5K03A

Crystal structure of comt in complex with 2,6-dimethyl-3-(1h-pyrazol-3-yl)imidazo[1,2-a]pyridine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
214
structure length
214
Chain Sequence
b'DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
molecule tags Transferase
source organism Rattus norvegicus
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
total genus 78
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k03A00
2EX4A 2H11A 4IKPA 3UJ6A 8MHTA 1QYRA 1DL5A 1TW3A 2AOXA 2ZULA 3KHKA 3KQSA 1ZGJA 1INLA 2PXXA 5CVEA 4BY9E 5CVJA 5KVAA 3KQMA 1XJ5A 3FPJA 5IH3A 3U81A 1RJDA 1M0EA 3EVAA 4M37A 3NMUF 2AOTB 1KP9A 4WVLA 5EZSA 2CWWA 2QRVB 4RVGA 3E05A 5EMMA 5K0LA 5E1DA 1FP1D 5E8RA 4AZVA 5DSTA 2EFJA 4QDJA 1FJXA 2AOVA 3LCVB 4XCXA 2FYTA 3EVCA 2VDUE 2ZBQA 3GRUA 2C7OA 2B3TA 3I58A 5EHGA 3UJBA 3TRKA 1KR5A 4ATNA 2JH9A 4U7TB 3AJDA 2AZTA 3OU7A 3I53A 5FQNA 3B7PA 1X1CA 3LDGA 1UFKA 4GC5A 3LBFA 1UWVA 2ONYA 5GIPE 2BR3A 3ELUA 1P91A 5EG5A 1G8SA 4YUXA 2AN3A 4OA5A 5DWQA 1VL5A 2ZWAA 4BLWA 4BP3A 4YV1A 2N47A 5KQSA 3P97A 5LQCA 2OPBA 4YUVA 3GJYA 1ZG3A 2QE6A 2PY6A 3LCCA 1WG8A 3GGDA 3HCEA 3M6UA 5EVJA 3SSNA 3EVDA 1I1NA 3PVCA 2ZIEA 5BP7A 1AQIA 3UA3A 3LECA 2E5WA 1BKYA 1R8XA 3L8DA 4GOLD 3HVIA 4OBXA 5K0EA 4GC9A 1OR8A 4RTQA 3DP7A 2FCAA 3I64A 3GRZA 2ZSUA 5EIFA 1X19A 4YUZA 5BW5A 4GQBA 1N2XA 3E8SA 2FK8A 3ELYA 1BC5A 3G8AA 4FT4A 4GEKA 2IBSA 3CKKA 4YMHA 3JWHA 4PGGA 1O9GA 3P2KA 4GF5A 5D1NA 3BWMA 5LQAA 1EIZA 2O05A 4ER7A 4QQKA 2OYRA 2NXNA 3NDIA 3ELDA 5DSXA 1ORIA 4M7RA 4PIMA 2IP2A 5K0CA 2B2CA 3FPHA 4HG2A 1VE3A 1WZNA 5FA5A 2PWYA 4B17A 4KWCA 2ADMA 4MWZA 3TMAA 1DCTA 2PT9A 5K03A 3M6VA 3M6XA 1G8AA 3LX6A 1KXZA 1AF7A 4PYIA 4CKEA 1ORHA 5DRYA 2P7IA 2PXCA 1BHJA 1VBFA 1IM8A 1NW5A 1ZHFA 5F2OA 3OCJA 2ZBRA 3DLIA 1RJEA 1JG3A 5C1IA 3MQ2A 4EK9A 4ER6A 5LR6A 5GINE 1M6EX 4P7FA 3HA3A 3JWJA 1EG2A 2EJUA 4PCAA 5EKUA 3EVGA 4H0NA 5GOZA 2ZIGA 3KKZA 1QAMA 4MTLA 3SSMA 3SVZA 4C06A 5LSAA 3FUUA 2IH4A 1SG9A 2UYHA 4DKJA 1WXXA 3MGGA 3OU2A 4UOEA 4R05A 2HR1A 2O0LA 2FHPA 3B3FA 3G5LA 5F2NA 5KQRA 4O29A 5KS2A 2UZ4A 1SKMA 1EJ6A 3JWIA 5E9JA 2I6GA 2OB1A 3VC1A 5DX0A 5FULA 2PBFA 4X60A 4RTPA 2ZW9A 4E2XA 3A26A 4F84A 3SXJA 1QAOA 1KYZA 3UJ7A 4PIPA 2AVNA 5FHRA 3CJQA 1I9GA 5EOVA 2LD4A 3O4FA 4QPNA 2OY0A 3VYWA 3TPZA 4E30A 4E2YA 4HSGA 5CD1A 1L3IA 3F4KA 4HGZA 5EEGA 2GH1A 3OZTA 1NW6A 2JHCA 3FPEA 3PB3A 4HTFA 4PCLA 2VDVE 1I4WA 2HV9A 5K09A 2G8NA 3DXXA 3KR9A 4OQDA 5FTWA 2QYOA 5LQUA 3TOSA 3B3JA 1NV9A 4OA8A 3NVMB 3NWBA 1U2ZA 3A7EA 4RVHA 2ZLBA 3QOWA 5CVVA 4EMSA 3ER9A 5HEKA 2P40A 3G5TA 2PGXA 1L3BA 1VP9A 3DR5A 3P9NA 3PFHA 3LPMA 5DTQA 3JWGA 2XYQA 4FT2A 3EGVA 4QVKA 9MHTA 2VDWA 3KQQA 1YFJA 3NW9A 5GM1A 3HEMA 4PYJA 4XUEA 4EKGA 3BWYA 3C3PA 5U4XA 3GRVA 4RTMA 3GWZA 3SSOA 4MQ4A 3ELWA 3OE4A 5DXAA 5HIMA 3MERA 3R6TA 1YB2A 3LHDA 2OXTA 3K6RA 1KHHA 2A14A 2GAFA 1JG2A 4RWZA 4NECA 2IH5A 2PX5A 2PSSA 4AZWA 4BP1A 4M36A 5JR3A 5DX8A 4YV2A 5FA8A 5DLYA 1XVAA 2OZVA 3EEYA 3TM4A 2NNWB 4P7JA 3R24A 3HNRA 3M33A 1Q0SA 1BOOA 3FUVA 5HIJA 3KPWA 3X0DA 4RTJA 4C08A 1KYWA 1XDUA 2BR4A 2PXAA 3P8ZA 3LDFA 4ZTBA 3T7TA 5ICCA 1X1DA 1IY9A 3BXOA 4CXMA 5CIYA 1Z3CA 5EMLA 4A6DA 4E2ZA 3FUWA 4GOOD 2ZIFA 4DF3A 2CMGA 2IDKA 3DULA 1P39A 4CTJA 1RJGA 2ZCJA 4DZRA 4LWPA 3EPPA 4C05A 2CKDA 3BUSA 3KQVA 2KW5A 5C0OE 2C7RA 2IGTA 3HA5A 2C7QA 2ZZNA 3MCTA 4POOA 3GRRA 5FHQA 3R9XB 4FZVA 1WXWA 3NDJA 4HC4A 4AX8A 3DUWA 3G2PA 3UBTA 4HH4A 2OO3A 3G2MA 2OB2A 5E1BA 4KDRA 5E8JA 2PT6A 3UA4A 4Y2HA 3DXZA 5BW4A 1NW3A 4A6EA 1R00A 1VPTA 3THRA 3EEOA 2BH2A 2P7HA 3DMHA 2G70A 2IPXA 5LQKA 4P7GA 4AZSA 3T0IA 2YUIA 1G55A 5IKMA 3KQOA 3AWIA 3AY0A 3KQTA 2AOWA 5LQJA 4ER3A 4KIGA 3QOXA 2K4MA 2YVLA 1N7JA 2NXEA 4GUAA 4KW7A 4X61A 5EMKA 2UYQA 3HM2A 4YUYA 2XYRA 3P9CA 2ZZMA 4ER0A 5EIWA 4EVIA 3HVHA 5LQNA 3MTIA 3KPJA 2NXCA 1P1CA 5B1SA 3ORHA 3OU6A 1VIDA 3OFJA 3G2QA 3TM5A 4X41A 4RTNA 3P9KA 2OKCA 5DX1A 3B89A 1M6YA 5T6BA 1JQ3A 3PFGA 2GLUA 2HWKA 4RX1A 3FPGA 1XCLA 3HCAA 2YQZA 2GS9A 3AXTA 3FRHA 3KR1A 1SUIA 1QAQA 1VP3A 1L9KA 3KQPA 2Y1WA 3FTFA 4PYNA 4YUWA 3GCZA 3NTVA 5HZMA 5K0JA 4C07A 2ESRA 5K05A 3REOA 1MHTA 2ERCA 4XUCA 2F8LA 1KPHA 3T7RA 1JSXA 5E2BA 2GPYA 5HIKA 3CGGA 1NV8A 5H02A 2DULA 2B25A 4GOND 4PWYA 3P2EA 3K0BA 3KU1A 4EKIA 2DPMA 4R6WA 4CTKA 4EQZA 1XDZA 5CVDA 4C04A 1Q0TA 3HVKA 5T67A 5GP1A 3DXYA 2P41A 2UYCA 3DTNA 4RVFA 2FRXA 3SX0A 4JXJA 2JG3A 3KQYA 1F3LA 2ZTHA 4LECA 2JJQA 1HNNA 2IH2A 1JQDA 2ONZA 1EJ0A 5DTMA 3LBYA 3GXOA 5K01A 4QQNA 3DMGA 4OBWA 4PYLA 3TKAA 2Z6AA 5CCBA 2HNKA 3THSA 4E70A 3RW9A 3TLJA 1JTFA 4LG1A 3CCFA 3A25A 5DM1A 5FWDA 3R3HA 3ME5A 4DQ0A 3DLCA 3KPVA 5DM2A 2YXEA 4Y30A 4PNEA 2ZVJA 3E7PA 3G89A 2Q41A 1UIRA 2QRVA 3BZBA 1FBNA 1NW8A 3P71T 1TPYA 1XCJA 4HRAA 5DPMA 3T7SA 3MHTA 3LSTA 4P58A 2UYOA 4MIKA 3ERCA 5DT2A 2AOUA 3FPFA 3A7DA 3C0KA 2IBTA 2PX8A 2YXDA 3LDUA 2ZFUA 4IV8A 1JG4A 3QV2A 3DOUA 3FRIA 2P35A 2G1PA 4IV0A 4RTKA 3HP7A 7MHTA 4RV9A 4XUDA 3TR6A 4PINA 3GO4A 4L7VA 5E1OA 10MHA 2I9KA 2PLWA 2NXJA 3Q87B 1R18A 4C4AA 1KPIA 1TW2A 5E2AA 3IHTA 5ICEA 1YFLA 4GBED 3HCCA 2BR5A 1G38A 4QDKA 2PX2A 1L1EA 4ISCA 3NWEA 5GIOE 2Z6UA 1NT2A 3MCZA 1HMYA 5E9WA 2XYVA 3FUXA 1JTEA 3UJ8A 3UJDA 1P1BA 3I9FA 1YUBA 2AN5A 3UFBA 3VC2A 4CKBA 5ICGA 2VS1A 3EVBA 3O31A 3EGEA 3PS9A 3FYDA 3KPUA 1YF3A 1RI2A 4OQEA 1VQ1A 5K8VA 3DH0A 1H1DA 4MHTA 4OX9Y 3C6MA 4FSDA 4PYKA 3SMQA 1ZQ9A 3TFWA 4DCGA 3LKZA 4C03A 5ERGB 4YV0A 2O07A 3FTCA 3KPYA 2R6ZA 2GA9A 3OPNA 2P3QA 4E2WA 4RTOA 4M38A 4KRGA 1XDSA 4DM3A 1SQFA 2H00A 3MTEA 4F86A 4E31A 3LL7A 2C7PA 5EPEA 5HFJA 3UJAA 5K0FA 1FP2A 1RI4A 2JHPA 2I62A 3HVJA 2V74B 3I5UA 5P8WA 4DCMA 5E9QA 2PJDA 2P8JA 3UZUA 5JUWA 1L3CA 3A27A 2HTEA 3ID6C 1WS6A 4DMGA 1D2CA 1SUSA 3A4TA 2GB4A 2I7CA 3FUTA 2ZZKA 1XTPA 4IWNA 3S68A 1EQAA 2XVMA 4E33A 3G7UA 4RTSA 1NE2A 2WA2A 5HIIA 5MHTA 2HMYB 3BWBA 4FR0A 5K0NA 5FWAA 3UJ9A 1F38A 2V7EA 1ZGAA 2EJTA 2AOUB 5GWXA 5FUBA 1YZ3A 3O7WA 5BXYA 2R3SA 3MB5A 2O57A 3CVOA 1RI3A 3HCDA 4LWOA 4PYQA 3EVEA 4FS8A 4QTUB 4X63A 3D2LA 1KPGA 2P1DA 3GNLA 3PX3A 4V0QA 5FADA 2AN4A 3SM3A 3CBGA 1Y8CA 4QPPA 4V0RA 4BLUA 4F85A 3P9IA 2PV0A 3IYLW 5M5BA 4RSRA 2FPOA 4PONA 3NVKI 3FTEA 1WY7A 2Y1XA 2WK1A 4P7KA 1AV6A 2YR0A 4HGYA 3HA7A 3OFKA 5DTRA 4FSXA 3IEIA 3VSEA 5LQRA 3V8VA 3PTAA 5EQJB 2B9EA 1EAMA 2P3OA 2YTZA 3H2BA 3HCFA 4G56A 3LKDA 4X1OA 4U7PB 3G88A 3LCUA 3RIEA 2JH8A 3LGAA 3ANXA 4CWAA 3CJTA 2YX1A 3EMDA 2PWPA 5T64A 1PRYA 4R8SA 3SR4A 4DA4A 2BM8A 3B3GA 3HTXA 4QTTB 1YZHA 3PX2A 5DM4A 1FPQA 4AUKA 3B5IA 2PVCA 2CMHA 2VZ9A 1D2GA 1NBHA 1SQGA 1V39A 2BM9A 3DMFA 4RVDA 3MAGA 1JSZA 3GDHA 5CM2Z 3WSTA 5KYGA 3PT9A 3FTDA 5K0GA 1JG1A 1B42A 3EMBA 1O9HA 3AXSA 3BGDA 5D1HA 4Z2YA 4KIFA 1X1AA 1R6AA 1RI5A 3KQWA 1AQJA 1G6Q1 2G71A 1D2HA 2CL5A 5FQOA 3EVFA 3ER8A 2AR0A 4FP9A 5EHIA 2IFTA 3SGLA 2NP7A 3IV6A 3UWPA 1R8YA 1QZZA 2G72A 2FK7A 2O06A 2P3LA 4R8RA 3TQSA 5K0BA 3M6WA 3R0QA 5DRTA 4ER5A 1ZKDA 4KDCA 4HTFB 1X1BA 4GOMD 5EGSA 2XVAA 1XXLA 5EZQA 3KR0A 1KIAA 4K6MA 2QM3A 1JR4A 3Q7EA 5EMJA 3BGVA 4CKCA 1VLMA 2BZGA 2OBFA 3GRYA 2ORED 3FYCA 3KR2A 1IXKA 5G02A 3RODA 3BGIA 3C3YA 4YMGA 1T43A 3EVZA 3OE5A 3GU3A 2JHAA 2IDJA 4QVGA 3BT7A 3UJCA 2AVDA 5HOQA 2IIPA 5EKXA 3FZGA 3PLAE 3OZSA 3BKWA 5C9ZA 2VP3A 4E32A 1R74A 3GIWA 5CCXA 2Z6QA 3NJRA 1N7IA 3CC8A 3EGIA 2PX4A 5EEHA 4PGHA 5GM2A 2B78A 4RYLA 5DM0A 4RTLA 3BKXA 1QANA 1RJFA 2ZBPA 2QY6A 4BLVA 2NP6A 3M4XA 1JQEA 1O54A 3G2OA 3V97A 5ICFA 3TKYA 2YXLA 1SVUA 1RI1A 4R6XA 2WA1A 2AOTA 2NYUA 3BWCA 3CJRA 2XBMA 3OZRA 1NW7A 3C6KA 1G60A 3M70A 5HILA 2PKWA 4AZTA 1NKVA 4KVZA 4PYMA 5CUQA 1DUSA 5DXJA 5F2KA 5FCDA 3HCBA 4FGZA 5CVUA 1PJZA 2H1RA 1NBIA 2EG5A 3P2IA 4PYOA 5E1MA 5EC8A 4RTRA 3G8BA 2ZWVA 2AS0A 4WXHA 3E23A 1MJFA
chains in the Genus database with same CATH superfamily
3DAYA 4YWHA 3PNVA 2ZTMA 5HK9A 1T9HA 2AOXA 4YCAA 1A76A 2C4VA 3KQMA 1CULC 5CTJA 3T3OA 3MILA 1UCFA 1E8NA 4TMTA 3KUCA 4FTWA 3LD9A 3O4GA 4J7CA 4BXOB 4Q4JB 2R7LA 4AZVA 1H1LA 2HDOA 3AV0B 4EAQA 1UFQA 2J9FB 5EIBD 5HUJA 4HAZA 4NS1A 4B7AA 1L8AA 3TB4A 1GGVA 2ZJ3A 4V2IA 3AC0A 5C8ZA 1U8TA 3TLXA 3OSZA 2F1JA 4KTVE 3GLIE 5J4HA 1GUAA 4I1YA 5IUNC 5LD2B 3F3YA 3AFGA 1T29A 4UNQA 3UFXA 4EARA 4Q4CA 1XTKA 4MV0A 2QX6A 4LX0A 2BR3A 1MW8X 4FGJA 1UC9A 4ROTA 1OBCA 1Q21A 5EXTA 3PGA1 4BP3A 3CR7A 3LUAA 3MW8A 3Q3HA 4UE3S 4WNAA 2YZ2A 4BPRA 5LQCA 1DTSA 4D6XA 1II8B 1N9GB 4BO7A 1U04A 5DW3A 4FDUA 3G8DA 4PBTA 3H5IA 2G83A 2QE6A 3CV3A 3RTCA 4RSMA 3SQLA 5LD2C 1IU9A 2FQXA 4RJJA 4TLMB 1HLFA 1HYEA 5EVJA 4MS1A 3SZRA 4C2UA 1H3EA 1I6MA 2FUEA 5BYAA 4NY1A 2IHNA 2PS0A 1OWMA 3AVOA 2WIBA 1M1XB 5BN5B 1CUVA 4G2NA 3EFOB 1BKYA 1WB9A 1B6RA 4GC9A 2GBGA 3TLGA 1ZGBA 4GWGA 2JAWA 4KE8A 4ZAFA 1KSGA 3WNCA 1ZOSA 2X5XA 1JBKA 2FK8A 4EW2A 1E2IA 2ZJFA 1PV1A 3Q2KA 3SJZA 2QT9A 1I2AA 4CM4B 3SK0A 5LQAA 3AJEA 1MQAA 2QROA 1SIBE 1GCOA 2C78A 3DVAA 3EW9A 3FKSD 1K86A 2XBUA 4G1EB 3NS7A 4HQ0A 4L4UA 1GZUA 5DW0A 5JY1A 3ZGYA 1CS0A 4F4CA 4G8DA 3EY9A 4LCJA 4C4ZA 3BSFA 5TGDA 5JDIC 3AYZB 3IRVA 2X0RA 4RF4A 4BV3A 4F2DA 1QRUA 3WBJA 2Z6VA 2H1IA 1ZGGA 4QBKA 3SKVA 1DC4A 3M6VA 2HWYA 4TXNA 3T4PA 4DEXA 4YJHB 2Q27A 3IP9A 2CE7A 2XF2A 3GLGE 2GPSA 2PZMA 3LE8A 1UM9B 1FMTA 1J0BA 2GN9A 3DCJA 3FCXA 3VBEA 1IM8A 4JI4B 4O59O 3RC7A 2Q21A 5GINE 4EY7A 2GMWA 2QENA 3DFIA 2W6ZA 3EUFA 2QU8A 4P7FA 3T61A 3GBPA 3NM6B 1UT6A 3EVGA 2PQ0A 1E5XA 3CHYA 3L9WA 3QOYA 1U0JA 3S2UA 4I99A 2YCBA 2IYTA 4BGVA 3DOCA 1V7ZA 2CW5A 2WYIA 1RZUA 2JAPA 3B3FA 3K7EA 2JBAA 4TS4A 5AKIA 3O2SB 3PXAA 1PGQA 1RBYA 2PN1A 3PC8A 2BFEB 1BEZA 1Z5UA 2CVPA 2QL6A 2WWFA 2V55B 3O5AA 4ZAZA 1CG6A 4AKIA 1Z2OX 1RRVA 1FX0B 1P7WA 4JQOA 1AUXA 2BKXA 1VCOA 3CJQA 3VR3D 1I9GA 3VX4A 5BMOA 5B7NA 4D5GA 1F7VA 2WD7A 1DMSA 3L6DA 5DXFA 3UMBA 1DZIA 2ETVA 3WISA 1DI0A 4C3UA 5JH7A 3C8UA 1OU4A 2C04A 3OZUA 1VIAA 4XPIB 2NVBA 1G5RA 2AEFA 2XQKA 3O8QB 4Z8XA 2WU8A 2MR6A 4BVHA 2XRMA 1CYDA 2FSGA 1QR6A 3KR9A 4PBRA 2GHTA 2QYOA 4DMRA 4JASB 5E0OA 4HDSB 3U3DA 3WL7A 3OT4A 5DP2A 3L6RA 3ZKWB 4KR6A 1J0CA 3ZGOA 1G9TA 5JCOC 2HA3A 4ZVNA 5MGBA 3U56A 2BFOA 3U1TA 13PKA 4NZOA 2I4TA 4EJ0A 1OLUA 1DBPA 3ZGLA 4EMSA 2FFQA 3FLBA 2ZWPA 3BH0A 1LS1A 3TLBA 4YRGA 3WFZA 2ONCA 3C41J 1AQLA 1GJRA 2L0XA 2VUTA 2Z9BA 2ZUBA 2XYQA 1USKA 1P1IA 4YDSA 4B3XA 2HU5A 4M7OA 3A4LA 2IYEA 1C7JA 4DSUA 3WWZA 4RS4A 1C8BA 2HRBA 3LA6A 3QPAA 4QYSA 4EHIA 3TW0A 5KPDA 2PD6A 3CWZA 3MA0A 1TVKA 3MMXA 4B0PA 1UT5A 1XLTA 2G4CA 1XDWA 3TIVA 1QRRA 2VYVD 1C3JA 2MSDB 3H97A 3P9SA 3Q8XB 3I8XA 2Q1XA 1XL0A 3DCIA 1RHUA 3L92A 3R6TA 4IDPA 4N40A 4FUTA 4HLUC 1ORWA 3BA1A 3DZGA 1QCZA 5F3DA 3K6RA 1J5PA 3MT8A 4J1TA 2IODA 2EKLA 3GFRA 1BE8A 2PJUA 2V7QA 4TRJA 3VPDA 2JA2A 3H2HA 4L0CA 4BVKA 4HH0A 5FBVB 2B2XA 3GT7A 2WVGA 1XXHB 2WP0A 3LOUA 5EXPA 1NVDA 1NHGA 3R24A 4HGOA 4C29A 4EZBA 2OCDA 3AQIA 2DRIA 5WRFA 4MK4A 5ESDA 3DFMA 3L07A 1W36B 3TM4A 1J0XO 5IC4A 1L6IA 1XVTA 4EO7A 1IXSB 1G2OA 1TT5A 2Q4DA 3LV8A 3QENA 2ET6A 2JDIA 5K4HA 1Z3CA 2EGHA 1CZKA 3UWOA 1Q0ZA 2GEJA 4HFNA 3UKDA 1Y82A 2EVWX 3WOVA 1E6CA 1SPXA 4M1KA 3VO1A 3COPA 1NSTA 1CF9A 3LFHA 3MVEA 3IUJA 3E0QA 4NZYA 3NXKA 4TWZA 1CWUA 1ZPDA 2WKSA 2Q4OA 1XVIA 4OATA 1V4NA 3T99A 4C4RA 2JANA 4MZDA 2ZCJA 1V8OA 2GN4A 1VMIA 1T3ZA 3MCTA 4POOA 3WLMA 3IIEA 2YIMA 1RMYA 3D6NB 2FGJA 3PUVA 3UHJA 4AP5A 4HC4A 5FWNA 1JR6A 1UXIA 3DT8A 2CNWA 4GVLA 2XHEA 3FYUB 1WXFA 1FRVA 1L5VA 3DCNA 3HCNA 4KDRA 3U61B 1SZCA 2ZSBA 1DV1A 1QHGA 1NBOA 3EUEA 4G9GA 4DRXA 3LBHA 2P2YA 2J3DA 3DE2X 4HYEA 4Q21A 1M2HA 3IAS1 1AHPA 2FSPA 1P74A 5KNLA 2DCMA 1WNTA 5IARA 1Y3AA 3DUFB 4B4VA 3BS4A 2MSNA 2D06A 1XI2A 3VM6A 4NZPA 1EVIA 2ZKIA 3GJTA 4U0KA 2ZRAA 4EB3A 1ZVVA 4CFSA 4RADA 2CF5A 3TCNA 1L5GB 5LA6B 1CQWA 4DVGA 3PG5A 3AF3A 4KAJA 4HWSA 3BH6A 3MTIA 3KTAA 4GVXA 1K68A 4TKUA 3TRFA 1H2BA 1WHTB 1VPDA 2FPXA 2O52A 2OO5A 3UK2A 3SBEA 1Q95A 2BZ0A 2CLHB 5LJLA 4FZ5A 4GGOA 3I6YA 3S7TA 2C5BA 1CJMA 4QFDA 2H4ZA 2MMGA 5DX1A 4C0XA 2EP7A 3FMGA 4PPQA 4ARCA 1Q1BA 3T9BA 2VJMB 5EYPA 1XCLA 3WGGA 3SU8A 4I46A 1HE5A 1XCPA 3H75A 4CM1A 2NO1A 4GLBA 1YR7A 2VWPA 4YAGA 3CLRD 4ABTA 1KFKB 5DHPA 4KC0A 1VP3A 1GL7A 3LF2A 2C9CA 3E22B 3D7KA 1L5WA 3EHEA 4AF7A 1FTSA 3LY5A 3NTVA 4RPIA 1N77A 3L7DA 4OU5A 3OJOA 1JQKA 2Z3WA 3A28A 3JYLA 4DXDA 1RTKA 1EUZA 1Z4JA 5AHOA 5E6SA 3E7XA 3PEFA 3OWHA 2OZLA 1A8QA 4WZ6A 5G0TA 3UAXA 3ICPA 3OZBA 2LW7A 3MWEB 1CRZA 5BUCA 3V8BA 4KBFA 3MINB 2F64A 4WKNA 5AJZA 3EQ8A 2Y2VA 2AIRA 2G76A 1QX4A 5D00A 4EG3A 2Y4OA 5TXGA 4FNOA 2QP9X 1KH1A 3SVTA 1XB2A 4Z2AA 3PJFA 1K92A 1QBKC 4MKHA 1ZJYA 2BOVA 1M2WA 3PUKA 3TD2A 1SVIA 4JUIA 2XXJA 4D6YA 2JLUA 2CNNA 2C9BA 1BFKA 1BS1A 2Z4RA 4R69A 4M9RA 4TV9A 2C97A 1RAGA 4R1TA 3LIIA 1G6HA 2HIAA 2JLZA 4EHNA 1K8ZB 1GPUA 3ME5A 4K6KA 1U0LA 3EXHA 4FW9A 3U7QA 3K2IA 3LYHA 2JLSA 4RGVA 4DTIA 1XCJA 1BIFA 3VKHA 2DPHA 1L7DA 4X3CA 1ZSNA 1L4MA 4IUYA 4UUNA 1VJTA 2PX8A 3TKLA 3VDRA 4CLXA 3KSZO 2W4QA 2VP6A 3AR4A 1XK7A 2XZDA 3M1LA 4M3NA 3F6PA 3SYNA 2P35A 1M10A 1SKUA 4AJHA 4PO1A 1WUHS 3AVQA 4L0DA 3SEFA 3H6KA 4HNAB 3VR6H 2R65A 4V3CA 1YC2A 5JRDS 1R16A 3V7YA 1XNRB 1HBJA 3SX4A 1W1WA 3GEMA 4AJJA 1WPGA 2F3SA 3ECAA 4PLCA 2EF1A 2FXIA 3G17A 4ISCA 3RVBA 2WYHA 1BTOA 1GUBA 3AQ4A 1QHEA 3I9JA 3ZV5A 3D7LA 1X94A 2PS1A 2I1LA 4TSFD 1I2CA 4F5YA 3HYSA 4LTDA 2XXBA 4MV7A 3G8YA 2ZRIA 3VC2A 3T3EA 2NSJA 5AM0A 4JI2B 4X20B 3AX6A 3CXRA 5JEEA 3PS9A 4WLVA 3ILHA 1NF2A 3M5DA 1NYTA 4E09A 1KI4A 1X77A 3RRMA 3RSLA 1LQUA 5BRJA 2ZBDA 1FBTA 4XFKA 1ZQ9A 2WFAA 1KNXA 3NVAA 5FF9A 2M6LA 2BHNA 2HL6A 3TI9A 4OIMA 5ERGB 4OTZA 2R1VB 4UMFA 3FB1A 4EI2A 5CM8B 5CDYA 2OHJA 1NQVA 4GMFA 4FWTA 1R4ZA 1AC5A 3TD6A 4D45A 1TI7A 1QZUA 4HDNA 2RI0A 2X5KO 3UK1A 4LBWA 3ZJ5A 4F86A 5JFGA 4F45A 3SAJA 5JQWA 1JZSA 4LVCA 4A16A 1KI7A 1U0NA 1GQ2A 2FPKA 3DZ8A 2BHRA 3K20A 4KH0A 3RROA 3EXHC 1OH5A 4DCMA 4RFLA 3PI6A 4MP3A 2VHWA 5DBHX 2RBGA 5DGCA 4MV3A 5CTAA 3HZOA 3BB3A 4HWOA 3QHAA 2H63A 3V8PA 2E6KA 4QBFA 3SJUA 4AMGA 3EODA 2I8LA 1C3OB 1D2CA 1VFPA 4YREA 4A6XA 3HBLA 5BSTA 4B3BA 2V5UA 3LUDA 4UUQA 3OIFA 1QMPA 4O4HA 2ICAA 3X1MA 4K1LA 3W6NA 4DG8A 1OFGA 1ELOA 1W76A 2VTDA 3O8BA 5C7YA 4ZT3A 1A2KC 3LZCA 4DIFA 1U9YA 1XVVA 4UW9A 4JU9A 2RD2A 3VV3A 2Q6TA 3ROZA 3D0RA 4QZVA 3ANYB 3I1JA 3IO3A 3INYA 4FS8A 3GNLA 3LSYA 3JYOA 4J3FA 1L4YA 2DUWA 3CNOA 4Q01A 5GADl 3KYJB 2NZ2A 1QE5A 3B1VA 1V8ZA 1JEYA 2AWNA 2XECA 4YPVA 3QMPA 5KTSA 4OXYA 3V42A 1J56A 2BISA 2YINC 3O4HA 3P2OA 3O8CA 5KDDA 2GD2A 2OBNA 3IAM6 3MCWA 4MI9A 5CAEA 4EECA 2CHQA 3LCUA 1AUVA 1N0WA 1YDEA 3SZUA 1YS7A 3ZLUA 2FVYA 1A88A 1G3IA 1Z38A 2GAOA 2Y0CA 3L6EA 4FYKA 1C2TA 3UHAA 5FWYA 3EGWA 4XWWA 4KYVA 1X9IA 3NATA 1SQGA 4PANA 3GP8A 3WZLA 2Q2OA 2XUHA 3SR0A 1K7XB 3WSTA 4OYLA 3PT9A 3R5KA 4Y1GA 2VTBA 1RQ7A 2MINA 3EMBA 4QM6A 3VNUA 3B52X 3N2YA 2L18A 3U31A 2G71A 1V1RA 2ZIVB 3EVFA 3WLFA 1PWEA 3N2EA 1I30A 4M1MA 5K2MA 4TYNA 1M2NA 2ZIZA 2F67A 5JPCA 3SEAA 1JLLA 1ZD8A 2HQBA 5CB4F 2FK7A 3RAFC 3WMEA 2GNPA 2VAPA 2ODEA 1J2RA 2Y1OA 3AEZA 1LY1A 4R8VA 5DHFA 4GOMD 4DDKA 2CD7A 1LU9A 1QFJA 1QZ3A 3TF5A 3AL0C 1CNMA 3NNSA 4DR4B 3P4UA 2WD8A 1IXYA 4Q05A 4DSZA 2DFLA 1FQOA 1ZCZA 2HWWA 4B3GA 4RMGA 3VR2A 2OBFA 3KR2A 1MO6A 3DT9A 2QJOA 3NHAA 4UUMA 5G02A 4DJJA 4TMFA 1T43A 2XCUA 3GU3A 3WAGA 3K72B 4BN4A 1U6KA 1WMFA 3LHFA 3VR5D 3L5OA 3BT7A 2GEKA 2O19A 4JR0A 2CVFA 2AD1A 4G4SO 4ZCMA 4GMHA 1N2CE 3FZNA 1N2JA 3OEYA 4WPGA 4GI5A 1UZAA 3WK7A 2LDXA 3BULA 3O47A 4DV3B 3HNPA 2IUTA 3E3MA 4K03A 4IR7A 3TLGB 4V0LA 4IS3A 3IP6A 2NU9B 1Q0PA 1CR2A 3BVPA 2JNWA 2HN9A 2G40A 3IQGX 2HKIA 3QLJA 4GZ6A 2FOLA 3G2LA 3Q6IA 3HYCA 5KO2A 5DB4A 3UV7A 4A9AA 5CK5A 3GH3A 5EP1A 1G9SA 3VGJA 1LSOA 3CZCA 2WA1A 2AOTA 2X9NA 3I30X 2X4IA 5CHEA 4CQMB 4ZOBA 4GG1A 2DEUA 4MKRA 1DKRA 4OHPA 3F9CA 4F93B 2UUBB 2YWRA 2AX4A 4DQUA 2QTHA 2Q6LA 2XY4A 3KLNA 2G1AA 3E9QA 4FMPA 4G84A 3IP3A 1NVEA 1S8OA 4GXRA 1CB0A 2HSEA 3ZQKA 4MWGA 4BFZA 1AUQA 1T91A 3WWCA 3LUJA 1E3TA 2DH6A 4HF7A 4G25A 2XNCA 3P2IA 1P0MA 1DHTA 1NVMB 1Z2PX 1M0WA 2VCYA 1JKIA 2ZWIA 3HI4A 4JT9A 4MH0R 4MQEA 4ZYLA 3DBOB 1ANKA 5A62A 2CUNA 4DV2B 1QRDA 5KCMA 3AR5A 4S35A 2DFNA 1UOEA 1P9RA 2A57A 4Q3AA 4BY9E 1A9YA 4GBGA 4M49A 5CGQB 5JALA 5JYBA 1J22A 2XUOA 4ZQEA 2Q9CA 3TNYA 4YRNA 1E5QA 5JFTA 3CF4G 3HBAA 4G1CA 3QFFA 2HFKA 1EQ2A 1UKEA 3BD8A 1OGYA 4NONA 1U3CA 1VJ5A 4TYQA 1A95A 1E69A 1NJ5A 1XZKA 2AOVA 3NBQA 3O4VA 3O8DA 3NTLA 4FFDA 3CR8A 4JYPA 4O2RA 4Q9NA 2E18A 3OT5A 1HO3A 1ADYA 1U1FA 3N2GB 4JBLA 4QSMA 2Q8PA 5CRIA 1J8QA 4AO7A 3D5QA 1Z2CA 2CDAA 3MN1A 5FPSA 4BE7B 5BWMA 2GKSA 2WIAA 1APBA 2XV1A 5LBTA 4C7BA 3OPQA 4F21A 1ODTC 3VZPA 3ZWMA 3LBFA 3DV0A 2H2FA 5BN3A 2NZJA 4BP9A 2AG0A 2ID7A 1G8SA 1W7AA 1VL8A 2ZUUA 3FMFA 1G2PA 4MUIA 3WRXA 2ZWAA 2ZBFA 3ANNA 3HO8A 3WR5A 2OPBA 2OQ2A 3N2LA 1Y0BA 1EDEA 2FZEA 3PUJA 3BE8A 3TIFA 1GZVA 4J8PA 1N33B 5TEWA 5EJGA 2WSMA 1Q15A 2YH2A 2ZIEA 4GGMX 1H6BA 1JP7A 1AQIA 4XGQA 2COUA 2HA7A 3WP1B 1R8XA 2I2XB 5LUAA 1PJRA 2PMFA 5BY2A 2Z2IA 2ZQZA 1CB7A 3P2JA 1DG3A 5AMXA 3IKJA 5TC4A 4INOA 3T5DA 3WFJA 1VBNA 1M8FA 3I9OA 1J7JA 4K86A 4Q47A 4BNJA 2C8VA 1EIWA 1ZD9A 4OLHA 5JMPA 2QTVB 3MRVA 1T5OA 1D2MA 3MS4A 2VNKA 3IMEA 3IUPA 1NAHA 3DGEC 2H8KA 3FGZA 3E48A 3DDHA 1MC1A 3M6AA 3OCZA 2FWRA 5FA5A 9LDTA 3MUNA 5F12A 5LU9A 1PFQA 5ISMA 5K03A 3DHVA 2V4ZA 1F2TB 3BJMA 4YCBA 4S2EA 4N8SA 1WQ4A 4ZC8A 4WY2A 4ZAGA 4E14A 2PZFA 1TYZA 5DVZA 1N6IA 3QEMB 4FR5A 4MUMA 4B3DA 2H51A 1H0HA 6ADHA 1G21B 1SULA 3LL4A 3DE6X 1LBEA 4DA4A 3JWJA 1ZM4A 5BSKA 5FFNA 1AMNA 5T6MA 2WTEA 2PPVA 2C2OA 5LSAA 3SSMA 2WUGA 4ZRDA 3RJ9A 4REMA 4ZN6A 1CTQA 1PFGA 2R4UA 1P1JA 1P9OA 2RSLA 3FSJX 3RSGA 3G59A 1OZHA 3TSZA 4I0WB 2R11A 2DERA 1HM5A 1EJ6A 3T41A 4LQCA 1EZZA 3UAWA 1A9PA 1UBEA 2MOKA 4IQ4A 5LXTB 4X60A 3AG5A 2HDNB 2XCOA 5FPKA 4YACA 2VWGA 5I4IA 4G9BA 2P6OA 4DJTA 3GRAA 4M6WB 1KE2A 3VNSA 3EE6A 4Q48A 3OPVA 1MW9X 2P2DA 5D87A 3ZN2A 3KLOA 1ML4A 5CDSA 3AF5A 4WCDA 4N0MA 3AIOA 3ZU5A 4ARAA 1OVMA 3HCOA 4OSOA 4A27A 3WKCA 1X7HA 1NVTA 2HXGA 3G2HA 4TRRA 4YQEA 4XFJA 3BL5A 1JEEA 1GQFA 4E0BA 5KC8A 1IOWA 4A1OA 1L4UA 2JIBA 4G4JA 5LB4A 4YAUA 5ALYA 3CIOA 1KP2A 1NV9A 3O3NB 3F7TA 4RKYA 3ZV6A 3NVMB 4RVHA 1T3LA 4Q9AA 5HEKA 3S40A 2VDMB 5D01A 1RJ9A 1G2IA 5ALDA 2FQ1A 2GWHA 5CFOA 3PFHA 3WE7A 2IL1A 4YI3A 2TSYB 4QVKA 1BAPA 2AQKA 3OQ6A 4AIRA 4D0SA 5GTDA 5D6OA 1X7YA 3C15C 4AXXA 3DZHA 3FNFA 4OD0A 3K2EA 2ZK7A 3FTPA 1CVIA 5TPZA 3H3JA 2QZZA 2XQFA 5LZ7A 2FKNA 3TDKA 3HA2A 4A10A 2P4UA 2QZJA 1PSWA 2NAFA 3L46A 5AK6A 3BDIA 2UZAA 2O5EA 1QFXA 1IZ0A 1N25A 2G0NA 2W71A 4DIEA 2BJHA 2WF6A 2Z8YM 5FUXA 2W58A 5DGTA 2A92A 3V1KA 3HY4A 4XSVA 2WM9B 2P4QA 1JPNA 4NZ9A 2DECA 1A69A 1ZRSA 1XMOB 1THTA 5FV7A 2JLVA 3V6LA 3ABSB 5KNDH 1CETA 1H2RS 3OFNA 3LBAA 4Q7JB 1N2IA 3LX5A 2J59A 1BXGA 1SXGA 1THMA 2PR7A 3LP8A 5K0LA 4ZGWA 2BSXA 2YYZA 3ANTA 4YONB 3MGAA 2W6MA 3DQPA 3EARA 4MWSA 4Z7QB 2ASEA 4QEZA 1GZDA 3J81A 1XWWA 1MQ8B 4HGNA 3ZR4B 4DZRA 2O7SA 3EPPA 4WK0B 2IPOA 5TQ2A 3JR7A 3WXBA 4BLQA 4HWTA 1R3UA 3C4VA 5DI3B 2F8MA 2J6BA 4HXYA 1YULA 1WTAA 1F6WA 1VHLA 3NIBA 3PTZA 3QVJA 1Y5RA 2MT9A 3ADOA 2IYOA 2VRCD 3ESXA 3OP1A 2NVUB 1IY0A 3WLOA 3U5ZB 5EHNA 3BB1A 1AHHA 2OO3A 3CLUC 3QNWA 1FVXA 3MIIA 2PSEA 2EHJA 4M88A 4HGPA 1U8AA 2FPMA 3QV1A 2PX3A 2PT6A 3NB0A 5B2ZA 4OUDB 5C31A 2FKAA 2DCUA 4JBXA 5C18A 3MQFA 1AMUA 2P7HA 4UFPA 3RBZA 1MVOA 2LV8A 1CUIA 3Q8MA 3A32A 3ZDYB 3G7NA 2NUAB 3ZGNA 1NUHA 1E9EA 2IPXA 2LKCA 4GI7A 2VC2B 4XGIA 4OKNA 1RM4A 3ROEA 2FWIA 5ALTA 4AZSA 3WO0A 1E63A 5IKMA 4RVSA 5CURA 4AWXA 5B3JC 1TEXA 2P6PA 2K4MA 4WXPA 3MWJA 4IWYA 3NHYA 1K7SN 2JI8A 1SXJD 2YVAA 5BW8A 3QPCA 2CZGA 4JUAA 4PW0A 1H8ED 4LHSA 5JCOA 3RS9A 3W1WA 1ZMXA 2DHQA 4X7PA 1II0A 4F71A 4PSUA 4IG9A 1TJ4A 4YCDA 3MSXA 3GOHA 3AESB 1B93A 4Y1RB 1XJCA 1G5TA 5JO9A 2J41A 1M6YA 1S3FA 3KOXA 3PF9A 4UM9D 3U0BA 2IHBA 3OZEA 5LIPA 4Z0PA 4YJFA 3SIXA 3FRHA 2XKAA 3BK7A 3H5WA 4J94A 3A1EA 1QAQA 1BDIA 5J2TB 2WMOB 1FP7A 1VKZA 3M1YA 2OCKA 3KZVA 3FTFA 4GLJA 1K88A 5BSFA 2FDRA 1ZC4A 3KD3A 3ZKAA 1HLGA 1OGIA 1NKTA 3CCCA 2YS6A 3RAJA 5BOSA 1KBZA 3ZWVA 1KPHA 3T7RA 3ZY4A 4FYMA 1RLMA 1R5OA 1NV8A 5C1DA 2GZ2A 2R79A 2OVBA 4JB8A 5CFRA 2VXYA 3P2EA 3PFCA 1KU6A 4L72A 3UEOA 4ENTA 2PG3A 4MXDA 3D02A 2YY6A 1RRMA 5T67A 2ZRJA 5GP1A 3DXYA 4PAOA 5EIAA 1V7QA 3KU4A 5BRAA 4M0PA 3PGXA 1OJ7A 2IYRA 2JJQA 2QD4A 2H5JA 1U0HC 2X3FA 3O4RA 4M0LA 1Q7TA 2VZ8A 4LXHA 2OPHA 1EP3B 3FAZA 3W5AA 4NFSA 4H4CA 1M34E 2NACA 3C5CA 4PAWA 2OQVA 1JFFB 4G01B 2V9CA 4N8EA 2QVLA 3FG9A 2ORWA 2CJWB 4MGZR 4XRGA 3NDPA 3E0XA 4MW9A 5D3KA 4OMDA 1J2EA 3M6MD 1YR1A 2D5CA 2IK8A 2R44A 5ANRB 5IMBA 4C4SA 2EX1A 1T10A 2JA1A 2BSAA 3BRQA 5HGJA 1C2YA 1I4DD 1FBNA 1E0AA 4IJ6A 3VR2D 4OH7A 4W5OA 3C85A 3L79A 1JRLA 4P58A 4MIKA 2C0PA 3B13B 1XRSB 3D7RA 3FHCB 1BA3A 1MGPA 1W94A 2JJ2A 5A3VA 4B6GA 3ZHRA 1R6UA 4CNBA 3OPXA 1UPXA 3R9WA 3DOUA 1I1HA 1TQ8A 3M3PA 3PKJA 1A9ZA 1UOOA 2R4QA 1F2UA 3K0FB 2CXUA 4MHOA 3DHEA 4Z9YA 5HCIA 5EHZA 1FFHA 3TEMA 2PLWA 4MWEA 1DX9A 3C3AA 1QK3A 3P96A 1N3IA 2O2DA 4DLTA 4C7MA 2GJSA 3TJMA 5HJ5A 3UB3A 2QMZA 2DBZA 4XVHA 2C8LA 4PZCA 2XGJA 2F1OA 3D3WA 4EGFA 2VF5X 4IXTA 1S89A 5ALFA 5CA0F 1JTEA 2PA3A 4AU1A 2HF8A 3N76A 2WZBA 4AT1A 5HUHA 4XE5A 4PFQA 4WHMA 2JJ1A 1YF3A 3FYDA 3FWZA 1ETUA 3MCVA 3D4LA 1SIUA 1UQRA 2ZJ0A 1I4TD 3B78A 4RD2A 4LRXA 4CL3A 5CB0A 5TVGA 1FU8A 4PYKA 3S2EA 3ASVA 1BQEA 1ZN7A 2Y3IA 4X91A 2WKWA 4EYSA 4C03A 4G5OA 4KBYA 3ZE2B 2BE9A 1EPUA 3C8HA 2R6ZA 3LP5A 1M1YB 5CH8A 5GONF 3ZX5A 3LTNC 1FJ2A 2GA9A 3NAQA 4Q7EA 1DEHA 2YVKA 3O3CA 5L3VA 1L8XA 2IJGX 4EELA 4BDSA 2B5OA 3WGTA 5IT4A 1Y9AA 1OHHD 2CL0X 3DD1A 1C1DB 4TZ0A 4Q4JA 1EB8A 3T1NA 1CDDA 3IP5A 4G65A 1A1VA 2PH1A 3UJAA 4ASUA 5K0FA 1YD7A 2M1XA 2D0PB 3ANSA 5E9QA 5ENVA 1GY8A 1N1GA 3SC2B 1B8UA 2PZAA 2XWJI 2HRZA 1ORVA 1VYVA 2FZKA 3ZZ0A 1DWOA 2DWOA 3WSVA 1JR2A 2ZZKA 3ECSA 4OHKA 3S68A 4IDQA 4J75A 3TAUA 4A2WA 1PR5A 3CY6A 4LVUA 4RZXA 5FPQA 2XQGA 5JS2A 2CK3A 1LD3A 1W2WB 4IAOA 4P08A 4UQOA 3U26A 3K0HA 5I9BA 5CT5A 1BYIA 4LE1A 1F38A 2C8JA 3HWWA 4FIZA 4QLAA 4P2GA 4R01A 2R48A 1J0EA 3DZFA 4EA8A 2R8XA 2GYYA 4J0FA 2O50A 5ERXA 3IBCA 2QGNA 1DX6A 1BMQA 2AW3A 4LC9A 2C98A 3CG4A 2P1DA 2QWXA 4ODIA 2JIDA 1Y8CA 4QPPA 1WDMA 3B6KA 1NN5A 1L4FA 4DR7B 4AMUA 3EPHA 1J8VA 3WRYC 3KZNA 1Y34E 3ZH2A 2Q46A 1TTPB 3U4QA 2G06A 3OFKA 4G1UC 5HX7A 4HDAA 1BS2A 3KYCA 4MRPA 1EAMA 2XH8A 4BQNA 1VJCA 3QKRA 4BE9A 4DC0A 3VTZA 5L95A 2FUCA 1FLAA 2GEFA 2IXFA 3CJTA 3PA6A 4B85A 2WKPA 2AFIB 2ZOSA 3L8HA 1C3VA 2PSDA 2HV8A 4TLAA 3SR4A 5B55A 1CE8A 3PNMA 1E62A 1QVVA 4YCLA 1RKQA 1GCIA 1IUPA 2IVFA 2PVCA 4GX2A 3KNZA 1YJAA 3C98A 1V39A 2B8TA 2FUKA 1Q92A 2C3MA 3Q9UA 3QKSA 4D4MA 2OKGA 3MWDA 3ZVKA 1OXSC 1CUHA 1QOQB 1FUYB 3BQ9A 4L4RA 3WOHA 2XODA 4EITA 2XKBA 4C1BA 2DWPA 2EIHA 3PDWA 3HR8A 3H5AA 2QX7A 1YDHA 2AYXA 1NVBA 3N2KA 4MUBA 3UW1A 2DXIA 1QUEA 2WM2A 4XCQA 4CMEA 1KE1A 4UULA 3EWSA 1P0IA 2CL6X 2P3LA 2CLEB 1NBMD 1GZ6A 4RENA 4YAIA 4JQCA 4HTFB 3DEYX 1WE2A 5D84A 1N1DA 1MIOA 5EZQA 3CS3A 4BFVA 2JLAA 3A0UA 5I8PA 4AKEA 5AI6A 4A91A 2GPBA 3VTKA 4TLEA 2WLTA 3IUYA 5IU6A 1JDBC 4MW1A 1ZY2A 2C31A 2DC1A 3OE5A 3QPUA 4NS4A 1CR1A 2IDJA 2NO9A 3NH6A 4LY0A 3D5TA 1NNSA 2XVXA 4ZT2A 5F1KA 5HS6A 1CJCA 4JI3B 1YJXA 2QS9A 1I33A 3GN2A 1P81A 3FZGA 1SOMA 1YL5A 2Z5VA 1X7XB 3IC5A 4E32A 1NGSA 1QIGA 2J4DA 3EAGA 3WQHA 2P75A 2RONA 3AUTA 2VXCA 3EGIA 4RJTA 2PO5A 4LJYA 4E12A 1SKMA 1OVGA 4ZJYA 2WSBA 3QVVA 3SN6A 4WA7A 3GBVA 2JGDB 3U4MA 3QE2A 5ADWA 3R41A 1ZL2A 2ZREA 4FE7A 5FIUA 4ZHQF 5IWAB 3LT1A 3V97A 1F8GA 2ZEJA 4J7AA 4TTPA 4PLFA 4XTCS 1K2VN 1L5QA 4MQ6A 4CL0A 3HFSA 1Y4SA 3BXEA 3FOWA 5TPZD 2WC1A 3PUXA 4Y6OA 3EEQA 4UNPA 3WNVA 1CJVC 1P5JA 5HILA 4KQEA 1PJTA 4P33A 4M9XA 2HNAA 3LFTA 3TUZC 3E35A 1G7TA 1N8NA 1QFMA 3LNTA 4WKGA 5CUQA 1IN6A 3T34A 2J33A 1Z0FA 3OCYA 1V9CA 3EUAA 4FGZA 2HK6A 2N46A 4HQOA 4RHUA 1Z0DA 3QP9A 2VJBA 1QTQA 1UBOS 3ILSA 4BMVA 5CBPA 2EG5A 1LA2A 4PYOA 2ZJ6A 3SS8A 3H7AA 2LRHA 4F46A 3I05A 4RZHA 5CLLA 1V1MA 5EZ6B 1NJ2A 3ZJUA 2NIPA 1AS0A 3NAGA 5D6NA 3Q5EA 2J9FA 4Z86A 2HX1A 1G8MA 1QVAA 2A8YA 1NOJA 3U81A 1RJDA 3N5KA 3VOSA 3CO5A 4HEQA 3EXHB 3HB7A 1U9ZA 2J0UA 4FCCA 2FSHA 1RPAA 3PT5A 1XRQA 2IYYA 4TUYF 3C6QA 4LHWA 1VPEA 3IV9A 1M7HA 4EAAA 1PQPA 3EVCA 3UH1A 4EPXA 2QTMA 3BC1A 3LLUA 1R6XA 4GR5A 4NE9A 1KIFA 4IIVA 1ZBDA 4U6SA 1Z5OA 3LS2A 2X6TA 1EUCB 4P3XA 1IQ0A 1Y7LA 2CLFB 4HUQA 3PTLA 3WGYA 1N2HA 1O87A 4LF5B 4WJZA 1QUFA 1JIUA 3ZCXA 3SF8A 3ZC3A 5I9NA 2UXCB 4ZQFA 2EERA 4GXQA 1V8FA 3GUZA 3AILA 1WMAA 4B83A 1E58A 1XZAA 1MBZA 3CX7A 2IIBA 3LOQA 4YA6A 4QHYA 3ROKA 5C1PA 4Y2JA 3OLWA 2R00A 1SXJB 1S3GA 2ZAGA 4RMJA 2AQHA 4RKEA 4K88A 1GPNA 3SC4A 3FWHA 1SVOA 3CX6A 4KUHA 3JQRA 4FFLA 1T5BA 5BURA 5KJ1A 2IS1A 3UXEA 3W5BA 3PWZA 1VJ1A 1QPZA 2MHCA 1UPAA 3GELA 4MVJP 4EHFA 4MR8A 3GLFB 1JEAA 1ECFA 1DSSG 3UT0A 4AQDA 2DR0A 1HYHA 3BWMA 4K46A 5JNTA 2OBBA 1EHCA 2HBQA 3K53A 4MPPA 3D7MA 5FYQA 1F0YA 2OSBA 5L51A 5LJIA 5TMBA 5SZHB 3SHVA 3QVGB 3GOQA 3K4HA 3LU1A 1TIKA 4HG2A 1VE3A 3OWOA 1WZNA 3SFVA 5C3MA 1UAYA 4QUIA 1E2FA 1XEXB 4OLBA 1BROA 2EAUA 4QOGA 3OT1A 4L8FA 2BF4A 4D25A 4HEA1 4DARA 4M99A 5KVSA 2WIKA 2PXCA 2M98A 2Z08A 4YRJA 1DNPA 4D8WA 1LBTA 3GQVA 2Y27A 4IP0A 2JJMA 3S1LA 1YL6A 4B4WA 1XX6A 5JTTA 2AE2A 3EOZA 4Y9TA 1O96A 4PG7A 5KC9A 4HX9A 4NBTA 4I4TB 4ZMSA 2BFPA 1H93A 3EG5A 3O8OB 5T4BA 3STHA 4ZVVA 1U2DA 1DPFA 1KJJA 5KQRA 3F0TA 4WUVA 3HWSA 3U9TA 2OCAA 2PUBA 5JD5A 1ZBQA 3N0TA 1BWRA 1Y8AA 4QHTA 4XLZA 5EZYA 4PLWA 4QD3A 4HDQB 5E7JA 1HDCA 1U1EA 3K0SA 3RCBA 2J4FA 4OL9A 2BONA 5A2QA 3LQQA 3P19A 2QV0A 1ONPA 1ZA2A 5IKPA 1K9VF 3WIOA 3MT9A 2QTGA 4CCYB 3CR3C 3CX3A 1R5BA 3ZHXA 3MAJA 5BR7A 1NRIA 3UWKA 4DA7A 4O4JB 4ZV9A 2OG1A 2JGNA 3FHLA 1JQLB 2D2XA 2I3GA 3O4IA 4L9SA 3RGWS 4PTYA 3T7CA 3FPEA 3JQCA 1I4WA 1KK2A 5AI0A 4LRWA 4RLFA 1SRRA 4ZCPA 2RHTA 3VDQA 1BG6A 4M8LA 3P0FA 1NLUA 3DD5A 1SD1A 5JXWA 2V4MA 3E9YA 3OMLA 4GHWA 1RZRA 1IBKB 2PLNA 3FFTA 2PGXA 1L1QA 5I3CA 4P38A 5LP6F 3GJ7A 2JLWA 2IZ7A 4PLVA 3RC3A 3ZVLA 1E66A 3FNQA 1E79A 3ND8A 1PO7A 8LDHA 2LIVA 5HVNA 2NT3A 3QVMA 2CCKA 3T1TA 1TZCA 5HKOA 1XN1A 3G9XA 1OAOC 2GR9A 1QQAA 1I80A 1PE0A 1TKAA 1IN8A 3EEBA 1IG0A 5EXSA 3ZDDA 1TO2E 2R97A 4JC4A 4H35A 1ZNZA 3QXGA 1NN3A 2JB9A 1G20E 1B3BA 3VH2A 1XZ8A 3GUVA 4H15A 4B34A 4BP1A 5K0SA 3ZEAA 1SD2A 2OM2A 4Y1FA 2AXNA 3FFWA 1P3JA 5CLGA 5IBCA 1P73A 2PMBA 4R3UC 1AHNA 1BDBA 1XXHE 2Y1DA 1N9KA 2Z8ZA 3FUVA 4Q18A 5JBQA 3HO1A 2OEPA 3RHFA 2B5WA 2PXAA 3RWOA 3U60B 3AHGA 2ZSHA 1IY9A 2FRDC 5CIYA 1WXQA 2QW1A 4MRVA 3BTVA 3ON5A 1W0JA 3JWEA 3P0EA 2WJ6A 4EABA 1AKTA 1JSRA 3QMMA 4K2AA 4YX9A 2IDKA 3COJA 2KBFA 4XYEA 4MLZA 5IKEA 3WLHA 1P39A 2CV1A 2CJXA 3W9SA 4DQLA 3LYUA 1MXHA 1Z0UA 4LWPA 3OX4A 5K99A 1DG9A 1ZCFA 2ZYHA 3KQVA 1REQB 4JVSB 4M1ZA 1UP4A 3OICA 2ODPA 3PFNA 5C0OE 5HPYB 1WB6A 4N8DA 4FZVA 3G02A 2LXNA 5JSFA 1KZHA 1FLDA 5KHOC 4WLEA 2EDAA 2J7KA 3G2MA 2OHGA 2J8ZA 2HCTA 4O3FA 4KDEA 4DR5B 5J4KA 3A1NA 2CBZA 4AICA 1H2YA 3NU1A 3SS7X 2WEKA 1B15A 2VHVA 3ETEA 3UVEA 4DCUA 5AIBA 3THRA 2ZB4A 3NI2A 4YMLA 1V5IA 3H2GA 4NE7A 1VPVA 2QAJA 1ZN2A 2ZRMA 4Q12A 4JB2A 3L93A 3RBXA 1EYZA 5HQJA 4P83A 3RVMA 1C81A 4D0RA 1U7WA 4ANFA 3MJFA 4YRDA 2G67A 2HXYA 3W4KA 4BMOB 3UCXA 5IAOA 3GLIA 1IPEA 3GR6A 4KZPA 4XIJA 5COBA 2BFDA 4RSGA 1DAGA 1XU4A 2IKQA 2DAPA 4UBMA 4WFQA 2QJTA 3V2HA 4NZNA 3GUUA 4KO2S 4J0DA 2WB2A 3HM2A 4YUYA 2XKJE 2EV9A 2YJ5A 4C6RA 4JXXA 4CTNA 1CS0B 5DLDA 2EBWA 1Z4IA 1OCEA 2MU1A 2R4TA 3RREA 5K9ZA 3EMKA 4NAVA 3R7BA 1DB3A 1NQUA 1KAMA 2JJ2D 4TWAA 1LB1B 5T6BA 2RBKA 1CJSA 1DTWA 3OIYA 3D3JA 2I6QA 3BX1A 3LPDA 3A9SA 4MKZA 2MMCA 3B36A 3BE4A 3FPGA 3L0DA 1ISPA 3OQPA 4Z99A 4KR7A 2GS9A 1FMFA 1GPBA 2QRZA 4KI7A 5K2OA 1KJ9A 1W0JD 1K97A 5IC6A 2CFRA 4ZI7B 3MC1A 4GXNA 3PHGA 4C4OA 1TU4A 1ZAYA 2E2WA 2X0EA 1E3WB 2C2YA 4K9PA 1C0EA 3QTLA 1C8KA 4NMHA 6Q21A 4HPXB 4RA6A 4FFPA 2XGOA 4I2NA 1PFVA 1CRQA 1P29A 3GLHA 3TNFA 5JFOA 3OQNA 2R8YA 1OFUX 3C1AA 2B25A 4CV1A 1SAYA 1O5TA 2DPMA 5AQ1A 2W2XA 4MGIR 1KGSA 3BRWA 5CA0B 3QBJA 2IUYA 4OGLA 3L0ZA 4NBKA 3G9UA 4BUCA 3DCYA 2OC9A 2WSSA 3TNLA 4KCGA 1MFZA 3UJHA 3IILA 3QVSA 4ND4A 3JQBC 3LT0A 3D0QA 5KVVA 3VUFA 1WSAA 1VXRA 3GXBA 2BHLA 4JBNA 4I1UA 3T5CA 1GRVA 3EYAA 1T36B 2FMKA 1KH2A 4XPIA 3W4JA 1F51E 2NVWA 1HQKA 1NWHA 2W2VA 4LG1A 3CZRA 4B80A 1QHNA 3QU9A 4Z6KA 2R2AA 5EWJA 4JOQA 3WB2A 3HCPA 4PRYA 4MDHA 1RWOA 4DUGA 1A50B 2RB5A 3P4YA 3ABRB 3ETHA 4E5YA 3C5WP 1V47A 3AGPA 1C9NA 1SBIA 3F49S 1M0SA 2AOUA 1IVNA 1ZD4A 1HV8A 4RMHA 3HRKA 4EJFA 3BHIA 1MENA 1NPYA 3EOBI 4WD3A 5KWVA 3FJ1A 4I8IA 4JMLA 3QGMA 4S1VA 3H4TA 2B6HA 2QTBA 4EYKA 2CMDA 3HU1A 3PXDA 1QONA 4QASA 4XAQA 3TOCA 1YA6A 4C4AA 1TW2A 1G7RA 4RHCA 2F55A 4BLRA 2VLBA 3NEJA 1ZJWA 1K3TA 3PEYA 4QUHA 3H9EO 4J7UA 3UMJA 3IV7A 1TZKA 1DDOA 3ZBQA 1E3SA 4OG2A 2IZ1A 1HT3A 1RXWA 4NI5A 3PQ3A 3G68A 4E1BA 2JHGA 1M2OB 1MQSA 2JI9A 1IWPB 2RHOA 2TMKA 4RD3A 3EC2A 1Q3KA 2OHFA 1AKEA 3PIDA 4O4IF 2JFYA 4S0XA 4B09A 4BNWA 4DDVA 3UFBA 3QPBA 4YBRA 5JRJA 5CFNA 5ELMA 1E1QD 4MQ5A 2BBSA 3V4FA 4N49A 1VQ1A 3PNSA 4Y9UA 4KPFC 5BSHA 2O20A 3MMSA 2XWBF 4AMVA 2LCQA 3HXQA 5CFZA 4YRAA 4YRQA 2A0FA 4NENA 5EE3A 1RT9A 3RYHB 3S29A 3QG1A 2BFNA 3U19A 1XROA 1RCFA 4RIIA 5T3UA 1VM6A 3KFXA 2PV7A 3HP4A 3HQ4O 3R0ZA 4H1VA 3V32A 5AVYA 1P5RA 4CR6A 1SXHA 2CB9A 2ZR8A 3BXZA 4DLPA 1E9CA 1MH1A 1VSUA 3UAYA 2FV8A 3P9RA 1NQWA 1TTHA 3Q85A 4M1SA 1J00A 2AMVA 2V74B 2PMCA 1JIIA 4OMFG 3WY9A 1NY5A 2ZYIA 2WUEA 2FPIA 4HWPA 1N32B 1KRXA 5LBIA 3O2JA 3JRXA 2EFCB 2DKFA 3OQJA 4JELA 3JX9A 4CZ2A 4DRXB 1F20A 2C9YA 2DH5A 1LW7A 4AJ4A 1N2GA 3PICA 3KL2A 2GK3A 3QU2A 1JH9A 4CKWA 1SQ6A 3LH5A 1ZRMA 1IN7A 4L7QA 5DWDA 3DDCA 5MHTA 3BWBA 1N36B 2QPAA 1TA9A 1X80A 4PZ0A 3I9KA 5EWMB 3GP3A 4NAHA 5DBFA 5HF6A 3IT2A 3DFFA 3UGQA 1XMQB 1RRCA 4UZFA 4EJ2A 4DV7B 1CRPA 1RCTE 1X92A 2E6UX 4QXAA 4RMIA 1YZ3A 3HN6A 3I34X 2DYKA 3CVOA 3UWDA 2YHUA 1GQRA 4L9RA 4UUOA 1NX6A 1CFZA 2HCBA 4XD7D 3W5UA 1MA3A 4MQFA 1A98A 2PV0A 3F6BX 2BFCB 4K9KA 1NXWA 2RH9B 3AEKA 3T54A 2G1KA 1JA0A 2HADA 2OZPA 2W2LD 3H6GA 1BEUB 3ZDCA 1ODSA 1QGUA 5DTRA 2W6JA 3TR0A 4TRNA 3M8KA 1NXVA 3ASYA 3DQZA 3EA5A 3NHWA 4ZCIA 5AW1A 4FJ0A 3PEWA 2FZWA 4W6QA 1T4BA 4PZYA 2XMRA 4LOHA 4U7PB 1ZIDA 3S1AB 2YX1A 1HLDA 2F00A 3IR6A 3VU1A 3OHSX 3H1PA 1MOZA 4LGYA 4LY3A 5CHYA 1I24A 4DW8A 1KC3A 5BR4A 5EIHA 3P52A 5M29A 4AL4A 2H9IA 2Q9AA 1L7AA 4L22A 5JD6A 3VO2A 2XB6A 3D64A 3DL7A 3K6SB 4HD8A 3HB0A 1D03A 5SICE 5FBRB 4FFNA 1M1UA 3H5OA 2ZB2A 4NNOA 5DNDA 5GGYA 5H3HA 1G6Q1 2ECKA 1JYEA 1D2HA 1VYUA 1WKVA 2NTEA 2YJGA 1ZNXA 2AR0A 1NVXQ 1CQJB 1S7CA 1F8XA 2HCJB 2HJRA 1ODCA 3IV6A 4II7A 4JBWA 4P3YA 5HQ3B 2WYWA 1QZZA 5DCUA 5AJWA 5LBUA 4DSAA 2R62A 2ATIA 2GGSA 4F8EA 1RPJA 1XTUA 1JR4A 4PR0A 3SLKA 5LLTA 2J6IA 3ZDRA 4PHGA 1EFLA 3GMTA 2D62A 5HTKA 16PKA 2CHVA 4JWTA 1RRPA 2VWQA 1XMVA 4QVGA 1AO0A 1KRWA 3QKWA 2B83A 2IVZA 2O1SA 4H6WA 2VIIA 3TMKA 2DFDA 5CB6A 1L5LA 3KM0A 2PHZA 2EG9A 2G3YA 1ZXBA 2B94A 4WI1A 3O1JC 3PYLA 1D8AA 1UADA 5LDGA 3PLAE 3GROA 3IUEA 2C00A 1LC3A 5B53A 1KSHA 4ZZ3A 5IANA 4UNSA 2AR9A 1EEHA 1XALA 1UMCB 2IIVA 3WG9A 2V7QD 2D7CA 1OTYA 3B53X 1RJFA 4M55A 5FDFA 4RJLA 1IB6A 4OQMA 2VUSA 3CKYA 1ONNA 3TLKA 5BT8A 5FWXA 2A67A 3O91A 2VA8A 4P8RA 3BWCA 3H5TA 3STXA 1KYVA 1AE1A 1H66A 1U9CA 4KXMA 3JD0A 4HPWA 5ALOA 3ZNOA 5A03A 1XJ0A 3M1AA 2NU9A 1NFFA 4BAGA 3KKPA 4H7JA 4GI1A 4BZPA 1TAGA 2ONKA 4JB0A 1DC8A 2UUCB 4KRFA 2VATA 4WKBA 3K70B 1UKCA 1S0UA 2WP8J 4D8TA 3V1LA 2O9JA 5CW1A 4L8VA 1WEKA 3KKKA 2XYGA 4FEYA 4NK4A 2R8ZA 2UZ3A 3B82A 1HK7A 4Z0NA 2C9DA 2ZTSA 1ZOLA 4LBVA 2FP3A 2AS0A 4OQ4A 1UBJS 2WINI 2AQ8A 2X0KA 3OFVA 3OQHA 5DMHA 3TYXA 1DT3A 3QNUA 1X3LA 2WDZA 2X22A 2C4NA 3VR4D 1GD1O 5B57C 2JAXA 2ZUVA 4WACA 4KQCA 3BMQA 1P4SA 4WVLA 4DKJA 5E4FA 3V4OA 4MS1B 3BCSA 3ONNA 4QEDA 1IMOA 5EE0A 1Y6GA 4CBVA 4Y6QA 2C2KA 3WB1A 4BNMA 2TECE 4AYXA 1QVWA 3DVSX 4AG5A 3P26A 5KYWA 3CW8X 1UDWA 4LKRA 1OZGA 4Y67A 2X8AA 1F2UB 3STWA 3FSGD 3T3HA 3ZW7A 2NZ8A 3ADBA 4JXZA 3FYHA 3BD7A 3PNBA 4LOJA 5HM8A 1M8GA 5KNDD 3KSUA 3J81k 3AP3A 2Q3JA 4YYEA 1Y9DA 1GADO 1T4DA 2J31A 2V9PA 5JAIA 3I8OA 3NHJA 1XGKA 2PRJA 3A3OA 3H2YA 5KQSA 4FMDF 4DN6A 2FN8A 4IH9A 1F6DA 2BUAA 2QTLA 1YACA 4C7OA 4FJ1A 3DAGA 4P84A 4JP8A 3DZJA 1BMDA 4PS1A 2XMPA 2GERA 3L8DA 2DVMA 1VMKA 4C4XA 2JFGA 5KKCA 1Q44A 3C8ZA 5LZ4A 4OPMA 1E0JA 4QPDA 3GRZA 2ZSUA 4YGYA 3REQA 4NH0A 1Z63A 1SUWA 1JDVA 4A03A 1DBSA 5F78A 4YRPA 2QPOA 3CKKA 2NQ8A 4HNGA 4NG4A 1CUEA 2D2VA 2B20A 3B2QA 4RC9A 1XLVA 2H1LA 2HRRA 3LDHA 4TT3A 3JQAA 1ND5A 5I7EA 2ZM5A 3LLVA 4HY3A 1Y4AE 2B1GA 2VTEA 4B4UA 2B2CA 2O3JA 2ZP1A 2WNIA 4I6EA 4NZMA 2CFCA 1XAHA 4B17A 4MAFA 3KZXA 2QGFA 3ZCPA 4LJ5A 4HCJA 1DELA 3EXG2 4EEZA 2V3VA 5FAKA 3GGPA 1RAAA 4HXFB 4B4DA 3GHHA 4BGEA 4JC8A 1KQGA 4CFYA 4YMUA 4XARA 1QK4A 2BFWA 2O3UA 3LQYA 1KVUA 1TECE 2K7ZA 1D04A 4KK4A 4PCAA 1OH6A 3RR2A 1J8FA 1G8GA 1QAMA 2PK3A 3RC9A 3L6CA 2M6KA 1A2OA 4X1IB 3CE9A 3IVGA 3GMSA 5EUCA 2J1LA 1N6RA 2BGRA 3W8EA 5KIAA 2QN1A 3WL6A 3UGTA 4ZOEA 1FNMA 3PSHA 1AF4A 1IK6A 2QSYA 3OPMA 1E7MA 5DX0A 5KJEA 1NTOA 4KGVA 1S6YA 3CNHA 4UEWA 4DBZA 1GXSA 3DE7X 5DHAA 1XAJA 4ZT4A 2B7BA 3ZHSA 4QM7A 1U3UA 3ZXIA 1R5NA 5J47A 2PEYA 5CX1B 1UJNA 4QPNA 3GN1A 1KQ3A 4TQGA 3TPFA 4V1CB 3DM9B 4CGZA 1PVVA 5H80A 2GVNA 4F72A 1V2HE 1W8DA 2IITA 2X8WA 4FNGA 1BU8A 1X1TA 3HGMA 2VDVE 4B43A 3U39A 2AZXA 2W6PA 4MR7A 4UPVA 1W0CA 4ND6A 3A11A 2VCHA 4V0MA 3RAPR 1TNDA 2Z04A 4F2GA 1RAEA 2CUZA 4FLFA 4NC9A 3NWBA 3B9RA 4OGWA 1W34A 5D5PA 4AY3A 4EGQA 4YROA 3T7DA 5HP4A 3GA5A 4TMXA 1JAXA 1NF9A 2J85A 3HXTA 3I9MA 1ZOOA 4CU5A 4A15A 3HPQA 1DKQA 3IT3A 3TZHA 3UFXB 1HYGA 1SK8A 3G0BA 1YFJA 5JMTA 4GOJA 3JQFA 1USIA 1VZ2A 2WUWE 3DPUA 4G0YA 5ELXA 5L53A 1B0ZA 3SSOA 1V5FA 2ON6A 1UWLA 1GQSA 4P22A 4RNCA 5IJ9A 1SUDA 5EP4A 5TEVA 4U02A 1QYVA 3LWBA 3UPUA 4JI6B 2GBPA 5IXYA 2FF7A 2EKBA 1RXEA 2PUWA 3FD8A 4RDHA 1TU0A 2ZJBA 4RWZA 2BEKA 2OM6A 4B5LA 1PUXA 5KZMB 1AU9A 1Z33A 3O21A 3OEED 4EW6A 1HA3A 2Y8EA 2C07A 1TDJA 2WUVA 5FA8A 2VRWA 2ZG6A 5IASA 3RRJA 4LK3A 3FJYA 1E9VA 1JXQA 1KYQA 1KA9H 4G23A 4TOIA 1HT1E 1UBTS 4N6OA 2N1BA 3CVXA 2BRUA 3O1HB 1KEPA 3PC6A 3HDVA 4RAQA 2GNOA 4BVBA 1P72A 5DI3A 3LF1A 1AQUA 4A8JA 4YRIA 1PFWA 2YXPX 3EULA 4M4SA 3PWSA 1HQDA 1XNJA 2FSUA 4JSRA 4EBBA 4IY1A 4MMYB 2VHEA 4UUAA 5K20A 4M83A 4BO8A 2CXOA 3UENA 4W8OA 3HB1A 4C05A 3QITA 1K7CA 2F9MA 3PQCA 4DDMA 3KAPA 4ND2A 4ILKA 4OSPA 5FHQA 3JSAA 5JAZA 3W5CA 4ZTZB 4R71A 5GPBA 1OZAA 3R7AA 3UJNA 5GAJA 2AZ4A 3COZA 5AR1A 4DR3B 3U44B 3D8RA 4TYYA 2GHRA 1RWXA 5DEOA 3CMCO 3VQTA 2RHBA 1G6KA 4MEBA 2E0IA 2X1VA 3UA4A 4FMBB 4B46A 1R00A 1BA2A 1PG5A 1VPTA 1IUNA 1PJSA 1XCGB 2AMJA 3NVDA 4COKA 4D8UA 2V8BA 4WIAA 3KDPA 5DISB 3T3DA 1IHUA 3L7KA 4OJKA 1YDFA 4TVSA 1OREA 3OLXA 4ESOA 1G55A 2GPAA 4ZO9A 1JA1A 3IEPA 3NNNA 3WWEA 2I4IA 1G6OA 3H2JA 3AWIA 4CG3A 2O2HA 4PHHA 4F92B 4B31A 1Y1PA 4Y1RA 4BASA 1RYFA 1KDYA 1N7JA 3FFXA 4JUCA 3FBTA 2VSQA 3O74A 4LZLA 3VU9A 1ZJJA 3AKEA 5EE1A 5CG1A 3N86A 4QNNA 1KDRA 3THWB 1CQPA 2YYYA 2QZSA 3OIWA 4OOFA 3OF3A 2O1WA 3BBLA 3V6MA 4KGDA 2AUTA 2WBLC 1VIDA 4KXUA 4ZJPA 2UVQA 3UHFA 4AQ7A 3AERA 1CX9B 2VZLA 4KVGA 4K6HA 4QUJA 1FFCA 1WXIA 4IVNA 3GJZA 4B81A 4WK4B 1WP4A 2J3MA 2ZR9A 1KSFX 2HYIC 2QXYA 1QVRA 3OUUA 4UVGA 4XB2A 1JA9A 4OXNA 2GFIA 4DMKA 1KY4A 3BTUA 4BO9A 2DY1A 4DSOA 2ZB3A 2XRYA 3AUFA 1VHDA 4I7EA 2V54A 4YYZA 1M72A 2O0JA 4EG7A 4RZQA 3AUJB 2EBFX 2GD0A 4QELA 1TMKA 3QI7A 1MJGM 3AL2A 3BD6A 4XIYA 5HKKA 3W0LB 2MSWA 5IHXA 3KJIA 1RXCA 3OQOA 1C41A 3LRXA 4K87A 2FLKA 3SFTA 2WFMA 4JBIA 2HLNA 1SB9A 2NV0A 3LW7A 1PT6A 2YKGA 3BRSA 5DN6A 1ZUIA 3HV0A 3OJLA 3QVUA 5K4GA 3EDRA 3WGUA 4IXWA 1PHPA 1JT9A 4MR8B 4LECA 3LK7A 4K7JA 2BUCA 1N6HA 3QFHA 4II3A 4CM7A 3JQBA 5AHKA 2Q3HA 1U5BB 4LX8A 3A6LA 3RVJA 3IQZA 3WS7A 3I28A 1S01A 2ZXUA 2FJPA 3EN0A 2QUAA 1Z7EA 3CCFA 3INRA 2PAAA 3JZAA 1T8PA 3HDHA 4QOIA 4UE6A 1KKLA 3FYUA 4PNEA 4IGFA 1NN0A 2D1QA 2I34A 3VV2A 2BEJA 1T5HX 5HSGA 1OX4B 4P4NA 1C0PA 2I2FA 1GNTA 1ES9A 5A02A 1FTQA 1JEQA 4PRLA 1I6WA 2REQA 5H82A 3OE1A 4ASUD 3ZIUA 4O0MA 3UOGA 1WDTA 1KY3A 2W90A 3DEZA 4RPJA 5ALMA 4ALNA 1WXDA 3KRTA 1USWA 4HQLA 4O4HB 4BFXA 4ZI2A 4I50A 3UHOA 3LRTA 4XLLA 5DHUA 4CM9A 5JNUA 3FIUA 1HE3A 4LDNA 3MCZA 3U6KA 1OLSB 4EHAA 5EXXA 1T26A 5TS2A 2ORVA 3MJHA 4GKBA 2VFAA 3PUIA 3I6QA 2O6LA 3MJCA 4GECA 4TM8A 3K6SA 3DNPA 4NNJA 2VHTA 3CW9A 2QN2A 4FZJA 1HKUA 3PRKE 4RZ2A 2NZYA 3U2QA 3ILXA 1RI2A 3C7TA 4AG3A 1Q1EA 4EJSC 1FVHA 1IE3A 1Z4PX 1PYOA 4RF2A 3KJQA 2P6RA 4NJOA 1ZR2A 1P17A 1KY2A 1MB3A 2VHXA 2G08A 1EGHA 1SQ0A 1L5HB 3URMA 3H17A 1DO2A 3CX8A 1K7YA 2Y0PA 4BB0A 5B6IA 3FHOA 3TTWA 2FU5C 3BILA 5ELLA 5J4VA 3OPNA 3HDYA 3L84A 2IZ6A 5G4KA 1J24A 4ZO6A 3D9QX 1X9GA 1JDPA 3D4IA 4G67A 1XWFA 2BUBA 3JVDA 4QDOA 1SQFA 2I03A 3OCCA 1ZCJA 1GKKA 2DWCA 1JE1A 2KLBA 1U6JA 3AUXA 5JT1A 4G8JA 3PE3A 4WECA 2ZUEA 3B20A 5EPEA 1XWIA 4J2OA 4RK1A 2G09A 5C2JB 1J2TA 5KX5B 3A6GA 5AESA 4PNPA 2B1IA 1GU1A 5DYWA 2CN1A 2PJDA 3WGZA 3P9QA 1CUAA 1EUDA 1AK1A 3S3TA 4ACBA 2HTEA 3M6FA 4LXQA 1T2FA 2XUKA 3EF3A 1M1ZA 3AUSA 3JZFA 1S4QA 3FF1A 4G0MA 1FU7A 4L5YA 1J8MF 1PKEA 1PZHA 4I14A 2H1HA 3WADA 2XVMA 2BEUA 3QX8A 1WBBA 1NE2A 3FYSA 5L8VA 3AVUA 4ZCRA 5F9FA 5ALGA 2YMPA 3HG7A 3KSDO 5SY4A 1JEJA 3MS2A 2XCRB 1L7MA 3FX2A 4WMLA 2E5FA 3AKCA 4I5GA 4ZARA 1JI3A 1PT5A 1VCNA 4J0JA 3ROQA 1SKYB 4AAYA 3HU2A 4RJKA 2P8SA 1PTJA 4ZAXA 4KMSA 1H8EA 5BQPA 1WTCA 2A5GA 3DFKA 3K1ZA 3P9IA 5D2CA 4MR7B 3A05A 4R1PA 4N18A 1QJCA 3R74A 1LI7A 2OD7A 1AV6A 1AGNA 3VSEA 3H2IA 3AVPA 1W581 2BY4A 2JKVA 3BREA 2Y99A 3LY7A 4S1NA 4CMIA 1RKVA 2YTZA 3D3NA 4NOKA 3QUBA 1EFRA 2NLOA 5C3UA 4ETWA 1Z83A 5JANA 1XZDA 3K30A 2OMKA 2IU4A 1G20A 5LKAA 1Z8HA 3FOCA 3O9MA 1ZH2A 3MEQA 4OAOA 5BSWA 2GK6A 2JAOA 5BYJA 1M8PA 3R3JA 1FSSA 4FFMA 3A1CA 4M86A 3JAWB 2AWOA 2WD9A 3QLEA 5KKNB 2JD2A 5ALZA 1XJQA 1VE5A 4KZKA 3AXSA 4QJBA 1YU9A 4IFBA 4FN4A 1CE8B 4UPDA 3ZVRA 3T06B 3SBDA 4JV5B 1U0SY 4FP9A 2E4YA 4ZKDA 3K9NA 1JLSA 1YE3A 4DGQA 3TZQA 2QNBA 1G5PA 3L0IB 1MB4A 1M34B 4J0IA 2BGGA 3DKPA 4KO8A 1WMSA 5DOVA 1CW2B 3E2PA 3LWDA 2QY9A 3L7LA 3JQDA 2JH3A 4WBNA 1X7WB 6GPBA 4LHZA 2QM3A 2E48A 2IQIA 2O48X 1N6KA 4LC1A 1GCGA 2BGUA 3L7OA 4KN9S 3W9UA 5KDLA 3GPDG 2FSSA 1U2QA 2M9MA 1E6UA 2QVBA 2TYSB 3EVZA 4RQBA 1VL1A 1E2DA 5DNAA 4W5TA 3VDXA 1F8FA 4OFBA 4I1SA 1KO7A 3KX2A 2P67A 4ILEA 4MAAA 1M9NA 3D31A 1AN0A 2CNLA 5IYZA 3NQ41 4EDHA 1EJBA 1FTWA 3LZ6A 4RCZA 3BRCA 3LQFA 3KIPA 5C9ZA 4NHOA 4DLXA 1NONA 1N7IA 5CDFE 1VA5A 2VHCA 4IIUA 4RTLA 1U11A 2HHCA 5DM0A 4L3WA 1R27A 1MJGA 3WSWA 4D9MA 1TE2A 1QH8A 2QKYA 1OI7A 4K40A 2H2AA 3WQSB 2F4NA 2ZWMA 4BNYA 3NHFA 5E6RA 3WJ1A 4F3NA 1M76A 2ZZNA 1EX6A 1TJYA 3BA6A 3Q3IA 5AKKA 4ZA2A 3WK5A 3M70A 4W6ZA 4E11A 4RMNA 3PE6A 4PQEA 4QBHA 4H17A 4RHEA 4UCQA 3HH8A 2FZLA 4Q3KA 3ONWA 1RKUA 3HKEB 3P0RA 4JNCA 3E70C 1PJZA 4MPTA 4N0QA 1CC1S 4FUQA 4HDKB 2O7NA 4KQ9A 3WMFA 3JARB 4XPZA 2R5NA 4MLDA 4OFZA 2MYPA 3H1AA 4IW3B 5EJ5A 2Z98A 2A1UA 1P2GA 3VH4A 5BN3B 1IDOA 1V7PC 4JLOA 2YYAA 5DNWA 4LVNA 1LTQA 1MAWA 1JE0A 3U6BA 3KHKA 8MHTA 5CVTA 1KZ4A 1UPUA 4KQ1A 2WMDA 4KLNA 5DLQC 3OCXA 1L5NA 5KVAA 1TIPA 4QU9A 4LQLA 4DLNA 1GEGA 4Z3DA 1RM5A 4M37A 1D1TA 4H9GA 2CWWA 4B3HA 3HLYA 2AE1A 1KVSA 1OXXK 1FP1D 1L0BA 4D4KA 2BKLA 4MCAA 5EY5B 1LPBB 1Z39A 3B1XA 3ZGXA 1XCMA 5K3BA 4UQLA 3EBPA 2IEBA 4LSWA 2WSYB 1UM8A 3KOOA 4NATA 4EB6B 2QJWA 2FYTA 5B1YA 1RLJA 1ZIPA 1F17A 5ECDA 3MOIA 1A5AB 1P6UA 3A3YA 3SOPA 4YTEA 3UW3A 2AHOA 4CKBB 2W2NA 3V7UA 3VA7A 3L18A 1UP6A 3G79A 1WCV1 3LXXA 5K3CA 3ZQJA 4J16C 4ENUA 4YBZA 1Q74A 3EGOA 1JV2B 4AD8A 1F8YA 1GARA 2NU6A 2EFDB 4FEGA 1K4KA 4TSKA 4DQXA 5EG5A 4JYZA 4FQ8A 4WZBE 4XD2A 3EZ6A 1L4KA 2XJ9A 3M83A 4OA5A 1SA0B 4P9NA 4E46A 1VL5A 3D8UA 3WRVA 4MYHA 4QLOA 2XW6A 1P33A 3CO0S 4JVNA 4LMRA 3GJYA 2GJ4A 4HUQB 4JP1A 2IUEA 3TL6A 1WG8A 2Q50A 3V8RA 1YHZA 3JQ9A 3ZNQA 3LLMA 2RC5A 4H4DA 6ABPA 1LDGA 2QTNA 3GLQA 3L4EA 3Q0TA 5BQOA 1QG0A 3VPFA 1BE1A 2R66A 4Q66C 4JOBA 1U90A 4YUZA 1E1YA 1JJ7A 1X19A 3IKVA 3WAKA 7REQB 3K8YA 1XUOA 4FT4A 4WZAE 1BC5A 2FVXA 2AKAB 4YLGA 1Z62A 2IBSA 2VKQA 2F3QA 4EFKA 3KAJA 4EPVA 5AW0A 2GAAA 2IGBA 1FNBA 2OILA 2Q1SA 4N1AA 1KVTA 2O05A 2ODQA 4MW4A 2JGMA 3CKLA 3S2SA 4BKOA 4M0CA 3AR9A 4WQMA 2EZ9A 2ZSJA 1N78A 4N9QA 2OV3A 1SKYE 3WYBA 3ZWYA 2O23A 4NXNB 2QR2A 4B2LA 4D3XA 4MWZA 1AQYA 2CJWA 1WULS 1Z6QA 3NASA 4Q3CA 3S8MA 4RIHA 1JKMA 1D8TA 3NGXA 5DU2A 4PPGA 4DANA 1U8CB 1FA9A 1E4YA 2GZAA 4MWDA 1G5QA 4XDZA 4YRTA 1VBFA 1Q7BA 1NW5A 3TQTA 1SQ5A 2MR5A 1QNFA 5H3CA 5C1IA 2EX0A 1ZN8A 2R96A 1E60A 1XLUA 4IGEA 4RZIA 5AXAA 2RHWA 5KYYB 1T2EA 3ETDA 1KI6B 3H1FA 3EFOA 4YAFA 4B47A 3SVZA 4X6YA 1SG9A 1Q0RA 1IQRA 1EFCA 3P20A 2WWXA 3S2ZA 5T7BA 3L82B 4Q03A 4BYMA 1K5PA 3D1JA 4P98A 5FOTA 1RMTA 3FDFA 2IT1A 2PWBA 3NT2A 3W9BA 4QYIB 3WLPA 4CHGA 1Q14A 4XYBA 3QU5A 3A1FA 3I01A 1FQKA 4AZ0B 1Q7GA 3AEXA 4LOKA 1NURA 4C3VA 3SQWA 5EXEA 5IABA 2AF4C 1KF0A 3R3VA 4KWIA 1ULBA 5HE8A 2GM4A 3DR3A 2ZRCA 3T95A 4GBMA 4R1LA 2EEZA 3F8WA 2AVNA 3UKOA 1DIBA 2VT6A 5FXMA 1EFAA 4MWTA 1UBRS 2J0EA 2QL7A 5K3AA 1SKQA 2QMEA 1MDBA 1WM1A 3VYWA 1T3GA 1L2TA 3F1LA 3SKYA 3NBKA 1KI2A 4DHEA 4GU5A 3DZDA 4ND1A 1BVRA 1PLLA 2OFWA 1D07A 1SVWA 4URHA 1QH1A 3ZY3A 1LLQA 1VSVA 1HFWA 4D4LA 1PDVA 4M1WA 4O5OA 1LBQA 3HUUA 2CWDA 1WLSA 3KQUA 1XTZA 2YC4C 1TCUA 4BRZA 5GJVC 2NVUA 5AXDA 4D4IA 3THWA 1U0RA 3O3OB 2AEMA 5KOIA 2GOYA 2HPZA 9MHTA 3CNEA 3P9XA 4RA9B 1XC7A 4RYDA 4KQ6A 3I04A 4YCSA 3R6GA 4EENA 3FKJA 1F5SA 4UPEA 2X4GA 2EYUA 4R1QA 1FDRA 1GU7A 1OWOA 2IQ5A 3L04A 4HN2A 2ID8A 2PKXA 2VR1A 5AXCA 3WX0A 4XI9A 1T6BY 4UFNA 4LWZA 1IY1A 1GPMA 1YHYA 2W6QA 4ND8A 4LY9A 4NECA 3CFYA 5BVHB 1N57A 2M6RA 4ZEOA 5DX8A 2AJTA 1VMEA 1NA5A 4I4IA 7YASA 3VAYA 1GA1A 4ZQHA 2OLEA