5K03A

Crystal structure of comt in complex with 2,6-dimethyl-3-(1h-pyrazol-3-yl)imidazo[1,2-a]pyridine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
214
structure length
214
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 78
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k03A00
4BY9E 1F38A 4LWPA 3L8DA 1EJ0A 3KQSA 3C6MA 4YUVA 2PT6A 3KR9A 9MHTA 3NW9A 1XCJA 3G2PA 2ADMA 4OX9Y 2A14A 2UYHA 2IDKA 3B3FA 1G6Q1 2ZZNA 2FCAA 3HCBA 5DX8A 4B17A 3TKYA 2IH5A 1R8YA 4QDKA 3LPMA 3F4KA 3NVKI 3KU1A 2VZ9A 3QV2A 1KIAA 2C7RA 3MHTA 2R6ZA 1RJDA 2WK1A 1FPQA 3FUUA 3HCDA 3UJBA 3M70A 4H0NA 1XDUA 3IHTA 4A6DA 4EMSA 3ER8A 2XVMA 3NWEA 4YV1A 5BP7A 1QAQA 5LSAA 4MIKA 4HRAA 4DQ0A 3M6UA 4OBWA 2ZZMA 5HIKA 1QAOA 2G1PA 5EPEA 4RVFA 3RIEA 2YX1A 5DRYA 5ERGB 1VPTA 2PBFA 4PIMA 5DM0A 3BKWA 5C0OE 4DZRA 1VL5A 5ICEA 2C7OA 2JHAA 4PIPA 5C9ZA 3LCCA 2GLUA 3CC8A 4XUDA 5EG5A 5F2OA 1G38A 3PLAE 1XTPA 4EKIA 1I9GA 3PFGA 1YZ3A 3IEIA 2EG5A 3O4FA 3G2OA 1INLA 2ZSUA 1JG4A 5FCDA 2OB1A 2P7IA 3NTVA 3KR0A 1YFJA 2OB2A 3DLIA 1JG3A 4RTJA 2BZGA 3I9FA 4YUZA 2GPYA 2NXNA 4DKJA 2GA9A 4CKBA 1JSXA 1JTFA 2YQZA 4RTPA 5FA5A 2HR1A 1EQAA 5GIOE 2CMHA 1N7IA 5U4XA 3UJ8A 2QY6A 2V7EA 3A25A 4RYLA 2CWWA 3HEMA 1RJFA 3R0QA 5CVVA 2VDUE 3FTCA 4AX8A 10MHA 2I6GA 5F2KA 4RTSA 4M7RA 2PX2A 2G72A 3MTEA 3CGGA 2G70A 2BM8A 5DXAA 5HZMA 3B7PA 3KQMA 1YZHA 3O31A 5F2NA 4RTMA 4QPNA 5CVDA 3B5IA 2H00A 3ANXA 4X41A 1SUIA 4O29A 2Z6AA 2I7CA 2ZBQA 5EVJA 3HM2A 1YB2A 5EMMA 2XVAA 3EGEA 1NW8A 3TKAA 3GWZA 4EVIA 2Y1WA 1VQ1A 3G2MA 3OFJA 3A26A 5FULA 5DPMA 1R00A 1X19A 1L3IA 2YXLA 1HMYA 1EIZA 3FPJA 3FTFA 1TW3A 3BWBA 2PKWA 3CBGA 4RWZA 4CXMA 3PT9A 2PXCA 2ZIGA 1KHHA 1AF7A 4PCLA 5H02A 4L7VA 2ZTHA 3G8BA 5FUBA 1SVUA 3FTEA 3OCJA 2EJUA 2ZLBA 3LX6A 3REOA 3RW9A 3THSA 2B3TA 3UA4A 5CD1A 2QRVB 2EJTA 3DTNA 3AJDA 1H1DA 4Y2HA 3EMBA 3QOWA 5E8RA 3DXXA 3HP7A 4DCGA 4EK9A 1QZZA 2N47A 2UYCA 1FP2A 2P40A 5FTWA 1ZG3A 3KR2A 3B3GA 3S68A 3UA3A 3SSOA 2ZFUA 2BM9A 5KS2A 1M6EX 5K09A 1IXKA 3DMGA 1MJFA 4XCXA 3WSTA 5KQRA 1O9HA 3GU3A 1BHJA 3KKZA 4F84A 5DLYA 3VC1A 3K0BA 2P3QA 3P2KA 3A4TA 5DTRA 3EVGA 5FHRA 2XYRA 2Y1XA 5DM2A 2PWPA 1L3BA 5EHGA 3C3YA 3DXYA 4YV2A 5DM1A 4IKPA 3VYWA 4GQBA 3KQVA 2PLWA 4PYOA 1WY7A 3I64A 3FRHA 4E33A 1ZQ9A 3EVCA 3HA3A 4MWZA 3BUSA 4XUEA 5LQKA 4OA5A 2C7QA 3HCCA 1VIDA 3ELUA 2P1DA 4DM3A 2FPOA 5KQSA 1VE3A 3GGDA 5FA8A 2PGXA 4KDRA 4CTJA 2Z6QA 5DM4A 3BXOA 5E8JA 3V97A 2Q41A 2PSSA 4C03A 3I58A 2YXEA 3FYCA 3KQYA 2IGTA 4HG2A 2AN4A 2ZWVA 3X0DA 3MAGA 3TM4A 1I4WA 2NYUA 2UYQA 4GBED 2JH8A 4OA8A 1R18A 1QYRA 2NP7A 3EVBA 5EHIA 1V39A 3THRA 2KW5A 5K03A 5GM1A 5EC8A 4E70A 3HCAA 3H2BA 1QAMA 2AN5A 1JQEA 4DMGA 7MHTA 3GCZA 2FHPA 4PYKA 2JH9A 3P9IA 2WA2A 3KQOA 1BOOA 3TOSA 4C04A 5K8VA 1JTEA 3NDJA 3NJRA 2Z6UA 3MB5A 3EVZA 3OFKA 3DXZA 2PX4A 5K0LA 5T64A 5FADA 3OZSA 2CMGA 4G56A 2OY0A 5HIJA 3TPZA 4RTNA 5EEGA 5CIYA 2YTZA 3LKZA 3UBTA 1XDSA 2ONYA 5K0EA 1WXWA 3KPWA 3EVFA 2AS0A 3E7PA 1JQDA 4P7GA 4WXHA 1KPIA 2NXEA 4R6WA 5T67A 3KR1A 2HMYB 4UOEA 3KHKA 4FSDA 4E30A 4QTTB 4E2YA 2FYTA 3LDUA 3AXTA 4BLUA 4ATNA 3PS9A 4IV0A 3QOXA 3FYDA 3NMUF 1AQJA 2IH2A 2ONZA 3E23A 1P39A 1XDZA 3G8AA 3EVEA 3A7EA 3HVJA 3BZBA 2PVCA 2QRVA 2ERCA 3LBYA 4KRGA 5GOZA 2P7HA 4Y30A 8MHTA 2IDJA 1KPGA 3PX2A 2HTEA 2PX5A 1ZGJA 3CVOA 4E32A 1Y8CA 1L1EA 1KYWA 3HA5A 1YF3A 1MHTA 5EOVA 2O06A 2PXXA 5EMJA 1TW2A 5KYGA 5FWAA 1DUSA 3SM3A 3IV6A 3G2QA 2GAFA 2IBSA 3G5LA 5E9JA 5EIWA 3TR6A 3FPHA 3M6WA 2GS9A 1L3CA 5E2AA 1T43A 4LECA 3EEYA 5FQNA 4RTKA 1Q0TA 1RJGA 4F85A 4YMHA 1X1BA 1WG8A 2V74B 3LKDA 3C6KA 5IKMA 1DCTA 1RI3A 1PJZA 4PYMA 4FR0A 1UFKA 1R8XA 3LHDA 3SVZA 5GM2A 4E31A 1O54A 3ERCA 4KIGA 2GH1A 4HGYA 3LGAA 4FP9A 5CVUA 2I9KA 3P8ZA 3G88A 5E1BA 2AN3A 4FSXA 5LQCA 1P1CA 3T7SA 3DOUA 4RV9A 4FT2A 2AVDA 2P41A 1RI1A 3KPUA 3BKXA 4KIFA 2I62A 4PYIA 4X63A 3AWIA 4RTQA 2ORED 2P8JA 3C0KA 5HFJA 5EZQA 4PONA 2QM3A 1UIRA 2AOUB 3B89A 5BW4A 4OBXA 5GINE 3OPNA 1NKVA 5EEHA 5K0GA 4R05A 2NXJA 2BR3A 1VP3A 2YXDA 3GRRA 1ZGAA 3BGDA 2BR4A 1U2ZA 4KW7A 4M37A 1NE2A 2FRXA 3TM5A 3MGGA 5ICCA 3JWIA 1O9GA 2K4MA 4QVGA 4R8RA 3KQPA 4X60A 1ZKDA 1M0EA 4ER7A 3BT7A 3SSMA 1NV9A 4YUXA 3ORHA 2UYOA 1OR8A 4PYJA 2UZ4A 5E1OA 2B2CA 4QTUB 3UJCA 5LQUA 1PRYA 3BWMA 3T0IA 3OZRA 3T7RA 1B42A 1WXXA 2XYVA 2E5WA 3FPFA 1BC5A 4MQ4A 1FJXA 2ZBPA 2ZVJA 4RVHA 2EFJA 1EG2A 3TRKA 4AZTA 1D2GA 1FBNA 4GOLD 5T6BA 5HOQA 3ELDA 4JXJA 1R74A 5G02A 1NW5A 2QYOA 2C7PA 4DCMA 4PWYA 4E2XA 2AOVA 5DTQA 3KPJA 3C3PA 5IH3A 3TFWA 4OQDA 4P7JA 4GUAA 3P9CA 4EKGA 1RJEA 3EVAA 4YMGA 1AQIA 2PT9A 3DULA 4CTKA 4GC5A 1VLMA 4LG1A 4AUKA 4E2WA 1KP9A 2AOTB 2DPMA 2H11A 1R6AA 2ZIFA 2JHCA 3M4XA 5DX0A 4GOND 4HTFB 5DTMA 3MCTA 4PINA 5ICFA 4PCAA 1G8SA 3CKKA 5E9QA 5JR3A 3GRUA 3O7WA 3KPVA 4P7FA 5K05A 3NWBA 4ER0A 1NW6A 3ELWA 4LWOA 5E1MA 4XUCA 2XYQA 1KXZA 3DMHA 1D2HA 5DT2A 5EGSA 3P9KA 3R3HA 5KVAA 3FZGA 3DMFA 3OE5A 4P58A 1NT2A 3GO4A 5E9WA 2AVNA 3SXJA 1XCLA 3GRVA 3PFHA 4ER6A 2IH4A 5CCXA 3FTDA 3LCUA 3MCZA 3OU6A 4FGZA 4IWNA 4DA4A 2ZULA 4ZTBA 1WZNA 3PTAA 2PXAA 3HA7A 4DF3A 1RI5A 5GWXA 2B9EA 4PGGA 2O07A 2VDVE 2OYRA 2G8NA 5DWQA 2YVLA 3EPPA 3KPYA 2JG3A 3R9XB 3LECA 5K0NA 1X1CA 2EX4A 2IIPA 3ELYA 2HWKA 4WVLA 5P8WA 2VP3A 4MTLA 3DH0A 3LCVB 5BW5A 5LQNA 2AOUA 3FRIA 3MERA 5D1NA 1QANA 4RTRA 1ORHA 4BP3A 2NXCA 3B3JA 2IBTA 1L9KA 1NW7A 3D2LA 1Z3CA 2JHPA 4NECA 3M6VA 3M33A 2VDWA 2OXTA 4C4AA 4YUYA 4RX1A 1XVAA 3CJQA 1VBFA 4HH4A 5CVEA 1FP1D 2H1RA 1N7JA 3P97A 3JWJA 3Q87B 3KQQA 1JR4A 3UJ7A 4C06A 4RTLA 1VP9A 1AV6A 2NP6A 2AOXA 4F86A 1X1AA 2WA1A 3I5UA 3PX3A 5DX1A 3ME5A 3SSNA 4PYNA 5EZSA 3BGVA 2P3OA 2PV0A 4KDCA 4PNEA 4P7KA 3G89A 2AOWA 4U7PB 3OE4A 1G60A 4HSGA 1IY9A 3JWGA 4PGHA 1XXLA 2VS1A 4QQKA 5E1DA 4C07A 2F8LA 2PY6A 1KR5A 3GXOA 3OZTA 5LR6A 3BWCA 3P71T 4RSRA 3DLCA 2G71A 3LL7A 3TLJA 2AR0A 3E8SA 5B1SA 3UJDA 1JQ3A 3HVHA 4AZSA 3AXSA 4YV0A 5GIPE 4AZVA 1SUSA 1ZHFA 3A27A 1EJ6A 3LBFA 4GEKA 3HCEA 4ER5A 4RTOA 5DRTA 3FUTA 1SKMA 3FPGA 4X61A 3AY0A 2CL5A 3R24A 2AOTA 5HIIA 4HTFA 2O57A 1EAMA 3LSTA 4FS8A 4OQEA 5K0JA 2BH2A 3K6RA 2ZZKA 2IPXA 4GC9A 1RI2A 2O0LA 5GP1A 3T7TA 3TQSA 2ZW9A 5CVJA 5JUWA 3UJ9A 2BR5A 2B78A 4R6XA 5CCBA 5EIFA 3SX0A 4R8SA 4BLVA 2OBFA 1KYZA 2HNKA 3OU7A 1G8AA 3KQTA 3JWHA 4CKEA 3A7DA 4K6MA 1WS6A 4PYLA 3CJTA 1M6YA 4U7TB 5EMKA 3CCFA 3R6TA 1HNNA 3HVIA 5FHQA 1NV8A 1XJ5A 5FWDA 2YUIA 5HILA 4C08A 2PWYA 3BWYA 1RI4A 4CKCA 1UWVA 3ER9A 5HIMA 1X1DA 1ORIA 2O05A 4FZVA 1IM8A 2FK8A 4GOMD 3UJAA 2PJDA 3GRZA 4C05A 1JG1A 4PYQA 5EKXA 2AZTA 2OO3A 2HV9A 2YR0A 4V0RA 5D1HA 5E2BA 3UFBA 2NNWB 3HTXA 3EGVA 3EVDA 3HCFA 2OPBA 3GJYA 4ISCA 5K0CA 5CUQA 3EGIA 5EQJB 3UJ6A 4RVDA 5K0BA 2B25A 4RVGA 2P35A 2CKDA 5FQOA 3EEOA 1P1BA 3MTIA 5MHTA 3VC2A 1SG9A 2DULA 2R3SA 4E2ZA 5K01A 2OKCA 1F3LA 3G5TA 3GDHA 1D2CA 3FUVA 5LQJA 3U81A 4QVKA 5DXJA 4IV8A 4CWAA 3FUWA 5K0FA 4EQZA 4MHTA 1NBIA 2IP2A 3M6XA 1YFLA 3HNRA 2LD4A 2ZIEA 3I53A 3G7UA 5BXYA 4M38A 3NVMB 3V8VA 2IFTA 3P2IA 3HVKA 4KWCA 1YUBA 3P9NA 1JSZA 3DP7A 3PVCA 2PX8A 5EKUA 4Z2YA 3GIWA 4X1OA 2JJQA 3KQWA 5HEKA 4QPPA 1NW3A 3FUXA 3NDIA 4FT4A 4GOOD 3P2EA 4HGZA 4AZWA 3LDFA 5DSTA 5EMLA 3RODA 4POOA 3ID6C 3MQ2A 5DSXA 1BKYA 3E05A 1NBHA 5LQRA 4ER3A 5ICGA 2FK7A 3UWPA 3IYLW 1I1NA 1TPYA 4GF5A 4KVZA 3LDGA 3VSEA 1JG2A 4BP1A 1G55A 1Q0SA 4BLWA 4HC4A 2GB4A 2ZWAA 1SQGA 3Q7EA 3SR4A 2ZCJA 4QDJA 3PB3A 1N2XA 3BGIA 3UZUA 2ZBRA 3DR5A 2ESRA 3EMDA 3OU2A 4M36A 3DUWA 2OZVA 5CM2Z 5C1IA 3TMAA 4YUWA 3SGLA 1SQFA 3CJRA 1KPHA 3SMQA 2QE6A 2P3LA 2XBMA 4A6EA 1DL5A 3GRYA 1P91A 4QQNA 5M5BA 4V0QA 3FPEA 3GNLA 5LQAA
chains in the Genus database with same CATH superfamily
2X9LA 2Q5CA 1KO1A 2JFOA 1AUOA 2RMKA 3LOPA 2HLHA 3U6BA 1SXJE 1CY4A 1V7QA 1RW4A 1AS3A 1FP7A 2QPLA 3MGBA 4GYJA 2A4MA 2EIXA 4MWCA 4RIFA 3R9KA 3VKGA 2Q7XA 2VBFA 3EQZA 1M1XB 1WCIA 1PR3A 1WULS 4J3FA 4KLRA 5U1PA 3LT2A 5F7ZA 4Y2SA 2X8AA 5AK3A 2QGFA 5GY7A 1H66A 4KQ1A 5IAKA 4UTVA 1E98A 3HCDA 4N0DA 3M70A 3T94A 1UK7A 2YWCA 3SQLA 1G3UA 1UFQA 4YV1A 1WF3A 1L5NA 4UDOA 4YI5A 4W5QA 4DSAA 1MXHA 1EZZA 1T5LA 5ALKA 4UVDA 1PJAA 3H5IA 3U61B 1NC3A 1YU6A 2J1LA 3GQBA 1I4DD 3AHCA 3LIPA 2DFDA 5KTRA 4G0OA 4Y0VA 1Z2EA 5CH3A 4A0QA 5C9ZA 3RC2A 3ADOA 5T6MA 5H8WA 2ZXEA 1OH7A 1X8XA 3VO2A 2M2IA 1H22A 1RPAA 3S5UA 1S1CA 3VX4A 4EG1A 3L1JA 1PWHA 1BKSB 5ALPA 3WRWA 2YHIA 1MB2A 4EEXA 1UBHS 2R6GA 3VI3B 3LRTA 1JU4A 2PH3A 3DONA 3WC4A 1WHSB 5BSKA 1G63A 3PWSA 4G1FA 1OT3A 1N2SA 1U6IA 5ES4B 5H3HA 3PHHA 1KZ1A 3NHZA 4P2GA 1WW2A 4L78A 3OAAD 4WK0B 3H1FA 4HDSB 4B81A 2BUAA 4BMOB 3BFXA 3CVYA 3THXA 5C34B 5DLPA 2IV2X 3MWJA 4RYDA 3IODA 1PU2A 4TMWA 2BJWA 1BHQ1 2QY6A 3K20A 2FH5B 3PL1A 4Q9IA 2HHLA 5JCJA 2XODA 3ZBQA 1ZD4A 2GHRA 2NZUG 1QV6A 3KS9A 4M87A 2HBRA 2MIIA 3S8MA 3Q3HA 2HPHA 2QUBA 2Y2UA 4QBHA 2IIVA 2MSDB 3U7QA 2N3ZA 4Z4QA 2J6CA 3LT1A 2POCA 1KK2A 5AHOA 2AD1A 1VE7A 1UUFA 2EEPA 1E4YA 3C3BA 3D2BA 2F6RA 2OD7A 1ZINA 3OQVA 4H59A 4WK4B 4XGIA 5FRDA 3T15A 3EUEA 1MCZA 4CMGA 4I1RA 1PJ8A 3QOYA 1IB0A 4KOAA 1T9CA 1QUEA 4BQQA 4EY7A 1T36A 1X0VA 2NPOA 3K0AB 3T52A 3OFJA 4LXXA 1NF3A 1ADCA 2E4VA 3ET5A 1WSBA 1JKJB 1R88A 2E37A 3FNBA 2EQ5A 4OHXA 4OU4A 5M29A 3CBGA 3ZJ5A 3NOVA 2YZMA 3AUSA 3JQCA 4TSFD 2O8NA 4WKOA 4TYQA 3VR2D 4Y1GA 2XT0A 4GYYA 1HYBA 3KT3A 3V2UA 4INJA 4BO7A 2P11A 3A8TA 4EARA 2B3TA 4PX3A 3EARA 2BTQB 4LX8A 4O5OA 1SCUB 3UH0A 3VPSA 4L5BA 3CNEA 3GLHB 4LVCA 3REGA 2BKXA 3HL0A 3ZZMA 1UOQA 4GL4A 3VR1A 5I5EA 4DIOA 3O1HB 4WZBB 2PD4A 3CYFA 5F52A 2HO5A 1G1AA 2REQB 3B3GA 3LCMA 2PM8A 3WRYC 2HCBA 1X38A 1IXKA 4HNQA 4KO3S 3UMGA 5CCEA 2IU0A 3P94A 1AKWA 2SICE 5AW8A 2R7AA 3DE5X 5ESWA 3I04A 3E61A 3ZWKA 4EI2A 2R751 1QQ6A 3A4TA 3LG2A 4FIZA 3A1VA 4L76A 1MGPA 1OXTA 1UBCA 3ABOB 4LXQA 1J0XO 2MTBA 3OEYA 4NQRA 5JYCA 5KNBH 2RH8A 3AV3A 2H2HA 1NRJB 3D7KA 4W8HA 2GPTA 2I4MA 5K6TA 2WT4A 1VKHA 1Q21A 2HV8A 3BCHA 3JQ6A 4DVGA 2PS9A 2YASA 3IEXA 1E2HA 1WHSA 1CDDA 1SU7A 2E21A 2IC5A 2IZ5A 4L3VA 5E8JA 3SBOA 2Z6QA 2Q41A 4J0QA 4LX0A 4ARBA 1MC1A 4LRYA 1VB5A 4PGAA 3MHPA 4F93B 4J16A 2HU7A 5CLFA 2BGKA 2FUG1 2X0JA 3DWGA 4HDSA 2ONJA 5EJEA 1G3MA 3GZJA 2WQ7A 4BO5A 3H11B 2W2KB 1BW9B 3ESCA 1OE0A 1RR6A 1AQYA 4JSYA 4OA8A 4BC0A 4H7DA 3UK7A 3N2EA 1Z6QA 1GTZA 1AK2A 1ZYUA 1BRMA 2O7RA 3NHLA 4E70A 2HXSA 7MHTA 1XD8A 3JQBA 3UUWA 3S44A 3P9IA 1QGDA 4C04A 2XE7A 5KUTA 3IXQA 3O2SB 2E2WA 1VIMA 1DC4A 4CLXA 3AVVA 3W77A 3O9VA 3OFKA 3ENVA 4BGEA 4EHNA 1U7PA 4P3NA 2SKCA 2NU7B 5JCPA 4HCJA 421PA 1ODTC 3K0AA 1P9OA 5JIBA 4PM4A 2VTVA 1DV1A 3FNGA 4Q47A 1KZ4A 5IMBA 3MJHA 1UKEA 1JKJA 5TV2A 2NXEA 1B1CA 1FL9A 1D6NA 2ZJFA 2J0UB 3ND6A 4J1QA 1TQ2A 2Y9MB 4FB5A 4E30A 3U4MA 1N3IA 4RDXA 3D7MA 4JHXA 4BX3A 2QJWA 4QBGB 2BTEA 3GCGA 4IUYA 3AVYA 1UJCA 2QLFA 3L7NA 1AX9A 3MK31 3R0VA 1EIWA 2CV2A 1G19A 1YBVA 1AGYA 3BZBA 3SHFA 2BTQA 2C3OA 2Z9BA 1SCUA 4FQ7A 3TRIA 2COUA 1KPGA 2IDJA 2X8WA 3B82A 1ZGJA 3MMSA 1EX7A 2GM3A 3GLHA 2G5TA 1W5BA 3H5NA 3HA5A 2RHRA 3SS9X 3T34A 3V4VB 4WZBA 2NTVA 5KYGA 4YRQA 2REQA 5CGQB 3UB3A 3W8FA 2I3GA 3ZVLA 1P9LA 4PRLA 1CV2A 5F7JA 5J2UB 3RD5A 3RVSA 2Y2VA 1QYDA 3KVVA 5E2AA 1D4ZA 1I0IA 3VGPA 3EEQA 3OJCA 1XRNA 4RK0A 3CEJA 3FVRA 1TM3E 3MPOA 2O7QA 4A8TA 4ZP1A 3S81A 1UOEA 3SZOA 1DFIA 3N8HA 4TWIA 3TI9A 3ERCA 1T10A 3PUWA 1LJ8A 2FE4A 1CQZA 2I8LA 3L4JA 4U5QA 2FJPA 3TD9A 1G8YA 4N65A 4C4ZA 3NGXA 1LVHA 2ZRMA 5CDFE 1J6UA 2YV3A 1MEEA 3EBLA 4UQPA 4CCSA 3SF0A 1Z62A 3GNSA 1P2BA 4DR3B 3SQXA 2NO1A 4FHFA 1S2MA 4KIFA 4EPYA 4JUIA 2UZ3A 1TTHA 3L6BA 4NMXB 3CH6A 4LF7B 3SMVA 4ZVLA 5JTUA 5HUJA 1V6AA 1SNYA 3HBFA 4GPBA 4CM7A 4GGPA 1HDEA 5BNTA 5BW4A 4OBXA 3TD6A 3PWKA 2IHVA 2QMHA 3OPNA 4RS4A 3GRFA 4ECEA 3GP3A 4PC6A 3H11A 2W2KA 1BW9A 2FETA 3GRRA 3L7CA 3PJDA 4LNAA 4MLZA 1E2MA 1OIWA 5MDHA 2GCNA 2RGYA 1USWA 4D9NA 1KQPA 1W49A 2VA9A 2YCLA 4YA6A 5K8JB 4JXZA 2PHZA 4HMPA 4NZYA 4X60A 1GYPA 1OZHA 4D9IA 1OH6A 3SSMA 1OMOA 4E21A 4C0XA 1CEQA 4N6OA 4DR6B 1E2NA 1K08A 3OZRA 3T7RA 4I5DA 1J8MF 2QLTA 3T0FA 1VL1A 2H08A 5JECA 1Z4OA 3B7GA 4P5PA 1KJ9A 2JI8A 2NU7A 2GCEA 2PTHA 4RJIA 3V4PB 3ZQ4A 3RS2A 1R0WA 1QTIA 3S6JA 1IHXA 1UBRS 3U4IA 3A4MA 3FI0A 4O8CA 3AH8A 1R4ZA 3JZAA 1N1DA 2I71A 2C7BA 2V54A 1KYXA 2JFBA 3A11A 4YRKA 5HOQA 5KWVA 2J0UA 2C7PA 3DMRA 2GN4A 2QN8A 2VNIA 3PRKE 5DHTA 1SVMA 5IKEA 1TQ6A 5LQDA 2VK2A 4GUAA 3EK2A 4RE5A 5AXCA 2XDAA 1GNQA 2O9JA 3ZJYA 1EJ2A 2PCLA 3QPVA 2JFNA 4L4UA 1S2IA 1XQ6A 2E18A 3CHYA 3R3VA 4CMCA 4DDVA 2JRLA 3O3MB 5LXTB 2QR3A 1Z2OX 1XEFA 2QQFA 1RHKA 1US8B 3VPBA 2YJ3A 1ZCJA 5HS6A 1JDBC 1TYEB 1U3FA 3OE7A 2FZVA 3OHSX 4ENPA 3A0UA 3GRUA 4UNNA 4F9GA 1APBA 3PCXA 5K05A 1ISRA 3GBVA 3S7TA 2QU8A 1E1LA 1ST2A 5JDIC 3DZJA 5J2UA 3G3EA 2PS0A 1CUSA 3JYHA 1GQQA 3D8SA 3CH4B 2R5FA 3R0JA 1O5IA 3Q4GA 3R9IA 3WKDA 3A1SA 3IPRA 1HE1C 1ONBA 3WLKX 3D7LA 4L9RA 3RAJA 3TXAA 1QIHA 3QVUA 3F46A 5EWMB 2G9VA 3DLPX 4LJ6A 3JR7A 4DHWA 1QCZA 1CR6A 5EWLB 1L7AA 3TBKA 4R9UC 2RB4A 3OLXA 4IDCA 1N2JA 3CPSA 2DY1A 1EDZA 4M8SA 3KOWA 2A9VA 3TUIC 5C80A 5L4NA 1K5DA 1WX1A 1MBZA 4RQAA 4GR5A 3B2QA 4WZAE 2XITA 5FUWA 1RQPA 2EJCA 4QXPA 4EY8A 2W8BB 1ZI9A 2AYYA 3L0SA 4MJLA 4RELA 4CF7A 3ZV7A 1GGJA 3ETCA 3ANTA 3OLWA 2C9ZA 3KYJB 4FCCA 1GGEA 1OPRA 1X7HA 3C15C 1PR6A 4IZHA 4KPFC 5TIIA 3FRIA 1NXQA 1RT9A 2CCGA 1NP3A 2B4AA 1UADA 3LLUA 1DJQA 2XY4A 1DEXA 5G40A 5FEUA 1QIEA 5LYJF 4YUYA 1GG5A 3QPAA 3QPDA 2PT7A 1OLSB 2H1RA 3ONNA 4K6HA 3RRNA 5DK4A 1RHJA 3KKOA 2V7UA 5AKHA 5B3LA 4ZT4A 4XGRA 5TF4A 2ECPA 3SYTA 5J4VA 3L4KA 1ZJ6A 2J08A 3RJ5A 2XF2A 5JY1A 4BNJA 1SUWA 4G4GA 4ZOLB 1HR0B 3EJWA 3BQMB 1JA0A 3CR3C 3HYTA 2GNPA 2XLCA 2D3TA 3VTZA 4K9NA 1E5DA 2PD6A 4KODA 3U49A 4C3VA 4R9NA 1JDBB 3UAWA 2FQWA 1VLQA 2GSWA 1JIQA 2OQIA 3IILA 3AXSA 1JKXA 1ZRNA 1QOPB 2WV9A 1U65A 3BILA 4L73A 4NV0A 4BB9A 5HJEA 1Z17A 4IS2A 2FWIA 4PLVA 4YR9A 3SIXA 1C7RA 1YDHA 2ANCA 2HYIC 1PDOA 4CFSA 2WMYA 4H3VA 3I92A 3Q7PA 5LXTA 5T57A 5FXMA 4FBGA 5THKA 1US8A 1QWSA 2XQVA 1EAMA 4AP5A 5BNIA 1CY7A 4PZDA 2CJPA 2DBZA 2F2TA 4O4JF 4WXPA 4JS0A 2YMLA 2ZYDA 3OAAA 3CRMA 5DMHA 3TZ6A 5GP1A 5A2GA 1IEXA 4QWWA 4XFDA 5BV8A 1RYBA 1YZGA 4I4TF 2BR5A 3KZ1E 3UAVA 5FAKA 2OG1A 1HG1A 3CM0A 1KYZA 2QP3A 2ZBFA 3I05A 3RI3A 1O6FA 1C7ZA 4XWTA 2H2AA 2OAEA 3IULA 3T7JA 3EFBA 1W1UA 1VRVA 3WK5A 3SNHA 1MORA 5IZCA 1YJ8A 5AJVB 5JY6A 3BXEA 3H9QA 4LDNA 2IXTA 1IN6A 2JGNA 5EWMA 4MAFA 3FFBA 2Y77A 3BBLA 2LVBA 4O63O 5CXSA 1RI4A 3ED1A 5EWLA 1QGOA 4EVSA 3H1AA 4U39A 5ELLA 1EM6A 2A0XA 4FQ8A 4YAKA 3HYCA 1KARA 1J97A 2GCPA 1MB3A 1PVDA 3MLAA 2YFQA 4IFIA 2W8BA 3UFBA 4F60A 1IN8A 3ILXA 4E1VA 1GQYA 4PWZA 1NKSA 5FBHA 2P9YA 4UTOA 2VTEA 5MGBA 2YIDA 1F0KA 1QTRA 3KXIA 4BLTA 3W6ZA 1BQ4A 4TSFA 1FUKA 3H04A 5EQJB 2IT1A 3VR2A 3BHMA 2LPMA 2CKDA 2ROQA 3SEAA 5I7FA 1GAXA 2RI1A 3HUUA 1HDGO 1XCBA 2X7HA 4Y9UA 1RP1A 3H1GA 1OLSA 3PIDA 4R1MA 3UEOA 1TM1E 3T1VA 2XMCA 3GPIA 2BGTA 2XHZA 3B36A 3DJFA 4IV8A 4NYMR 2Z2JA 3SXPA 3LXMA 5IF3A 1KIMA 1LBQA 1RP7A 4TL8A 3FOZA 1NBIA 1D2NA 4B4WA 4BBJA 1XVUA 1DBPA 3LK7A 2FGJA 4ZOLA 4F1WA 1BHSA 1M8JA 2VEDA 2YCBA 2WRZA 1JSZA 3Q41A 2IDMA 3PPYA 4Z2YA 3S1LA 4I3GA 1CJKC 4KN5A 4O8ZA 1KQOA 2XA9A 3J80A 3M34A 2FPSA 3C3MA 1R0YA 4PQFA 3LTNC 2ZIZA 3D6VA 2ZOSA 3PL5A 5D5PA 4XVRA 3DZHA 4ALLA 1ZCZA 4DNXA 4DRXB 1TZ2A 4FFRA 4QT0A 3PQEA 1CYDA 5E4FA 1UFRA 2XTZA 2NZ2A 1BXRB 1TPYA 3M4JA 3WXMA 4KNVA 1JG2A 1W581 3H2JA 4DCJA 5JAPA 1UPTA 5JD4A 2CD7A 3EVTA 1P75A 4UM9D 3TWOA 1UJ2A 3JAWB 5L3ZA 3SIPA 3HYLA 3OQNA 4LF5B 5BRNA 3TQFA 4M8IA 1RLOA 1VYUA 2P9JA 2R2AA 3W8DA 4IFTA 3GJSA 3LPDA 1J8QA 1MDBA 1SQFA 3GCWA 2B8NA 1K97A 1OGIA 2HC9A 3OIUA 3RT1A 2GAOA 2IW1A 1E9FA 3LGSA 5IN5A 3LZCA 4MS3B 3AQIA 4EJFA 1YQUA 3NTUA 4IMIB 4TS3A 5AQ1A 3QFCA 5DBOA 1N6IA 3IE2A 4FX2A 4KACA 3D2CA 3VZSA 2WWXA 1YH3A 2AJLI 4B7ZA 1G64A 2D1TA 4FGLA 5HSGA 4CR7A 2QMOA 5J1TB 5CEJA 3PUHA 3LAWA 4D4IA 1M74A 4EKYA 1MDFA 3H1TA 3F4LA 1RWMA 4G63A 5DX8A 5KQLA 5AM3A 1JSCA 1Z33A 4QM7A 3CN7A 3UMVA 2H1LA 4QYIB 3TLKA 4UFOA 2PZAA 4US0R 4AULA 4LSGA 1GR0A 1JSRA 3D0KA 4FCVA 3FWNA 2PGAA 2WVJA 1DAKA 3COJA 2PT5A 3BB1A 1DADA 3EXG1 4KO4S 3RBVA 3CNQS 4NMMA 3T35A 4B33A 4EGAA 2O5RA 2I03A 4JLPA 4KYVA 3I1YA 4MVXA 4AJPA 1RCUA 5IG2A 1ZIXA 5IFLA 4ML3A 4DQ0A 4OBWA 1LB1B 2GAIA 2F3PA 1ULUA 1A5BB 3EZFA 1SXQA 4S35A 2DC1A 1KR2A 1QFJA 3HADA 3BJEA 4TXHA 4X94A 4K6FA 1J2JA 1LWNA 5ICEA 2JHAA 5CLIA 2C1XA 5JJIA 3WISA 5CLQA 5FFFA 1MFPA 2JDID 3CC8A 1C50A 3A6FA 5H4HA 1D2EA 1LRJA 3DOCA 1S3GA 4RD3A 2RGXA 5I8PA 3GD7A 4UHHA 3RIGA 4P81A 4B3JA 1QQAA 3I76A 2ONCA 1M5UA 2OBYA 2Q2OA 4IIVA 4M9CA 4M1KA 4PPGA 5IVIA 3U3ZA 4AL4A 3KQNA 2IIBA 2JAQA 3ENQA 4LDAA 3KKQA 1WWKA 3EDCA 4IHJB 4IIGA 4MWBA 5KTPA 2SECE 4OHOA 1JSXA 1JL3A 1M0WA 4OO3A 1JR2A 3NQ41 4N3NA 4RTPA 2RIRA 5ITZB 4DCSA 5H1YA 2GUGA 5F35A 4JUAA 4DRXA 2ZJ1A 2O5EA 1RABA 2ZUDA 4J07A 3HEMA 4Z53A 3NHKA 5C8YF 4GG1A 1BXRA 2GDJA 2I6GA 3ROMA 4B4KA 4E3WA 2ZCVA 4URZR 1Z4LA 2JHFA 3CPHA 1VJ1A 3K96A 4O4HB 5KVSA 1R0CA 3D7NA 4KXVA 2NU8B 1IY8A 1PEAA 4UPDA 3JAWA 2CDCA 4J6EA 3RBAA 5IAOA 1YZHA 1I36A 4AMZA 3ANXA 2CZQA 1FUEA 1NURA 2IZ1A 4X41A 3VH2A 2NZWA 4BFWA 5C7LO 2PUEA 2FPGB 1BYUA 1DWUA 3KNZA 3GWZA 5JDCA 3KK0A 4MS3A 2XKAA 5BYAA 4XTRA 3OZEA 4U02A 2YWJA 5HJ7A 3NEPX 4HDCA 5AKGA 5DCWA 3F3KA 1UP6A 4L8WB 4PSCA 4JI2B 4PO1A 5LBIA 3WAGA 3NM4A 2PXCA 3DMTA 1I2CA 4NL4H 1ZX1A 2ODWA 2WJWA 3ZDXB 4X5OA 2OCLA 1GV1A 1XNGA 1G2PA 1GA1A 3IVXA 3WBBA 1WW8A 2JGRA 1HT2E 3A6GA 4KC0A 4CODB 5B3JC 5KOJB 1MZVA 4UD2A 1QHNA 5A4KA 5DNEA 2XUPA 2J5KA 2WF9A 3KSZO 4BASA 1UAYA 4NJMB 4QYIA 3EISA 1EHIA 2IY8A 4Z0NA 3HP1A 1NVGA 3PKZA 4JVLA 3O9MA 4PLWA 3JYQA 4R3WA 3RO7A 4JT2A 3SVLA 3E81A 1NSYA 1YBFA 2JJYA 4JLJA 5COQA 3SFTA 1BA2A 3VR3A 3ZUGA 1YKFA 2FSVC 1ZJ4A 2ZR9A 1WZCA 5FEMA 1NQOA 4RL4A 1JHDA 2ZT8A 1F4LA 4IGKA 3NG1A 5KSYA 3G17A 1DAEA 1NONA 1PJ2A 2PWPA 4QHYA 4P3YA 4RHFA 2IWRA 1JWBB 4JLNA 5KTSA 3C3YA 4ZT5A 2YQ5A 4N8EA 1KE2A 1X7WB 4FNAA 3DXYA 3SN6A 1E63A 4KQWA 4RKYA 5LP6B 3TOXA 4JYBA 3AKEA 2CDAA 1TMYA 4OTZA 2CXPA 2PZEA 3SC4A 2L69A 3QWAA 3RFFA 4DA7A 2X6RA 3RG2A 3ELUA 2QXYA 3PD7A 4L5AA 3T1NA 4C14A 4ETIA 4YJ2F 4TVSA 2Y66A 1XRPA 2H4YA 2XNSA 2ZR7A 1M73E 2ZUSA 4OP3A 1WP4A 4IHJA 3I58A 3QVXA 4HWSA 1CUEA 1UDRA 4QU8A 3W7AA 4MA0A 5ITZA 1VKOA 2I8AA 1COWD 2XOKD 4JL6A 1FFDA 3LPCA 3BVPA 4JEIA 2XTNA 3F71A 4FFOA 5DCUA 2VRNA 1RQGA 3P2OA 4MI6A 4YONB 3ZDRA 3I9OA 2OZLB 3HPQA 4IX1A 3WLFA 3YASA 5EC8A 1SC1A 4J75A 3A3NA 1E6UA 1J33A 4O4HA 3OQHA 5DHPA 3GX1A 1IPHA 4FWBA 2NU8A 4DC1A 1W30A 1RIFA 2QTVB 1JR3E 2AC7A 4KX5A 4RH3A 3KV1A 4Z86A 1H23A 4YIKA 2O1EA 1GKUB 3EXAA 5K0LA 1KFBB 4XWWA 3R5KA 4JJGA 2J3KA 3OZSA 1IUKA 2FPGA 5IDXA 3TPZA 3O47A 3QEBZ 1TKAA 2BDTA 5CMLA 5FR2A 4OFXA 3UK0A 2EGGA 3FRJA 4G5XA 5EXEA 5K0EA 4Q15A 4DB2A 1OVGA 2D5BA 3LP5A 1X8KA 2LDBA 3EG5A 2BFAA 5B58T 2QROA 1KYTA 2QQ5A 1B14A 3LDUA 5LN1A 3E27A 1RKQA 1E6MA 2CVZA 3PXBA 1G20E 1XDZA 4NCNA 3PC7A 3H4VA 1TJPB 3KUUA 5KOJA 1DCMA 4OHFA 1KGDA 2JFVA 2VQSA 3ZQJA 1OKKD 1PNRA 1F17A 3X2FA 1XDGA 3NHAA 4NJMA 3HWWA 2DTEA 4JUBA 1UC8A 1URPA 5AVWA 3EF3A 1PQWA 1N2OA 2RE8A 4IWXA 3GAZA 3TR6A 1U3CA 3LW7A 3H42B 3VR5H 3O92A 1YB1A 5CG2A 2EXXA 3NDPA 1W0CA 1PS8A 2ACVA 2E4ZA 5JCXA 1QIDA 4OJMX 3C6KA 1GPAA 3MFQA 2NZXA 4D25A 4L4SA 2NTEA 1PJZA 3BAFA 5FLKA 5TR9A 4BMSA 2DYKA 2IYNA 4JBIA 3IHWA 1ZXXA 1P18A 1XPOA 2X9VA 1OJLA 1X7WA 3O4GA 3LVRE 3K0EA 3EWAA 4ZVTA 3G88A 5LP6A 2FQ1A 3SY8A 3O4HA 4RV9A 1FFEA 1T8RA 4FT2A 7MDHA 2EJVA 2ZPUA 1UDXA 3ND5A 3GLGE 1Z45A 3RARA 1GQRA 3IS3A 1Z0ZA 2VOJA 3L7IA 4KREA 3VZBA 1VHLA 4I19A 3RBZA 3HCRA 3V1LA 3GFOA 1K92A 4CIWA 1SUDA 2V5VA 1NUHA 3OZVA 1UIRA 5DGHA 4DA6A 2QU7A 3H13A 3KB8A 1RRCA 1C81A 3C5EA 1JVBA 5GINE 4Z4EA 4JBNA 1QU2A 1BZYA 4HPWA 3LLVA 1Q11A 4IXNA 2NXJA 2XECA 3DEFA 5CPBA 3VNAA 2C04A 3AFGA 4NU5A 1KTIA 2BGJA 3R3UA 3RUCA 3RADC 3GJ4A 3T1HB 4D3XA 3KJNA 1H2AS 2OZLA 5JVDF 4F72A 3ETGA 4EEKA 1AD2A 4V24A 1MPTA 1XPJA 3VTKA 3AUXA 3D6HA 1ZU5A 1KO7A 2ZTMA 2IK8A 1NV9A 2QTVA 1FNMA 1C8BA 2J3MA 1PJCA 3GW8A 4E2FA 1Q7BA 3BDIA 5LQUA 1RPJA 2FLKA 4C0KA 3O8BA 1XXHE 1QXSA 3N76A 2YIJA 2V7XA 3KVYA 4DIEA 2JFWA 5HJ2A 1JIIA 2IZ7A 3IMEA 3DL4A 3UT0A 5EE9A 1TVEA 2IYEA 1W4BA 2CZGA 2HSJA 2Y76A 3AEQB 5G02A 3TCXB 2FFQA 3H9GA 3W9BA 2FXVA 4DRZA 5JAZA 4JL8A 1DX6A 2AOVA 2QR2A 4OMDA 4PZ9A 4LF4B 2ZAYA 1HLGA 1SGWA 3P4XA 4ZOAA 2EX1A 1T1IA 2IXDA 2ZYWX 2HA5A 2DPLA 2WVAA 5ECDA 2FSVA 1P0FA 1QFXA 3DZIA 3HJCA 4GC5A 1D7AA 1P31A 1MUUA 2R65A 3DFKA 2NXWA 4INPA 1X14A 4M53A 2H11A 4OXQA 4ZT7A 5IDYA 1YSCA 5KAMA 2ST1A 5IM5A 2E55A 2VJMB 4QPDA 3SJBA 2VF7A 3TNDA 1DDOA 4YMUA 3NBYC 3AU9A 5ICFA 2GM4A 3ES9A 5ALYA 3A9SA 1G4HA 2NN3C 2J67A 4H1VA 1AMUA 1I2DA 2QVCA 4MVJA 1NW6A 2V4UA 4CEHB 3HXPA 1CDZA 3R7FA 2X42A 3ZDAA 1E5LA 4LFCB 2WE8A 4HZGA 4E5MA 3VNVA 3VX3A 1FDUA 2YY6A 3HJHA 4H7EA 2VDKB 2FEAA 4YBRA 5DHFA 2H4WA 4UUPA 5L6LB 1TAHA 5TX7A 3FTDA 1JMYA 2A9PA 1OC2A 4U2EA 1GNVA 2J48A 2WP0A 4NKRA 1KE1A 3JQDA 3ZXXA 4K9PA 3WYAA 3B53X 2BF4A 4IDPA 3KWLA 4BVHA 1FUUA 1XFDA 1JLKA 4IHAA 5K0NA 3ZTWA 1YCGA 4FILA 2OV2A 2HHHB 4RWEA 4EFKA 2QL7A 2P4HX 3VDQA 2HWKA 4BZXA 4KFTA 4IDDA 1Q12A 4CIYA 2X2OA 2X0KA 4Z4FA 5B1HA 1CUGA 1WDLA 4DTCA 1B93A 1E5VA 1H0HA 1Y6QA 4Y6OA 5IZ4A 1L9KA 3AVWA 3Q9LA 1J1IA 5CM9C 1J0BA 1JKFA 2JZNA 4RX1A 5DEOA 3AY7A 3HB7A 1DKMA 3DG9A 2GEJA 2XXBA 1KAHA 1OFVA 2XNJA 2J5QA 4NARA 3CU5A 5DSZA 4ERNA 4S3MA 3WK6A 2X3FA 4RK5A 2NNLD 3EIQA 2FWJA 3SSNA 4V2UA 3WGMA 3EGOA 4X8HA 2AB0A 4Q9LA 1HK7A 5JEEA 4M55A 2PV0A 1H2WA 2GXAA 1LWOA 4TMYA 3EEBA 3QYAA 2IHTA 3VV2A 2HX1A 4PZCA 5LZ4A 5A0VA 5TEVA 5B3KA 3ZHUA 1H2XA 2DKFA 2LV8A 1BA3A 1U7ZA 4N6NA 4YRMA 3U1BA 4R1QA 3M82A 4R2KA 4W1RA 4A6XA 1NVEA 4RSRA 3ULKA 3OD1A 4B7CA 1LDMA 3A04A 3AEQA 3I6YA 4MRVA 3S2GA 5B1SA 3GLFE 3UJDA 4IWYA 3R40A 3GFBA 5LMZA 4JI4B 5JLAA 2VHXA 3JYNA 3ZN2A 3DUFB 3G2JA 3A9RA 1EJ6A 5A1TA 5HP4A 1BD3A 2NIPA 2FZWA 1ESMA 1GPDG 2NV0A 3O4JA 1NTRA 4S24A 5HA5A 3SK0A 3TLGB 4ARUA 1S3IA 1ULHA 5K2OA 1E9EA 2CK3D 2QN6A 2MYNA 1H8ED 3KOOA 4B6SA 3ZDFA 1KYYA 4OP2A 2OYSA 2VJMA 4G07A 1BS1A 4IIHA 4IS3A 2O50A 4F5YA 1JH9A 4RS3A 3OCCA 2QUZA 1NDUA 1CUCA 3Q3CA 4UJ3A 1R6BX 3A6DA 4Q9HA 2Q1XA 1K2VN 4B4UA 2XCTB 1P0PA 1PYOA 3M83A 2XGOA 4URFA 2X0FA 2HDOA 2LTAA 5DDIP 1Z7BA 1I30A 4WERA 4DR5B 3FGPA 1CEXA 4HYTA 4MW9A 1GEGA 5CURA 3RREA 2BZ0A 1H93A 4RIHA 1WS6A 4R1TA 4YCSA 4WBXC 4DSOA 3SJ7A 1UDWA 3G0DA 3ZE6A 2RAPA 2XKJE 1YR1A 1U7WA 1L4NA 1G8HA 4H77A 4QDZA 1XJ5A 4ZO6A 5FWDA 3Q7IA 4AYWA 1FFYA 1CNEA 2JA2A 4LXTA 1EHYA 2TECE 3KHUA 3GH3A 2FK8A 4LBZA 1XVVA 4MLCA 4BNYA 1JEDA 1EAYA 2DBVO 5E2BA 4Q00A 1QOQB 4ROSA 5ALFA 3VDMA 2ZB7A 1T35A 1TKBA 1B8UA 1XAJA 2YVAA 4GD3Q 4X8OA 3WZLA 1GNSA 1LC0A 1X1EA 1NMXA 4A2QA 4JI0B 2PRIA 1HNWB 4ETWA 4HPJB 1FQWA 2QENA 5C18A 1ZKMA 5ALQA 3CWCA 3MGKA 1W25A 3NHPA 1N9ZA 2I34A 3DKVA 1UC4B 2WZQA 4X91A 3CLRC 5K01A 3L7LA 4MQEB 2IBMA 1H0RA 3LP8A 4AAYA 2NV2B 1A1VA 3TQOA 3SQDA 1TA0A 3I1JA 3W8RA 1F20A 2C82A 5G4LA 2CXTA 3G5MA 3HNRA 3OWOA 2X9GA 3ZXYA 4C3OB 1Y81A 2FRDC 4FZJA 3BTSA 3IAM1 1IHYA 1U5BB 2UZAA 1JDTA 3P9NA 4D2IA 2IEYA 1T9KA 1YO6A 2FSSA 1EFVB 1GCGA 1PJ4A 3C1UA 3FSEA 5JZOA 4E88A 1KGSA 4FGSA 1ZK3A 3BK7A 4AZWA 3V5NA 4CKBB 4POOA 5SZHB 1ENOA 3LD9A 5AVVA 1ZEJA 1KAOA 2HWYA 4PNPA 3DUFA 3UV7A 1WPQA 2IEAA 4LTNA 3ZJUA 1UMBB 3TLGA 3WGUA 4TWZA 3FOBA 4P5EA 1SU6A 4A1FA 1FRVA 4GF5A 3C43A 4DAOA 3QTBA 4F3CA 1OLOA 3FCEA 1Q0SA 5ED4A 4IDGA 4PAQA 2DQYA 3W9YA 1SCJA 1SQGA 3WGYA 2X1VA 1PUJA 4OHMA 3HGMA 5D01A 1PS9A 4M83A 1A4RA 1FSZA 1YQXA 3RS9A 3CPEA 3ACDA 1U4SA 2Q99A 5J4KA 2CXRA 3LFTA 1COWA 2XOKA 3H2KA 1NVBA 3W2GA 4UBJA 1GAJA 1XRRA 3QXJA 3M4ZA 3PYMA 2AXEA 1GTSA 3JTEA 1P2FA 2NYAA 3HL4A 1X39A 4KE8A 3E7XA 4O2LA 4R9SA 3TZBA 2B8TA 1XUOA 1M66A 4GMKA 3SLKA 3B1KA 1KFEB 3VDNB 3BE5A 3QLUA 3S0JA 4F96A 2CMKA 3ADPA 1G6Q1 821PA 1QB8A 2FCAA 5KSPA 4YX9A 1L7MA 4Q01A 5I7VA 1E9SA 5U9CA 4WNYA 4FC6A 2ZIAA 1ZCFA 3HHEA 1NVVQ 3KQLA 1DRKA 4ZQHA 4K81B 5C2JB 1KVUA 3A1NA 2OCGA 3HY4A 4GE0A 5DVZA 3VJKA 4P53A 1QWOA 2KPOA 3LYHA 4TLDA 5CFMA 2D0OB 4N5DA 2DFVA 3ROKA 1T0HB 2SBTA 4EG5A 2PMKA 2VYVD 4XASA 4MQEA 2WB2A 1U2SA 4MYRA 3L93A 4N40A 3RPEA 2R87A 3LIIA 1OKKA 2YHBA 2JZOA 3DZ8A 4AKHA 5DM0A 5AFSA 3D1JA 4DZRA 4UVHA 4BO1A 4YRDA 4W5RA 3RVDA 5GGXA 1CG6A 3TG2A 3UV3A 2FXIA 1Y7IA 4IR7A 4D80A 1TQDA 3ZLVA 3S70A 1U5BA 3WWEA 4F1KA 1DXQA 1ZHOA 4WY8A 2ZSUA 1QFMA 2R8YA 5TEWA 1JG3A 1EFVA 1R4AA 3V2GA 4MXDA 1BJRE 2X13A 2WJ6A 2HF2A 1X77A 3NEJA 4H15A 3WKAA 4BEBA 4CKBA 1NHGA 3Q9NA 3VZCA 1M7BA 4NU6A 3EIFA 1TFRA 2NVOA 2AFRA 1T9GR 3AYXB 4TSKA 4TLMB 1UMBA 3NUZA 4NZOA 3VVCA 3OBIA 3DAFA 4RHXA 1T6BY 2ES4A 3SGLA 2PLFA 3HYRA 1UMKA 4OQPA 5JISA 4RTSA 1NFRA 2WOJA 4M7RA 1M10A 4QICA 2PX2A 4L5YA 1PQYA 3MTEA 4GP6A 1AIPA 4UW9A 5A9RA 1ZBQA 2RBGA 5DXAA 2PZMA 5IXJA 1YC2A 2G83A 3EN0A 1Y3DE 4RTMA 4H4DA 3MWLA 3IMFA 1PEKE 3NH6A 4BVGA 2Y92A 2R6AA 4E46A 1OBHA 3LM8A 3WKCA 4BKOA 1NW4A 3KHSA 1GUFA 1XD9A 2Q1YA 3D5TA 4FFMA 1XRSB 3B13B 1NW8A 4L74A 1AQUA 3TKAA 3Q3GE 5JROA 1ISFA 1YE8A 2ZM5A 1ZGCA 1B0AA 1Z6AA 1HXHA 6REQB 2ZE5A 4KE7A 4P98A 1QQBA 3FPJA 1Z4IA 3FHLA 1JEJA 1RWQA 2AJCA 3OZDA 4RF3A 4YJGB 4ZXPA 5IJXA 1J0EA 5BXQC 2V7TA 3BXGA 4Q9KA 2OWDA 5GONB 3BHJA 1Z5UA 3PA6A 4QGHA 2H07A 2ERXA 4ZAFA 1Z5WA 1XTRA 2D4AA 1X1QA 2JI6A 2Q6LA 3OE1A 3RC1A 5LNK1 3HH8A 4QRIA 3PDWA 1FS4A 4A92A 2HF9A 3PICA 4Y2HA 2GERA 1QG2A 1XYVA 1HZZC 2OILA 3DXXA 2YOHA 1KVQA 3HP7A 1XZBA 3TLEA 3VO1A 4CDGA 3ZZNA 1LK5A 2H29A 1T1RA 1PEDA 4PLYA 2DQZA 5FTWA 1MAUA 3KR2A 3S68A 4U7JA 3SSOA 4YDHB 3L8FA 1WV0A 2R1TB 3DMGA 1X7GA 5K51A 5TJHA 1D6SA 1HMPA 4DNQA 4EDHA 2IYXA 5LYJB 2FEKA 3RRJA 3QE3A 4FFVA 5KCZA 1SXJC 1IJFA 1LF5A 4EMBA 4DV5B 3O8OB 4KH0A 1CF9A 1C5KA 4NZZA 3QXHA 1SKYE 1G5QA 4M21A 3GXBA 1ZJYA 3K8OE 4EG8A 4AUMA 2I9PA 4D4KA 1E3WB 1ZUWA 1LS6A 2P62A 4QPJC 2QTBA 3SC3A 3PEYA 1H9CA 3DLTA 2IF0A 4Y1RB 1Y6ZA 1NDHA 3EVCA 2ZRLA 1MHPA 2FSIA 3KALA 1M2FA 1WUYA 2PH5A 3F6BX 3NIWA 3WIEA 1A9ZA 1EEHA 1U6JA 3Q3EA 3DEZA 2OLKA 5EL0A 5FA8A 3MTJA 5TQ2B 2PSSA 1NC1A 2RHJA 2AN4A 1N6OA 2P9TA 5FOTA 1FF9A 4D74A 5A3QA 5H4GA 2ORYA 4WMLA 3TM4A 4YRIA 3SE7A 1KZGB 4CLRB 4MIOA 4Q6BA 1Q92A 3W7BA 4NCJA 2I0FA 2JANA 3USZA 3RF7A 2R6JA 3GUHA 4FW9A 5ER6A 1EP2B 3FOAA 1PYDA 1YD7A 2JD0A 1OI7A 2XIJA 4PG8A 4WRRA 4G9BA 3FDZB 2P6UA 3OESA 3NDJA 4O4JB 3PC6A 1P77A 3P0JA 3T5DA 4MTCA 4GYKA 2QLBA 2GEFA 1S96A 1WUHS 1OIXA 3EFHA 4HQRA 4X7PA 5G1PA 3ZWDA 4F5ZA 1ISPA 2GEUA 2VUUA 1GAWA 2I1WA 4ETMA 2R66A 3R7AA 4JEUA 4BS9A 2R60A 3IOBA 4ACAA 1KEVA 2HK9A 3VPGA 1JQDA 5A62A 6REQA 4LFAB 3QXCA 1HA3A 4DV1B 3ZLUA 3SDBA 1P6XA 1BH6A 1YDMA 3K73O 4K88A 4HEA1 5T67A 1YFKA 2ODNA 4YJGA 4F2DA 5T4HA 2DF8A 3DZDA 3A6JA 2EWMA 3QVGB 5H5JA 3KEOA 4NX2A 5TMPA 1MX5A 1Z0JA 2YBDA 3MTBA 1QQ5A 3O4RA 5GONA 1V9CA 4Z3KA 5CDTA 3QM1A 1FQOA 2IUYA 4AWBA 4MLPA 1SXJB 3LHIA 3WRVA 4CTMA 1IH8A 8ATCA 1AUPA 2HTEA 4LKRA 2OV1A 3IIKA 4N49A 4ZVUA 4MLDA 2TMDA 3LUDA 3T3HA 3QV1A 4EHBA 5I4KA 1DQPA 1O03A 1ZD2P 3ROPA 1NNEA 3MRTA 4AKGA 1S02A 2SCUB 2Z3WA 2I55A 3N8GA 4O2RA 2IW3A 1R6XA 3PSHA 4YT5A 4ZEMA 4ND8B 1DXOA 2R1TA 2GILA 3TGWA 5F3DA 1VMKA 5LYJA 2O2GA 1NZFA 2O3TA 5EJIA 3IP6A 1SCBA 1Z18A 1V3QE 4MW5A 3LFUA 1X1BA 2CK3A 4QLAA 4TSRA 1XNQB 1H8EA 3O8OA 3FMVA 3IOYA 3T8YA 2O3RA 4OQFA 3O0DA 5KYUB 1MO3A 2V1XA 3CUVA 3WYGA 5KU1A 1E3WA 2P6NA 2FWMX 1IZ9A 4W5HA 3HM9A 1OB5A 1U7TA 4Y1RA 1CY6A 3WWCA 1F8GA 1NPYA 2AVDA 5JS6A 3CSUA 2P8SA 4TV9F 3OPYI 1L5KA 3R5FA 1Z4MA 3IV7A 3V4RA 2FX3A 5TQ2A 3G2NA 2V4MA 3K72B 2NO0A 1HDOA 4RZQA 3R3ZA 4YRCA 5CLLA 4EOGA 1FZQA 4XYLA 4ZREA 4RULA 5I7WA 2QNRA 5AJYA 3RV3A 2FFRA 4F3RA 1E9AA 5TGTA 4CLRA 1ZGAA 4B3DA 2XB8A 1MVLA 1ZXLA 2F4VB 4DLAA 1ESEA 1N1GA 2C1ZA 5HJ5A 4KDEA 1SZPA 1SOVA 1CPYA 4FMPA 5EIBC 3AW9A 2QXUA 4EGJA 3FDZA 4HQNA 4O4JA 4J1NA 1U0TA 2O2ZA 1G2IA 3DEHA 3NP9A 4FNMA 3TD2A 3BWMA 2AWOA 4CIBA 5KTYA 3QNWA 1OF1A 4FDUA 1XJ0A 1YS2X 1T25A 5F33A 4BGDA 1RIIA 1WRBA 3O8LA 1HZZA 4YMSA 2XVXA 3AK4A 1JIUA 3ABIA 4DWOA 1K3FA 4EW2A 5JZ9A 3B2EA 3QFRA 1ZD8A 3IT2A 5E4TA 3L7OA 3HXTA 3VZDA 3ONFA 4FHGA 1Z5NA 3LUBA 4PWYA 5CT6A 5DTQA 3QVGA 3W9SA 1XD2B 4MSUA 3EVAA 2C2OA 4ENUA 1GM5A 2PT9A 2PKYX 5DYGA 3SHWA 1X9IA 3X2SA 1EQ2A 3AF5A 4Z4GA 4E2WA 3U40A 1SXJA 4XLZA 1U3TA 2AKYA 5JNRA 5IFKA 4DUGD 2C4WA 4TUYF 5TQVA 3WDKA 1R0SA 4FYXA 3O7WA 2D7JA 2SCUA 4Q4HB 1RC0A 3UUGA 1R0BA 3C98A 3IHKA 3WWYA 4AB1A 1OAKA 2I8CA 4LWOA 2JNWA 4AX4A 4ND8A 5KWSA 4QOSA 4UHBA 1UJ6A 3UT5B 1GU1A 4L8GA 4NI5A 4RFVA 2B98A 3QXGA 3GPDG 1B26A 4QGFA 4YP7A 3QPCA 5LJLA 5IHPA 4X8MA 2ZTUA 1T0JB 1UT6A 1O58A 5KYUA 4UDYX 4X6XA 4Z9AA 3G1WA 4PN3A 4X66B 2ISQA 3OUTA 1VE9A 2ZDGA 3BWEA 1V7CA 3IBTA 3OCUA 3PTAA 3GFRA 4CT5A 3V1TC 1G7TA 4ZVMA 4WZ6A 5I8ZA 3PNOA 4DF3A 1HNZB 1Z4KA 1OIVA 1L4HA 3PIRA 3W6NA 4J6FA 5F76A 3KPYA 1YCFA 4K28A 4LWQA 3QLEA 3OJ0A 4QXMA 1F8YA 2GBIA 4AZ3B 4NEHB 4C6TB 2Q3BA 1MAWA 3CF0A 1XJQA 4CG0A 3CTMA 3O6VA 1SH7A 4ZN6A 1NVUQ 2HH9A 3RSCA 4CMJA 1OYOA 1Q15A 1U8TA 2RHGB 3CWZA 1JIKA 2QT1A 3K6KA 3BSYA 3V80A 1GZ3A 3MJTA 4D8WA 4JJAA 1LKZA 1T2NA 1TYDE 2JEZA 3UAXA 5C8YB 4F45A 1UT5A 3C5CA 4FE3A 1GRCA 2DQKA 4AJEA 5FUQA 1P60A 3U3RA 2IODA 2OG2A 1PZFA 3WGTA 2WA1A 4QYXA 5CK4A 2QVBA 5H70A 1UPCA 4Q4CA 1DBIA 1Z6PA 3G89A 2D7DA 1N5IA 1XMVA 4MJ7A 2BMAA 4K0KB 1DIOB 2VOEA 4PGHA 4D82A 3KFLA 2FF5A 2HCJB 3EPRA 3GXOA 4QRDA 5DHRA 3S4YA 1BU8A 4ZGGA 1ACMA 1TX4B 2V7QD 2VYVA 3JYPA 4HL6A 4JLKA 1KAMA 1MG0A 1X80B 2AR0A 3DO8A 4BNMA 4RETA 4AZSA 1O6BA 1P7VA 2GZ1A 4GMFA 4O4IF 2ZUEA 1XD2A 1Y98A 2IEDA 1PDWA 1KNXA 2E89A 2R9VA 1IWOA 3DF9A 1WJGA 3B6IA 3PHLA 1Z0FA 4GEKA 4QFMA 1LK0A 4IGEA 3ZGYA 3FPGA 1YB4A 1KMMA 4FLEA 1Y3BE 2KJQA 5ERXA 3AL2A 5HZKA 1OI3A 4JSRA 5L7TA 2AK2A 4X97A 1Y33E 4NH0A 2ZS9A 4L2IB 1A50B 1EA5A 2QG9A 2ZZKA 2Q1SA 4Q4HA 3JQ9A 3MJVA 1S7GA 1WCWA 1JI3A 1YT5A 2HI0A 1GPLA 3CEPB 4D9CA 5I7OA 2XCLA 2HA7A 3JQ7B 2OLEA 3UT5A 1E8NA 1PJQA 1PFGA 3Q5GA 4DILA 5K4HA 3PNPA 5C4GB 1OVMA 5I9NA 4P4LA 4TMVA 1KH2A 1XZIA 2GVZC 1V71A 2O1XA 1M0TA 4HQ0A 4CM3A 3OSZA 1Q0UA 1DQNA 3WA6A 2XBLA 4AQDA 3E2PA 1KORA 4CG2A 4E5DA 3I6MA 1VOTA 4D4LA 3GUUA 3JZDA 5DHSA 1C0PA 4DLKA 1JYFA 5JH7F 3PGJA 3IDOA 3LQ4A 4J9UE 1VL0A 4N1AA 3UMBA 5B1YA 2PJDA 3THOA 5JD5A 4OSEA 4AZ3A 4PYQA 4C6TA 1QF7A 4R8MA 4D56A 1E2PA 2H48A 1KKMA 1X6VA 2JJ8A 3H18A 4LC9A 4PC2A 2JI4A 3TJRA 3MOSA 3ZZTA 4ZZ0A 5G1OA 2IVZA 3EVDA 2WMNB 3UHJA 5IM4F 1DSSG 2ZCUA 4DANA 4ZDKA 4ME6A 2JLUA 2OGWA 3LI2A 521PA 4JGIA 1V11B 3DHEA 4JAVC 3AZOA 4DL9A 3RNOA 5C8YA 2Z95A 2PSFA 2XT6A 4QUIA 4J4TA 3U7RA 1R0KA 4FZ5A 1RXIA 2QN1A 2W22A 1ZIDA 4I9FA 4KQJA 1QONA 4I3FA 5FYDA 1PW5A 1UZAA 3O4VA 3V00A 4R5MA 1K6JA 4F8JA 1M2VB 4BMZA 2HYDA 1ZD3A 4QL3A 4E5KA 4TKVB 1NBOA 1H3EA 1KAQA 2WJ4A 1D0SA 3KLOA 4OI2A 2F1HA 4F12A 4TWAA 1W0JD 3P2IA 4B5KA 2PKCA 5BW6B 4HNUA 4IQ8A 4DHEA 4FD3A 1T4DA 1XCGB 1ZRSA 1CDOA 5LLSA 1V2GA 3TZKA 4DABA 2B2NA 3V1KA 5DBIA 1V5FA 1X80A 1XZKA 4UAUA 1XU7A 1IZYA 3LH5A 4UFNA 4PHCA 3SFVA 2KM1A 4M99A 4MEJA 4NYJR 1M2JA 2FK7A 4WKBA 1FBTA 1DC3A 4RPCA 3IIMA 4BEJA 4CRWB 4B6GA 1QIMA 1SOUA 3LDGA 1LX7A 9LDBA 1KQNA 3L0YA 3QFSA 2ZJ3A 1L4GA 1UIMA 2HMWA 4UKDA 4WFQA 4L2IA 2DWQA 2D13A 1ZCBA 3BGIA 2AI1A 3SWWA 4BO0A 3WLLA 1MNAA 1VRCA 1Z8DA 3JQ7A 1HEIA 2CEAA 3WJ7A 1OJ7A 2DBRA 2P2LA 3AM3A 3HCOA 3LT5A 2QE6A 1PSDA 3QA3E 4HO1X 4HQOA 4IJKA 4NESA 1P91A 1UK9A 1G17A 2C96A 4JQSA 3PC8C 1TYCA 4KDFA 2PBLA 2DLCX 4ZOBA 3I0ZA 4WLFA 1K9VF 4YALA 1EDOA 3TK1A 3DDWA 4UUOA 1LVGA 1NR5A 4NBRA 3FCUB 1XQ9A 4KAXA 2C7VA 2ODQA 1IVSA 4DEYA 4WV3A 1IZ0A 1Z6YA 1J1ZA 1WP9A 2RAFA 2XADA 2XMZA 4C1BA 3JD4A 1LTHR 2ZZNA 1LPAB 3T0GA 3CEAA 5CDFA 4LHSA 2BMWA 2NTYC 3BD8A 3D3QA 5C8VA 4G97A 4WLOA 2UUAB 2GD6A 1OD6A 1OFUA 4RXMA 2R6ZA 4J7CA 4Q1BA 1QZTA 3ET4A 2Z4RA 3FVWA 4GWLA 1E0AA 2QGNA 4N18A 3UJBA 1WEKA 1SN7A 3TF5A 3QHPA 3PNQA 5CH8A 1YGYA 1CVLA 1V11A 1CERA 5JHHB 2QORA 4AY3A 3EB9A 3L49A 1ZESA 4LXHA 4HR7A 3V8MA 4HAWA 5A06A 1WPXA 1RYYA 4MVJG 4RNDB 4REMA 3WL5A 4RVFA 1XMIA 3LC0A 5GJWC 1FMLA 2DHDA 1NP7A 5DBEX 3GAFA 3QX9A 1D3AA 1ISSA 1MVNA 1M2VA 3NTLA 4NU0A 1OBVA 1DNPA 1V6SA 5I6DA 1EVQA 2HAEA 4TKVA 2YY5A 2XB9A 3NTRA 1QC5B 1Y7LA 2WYHA 4PXAA 1I2ZA 2Q3MA 3O4FA 4KEAA 4CM8B 4G5HA 2IPOA 2JGAA 3KOMA 1I7LA 2P9CA 3R0XA 1BDMA 1ZM9A 3WLHA 1CUYA 4G1EB 3M8KA 3ORSA 4IBOA 4DKJA 1JYSA 3FJ1A 3H9CA 4P3KA 1WBJB 1ZD5A 5CA1B 1N7IA 3RBXA 1WQ3A 3TVTA 5I47A 1AN0A 4BE9A 3IJPA 4OOEA 2HFJA 3R0QA 3CSSA 1XLVA 2JLVA 2J45A 2VAPA 1TD1A 1UEIA 4DQKA 1XE3A 1L7DA 2BJVA 2N0SA 2WSBA 4EGQA 3AF2A 1P7YA 3CGGA 2Q6VA 3K2IA 1I01A 4GXRA 3AT1A 4HDMB 1NDQA 3IUBA 1XT6A 2WSMA 5TLSA 4KYUA 2ID8A 1SCQA 3RTCA 1A8SA 1RWOA 1JILA 1LK7A 1L5GB 2ZBQA 3T7AA 3ZHOA 2LWIA 3HU5A 2WKWA 3ODPA 5HYVA 3LNTA 2CVHA 2BEWB 3ILYA 1MJ5A 5FPPA 1DEAA 1E2FA 3G2MA 4YAJA 4DMCA 1KI4A 3FKJA 5D87A 1GLNA 2B21A 1L5ZA 5TF0A 5HKBA 2GZRA 2HNAA 3R3JA 1FE8A 4NFLA 1OGJA 4A82A 4BNTA 2IVFA 3PPVA 4C76A 2YYZA 2BZSA 2ADFA 2OFXA 2R7KA 4B80A 2A9JA 2GEBA 3L0CA 4H35A 1Q16A 5CR9A 3SYKA 4JI3B 5EP1A 2C00A 3WWPA 1HZJA 1XFAA 1BCSB 3DTVD 5CIWA 2N47A 1OREA 1UC5B 3UQZA 1L8AA 3DE4X 4IP0A 3FY4A 5E7IA 4CMEA 1I14A 4FFWA 1Y34E 5AD1A 1F7UA 4JENA 3WGVA 3BICA 1SD1A 2G0TA 3NO4A 4HH0A 2JS7A 1JR3D 3M49A 4QRHA 4UTPA 1RHQA 2PUJA 1O9HA 2CLEB 2JCXA 1DC6A 4YGYA 1LVUA 5DM60 5DLYA 2LDXA 4NQZA 4E2XA 1KJWA 2HM7A 2IX9A 2X23A 1S2DA 4FYKA 5FPQA 3DAPA 4DUGA 1QHXA 2G67A 3UMYA 5AK6A 1WLYA 3MBIA 3THWB 1VTKA 3F6YA 1TIPA 1PZHA 1VHTA 5TS2A 4F4HA 3LC7O 4FMBB 2H1HA 1YR8A 2QLMA 5ECYA 1QC5A 4DS3A 4S0ZA 3OTOB 3U0BA 4K26A 5DEIA 1WKBA 5REQB 4JC8A 3ZH2A 2P1DA 1MJHA 3CN9A 4CM8A 1N5LA 2VP9A 3FSJX 2VNHA 3T1TA 4R1PA 5DM4A 1O6GA 1Z37A 3ETDA 4W5TA 4M60A 4E7OA 4JKYA 5F98A 4QXOA 5IVDA 4WLUA 5JSHA 1RCTE 5HKOA 1J7JA 3L40A 2JARA 1J8DA 5BQXA 5CA1A 2XD9A 3NBUA 1EK2A 2DCMA 1R18A 3NNSA 5AJHA 4GT1A 2FDCA 1N3YA 3R77A 3KBOA 1SA0B 4P1ZA 1TCVA 4GQAA 4Y1EA 5EXDA 3UYLA 4TVBA 3X2EA 1GDDA 4BNHA 1NYTA 3R2JA 5GTDA 1VPVA 5E95A 4IDNA 4KFCA 5BN1A 1GEEA 1C1XB 1UXGA 4K9OA 4C0HA 2OSVA 4HDMA 5G3YA 3A6ZA 5B6JA 1D1QA 1BOOA 3PC8A 4QO7A 5K8VA 3DOEA 2A8YA 2Z6UA 1TCCA 2HD4A 1NYLA 3QPWA 4XI9A 4HQFA 4JNCA 5AHKA 2DH5A 1AJEA 1DAOA 4OYRA 4Y2YA 3AHDA 1RXYA 2BEWA 4M76B 3V9AA 2HA2A 2HFKA 3H2ZA 4KQHA 3I2IA 4X20B 1JFSA 1XRQA 1PWXA 4KXQA 2QEQA 4IZOA 2B7CA 4KJZA 3R8FA 1K89A 3ABSB 3LE8A 4XQEA 1E7MA 1A77A 2J59A 1MTOA 4NCAA 3T38A 2I2WA 3WLOA 1MAHA 3ZWYA 4HADA 2YDYA 2Z83A 3C41J 3D0QA 2DHRA 3EGXB 3MF4A 1JQBA 4MYDA 4PXYA 2FN9A 3S7ZA 3HGTA 5EXTA 2B82A 1RLUA 2B1RA 5EUMA 4ZO9A 2XSZA 1JPUA 1BCSA 4B3IA 1CQPA 3IEUA 3GLIE 1T1EA 1DCFA 2BHSA 3X1XA 5IJWA 3BMOB 3KXDA 1A72A 1ANKA 1E1DA 4PO8A 5LMNB 1GZ4A 1BXKA 1Y9JA 3MWGA 4HQ6A 3DVSX 3G2QA 4HX9A 4KLNA 4YO7A 3SM3A 2JIQA 2VYCA 2G40A 2UXCB 5LZ5A 2O8EB 3FPHA 4NV1A 1V8PA 1UJ4A 3OP4A 2WC1A 4CFZA 3ZD6A 2FSGA 2WAXA 1BGWA 5KTTA 1G7CA 4HUQB 4AU1A 5IYZB 1BE8A 1JJIA 1G8PA 3JATB 3LHDA 4MKZA 4AKIA 5FFMA 1QDLB 1XPRA 3WNVA 3THWA 4XSVA 3OY7A 1GG2A 3DCNA 1U90A 1J8VA 3RRYA 2HCTA 1EWRA 4JL5A 4WINA 1CZRA 1WXQA 2AYZA 4HZUB 4F2WA 1JHMA 2P41A 4QELA 2ZWMA 5REQA 2PBRA 2OEPA 3SKXA 1EWQA 4C4TA 4ALKA 1VHQA 1WKCA 4CFYA 2VAVA 5MN6A 1QMGA 3F5DA 2HRZA 3M7IA 5HQJA 2O2SA 3PGXA 3MWYW 1WA5A 1YJ5A 2R97A 2FKAA 2RC6A 5I9BA 2KBFA 4U0KA 4UZSA 1IPFA 4BLSA 1E8MA 5JFGA 3GCDA 5K0GA 3L7KA 2X4IA 2EKZA 2HW8A 4DG5A 2JFPA 2HU5A 1R0RE 3OQIB 3GHYA 4U9IS 4KGDA 1SA0A 2B8JA 2QRNA 3ZI0A 1WOYA 1QCYA 2G1UA 1K86A 1TA4A 4JYZA 5DF1A 1O9GA 2VFAA 4PG4A 1C1XA 1Y9ZA 4KTVE 4KR3A 4X62B 1YQ9A 1SC4A 4FDTA 5CB6A 1ONSA 3ORHA 2C31A 2UYOA 1OR8A 4CXMA 2AXQA 1HE4A 3BDVA 3KLPX 1SK9A 1E92A 1TIBA 4OJQA 2YV1A 3PR2B 3HDVA 4HXEB 4QUGA 1BC5A 4X24A 2H63A 2HJRA 3AIIA 5BSVA 4F91B 2GHQA 1W2WB 3BSFA 3ROEA 5ALIA 6GPBA 5GZ1A 4F56A 1MIHA 1HFJA 4X20A 3BFPA 3TIIA 5BRAA 1RAAA 4QODA 4A16A 1WB9A 3CNLA 3I2HA 1NOIA 1XTQA 3ZIDA 1U6KA 2QUKA 2X4DA 1RRVA 5CXUA 2AFHE 4BKRA 1T6NA 3QNMA 2EKQA 3EGXA 1JE0A 1Y42X 4WN9A 5ALEA 5FJIA 1NVXQ 4RDCA 5LMUB 1F8UA 5PNTA 1W0JA 2EWVA 4LG1A 5J4YA 1W1WA 4PHHA 2DFLA 3ETEA 3ZV3A 1QLJA 3H97A 3EXHB 5GADl 4DG9A 2W7TA 4ZRMA 4LK2A 2P9BA 3M89A 2ZSEA 1GFWA 3BMOA 3DVQX 2H17A 4Q7JB 5FBKA 3ZGXA 5BUZA 3KPVA 3IB3A 4PYRA 5EXSA 1SHZA 2O8EA 4FN4A 2XRYA 3TR0A 3R3SA 3E2MA 3OTHA 3IQWA 2D1RA 3PCRB 5A3SA 1NXPA 3EYWA 3OM1A 2ZRFA 3R3HA 4RORA 1DQRA 2YWRA 1MOZA 3KU4A 2DFNA 3N2ZB 4HUQA 3BSSA 4JUFA 1P9NA 3U4DA 5IYZA 4PNZA 3FCSB 3IVCA 2YUTA 3OFVA 3ZVMA 2CLLB 3NIDB 1QVZA 3H3XA 3HA7A 1EFKA 4EECA 1O87A 1Y3CE 3R7NA 4CKCB 2AF3C 3N2IA 4HZUA 1N9GB 2P75A 2OYRA 4CJXA 4G5OA 1I24A 3EPPA 3I6BA 2GASA 2WJYA 3BH6A 4KBYA 4R7TA 2EX4A 3OH8A 4ZPXA 1TEZA 1XVTA 4BNUA 4QQRA 1T5IA 7YASA 1BMTA 5A71A 4QBKA 1N78A 4Q3NA 3GLRA 3LS2A 1OXXK 4NNOA 1JJ7A 4BO6A 2V0CA 3LUCA 3OTIA 4J76A 3Q98A 3ZGOA 4KHPB 3SZUA 3OQIA 3W3AD 3DO5A 4JYCA 3M6VA 5MFPA 2AYXA 3OG9A 3ZKAA 3Q87B 2AFIE 1P17A 3DTVB 5K2MA 2ZYVX 2XUJA 4LE2A 2HPZA 3VKUA 2R68A 3C39A 1NUSA 3GC6A 3ZCPA 4EZBA 5HKKD 5EZSA 1YZYA 1RRGA 1P1KA 1MQAA 3PNBA 4XD2A 1WSAA 1PHPA 4PG7A 4U7PB 3WNZA 5IBPA 2CSUA 2EDCA 3D6TB 5E1DA 4KN6A 4KK4A 1XEWX 1UDBA 4WZZA 1J1UA 2GZ3A 3PVSA 4OGGA 1WSDA 2G71A 1E3MA 5F73A 1UL1X 3E8SA 4YV0A 2YC2C 4ARVA 1Z35A 3NFYA 5ALJA 1WB6A 2C8LA 4H6PA 4KBFA 3L9XA 4ZYWA 1E2IA 3QF4B 2EX0A 1X86B 2D0PB 1IY1A 3CO0S 3WQSB 1X3LA 3E35A 1I5OA 3NB0A 3UF0A 2BHNA 5JJBA 1G20B 1UC9A 2RHTA 3EXHA 2BSQA 2JFGA 5DV9A 4MULA 1SVNA 3P5SA 1TJ4A 1RYMA 2Z2YA 5A3VA 4B2YA 4D3ZA 4JJIA 4OAOA 5BPHA 3I5YA 1UAGA 3OD5A 2EZ8A 5LZ8A 5FNVF 1QNFA 4QAJA 1EVLA 2C7GA 2CFTA 1VHJA 3KQUA 1YMVA 1N2GA 1LTQA 1UXHA 1DOHA 4RPKA 2RGDA 2RGBA 2JGEA 1P81A 1GFIA 3GDWA 2F1JA 3OPYA 1WMDA 3MCWA 1J07A 1MQ8B 2CLCX 1VJ5A 4LXUA 1IU9A 1CR2A 1YJAA 1XQ1A 2BEUB 4HP8A 1PX2A 4BJ6A 4JLVA 1M6YA 5HRCA 4W5NA 5NULA 1NP6A 1N0HA 3G0OA 1AK1A 2OYCA 3ICQB 1KNQA 3ZV4A 3V9PA 4CKCA 1XZNA 2XMRA 1E4VA 1N9GA 4P4UA 2X0NA 1PKXA 1F6DA 1NT4A 1PG5A 3IQZA 4HX5A 1Z0AA 3FBGA 1NY5A 4MV1A 4OSPA 5EKXA 2AQHA 1ZM7A 2YR0A 1XHFA 3BN3A 1RQRA 1YTLA 3L1UA 1KJJA 3PNVA 3GLGB 1UKAA 3GAAA 1QP7A 5JBQA 4GSLA 4LHZA 1P45A 3INTA 5CUQA 5B57C 2YWXA 1DAMA 2CCKA 2XB4A 2NO6A 3UWMA 1NA5A 4AMYA 4N8SA 5FQOA 2PL1A 3CISA 3R5SA 2A5FA 3FWHA 4EY4A 2W98A 3E8MA 3KKLA 3VC2A 3SBDA 1FRFS 4TQUS 4DJAA 3MRSA 1AKQA 4FLMA 5ALXA 3JD1A 1DEKA 1BFDA 1XROA 5CT5A 1KDPA 2QD4A 2PUGA 1T1JA 3DTVA 1B41A 2GRJA 4WCFC 1ZBDA 4DCUA 1P0QA 5JS7A 2OBNA 1Z63A 1YFLA 1OA1A 2GRAA 5CX1B 3ZW9A 3BJRA 3JD2A 5EGNA 3PQ8A 5DM70 1YA6A 2HCFA 1J2UA 3JQPA 5EJFA 3Q1KA 1P8JA 2O2EA 1Y82A 3X1MA 1R66A 4EABA 3PGMA 4DLRA 4MVYA 1W1IA 1MB4A 1O97C 1P5RA 3KCQA 2BRUA 1CFZA 1XXHB 4AZ0B 2WZCA 4CGYA 1M34E 5KX5F 1QE5A 2A9OA 3T4UA 4DYDA 4QFDA 2XB2A 3MSXA 3CNOA 2P4EA 3I0NA 3BBPA 3BTUA 4OKSA 2QMEA 4LYHA 4NONA 4Q82A 1UBSB 3UWPA 3QF4A 1PQPA 2BDEA 4KPGA 1R0XA 1U9ZA 4IRMA 4QQ8A 3R7SA 3AVTA 2M6LA 4V3BA 5DBGA 1G20A 4HC4A 4IGAA 3UFXB 4ZMRA 1AKNA 4MV4A 2ZCJA 3EF1A 2JLWA 1N2XA 1FTGA 4KGXA 5K9ZA 2J0SA 3QU4A 3OZBA 4M9UA 1D2RA 3EFEA 3NWJA 2OV4A 2GNOA 2PKQO 1ZOSA 3MTGA 4OXIA 1H42A 1REQB 2LW7A 1FU4A 5AI8A 2BELA 2M1XA 3UVEA 2XEDA 1UODA 4F4FA 3ORFA 5C3UA 1Y3IA 3ZZ0A 4ZCTA 3AVUA 1QK5A 5AKEA 3MCUA 2BEUA 3PPWA 4YQFA 3T5PA 5IT9A 2A1IA 4GXQA 3RTDA 4BPRA 2WU1A 4N39A 4YWJA 3NW9A 2X5KO 1UXOA 3DEJA 3Q3VA 2N42A 3CX4A 1EFTA 4WN9B 4WBNF 3GNQA 4OX9Y 2WBLC 3V8QA 4OX9B 5CIQA 1U9IA 1RVV1 2WJVA 3H19A 1FFHA 3EXEB 2OFPA 3F4KA 1EXMA 3GLGA 4FOTA 4DQLA 2G1AA 1PW7A 1H4SA 1KQ3A 2AUTA 1Y4ZA 4TTVA 1E99A 1GSAA 2C9BA 2Q0HA 4LVUA 3IHTA 3PXDA 2FG6C 5CTAA 2D2IA 2Q7OE 3WFJA 1RXWA 4HRAA 3TTSA 2FPXA 4QARA 4TRJA 2LR0A 2OORC 4TKZA 1UBUS 1QAOA 5EPEA 3U3DA 1C30B 1OXUA 3BXFA 1SVKA 2QL6A 4RADA 2PBFA 3IMCA 4ZA2A 5IC6A 5JMPA 4F6LA 1W96A 5E7JA 4UEJA 1ZL0A 5CX1A 3D6MA 2ALJA 4ZO7A 5CFPA 3OQOA 4LNHA 4JB0A 2CVOA 2A0KA 1JQ5A 4CGZA 1J06A 2BSXA 4GPD1 3G2OA 3PRJA 4TM8A 1EGQA 1ZR2A 4JKOA 2PV7A 4C78A 2AJBA 4LY9A 4RLFA 4UPVA 4XDGA 4AZ0A 1XXHA 4FK8A 1I2BA 1VJRA 1YZUA 4EVQA 2OO5A 3ZDZB 5T3YA 1SFRA 4JLOA 4KX3A 1EVYA 1Q1BA 3GT4A 5ARDA 1AY0A 1L5YA 1P1JA 3GLFB 2V7EA 4GZMA 4FYVA 4KQIA 3U31A 3ZE8A 1EXDA 1P33A 3LC1O 4ND1A 3PTZA 10MHA 4HVAA 3KEMA 3OMXA 1WM1A 2ZROA 1QH8B 1U0LA 3UFXA 1MD9A 2BM8A 3ABQB 4QC2A 1A9TA 1YNOA 4UE3S 5AKYA 4J49A 1C3VA 1O5OA 1KZHA 2YVQA 2BM0A 5KYXB 4MR7B 1H0KA 4K8OA 1DUVG 4RLQA 1DWQA 4H7PA 4OHBA 3UXHA 1B3RA 2Y27A 1H1TA 2C0CA 3P2YA 1REQA 2YKGA 3PHGA 3V4LA 4D9GA 4ZFNA 1CR1A 5AVJA 1ESDA 1R37A 2OUIA 1V47A 3FLEA 4PZPA 5JCOC 2LIPA 4TLAA 2Q8NA 3VC7A 2WKRA 4HEQA 4PLCA 4ZICA 1TYZA 3K2BA 3C5WP 3G49A 4V1CB 1ZHHA 2CLSA 1NN0A 4CL3A 3S27A 1MF7A 2A5YB 4LZJA 1E32A 5FOSA 3WGOA 2BM1A 3IH5A 2B8WA 4R3UC 4PBRA 3IALA 4LY3A 1M1YE 3CEHA 3D8BA 3PF9A 3RW9A 3SX4A 1KYQA 2IXGA 2A0FA 3AG6A 2R8PA 3LHKA 3LPLA 5FORA 2DGDA 3ZUPA 4ZHSA 1T5BA 2OXIA 3EXEA 2PGJA 2Z04A 2FEXA 1NU8A 2EBWA 4EO4A 4G0VA 1JEEA 4GU5A 2G28A 4KYTA 3RUAA 4ABTA 4D44A 1XL0A 3V7UA 2H1FA 3QH4A 2X2EA 2ZFUA 3A05A 2F1RA 2CFRA 2INGX 4FQ5A 2IU3A 1GA4A 4MUGA 5KS2A 2Y68A 2C4UA 4XPIB 5SYMA 4GIBA 4YVFA 1N0VC 3WSTA 1OOEA 1YAHA 1CY0A 3H7IA 3WL4A 4TRMA 1BHJA 1D2AA 2W48A 2GFHA 3PGVA 4YRTA 2WB4A 3K0BA 1EGVB 1DC5A 1YGPA 3P2KA 2XVYA 1RE1A 4X54A 3T1QA 2HA3A 5IHXA 1C30A 3B20A 3UGQA 1G1MA 4RMJA 4W9RA 3GBPA 2QHXA 5EHGA 4EJSB 3IB6A 2F59A 5I4IA 3H5OA 1S2LA 1VLZA 4GPAA 3VHXB 4PS0A 4QBFA 1WY7A 4M9RA 2GN9A 3BUSA 5CHYA 2G0AA 1CLUA 1KL7A 3I9V6 4HBGA 5JWHA 5L53A 4QJBA 1XK6A 1ZSNA 2FZKA 3RASA 1JWAB 4BQPA 1YRHA 5H9VA 1TJ5A 3DYVA 2DP4E 1Y5RA 1CUVA 4QGBA 3W2EA 4YCLA 3VPHA 2JJMA 1P8AA 1GRQA 5H80A 4DN6A 4LW8A 1SZJG 1J2YA 4ED9A 3BIXA 5BWCA 3GPLA