRYA 2JFFA 2HF9A 4AUEA 4Z7JA 1LQTA 3BBPA 3CUVA 3U60B 4RVFA 1Z5UA 3GCZA 2OHJA 2B7LA 3NQ41 3ON5A 2ORWA 3CIFA 1M8PA 2I7XA 4QDTA 4TLMB 5EVJA 4E51A 3R0VA 5LN1A 3GJ0A 1HEIA 1U81A 3NGXA 1RXYA 2Z57A 1MO4A 4JVLA 2I6XA 2V9CA 5HF5A 2C9MA 4JB2A 3OHMA 4V1CA 2H1LA 1TJNA 5DCWA 4FBLA 4ZYLA 3FYDA 3OURA 3GQBB 5I9MA 3GAAA 4QDZA 1AO0A 2R79A 3FSGA 3QP9A 5K3AA 2EQ5A 2BTEA 2FSSA 1P45A 2FFAA 3HJUA 2NVOA 3C41J 5ESDA 4UDOA 4ZVRA 1XXLA 4MITA 2HA3A 4YJFA 4GKAA 1UWCA 2J45A 3PK0A 5DCLA 1NPYA 2B5VA 5I01A 4U3JA 5B6PA 4DJ5X 1A72A 4UUNA 4QLBA 1BGVA 1YV9A 4J6EA 2W2PA 2HSEA 3UAXA 3JQ8B 1KDTA 4AICA 4C4AA 1MIOA 2ASEA 3WO1A 2I8CA 3FPCA 3G2MA 4MYDA 4RK6A 4I1VA 4IV5A 4CMIA 4Z4HA 2ACKA 4U6SA 1NXSA 1P44A 2XUQA 4JHXA 2A9VA 2IZ0A 2QV0A 1IJBA 3CRMA 1YZHA 3U3ZA 3CNNA 3L49A 1EINA 2C4KA 3RROA 3TXYA 1QONA 2BFNA 4MWDA 2GK4A 2E4ZA 4MVJD 5HF9A 1SM4A 4ZOAA 4M9CA 1ZVJA 3X1KA 1OLXA 2ZDHA 4L15A 4Y2GA 1DC7A 1GT6A 2XMSA 3H5OA 3A3OA 4QARA 5E7JA 2P78A 4QVIA 1NFQA 3BRWA 4Z5XA 2J3IA 4NJMA 1X0VA 2IVFA 4X8HA 2GARA 2PCJA 2QW1A 1ODLA 4KQMA 2I6FA 4W99A 2XMZA 5DHUA 4B81A 2SKDA 4DJFC 4HL6A 4JC5A 4XWGA 4EY4A 1UC9A 1G17A 2R7MA 2VPIA 4NHOA 3ZE1B 4B48A 1ABEA 2G71A 3PUXA 1RWBA 2E18A 5D1NA 1FQWA 5I4IA 1GOTA 1N2SA 4ABTA 2CBZA 3AUTA 5BOVA 2SBTA 3Q3EA 2XXAB 4AJKA 1T3TA 4LYYA 5K3OA 1TM2A 2XJ9A 1Q11A 4MUYA 5G1PA 5K6TA 3FCAA 5DCYA 1RNLA 4IMIB 4R51A 2CHEA 3MD9A 3SJ7A 1V71A 2BT4A 5ALEA 4CEHB 2JIOA 1JR2A 2CLFB 1NR1A 2NO9A 2V7BA 4IMJB 4XQ0A 1G4AE 3TW4A 3ZE0B 4ESEA 4AZSA 4CV1A 1OA1A 5E2BA 5JNRA 2EHJA 1NNSA 2NYAA 2PDAA 4H2DA 4AURA 1WBJB 1RYNA 4KLNA 2Z98A 4AUNA 3U2QA 5EJEA 4QUKA 4YAIA 4LWPA 1V6SA 3SU8A 1K98A 5I7HA 2YOHA 5D6NA 3ZU5A 1EK5A 2VDNB 2AS0A 2V54A 1SKUA 4EPRA 3MCWA 3TVTA 1D0SA 1NV9A 4KQJA 4LHVA 4WNIA 5TJHA 1NQUA 1AK2A 5JLJA 5CVJA 4XDHA 1IRIA 3CKKA 3OFJA 1L4KA 4MLCA 4IMPA 4X54A 1CUXA 4TWAA 5LLTA 2D5IA 3S2SA 1OC2A 2LKCA 3BMQA 4P81A 2UZ3A 1BKSB 4PBSA 5LUBA 5P21A 4HN4B 1CFJA 3TDMA 3L7BA 4TT3A 1SHZA 4EDHA 1GQFA 3HCFA 1RQ7A 3T94A 5JXGA 2EHDA 1FDOA 4HZUA 2E37A 2VUIB 2GKSA 1PT8A 4RZIA 2CHGA 4MV5A 1S7CA 1LXCA 1DNPA 1L6IA 2C3UA 2GF9A 4URUR 3DF7A 3Q5EA 1QH1B 1IY8A 3I9KA 2OCAA 1F6BA 1XF1A 2HFKA 1GV0A 4J0CA 2CNKA 3FRHA 4MDYA 3VTAA 3WY9A 1CQIA 4IHJF 1DG3A 4IKOA 1WL8A 5GOZA 2UYCA 1ZK3A 4LHSA 4V02A 3L8CA 4AJLA 3EDRA 1KOFA 1V35A 5LUAA 2HREA 2C57A 2XKAA 3WWCA 1BVRA 2VF7A 3CH5A 1R0KA 3PLRA 3P9PA 3UT6A 2LPMA 5JT1A 1FFWA 1QK5A 3GAMA 3D7SA 5K8CA 2UUOA 5AT1A 4N3NA 2AD5A 421PA 3UJ7A 3CSSA 1TKAA 3HKBA 4IVPA 2EXXA 1GZSA 4PPYA 3I73A 4UVGA 4NPCA 2P77A 3CBGA 4WY8A 5DISB 3K6KA 2RC5A 2ZJ5A 3ABRB 1GN8A 3AETB 4LXIA 5ENDA 4FR2A 4YK7A 1JIJA 1OLSB 1R8YA 4IQGA 1QH0A 5FPYA 4X00A 5L3QB 3KDPA 1S2OA 1TJ4A 3N70A 9MHTA 4YJ3A 4DADA 1QV9A 1U2GA 4OK3A 5BSMA 4K9KA 2R8YA 3HUFA 2JH3A 1JE0A 3NU1A 3WKAA 5LD2C 1BA3A 1EVEA 4WINA 2SECE 3PUHA 3PDUA 4WHMA 4ARZA 1G66A 4MQ6A 5AXBA 1DS6A 2CLHB 2P2NA 4GOMD 4AXXA 5IYZA 4NMHA 4C0WA 4BMOB 4K8RB 2IP4A 1PVOA 2I66A 3WRYC 2C0QA 1J8QA 2UZ0A 4UZEA 3P4UA 5EWMA 3N8IA 3B2NA 3OCYA 1JSLA 2CFCA 2VJMA 1MH1A 1LBIA 2W42A 1SVOA 2DUWA 1CJVC 1DIRA 2FTKE 5ALKA 5AW0A 3VHXB 1H23A 1MB0A 2JGKA 5I7UA 1WV0A 2B35A 3PL1A 1DVRA 4JJFA 1FFDA 2FR8C 1OH6A 4YAOA 4QPNA 3PCTA 3RSOA 4DIBA 3BF8A 3V4PB 4DLTA 1P72A 2WG1A 1EP3B 1NW5A 2KE5A 2NZYA 4Z1MA 5JPDA 4GGPA 3KSBC 4D9KA 1LPNA 8AT1A 5IUNC 1ZMBA 3I6BA 3KU1A 3NP7A 4UMEA 3W05A 1ENZA 1UANA 2AE1A 4ARUA 1M0EA 1ZGAA 3RWMB 1ZNXA 1DBQA 3DLCA 3E3OA 1VSBA 1YR2A 3A2MA 1M7HA 4JBWA 1SKAA 4R1QA 4XD7D 1JWBB 2JGLA 1JR4A 1DIGA 1H05A 1YS7A 2BM9A 3BH0A 3BQMB 3LX4A 2GETA 3NBQA 4JJAA 4PTYA 4C7OA 1WVGA 3G0DA 3U80A 1DIBA 3OZTA 1ISFA 2YIMA 3OZFA 4BNUA 1T9HA 1X92A 3HP1A 5EHXA 1VPLA 2HMWA 1PTJA 3D7NA 2JIZA 4RLSA 3RI3A 2GM5A 4BASA 3E03A 3C7TA 1JHUA 5IT5A 3RAFC 1RCTE 2QD3A 3WZ2A 1KZ6A 3DUFA 4EGCB 1IZ9A 1W35A 2XY4A 1YI8A 3MRVA 5JXIA 2NLOA 4L02A 5BQFA 4JC0A 4K9LA 5I8PA 1A5SB 1WMDA 4IOKA 2NU8A 2DWUA 1JF8A 1JSZA 1OPXA 3CO0S 5KYUA 5KX5B 3OZ7A 3L4KA 2AQKA 1OOEA 3NYIA 4GFDA 1WXGA 4UEOA 5DX0A 1TECE 3R7SA 3YASA 4L8VA 3AV0B 3BE5A 1XLTC 2WZBA 5ARCA 4BTLA 1P7CA 3GFFA 2ECOA 2Y3IA 5ECYA 4PZZA 1H9BA 2ZLBA 4XPIA 1C0KA 1J0BA 1TKRA 4E7OA 1G1MA 2GSWA 3RS3A 5A9RA 3DLBA 3IUYA 3Q4GA 5EJAA 1C9JA 2ZB2A 1C7IA 3RHZA 3VO2A 5DM60 2BP7B 2AXNA 1MXHA 5BUSA 2MTBA 4GLFA 2OL4A 4BPRA 2PUGA 1ABFA 4BB6A 5BURA 1AMNA 3FTCA 1L4HA 4AT1A 5JZVA 2WV9A 5GJWC 5LXTF 4BNGA 2C54A 3NUQA 4PN3A 5A4JA 3EQ8A 4YR7A 5EQTA 3HADA 4MYCA 2V3CC 2BEUB 3HM2A 3IHKA 3SBXA 2D8MA 4YYZA 4WEOA 5IZ4A 1K5HA 3KEGA 3HDYA 3W1EA 4M1EA 4BNFA 2YQ5A 2F8SA 1NU6A 3OTGA 4DEVA 4KQ1A 1APBA 1CYEA 3VDNB 3HXQA 2AMVA 4B3RB 4A2WA 1Y5NA 3RFFA 1XRSB 4AVYA 3BXGA 1B15A 2V7PA 3S68A 1XKQA 3FOZA 4LF6B 4DLNA 3WLRA 2M9MA 2EFDB 3TX6A 3NNNA 3FIUA 1OXKB 4ZZ2A 3VQTA 4AMVA 4OGGA 5CLFA 3TR0A 2DUUA 4Y0NA 5JD6A 1LH0A 2TRSB 2D7CA 4BQSA 5IARA 4EKGA 4PNHA 2B6NA 1FJ2A 2P9CA 3T9DA 3PT5A 3LC2O 3SCZA 4KDEA 1MJGM 2QRLA 4WWHA 1EK0A 4NG4A 1C9YA 1NLYA 2QTZA 4OCZA 1BMDA 4YO7A 1Z06A 3VTKA 3ZZ1A 3BIJA 4GMHA 3P9YA 1DDGA 4J2TA 2P35A 2PRKA 3E1KA 4RVOA 3F9CA 3N3AC 4H6VA 1V96A 1WDTA 3DEYX 2ZXFA 2FHPA 3EZ6A 3ROTA 2F43B 4KB5A 2OFPA 1I4EB 3LM8A 3EXAA 3B5JA 3STUA 4BGIA 3OIDA 3AESB 3KKKA 1L7OA 1BH6A 1RS0A 1XL1A 1TM7E 4HVTA 3PNKA 5SY4A 2HK6A 4GBJA 1H42A 3L7CA 4C1NA 5KYKA 1AUQA 3HDTA 3SHTA 4CYMA 3QKRA 3RSSA 3EZNA 3LZ6A 3VRHA 5EJ8A 3PPVA 4IPTA 1NUUA 5JY6A 1H2YA 4Q7EA 1SUEA 4Y9UA 1ODIA 2BI4A 3PP8A 1VP3A 1BDMA 2FPRA 1UFQA 1EQUA 1E4EA 1WZCA 4LQCA 4Q4HA 4HPJB 1XRRA 3AVPA 3ZE2B 3F4LA 5DOZA 5CPBA 1HA3A 2J1LA 1JTEA 2PX3A 3H1BA 3JVUA 1PO7A 2CDNA 2VJNA 3LL7A 3KTOA 4PQEA 2QP3A 3NTQA 1UKCA 3FPHA 4Q9AA 3QIAA 3DPIA 5SZIA 1AJEA 3ZBQA 2BFWA 3UK1A 4HRVA 3UXYA 5IT9A 3FI9A 1FRNA 3UAVA 1FDSA 1PR4A 3OOSA 3DEIA 2C42A 1DBWA 3V2HA 3L4EA 4JGIA 1JDTA 1GZHB 2P3QA 4BP3A 4HSGA 1L7DA 2JI7A 2ODBA 1DFIA 3EVAA 4IG9A 4J0FA 4OHXA 5B30A 3TF5A 1X1QA 3BMOA 4XX0B 2I54A 5CU7A 1W4AA 4NFHA 4RTKA 3AR2A 2VHTA 5F3RA 2V0CA 1M73E 4QUJA 4XD7A 2CUNA 3SLKA 7GPBA 3MELA 2BFPA 5AK0A 2QL5A 2GLXA 1UDBA 2R6FA 1YRQA 3ZDEA 1UJ5A 4DSAA 4FFBA 5HRCA 3H16A 1DXOA 3M33A 1NI4A 1T0JB 1PHRA 2HDWA 3MINA 1K5GA 1BKDR 2E7ZA 1LSUA 2D8AA 3UYLA 5J4KA 2ILTA 2XYHA 4IDFA 4L28A 1PP4A 2B78A 2FWRA 2QTMA 1E2HA 1TCCA 4QXQA 2ZXUA 3SX4A 5C8YF 1XZDA 4NZPA 3OCZA 1UWLA 4R7ZA 4WPGA 4J8PA 4DXHA 4BV8A 1NW6A 4WDRA 3PFNA 1F12A 2XCUA 4MV8A 2XZLA 1U6KA 3EDMA 2WZQA 3PRHA 5E0KB 4AZ0A 1XZ8A 1YZLA 1ONSA 1UAAA 4K6FA 4QQFA 4CCSA 2BCEA 1A9XB 1YVDA 1JZQA 2HU7A 2JBWA 5GZ6A 1CJBA 2Q5OA 2EKZA 1G7TA 1PL8A 5AI4A 4BNWA 2YIDA 2HK8A 2QMZA 2FFJA 4FGKA 4OAPA 4ZO4A 3N2NA 3GHYA 3W2GA 5K6AA 1TX4B 1ZC4A 4WFKA 4XVRA 3A1SA 1P9OA 2ZBVA 3GEMA 3O2NA 4Q0MA 4DS3A 3JVDA 3CS3A 1SVWA 4KPEC 4KWHA 4W9MC 3VZSA 1LDEA 4EMBA 1W0CA 3AHGA 3GJ5A 5IC4A 4K40A 4FFNA 4UJ5A 1ATZA 3VO1A 4C06A 3PHIA 2GR9A 2R6JA 1WUIS 2NPOA 3C7KA 3K7EA 1A8HA 3TLYA 3W78A 3AVXA 1B43A 1SZPA 1EUDA 4EUEA 2CL7X 2I71A 4X91A 4IHKA 4KQFA 4ZARA 4IIEA 1T9BA 5DNAA 5ER6A 1Y1TA 2PSDA 3BYZA 2ZGVA 4WADA 5B53A 5BN1A 1Q1AA 5EMHA 3EJ6A 5AM5A 3OPVA 6LDHA 2WMOB 2AN3A 3GUHA 1M0SA 3TNLA 2ZUCA 4GOOD 3EVCA 4GSLA 4NL4H 4QJ4A 5ALRA 3UKDA 4A0SA 1J49A 3WDMA 2IPOA 4CF7A 3D2AA 4IHAA 1Q74A 4M0KA 4DRYA 1XRQA 4LJSA 4FC6A 4NMWA 4DA0A 3EVDA 2RH9B 2JHAA 1YASA 3AR6A 4FFDA 4RFLA 4RMJA 4ZQEA 3WGJA 2HXYA 2WFAA 1M8KA 3QITA 1UZNA 2I22A 3U4DA 2MSKA 3THWA 2IBTA 1BXZA 2V5UA 4IWXA 3O94A 4DR1B 3SQWA 2PVCA 3KWMA 1TO2E 3TJRA 2WJZB 3THYB 2Q27A 3ASVA 3F2VA 3PA6A 1O8CA 2K7FA 4DA8A 4O4LF 4IZHA 1NRWA 1Y9ZA 2QZJA 3UHAA 1U0TA 5SY6A 2R8RA 1EX1A 1Z74A 2GERA 3IKJA 3L7JA 5EUCA 4BN0A 3KPJA 1PUXA 5JRDS 4BX8A 4ZKEA 5AW9A 3BD9A 5L8VA 1KYWA 5AK4A 4JP8A 3C3WA 4DSZA 2I1QA 4WK4B 5LDHA 1G8YA 4UBMA 1KFBB 2XCTB 3AI7A 2J9GA 1C0EA 1WZEA 2D4HA 4YALA 7MHTA 2IHZA 1Z6ZA 5K0LA 1T8YA 4BNDB 2GYVA 3CY6A 4U6QA 1QRSA 4I4TB 4J0KA 2F59A 5M5BA 1JN0A 1CF4A 1R2QA 1VE6A 2VWPA 3UK0A 3K0SA 2PWAA 3DJFA 1O3YA 3H2JA 4FUQA 2OGUA 4MW2A 2YJ6A 4M7PA 4WK0B 3NTVA 1CHNA 4CKWB 1R50A 1E5LA 2H5LA 4MWGA 4UOEA 5BV1A 1GV1A 4JEUA 5J59A 4JENA 3TZCA 1ZL0A 3K8QA 3IR6A 1LI7A 1Z08A 3PI7A 4UBNA 1E5QA 1OZFA 1ZJYA 4E5UA 4ZDJA 3AUFA 4R2WA 2DM6A 4FBMA 4Q5IA 2HV9A 4EVSA 1W4BA 1P1IA 3PQ5A 3K9WA 1IG0A 5FRDA 4B79A 2BP7A 5ALTA 1M2EA 4UTZA 4JL6A 1ZXBA 2Q6OA 2ZSHA 3ANLA 4N6GA 5F64A 3NDJA 3O4IA 4FD3A 1U9IA 1ZZEA 4JEIA 3L06A 4XGKA 5HE9A 4C0BA 2WSBA 1GDDA 3FPJA 3RU2A 1ACMA 3ZHQA 6ADHA 4W7IA 4U5XA 3TOZA 4KN9S 3VH3A 3JVVA 4B35A 2A4KA 1GPYA 3C14C 2E4XA 3GPIA 2A5JA 3OECA 3URMA 3VV2A 3H1FA 4FOOA 1T6XA 3ND7A 3O90A 1JLHA 3IILA 4YLEA 1E89A 5BXQC 3OU7A 1E9FA 2R66A 1VYVA 2ECFA 2ONKA 4PYRA 1X70A 2NYRA 3DBHB 1NXVA 3EWIA 3F7TA 3AEXA 3FCSB 3FXAA 4Y1RA 1AS3A 1KK2A 3CWZA 3G0OA 4LFAB 1II8B 1W94A 5CA1B 3QF4B 2O0HA 3I9MA 1ORHA 3GW8A 3UVEA 5IJ9A 4TYWA 1EWQA 4D3FA 1TT7A 4IXMA 2J9ZB 2Z8ZA 4NYIR 5DBFA 5D85A 2P6UA 1BEUB 1ESCA 1SH7A 3P9XA 2P2LA 1JAXA 3GUUA 3CX3A 4PLHA 4Q82A 4MA4A 4D98A 1XRMA 4NBSA 3MA0A 4H6WA 1CVIA 4M0LA 1UK7A 3MYYA 3O4VA 4TS3A 3CTPA 3GB9A 4PYIA 4TSKA 2I2WA 3BCSA 2GD6A 1BXGA 1NQOA 2DLNA 1CZOA 3AJEA 3O92A 5JH7B 3NVMB 3MT8A 1G55A 4DBLE 2EJWA 3O8BA 4WBXC 2JFBA 1FNBA 3O2JA 4C43A 1JKXA 1T3GA 2QZPA 4M1ZA 1XU4A 4MVJE 2NV6A 3EARA 1NXOA 1STOA 3C24A 3LQFA 4URWR 5LSAA 2IIVA 4RTSA 2ZYGA 2IELA 5E9AA 3PD7A 2WVGA 4HQKA 2AYYA 4BZZA 1XGKA 2VYVD 4LG1A 1VHLA 1JJVA 3HCWA 3LL4A 1Z7GA 2C5GA 4DV6B 1Z83A 2ZULA 1J1IA 4QDKA 1TU0A 5JFOA 3GPDG 4GWGA 5EIFA 5AVJA 4DAEA 1OXTA 5AVQA 5JCPA 1NMSA 3X1XA 1UDXA 8ABPA 2X9LA 4IUCS 4HXEB 3QE3A 2DFTA 1U90A 3GFTA 3P9IA 2ZREA 4WZAE 4Z4EA 4KBYA 2JIMA 3QW2A 4G89A 1YU9A 1AC5A 2R8EA 4UHBA 3CF0A 2ZBEA 5ALFA 3ZZ0A 2CWDA 2GNAA 4KI0A 4UTOA 2G63A 3LIPA 3EG5A 4J4HA 3W1WA 2D1YA 1MTOA 1WIWA 3WADA 1DT5A 1QM5A 1SKYB 2HC9A 3P20A 2WHEA 1NX6A 3TDKA 1W0JD 3RVMA 3TCXB 2BHLA 3FTNA 3ZNPA 2O0LA 2FZEA 5BN5B 3WKCA 5DNUA 1NQTA 1R6BX 3C48A 1XZAA 1GG8A 3KL4A 2DEUA 2IYVA 3D6UA 4G07A 5IBRA 3WISA 5KX5A 5KYUB 3COJA 4CQMA 3BAFA 1ZBQA 2RK3A 1LV7A 2DE0X 2IOYA 3BB3A 2C3PA 5JSQA 2CUTA 5LP6B 3D1LA 3DKRA 2Z4TA 2D00A 3T95A 4O0MA 1E1RD 1A1VA 1TQDA 4OP3A 1VJTA 3VZRA 2VPYA 2X8WA 3E2PA 5EMMA 3O0TA 1X1RA 1I7PA 4D9CA 5BQPA 1UFRA 1NLZA 1XTPA 4EHNA 4N47A 2BKAA 4WY2A 1XJCA 2WTEA 3CEJA 3FZYA 3VV3A 5HJEA 5K6AC 2Q5CA 2WKPA 1ONPA 3GQBA 1EFAA 4IIFA 1Z8NA 1ADFA 4XWTA 3FYHA 3T3IA 1ISMA 5I7VA 1GCOA 4OB7A 3TB6A 1N3LA 4N5NA 1F0YA 3EYWA 4QTUB 2QUKA 3BQNB 3KTFA 2O9JA 5TPZD 2H31A 3QEAZ 2G17A 3ZDRA 2WU0A 3EGOA 5KKNB 1JDVA 4F2WA 4C20A 3DOJA 1I94B 1CJCA 1YO6A 3AR8A 4RETA 2ZWIA 3V00A 2X1LA 1R1DA 4BVKA 1EMDA 2H9AA 5JD5A 3CLUD 1CT9A 4IFTA 5K3SA 1OVGA 4J1QA 4I9FA 3P45A 3ZE6A 1Y3DE 3UWOA 5HTKA 4FMDF 2ADMA 4JQOA 1CERA 1E7QA 2G08A 2YZNA 3HCPA 1BO6A 1OFUX 2BFFB 3SHVA 4DF3A 3AL3A 2C07A 1QPGA 2HX1A 1ORRA 5I9LA 1TAUA 2HT1A 5BN4A 2NZWA 1LI5A 4RHTA 1LJLA 1NLUA 1VJ1A 4PVDA 1RKBA 1UMBA 5EUMA 3DV0B 5LYJF 1FXWF 1EX6A 1SKBA 4RMGA 1ZCFA 2C2YA 1PI3A 3AJ9A 4FHDA 4BX9A 1N1GA 3MJSA 1SBYA 2ZT5A 5AM4A 3THXB 2WJWA 4G9BA 2HSZA 3HCNA 1NI3A 4MEBA 3LRPA 1KBOA 3ZQ6A 1U2GC 1PR2A 4EG8A 1CEEA 3AQ4A 1G42A 2CDRA 3SC2A 1FY2A 1P3Y1 4RY2A 3UM9A 2OHFA 3ZZMA 1U3WA 3OT1A 4HYYA 3NXSA 4LHEA 2JGIA 1IUOA 4BQQA 4LKOA 4U2BA 2COEA 5C0OE 2DT8A 5A4IS 3R9XB 1N7GA 1W30A 4GYKA 1TGVA 4G0VA 2HXSA 3DDSA 4FP9A 4F96A 2B1QA 2P0AA 1V9LA 2B82A 3BGDA 2QI9F 3IQDB 2P9FA 1YCDA 4I55F 3DCIA 4A10A 1FIUA 3NT5A 2G1UA 1A82A 4NFYA 1JAYA 2OSVA 3EZGA 3FDZB 1ZNQO 2VCHA 3CU5A 1JLRA 4IO0A 1M34E 1JSCA 3AR9A 4Q3AA 1LFDB 4N40A 4DR6B 3BSSA 3FTEA 4EZIA 2CB9A 4LJ8A 3WGUA 3OAAA 3PEEA 1ISIA 1G5IA 3ISVA 3PE3A 5K6RA 4I9GA 4DPMA 2I9KA 3VYUB 1WXEA 1JW9B 4F8YA 2JRLA 3HJBA 4F72A 2XWQA 4W1PA 5BWMA 5ITWA 4OQQA 1FMTA 3A2NA 1K66A 2F9MA 4YJHA 2H3EA 1RXEA 2FMUA 2NUPB 4JODA 4Z9YA 1QE5A 3QBTA 1THMA 2IHVA 3GI1A 4H4DA 4QLAA 4WOKA 1TXGA 1GCAA 1JR3A 2OM2A 1XTBA 3L0OA 4HAUA 1CIVA 4FYJA 3FKSD 1SU8A 1O89A 4G1VA 3ZWAA 4C0SA 4YI3A 5K05A 2GBFA 2AX4A 5J2TF 3IHWA 4RZQA 2X13A 2Z1MA 4OQEA 4MV7A 4Y98A 3E7WA 1A96A 3FKJA 4GLLA 3T5CA 1QU2A 2HQ1A 4JP3A 3OJEA 4R2HA 1GPBA 4PRYA 4DUZB 2PO7A 1KA9H 1T2UA 5LZ2A 3IVCA 4HB2A 3BHJA 3KR0A 5LQKA 1P9WA 5C35A 2MYPA 1F48A 3W5VA 2Y6VA 1A88A 1VC2A 1BMQA 1YKSA 4RW0A 1SBHA 3MTIA 3STWA 4Y2QA 3ZWMA 4LQLA 3IUQA 3TW0A 3H6GA 1HQKA 2JZOA 4BGVA 3PITA 2C7BA 4FS3A 4LOHA 3R7WB 2C5FA 1JWLA 4QU5A 3CT6A 2QE6A 1UT6A 4H7JA 3MTJA 1JU3A 3HJTA 3DAHA 1JEAA 3HLKA 1RU3A 2GO7A 2V4UA 3K0FB 5CCDA 1MEEA 1VRVA 3VHRA 5HM8A 2NMVA 4ZT5A 2H2FA 5DASA 1GNTA 2EKLA 5EZSA 1TZMA 4DNOA 1DQRA 2AFHA 3GH3A 3CSUA 2C4UA 3HWX1 5C9ZA 1DTWB 4YCDA 1QE0A 1RTKA 1RPAA 5IPFA 2RHBA 4D3ZA 3F2IA 1I1OA 3SKVA 3Q6NA 1NP7A 2J6IA 2CLIB 2YRFA 3CZQA 1T2NA 4MYHA 1FS6A 3PTZA 4Q1EA 4CKBA 1ZI9A 2HBQA 2GNOA 5IKMA 1V2GA 3A06A 4M9UA 2J87A 3B6ZA 2OK8A 5EN4A 1RAIA 3MOGA 4KZKA 4KV9A 2H4FA 5AJUA 1T2FA 1NVKA 1JSXA 1O9BA 1YJXA 2X76A 4QECA 5CM8B 4A26A 5JIBA 3CISA 4N41A 3FLAA 5TEVA 4GR5A 1KYXA 2H1SA 4TYPA 1HWYA 2ZRMA 1VJDA 5AJWA 2VTBB 5GV7A 2YZMA 3BDIA 5LQSA 3GLFA 2FQ1A 3JPWA 4I50A 4NZZA 4KFUA 2O8DA 3T4PA 4O2AB 3KZNA 3KCQA 1P2SA 3HKEA 4EHHA 4L9RA 3DNPA 5AKIA 1RRMA 1L5FA 3IJPA 3F6CA 5K0JA 4FDTA 1ONBA 1PYGA 2O8CB 3UV7A 3FMVA 3RIYA 1YHYA 1YQGA 3A6KA 3DEKA 4JI7B 5T8KC 3LS2A 1W5AA 4M9RA 4BWFB 5I4KA 1GXSB 2Q5FA 3GP5A 4EJSA 1GGHA 5JCOC 1M54A 3U44A 1IWBB 4RY8A 1G8AA 4XB2A 5HRUA 4Z3OA 4IF4A 2NZUG 3RFUA 1N8NA 4E5KA 3T8YA 5EGSA 1QCDA 1L8AA 4M1QA 1NXPA 3LPDA 4O08A 4C7OB 2ZSIA 3B1FA 1FFAA 1ZD8A 1N7JA 3NOQA 3FYUA 5AUNB 7YASA 1QWOA 1XEXB 1UK9A 1S7GA 3MT0A 3FPAA 4JSTA 3GD7A 4BAUA 2GWHA 2XXBA 2OILA 2YJTD 1DC5A 2KPOA 2X58A 3LDAA 1OBOA 3VR6H 3T3EA 3VR6A 3DTTA 4YRIA 5F7JA 2FV8A 5LU9A 2E48A 3NGMA 2CXPA 1F06A 3RU7A 4R2IA 4K88A 3MWFA 4BMXA 4EX7A 1LNQA 3L1JA 2QZ9A 5K0GA 2A9JA 3T6KA 2H1CA 3PNOA 1PJLA 1JQ5A 4IXDA 4IHJB 4PPFA 4FW8A 4OXIA 4WA8A 3ET5A 5CX1A 5CFRA 1JZSA 7REQA 5IDVA 5CT4A 2OB1A 2BEWB 1UBKS 1E18A 3LHSA 3M6IA 1BEZA 1ORVA 1WA5A 1CUWA 1DWPA 3QXCA 5HVNA 4KYIB 1AXEA 5ITZB 3IAHA 4ZXPA 5BSGA 3KP1A 3BB1A 3FBTA 4FCCA 1ZU5A 3U81A 1U0BB 2Y68A 1J0XO 3DNFA 4G2NA 1QDEA 4MPPA 4O4HB 2QTAA 2RE8A 5HE8A 3JQPA 3UJBA 3I12A 2IDMA 1YMQA 4GYYA 1CULC 5LP1A 5ENVA 2CZCA 2R84A 1FDUA 1FW8A 3FDFA 4EYOA 3C6BA 1Y8QB 3ZG6A 4XSHA 4O5AA 2PE5A 4IGEA 4K6CA 2BZ1A 2J9FB 1SQ5A 2FWJA 4LGMA 1HE2A 4MP6A 4D9FA 2DSNA 1LK0A 1RLMA 3H2YA 2DR3A 3QWBA 3TQSA 1JHYA 1IQUA 1E58A 1Q7GA 2G8NA 5ILQA 4MCJA 3RU3A 5HZHA 3O95A 3ZJUA 3L8HA 2QEQA 4DIDA 1I4TD 1EVZA 1V7QA 2FOXA 3RSHA 4W5QA 3GLRA 3ZLVA 1W87A 1Z2EA 2QSUA 4Q1BA 4Y6SA 1IN7A 1VM6A 2ZZNA 3R5XA 4R8MA 3EDQA 1P7VA 2HCJB 4O2BF 2CVPA 2PYZA 4W5RA 4NE9A 1ZO8A 2WJGA 3WZLA 1LKZA 3AB3A 4G0NA 1OFIA 4E88A 2UXDB 1XRPA 3OF3A 4BAZA 4G9GA 1TE2A 2FCAA 3CKLA 4I4IA 3FB4A 3LLMA 4GPD1 1V6AA 3JQCA 1PFQA 1L5MA 3KNZA 3N2EA 3NW9A 4P2BA 4TRMA 3T4XA 2JVKA 3EXEB 1U4OA 3BZBA 3JD2A 2Z4SA 3JD4A 5CFPA 2H2DA 4NR0A 4D02A 1XK6A 1N4DA 1V16B 3ABIA 5KVVA 1NVGA 4HYEA 3LWNA 3ESAA 5EJMA 2CFIA 2HMAA 3ER6A 1U2SA 3UEOA 3OC6A 1FYFA 4PBTA 2VYFA 5GONB 3ZCTA 5C4IA 2PQ0A 3JQ7B 1QVVA 2TSYB 1X7YB 1NVXQ 1OASA 2WV7A 2D5BA 1OIWA 2RGWA 4Y1FA 2CYBA 2JFQA 5AESA 3VNUA 2DH6A 5EESA 1PJZA 2VP2A 1N2OA 2XGGA 2DUJA 3QVLA 4IJVA 4D41A 2PRIA 2LBPA 4TTAA 2NADA 2QNRA 1V3TA 1EGQA 1KO8A 3QUTA 4BJ5A 4QJ5A 4KGXA 3DL0A 2WTNA 2RHMA 2ZJZA 2YZ7A 2Q4OA 1GGJA 1IEQA 1PRYA 3M1IA 1Q95A 1KETA 4DR2B 1QAQA 4MJ7A 2NUPA 3A8TA 4PC2A 3PBKA 4JBXA 1RYBA 3FNHA 1S5PA 2X5JO 3DLTA 2JVIA 4FQ8A 4IKEA 1GZ6A 3WYEA 4ZREA 5HOEA 3A4MA 1MX9A 4TZTA 5AJTA 3ER8A 2ZWPA 2R68A 3DW1X 4R69A 4JLJA 4L0MA 5IJ0A 4FJ1A 4NCJA 3HUDA 1R4MB 1ZH4A 4G8JA 2G40A 3O03A 3IDQA 5C31A 1OZGA 2BGRA 3DWEX 4PZLA 3DAPA 2A1TS 4R98A 4TLLB 5TVGA 4MR7B 1ZMTA 5EE5B 1AKNA 1KSHA 2ZWOA 5ERXA 1XU9A 4CIYA 1KJQA 1PJ3A 2WRZA 4YCCA 3W5IA 4IIJB 4KX5A 3U9TA 1JX6A 1NV8A 4TROA 3DBLB 1Q20A 1R0WA 3IYLW 3LBYA 4J07A 4CEIA 5D51S 3S0JA 2H54A 1VKRA 3DB1A 3LZDA 4DG8A 1FPQA 5FTNA 1G5TA 3MGGA 3WK6A 1CQPA 1G2QA 4R0NA 5AHRA 1Y5IA 4UFPA 2H51A 3Q9UA 1QHSA 4GP6A 3DDCA 3L82B 1V48A 3K5WA 1P8JA 2QMHA 1Z8FA 1GAJA 3CUTA 1IQ0A 2Q4BA 3G82C 1TCAA 3LYLA 3LYAA 4HGNA 4ND4A 5ALHA 1XIVA 2BKLA 3SZ3A 4EEKA 2VIIA 3HYNA 1YOVA 4R9SA 1SNYA 4ZGGA 3KOXA 4D7AA 2UZ4A 2OCXA 4NULA 4KITB 3VKGA 2G6BA 4YAJA 2WWHA 2Z9CA 1VHTA 1TEVA 4RVHA 1XCOA 2DR0A 5BSUA 5E1OA 2X5KO 3LA8A 1SEVA 1X8KA 4O29A 5BN4B 2Z0MA 1TMGE 3C6KA 3EPPA 3GFOA 5FTMA 4RV5A 4PFJA 1X94A 4MVJF 4QOEA 4B4OA 2H17A 2DH5A 1R5NA 4RANA 3V3KA 5I4BA 2GN4A 2ZPUA 2IUEA 3K35A 3O31A 4KE6A 2OGWA 4R9RA 3TSZA 3LT2A 4A82A 2AG5A 2R62A 1V47A 5DI3A 3NOVA 3I1FA 1TQ2A 1ZDMA 4GUAA 3WLFA 1NWHA 4UVEA 3SBDA 3SICE 4CMHA 3C3EA 1WKBA 3FWNA 2JGRA 1M0TA 5C8YB 1JDJA 2P75A 3E0XA 3H97A 1Q0TA 2V96A 1FU4A 4IGAA 1NJ5A 1U1CA 3MAGA 2Y05A 1D2RA 2QVXX 3AIOA 1W36D 3GJSA 4WAUA 3GNQA 4Q7MB 1ODFA 1JHRA 1XAHA 3PIDA 1IEVA 4NCXA 1W6UA 4OMFG 3W8NA 4CTJA 3HO1A 1BFKA 4ZAVA 3V1NA 1SKQA 1X9HA 4DZTA 4JY7A 4JI0B 1OXVA 2JD0A 4ML3A 4UM7A 621PA 4NEGA 2DT5A 1HMPA 4DLZA 5MGNA 3CF6R 4FNAA 2Q62A 4G56A 4UUQA 1TVCA 5DWVA 3PD1A 2P8SA 4TL6A 3MD0A 3FWYA 4YNBA 3W5JA 4N6NA 3RRMA 1I1NA 2X0FA 1QXSA 1RXSA 1X1CA 4J76A 1ZK2A 1XHFA 4QX6A 5FO0A 2BMDA 5DLPA 5KMGA 4JLPA 1SUSA 4M9XA 1UXKA 3ZX5A 3HFJA 2I3GA 3JQ8A 3PFIA 5IBCA 4QPCA 3IMKA 5AKKA 4ZVOA 2HL6A 2HCTA 1NUTA 1Z6AA 2ZRKA 3QYPA 2WKRA 4YDHB 4EL0A 1GFWA 3H7AA 4HWGA 1DEHA 1ZMOA 2FX5A 2HO4A 3CMCO 3GZJA 2PGDA 2XYGA 4PC1A 2AT1A 4RACA 4R5MA 3F7NA 3ZQJA 1NNEA 3RT7A 1FUYB 4R2XA 2XB8A 3TRKA 3IVAA 3E9QA 2ZE8A 4INJA 3SVLA 3EWNA 2HADA 1CUYA 1LTKA 1EDEA 1GQSA 4O4IF 1EFRA 4P3PA 4IIHA 3P9KA 5B1EA 2Q2OA 1QO0D 2XBMA 1RACA 1ORTA 2UYQA 1KERA 2OXIA 4TKLA 4WZBA 3FBGA 3GJZA 1Y1LA 2GFQA 4E2FA 1RD4A 1TT5A 2Z04A 1CYDA 2CKMA 2I78A 2VSFA 3HJRA 3R3UA 4G3XA 2XT9A 1D6NA 2RH5A 3FPSA 2K2QB 1SIOA 4J4TA 4U2FA 2O8NA 4U39A 5AVZA 5CX1B 1UP4A 2FR1A 3EQ6A 4W4TA 5T7BA 4S1WA 2ZBGA 4L51A 3RC7A 4C4YA 1P1KA 5DTEA 3BILA 3P2IA 4FCVA 4PV7A 3SJUA 1BAPA 2Q3DA 3R7WA 4I5GA 4ZEOA 4ALMA 2GESA 3N6VA 2X6TA 4G4SP 4A0GA 1EXDA 3ELWA 2PRJA 3H86A 3OBBA 4B3DA 4HATA 5LQJA 3I9OA 2I62A 5LZ4A 1K7YA 1MD9A 1ESNA 2XWPA 1EJ2A 4UW9A 1U8UA 3FTFA 3HFRA 3IEKA 2O06A 1JQLB 2JJQA 4ALIA 1UWKA 5JU6A 4ENQA 2B8NA 4EQ6B 2O4CA 1DAEA 4Q9IA 3LJKA 4E4RA 3B3FA 5TIIA 1S9HA 3FUWA 4JI3B 2HLHA 1VJ5A 3WMXA 4OLBA 2WLTA 1NTOA 1HURA 3CWCA 5DHRA 3A9RA 1TM3E 4L27A 3I62A 1A2KC 2P6MA 1XTUA 4R8LA 4YUXA 1ZCAA 4R9UC 4IIXA 4PS0A 5A03A 2H92A 3U7HB 4V03A 4HDKA 1E2QA 4JYCA 4A1FA 1J07A 1OROA 2MSDB 3O84A 1CB0A 2EF0A 3LBHA 5AUOB 4KAAA 1DLIA 5F23A 4LPSA 4ARBA 1FRZA 2IQ5A 5IMSA 1RYMA 2RGNC 1YCHA 2VH1A 5TQVA 1ZJ6A 2RGUA 1YMUA 2WJAA 2WQZA 3Q0IA 4RM3A 4XUCA 4HN9A 1BW9A 1KIMA 1WUKS 5CNMA 5K3DA 4C88A 4DC0A 1SAYA 1OFTA 1UBCA 1GL6A 2A1UB 3SZOA 2VDWB 1WMEA 3GT0A 3H1AA 5KNCH 3L4BC 3KETA 1F5SA 3PFBA 3W04A 1T2VA 1N3IA 3PR3A 4DREA 2YVKA 4GM0A 1P39A 2VK2A 1DE0A 1THGA 3VVBA 2GD0A 2VK4A 5J63A 3WQBA 3W7VA 4F4IA 1HSOA 1RI2A 1MGPA 1SGWA 4M53A 3EMBA 3HBJA 4QGBA 3TZKA 2PZEA 2IYTA 1IXZA 2PYDA 3MMNA 3PA8A 4YGYA 2O1WA 5BUCA 2VHXA 1KEPA 1T3ZA 2ISQA 3GZNA 2YWEA 1H8ED 1MOQA 2GEDA 4UNPA 1HXHA 3JQ7A 4R0VA 4AMUA 4EPYA 4HT3B 4JGGA 3AL0C 1UMCA 5ALDA 2O8FA 3ROEA 3N0XA 1ZHFA 2Y4NA 1BTOA 5AI5A 4DWOA 3D31A 4L22A 3RF7A 4YDQA 3PPWA 3FWKA 3A6ZA 4K87A 4QDUA 5ICCA 3G02A 1GQQA 1F8FA 3WHLA 1RI1A 1O6GA 2X0EA 3K1YA 4EUKA 4DCPA 2NNLD 1Y82A 2EJBA 2OYRA 4EYEA 1HLDA 4D44A 4Q37A 3AVUA 1P81A 4KK3A 2B6HA 2OLEA 2W8ZA 5TB5A 3RBXA 1YZFA 3AFOA 5FX2A 3QX9A 4XZ3A 3GBVA 3RUEA 2EEZA 2YDYA 3GFSA 2DY1A 2KHZA 3WAGA 4CM5A 5K0FA 2B4AA 4BNIA 3HFSA 3HEMA 1JTVA 2Q0XA 1YCGA 1S4MA 1QQ7A 2ZI5A 3QFTA 3UUGA 1GARA 4AKTA 1AG9A 3BRQA 1TMOA 1F6DA 1G21A 3A4YA 4OAOA 2GYUA 5JOQA 3WGYA 5FADA 2R3SA 3QBEA 3WLNA 1KZYC 4ZT7A 5KVAA 4HDCA 3CURA 3HA7A 2P90A 2QQGA 3IHLA 4DYHA 3CE6A 1OBFO 1VPTA 4QU8A 3ACCA 3GY0A 5A9SB 2BCJQ 221PA 4FFVA 3PC7A 4KQKA 4AP6A 1XZIA 3E7DA 4RORA 4NVRA 3V7FA 1YT5A 1R10A 5LJLA 2AZXA 1F9AA 4FMCF 4EF4A 4DUYB 3IP1A 4N5DA 5KTMA 2B99A 5F7OA 2WAMA 3LW8A 4GLJA 1M2VB 2C5BA 2PBFA 3LC0A 1KP3A 1EVYA 3OFKA 3OX3A 1D2AA 4HWSA 4FLFA 4ZVMA 1HGXA 1O6ZA 5F98A 3KSMA 3U56A 2OR3A 1H3NA 4D92A 1WR8A 4KO4S 2WE7A 2IA5A 4ER0A 1R6UA 1RYEA 2KBEA 4YP5A 1OD6A 1FRQA 3LZCA 3WB2A 1HTWA 3K70D 3D3QA 4NE7A 4AS1A 4XQGA 1II8A 3KDSE 3UF0A 1UBNA 2ECPA 2L82A 2WSSA 3CZ4A 2ZUTA 4EF5A 3X1MA 4L4XA 1Y8RB 5CDUA 2JARA 3TD9A 5JDCA 2EL9A 1YI0A 2JFOA 2GZ2A 1MAVA 2MSWA 2PSFA 3KAKA 4YT2A 2ZT8A 1YR7A 4X66B 4LNHA 1X1TA 1JRLA 1V3QE 4M9ZA 1EU1A 2PSJA 1L5NA 4KR9A 3GDHA 2D3WA 2AI2A 3G0CA 3Q40A 2F4VB 1U5BB 4IEFB 3TX2A 4CHTA 5CG2A 2BBWA 3SNHA 1O54A 3CC8A 5HMMA 3IH5A 4WLVA 3FCUB 4FE4A 3D0RA 3VR3A 4J9VA 1JPVA 5FB3A 4R1OA 3REFA 2AQIA 2PIAA 2GFHA 4P5EA 2UVDA 1X77A 4HS9A 4L5IA 4ENTA 1TQ6A 1SC6A 1ZP6A 5BR8B 5COQA 3AR5A 5JS8A 4D9IA 1ZJ4A 4F0JA 1E63A 3AUXA 4L95C 1ETUA 1FEZA 1JMVA 3KWLA 2PH5A 5SYMA 3WGQA 3KD3A 1P5FA 5EXDA 1LLFA 2B69A 3LT5A 5HQTA 5G4LA 3JYPA 3GWGA 3OT5A 1MRZA 1NLMA 3CONA 1X74A 4EUNA 3MRSA 1D6JA 4NWIA 1ZRMA 2BEUA 2PH3A 1TUBA 5JNWA 2LXNA 4ONEA 1QPBA 2P4QA 5FHQA 4D45A 4QXRA 5A5VA 2G88A 3DE2X 3GXBA 2PR2A 4UBJA 1MH9A 4EHDA 4BWYA 4UQLA 1XN4A 1U3UA 2PS1A 1MO3A 1V0JA 2I8AA 4KR3A 4DR5B 2OO7A 2YY5A 4RHFA 2OV8A 5AM3A 1CY0A 1RC1A 2CL5A 3Q8LA 4IJMA 3STXA 2QRJA 1NRIA 4EBFA 3H3FA 4RWEA 3FI0A 4UXJA 4EMUA 5IT4A 4BV3A 1UM9B 4M0MA 8LDHA 1VBMA 1YNOA 3QJGA 4BVGA 4CUZA 1RXVA 2JHGA 2WJ3A 4EYQA 3CYFA 4AG6A 4YV7A 2JG3A 3DJYA 3EEOA 2R25B 1ZCBA 2B1RA 3PUIA 4J2OA 3RYIB 5CLGA 2Q50A 3T4EA 1GGNA 1TYCA 1QF6A 1E2EA 1D1QA 4FSDA 4IDOA 1MVLA 3PX7A 1PDOA 3BHIA 2FCRA 1WF3A 4MNTA 5LWQA 3G8AA 2Y4OA 1E9CA 3CO5A 1RAAA 4HADA 4KUHA 5FBZA 4RK0A 1RVV1 3IL2A 2CCKA 4J7CA 2R1TA 1SVKA 1DQZA 4YIKA 4K9DA 3ZY4A 1GT91 4DZZA 3TGLA 1KXZA 1CC1S 3G23A 2C04A 4ND1A 3TE7A 3TK1A 4OMUA 2ZYIA 4IF6A 4FFLA 2WIKA 4JBNA 4JVOA 3CNQS 4JXXA 3ZJTA 3GFPA 2I4MA 1E9VA 2O07A 4EY7A 3OUZA 3LF2A 5JDIC 1FXWA 2IZOA 1A95A 1P8AA 2OHVA 2ZTUA 3HN7A 2ZJ1A 5AJVB 2GEBA 1PWEA 2X6QA 3E5NA 4JYPA 4KGVA 4Q24A 2AC4A 3CZPA 2BF7A 3TAUA 2L17A 2AFHB 2WNHA 3Q1LA 4O59O 2ZWVA 1KPHA 2X1VA 4I4TF 2ODEA 5CUQA 3ZGOA 4BMSA