5K03A

Crystal structure of comt in complex with 2,6-dimethyl-3-(1h-pyrazol-3-yl)imidazo[1,2-a]pyridine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
214
structure length
214
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 78
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k03A00
3C3YA 2GAFA 5FWDA 2HTEA 2PJDA 1NKVA 4YUXA 4RTLA 1SKMA 4H0NA 1R74A 1ZHFA 4KDCA 2K4MA 4P7GA 3D2LA 5E1DA 4GOMD 5E2BA 2PX8A 1QAQA 3RW9A 1NV8A 4E70A 2XVAA 2HR1A 3A7DA 3LCVB 4BLVA 3UA4A 3JWIA 1RI4A 3EPPA 3G5TA 1O9HA 2NXCA 3BWMA 3EGEA 4YV0A 3NWEA 3LCUA 3UJ8A 1RJGA 4RTNA 2JJQA 5ERGB 4PINA 5K09A 3HVIA 1DCTA 3HA3A 5E1OA 3GRRA 3LKZA 3C6KA 3C6MA 4KDRA 1YFJA 3ELYA 1I9GA 1ZQ9A 2GB4A 7MHTA 4K6MA 2NXNA 5EZSA 5P8WA 2I9KA 1WZNA 2ZFUA 4F85A 5DPMA 1RI3A 2ZZNA 3NDJA 1X1DA 5FADA 5EG5A 2ZLBA 5GWXA 3QOWA 4E2YA 3FUUA 4RTMA 1IM8A 3ID6C 3LL7A 3FRIA 1TW3A 5FTWA 2I6GA 2UYOA 3UJAA 5GOZA 2B3TA 3GJYA 3HVHA 3OU7A 5K0JA 1P39A 3PVCA 3LGAA 3L8DA 4POOA 2NP7A 4GOOD 5K0GA 4FP9A 1N2XA 2G71A 2OB1A 3NVMB 3OZSA 4GQBA 4HGZA 3KPUA 3OZTA 4HTFB 4PYLA 3GWZA 5DX0A 5E8JA 1FP1D 2ORED 3DOUA 3JWGA 3DTNA 4OQDA 4PYKA 4PYMA 3AY0A 5EOVA 2A14A 3MAGA 4JXJA 3S68A 5T6BA 5K0NA 3UJ6A 5K0CA 3B5IA 2ZBQA 4QQNA 1FP2A 3SVZA 1BKYA 3OCJA 2BR5A 3KPWA 1FPQA 2BM9A 2P1DA 4ER3A 3UA3A 1IY9A 3CVOA 4DCGA 4FT2A 3BGDA 3E23A 3G2OA 3JWJA 2H11A 2ONYA 4PGGA 5HIIA 1H1DA 2QRVA 1XDUA 2OY0A 3PX2A 2YUIA 4OA8A 4ZTBA 5DM1A 4XUCA 4R05A 3PB3A 3DXXA 3HVKA 4G56A 5EKUA 5F2OA 5DT2A 2AS0A 3SXJA 5G02A 5T64A 1F3LA 1VP9A 2AOUB 3LSTA 3NDIA 3ERCA 2GLUA 4R8SA 3T7SA 4C04A 4RTQA 1JTEA 3AXSA 5EIWA 1R18A 5ICEA 5ICCA 3P9CA 4QQKA 4C05A 4RYLA 2VZ9A 1JQ3A 4NECA 2G72A 5FCDA 5HIJA 5C0OE 2H1RA 1DL5A 2E5WA 3TM4A 4E2XA 4U7TB 3KU1A 4LG1A 1QZZA 3OU6A 4E2WA 3KQVA 5CVUA 4BY9E 1L3IA 3CJTA 3MB5A 1WG8A 1TPYA 1XDZA 4YUYA 4HSGA 2KW5A 4KW7A 5B1SA 3TKYA 4YUWA 1X1CA 1D2HA 2P8JA 3ANXA 2PX2A 3DUWA 1YZHA 3G5LA 3KQQA 2PWPA 3DR5A 4CKCA 3GRVA 1KPHA 3BZBA 3EVCA 2PXAA 4C08A 1JQDA 5FA5A 2PXCA 3BWYA 4R8RA 3TFWA 2NP6A 1NW8A 1WS6A 4DM3A 3OU2A 4AUKA 3FPFA 4P7KA 2PXXA 4E2ZA 2R6ZA 4ATNA 1AQJA 10MHA 3C0KA 2NYUA 3CC8A 1B42A 3FPHA 3UBTA 3X0DA 4BP1A 1G55A 5M5BA 4RTRA 4GF5A 4FS8A 3ORHA 2P41A 3LBFA 2ZIGA 2CKDA 5HOQA 3FZGA 3EVBA 3GRZA 3BGVA 5E8RA 5JUWA 2IP2A 5JR3A 3P9IA 2G8NA 5LQCA 3HEMA 3P2KA 2XYQA 3PFHA 4E33A 4MQ4A 5GIOE 3RODA 3A26A 1BOOA 2JHCA 3CCFA 4Y2HA 5HILA 3VC1A 5BXYA 3KQYA 1KPGA 4X63A 5EZQA 3GIWA 3KR9A 1XXLA 3SMQA 3TQSA 1EQAA 3UJBA 3VYWA 4PYIA 2ZTHA 4AZTA 4KRGA 4GUAA 1FBNA 2IFTA 4HH4A 4RSRA 1P1CA 1EJ0A 2P7HA 3A25A 1KYWA 3G88A 3EMDA 2IBSA 1PRYA 3SSMA 5FULA 1G6Q1 1KR5A 3BWBA 4U7PB 2ZBRA 4CKBA 2I7CA 3OZRA 2JHPA 2P3OA 2B9EA 3KPJA 4RVFA 3JWHA 3G8AA 2V7EA 4QDJA 3Q87B 4GOND 2AN3A 3DXZA 5EEHA 2ZVJA 3HCEA 1NBHA 4ER0A 3O31A 5DRYA 3HA5A 3LECA 5CVJA 4RVHA 3H2BA 4CKEA 2AOUA 4P7FA 5CUQA 4ER6A 4RTPA 5CVDA 1SUSA 4YV1A 4PNEA 4Y30A 1FJXA 3ER8A 1SVUA 3CJQA 3UJ9A 3FTCA 1O54A 2YTZA 3EEYA 1G8AA 5CVEA 2O07A 4RV9A 3UFBA 5DXJA 4BP3A 4EQZA 3PLAE 4OX9Y 2IBTA 1Q0SA 3I5UA 5E2AA 3HCAA 2ZBPA 1XVAA 2ZIFA 5KS2A 3PTAA 4B17A 5IH3A 4E31A 3T0IA 3TR6A 3EGVA 3KKZA 2UZ4A 4IV8A 4AZWA 3P9KA 3OE4A 2OZVA 4L7VA 4PONA 1NW7A 4PYJA 3M33A 3GXOA 2YVLA 1VL5A 1KP9A 3BKWA 3FUXA 3FUWA 5HEKA 2QM3A 3MCZA 5D1NA 1JTFA 3EEOA 1BHJA 3PT9A 3SGLA 1PJZA 3ELUA 5DXAA 3SM3A 3DLCA 3LDGA 2OYRA 5C1IA 1VQ1A 1SG9A 1L3BA 2AOVA 3A7EA 4FT4A 2PWYA 3P97A 4HC4A 3RIEA 4A6EA 2C7RA 3OE5A 4V0RA 2O05A 3AXTA 3A4TA 4ISCA 2ESRA 3T7RA 1IXKA 2FYTA 3UJDA 4BLWA 4KWCA 1NV9A 3KQTA 3DH0A 3SX0A 1VIDA 1G38A 5EMLA 3C3PA 5DM2A 4YV2A 3KR2A 5DTMA 3AWIA 4IKPA 1RI5A 4F86A 1R8YA 4YUZA 3LPMA 2FHPA 4R6WA 5LQNA 4RTOA 3CJRA 3DMFA 1JQEA 5DX8A 4DF3A 3O4FA 3QV2A 4GC5A 3HA7A 2ADMA 1UIRA 3LCCA 4CXMA 3GRUA 3B3FA 4GC9A 2YXDA 5K0BA 2AOWA 1VBFA 2AR0A 2VP3A 1AQIA 3E7PA 3M6XA 3DMHA 5DRTA 5K8VA 3GGDA 4C07A 2BR3A 1Y8CA 3ELWA 2IDKA 5HIMA 1AF7A 3NVKI 3NMUF 1YB2A 1ZGJA 3TKAA 3CGGA 3IV6A 2Y1WA 5LQRA 3CKKA 2O57A 3P2IA 1BC5A 2QE6A 3KQSA 4DQ0A 2WK1A 3TOSA 1L1EA 3MCTA 2PLWA 3DULA 1SUIA 3DXYA 3EGIA 1QANA 4DA4A 2YQZA 3B3JA 3IEIA 3KPYA 5BW4A 5C9ZA 2ZWAA 3T7TA 5LQAA 4MWZA 3SSNA 1L3CA 4OA5A 1XDSA 4UOEA 5GM2A 2PX5A 3G8BA 1EJ6A 3M6VA 1X19A 5EKXA 1SQFA 3KQOA 5IKMA 2VDWA 3UZUA 1R00A 2PKWA 1QAMA 3GNLA 4YMGA 2XBMA 3F4KA 5CIYA 2OPBA 3TPZA 2YR0A 3G2MA 2YXLA 4LECA 3THSA 1KYZA 4P7JA 3R24A 8MHTA 4KIGA 2QYOA 1N7JA 4DMGA 2AOXA 4GOLD 1ORHA 3EVZA 3FTDA 3E05A 1QAOA 3BGIA 2UYHA 5GIPE 3KHKA 4RTSA 1JSXA 1D2GA 3O7WA 3KQWA 1AV6A 4M36A 2IH4A 3DLIA 5LR6A 1VLMA 2AVDA 5DLYA 3LBYA 5KYGA 5CCBA 2Z6UA 5FQNA 2ZCJA 3KQMA 3MERA 2CMGA 1RI1A 4C03A 4FR0A 5EMMA 5E1MA 4HTFA 3PS9A 2EFJA 4DCMA 5FA8A 4AZVA 2P35A 3OPNA 1INLA 4YMHA 3FUVA 2IIPA 5F2NA 2H00A 5ICGA 4RTKA 2PV0A 3GCZA 3EVDA 1JG4A 2PVCA 2PY6A 3NW9A 4WXHA 4RVGA 1XTPA 4PIMA 4OBWA 3G89A 3KR0A 1F38A 1KXZA 2FK7A 3HCFA 4LWPA 3P8ZA 1JSZA 2QY6A 4MIKA 4RVDA 4GBED 4X61A 3UJ7A 3SR4A 4C06A 4CTKA 3LHDA 2JG3A 2BH2A 2NNWB 2NXEA 3LDFA 2IPXA 1Q0TA 5K03A 2HNKA 2O06A 2AZTA 3B7PA 2B78A 4RWZA 5GP1A 4IV0A 2P40A 1NE2A 1NW3A 2FRXA 4QVKA 2DPMA 2Q41A 3FPEA 5FQOA 3FTFA 3TM5A 4XCXA 1EIZA 2AOTB 4KIFA 2YXEA 1ORIA 4E30A 3HTXA 2OB2A 3HCCA 2EX4A 2ZSUA 1R6AA 1EG2A 3GU3A 3P9NA 4FSDA 2ZZKA 4BLUA 4E32A 2VDVE 1KHHA 2G1PA 4O29A 4EVIA 2HMYB 5LSAA 2XYRA 3PFGA 2IH5A 3E8SA 4PIPA 4RTJA 3P71T 1VE3A 1JG3A 2ONZA 2PX4A 2CL5A 5EMKA 3BWCA 5ICFA 4R6XA 4FZVA 1NW6A 4ER7A 1Z3CA 3DMGA 5GINE 1U2ZA 1QYRA 1YZ3A 3EVEA 5DTQA 4Z2YA 3I9FA 3EVGA 2FK8A 5E1BA 2PT6A 1YUBA 1WXXA 3IYLW 3R3HA 5E9JA 2AN4A 3LKDA 5KVAA 5K05A 5KQRA 3B89A 3V8VA 3GDHA 2B2CA 2NXJA 2G70A 2ERCA 3I58A 5CM2Z 4QPNA 5DM0A 5K0EA 4V0QA 5E9WA 3NJRA 3NWBA 3ME5A 1SQGA 3MTEA 1XJ5A 5HIKA 4YUVA 2GPYA 4M7RA 2ZIEA 1O9GA 2EJTA 3MQ2A 2Z6AA 3M6WA 3HNRA 3FYCA 1HMYA 2LD4A 3I53A 3MGGA 3SSOA 3AJDA 5K0FA 3ER9A 2UYQA 3M6UA 5KQSA 2IH2A 2GH1A 1G60A 1MJFA 2OO3A 1L9KA 2WA2A 2XVMA 3HCBA 3UWPA 4IWNA 5F2KA 4HRAA 1V39A 3KQPA 3CBGA 3GO4A 1M6YA 2YX1A 1M0EA 1YF3A 1VP3A 2XYVA 2I62A 1OR8A 2CWWA 1JG2A 2P3QA 5LQUA 2JH9A 5DSXA 5T67A 3TLJA 1YFLA 2JH8A 3HVJA 5EC8A 5DTRA 3IHTA 5EIFA 5EVJA 1G8SA 3ELDA 2VS1A 3DP7A 1KIAA 4RX1A 3R0QA 4PYOA 1ZGAA 3G2QA 5H02A 3K0BA 1D2CA 5EHIA 3KR1A 1NW5A 1X1AA 4XUDA 3OFJA 2P3LA 3Q7EA 2R3SA 3EVAA 4AZSA 3UJCA 3HP7A 4PCAA 2C7QA 2ZZMA 4CTJA 5EHGA 2AN5A 1WXWA 4QTTB 2WA1A 4PYQA 1XCLA 3REOA 2B25A 4CWAA 3R9XB 1JR4A 2HWKA 2ZULA 3G7UA 3HCDA 4FSXA 2V74B 4P58A 5CVVA 3THRA 1RJEA 1I1NA 5LQJA 4EKGA 1NBIA 1RI2A 4FGZA 4OBXA 5E9QA 2AOTA 3WSTA 4EKIA 1ZKDA 3M4XA 1HNNA 3FTEA 4EMSA 2AVNA 1UWVA 4A6DA 4MTLA 3I64A 5MHTA 3FRHA 4QDKA 3FUTA 4F84A 3GRYA 3MHTA 1R8XA 3LDUA 2HV9A 3MTIA 3HM2A 5DWQA 2BR4A 2BM8A 1RJFA 5EPEA 2EJUA 3TMAA 5LQKA 2JHAA 2Y1XA 1N7IA 2ZWVA 4GEKA 1X1BA 1I4WA 4OQEA 4DKJA 2CMHA 1KPIA 1P91A 5EGSA 5K0LA 4M37A 5EEGA 2O0LA 2PSSA 1VPTA 4X60A 3BT7A 3FYDA 3BUSA 3OFKA 5EMJA 3P2EA 3K6RA 2C7OA 4DZRA 1P1BA 2PGXA 3VSEA 1RJDA 4HG2A 3R6TA 5HZMA 2GA9A 5HFJA 3B3GA 5BW5A 4QPPA 3A27A 5CD1A 2N47A 2P7IA 3V97A 1JG1A 2FPOA 3G2PA 4PWYA 4X41A 2EG5A 3VC2A 2IDJA 4KVZA 2GS9A 2PT9A 1DUSA 3EVFA 4QVGA 5U4XA 2FCAA 5FWAA 2F8LA 4X1OA 4AX8A 3EMBA 1MHTA 5FHRA 2IGTA 1EAMA 2QRVB 4WVLA 1TW2A 4MHTA 4HGYA 9MHTA 1ZG3A 4ER5A 3FPGA 2DULA 4PYNA 4EK9A 4M38A 5FHQA 3KPVA 5GM1A 2OBFA 5DM4A 5D1HA 4C4AA 5FUBA 3U81A 2VDUE 3M70A 5K01A 3PX3A 2PBFA 3QOXA 1UFKA 1WY7A 3BXOA 4PGHA 4XUEA 5DSTA 2ZW9A 5CCXA 1M6EX 4QTUB 3NTVA 5DX1A 2BZGA 1XCJA 5BP7A 2Z6QA 2OKCA 5EQJB 3LX6A 4PCLA 3BKXA 3TRKA 2UYCA 2OXTA 1NT2A 4LWOA 2C7PA 1T43A 3FPJA
chains in the Genus database with same CATH superfamily
5B12A 5FWDA 2O8CA 4G0PA 4UHEA 1VFNA 2P1RA 5I7VA 5AM5A 1QR2A 1BCSB 1NYTA 2YFKA 3BD6A 4IJKA 2B4RO 4IQ4A 3T5TA 1D9ZA 1ZKMA 2ZSIA 5K3FA 2ZXFA 2EXXA 4YPVA 5JT1A 1QIEA 4LNAA 3K0HA 3T9EA 3DL7A 4W63A 5B1IA 3SQOA 2DHEA 1LTQA 4GVXA 2P6OA 3FVTA 1W29A 4I3FA 4MHSA 2UVQA 2E4VA 2GCEA 4KMOA 4YC7A 4CF3A 3E6AA 3HVIA 5I9MA 4L8FA 1RKUA 4FGSA 1ZM3A 1M1ZA 2CLIB 1BKDR 1YWGO 2I2DA 3RRNA 4RCZA 4JYPA 4ARZA 4F5YA 4QHYA 4MUHA 1JHPA 3H8VA 2G7ZA 3ZIAA 2BZSA 3IOCA 3EARA 1M8FA 1MVNA 4LA4A 4U7JA 3QOWA 1XDDA 3LQ1A 3MJVA 1UDWA 2GN9A 4ZZ2A 4JUBA 2G9RA 3O21A 4QUEA 3Q10A 2O48X 2BM1A 2VSOA 5JYCA 1MB4A 4M89A 1K06A 1SVSA 1MG0A 4MR9A 2JK0A 3IAFA 3L1HA 4IZ6A 3WTCA 4F9GA 1ZRSA 1Y3IA 1U8CB 4PG7A 3WE7A 2H4XA 2FGKA 1EE9A 5JG7A 3FSRA 2Q4OA 4D5EA 5LZ4A 1M66A 2Y9MB 3NI2A 4V0KA 3VU9B 4F1KA 1FTWA 4PLCA 5K0CA 1PT7A 3JQ8B 2H18A 4J76A 1LQUA 1IXYA 1A4XA 2DR0A 1Z0IA 2AFHA 4YRTA 1DGQA 4FEYA 1JHUA 1L6IA 5FBRB 5TDHA 2XRYA 3KTDA 2VP2A 2IKQA 4LISA 4D8WA 4ER3A 4WHMA 4LF5B 3BDAA 4H7KA 2VUTA 1IU9A 2WBLC 3GT7A 1EA5A 4YIKA 3RVRA 1MJHA 2DFPA 1D0IA 3N0VA 3QEMA 2H08A 4OQLA 3IAS6 2AS0A 4M7PA 5G02A 3W5UA 1XV5A 1KY2A 1AG9A 4D82A 1N4AA 2Z2ZA 1FJ2A 4CL2A 1Y6ZA 2R6R1 5EXDA 1JU4A 5JZOA 3WB2A 4C4RA 3A9RA 1SURA 2C95A 3TD6A 3ZK9A 2J3DA 2FQYA 2QQ0A 4OJTA 1ZIPA 4JIGA 3GLHB 1KAEA 3MQFA 1E94E 1XCMA 2E5WA 4YUWA 1CY2A 4I4TF 1U3UA 4G4SO 1QZZA 4Z1MA 1KVQA 5CD1A 5CVTA 3N8HA 4GWKA 4DV0B 2NNLD 1LGYA 2QTGA 1Y34E 4HSGA 2KW5A 4YJ3A 2NU8A 5KOYA 5DN9A 3ET5A 4JLAA 3GPBA 2A1UB 3KQQA 1DU4A 3BS4A 2EFHB 1XTVA 3IAS1 4KWTA 1M2GA 2PWPA 4L0DA 3TL6A 4KDFA 3IS3A 3DBVO 1HE5A 3GA5A 3N0XA 4BQFA 4C4TA 4CQLA 1MU0A 3WLFA 5JSKA 2XT6A 4P08A 4KQJA 4NEGA 2JI4A 5THXA 1JQDA 4CMIB 5IABA 3MYRA 1WXIA 3HEBA 3NIGB 2NP6A 3LL4A 2AXNA 2H52A 4NMMA 3OZIA 5G40A 1NBOA 2PXXA 2FP3A 2MYPA 3V1LA 1BWQA 1E6WA 4TS1A 2EVWX 5IVKA 3ZXYA 1ACLA 1I33A 1V5FA 1W0KD 1ZS9A 3UWKA 2YWJA 3MPUA 2OHXA 3COZA 3LBFA 1C0PA 3OTOB 1OXTA 5MGNA 1M33A 2I4TA 4HNTA 3CG0A 4GMHA 4M6WB 5IT0A 4J03A 5KYWB 5BN3A 1OJLA 5L40A 2P9QA 4A2CA 2HD4A 1IB0A 4HB2A 3RS9A 5JSZA 3EPJA 3G85A 3OT1B 3SMQA 3LJKA 1LS1A 3TQSA 3M6AA 1T5LA 2X40A 5JFOA 5KYNA 4JYZA 4CLHA 4BYGA 1O95D 1ECPA 5SV2A 5CFRA 1J0DA 2PRKA 3NTRA 3HKEA 1YE8A 2BP7B 2P9YA 3R5KA 1Z4QA 4YJFA 1U0TA 1SUDA 5AT1A 3VGJA 4DR3B 1ZSVA 4RSHA 3NAMA 3C15C 1I13A 3EGCA 3OOWA 1K6EA 2E87A 3PLNA 5CH8A 1NJFA 1FMFA 1IMJA 2BZ0A 2RC5A 4H4DA 1G4HA 2ZRQA 4LK2A 1JMVA 1D2NA 1ZJ6A 5E3IA 1QQ7A 3T5CA 5HSGA 1VPDA 3WADA 1SXPA 4JI5B 1FQKA 1WULS 1SIWA 3TX2A 1NRWA 2HCFA 4J49A 1KDZA 5ALRA 2R8ZA 4CIWA 3U4QA 1QIMA 2EF0A 3I6YA 4RY0A 5IDXA 4WXEA 4EYEA 4M55A 3NONA 3Q8WA 2UXDB 4LS3A 1SEPA 2H1VA 1TUIA 3VBCA 2G08A 4P7BA 4AQ7A 4TMYA 4XH9B 3T7EA 1W96A 3JWEA 4EHIA 3H87A 4YONB 1Y6RA 2X76A 3OIDA 5K6AA 3LQRA 4WCFA 3GUYA 3DMYA 1QG2A 3NT2A 2WF9A 4R8LA 1DIBA 1GRQA 3JALB 3CZQA 1M0WA 3CLTC 2ZBPA 2EAUA 1KMHB 3OIFA 2BGKA 4JI6B 4Q4HB 4YRPA 3ZZMA 1XE3A 4UHHA 1L4LA 3ZZ1A 3MEQA 3DP9A 3N0TA 5KYXA 2YNMD 4JI0B 4Y2TA 3ZZNA 4G9GA 1NW7A 1P0MA 4J0QA 1D8TA 3MJRA 3W04A 3GXOA 4X54A 5KVVA 3O0TA 3KXPA 5MFPA 1EM8B 3O0DA 1M7GA 1YKFA 3MILA 4GX0A 4YYZA 1GIAA 4JZYA 3GVXA 3KL4A 1BXZA 3IEXA 3OETA 4L9WA 1A9RA 4RVSA 5C1IA 1RQPA 3MWJA 1F6WA 1E64A 2O8FA 4F4HA 1YK0A 1DAPA 2A30A 2XODA 2PK3A 4HN4B 5EESA 5I8WA 1YR9A 2F3RA 1DRVA 3EOAI 3KT6A 2HEGA 2R96A 2OESA 4IHQA 4JJIA 2W93A 1E3TA 2FMFA 1U1CA 1Y4SA 3DZJA 2GYWA 1WD7A 2VH1A 3IR6A 4IUYA 2GXQA 3RG2A 2RHRA 3A6GA 4HB0A 4I0WB 2GN2A 3PGA1 4C30A 4F38A 1M2JA 1ZHOA 4ZVLA 1X7WA 3CMMA 1EVKA 2O8VA 4MEJA 1M2VA 2XE7A 4Z49A 1IY0A 1OA1A 3GFBA 4QNRA 5HF8A 1X77A 2D2XA 3KOMA 5JEEA 2VK1A 1JH9A 3TZHA 4ONEA 4G1UC 3LPMA 2QNIA 4M0MA 3KUKA 1A9XA 4Y9RA 4Y0VA 1XDBA 5TT0A 2ZDHA 4GC5A 3F90A 5JXHA 3A3OA 1QHSA 1XZHA 1I2BA 5DISB 2J7KA 3HB1A 5DRTA 4I9HA 4DNFA 1UCFA 3U3JA 1WM1A 2N1BA 3KK0A 4KYUA 1JQAA 4UBJA 2AJTA 1VLQA 4B85A 4DQXA 4YRZA 5DN6D 4HDSA 3D6UA 5JH7F 1ZH2A 4QBFA 3ESQA 4RHXA 3O8QA 2NU7A 3Q7PA 4UPDA 2C2WA 2CXRA 4Y3UA 4EM6A 1Q7CA 2CYBA 4JEHA 4YAEA 3I9OA 5CNIA 4QYWA 2XCIA 1CUCA 4A6PA 2HA4A 2FFBA 4MWZA 2ORVA 1ZINA 1RBYA 1L3CA 5C37A 2VATA 2H1CA 4D9FA 1PJBA 3S2ZA 1Y1KE 1OXUA 4FYJA 4PVDA 3WK8A 2YQ4A 1W46A 3TQRA 3TG2A 5CIYA 2DLCX 4JI8B 1A2OA 1JDBC 4JEIA 2LCQA 4IOMA 4R81A 3IP7A 4X5OA 2QV7A 1ZCBA 4S1OA 3WJ2A 1W0JD 4AJ9A 5HHTA 3SICE 3EVZA 2HHLA 3B9QA 4HJXA 4TVBA 1N5OX 1RAIA 2HXYA 1O4VA 4ZT5A 1YRLA 2FW8A 3A05A 1ECBA 2RH8A 2CVFA 1TM3E 1YL5A 4XB6B 3BK2A 4GO1A 2AFIA 4UXJA 3GJZA 4JXKA 1HXHA 3V7FA 4BAZA 1PZFA 3H2HA 1WBJB 4UARA 3FYUA 3KQMA 4FEEA 4MMZB 5CM9C 3ZXIA 4Q1FA 1JMYA 3AEKA 4H3KB 4Z4EA 3WK7A 1LQ2A 1QGDA 2IYSA 2VDRB 2PS9A 4QRIA 2P6RA 1KRHA 1VBMA 1SULA 2GEBA 4KQFA 5DBFA 3F6EX 4JC4A 3G7SA 1RLOA 3QW4B 1E1YA 3EEBA 3QG5A 4NJEA 3TLKA 4LDNA 4MV5A 1ISSA 4UDOA 2XUIA 1WX1A 1TD9A 4DIMA 1PIWA 5ALNA 5C53B 3P8ZA 4F04A 2GILA 4Q05A 2JF0A 5IUKC 2OHGA 2XUKA 1BDBA 4GBED 4XQCA 2BH2A 1WTCA 4WZAA 2E6KA 1VM6A 3ZGNA 2OK8A 4FC7A 2WYIA 1NX9A 4F2HA 2AZTA 1ZLYA 2WMYA 4RWZA 5FPTA 1CWUA 2LCIA 3B6EA 2IHUA 3EDQA 2C99A 4K3UA 4XCXA 2PUEA 2AX4A 2IE8A 2PZAA 2WJ6A 4TUYA 3JTMA 1JXQA 1QE0A 1U4SA 2FQQA 5AUOB 2XE4A 1WHTA 5LP6F 2G1PA 3AR3A 2VDVE 1A97A 4O29A 4GAEA 5LSAA 1GAXA 3ORRA 2V7UA 3MINB 1HYGA 2IH5A 2KJQA 1XRPA 1SIBE 1JG3A 2HO5A 2CLOB 2WZDA 1OWMA 2BFEB 4FMPA 2CLHB 4RDIA 5ICFA 4KGZA 1NW6A 4K9DA 4R9UC 1PT8A 1ZUNA 3LUPA 4YRCA 4XYLA 3TXYA 1GPYA 5LDGA 3T0GA 3T9BA 2XSZA 4C0KA 3LTNC 3HABA 4K86A 3TI7A 4WK2B 3W7VA 4MDYA 1PTJA 2AN4A 2RH4A 4OQYA 1IHUA 4I4IA 1VIAA 3QVJA 2YFYA 3V8VA 3F5MA 4MJ7A 1BMDA 3AYXB 3P20A 2WHPA 2O3QA 1JHOA 2CVZA 1RQXA 3GVCA 4ZAYA 5EHXA 4OU5A 3VUFA 4EGAA 4YUVA 1Z0DA 2NTYC 2ZIEA 3ZWYA 1E2BA 5HKBA 3UUEA 4ISBA 1EESA 3RYFA 4RQBA 2C88A 2ORYA 3KUUA 4JYAB 2HTFA 4A8TA 4UXIA 2C3UA 2WIJA 2GH1A 3QG1A 3AUKA 5IMBA 2WJ3A 1JFTA 1HV8A 1TO1E 4RPHA 1XFDA 1QZXA 4HOYA 4XD7A 3RT9A 5EY5B 2HGZA 5FNVA 1HE1C 2GPTA 1LI4A 2HU7A 4ZQFA 4EB0A 5EIBD 3IE1A 1SHKA 2VK4A 2ZTVA 1SOWA 4LZWA 1Z35A 3OMXA 1PLJA 4XB1A 3T38A 2UVPA 2I2CA 4MR7A 5CR9A 1YONA 3N7UA 1JL3A 2ZYWX 3GROA 3KZMA 5EFZA 3M4ZA 2FSHA 2YZMA 3L4KA 1P77A 2V1XA 3AUTA 4PNHA 3MTQA 3RNOA 2CCGA 1Q0ZA 5EC8A 5EVJA 1QP4A 2NO9A 2WTBA 3NP9A 4LMPA 4QDOA 1BOFA 1KIAA 4KNYA 2I3BA 3CNNA 4PYOA 1E4EA 3CA8A 3DYBA 5KCZA 1KQGA 4N1AA 3MT7A 2MJLA 3RUCA 1YR8A 5DE3A 3VMMA 1R4NB 2OV8A 4RD3A 3UJCA 4C9BA 3BN3A 4EY4A 3DE3X 5K3OA 5JFTA 5G0UA 3UTCA 1DEKA 3UY4A 3KAJA 1NPTO 5H83A 5BV7A 5JS1A 2WWGA 4MP3A 4Q3LA 3NOOA 4DG5A 4TYNA 2QBYB 2V6JA 5LCXA 3DFFA 1U1DA 2VSYA 3W8FA 4OBXA 3WBKA 1HG0A 1SWVA 1UXGA 4PSKA 5AESA 5IX8A 3K1AA 1OBFO 2PH7A 4IILA 2HHCA 2YXNA 3WLLA 1XROA 3K96A 4WQMA 4D4MA 4YV1A 5IHPA 3ZNQA 1VL0A 3TIXB 4MP8A 2DB3A 3UH1A 1MOZA 5HGJA 2ZRFA 4I1VA 5IAKA 2QQEA 3C74A 4CG1A 5ULLA 1HUQA 4KQXA 4XX0B 4E46A 5JOQA 2HEIA 3PICA 4O2AF 3T41A 1NL3A 2GJSA 1EX9A 2R84A 4JYBA 1JDJA 2ZPTX 2ZR0A 4FOOA 1RWQA 1GVNB 3K2BA 5CX1A 1LPSA 3SKVA 1EH5A 3CY6A 3ADKA 3U7EB 1ECFA 3SBEA 3I5XA 1K7FB 4ZRDA 3M5DA 3PGVA 1M83A 4O4LA 5G1NA 3VJLA 4IWXA 4M83A 4R71A 3PGMA 4G81A 4Z4GA 2IW3A 2OGZA 1ZGCA 2AEFA 3H5NA 4L16A 4X41A 2WU8A 3WFIA 3L6BA 4B79A 4BKUA 1GR1A 5CFZA 2PQ6A 1VDZA 2QMUA 2EJCA 2CBZA 1X1RA 4C22A 4URVR 3AUJB 1DTEA 3P9XA 4YRAA 3FUCA 3AY6A 2WR8A 3ZPXA 4ETMA 1H1LB 1N2CA 1G2QA 3FNGA 4BUCA 1Y6FA 5I5GA 1WHSB 3WKDA 3VSBA 1VKOA 3L6DA 1MDFA 1H6AA 3HFJA 1Q17A 2XQVA 5CURA 2DULA 2JD1A 3I23A 1GZSA 1E2LA 3MB8A 4FWIB 2XAAA 5FHQA 3KLBA 2JAWA 4FOTA 1VCNA 2FGJA 4U2FA 3T9DA 1XU7A 3DKRA 4KO2S 4S0ZA 1PUXA 3RYTC 3WNCA 1WV1A 5HJ7A 1WY7A 4OOFA 4MVJE 5F9HA 5AOVA 1HNXB 2R5NA 3FI0A 1KR2A 3NZEA 5FYDA 5KPDA 4OMCA 4C7JA 1AUVA 2C98A 1IUKA 4G89A 4TKUB 4DLAA 4MVXA 1ZD5A 1KAMA 1UPXA 4UBKA 4WDQA 4XEUA 2DZDA 3WNDA 4FINA 1Q16A 4ZGBA 4RTLA 2QOEA 2OCAA 1RJ9A 2MSNA 2RHJA 2H4FA 5E6UB 4GOMD 4AJPA 3PPVA 1GRNA 2G09A 2NW6A 3FHJA 3JQ7A 1BMQA 4KSBA 1KK0A 3DDCA 3KVNA 4NG4A 1HQDA 3RJMA 4BMVA 3KETA 3DEJA 3IPXA 3PXEA 1EWYA 1ONPA 1U31A 3QQPA 1XL1A 3QE3A 2P6PA 3WGQA 2PRZA 5IVIA 1VL6A 2AHOA 3UT5B 3IAEA 3RKRA 2HMWA 3WVNA 4D9BA 4H16A 2D3TA 4QDTA 3ZNPA 2W6PA 4B33A 1C7QA 3U44A 3V2UA 2OD2A 1C2TA 1O87A 2JJMA 3ORFA 4L4RA 3O75A 4RF3A 4RLHA 3SC6A 3TTSA 4E2YA 4UQLA 3VR6H 2B21A 1QMPA 3N8KA 3CGWA 3OIWA 4LJLA 4FHDA 3WRYA 2DBVO 2I6GA 3R9XA 4BRWA 2YYYA 1P3JA 2NZ8A 5DGCA 4ZYVA 1NZJA 5C5EA 4JUCA 1U1EA 2R1UA 5LIRA 2C2BA 4Y2JA 3LGAA 4PQYA 3ZGLA 5DTJA 1XD8A 1XD2B 4F5EA 4H4EA 2NP7A 3OWXA 1KZ7B 2QLFA 4GQBA 4BMCA 3TAHA 3C8HA 1AE1A 1SM4A 5LZ7A 2HH9A 4BRZA 2GJ8A 1FOEB 3AEXA 5JMWA 3H2JA 2W90A 2WDZA 1GKIA 1OXXK 4D81A 3PQ5A 1U6KA 1PLLA 1PZNA 4KK4A 4MQ5A 4QQNA 3GLFE 3SZOA 3VH1A 1YB6A 1OH8A 1T91A 3OCJA 1ZH8A 2BR5A 2ZRCA 1FS5A 4WLEA 1UZMA 3EIUA 1ULTA 3TLEA 2SICE 2B34A 4L50A 1TCAA 3HBLA 2JKVA 3CVOA 3A6DA 4HD8A 4U2EA 4E7OA 3D4BA 5BRAA 4IKOA 4WKNA 4YRNA 5B58C 3WL5A 3W2TA 1ZVVA 2XIQA 2W8BA 3AW9A 3QGMA 4EPTA 7REQB 1SOAA 3U4IA 3QUSA 1BEEA 3WWOA 4C29A 4DKXA 2PYIA 5F2OA 1JIIA 3F7OA 1TI7A 2FXIA 4C6TA 3B8EA 5LZ2A 2FEOA 4LV5B 3ROXA 2HJVA 3C41J 2DBZA 3N5KA 3I6MA 3Q9UA 1PP4A 4LBZA 2G04A 4OJMX 1W88A 1X3SA 4AURA 2YYSA 2WT9A 2QT9A 3L1UA 5KVCA 3I5YA 2K87A 2XXBA 3F3SA 1I2ZA 4JBLA 1TCBA 1COWD 4JASB 1E6CA 4V1CB 5H3CA 3IDZA 1J8FA 1LDGA 1N1MA 1F06A 1DWUA 1Q1EA 3B53X 1VHDA 3QU2A 1C29B 3Q5EA 4GPIB 5CVUA 1PFGA 1XDZA 2P62A 5AYVA 1N3LA 4BE4A 5B1SA 3KJEA 3V34A 2JKZA 4XIFA 1EK0A 1NXWA 2MMGA 2HF2A 3CPEA 3DLPX 3UH0A 1CK4A 1ECGA 1FYEA 4W1PA 2Q0XA 1EFLA 2FZLA 4RMGA 5I9BA 1S3FA 1TJ5A 1RZUA 4J4HA 1CETA 3W77A 5IANA 3RUHA 4MQFA 4DBVO 5E4TA 1DT5A 3D2AA 3OX1A 3HZZA 1CF9A 3BWYA 3L0YA 1Z26A 4HADA 4KAAA 4NDAA 1GZUA 5EE1A 1GZDA 4EGJA 4LJSA 1PAUA 3GUZA 2QTFA 3H9QA 4N41A 4JJEA 1H42A 4LXGA 2ZYHA 3MPOA 4WLUA 1Y37A 3QWFA 4RYDA 1P72A 2O6LA 2DF8A 1DI0A 5A3QA 5ALLA 4GM0A 2BZ1A 3KTFA 4HEA1 3RH0A 1W2GA 3A6PC 1ZMXA 2PHZA 1NIPA 3G0CA 1YA4A 1MOSA 3H1PA 3MWDB 5KCMA 4DE5A 2QN2A 2Q4TA 3RGGA 1TQ8A 2JJYA 2ZJ5A 1K8XB 5C18A 2D2EA 1E7YA 1BE8A 3JSAA 3F98A 2F43A 3D3JA 3D3QA 3QVMA 2ZTHA 1DKPA 4AZTA 1KC1A 1WPXA 2R8PA 5JY6A 2PH1A 4JNCA 1VECA 2WICA 3RFUA 4D6YA 1EUCA 3NHKA 2KI5A 4J3JA 3HJUA 1D7OA 3SZRA 4G2TA 3X3HA 3ZJVA 2AEEA 2VTDA 1KWGA 1HKUA 4X1YB 4Y1FA 3WO1A 5JAUA 1M67A 3WV5A 2BDEA 3CLUD 4D74A 1RR6A 4WRRA 3TGPA 4U8HA 2PGDA 3DOEA 4KGVA 5DHQA 4KB5A 4ND2A 1IZ8A 3WGGA 2EX0A 4ZALA 3HDQA 2JGFA 1QS0A 3DHWC 2RJOA 1A9TA 4F4JA 1SQ0A 2O1EA 2TYSB 4M8KA 3CT6A 1JDVA 4WBNA 2RGWA 3G49A 3EUWA 1HQKA 2Q1YA 4RNCA 1VZ2A 2O2XA 4ZXPA 4A10A 1NXSA 1Z7EA 4UQPA 5ED0A 5JAOA 4LSMA 3G6WA 1UMKA 4FYVA 3WAJA 3LYAA 4J43A 4JBIA 4R69A 5ETJA 2GMWA 5KNCH 1ILWA 5J47A 4PNEA 4Y30A 1ZJZA 5JO9A 4L2IA 4MV7A 1FJXA 3DKPA 1FLDA 1T1JA 2GLTA 3UFBA 3HBMA 5KSWB 1Q0SA 3U4MA 1DV1A 4QFCA 5DH9A 3LUHA 5E2AA 1WUJS 4R1SA 3R7LA 5E6RB 3USES 4B17A 4B6RA 5IAOA 3LYHA 4Y2VA 3VTFA 1FMLA 3FCSB 5JZSA 1JJVA 4LNUB 4MYTA 5TQVA 3KJIA 2FZ4A 5KOHB 3LOUA 3VTKA 1KEEB 2V0NA 3M33A 3TD2A 1RYDA 3WLMA 3VDNB 3I01M 2IHNA 5HEKA 5K6AC 3FFAA 1DO2A 4NAHA 4UNSA 4KN8A 4WCFC 1O0CA 1H8EA 1VJRA 3RRMA 3SGLA 1PJZA 1XTIA 4RAOA 3TMYA 4ZYXA 2ZI3A 3F73A 4OLHA 4C5BA 4KQCA 4Q9DA 5FL7D 5AW2A 3ZTTA 4PO9A 1JSCA 1S1CA 4XWAA 5ALUA 2PWYA 5CAEA 3OC0A 2CXOA 4K2HA 3S28A 4EF5A 2JANA 2Y6UA 2QU7A 1IPEA 4G0VA 3AG6A 2UXBB 1P7YA 4UHJA 4K1LA 3SS7X 2XQJA 1Z2OX 1L7DA 2A9RA 2B8WA 4D80A 1EJ2A 5IXSA 1LZLA 4O4JA 4K6OA 5PGMA 4DLSA 2WF8A 1IXZA 4YV2A 2CHQA 1CY8A 1G8JA 3AUYA 5DTMA 1AF4A 4HYEA 3OOEA 5L8VA 5H7XA 3BMOA 4YUZA 4FOLA 4KMRA 2Q45A 3FF1A 3KKKA 1RWNA 4E5UA 2J5KA 4ZEOA 3PXGA 4L28A 2QV0A 1E2NA 1I6KA 2VZEA 3OY2A 2PX0A 3FZQA 3Q0EA 4G2NA 5KYUB 2HR1A 3K9LA 1MEEA 4I5DA 3F49S 2NO5A 3PG5A 4MPJA 3FHLA 5AVOA 1ZL0A 1UJCA 2EKLA 2Y1WA 3DCJA 3FKQA 4DCNA 4X6XA 2WINI 3IKJA 4Z1OA 2MSCB 1KK3A 3GVIA 3N0WA 3RSQA 2FZGA 4MICA 1JHYA 3V33A 5BW4A 3B9BA 4V0LA 3LY5A 1E77A 3U62A 4M8SA 1Z6GA 5LQAA 4EI7A 1NLMA 2ARKA 4R5MA 5IC5A 2ICAA 4OA5A 4NCBA 2XYHA 2VO1A 4TRNA 4GRIA 4I46A 4JMLA 4KPUA 2GPSA 4H1VA 4PRKA 4XFKA 5B7NA 5IKMA 1I7DA 5TQ2A 1R00A 1U2RA 4PZYA 2BRUA 3GNLA 4BZQA 3EDRA 2Q8PA 3KOWA 1W5TA 3RT1A 4EA9A 2ZXUA 2QX8A 3I2IA 1JHVA 1B2RA 2DPLA 4FDLA 1WTAA 4J9VA 2NIPA 4HEHA 4TN1A 1GQSA 1VSUA 4MQEA 3W2HA 4YCCA 1WETA 2PQ2A 3LXUX 5LBTA 4DZZA 1E9RA 4LE0A 1FYWA 4S3MA 3AB8A 3KHKA 4G9EA 4OV6B 3EGDA 1V5GA 1Z6ZA 1GY8A 2ZYRA 3MCVA 1JFSA 1HQYE 2EZ8A 3DZGA 3GDWA 3GNSA 3R0JA 4P38A 1U6IA 1A50B 1JXOA 1DDGA 2VPQA 4LYYA 3FR8A 3MSXA 1J0AA 4E6PA 4R1NA 1KAGA 3UATA 1K6JA 4X0EA 3K70C 4II7A 4C03A 1L5FA 4WOBA 4DSTA 4FGUA 2CUNA 3MUFA 3QENA 5ELLA 3L6OO 2F67A 5AW3A 2GCOB 1ORRA 5ALDA 1N0HA 5COAA 4BQRA 3DEHA 2RHGB 5FBKA 1PQYA 4L57A 2BI8A 3ZXUB 3IDOA 2JLSA 2OYSA 3P5BA 3PGLA 2WJPA 3CZPA 2R25B 4GEGA 4WXHA 3VNAA 3WLQA 3SQXA 1V11A 3FYUC 4W1SA 4N01A 3DAGA 1CD5A 3TW8B 3M1AA 3B51X 3HGMA 1FSGA 2VL7A 3B1WA 2DM6A 3BF7A 1V4NA 2NNWB 2ID8A 2V3WA 1XQYA 4GWLA 1SRQA 1V4VA 1B8UA 3FTFA 5FQOA 2F1KA 3D6VA 1JBEA 4JLKA 1A76A 4LRWA 2E9SA 5BPHA 2N9UA 2AOTB 4ETWA 1P7WA 4IYJA 5C5DA 2Q6OA 3VR0A 2F8SA 1QHFA 2QUZA 3QBEA 1UQUA 1KDRA 1PE0A 2Q9BA 1GFWA 1VRCA 4IX1A 1LJLA 5LC1A 2I2FA 3P9NA 3EBLA 5EZ6B 3TTXA 4B82A 4C6SA 1GNTA 5KMGA 1XTRA 1F0YA 2C4NA 3ISVA 4RTJA 4GPZA 5DP2A 1AT1A 5IT5A 1ZESA 5DV9A 3KEOA 5TQ0B 1G21A 3JQ6A 5DTQA 4B3FX 4XDZA 1UBLS 4C7BA 3OLVA 4TS9A 2C84A 3IYLW 4M1QA 1CDOA 2ZJ8A 3IE2A 2R7MA 2ZYDA 3MMSA 4LXHA 4QBKA 5BN4B 4EUSA 5JXWA 2ZM5A 2BCGY 3TNDA 1VE7A 3K5PA 2KHZA 3KKMA 4BVBA 4RDXA 2VN8A 4IIDA 3EFEA 1XVIA 3HYCA 4AD8A 4HDRB 3G7NA 1KQPA 4WFJA 5DT9A 1XU9A 3AMVA 1NVAA 1GG2A 5CYPA 1IM2A 1M34A 1PTJC 3AV3A 1L5RA 5FB3A 3DFUA 5IC6A 3SSOA 4YAGA 1ANKA 1JLLA 3I28A 4JD5A 5HQ3A 3D0KA 4JSRA 1MRZA 2A0KA 2FPGA 1SBYA 3GG9A 3TQIA 3V1UA 3WKCA 3C3DA 1N0VC 3ESRA 3VFDA 5AW1A 1XG5A 3P4YA 4E07A 1Y6JA 3TE7A 4AC9A 1FPMA 1B7GO 4I55B 1R88A 4B73A 1O2DA 3ETLA 3EZ7A 1ZNXA 1V1RA 1WIWA 2C4KA 2XRFA 4M0DA 4NRDA 1T36A 4D4HA 1Z0FA 4NVRA 4RFSA 4U8GA 3AHDA 2CWWA 4HYQA 2F3UA 3CRZA 4ZEVA 1GNPA 1XLUA 5CCEA 3ZDRA 4LTMA 3H6GA 5AJWA 4G8CA 3W4KA 2B4TO 2HIAA 1J1ZA 3DP7A 1FU7A 3V4RA 4MCJA 3H6KA 1J56A 5CX4A 1ZGAA 4HDOB 4M1KA 3EWSA 5AKIA 4F1JA 5E95A 2R44A 2W70A 3LVQE 2PT5A 1F7VA 4M8IA 1B73A 4WJKB 3L05A 3A1VA 5CFMA 1GGVA 1TZBA 2CXTA 1FTGA 2IOFK 5GONF 2FAXA 4LF9B 4ZO9A 4N7JA 4FE7A 221PA 2O5VA 3H75A 4BECA 1EUQA 2H9AA 4UTZA 2NVUB 2RARA 3DV9A 2VYFA 2WIFA 2KLHA 1ZK0A 5FR2A 1NYLA 3MIZA 3QLTA 4ZVVA 4Q34A 5T4FA 3BL6A 4BFUA 1QH0A 2EL9A 1JEYA 1ONNA 1OXBB 1P60A 2LXNA 2PX3A 4WXMA 1JR6A 4MLZA 1RC0A 1T2AA 1UMBA 3W5IA 1ZMTA 4QECA 2EKZA 4ZQBA 3DYIA 2QUAA 2IOHA 3FUTA 4QDKA 4D41A 3IDAA 1R8XA 2NSJA 3D59A 4I4NA 1JDTA 1DINA 1R6BX 5LQKA 3QBJA 1KKUA 2JGMA 5DGTA 4REOA 4RKWA 4F3NA 4I8XA 4LNHA 3VDQA 2M9MA 2VCYA 3ANYB 2CJWB 5HS4A 2DGDA 1GV1A 1EGQA 1U63A 3K9CA 3OFKA 2VKTA 1E99A 2UV8A 4ZJUA 2P68A 5J40A 1J23A 2Y8EA 1M5UA 4I9FA 3PXBA 2GA9A 1YUNA 1W4ZA 1Z3IX 2BJWA 2QVLA 4RHEA 4UULA 3U48A 3X1DA 1G20B 1QH8B 1G98A 2JFYA 2P7IA 1MGPA 4OSEA 1ZA2A 1U90A 2AZDA 4B4WA 4RGYA 1PSDA 3CF4A 1A27A 2IY8A 3KM0A 1Y80A 1CIVA 2NQ8A 2IDJA 3G1WA 1QTNA 3RS0A 1F2DA 1I4DD 1VKNA 3X44A 1I14A 3LMKA 2OORA 1AIPA 1X38A 3NS7A 1QH1A 1UEJA 5AVQA 2PUGA 3BMQA 3OZAA 4CM8A 1D4ZA 3VDMA 2J7PD 3BXFA 2WU3A 1NMZA 1BX1A 1ZM9A 2UZ1B 4LYAA 5EZYB 5GM1A 5I51A 5D1HA 3IIIA 1FNSA 1NW9B 2WYUA 2QSUA 5BWNA 2IXEA 1E1RD 3GGOA 2FEMA 3KLMX 4QA9A 2PR7A 4XUEA 4CF4A 1S2DA 2QJRA 2H16A 3NTVA 2BOVA 5CPFA 1NMSA 5LZ5A 1L7XA 1XCJA 1E3SA 2G67A 4PCLA 1UM8A 3CUKA 2WWHA 5F7ZA 2XTAA 3VV3A 1P0CA 2MWMA 4NZZA 3ASYA 4CLEA 1U6JA 4EY6A 4JOBA 5K8IA 3QVSA 4JI2B 2NZJA 5I4KA 2WSLA 2I7TA 3A1EA 4J0FA 1RRPA 4HWSA 5JDIA 3D3NA 2XVAA 1TC2A 1HFKA 2G9QA 2QN8A 1CP3A 4RD0A 2X0IA 3FDZB 4IDGA 2ONJA 1CUZA 3U9SA 2QRZA 1YBHA 3IUBA 3QRWA 4LRUA 3UOWA 5IAAA 3SYTA 1OIXA 2DCUA 3DDSA 3FSEA 4C7OA 1CUXA 5ERGB 1E9CA 1WUIS 2WU4A 1N2CE 3PL5A 4QYSA 5TMPA 3L0CA 2LPMA 4PVCA 3J81A 4LHZA 4R9RA 2HMAA 2FWBA 4NBKA 3ZHYA 4XWKA 1RZRD 2GB4A 7MHTA 1G3MA 2NXNA 1RIIA 3IDQA 2WUDA 4IDQA 1Y1LA 4G1CA 9ATCA 1O4WA 4OHMA 4PSVA 3G5UA 3FF4A 3I3SR 3ZWNA 2Q99A 3HDTA 3J81k 3CO0S 2GHRA 3SZMA 3ZWBA 3FUUA 1HT0A 4FD3A 3QHPA 1MG5A 1WF6A 1XA4A 3R8XA 4ALLA 4G0NA 1FW6A 3RVMA 1C80A 4I9NA 3V46A 4X66B 3EF0A 1P2VA 4GFDA 4FW8A 4TTTS 1AKNA 3TW0A 3Q3VA 5CDFA 1A2BA 4QDUA 3RS3A 2C7GA 4E6EA 3WMFA 3EGWA 1VB3A 3DNMA 5TXGA 4KIJA 3KXKA 2O0KA 4AF7A 4WAUA 4PSDA 4PYKA 3AF0A 4GDMA 2YOHA 2OQ2A 4H7PA 3O1LA 3WRYC 4ACBA 1UM9A 3DGFC 4OATA 2UZAA 5IM4A 1UOEA 4Z5XA 1BHO1 2A6PA 3VC3A 4JUDX 3M0EA 4OHUA 3CW8X 4ZVOA 4BJ5A 3HV2A 1YCHA 1NR7A 5JMOA 1ZYUA 4HNRA 3PFIA 4HWGA 3RLIA 3T6KA 4LQ4A 5C5CA 1K3TA 2ST1A 3M34A 4P82A 5AI0A 2P1ZA 4Q18A 4Z51A 1A8PA 5LD2B 1ZBQA 3TQQA 2QTRA 1G3UA 2R60A 4RPJA 2JLXA 1GSIA 2Q21A 1C1XA 1N57A 2ZRHA 3CN7A 3NYWA 3OX4A 3PE3A 4FHFA 1UANA 2FP4B 3H3XA 4AJOA 1Y3HA 2ZYTX 4DDMA 4UVIA 1Z9BA 4NXMB 1GRCA 4HX2A 1VJCA 4R8SA 2BMVA 1DCKA 2FMTA 1MX9A 3P9CA 2F3PA 4ZEXA 3AFGA 1JQ3A 4NECA 3UMFA 3VHQA 1D03A 2XCUA 5SYAA 2F62A 4GMFA 3L0SA 5L3SA 4F8YA 2Q62A 1SCKA 1K5PA 5K7SA 1VKZA 3G9UA 3ONDA 4S1TA 2RGYA 2CV0A 5ALJA 1QH9A 4QODA 2PBLA 1TKBA 2L69A 1ZGHA 1KTVA 3BRWA 2H1LA 2HPHA 1XK6A 5B64A 3DR5A 2WMNB 1JG6A 1F6BA 1EFRD 3K30A 2XQKA 3GMDA 3EA4A 4D3YA 3KQHA 3DMTA 1BG6A 1I7LA 1SUCA 2X9GA 3EZ2A 1CUEA 3QKSB 4QWWA 3HH8A 3QBVA 4A0GA 3NGLA 2JARA 4R8VA 5GOTA 4D9NA 1GUYA 4OLFA 1W4AA 1O6FA 2PL9A 3FI9A 4HS9A 3KVRA 3RNLA 5AVSA 3A9SA 4ALJA 4UC0A 3VYSB 4KFTA 2XUAA 1LPBB 4DA0A 2XGJA 1EB8A 1JQKA 3KHSA 4KO8A 1W2WB 4P4SA 1I2AA 5ER9A 1TMKA 4ZZ1A 3CZAA 3QNUA 4XGKA 2O7QA 3A0RB 3PFHA 3CWQA 3TECE 3G3EA 3EAQA 2ZUEA 1UR5A 1WDLA 3RODA 3A26A 3CUVA 3AC0A 3PDUA 4YH1A 5JANA 1E5DA 1EP3B 2JIDA 3GIWA 1ADCA 2J41A 2JIBA 4D9HA 1B8NA 1II0A 5JHHB 3FZEA 2BEVB 3AI7A 6ABPA 5EYPB 2ZAYA 5J1SB 1E4VA 3OQNA 4Q02A 1LF0A 1NOJA 1BRMA 1NXPA 1HETA 4UCXA 1KH2A 3DZFA 2G5PA 1O6BA 3LUBA 2XTZA 4CCYA 3UAXA 3U3KA 3A2KA 4LJ9A 3VJKA 4F91B 5LPNA 1XIVA 5TPZA 1Z8HA 3IFSA 4CKBA 2RG7A 3VX4A 5JD5A 1C30A 1LW6E 3LG2A 4FUTA 4XWOA 1PBNA 2GEJA 4OH1A 4WKPA 4W5NA 3HLYA 1ZD9A 3OE1A 5A62A 1HOXA 4IMRA 1VIYA 4CM9D 3GRFA 2GF9A 2BMFA 2J32A 4UHFA 1Y7PA 2G80A 3SR0A 1V6AA 3LT2A 4I1IA 4MIEA 4ZDKA 1OREA 2X0DA 3LECA 1GA6A 1X9IA 3ROQA 3OVMA 1FS4A 4QLAA 2V9CA 2G1JA 5EHZA 2FOLA 2OWEA 4HI0E 3JY6A 2NZYA 5TLSA 1J39A 1DT3A 2DAPA 1B16A 1VGQA 3FA2A 3NAGA 2Y1DA 4H7EA 5G2OA 3C5HA 1UMCB 3BBPA 4ZOQI 4AM8A 4HVAA 2CSXA 4Q4JA 3GGSA 1R15A 4JJ7A 1I2DA 4ZC8A 2VRWA 4B44A 5DI3A 1CJSA 4P22A 5HKKA 3PPYA 3NKVA 4YT5A 1XN4A 1TVMA 2I29A 1M2HA 2QORA 3QBDA 3STHA 3GAZA 4LDPA 4TWJA 1ZD4A 4CV0A 2OCPA 4CHTA 4BAUA 4BQEA 2JCVA 4DV3B 2FJUA 3EGXA 2IJGX 5IH7A 1M8GA 3KXDA 1RQNA 2I65A 4L7VA 3FH0A 4P83A 4UATA 3UBMA 1F60A 4PPFA 4WA8A 5A5GA 1FVHA 1QIFA 4QJ4A 4XEHA 3H8WA 1V8ZA 2JD2A 3FUXA 1HE3A 5DMXA 2DH6A 2WRZA 3O91A 1JWBB 4FYXA 4BB0A 1I80A 1JIXA 1SU4A 2JLAA 3ELUA 4J75A 4ZAGA 2NU9B 2OEPA 4QBGB 1G18A 2ZJOA 3X1JA 3ZDFA 1O97C 1E98A 1PW5A 4ALKA 1C7RA 4Q7MB 1U2EA 5T4EA 2QM8A 2IF2A 3MS2A 5ELMA 4M1OA 1ZJWA 4BXOB 1J8QA 5JH7A 1JKIA 3HNPA 1L7AA 2AFRA 1Z2EA 1HE8B 1NC1A 4BV9A 3LA8A 1AQYA 4TLMB 1FFXB 1M1NA 1TJYA 4MW7A 3SXUA 2CEAA 4YRBA 3KR2A 5KJEA 1BNCA 4BJ1A 1KY5A 2ACWA 3QX8A 2W48A 1YOVB 2FFQA 4OLBA 1Z4IA 4CNQA 4R6WA 4WACA 5A5DA 1RYHA 5B5SA 4WDRA 3HA7A 2QROA 3QMPA 4HO1X 4FBLA 5DNVA 1PV2A 1UIMA 3BTSA 3KE9A 2RE8A 1L7RA 1BW9A 1V9LA 2OXRA 2UZ0A 2VDLB 4AMBA 1EDDA 4GZLA 1Y8CA 4GGMX 1ZXXA 4WXRA 2PZBA 3LOQA 2V4ZA 4YGYA 4N3BA 4WZBE 1KI9A 4XQ9A 1ZW6A 1G63A 2P67A 2F4VB 1I3KA 4OQFA 3HWRA 2XNKA 2XUPA 1E6LA 4P86A 4HZUB 3BJZA 3QU7A 1KJZA 4NICA 2EKDA 5CM8B 4F97A 5C46F 2Y71A 1XZPA 3ONEA 4EARA 4Y9UA 4KPFC 2J3QA 1P18A 2PMKA 2VAPA 1CRLA 1EFVA 3G2HA 3MTJA 1VSQA 3Q9SA 4G5QA 4M46A 1UEXC 1B3RA 4O2LA 1A77A 3KZNA 5HBRA 2GBFA 2PGLA 3E22B 3GD7A 3OH8A 2P0EA 4FDAA 2AWOA 2RAVA 4EG7A 2CXNA 4W8GA 2IKSA 3EDYA 5BSUA 2O3RA 3MBIA 1L1QA 3EXEB 3UK0A 2E6UX 3C4JA 4OO3A 1N7JA 1QGOA 4PSCA 3UAOA 2AOXA 2Q6TA 3NLLA 1ODCA 4EFDA 4US1R 1FTQA 5EPOA 2F17A 1JMKC 2VJMB 4GIBA 4UVGA 5DBHX 3PPIA 1QCZA 3KQWA 2APJA 2PD4A 3ICEA 1O89A 1A71A 4Z1MD 4CBVA 2BRUC 2V03A 4Q6BA 4ESHA 1PGJA 3VDXA 3L7DA 2WUEA 1DEHA 2DT5A 1ZJJA 2CMGA 2ZWOA 4FGJA 2B0JA 1QKIA 1W73A 3P9QA 1LA2A 1THMA 5EMMA 2CLSA 4D44A 2R1VA 2Z8XA 2CKMA 3E2MA 2QRNA 4XOIA 3AFHA 1HZZA 4U5XA 4BUZA 1LSOA 3V80A 4EUKA 3AF2A 4RIFA 1X7XA 2I91A 4FM9A 1M72A 2VJPA 2X5NA 2HOQA 1MD9A 1XTPA 4BPBA 1CB0A 4D8XA 1R9GA 1Z2PX 1CZUA 2Q9CA 2WUVA 4PLZA 3PUYA 4RFVA 5K3BA 2ZJ1A 3SYRA 3M6LA 3N58A 3I0MA 3S29A 3IO5A 3TTYA 3C7AA 2P9ZA 4ZOLB 2YN0A 4BTEA 4KRFA 3PZBA 3FWKA 4RKYA 4UM5A 3UQYS 2UUBB 1JG7A 2O06A 1WZEA 3OKAA 3VNSA 5JJLA 2B20A 2XT9A 5C1PA 4LHEA 4DIOA 2RD2A 1DTWB 2D3WA 2FXVA 2JCBA 2V9ZA 4KGXA 3PF9A 4NPCA 3THOA 3TM5A 3KT0A 4FBGA 1DARA 2W4QA 4HDNB 4M86A 3ADBA 4F21A 3O9VA 5JXJA 4L4ZA 3FR7A 5KYXB 1GP2A 1XQVA 1Q2UA 3H13A 2QPTA 3ODPA 4H31A 3P0RA 4QT4A 1L5NA 3COYA 5J63A 1U0BB 1DJQA 1QO9A 4C1NA 2AMFA 5K4HA 2CJXA 1CNMA 1SUBA 3CZ9A 3JU3A 5FJIA 1P81A 1KBOA 3EOZA 3ADOA 2A59A 2DWCA 4OFZA 3PC8A 1EBBA 1OJ7A 1XTZA 2PKRA 4IEFB 3UNXA 1Z5ZA 3LUGA 2MSKA 3H84A 4MYDA 4X97A 2XJ9A 3ASZA 4HS4A 1UBKS 2X3YA 3RB8A 3V8MA 3EZGA 2XMDA 1NG9A 3T7DA 3DB1A 3LTEA 3NJRA 1MEOA 2VA9A 3OEHD 2EV9A 1C3OB 2REQB 1EM6A 3HO8A 4LCJA 1YR2A 2QAJA 2FEAA 1JB1A 4TKMA 2OBYA 2RGAA 5HBGA 1JJFA 3BRQA 4AUMA 1P4JA 5CJJA 5ALYA 5B3KA 2ZQZA 4QUHA 4OREX 4I2VA 3AJDA 4BX8A 4F72A 4B4VA 3CURA 2XA9A 3RO7A 3OQIB 2OO3A 1QQAA 2DPXA 1EVIA 1V39A 3S5UA 2C9ZA 1UXHA 3L84A 1U0FA 4ZQIA 1H66A 4H1TA 3IAAA 3I8OA 2GFQA 5CA1B 1HRKA 1OR8A 3B1XA 3QU4A 4DNOA 2JH9A 3HFGA 1W9HA 4D9CA 5EUCA 5T3YA 3BPSA 3R7WB 4A8JA 5D7NA 3II6X 4G3XA 1B0ZA 3GLIA 1V6SA 2VS1A 1H94A 3R0QA 4UFPA 1XJ0A 3MJEA 4Y0AA 3IQWA 1USIA 3BIOA 1VYVA 5DCUA 3DCYA 2FRDA 1G8YA 3FETA 4QQ8A 3UB4A 4GGPA 4MW5A 5G1PA 3ZY6A 4MI6A 4MO2A 3T7JA 1L4EA 4X94A 4AF6A 4BFTA 1L9XA 1N5LA 3MWYW 4QTTB 1J7KA 1CJKC 5ENVA 3FTQA 4GG1A 1L1RA 3FCUB 3VZQA 1PEKE 1KZ1A 1U28A 2HWKA 1W0KA 2ZULA 3DAPA 4LGVA 4V24A 4EEZA 4WUTA 1GUZA 1NBIA 1WKVA 1ZEMA 4KXXA 4BBAA 2OZEA 3CKYA 3UMVA 3F96A 3ER6A 1GT6A 1L5ZA 3C1UA 3GEDA 3IXMA 3K1YA 1Z4NA 5C7OO 1QWOA 1V43A 1HYEA 2ENWA 4H9GA 1ZI6A 2I2XB 4QATA 1XRNA 2Z9CA 1GTMA 5CP8A 5JLAA 2PWBA 5BV2P 1G59A 3M4YA 1K7YA 3GEBA 5DWQA 3IQDB 5EPEA 2FU5C 1DHRA 2C4MA 4GZ6A 1NN3A 1B41A 5GPBA 2GASA 3A70A 2J6CA 5GY7A 4LJAA 4QYIB 4CEHB 3I39X 2HO4A 3PNVA 1OBOA 1YS6A 1DIHA 4IDNA 4EB6B 5GJBA 2V4MA 3DWGA 3U37A 1Y0BA 4RQAA 3WQBA 2BFDA 3OICA 4L95C 1QVWA 1O9BA 2PGXA 1FNBA 2Y2VA 3L8GA 2QYSA 1AA9A 3R6TA 2E48A 1UFOA 2COUA 1TKRA 1S0UA 1RQ2A 2IDMA 2B1GA 2D5LA 3CX8A 1DAFA 3D6HA 1GQRA 4I4LA 4OAOA 1YZUA 4QPPA 4BKRA 1E3WA 1KYVA 4D7AA 1Q1NA 1FX1A 1PJQA 4PO8A 3EAFA 3ECCA 1PT5A 3LF2A 4RGBA 2GD0A 2ZEJA 4QIHA 3UWPA 2GS9A 2SKDA 3DC2A 2DYKA 3EVFA 1U2SA 3JD3A 4HZGA 1T35A 4QYXA 1U7TA 4LY9A 1EGMB 4YRMA 3J7AC 1Q7BA 4DY4A 1DHTA 4AL4A 1FBTA 1NNEA 5A6SB 1P31A 3FPGA 3RVSA 2HA5A 3TZLA 4KR6A 3GEEA 2VCHA 3FPAA 3UG7A 2RHBA 5DM4A 2J3MA 2AEMA 2PLFA 2ZB3A 4NBLA 5EXSA 1WCIA 2X9QA 3PX3A 3QTTA 1HC7A 1UFKA 4MA0A 2QL5A 4URHA 2AQIA 4XYGA 1GZ3A 3WJAA 3N2GB 1M10A 5KYYA 2JNWA 2IPNA 2OORC 1GFIA 1M2FA 4KFSA 4AT1A 3Q5DA 3W79A 5A1JA 1Y8AA 3C4QA 2D2VA 4KC0A 2C5BA 2FEXA 4KAXA 4LUCA 8OHMA 4YP6A 2HPZA 3MN1A 4P4TA 2GKGA 2GLXA 5E4FA 4IO0A 4TMFA 1ULAA 1US8A 2NZUG 3RASA 1NVKA 1DB3A 3OPQA 1UBSB 4ZREA 5IEBA 2YNMA 1EFPA 3TJZA 3AJRA 1FYVA 4NU8X 1RMYA 1YR6A 1WE2A 4QHTA 2ZE7A 3R7AA 4ETNA 3EWAA 3W5CA 2EKBA 1YHYA 2IYAA 2JLCA 2WKWA 3HV0A 3BWMA 1V2HE 5JTUA 4PGFA 3VZDA 2AMYA 4DANA 3NWEA 1FXWF 3BIJA 3STWA 2K7ZA 3LP6A 4ND8A 3S7ZA 3I4FA 4UBIA 4PINA 4O4IB 4ARVA 1GU0A 3QSYA 3LBHA 3WSWA 2PRSA 1J6UA 4H17A 4RHCA 3SP1A 4BO5A 4H7HA 4RADA 3JARA 4LXQA 4LFBB 1QZTA 1LH0A 1TMGE 5DPMA 2HI0A 5EJAA 5JDIC 5LN1A 1ZNQO 2RI6A 3NDJA 1R0KA 3L1IA 3P4XA 1IPFA 3QLEA 3SE7A 4L0MA 4OQ4A 2IQIA 5A3SA 3EW7A 1ODTC 4INAA 3RLFA 4BMDA 3A6LA 3JYOA 1JJIA 3RFTA 3U4DA 4U7HA 2IVFA 4F7WA 2WT8A 3UJAA 3V9PA 5HDBB 2RJNA 4BWVA 2FG5A 1UF9A 1IZ9A 1V9SA 5KNBD 5C7YA 4NOMA 1CIJA 3F8SA 3KEQA 4DAEA 3RUDA 5F7XA 3RHFA 1BS1A 1RXEA 1GT91 2HWYA 3DTVD 3AFIA 5KX5B 2FJ0A 1IWPB 3ZOZA 3EBOA 3NTUA 4PYLA 5DLDA 3REGA 3GWZA 5CK4A 1P5JA 2XTNA 3I6QA 1UDCA 2RKOA 4KAJA 1XBTA 2H2FA 4NENB 4HH1A 4FYYA 3G0GA 1IUNA 1MVOA 3KZ1E 4NZ9A 3ED5A 2CWDA 4RORA 1POXA 2HPAA 3E5MA 2ZVDA 3DM9B 4LTDA 4I4TA 4X8LA 3SS8A 3VR4H 2Z9DA 4RPCA 2CJYA 4QOEA 1NVDA 1USWA 3ONVA 1NUTA 1CCWA 3AKYA 3W5SA 2CXUA 3TLMA 2X5KO 1YDGA 4Q3OA 5F7JA 5J59A 4CT4B 1KO8A 3PUJA 3WIBA 4DM4A 3FHOA 3LWZA 4GI7A 1JHXA 1I7NA 1TT5A 3GEGA 3GLHE 2J59A 3S1LA 1U9JA 4BZXA 1YC2A 4GR4A 4XWWA 1CVIA 5F64A 3JYNA 2A1TS 3AI2A 3ZHCA 3FPBA 4BV2A 3TS1A 4C0LA 3KEGA 1J90A 4DMCA 2C0CA 1T5OA 3NHZA 4UUAA 2GBCA 5EERA 3PJEA 1KORA 5EIWA 4F9FA 5ICCA 2VHZA 3DFIA 4K46A 3K8QA 3RRJA 3N9IA 2AI3A 5DNAA 1RRCA 1CY4A 4UNNA 1Z2CA 3CS3A 1N1DA 4OQZA 4A9AA 1DQYA 4FWTA 2NUAB 2NZWA 5CT5A 2WKPA 4MA5A 1HYBA 4Q19A 4Z99A 2AG5A 1C8KA 1E3IA 1NUSA 5EJ5A 4Q12A 1ZRHA 2BUCA 3ASUA 4UQOA 3AGPA 1BMTA 1YZHA 2A0FA 2E4ZA 1I24A 4CKCA 1ZJ4A 3DZBA 4S1VA 2NVBA 4RK1A 1XUOA 1Y9EA 3AX6A 4TKVA 3CG4A 1NI3A 2JBAA 4L72A 5E0KB 3WHKA 1AVTA 2QD4A 2QXYA 5FA5A 5A4KA 1I3MA 4QJ3A 2ZM6B 3Q9LA 5AHWA 1AS2A 2PKCA 1IQPA 3M1IA 4ATNA 4MVJP 3DHVA 4RSMA 4QBIA 3RR2A 1BD4A 1DWOA 3MXOA 3RC8A 2GZ2A 1Z4LA 5DNDA 2V7VA 3GCXA 2HREA 2O1XA 2EIXA 3E61A 3EZFA 1JXAA 3TRFA 3ORHA 2VK8A 3ZN2A 1Z07A 2ZIGA 1IL0A 1NUPA 2P9TA 4IS3A 1EKXA 5HOQA 1PG2A 1J20A 4M1ZA 1UXIA 2CDBA 3T94A 5JUWA 1RT9A 4RULA 1W1WA 3DMTC 4AJJA 4Q3DA 5CB4A 2WG0A 5AVWA 3WDSA 4ITVA 1AX9A 3H86A 4PXYA 1L8AA 1SBZA 3RVPA 1XZEA 3PITA 1WRBA 1NSTA 3LD9A 1A7KA 1OMOA 4QUKA 1AKMA 2AI2A 2JLQA 1FFHA 3D4IA 2XBUA 4I50B 1Q74A 2PANA 3OCWA 1YVPA 4Y6OA 1N6HA 2BF7A 3HJBA 5ESDA 3HDHA 3TAUA 4BO2A 5F1PA 1BHQ1 1L7NA 4KP7A 4UPEA 1C9DB 3KX2A 3SBDA 4BZZA 4X62B 3OJWA 2X0KA 5ALMA 5L3VA 3M9WA 1OWLA 5IWCA 1K86A 2EBWA 3COPA 2PGAA 3T5MA 3OZRA 5LA6B 2VEOA 4TL8A 4KR3A 4Q1BA 3AVOA 2C4VA 2EWMA 3T3PB 2MR6A 4E08A 1KZGB 3Q88A 2Q7XA 3BE6A 2WZCA 4HUJA 2AN3A 3A1SA 2IWRA 3SK0A 4OMUA 2ZSFA 4WZ6A 2A0YA 4DIFA 1TZMA 4NK4A 4YJGA 4AYWA 5INTA 1AKYA 4ER0A 4BQSA 2OHOA 3AUUA 5BUCA 1ABFA 3DBRA 3JQAB 2Z5FA 4O2RA 3D0QA 1JLKA 4RVHA 4EYOA 5FPKA 4K40A 2AOUA 1IZYA 3K9HA 3ZK8A 4AXBA 3EEYA 3JATA 2RC6A 3PNPA 4MS1B 4ZT4A 3HR7A 5KDOA 1WNFA 2CXPA 4FZ5A 1N9ZA 1CQIA 2X0NA 3FCEA 4C5AA 3MUNA 3JZIA 4PM4A 1Z88A 4I1SA 2JRLA 2QM7A 2ZIFA 2O8BA 4EZIA 4CMEA 4H4CA 3TL3A 1BQ3A 4Q7QA 2IYEA 2XX3A 4H1HA 1QGUB 2GERA 2A9KA 2J3EA 2ZRBA 4UPVA 4DADA 4PYJA 1LWOA 1U5BB 3U6BA 4GW3A 3OFND 4LW8A 1R6XA 2GAOA 4US2R 3N53A 5K8LA 1N2GA 4MGIR 4Q1VA 1IOWA 3IA7A 5FUXA 5BW8A 4HUQA 5CGQB 3CXRA 2C97A 2RGUA 3IQXA 5FFMA 1SK8A 1SG9A 4L9SA 5K2MA 2UUAB 2J5QA 5C8ZA 5AH0A 5JPDA 4U2GA 3X2EA 2ZROA 2MYUA 3F9IA 4TV8B 3IUYA 5F9FA 2Z09A 1M0TA 1JZTA 1OIVA 1ZL2A 4ISCA 3T06B 3FOFC 5E7JA 2PEYA 4XYMA 4KWCA 4U6NA 1CFZA 2FUG6 2FNAA 4UU0A 4WV3A 4H15A 3RSGA 4I6EA 1PQ4A 5TRTA 3OPXA 1OFIA 3H1BA 3FG9A 3ZLBA 2KPOA 3HKDB 4KMMA 2R48A 3T7IA 3ESYA 4UHBA 3PHCA 1RI5A 4GOKA 3BL8A 4Z4QA 1JEQB 4WERA 3JQGB 1RWPA 2D5IA 5HF9A 1TO6A 1QRDA 3O4FA 3Q8XB 4LF4B 3CF4G 3N2KA 2ZG6A 3O8OA 4NXNB 1UK7A 3M6XA 1AQIA 3THXB 4MMYB 1QLHA 5EIXA 2BR3A 4I1YA 5MF6A 4H6XA 5U9CA 1J2UA 5AI4A 1C8BA 2ZSBA 3NRCA 3E5NA 5DJ5A 1GZ4A 1RRVA 5LUBA 5JD6A 4HQLA 1DG1G 4NEHB 4HP8A 4X95A 2WK1A 2Q3DA 3TOSA 3R5SA 3A2LA 1PJAA 4JB2A 2WVHA 3V2IA 5AW4A 4NU0A 5C9ZA 5IBCA 521PA 4BNDB 4J91A 7GPBA 1XDSA 3AIMA 4FMBB 3JQFA 2LNDA 2MDTA 1FFDA 2WW8A 4OQMA 4H08A 2Y68A 1T9DA 3BB3A 3GJXC 1QAMA 3HSKA 1Z62A 2AZMA 2WSYB 3TPZA 2CJFA 1ESEA 1LLCA 4OBBA 1OH7A 3HK2A 4J3FA 3OO1A 3JQEA 5IWAB 3OD1A 1X1QA 1L5OA 1JDPA 3FTDA 1GPDG 1U65A 3KQKA 4MNTA 3ECSA 3RV4A 5M2QA 2XUQA 2EZ9A 1SVKA 2WKSA 2XNSA 2YRXA 3K09A 4NULA 5JU6A 4ZU3A 2J9FA 3DLIA 3QE9Y 1T5SA 3VRHA 1HF3A 2A3NA 2AVDA 5I7FA 3JWPA 3L40A 1PL6A 4D0NA 3HXOA 5AVZA 1RAHA 3NATA 3T5BA 2HM7A 3QI2A 5JADA 4OLAA 4E94A 3OJCA 2VBGA 4OUKX 1Q1AA 1MCZA 1CDEA 1ODIA 3I5MA 4IAOA 1LTKA 2IIPA 2VQ3A 4IIHA 1XVLA 2HLDD 3UJPA 4DC0A 2EKPA 3ZHBA 2GAJA 2WTEA 3BB1A 3QJYA 3KKEA 4KKVA 1R0XA 4OBWA 3WYGA 1QIHA 4DUGD 5M7EA 5GAJA 1THGA 3HJGA 2L42A 4IDPA 3LHDA 1B15A 4E13A 3LLCA 1IJKA 4MYSA 1HZZC 3ZWWA 5LXTB 1P74A 4IV0A 2GK6A 1NQVA 5KHOC 3NYIA 4DPMA 1O94D 1FYDA 3EXHA 5SY9A 5HW0A 5FTMA 5AFSA 4ITUA 4KIUA 1ORWA 3FCCA 3HG7A 3UFXB 4BLUA 4PFSA 1TAQA 4GMGA 3ZCTA 4EGCB 2XKKA 3WDMA 2XZLA 1RLJA 3OUZA 3Q12A 1TECE 3NGMA 3QPWA 3T3DA 3UXHA 4CLXA 3ICOA 4EY5A 5FEUA 3GOQA 2H65A 5HZKA 3BWCA 3QU9A 2LVBA 2ZUFA 3SQLA 4EITA 2MU1A 3UYKA 4CEJA 3ZH9B 1U2ZA 4TV9B 3WMXA 4BRUA 1K0FA 4XTCS 1RAAA 3MJTA 5I9IA 1VLJA 2QR2A 2RBGA 2HFKA 4J0HA 5BR7A 3AZPA 3UVEA 5KQRA 3AF4A 1GPWB 4H6VA 1AK1A 4P84A 2NXJA 3TIGA 4JBYA 2PAAA 2MT9A 1S2OA 2JAXA 3FJYA 4PG4A 4FHEA 3OZXA 3ME5A 3DDNA 1Z7YA 2V5AA 1FUIA 3C6QA 3TBFA 1XJ5A 4KYTA 3PC8C 3LYUA 4AKGA 4JQZA 4RD4A 4TMZA 5AK3A 1GGKA 4HVTA 1E4OA 4R1TA 1Y1QA 3AVWA 4OI4A 2CMKA 1K63A 4XOUA 2WM2A 1CYDA 4IYRA 1JR3D 3VU3A 1GJRA 5A4DA 5I45A 1TUGA 1QX3A 1S8OA 1RP1A 3QE4A 4FI3C 1MJFA 4RABA 4X8MA 5FA6A 3C4VA 2OYCA 3I2GA 4ND1A 4XVHA 5F9MA 2QX7A 1FMTA 1P9WA 2FVYA 4LHWA 3SY8A 3UW1A 4UMFA 1ACMA 3L7LA 2QAGA 4RK0A 5K0SA 4FHZA 5ARBA 3U26A 3FB4A 4ZICA 2AN1A 3DDHA 3N6RA 4FOSA 1ICIA 4KUEA 5DNWA 4A92A 4H3VA 1M1YA 4WFKA 2BEUA 1G4UR 3PIIA 1U3TA 1VKRA 3A2MA 4WH0A 3ZDYB 4FW9A 3KDPA 4AIIA 2J85A 5I7RA 2H7CA 3OI7A 3FFTA 3MS4A 4K9LA 4LFCB 4PC6A 1Y8QB 2JVIA 2QRGA 2C61A 5EHIA 1CUIA 2X19A 2QF7A 3LFHA 4YXWA 3DE4X 3EVAA 4MS3A 5KC8A 4PCAA 1NAIA 1SOVA 2IHJA 3WO0A 4O2AA 3DBLA 3WLRA 4I14A 2J5XA 4B3SB 3REOA 2C5AA 3GFTA 4A8JC 5ITVA 3R9XB 2W83A 4FSXA 3E18A 4YAUA 5BMVB 1FTNA 1PWZA 4NR0A 3NT4A 4KEAA 4P5DA 3HJFA 2QPAA 4FHGA 1GDHA 2FRDC 4QXRA 3DMNA 2H92A 2OAP1 2Q3FA 1V8PA 2CC2A 2GEFA 4GU5A 3LY9A 5FOSA 5LKRA 2O2SA 1IM5A 1UKCA 2QU8A 4WNIA 1MDBA 3GAMA 4XSGA 4MRMB 4C4XA 5MHTA 1HR0B 4XRRA 3HUFA 3COJA 5EGNA 1E5XA 1I5OA 1OTXA 2ZVQX 3FB1A 1OF1A 4TKZA 3MYYA 3TMAA 2WY2D 2XVYA 3QMVA 1U28C 1DC6A 2W42A 1XLWA 2IPAB 2B8NA 3C3XA 1XQ9A 1T2NA 5EEGA 1OXSC 4GRDA 2O0LA 5JWHA 2A5YB 2P6UA 4LGCA 3FMPB 1M2OB 5I7OA 3GLIE 1T3HA 4R1PA 4JWKA 1QGYA 5TPWA 2IU6A 4Q1EA 4LEIA 1L4GA 5SY4A 4GKAA 2R86A 3SZ3A 2DQKA 3B3GA 1PGOA 3NWJA 2QRKA 1TZJA 4FJ0A 1ZO8A 1LJUA 2N47A 1SUFA 3WK5A 4ZHQB 4NU5A 1XCGB 2ZSDA 1M75A 4BX9A 3Q6NA 3L7MA 4QZVA 4LJ4A 3ZCXA 5FWAA 3TUJC 3PQ2A 7ADHA 1OX6A 2X4IA 2OSVA 3W9YA 2OV6A 2HIMA 5JNRA 2B1IA 4G63A 4WVLA 2XUJA 1T3LA 3EXIB 2Q6LA 2IHYA 3LKBA 4M49A 3TOVA 3B5EA 2EZ4A 4X24A 3NRBA 1HURA 3IOYA 1Y5IA 1NP3A 4OKSA 3KPVA 3L6UA 4TQ9A 3ROGA 2GEKA 3TLGA 2A78A 3UMGA 3U81A 3ZY3A 2TMKA 4NJOA 1ICEA 5K01A 3LP8A 3DXFA 3DDZX 3QOXA 2DOKA 5GV8A 3HJNA 2CXHA 4RD6A 1ID1A 3VAYA 5KNDD 3MSCA 4CMHA 1XPUA 2N1MA 3U16A 1CVRA 2FUKA 3CYFA 2ZT6A 4LJ5A 5AVJA 1UXJA 2CLFB 3O2JA 3RVLA 1U0GA 4RMIA 1UMDA 1H4SA 3JV7A 1WABA 4L27A 2PR2A 1V7ZA 1YZVA 2E82A 1X15A 4XGRA 4R1MA 3TN7A 2QTZA 2X8AA 4B6GA 5IBQA 4DLPA 2WP0A 2AIRA 2O1WA 4IHAA 1CZLA 4KODA 4U4AA 2HDNB 1IY1A 1W2HA 3BSYA 3E5HA 4CG2A 2W2KB 3PNSA 2WU1A 5IEJA 1F51E 1N0UA 3UA4A 3JWIA 2G82A 4YV0A 3E58A 3HI4A 3PQFA 2O2IA 1XX6A 3VQTA 2RGGA 2CNBA 4AWXA 2O2EA 4DIBA 2X0FA 3N3AC 2C92A 5FL7A 1TVKA 2JAPA 2OUKA 4IHJB 5AKYA 3D1VA 3H5OA 5HFAA 4JC5A 4MPPA 1ENPA 2B4KA 3GCDA 2A9OA 5CNKA 3S2YA 5LQMA 1ND6A 1R0CA 2YNMC 3NHWA 4K6MA 1CS0A 4MQMA 4ZVKA 1WZNA 1HE2A 3CLRD 3PR3A 4G41A 4ZRMA 3AZQA 2DUNA 4JT8A 1QQ6A 4HVLA 3STXA 2O2GA 2ZLBA 3WKEA 1A7AA 4MVJG 2I8CA 1HA3A 4MKZA 3OZFA 1H5UA 1U2DA 1WPRA 3N76A 3ACCA 4Z9AA 5JJCA 2IWHA 3FTPA 1AB5A 3AVXA 1G3RA 5C1OA 3HN6A 3AINA 1YR7A 2D0PB 4JENA 4X84A 1P39A 3CF6R 1PWXA 2V5VA 3EFBA 1NJ8A 3JX9A 4GSLA 4J6FA 3RKSA 1MT3A 3N87A 3R7SA 5JAIA 1NVBA 3MJ4A 4FNMA 4DVJA 2X8JB 2JZCA 3PRKE 3PYXA 4WADA 2XGSA 4O0LA 2ORED 4ZCRA 4DV2B 3ZNNA 4C7VA 4JXJA 3UJ6A 3A6EA 3JYHA 4HVCA 2IXAA 1X7YB 4W9RA 5E9AA 4IH4A 5IMSA 4GHWA 3UHPA 3KE8A 2VJAA 1L5QA 3VKHA 4ENSA 5HUJA 4GR5A 4LPKA 1QFYA 5ALSA 3PDWA 1DAKA 3KSZO 3WB9A 1U2QA 2ZRLA 2NACA 3KFXA 4EVSA 5G4KA 4XPIB 2XMRA 3U09A 3F6BX 4JGGA 5BYBA 4IDHA 4EQ6B 4EATA 2GSDA 3HKBB 4G56A 4D4LA 1AO0A 4NFSA 4B0PA 1I0IA 4G9BA 5J4HA 1Q15A 2FY8A 1RHMA 3QVWA 1A2QA 1UADA 3IBFA 2JGRA 1OXKB 3DQQA 3EY4A 3W2EA 1OVMA 1N25A 1OYWA 3ERCA 5A2GA 4NKRA 1BA3A 3N7TA 4A0RA 1X92A 1OBHA 2XWBF 1B0UA 2ZI7A 3QLJA 5ES4B 1FY2A 1NVGA 1TU0A 4R1UA 3QKRB 4A73A 1SD2A 1QTQA 2XWQA 3IP6A 2XI4A 4RHTA 2E7ZA 2PUCA 1S2GA 1EP9A 1AB6A 1X1EA 1HEUA 1NJ2A 3KQVA 3KOOA 3OU6A 4HWPA 5AUNB 3U7HB 1KS9A 3W5JA 4TWAA 4GL2A 3RK0A 4MK4A 3ROTA 2Q2QA 4JLBA 2I3ZA 5A9SA 1EVLA 2FW6A 2XD9A 4GX1A 1K2VN 3LOPA 3ED1A 1NMXA 5CLFA 1B4DA 3R6LA 2P4HX 2Y76A 4Z0HO 4ZOLF 3BJMA 1H0RA 1OGYA 1Z13A 2XE6A 4QO8A 1DRWA 1P2TA 1LPOA 5IM5A 5BQFA 3R7NA 1JKJB 2IZ0A 3PC3A 1TCUA 4EZEA 1PKXA 3EWIA 1JWLA 4DV6B 2R87A 4X7RA 1LW7A 4BP1A 4CG3A 3KCQA 1SA0A 1JPVA 4PE5B 5KBYA 1U94A 1X2BA 2X86A 1E4YA 4MARA 5C3MA 1KI6A 4EJ2A 1K4YA 5I8ZA 3CBQA 3STYA 3GRZA 2GAAA 3MGAA 4FDTA 4XGNA 1AA6A 5KREA 2QYTA 3BFKA 4B3RB 3DD5A 3ZU3A 1YB4A 3H2IA 3ZI0A 1KMIY 3EISA 1S5PA 2BY4A 4FFBB 3VC1A 4IIGA 2D1SA 1DUVG 4X92A 3R23A 1GCUA 4MWTA 1GDDA 1N1EA 2LWIA 3EH1A 3K3PA 1KL7A 2JFXA 3RBXA 1JZQA 3AHGA 1RRGA 3RF7A 2X2PA 2GPBA 2A35A 3O6VA 4HNAB 3I1FA 2WHQA 1KYWA 2JH3A 2ZSHA 2OHFA 1VKJA 4QU5A 2O52A 4BNKA 1V8DA 2ODPA 1JLHA 4BYMA 3R3UA 1L4MA 2I7CA 4V0MA 1E2QA 3CHYA 1V16B 3WLJA 4AKIA 3KPJA 1E1QD 1YBVA 4I1RA 4NS4A 3UUFA 2RIPA 1OFVA 4CMKA 4LJRA 3CWCA 4JV5B 1XEFA 3OLZA 2I54A 1QQ5A 2VHVA 4ZP1A 4R2IA 1DBQA 3H05A 2G63A 3IAM1 3IODA 1X2EA 4DLNA 4UD6A 3RC9A 1YJ8A 3L43A 2VQSA 4EGSA 4XW2A 3X1YA 1U7UA 2J9ZB 2OAQ1 2OM6A 3MJFA 4P7FA 1ZC4A 4LF6B 4KXWA 5FBHA 1OLSA 3I9KA 2FX2A 1SVUA 1Z6AA