1X9IA

Crystal structure of crystal structure of phosphoglucose/phosphomannose phosphoglucose/phosphomannoseisomerase from pyrobaculum aerophilum in complex with glucose 6-phosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
300
Chain Sequence
b'SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glucose-6-phosphate isomerase
molecule tags Isomerase
source organism Pyrobaculum aerophilum
publication title Structural basis for phosphomannose isomerase activity in phosphoglucose isomerase from Pyrobaculum aerophilum: a subtle difference between distantly related enzymes.
pubmed doi rcsb
total genus 111
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x9iA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x9iA02
2YVAA 2HHHB 1Q50A 3UJHA 4DR2B 3ETNA 4JI6B 4DR1B 4DR5B 1XNRB 4JI8B 1TZBA 3LJKA 1GZVA 2CXSA 1HOXA 4LF9B 3JAMA 2PUVA 3QKIA 5IWAB 4DV7B 1MOSA 3FKJA 4LF5B 4X64B 2O2CA 4DR3B 3Q7IA 4LF8B 1N8TA 1C7RA 1VI6A 4JI4B 2Q8NA 3J7AC 4DUZB 3G68A 2XBLA 4AMVA 1DQRA 4LFAB 3KNZA 3J80A 1IBKB 4DV0B 1XMOB 1G98A 1HNWB 2ZM6B 2VQFB 3T1HB 1B0ZA 1HNZB 1IBLB 2UUCB 1J5XA 4LF6B 2UXDB 3BJZA 4IVNA 4DV5B 1TK9A 3JX9A 2V4MA 2ZJ4A 3IFSA 4GKJB 2XHZA 1IRIA 1N32B 2UXBB 2E5LB 4U6NA 4JYAB 1JEOA 4LFCB 4DR6B 4DUYB 2F4VB 3TBFA 4B3RB 4YY3B 4X65B 1I94B 5BY2A 3NBUA 4DV6B 3EUAA 3M5PA 1JLHA 4JI1B 2CXOA 2CXRA 2A3NA 1HM5A 4DV3B 2UU9B 2CXQA 1N34B 1M3SA 4JI3B 2O2DA 2PUWA 3HBAA 4EM6A 1X9HA 2CXUA 2CXTA 1XTBA 2CXPA 1MOQA 4AQYB 1N36B 2VF5X 2POCA 4DV4B 3C3JA 4TOIA 3ODPA 3PR3A 2J6HA 1HNXB 1KOJA 4DV1B 4JV5B 2AMLA 3T1YB 4B3TB 1C7QA 4DV2B 4JI5B 1T10A 2X3YA 3FJ1A 1NRIA 1ZZGA 1HR0B 4YHHB 4B3SB 4LFBB 1IATA 2E5FA 4X62B 4DR4B 2UUBB 1NUHA 5I01A 1TZCA 4LZJA 2UXCB 2ZJ3A 5FLXA 2VQEB 1U0FA 3J81A 5A2QA 4NXNB 3TRJA 1VIMA 1X94A 2I2WA 1VIVA 3FF1A 4M0DA 4S1WA 1GZDA 3HJBA 2UUAB 4LF7B 5BR8B 1XNQB 1FJGB 1X9IA 3OTOB 5LMUB 1X92A 4OX9B 4JI7B 4DR7B 4B3MB 4S12A 2VF4X 2PGIA 1IBMB 4KHPB 3CVJA 2CVPA 1MORA 4JI2B 3I0ZA 5LMNB 2CXNA 2WU8A 1VI5A 3FXAA 5LL6P 2DECA 1U0GA 1WIWA 4LF4B 1JXAA 4K0KB 3BCHA 4X66B 2I22A 4GKKB 1U0EA 1XMQB 1N33B 2DF8A 3SHOA 1JIQA 5IT9A 2PUTA 3Q88A 3OOJA 4JI0B 1J5EB 2CB0A 4NXMB
chains in the Genus database with same CATH superfamily
3GLIB 2NVUA 3DJYA 4BMCA 3BB4A 1ZPDA 4H4DA 1XLUA 1QDEA 4HWRA 4G8DA 5K03A 3R1IA 5I4CA 1RWKA 3UC5A 3HBNA 3KSAC 3SCZA 1A8QA 3CUUA 4MS1B 2OBBA 2IS1A 1BCRA 1QRAA 1A8UA 4NPCA 1MDFA 4XPZA 3V00A 1FSGA 5LP6B 3ZVNA 1IXSB 1ZQ1A 5EYPA 3WMFA 1E1KA 5B37A 3VISA 2QXYA 1SKYE 4LJLA 5JR3A 4KQ9A 2MTBA 4BYGA 5DNDA 1T8UA 2XE7A 4EMTA 3D6NB 3W9SA 5HKKA 1SB8A 1UOPA 2OHHA 2CL5A 1I9CA 2FJ0A 3PVZA 2QPTA 1DC4A 1I7NA 4TQAA 1FYFA 2V7VA 5JCOA 4CM5A 3SDZA 1VI2A 2GCIA 3EH2A 5K8VA 3HO8A 1IB0A 1EBBA 1ZOIA 3B36A 1UZLA 3UK2A 3W34A 3WK8A 1XAHA 3K32A 4D9EA 4EECA 5J1SB 1W4RA 3NRCA 4B5LA 1L7AA 3AWIA 2X4IA 4PNZA 2NQ8A 1IIRA 2NT3A 3FTQA 4IX9A 4XLLA 4F93B 4ZTUB 1XP5A 2ZJYA 2HLPA 5LXTA 3BCSA 3D9QX 3GGSA 4X3PA 2F2TA 1KFEB 1J4AA 1QTNA 2QTVB 4YQYA 2QLTA 2P1RA 3IT2A 2AI2A 2NZJA 1W88A 2RGEA 1UBRS 2XTNA 3RRYA 1LBHA 4PGAA 4Q9AA 4B8WA 3O3OB 1QKKA 2F48A 1I5RA 3CF4G 3HBLA 3QUAA 4DV6B 2GBPA 2TSYB 3NU1A 4RE6A 2MU1A 1CRWG 1OWMA 5J3JA 3C85A 2RD2A 5JAPA 1FMCA 2B1GA 3I1JA 3WYDA 4F3CA 3MJ4A 3EB9A 3QEAZ 2CZQA 1BIFA 3B6IA 3VDXA 4E32A 2FA9A 3NM4A 4MA0A 1JQEA 2W4IA 1B73A 4RCVA 3VNUA 4MVJH 2BBOA 3CSSA 5BSRA 1IMJA 2JHGA 2GPWA 3OLXA 4KQFA 5D85A 3BRCA 1MABB 3FVTA 3QK7A 3VHXB 2EDAA 1U1CA 3OQPA 1N9GB 4R16A 5FOQA 3HXPA 3KBOA 3UJ9A 2R4UA 2H8GA 5EEGA 4PO3X 4ZJYA 5B30A 1R5BA 2GN6A 3BGIA 1OH7A 3KAQA 3U4GA 4P4UA 2GKGA 4I14A 3TAHA 1N2IA 1QUEA 2QN1A 1UQUA 2FPRA 4BZQA 4ZTZB 2BELA 4HPXB 3BIFA 2QQEA 4NHOA 4XWTA 4Q01A 4YMUA 1N3IA 5LWQA 1AA6A 1W4BA 4M98A 5KTRA 2C7PA 2PXAA 5CEJA 4XI9A 4UTPA 2JEZA 3EC2A 2YS7A 3WL4A 1THGA 2O0KA 2XZDA 3BJMA 2A5FA 2IUTA 1D0SA 4TKLA 5AT1A 2R0QC 3ZGOA 2PUAA 4KR2A 1F9AA 3JQDA 3P2OA 2XOKA 5AH0A 5THKA 3VYRB 3GBVA 5HS6A 5AW8A 2JBAA 5AVKA 4Z9AA 3K1YA 3ND8A 4G86A 3TL2A 3C3PA 3JZDA 1P45A 4Y9RA 1ECGA 2C96A 4REOA 2C2BA 3MRSA 4TWZA 3ON5A 3FI0A 4MJXA 4EJMA 2ZBQA 2QJFA 2OCKA 3D6VA 4ML3A 2GJ9A 4JBNA 2CN1A 5CDUA 1IG0A 1TA4A 4HDRA 4UU1A 1RRMA 4D98A 1P2FA 2HIHA 1UEIA 4BO9A 1G5FA 3H8WA 2ZT5A 2AUNA 3N0VA 3UOAB 5EMKA 4LMRA 4R5HA 1A96A 3VH4A 4GIBA 1EAMA 2AI3A 3TIGA 1A4XA 3GZ4A 6GPBA 5AM4A 5EZ5A 4RGYA 4KCGA 2VP9A 4HNTA 1GPH1 3OZIA 2ZUBA 1LBIA 4PHGA 1AG9A 1QBGA 5FWDA 5IDYA 1ZMBA 2ZULA 3K0CA 3WOHA 2YIJA 1XWFA 2COUA 2H1VA 4L5CA 2CYCA 4LTNA 4KYUA 4ZCPA 5A5DA 4PX3A 1G4UR 5CW1A 2O6HA 3P32A 4WKPA 3LY7A 5FKJA 4CPDA 2P5TB 1WW3A 1FNCA 1KC3A 1F3OA 3FA2A 1VXRA 2CLFB 4QSMA 1QHIA 4TVKA 3S3TA 3WQBA 3I73A 3LECA 1KVRA 4BNYA 5CDFE 4DMUB 2PMBA 1ZOLA 2B0CA 2IEIA 3LXXA 3QIVA 4IJMA 4AROA 3MOGA 5EE1A 1A04A 4WMLA 3V7FA 1Y3BE 2VWPA 4HN9A 3BKXA 1LSOA 4EY4A 2ZSFA 3NYQA 4KXNA 5L7WA 4R9SA 1X74A 5ICMA 1YL5A 3KVYA 4O1HA 2ZM6B 1JXQA 4Y2HA 2VQFB 5TQ0B 2C3YA 1MAHA 4L4ZA 4NBUA 4ED9A 3WLTA 1WEHA 1CY2A 1GFWA 1W94A 1GL9B 4RY0A 5LLSA 2Z4TA 1V1RB 1I24A 1JKXA 2IPNA 2OO5A 2JASA 4DIUA 3F47A 2WYHA 3PGKA 2IZ5A 4MSUA 4HJXA 4ZRDA 5F12A 1PUXA 4WCVA 1IUPA 1SA0B 1P9RA 4S24A 3WGQA 2RH4A 4WN9B 4CU5A 1W36D 5HRCA 3C3XA 2QEQA 2IK8A 3K5PA 1JIKA 6AT1A 4LRQA 1MPTA 1U3WA 1QHGA 1XQ1A 4KODA 3KL4A 2C5GA 2E89A 1XPJA 1SVSA 2YVUA 3QV1A 4GEGA 2YW9A 3UFBA 2CLDX 1GO2A 1XQXA 2F1RA 3LE8A 2GK4A 2PIDA 5FCDA 4RENA 3LGXA 621PA 2DMRA 2VK4A 1MF7A 1T4DA 3GUYA 4ESOA 4J9VA 3LCMA 1U7HA 3A26A 4JAVC 4KQMA 1EQ2A 4EYSA 5JCZA 3U7IA 5E6RB 5J5CA 4YP5A 3MJSA 3UJ6A 1CUUA 2WKRA 3MD0A 4X60A 5DH9A 3JY6A 2CBZA 4N0PA 3VNSA 3ZWXA 4ERXA 5HUJA 3CH4B 2ZB2A 3LLCA 3FYUC 3IUYA 3AEUB 5A5VA 2JJMA 2Y77A 3TX6A 2UKDA 2HMUA 4HMQA 4G5SA 4JJ6A 1R0XA 3ENQA 5FBVB 1EYZA 3H3FA 4KBYA 4MGIR 4RTJA 4R68A 1CUZA 4NBTA 4RIFA 1KYIA 3LCVB 5KWIA 2OCGA 2C8LA 2NPOA 2VF8A 3GFGA 2DBZA 4U9HS 3ESQA 1FMJA 5BR8B 2AFVA 3EXHA 1OC4A 2XQJA 3RQSA 1DTEA 2BKVA 2P2YA 3IV9A 1ZC4A 3RT1A 3ANYB 2RDMA 4O4JA 1BXRA 2O2GA 1WMFA 4XGIA 3WTBA 1NMZA 5U1PA 1DKUA 2V7XA 1BDHA 3LLVA 3F71A 3H7AA 3DBOB 1O8CA 3R0QA 4IFEA 5G53C 1BWSA 1Y5MA 3W8FA 1L5GB 4YAKA 4N5DA 3OHPA 1E1CA 1QR2A 2DYKA 4HFRA 3WGIA 1U0GA 1AGRA 2QRKA 1L7VC 2WTBA 2QYSA 3L79A 4MCHA 1YDMA 4HMPA 3TIIA 5T4FA 1CZOA 1FS5A 1QYRA 2OZLA 3S28A 5BMOA 3ESAA 1NVMB 3PE4A 1J97A 3RSHA 4TUYB 4MCJA 5TQVA 1LLUA 3GN1A 1JKMA 1C7JA 2YWCA 4YAUA 3A31A 4FQ8A 4OQDA 4CLEA 2YIVX 3NPMA 5KQGA 4LSWA 3LRPA 1NIJA 5F1PA 3CF4A 4FT4A 3G1WA 2V54A 4I8IA 4V39A 1PEYA 5LZ8A 1EM8A 3ETGA 3T1TA 2XCTB 1VHWA 1HE3A 2H54A 2J07A 1VGQA 2IQ5A 1Z2OX 3UMSA 1UKBA 1R5OA 2GJ4A 1WVMA 3T1QA 3BMCB 4DRXB 4CLOA 1RP1A 3CZPA 1VB3A 4Q5IA 2EP8A 1R6DA 2YZMA 4D3ZA 4L73A 1UJNA 3DEFA 4O5OA 3C6KA 1OV4A 3EY4A 4IJ5A 1GCAA 2OXRA 1G7TA 2X40A 4DEXA 4PN3A 2PFSA 4PINA 2GVDC 4HL6A 2EAUA 2CUNA 3OZGA 3NIWA 3OPYA 4QPDA 2QVZX 4S35A 2ZYRA 3RT9A 3W8NA 5HKAA 1QG6A 2OKGA 1G3MA 1ADFA 2WQZA 5BORA 5TF0A 2WT4A 2C54A 1XFAA 3ICPA 5EPUA 4CUZA 3FOEC 3M34A 4O5AA 3VYVA 4CFZA 1ZI8A 3IO5A 2A9JA 2XNCA 4GOND 1RYMA 3BXEA 1QONA 2GM9A 1W46A 1E4EB 1I13A 3DDOA 1XDUA 3GVIA 3S44A 3HNPA 1Q7GA 1HXHA 2FPGB 2JI4A 5DMXA 4ZVNA 4YUZA 5C2JB 3PUZA 1XA3A 1ZGAA 3ZD7A 2Q5FA 1WU8A 4I6EA 3MAAC 1B8OA 1JG1A 2FE4A 2P9GA 2P1ZA 3AJ9A 3MJCA 4B83A 2Q5JA 4MYCA 4W5OA 2ZCUA 4DKJA 4NL4H 3BMOB 1LVGA 2VYCA 2ZDQA 4G4GA 3S70A 3KC2A 4Z86A 3AUTA 2PA0A 2E87A 2X9LA 2O06A 3O31A 3PDHA 1PGNA 1R9MA 1Y1TA 1KXJA 2O2JA 3M1IA 5J2UA 3BWXA 2GXSA 3NOQA 2P2LA 5H9WA 1B23P 2PPLA 1KJJA 1Z88A 2R4TA 5KYUB 3WRYC 4EHDA 1B4DA 3N5CA 3KZNA 4B3TB 3THOA 2XUFA 1W4AA 4GP9A 3GV0A 3TCNA 4RZ2A 1XWIA 1BMTA 2EWWA 2NO4A 1ZVQA 4TGLA 4BJ1A 2B25A 3ERCA 4J94A 4TQGA 5JXIA 4IOMA 5EE3A 1YK1A 1LRJA 1NVWQ 1GGMA 4M8KA 4GYKA 4OHUA 1HWYA 2JLUA 2SKDA 2A9FA 5IJ0A 3PC4A 1PK8A 1E3DA 1RAHA 4H15A 1GGEA 4YCMA 4AS3A 2HIAA 4RKRA 3V34A 1ISSA 2YMPA 1V9SA 2R79A 2J1LA 3E6AA 4IUDS 3A70A 2OZEA 4DR7B 1XU7A 1ODKA 1OLSA 3MW8A 4RX1A 1KETA 4NZ9A 5I7HA 4IV0A 1KE1A 1OIVA 1NVVR 3H75A 1FTWA 1ZUNA 5T8KC 2H7XA 4CI9A 1H9CA 8MHTA 3U56A 3V7NA 5D7NA 2DECA 3ZE0B 1WR8A 2FTKE 1XYGA 2HK6A 4WCFC 3SI7A 4CKCB 3TQQA 4CMIB 3QKRA 4EHLA 4F6RA 1Z08A 3KQHA 2C2WA 1KI1A 2XYRA 1BMQA 3DO5A 4BN0A 1B26A 1S96A 1NI4B 2FP3A 1KU6A 2X0JA 4KPGA 4LNUA 4XLZA 1CIPA 4DM4A 5I9LA 4UDNA 3W2FA 2O2IA 4DDHA 1NXTA 1U80A 1XKXA 2DHEA 2ZIXB 4Y6OA 3VR5H 3KBBA 3KQPA 3ZG6A 3BSWA 4YYZA 2D0PB 3KPJA 1RCFA 1OKKA 2JFBA 4GM0A 4TLBA 3NIFB 2R1UA 2AFHE 3GEDA 1ILWA 2QMZA 3I4LA 5DXFA 4DUGD 2IXTA 2C2HA 2NN3C 1C8LA 3KUXA 2QTNA 4QVGA 3RAEC 3UT5A 4DMRA 4X6UA 1TKRA 3QKIA 4ND6A 4HB4A 3IA7A 4MRSA 2NADA 2PY6A 4G24A 1CJMA 1C7RA 4GI7A 1CB7A 1ZN9A 2ERXA 3IQXA 4HGOA 3S1AB 3CNLA 3O26A 4Q34A 4EELA 4BMDA 1XTRA 3DE1X 4FKMA 2CMFA 4IX1A 2O14A 7REQA 2SKEA 2CY0A 1N2CE 5AI5A 5FWYB 4OJYA 2GNAA 4GGOA 1KL7A 3G85A 5BURA 3MWLA 5EZYB 4KMRA 4E3ZA 1QOPB 3P9IA 2QF7A 3GLUA 4OHVA 3MGGA 3PVSA 5FPKA 4IJWA 3U49A 3JPYA 1IQPA 1NURA 1E9BA 3IEVA 3EGDA 1C3XA 5C34B 3VH3A 3UAVA 3SK0A 3Q15C 1KC1A 1DXOA 1NBOA 4XIYA 1HDYA 4LE1A 5EJ5A 1BFUA 4LSGA 4RPKA 5KTYA 3ASUA 3P2MA 1CQPA 3X2SA 5DNVA 2H85A 4C22A 4NC9A 4G6ZA 5TQJA 2GARA 3UUGA 3M6LA 1FU7A 1T1RA 3B7PA 4UE6A 1N34B 2FR8A 3WGOA 3O8OA 3HBAA 3JQCA 2YBDA 2V0NA 5AW6A 3RAGA 1MIOB 2HREA 1R4MB 2VATA 3OMLA 1N36B 3V1LA 2F8LA 5CH8A 1T13A 1T0UA 2V55B 1QQBA 2CNNA 2OHOA 1L9KA 5JDCC 1NW7A 1NUSA 3N2YA 3A9RA 2WKWA 5FLEX 2AD5A 2J5KA 1K8ZB 3I32A 1N6HA 4N6OA 1WUYA 2WJYA 5IEBA 4AX4A 5K0FA 5JI2E 2HSGA 1FJXA 3SVTA 1AKMA 4DPLA 2ZRHA 4NBKA 3ZGYA 3L7NA 4JZKA 3NV9A 7MHTA 1TJ5A 1P6QA 4UMDA 3WK5A 5FLXA 4RK7A 3PG5A 4PSVA 4YJGB 4WFJA 4JX9A 1LDNA 4J0EA 2YJ4A 4CKEB 2EG9A 2ZB3A 1OA0A 3IPLA 5AI8A 4E4YA 5CA1A 3OZTA 1KGSA 4ZCTA 4G4IA 5JNTA 1D1SA 2J45A 1N6PA 3T0IA 4CM9A 1HKHA 1K5DA 1TF2A 2XQGA 4RQBA 3LDFA 5JPDA 2HK7A 2O7SA 1T2NA 4R0NA 4EY3A 1AE1A 1QV7A 3MAGA 4PX2A 5AUNB 1P5FA 1K5HA 1UBKS 1FEZA 2D7JA 2WKQA 2OD2A 3N2GB 3O8BA 4NPHA 5KAPA 4F91B 3U9LA 2EP5A 1HFKA 3W7BA 3WHPA 4RSRA 3T5CA 3LCJA 4OYHA 1TO2E 2JAPA 2ZVJA 2ZEJA 4D3XA 2ZIEA 1N2HA 1ECFA 3OZVA 1AKEA 2RGGA 4FYYA 1U9CA 2J3KA 3N9IA 3O7WA 2GHTA 2ZZKA 4P31A 5T6BA 5ITZB 2BFEA 3FGOA 3U4AA 1FXWF 2YYSA 2GLTA 2Q7XA 4YLGA 1K7CA 3ASZA 3E2PA 1I6MA 3GMDA 2XCSB 5BQFA 1O0CA 2FJPA 1FP1D 2P6NA 2HHCA 2GDJA 4P5PA 5I9IA 1IVSA 4JYPA 5C5CA 1L1RA 3WK7A 1E9DA 1KDTA 4Q03A 4B33A 5LNK6 1XNRB 3FSEA 1TEXA 2XOXA 1Y1LA 3N76A 4K0RA 4A3SA 1AUVA 1OYYA 1TTQB 1J90A 1N3BA 3IESA 5BSWA 3V8MA 3H1AA 2OILA 4HYYA 1PUIA 1P7PA 2FG7C 5ER6A 3U3XA 5K0LA 1KRHA 4IHJB 3DYIA 4X8OA 4M7WA 3QLUA 1GDDA 5A7HA 3RKSA 1UEXC 3L18A 5FHRA 3PC3A 3L92A 1T1JA 3VV3A 1Q95A 5A9RA 3C48A 2VOJA 5JSZA 3DPSA 2WNSA 4RADA 4XRRA 3DUWA 1WPRA 2W98A 3LIIA 1E9EA 1C0EA 2O7NA 3HLKA 4OBBA 3D4PA 2P6OA 2VP6A 4HH3C 2WF5A 3AERB 2C9OA 3OO0A 4HWPA 2MHCA 2OV6A 2V6GA 1ZM3A 3HKEA 1CT9A 1F6DA 2YHAA 4FI3C 1EIZA 4LHVA 2UXDB 1CZUA 2W90A 2YZNA 3T7AA 2DM6A 3VJRA 2KLBA 5BVGB 2OHGA 5AJZA 4WKBA 3RUDA 3JARB 3ZOKA 4RY2A 4JP2A 5DPMA 1TU0A 2HJSA 2MMCA 2V58A 4TXJA 4BKQA 1MJHA 4ZCQA 5LBIA 4UTNA 4PFSA 1P2SA 1P9LA 1WPXA 3F49S 3FRJA 3Q72A 5EPOA 5TR9A 3NAMA 2A1TS 5EJEA 4KWCA 1UK6A 2BY4A 1Y8AA 1CS4C 1JDNA 2X86A 3GGGA 4H7HA 4OXNA 4U2BA 1M1ZA 2X5KO 1B6TA 3C5HA 4L50A 4XGRA 1TB4A 4YV1A 1QVRA 4KXMA 3GLHE 1KJIA 2OZVA 3AB7A 3LZDA 3SYNA 2YJGA 3HFRA 3BK2A 3PFIA 1HQDA 1QHSA 2IY9A 3GGDA 3WKBA 1YVEI 4UDYX 2FMHA 4ENPA 3ZJVA 3ZHSA 3COSA 4O4JF 2PD3A 3JQ7A 4RVUA 1QZTA 1QYCA 3EZGA 3OZUA 5IUKC 1SVUA 4YJFB 3T1YB 3PDIB 4NZZA 5AM1A 3VDRA 2WTUA 1ZCZA 5DNYB 3Q3HA 5AI6A 4AI6A 1T36B 4X62B 4DR4B 1XTPA 2RIPA 4RKWA 4M8IA 2AF4C 1AO0A 5I01A 1FSPA 2IHZA 5FWXA 2IVZA 3RVDA 1BXZA 2D2IA 4LVUA 2DB3A 4TXNA 4BV8A 2OLKA 2B30A 3I1FA 1QTRA 1NC1A 2E85A 1G2OA 3PD1A 2HFJA 1RJWA 2BIFA 1U8TA 5ITSA 3DW3X 2JH3A 5DCYA 3D64A 1O0BA 3CG4A 1E2UA 1YRWA 1C50A 3V1YA 4TTVA 3A25A 4TV8A 2ZS7A 4QREA 4Y9UA 5K4GA 2N42A 1DBVO 3CTPA 4DIMA 4RZQA 2NUBA 2HJGA 2FN3A 5FI5A 4Q4JA 1GUBA 2LDXA 2R65A 3PX2A 4K88A 4LHYA 1ULAA 4IO1A 4RY9A 4ZARA 5T4HA 5LL6P 2NSHA 2HMTA 2B4KA 3OCJA 4PPQA 4MWOA 4X00A 4XQEA 3P0IA 4TPKA 4XM1A 2J3MA 1XF9A 2XY4A 3BHJA 5FNVB 4BGVA 1REQA 3TK1A 4P3NA 3OX2A 2AS0A 3TZCA 4HTFB 1KP2A 1UKVY 2DQSA 2G4CA 2V8OA 1I3OA 1ECPA 4P7GA 4I1UA 4YP1A 2N75A 1L7OA 4CZ2A 2Y66A 1JG4A 4AIIA 5LN1A 4JZYA 4OATA 4EGQA 3BD9A 2HEIA 2HADA 3R2JA 3E9MA 4FFSA 4RIIA 1NQ5A 3OE4A 4JBWA 5CX4A 2VTBA 1TXGA 3ZVRA 1P4GA 1YKGA 4K05A 2HTEA 3FMIA 1CUDA 1X7ZB 3GJ7A 3I3OA 1N8TA 3VKGA 4URHA 4CEJA 1E79D 3FVVA 3WLPA 2IUUA 4HVLA 3BL6A 3QXXA 3MQ4A 2RGDA 4PS0A 4HTFA 1PVOA 4XWYA 2ZDHA 2ZAMA 4DM3A 1K08A 2DSTA 1AHNA 1HT1E 1NKSA 3C1UA 3NI2A 4RD1A 4UD6A 2R84A 3I6BA 3K6SB 1XMOB 4AS1A 2Z83A 5SZHB 2O5EA 4IWNA 3K7EA 4IDHA 1BYUA 2H63A 3AEQB 1F2TB 3CISA 3O4RA 3UJCA 2V3WA 1P9NA 5DASA 5DP2A 1XRQA 4Z0NA 1O94C 2FRXA 4W5NA 2ZBRA 4WZAE 4AT1A 2NPIA 2B21A 3TTVA 4ASUA 4ATNA 1KFCB 1VMAA 3ZS8A 1A5SB 1BKSB 1OZGA 4TV8B 5BUQA 3I52A 1BJRE 3K0AB 3LLSA 4X65B 4JJGA 5HOEA 4FM9A 2FN7A 3B9BA 1CF9A 2HQBA 4QGGA 2PCJA 2V45A 1O5OA 1F0YA 1FE8A 1FFBA 1M3SA 3KFVA 3PZRA 1ZOSA 4H17A 4EPYA 1CTQA 3PQ3A 3F90A 3QE3A 4B3XA 5KWJA 4RVFA 2NMVA 1U5AA 3QVSA 1RRGA 1AQLA 1PL6A 1YDGA 2P1DA 3NEAA 5KYVA 3WOVA 2UAGA 1ABFA 2VXOA 2QZJA 2XJ4A 3ZWCA 4EHAA 2J5RA 2QAGB 3NTVA 4TRJA 4NYMR 3ZCVA 4MKHA 3HB9A 3PDIA 4CMBA 1V1MA 4PC3A 1RRPA 2OQVA 3WMRA 3ZVLA 2YNMA 3TNJA 5JD4A 1KJWA 2J3IA 1UDBA 1NP7A 4YJ2B 1H8EA 4NE9A 2J46A 1F8FA 3A1NA 2YWGA 3LPMA 1HG1A 2AOWA 2DKNA 3B5EA 1NONA 2ZJBA 4B3DA 3MHTA 1AK1A 2A14A 4RJKA 4W5JA 5EMJA 2PRYA 4AJHA 2RCYA 1R7RA 3OLVA 1PL8A 4J16A 3IQIX 4XCXA 1P4AA 1R15A 1ZRSA 2H7CA 2VA8A 3KZXA 1SUWA 1X80A 2CLIB 3CLSD 3MMPA 4D2IA 4Y9SA 1OA1A 1MW8X 3E18A 1SCUA 5DHFA 1CHNA 3QYFA 5A0FA 1PT7A 3IAS6 1LX7A 4AYXA 2W6MA 2ZU6A 4QOJA 5TLSA 3EE6A 2H92A 4KHPB 3JARA 3VQTA 2HRDA 3WQSB 4G8JA 5B12A 3KJHA 1XEFA 4J6EA 3NOXA 1V6SA 1XL1A 3ONEA 1QHHA 2CXXA 1DDOA 1LW7A 4YCNA 1VPDA 4W5HA 2WZCA 3R7WA 3OESA 3NGLA 4CXMA 1VCHA 2C4NA 2EYQA 3HEMA 3DVLA 1IQRA 4J43A 1IZ9A 3ZWQA 4ENVA 2QSYA 2K7FA 3ZZNA 2ZOSA 1I6WA 3EZNA 1BEUB 3GLFA 4E1VA 3TLJA 1YJ8A 3FZNA 4O2BF 4OIFA 5FJJA 4MDFA 2QD2A 1KJQA 5L4NA 3P9YA 1GL6A 5K3CA 2C5AA 2QZ9A 1L5WA 2WG2A 3FCOA 4XWAA 2Q9BA 1AQNA 5ALGA 2G0TA 5REQA 4EG7A 4QASA 3BMXA 4Y98A 2P9JA 1I4WA 1M72A 4AM8A 4WBNA 1Y1QA 2SICE 1NVVQ 4BTVA 5KKNB 3W6OA 2P6MA 2CVQA 2JVJA 5LIPA 4N40A 2V65A 4HMOA 3A4MA 2JFPA 2VUTA 4UM5A 4KK3A 1I2DA 1S2IA 3TLZA 3W6PA 1ZONA 4ZCLA 4DIOA 1P4HA 3FR8A 3ONVA 5B36A 5M7EA 1BH2A 3EGEA 3J7AC 2ERCA 1Y0BA 4AIRA 2JI7A 2WIFA 1CDZA 1VG8A 1TJ4A 4BXOB 3USZA 4YRFA 1O6ZA 4K81B 2E18A 5HKKD 1NVAA 1V35A 3AFNA 4MHTA 4B34A 3K96A 1X1SA 3W5HA 4JVMA 3UN1A 4G23A 1P0CA 1KRXA 4ZYUA 2IDJA 2VA9A 1GNVA 4G0YA 3G1UA 3H4MA 3NVKI 3X1KA 2CLLB 5KS2A 3PFNA 5F7ZA 1DEOA 2FK8A 2W2QA 1NPDA 3AWDA 5TRTA 2VZEA 1ZIOA 2F1OA 3SSNA 3VI3B 4K86A 2P5YA 4M9ZA 4FB5A 4MWBA 3KJNA 1JEDA 1NJ6A 3IQDB 4E6PA 1EDEA 4RUKA 2IHNA 5TEVA 1AC5A 2R00A 3DAOA 4TYQA 1P73A 1BE0A 2GH1A 2PRZA 3NB0A 2QENA 4BFLA 3IPYA 2N1BA 4ZIRA 2BZ1A 3BVPA 1EWKA 1D03A 3GRVA 3L77A 4QYXA 4RORA 3JZMA 3KXLA 1SXJD 3KB8A 4DRZA 5IJWA 4Q18A 2QGZA 5KYKA 2QU8A 3HXTA 4NABA 4JUCA 1DC8A 2VKTA 4RH1A 5IAGA 2X9VA 2X19A 1AQJA 1S3IA 1VHTA 1QIMA 2OT3B 1YQQA 1G5RA 1VBFA 3Q1LA 3WRXC 4QQFA 3VVCA 3W05A 3O94A 4EA9A 1YE5A 4P38A 2I29A 5HQ3A 4RZSA 3KELA 3T41A 2Y0EA 3RHZA 5GY7A 2BBSA 3ZY6A 2DETA 1V7ZA 3STTA 3ZNPA 4O3FA 9ABPA 5IYZA 4H6PA 3DKKA 2E4WA 4K03A 4BCBA 3EISA 3I9LA 4JP1A 1MTOA 2C2OA 2I6SA 4HDAA 3CRQA 2CMKA 3UXYA 5T3UA 4HGPA 4AO6A 1GAJA 3FCYA 4JQCA 2BM8A 5C1PA 4TTAA 3KHTA 1ODCA 2I1VB 2WM3A 3WKAA 1E3QA 3TTYA 1J22A 2A0KA 2AIRA 2ZXFA 5GJVC 2RGAA 2YY5A 1ZRMA 3C97A 4BZWA 4YRBA 3U4QA 4Q4DA 5TV2A 5LQCA 4DNQA 1R3UA 2DERA 3K09C 1XTVA 5CU7A 5G3YA 4M9QA 1B93A 3EODA 3K0FB 1XROA 2D7DA 1N5RA 3OJCA 1O0SA 1IIBA 4DLUA 3K53A 1ES9A 4OJQA 4IGFA 4OXKA 5HA5A 4ARBA 2EQBA 2YWHA 2AXNA 3PTLA 4LCJA 4LGMA 4X66B 2ZM5A 1G5PA 1S01A 3VAZA 1RZRD 2CCKA 3ZU3A 7REQB 2WF8A 4GYYA 2F43A 1TVEA 1G0OA 2RHWA 3H0CA 3FB4A 3NHBA 1DMRA 1RZRA 3BFKA 4E11A 4KRGA 4UPVA 4RJTA 1R27A 2HU5A 2YWJA 3BHMA 2FLVA 4IJ6A 4DIEA 4H3VA 3D4IA 4RS3A 4MWEA 3GRRA 4JI7B 1A2KC 4OQYA 3RSGA 1IVYA 1IEWA 1DEAA 1SXJC 3LJKA 1LB1B 5FXMA 4Z7JA 5KDOA 1KYQA 1GNRA 1OT5A 1ZXBA 2E48A 5LQRA 3TM5A 4QUGA 5AQ1A 4KRYA 4CL3A 3DT6A 5AYVA 4GPIB 5UKDA 1XF1A 3C8DA 5B55A 1Q14A 1W44A 3B7GA 1EFRA 1HDGO 4X54A 3LQYA 4XQ9A 4V0ME 2OGZA 2ZAYA 3A6JA 2DCMA 2VDRB 3D6UA 4JP5A 4DGQA 5BN3B 4LPSA 3ZWMA 1NUPA 4RNCA 4ZQGA 4M0KA 2FP4B 2VP3A 4I5FA 1F38A 5H82A 4F7DA 1ANKA 4CW7A 2FWRA 4XX0A 4AZTA 2A1UA 2B98A 1PYOA 4KMOA 5LR6A 1DOAA 3EWNA 1TU4A 1NI4A 2AJCA 3K4PA 4I6JA 4LJ6A 1TVKA 4R2LA 5FUBA 1M34B 3ADPA 2H1CA 1NYQA 3J7TA 4IRXA 3UANA 5C8DA 5KYWA 1EK5A 1LBQA 1OYWA 4CMIA 4F6RB 2PX8A 1M2WA 3T3OA 3CIOA 3QEMA 2PKWA 4DLSA 3EFOA 2RHDA 4YP0A 4GC9A 3AG6A 2NT4A 3CCFA 3P27A 5DSZA 2BKXA 2QT9A 1ZUNB 3U4IA 3WY9A 3BFJA 3QEJA 3C6QA 4RQUA 3S2SA 3OX3A 2O4CA 3K8YA 3OMWA 3WZLA 1ZGCA 1N2BA 1W0JD 1WTCA 3EGXB 3I04A 3LRTA 2ZUEA 3GJXC 2WAAA 3JAKB 4XEHA 1OXUA 3MGAA 1E62A 4Y18A 4CQLB 1RC0A 5I4IA 1X8LA 2QLBA 4RLFA 4WXMA 5FYDA 1CVRA 1AO3A 1UKYA 1D09A 1JEQA 3G02A 3URKA 1Z7WA 5CG1A 4F2DA 3H16A 1NI5A 3LA6A 5EHNA 1CR6A 4ON9A 2ZK7A 3CUSA 2IITA 3KFLA 3Q8XB 2PZKA 3OQBA 3GAZA 4NCIA 4CE6A 2J9FB 1KZ4A 4GKBA 1F4PA 4KMSA 1DQNA 3E81A 1M8FA 2Q0QA 1PIWA 1RACA 1E9RA 4LOAA 4C7MA 5JJ5A 4B79A 3EXIB 4C05A 4RD2A 1GNQA 2OQRA 1E77A 1GWNA 2XUOA 4NS1A 5J2UB 2HYDA 5L51A 2QMOA 4IMIB 4LBVA 4Q4LA 2Y1GA 2JFOA 2XF8A 4TL9A 1J21A 3EPRA 4WBXC 3TOVA 3D3EA 4I4IA 4IH9A 1FUEA 2YV3A 3BRWA 3BMOA 3JQFA 3ANTA 5AHKA 4QXQA 3VKFA 5AM3A 1A8SA 4DYHA 5FR2A 4BLPA 4CKBB 3REFA 3QU5A 3PEEA 2IV7A 3HGQA 2EHJA 3K16A 2X2PA 4CL2A 4RHXA 4RVGA 4I4LA 3MMZA 3FCXA 1HNNA 3D6FA 3KVOA 3W6NA 3VNVA 4HXEB 4AJOA 4MYRA 4LRTB 4PPNA 5K0GA 4W7SA 5SV2A 1KH1A 2Q6TA 1ZD2P 1Z0AA 3GQBA 1GCIA 2ZP1A 1DFHA 3M70A 3VR2A 1XNJA 1V4BA 3EEYA 5DHRA 1FP4B 4GD3Q 2HOQA 4MW2A 3CWQA 3GPDG 2VH5R 3ZYCA 5DSTA 3IJ5A 3WGJA 4JI0B 4JYZA 1MZPA 4YRQA 1GPWB 4RQAA 1M2JA 4QBHA 3WE7A 2HWKA 1I1OA 3AUUA 5AOAA 1O89A 1RYYA 2WJ4A 3E58A 5ALHA 1E2PA 1EG2A 2VTEA 5JROA 4JI8B 4U9UA 1BXKA 4IIYA 4L3VA 4B6SA 1TJPB 1PHRA 1EGMB 2QG6A 4HWGA 3ZWVA 3PLAE 3KJFA 4BOYA 1JLSA 5J2TF 1N7GA 1KZ1A 1MC5A 2PSDA 4DV7B 1FXUA 2PBLA 3C39A 2ZIGA 4C5CA 4CCYA 5JFTA 4XYLA 2PWYA 5EE5B 6ADHA 2J48A 4BQEA 1P2VA 5LPNA 4W7HA 4C7KA 2QAIA 2E4YA 3F6PA 2NXNA 1JPUA 3T7EA 3QWAA 4ZI7B 1KORA 1FQJA 4UHHA 4BO8A 5DT2A 3OWOA 4LOLA 4RF2A 3WDMA 4E5SA 2AOXA 4Y0AA 3K6RA 4KX5A 3W4KA 1J5XA 4C6HA 1J9EA 2QD5A 1NE2A 2AI1A 4O4HB 4IQFA 4YDSA 3WGLA 4EYOA 4YCLA 2XUQA 3SOPA 4GUDA 3T7SA 2QQ5A 2VRNA 4QTYA 1UZAA 3IHWA 1ZRHA 4ZC8A 4ZYVA 5BVHA 5ADUS 2R87A 4G81A 4RPJA 3OJXA 5I9MA 4YMLA 3TTTA 2FZLA 1U31A 5EWJA 4D4IA 5ITWA 3O8CA 1A9TA 1I2MA 5C4MA 3IAEA 3T0GA 3OTHA 1FXSA 4O25A 4M1MA 4AX8A 4CQMB 2JCBA 3BXOA 3CEMA 3PYXA 3PEWA 3DLBA 4TYPA 1XRNA 1KZYC 3EUFA 3LX5A 1NG1A 1T1GA 3N2ZB 3HU2A 3QLUC 4TN1A 5FB3A 4HB2A 1ZIXA 1E7QA 4RESA 2I80A 3F5QA 1U9JA 3AUFA 2XTAA 2B2CA 2OCPA 3NC4A 3W6UA 2V7UA 5F2EA 5JH7B 1YA6A 2ZDGA 5H4HA 5EWMA 1VKJA 1OH6A 1LJ8A 5I5GA 3M4YA 1C0LA 4R40A 5GTDA 4G97A 5KINB 1ULUA 1DRUA 3TFQA 2WDPA 3RTAA 2DFTA 4AP5A 1XCMA 2FSPA 3CBGA 3FIJA 1C3OA 2JD0A 2VYFA 3RANA 4KC0A 4PHHA 1IN7A 3ICOA 2DHQA 5SY4A 4BFUA 4Q6BA 4QUAA 2EYUA 2BDTA 4WBNB 4J2TA 3HC7A 4QQNA 2NACA 4XAQA 3MJFA 2Y1LA 5HQTA 2N9UA 2JI6A 4BWVA 3FPCA 1AKQA 4PTZA 4WN9A 3CVWA 3GP5A 4NJEB 4FVTA 5DYGA 5EXSA 2YJ3A 3K1AA 4KB5A 2CLEB 3B12A 5B7NA 3OZCA 1ZNWA 4P4TA 3NMUF 1RVV1 1SIUA 1OGYA 1JTFA 3QUSA 4L28A 3T52A 2JHPA 3SQWA 4AICA 5EQTA 3C45A 1PI3A 3ZYZA 4EF4A 1J23A 3GEPA 4YR7A 1TQ2A 1ZL2A 1H23A 1FOEB 2IE0A 4OVKA 3TCKA 4OUDA 3RFFA 4EENA 3W3AD 1VMEA 5K2OA 1MO2A 1QX3A 2PCLA 3RT7A 3DR3A 2NU6B 4NULA 1Q57A 2ZWIA 4XYGA 2C7OA 3IOEA 1R9GA 3CC8A 3JQ9C 4GI3A 1OSNA 4LJKA 4LI0A 5G4LA 5MF6A 1JPJA 3FMGA 3KT6A 4YRDA 2CDCA 5B4UA 4RHFA 1GQYA 5HF9A 2NWQA 3B1JA 4KV7A 4MP8A 4TLDA 5DVZA 1X80B 4EUHA 4FYKA 2QE6A 4FKBA 3ADKA 3PD7A 3FNIA 3K9QO 5ES3A 4B4WA 5HDQA 2Z6UA 3NEJA 2FW7A 2P41A 5I3CA 2O8BA 4PLYA 5G2OA 4KFUA 2JJ8A 2IX3A 1E2DA 5I8PA 5EXXA 3GJ0A 1A1SA 2PVPA 4GLLA 2D5LA 1NNSA 1SQ0A 2I4LA 1DQPA 5BW6B 1MX5A 4X1OA 3S2YA 3M6VA 1VIYA 3H19A 5HZKA 2I62A 1VCMA 3RYCB 2VT2A 4EFNA 1O97D 3OFJA 1USIA 3C3DA 3A4TA 1CZRA 4V0QA 1MVNA 3KDSE 2W4MA 3BFPA 1FZQA 1BE6A 3DOEA 3HA7A 4GZ6A 4CM7A 2H4HA 5A4IS 1QGAA 4AKSA 2G5GX 2KBFA 3ESXA 5BNTA 3F8TA 4QGAA 5FA8A 1LDEA 4B48A 5JAIA 1H4SA 1EFCA 3THYB 4KRFA 2ZBDA 2LW7A 5CGZA 4FFNA 4GGMX 5HK9A 4A27A 3WL5A 1FP7A 3AI7A 2JW5A 3EIHA 4YJHB 2QN9A 4UUMA 2BN4A 2JBAB 1TT5B 3K0AA 3GRFA 1HYEA 2JLCA 4E4TA 2QTMA 1NXQA 3QY0A 5BY2A 1P2TA 4Y2UA 1JLHA 5CT8A 4EKIA 3MA0A 3EXHC 4MK4A 1VKZA 3WK6A 2CXRA 2YQ4A 2D5AA 1SOWA 2H07A 3F6CA 3L0BA 3HLYA 3LUFA 4K9MA 4NEHB 1CW2B 1V8OA 5E9JA 1TD9A 2HLDD 4KPFC 3ZDBA 1T6ZA 2PKCA 2Q0HA 2C97A 3D8UA 3OPXA 3RKUA 2XWBF 3NANA 1BQ4A 1NVBA 1P2GA 5TGZA 3HBJA 4PC7A 1FTYA 4OQZA 4RFSB 1T8RA 3PUYA 1S7CA 2C82A 4E2FA 1RM4A 4Q00A 3DZBA 1CVLA 1HL3A 4ZA2A 4ZZ2A 3EARA 2JLXA 5TF4A 1EK1A 2Q46A 4KIJA 4R54A 1VL2A 1R0SA 4LUCA 3W06A 1JKIA 1DKQA 3T7JA 1WXQA 3G49A 1QZUA 2RHMA 4YHHB 3P9XA 2G5CA 2OSVA 3I05A 4M1OA 3NCHA 1ZBQA 1JLMA 4PC1A 3RWBA 4N12A 1BE1A 1SD5A 1IBCA 2L2QA 3CIFA 4Q9DA 4RGBA 4HDNA 1ZYUA 3FUUA 4JC4A 1OAKA 1OXVA 4BX2A 1NA5A 2VTBB 4NXNB 1B0UA 1NBAA 1J1ZA 2C0PA 4DS3A 5I7EA 1GRNA 1XRSB 1C8KA 1WUHS 5HJ2A 4IRUB 3ZY5A 4EFMA 1QLHA 1KR2A 2PSFA 4WXHA 2YV1A 4JIGA 1E2LA 1WBBA 2J7PA 2PLFA 3DOIA 1E98A 3NTUA 1JJ7A 4Z6KA 2QTVA 3UAWA 1KP3A 3WNQA 2NZ8A 3S7ZA 1P7YA 3SP1A 5EERA 3PSHA 1JTVA 5HMMA 5KTMA 1MGOA 1I9GA 2ID4A 2QDKA 4FMPA 5JWOA 3TFOA 1P4SA 2AQIA 1BS9A 2GT1A 2QN8A 1ZISA 4J4TA 1F0KA 1HL7A 5TSDA 1ZFNA 4CF3A 2RE8A 3W3AH 2AF3C 4U39A 2HK9A 3DZIA 3CW2A 4EUKA 4C88A 2WD7B 3S8YA 3PL1A 4XARA 1IZ0A 3MWFA 2CGEA 2IU6A 3D02A 4NVRA 1OFGA 3PXXA 3BICA 4RVDA 1VDMA 2VF2A 5ADWA 4LRYA 4KSCA 4EJSC 2A5YB 3L0CA 1IY2A 2O3UA 4MINA 1NXSA 1IY9A 2EX0A 2EJUA 2ZIFA 5GP1A 3TNLA 1QIFA 4AY6A 3JVVA 1NBMA 3KX2A 3QLEA 3NHFA 4YRLA 1I2AA 4FMBB 2QMQA 1NZJA 4QELA 1OJLA 1ZCJA 4YR9A 2G76A 3T5DA 2DT5A 3EA5A 1YZVA 4IS2A 4FDVA 4L76A 1BD3A 3ULKA 3RROA 4E51A 5IULC 3L6CA 4FW8A 3G68A 3ZJTA 2BWJA 2DKOA 4JQYA 1PZXA 4MGHA 2J4CA 1IUNA 4Y2VA 1I80A 2OGWA 2PEYA 3HFGA 4MUXA 5DW3A 4RIHA 2UUCB 2ZTSA 1QQTA 1N5JA 3EGVA 1PP4A 4IG9A 1OFVA 4GR9A 4KL8S 1ULBA 5EHIA 3UAZA 1WSDA 4XJVA 5I7FA 5LDDC 4EW6A 4PGMA 4PXSA 4CODB 3KQYA 1TK9A 2HF7A 4GICA 3SFTA 2P9YA 3ZQKA 2VEDA 4N41A 2EJBA 1T2VA 3ZLBA 1XRJA 3GP8A 2AYYA 5E1MA 2J59A 4L8YA 4QUBA 3RFUA 5F78A 5DZSA 2YN4A 3K4QA 4E94A 3IAHA 1D0VA 4KXUA 1TCVA 4NBRA 3T5AA 1JDJA 2OP1A 3HCDA 4ZVPA 2Q9CA 4FYWA 2OOSA 1PVVA 1TYDE 3KXIA 2PU7A 1FX0B 5HKBA 5F77A 4QTUB 1OXXK 4FMCB 4LOKA 3KSBC 3ZY4A 4YRIA 1X0XA 1R18A 2FMXA 2A0FA 2OXCA 1KTVA 2JEYA 2UDPA 3DBLB 4OOFA 4Q4HB 5JLAA 3OSZA 4P3OA 2QLLA 3Q10A 3CLRD 1Y7HA 1YR7A 1XRPA 2INGX 4HAUA 5JOQA 1DJOA 2PBRA 4Q3DA 1QZXA 5DLPA 5F2KA 3WTCA 5JSZB 2O05A 2QLJA 2GGSA 2H65A 4UM7A 5HFAA 1ZN8A 2PMEA 3B3FA 3T5TA 3V7YA 4EKEA 3ZHYA 1QH9A 4M36A 1SMKA 3P2JA 4NU6A 3KKPA 4A2CA 6YASA 4WRRA 4Q3NA 1DXQA 3QSYA 4RELA 3NP7A 2JLRA 3IQGX 2X5XA 1NAHA 4B84A 4DNPA 4IH4A 5IC4A 4BFWA 5JSHA 3SZRA 3Q0IA 2F7SA 4LNAA 4DNXA 2VNSA 4KVFA 1D9ZA 2B7BA 1TZJA 1TI7A 2GESA 3QBTA 3T35A 4E14A 2C2KA 2FMKA 5E1DA 2VAXA 3C1AA 2VSOA 2XB6A 1G9TA 1VLMA 2VWHA 4JBLA 4NOKA 3P0EA 2IP1A 4Q4AA 2R9VA 5DXAA 4FSHA 3UK0A 3VKUA 5IP5A 2HLDA 4DJ5X 2FQYA 1PK9A 4B76A 4DLAA 2BFEB 2YFYA 3EQ7A 1QFYA 1R0KA 1ST2A 2EGGA 4PLZA 4EWLA 4G5OA 3F3KA 1GEEA 4I66A 4YRJA 4V0NA 2RI1A 1L5OA 3IIJA 4D82A 2ARKA 3F8SA 3M89A 1O57A 2XB8A 1BHQ1 1D2HA 4K6HA 3L2OB 1PTJC 5KNDH 2R6GA 2XRZA 1QZZA 4WLUA 3ABRB 3DE4X 1XZHA 1IC6A 2VR1A 3GA5A 3WLOA 1NGSA 1ESMA 4M1KA 3N2GA 4GOMD 3HN6A 4CG3A 3HXQA 1KYTA 2B8TA 4YIHA 5ENVA 2F4VB 5A9TA 1DT3A 1BHSA 1RAIA 1XVIA 5AHXA 4CIXA 2XZPA 3SJUA 3GVCA 1TZ2A 3A27A 2ORIA 1OX5A 1JMVA 221PA 2VNAA 3A9UA 4IKOA 5KJEA 3LM8A 1HOXA 2FMIA 4CKEA 1XQYA 1QH8A 3MERA 3OECA 1B3BA 2H5EA 1VRWA 2WAOA 4JXZA 5CM2Z 4LJ9A 3U48A 1V45E 3C4QA 4UVHA 3U4CA 2I65A 1AXGA 4I50B 3K09A 4ZOAA 4AP6A 2G63A 2ZFUA 1SEVA 3GFVA 3K1AB 3MGCA 1UQRA 1T3ZA 2QV7A 3A4VA 3BQMB 2WE7A 3IBYA 3PFKA 2E2WA 5G1OA 1Y3CE 3EBLA 1YRBA 1RYEA 1FBTA 2VSNA 3IB6A 3MRTA 5JDCA 3KYDB 2OBXA 3O38A 4ZOCA 2G83A 1EXVA 3HVHA 2BE9A 2NV0A 1ECBA 4EJ2A 4FZVA 5CJPA 3I2GA 4R8SA 5FPQA 5HUQA 1YCDA 1ODJA 2J87A 3ZE9A 1ZZEA 4CLXA 1N77A 2BI8A 2I4MA 4R2KA 2DWOA 3PCTA 1E2GA 2JBHA 4HNQA 3SYKA 4XB2A 1RKUA 3RIYA 3QH4A 3C8UA 1Y5RA 3CX7A 2OFWA 3TZBA 4JU9A 4L8GA 3ZW9A 2PH3A 3OICA 1ORHA 2J85A 4GBGA 4YJDA 2FSIA 1WJGA 1DKPA 5D5PA 5EWMB 4C07A 1HETA 2ZWVA 3IEUA 1CUVA 4FPXA 4EL5A 5JH7A 1O6CA 4ZAVA 3M81A 5ICCA 1MAWA 3NORA 1AK9A 1GZ6A 3UMYA 4KQGA 4HVTA 4JS0A 1HI9A 1AUQA 1H2YA 2MSWA 1TRKA 3G0OA 3HCEA 2BEKA 5ALWA 3ETEA 4JHXA 4F2PA 4EH1A 2WD8A 4HYEA 1TLLA 5IKMA 1J1IA 2NG1A 2OAQ1 4PSUA 3ZKWB 4CQMA 4C7BA 4G1FA 4KG7A 1VOTA 3CVXA 3LW8A 4H59A 4JB3A 3CY6A 4IDDA 5A7FA 2PGJA 2CW5A 2PANA 4PGGA 4R1LA 5BVHB 1TUBA 3HB7A 4JN6B 1GR1A 2A67A 3RYFA 2QPLA 1GDHA 3WKEA 1JB1A 3BJRA 4GL2A 5KJFA 3PNLA 2R60A 4AO8A 4PR0A 3AZOA 4C4YA 1PD1A 1JIVA 4ZO4A 5THXA 3UXHA 1AKTA 2H2FA 4BO1A 4YRNA 4RXUA 4YXWA 3UAYA 1NP6A 4BJ6A 5H8WA 3R7FA 3U5ZB 2FR0A 3BMNB 3T5GA 2QTWB 3OHMA 3RJMA 4CF4A 4D9NA 1SNYA 2OCBA 5CB4B 5M04A 1IN8A 4L5AA 1QK3A 2BFWA 4FR0A 4LJSA 3SD7A 3MF4A 3WLNA 1AZWA 3ZXYA 4AY4A 3KKKA 3G13A 1RQ7A 4JOSA 4NBNA 3TPZA 3UK7A 4TVBA 2JGAA 1AQUA 4ZT3A 2IUSA 2R66A 4O8CA 5IAJA 2OB2A 4F4FA 3MT7A 2O3TA 3U2QA 2WWIA 2X8BA 4D3DA 1QB7A 2XVXA 3IMEA 1X1RA 3JZAA 2VBCA 3AEYA 4YRAA 3FTNA 1VLVA 2YHUA 1C9MA 4FC7A 1G7RA 4E5UA 1EEHA 2A0WA 2CJXA 2ODAA 1V1JA 3E4CA 3JQQA 3K2EA 5EJMA 4OQ4A 3ANLA 4UUPA 1WD5A 4ZMBA 3CVYA 5KC8A 1J8MF 3HU5A 3ZWNA 3FPHA 1KKUA 2BUAA 3HO6A 4P82A 1V6CA 1DXHA 2W71A 4AN0A 3P0FA 3JWGA 3D1LA 4JUIA 2FR1A 3U61B 2B1JA 2VHWA 1Q3HA 3FCSB 3VHRA 3EEBA 1NN0A 2R6FA 3GQBB 1SU8A 2NW6A 4ZAXA 1NULA 4J4HA 4JC8A 4KXQA 1T2CA 4ZYLA 3RC9A 1TRHA 1ZUWA 3G5LA 5TPWA 3FHTA 1WQ4A 4L7QA 4L8LA 1VKOA 1I6LA 3GBPA 3KOMA 3KYIB 3LC0A 4ZHSA 5BV2P 2BV3A 2YWBA 3IQFA 2E6UX 2GHRA 4CL8A 1YQXA 1UBGA 1ZMOA 2QTRA 2QRLA 3ED1A 4DDTA 1PG0A 3BXPA 2YOHA 2CWDA 2O5VA 5AK6A 1HNZB 2QXUA 1EGHA 1YUNA 1OB5A 4KV9A 2TMKA 1UJ6A 2JD2A 2XQFA 3CZ4A 5C7OO 3K2BA 4HDMA 3KRTA 3AUSA 4URVR 4URFA 1RXVA 3S4YA 4MZDA 1SURA 4QVIA 3HCNA 4YA6A 1JJIA 1ZEMA 2XMPA 1MPXA 5EIBC 3GOQA 4L51A 1GUYA 3IT0A 2Q6IA 2XOEA 1WXGA 3KLPX 2B1IA 1UC9A 2COEA 4UHBA 1AY0A 3EZ9A 3G9ZA 3N7UA 2W22A 1NJGA 1T9CA 3UFXB 5IKEA 4RACA 3MXOA 3TQFA 1JFTA 1XTIA 2WTXA 1MQ9A 1YDWA 1EESA 2J9FA 1EXDA 5TPWB 3V2GA 1XLWA 1NDUA 1FNBA 3JTEA 2IGTA 3SIPA 3JQPA 1LPSA 2A5GA 1LNQA 1BEEA 2AH5A 4AKGA 4V0RA 5P8WA 2C7QA 1Q3KA 3X1DA 1IB6A 4KAJA 2XUHA 4YDQA 4ND3A 4DC9A 1EZ4A 1HLPA 1UH5A 2PSHA 4HCJA 4OIMA 3S0JA 3KU4A 3DQPA 3HTXA 3AVXA 5JS1A 4HWKA 4TS1A 4KE6A 4RV9A 1PT5A 2EL9A 4L02A 2XKJE 3OPYB 4PM4A 3JTMA 2GILA 4LJ7A 4EVIA 3W5CA 4ZT7A 5FPYA 2WV7A 1TTPB 1V71A 3WL7A 4BATA 1M8JA 3TS1A 1E1RD 1GZHB 1FFEA 3OC0A 1QFXA 1X39A 1YS2X 2BRUA 2W6OA 3Q8MA 5BQPA 1EZZA 3INRA 5TMPA 1UDRA 5FUYA 3GFPA 3WGGA 1IY1A 2XEDA 4MQEA 4DSOA 3LFTA 3BAZA 1M34A 3JQGB 1EM8B 4C3OB 1Z4LA 1X7XA 4F3YA 1B00A 4H31A 3LC7O 4YJ3F 1QQ7A 2I7XA 1AQ6A 3L0SA 4G2TA 4G56A 1Z18A 2OLJA 4BQIA 4Q3CA 1UFOA 3ZDEA 3W5AA 1KGDA 3QZUA 1G60A 2LZ0A 1JU4A 2BKUA 3Q1KA 3VPXA 3VU8A 4H9GA 5K0ZA 3H2JA 5DGXA 1NFQA 1SG9A 3B1VA 3P9QA 3RJTA 3IBCA 3DZCA 4YWHA 4RHYA 1SUFA 4O4LF 3TXAA 1JEJA 3I6ZA 3DMTA 4I5GA 4BBAA 4MCIA 4F72A 1F7VA 2GD6A 3AVQA 2ZYTX 3ENZA 4OKSA 2VHVA 4OFZA 4IEIA 4L4SA 4PYLA 2QN2A 4H0CA 1I5OA 4DIBA 4FOLA 4LYFA 3IV7A 4M0MA 4O4JB 4QHSA 5CFQA 1YBAA 5D3QA 2BMVA 2AT1A 5FWAA 2VZ8A 3L4JA 1ITZA 1Z36A 3ZKWA 1C3LA 1T9AA 2WWRA 3HCCA 3L5KA 4ITUA 3SHVA 1E3SA 2IUFA 5CDYA 2ZYSA 3VGJA 3L8DA 1ZA2A 4NV0A 1U81A 4P92A 4D92A 1M2EA 5CYOA 3WLKX 1P1CA 3KZCA 4DDMA 1E3TA 5LZ2A 3QW2A 3TJMA 1RLUA 3EDMA 3ZCPA 1Y8CA 5IJ9B 4MUBA 5DULA 1Z2CA 3VI4B 3AEUA 2RGXA 4L0QA 1K8YB 5IVHA 4C2AA 5FWNA 1AS3A 3QVOA 3U4QB 1RBQA 2BFFB 3BXXA 4KTTE 1P1HA 2XBLA 3JYQA 4X8HA 1GD1O 4UTXA 5AJVB 2CMDA 4NCHA 3STXA 4RY8A 4ZVMA 1E4YA 2VUUA 3FVWA 1JKJA 2CEAA 3H0KA 1TCAA 1Q22A 1ACLA 1V43A 1J20A 1PDVA 2OBFA 3PEUA 4UW9A 4OI0A 4TS9A 5AOCA 1FRZA 1K86A 4IY1A 2QQ0A 2FFQA 4IIXA 4DE5A 4YB8A 4U00A 4DIKA 2O7RA 4GPTA 3VTKA 5M3BA 4TKVB 4C0HA 1CY6A 2HEGA 2P4EA 3C24A 2BI4A 3DSRA 3QPBA 3G2MA 3RVPA 4URXR 1FUYB 1T9DA 3F3MA 3WWYA 1TA0A 1UBSB 2PD4A 2F62A 2HAEA 1SOMA 1AKUA 3WGKA 1P75A 3LX6A 3NJ8A 4Y2XA 5FTKA 3JRNA 4G5XA 3H8VA 4Y8VA 3REOA 5L3QB 1VHLA 3R9XB 3H2BA 1UZMA 1OPXA 3D6HA 4YGXB 5BN4B 5ICFA 1P3DA 3CPJB 3UHFA 4Q3OA 4N54A 2XJ9A 5KQSA 3QMMA 3IKLA 3K8QA 4FLMA 1H5QA 3H9UA 2KJQA 2V5VA 3RH0A 2CZCA 2GZRA 3HKBB 4EJSB 2AFHB 1CK4A 2JLBA 3C7CB 3FJ1A 3COPA 4L85A 1NRWA 4M2LA 3PHJA 2XKAA 4QQ8A 2H48A 4KXWA 2ZR0A 3R5JA 1DQSA 2RKOA 4A82A 3DT8A 4AZSA 1KDOA 3LUBA 4JJ8A 3R8FA 5C35A 5MN4A 4RM3A 3ECCA 5K0NA 3DP9A 3O4GA 4DOMA 3VZSA 4HH1A 4Z53A 4JGGA 2ZU0C 3D54D 4RDHA 3MBIA 4BKRA 3PHLA 4BLWA 1E1QD 2DOKA 5G4KB 3QBEA 5EFZA 1XQWA 2BMJA 4R2XA 1QIEA 2A0YA 4UNNA 2ZYVX 5CVUA 3L7KA 4QBIA 1VRVA 1P5JA 2XKBA 4JP3A 4ZOBA 3DGFC 4GI2A 1NRJB 4JIMA 3P9NA 4QPNA 2HSEA 3TLAA 2YXPX 3K0SA 3VKHA 3WLEA 3FG9A 1N5OX 4M1EA 5REQB 3DH0A 2W2OA 3H2IA 2PZBA 3ED5A 4R8RA 1R12A 2CB0A 3KSRA 4TWJA 1A5BB 1H5NA 4AQ7A 1C9YA 2AQKA 1FQWA 2O7QA 2Q4DA 3ZWAA 2HF8A 4CMHA 4HADA 2YQ5A 4CM9D 2A3RA 1L8OA 1QVVA 2WWTA 3DBLA 1LGYA 3CZ5A 2BEJA 4NDAA 2JIPA 4AF8A 5K45A 1QFMA 3OIYA 1E92A 3NG1A 3K1TA 5CT6A 4WPGA 1RDFA 1FLAA 2XX3A 4QGHA 4DA9A 2PLWA 3L7DA 1MH1A 1OFTA 2B4TO 4RLHA 4AMGA 4F4DA 1BDIA 2CHUA 2ZYHA 2NNLD 2M98A 4HO1X 4HYTA 2PNFA 1BGVA 1E7SA 4NQRA 4A10A 4L0MA 4BC1A 5AVRA 4AMZA 3GEMA 4MA4A 1Q1ZA 3NW9A 2G17A 1N6KA 3VVBA 4C87A 4TT3D 3LBNA 4WKNA 4KPUB 2FQ1A 2C8KA 1MABA 3ZHVA 3DE7X 5JSUA 2WP8J 1GNPA 2JDIA 3HBMA 3N6XA 4EG3A 1NXOA 2H0AA 1SCUB 4RZUA 4GKVA 3BQNB 4RVHA 4IDGA 5CIWA 2X5OA 1U0BB 4FFPA 1GUZA 3AI2A 3G2QA 1MB3A 4Y2PA 4QEKA 2GTPA 4D42A 3HWX1 5BYJA 3AIKA 4NZYA 3T9FA 4DA7A 3B53X 4KH0A 4IYJA 4TTPA 5LA6F 3U3ZA 9LDBA 3SNHA 4YBZA 3VJLA 1WETA 3ROPA 4IOJA 4FD3A 2W8ZA 4YJ2A 2ZSAA 1OE0A 4OQQA 1BWQA 3A37A 1IWBB 5T4BA 4ALNA 2AKEA 3DZKA 5DEIA 4DQDA 2LR0A 2R47A 3E9DA 4DCPA 1R50A 4DLNA 2M6RA 4CIAA 3U4MA 5TQ2B 4A03A 5LQKA 2RG7A 4BN4A 4LJ4A 2IXBA 2H16A 3AEXA 4CV2A 4JUAA 2O2XA 1ZGBA 2GKOA 4PZ0A 3IE1A 3UBMA 3NX4A 1H0RA 5IAKA 1XCBA 4BKUA 5ICEA 1BXGB 4X63A 4C5AA 3ZDCA 2L69A 4X85A 1X7WB 2YWEA 5BSUA 1PJQA 3IMKA 4NBLA 4WK2B 3SSMA 3ZUPA 3DL0A 3W5BA 4ZV4A 3BZWA 2OE2A 1E20A 1P9OA 3E9RA 4AF6A 3AT1A 4QUIA 1F6WA 1Z5GA 5D3KA 1A88A 1K6EA 1T0PA 1DTSA 3MUNA 4UZFA 7GPBA 1DTWB 2ZJ5A 2HPHA 2PFKA 4M0PA 2GKSA 2XDWA 2RAPA 2JZOA 1NI3A 4N3CA 2J0QA 1EP1B 1UWVA 2C4HA 4Q9JA 3ZZTA 1NPTO 2NNWB 2ZSJA 3D7LA 1GPDG 5EMHA 4ER0A 5D1HA 2WPDA 3ZWKA 3AHJA 4TYWA 2Z2ZA 2RH5A 5IDQA 2LPMA 2C29D 2GWRA 2H7VA 2HMVA 1W52X 4FHDA 2ZREA 4MS1A 1F48A 2XSZA 1XGKA 1OWOA 3MINB 4OKNA 5AI0A 3TQHA 3DDSA 3OOSA 1X38A 4HPJB 1WSWA 1H2BA 2WNHA 4HOYA 4UHFA 3ZCSA 3R5KA 4JWTA 3RREA 1BD4A 3JAWB 3SHTA 4A8JC 5JD5A 3GLIA 4EEXA 3GFQA 3CVJA 1OI7A 3LV8A 5G4KA 4A8PA 3SQXA 1LNZA 2BPOA 1F3LA 3ESRA 4ERNA 2Q3CA 1CULC 4OF4A 2JG3A 5BQXA 1UXKA 3K2QA 2VDKB 4CMEA 4K1XA 5BUSA 4R01A 2B4YA 1T1IA 2MR5A 3PQ2A 5KQRA 1MO6A 5AVSA 3I72A 4HDNB 3T38A 4B3GA 3ITKA 4HB0A 1Y6FA 3BT7A 2MOKA 3FCCA 3JXEA 3SXUA 1VFNA 3H5LA 4C6SA 4M22A 4V0SA 1SQ6A 1A8HA 3INTA 5K8UA 1YQUA 1KIAA 2PM8A 2VNKA 5JAMA 4DSNA 4GBMA 3AB3A 3HNOA 3UB4A 2BEVB 1YNOA 2CL7X 5ARDA 5KWVA 4CTOA 1HORA 1ZAYA 5FNVA 5TEWA 3ROMA 3L06A 1JYEA 4I99A 1U90A 1YL7A 2OD7A 3AJAA 4FK8A 4JXXA 2RGRA 2R85A 3SHWA 1AUPA 3D1JA 2XUPA 3BYZA 2JGRA 3TMAA 3MJVA 5IG2A 1F9EA 1U98A 2HO4A 2JHFA 2OAGA 1T0BA 2O8FA 5L3QA 3R9XA 1E0AA 1B8PA 1RE1A 2EJWA 3QHQA 2X0KA 4Z2AA 3LLMA 4OJNA 4B85A 3A05A 4TV8F 3NUQA 1XZIA 4E2ZA 4D5EA 2YZ7A 3PYLA 3NDRA 5A6SA 3K6JA 1LSJA 3PQEA 1KMNA 4YJHA 1CUHA 5D2CA 4J0JA 3W9YA 5HYVA 3DXYA 3SX4A 4BVBA 4LBZA 4OMDA 3QUCA 3UW3A 1SCJA 3AW8A 3AJEA 3ZHUA 4UBNA 3DR5A 3JVDA 1CQXA 1W49A 5FWXB 2YYYA 4N39A 2Z4SA 1GKYA 1JQLB 2CB9A 2XVZA 3U4HA 3UK6A 4YMHA 4RH3A 3E2IA 3HM9A 3E9EA 4LE0A 4BB0A 3IL2A 1Z22A 4RPHA 1WX1A 2MYUA 2Q7OE 5BV1A 4BX0A 3V7WA 3ZCRA 4N6GA 3LQQA 2BFFA 1GADO 2G67A 1QRDA 4INZA 3DF9A 1Y3DE 5I6DA 2AX4A 2O8BB 1TLTA 4QU9A 4LHXA 2VUSA 3BF7A 3KE9A 3PQ4A 3OC6A 2E55A 5IBPA 2NVBA 5FL3A 3HDQA 1OAAA 1KMQA 3IHTA 1YE8A 3TLCA 3WB2A 5KWSA 1N92A 2BZSA 3TVDA 1QIGA 2C0CA 4LOJA 5GADl 3EG5A 4BNZA 1TUGA 2AOVA 2HTFA 1ZD3A 2YX1A 4G1EB 3T3IA 4UPDA 2REXB 4OUDB 3USCS 3DDUA 2PGLA 2O4UX 1G8SA 2QX9A 4KVZA 4WOCA 4WH0A 5FRDA 3WGZA 5KTNA 5DRYA 1BE8A 1F51E 2OL4A 3DB2A 3WL8A 4Y2RA 4I36A 1FTQA 2EERA 4EW1A 4YBRA 1HLGA 1HRDA 2A78A 1H2RS 3WWCA 2PLNA 3GFRA 3OA0A 1JLRA 3ENWA 4HSEA 5FV4A 1GQRA 2DC1A 2JVKA 1D6JA 1KH3A 1PZFA 2VN8A 3LXRA 3P0HA 4OSEA 3S1LA 5K5EA 5LLTA 3ER6A 1F17A 2VLIA 4TSFA 4DEVA 1CQZA 3B6KA 5K6RA 4DHWA 2RGYA 2YWXA 3KWFA 4CUJA 4ZHQF 3WGVA 2P2SA 2RH9B 4G2NA 4J7CA 3ELYA 3QMWA 3M6MD 5HVNA 4PYKA 1FLVA 3BWEA 5KOYA 2COKA 3GFBA 5J1TB 3PNPA 4KDFA 1T3GA 3IP8A 3CGWA 3HFJA 2YVAA 3V4RA 1RI3A 1L8QA 3VU3A 3B52X 3AHCA 4P6VF 2XA2A 5CEFA 4GLFA 4KN9S 5AXAA 4CV0A 2XXAB 1XN1A 2PJRA 3O2QB 3NP9A 4A2WA 2JARA 5ITZA 2VDNB 1GPJA 4RXTA 1HBJA 4A92A 1YWGO 1W19A 3G9UA 3GZNA 3P94A 1DHTA 3GUZA 1ETHA 1JRLA 1AMOA 1EWQA 2GN9A 2P0EA 4XZ3A 4DMKA 5JEEA 3E15A 4YUAA 2YQZA 1Z47A 3FOBA 3LVRE 3M3DA 3R7AA 2L18A 1EWYA 5BMVF 1E1MA 2DZDA 2QX4A 3FNEA 4I9FA 2GM3A 3D8NA 2AFIE 1N5KA 1Y9DA 4G1VA 4TWAA 5IAEA 1ISFA 4AZ3A 5BN5B 1TYBE 4JKIA 1FYXA 4UDOA 5FORA 3CUTA 3FHOA 3R40A 2VJCA 3RU2A 4V1CI 1DV1A 1ONBA 4WA8A 3HP7A 2ZSBA 1KHHA 4WGGA 3TSYA 3DTVA 3HFSA 2VJAA 5J59A 3U3DA 4Q3LA 1P62B 3DD1A 3OJ0A 3ST7A 1ONOA 3EDYA 4OQLA 4QLOA 4HQNA 1SWVA 1YMVA 1VHQA 2BF7A 2F1JA 3IR6A 2EFEB 4HDMB 4IVRA 4UFOA 3T3MB 4R4JA 1RYBA 4LCEA 3H6KA 2PX6A 2QAJA 4AJIA 5AD1A 4G0NA 4MVYA 3ZDRA 3IDFA 4JC5A 3RUFA 4H7FA 1E8DA 1KBQA 4PQEA 3CPHA 4V1CB 1DAPA 4PRLA 5GWXA 3NHUA 1W4ZA 2I2BA 1ATIA 3ISVA 1JA0A 1ZIYA 4MGZR 5A4JA 2UYHA 1E2FA 4OK6A 5TX7A 4U2CA 3ILYA 1R4MA 2IYLD 4FE7A 5E8JA 3WICA 5DYNA 4EF5A 2CXUA 2PWBA 4FYJA 5DSXA 4MJ7A 1NMXA 2PUDA 3H7IA 1KJNA 2G09A 1O87A 2J32A 4UNSA 4ARZB 3GLHA 4KQIA 4MYDA 2NPFA 3QI2A 4P22A 3GDOA 4LYAA 5AW5A 3U17A 5K8LA 4J03A 3I4FA 2QG4A 2AVNA 2BFBA 3SYTA 3SE0A 2OFOA 4R05A 4MYSA 2HMWA 3QWBA 3QXHA 1WY7A 4JR2A 4OA8A 2WSLA 1L4UA 4KUEA 3U7RA 4KREA 4PBRA 4MVJP 1ENZA 2FEWB 4AXBA 3N0RA 1XMPA 1SC3A 5JXHA 2ZIZA 1J0DA 4WCDA 3DMHA 1VG9B 4BNNA 1TD1A 2BFBB 5DM1A 4BNVA 1I4TD 2UYQA 4CTMA 1ZD1A 5BPHA 3L3BA 2DHRA 2P68A 2QJTA 5ALKA 4QZVA 3G59A 3LT5A 4GRDA 1HZZC 1U3DA 2IXEA 1R9NA 1DAKA 2DPHA 1LDMA 2OUKA 2FNAA 2EKQA 3ET4A 3N86A 1CG6A 1CJTC 5FADA 4DF3A 1ZW1A 1R8JA 1DP4A 2TS1A 1TM5E 3EAFA 4V1CA 3WSWA 2QW0X 4BV2A 5IUJC 2ZVPX 2ANBA 1CC1S 4RA9B 4ECEA 3A9SA 1ZOPA 1NUTA 4YRGA 5LP6C 4ND5A 4NSNA 5SYMA 4A26A 1KWKA 3BA6A 3UT5B 2BGTA 4JLUA 3OQIA 2W2KB 3DVRX 1HEUA 2V5AA 1C9NA 4HEA1 2ZE5A 3ZQUA 1Y5NA 3M82A 9GPBA 2OHXA 4R98A 4LCBA 1T6XA 4ROTA 3BILA 3RIEA 1I1HA 4LY6A 3Q7QA 1FPQA 2BRUC 5JNLA 2CLKB 1SCQA 3EXIA 1DO8A 1JIIA 1RBMA 2DWQA 2OCDA 3ND7A 4N3BA 4DZZA 4DR2B 1JHAA 1FQKA 1F2VA 5ALZA 3M5CA 4JGBA 4AJ2A 4BMXA 1JG7A 1GFIA 1LF5A 2P4QA 4B7AA 5EXTA 2A92A 3C98A 2EVWX 1WBJB 3QKRB 4IOLA 4NBSA 4ZT5A 2BBWA 4P1ZA 2E5WA 2GMWA 2HU2A 2IBMA 2V03A 2XMQA 3CF6R 4UUQA 3RHTA 4L6IA 4WJKB 3KB6A 4HGYA 1QO0A 1KRWA 3KD2A 1H42A 2W6JA 1QOQB 1QVWA 2QYTA 1YFJA 5JWRA 1EVYA 2QTGA 3CZAA 4J1TC 4K3VA 3OCCA 1CJKC 4EJFA 1TPYA 2BGIA 3GLQA 3K3PA 2XVMA 1WZCA 1IOVA 3PF8A 2H2GA 4Q12A 3T6KA 4CMGA 1B14A 1IYZA 4QXRA 1J5PA 4MKXA 3B8HA 3RRNA 5AXDA 5JEDA 3ZBQA 4NR0A 4YRCA 4D9MA 1UFRA 4PGFA 3PUWA 3V9AA 4NICA 2GHIA 4IDQA 3EXFA 1D1PA 4O08A 5JYCA 1PFWA 4Q0MA 5JCPA 1RPAA 1J70A 1ODTC 4ZQIA 2C5EA 4G0QA 3IQEA 3Q6IA 4KQXA 3A1VA 4O4IF 3E1SA 1FMLA 1L0BA 2PX5A 2QMEA 3EF1A 3AESB 3OKPA 5J4YA 1KEKA 1D4AA 1LSSA 4K8RB 1TVKB 3KYDA 3KUDA 3ORFA 5EZYF 5D86A 5ALOA 1YZTA 3SG0A 4B3RB 1I2BA 2EV9A 2GXQA 3L40A 3I8SA 3SZMA 5LQMA 4FB4A 2OEPA 1M1YE 1WB4A 1J2YA 1MR3F 2IY8A 2SECE 2ZPAA 5H9VA 4DANA 3DT9A 3EBOA 1FFDA 1XEWX 4DWWA 3OQNA 4YUVA 1QR6A 1V7PC 2RHGB 1B8UA 4PRKA 3IMFA 4KZKA 1E1YA 2WFMA 3B3QA 4R69A 1GFSA 4WHMA 2P4SA 4LGVA 3PEYA 4BQSA 3HGMA 5J4LA 4TOIA 1EXWA 3N70A 5KYGA 1GQFA 4QJ5A 3TAXA 3RS0A 3EJWA 4B3JA 2BMFA 4YJ3B 2WG1A 5AKEA 5KUTA 2J4DA 1BX0A 4GM1A 5A3RA 1XDZA 2F43B 4L9WA 5ALXA 2HCTA 3FPSA 3AB8A 4LZWA 1ISHA 1UKAA 1QXSA 3SC3A 3DM9B 2FEKA 3L5OA 1PNVA 2DCUA 2JPDA 4GG1A 1XEAA 2I54A 2XYVA 4I1IA 4BE9A 2IYOA 1R74A 1ISMA 1UC4B 1NP3A 3I2FA 4G1CA 1YQWA 1MRSA 2QM0A 1ZD8A 1E0KA 3NUGA 2C58A 1VJTA 2IZ0A 3LG2A 4NEQA 4CUKA 1JQ3A 4XVRA 3LHKA 4AVYA 3NHMA 3B6ZA 2CUZA 5HM8A 1H3FA 2IHBA 3T7KA 3QU4A 2XUIA 1P19A 1UFQA 3KD3A 1WV0A 3QPUA 4Q4AB 4ZODA 4HY3A 4ZANA 2DKFA 1FW8A 2Q4EA 4H7EA 4RPGA 1KQNA 2W70A 3VPBA 4XDHA 1ZK0A 4C20A 5CCEA 4PZYA 1RKXA 4AMYA 4BFSA 2PUHA 1SKMA 5EGNA 4G0WA 1ZH0A 4EI2A 3GVPA 2FZ4A 2PLRA 3O75A 1PR5A 3HI6A 3GFOA 4OLFA 2CCJA 4XJTA 4WDRA 2QE7A 3OZXA 2IRWA 3G0DA 3TKAA 4DV3B 2V96A 1GGJA 2C42A 4LMBA 3QUQA 5AJHA 3M6IA 4MPTA 3VO8A 4E4RA 3THWA 3WP1B 1CQJB 1XHFA 2P6UA 1JSRA 5FTLA 2BDEA 1RWBA 3C87A 4FX5A 1HFWA 3OCUA 4J8PA 4YAFA 4TXLA 4A91A 3LBAA 1X8KA 1ND6A 2YH2A 4OUKX 3RRZA 2OGTA 3QBVA 3TBHA 3CLUC 3IURA 3TQRA 5CPBA 1DNPA 2WSSA 1NXVA 3K8OE 3S68A 3K1ZA 3PXDA 1NE7A 1EJBA 3K9WA 5LDHA 2QNRA 1J09A 4XVUA 1NYTA 3CX6A 3EASA 3NVDA 3RSQA 4DTIA 4LRUA 5KCZA 2P35A 1DRVA 1NYLA 1W6RA 3G5UA 4Q9LA 4Q47A 2OGUA 1DQRA 5J2UF 2GQ0A 1MLDA 2QM8A 3DPIA 3GMSA 1WCWA 2GZSA 2J3JA 5JQWA 3EXHB 5A06A 4OQEA 4E0BA 3OT4A 1IBLB 1JB9A 4IP0A 3GD7A 3TL3A 4UARA 1QP8A 2D4AA 5LA6A 3RQIA 5L45A 5FI3A 2FHSA 2WU3A 2XT6A 4EMUA 1Y3HA 3BJZA 5IW8A 4DLLA 2H1SA 3CCCA 3JV7A 4WN3A 1QHNA 1DJMA 1J7KA 4RD0A 4S0XA 5GZ6A 1DDGA 4JDUA 1OCEA 3F1LA 1JP7A 3KQLA 3L8YA 1QP4A 3DMGA 4TYNA 2CD9A 3ZHRA 3I6IA 1RMTA 1LZKA 2TECE 4Y67A 3QXGA 1FFXA 4LWOA 2BGWA 2PXXA 1G55A 3DXZA 5AQEA 3R7LA 5HE8A 3JAWA 3VRHA 1SXQA 5L53A 3C41J 1K1EA 1EUYA 2WSYB 1Y63A 1UJ4A 1NQUA 1V5GA 1WQ1R 2HUNA 2QW8A 3B3AA 3NDPA 3U3RA 3WK4A 1C0PA 1A5AB 2VYQA 3MWEB 1OXMA 1WDWB 1JWAB 4MUFA 5LP1A 1RFGE 3F7OA 4IFIA 1FSZA 1T0JB 1WXXA 3NTXA 4J0GA 2FQWA 2A86A 2QNBA 2V98A 4Q21A 1NBIA 2XIJA 3ADBA 1RXWA 3K30A 3SZGA 2I2FA 1J06A 1JU9A 2Q29A 3GLFB 2HCRA 3IP3A 1Q77A 1FUUA 2OENG 2VDUE 1XB2A 2VJMA 3TLEA 4BMSA 2RJOA 1XL0A 1DINA 4WJZA 5DFAA 1W8DA 1X7WA 2FZCA 5AJYA 3AR4A 5JRZA 2OCAA 1K7YA 3LUGA 1U4SA 1U7OA 1HT3A 1UIMA 5E3HA 3A6GA 4NFSA 2QAGC 3BN3A 3STUA 1BGXT 1TFUA 3L7MA 2JFFA 4C43A 1F8UA 3WLFA 4ZZIA 2BJHA 2IYUA 4ND8B 3TR5A 3ZI4A 2YJTD 3UCFA 1GTG1 1PHPA 2XADA 3LL4A 4FBGA 3HV0A 2BFDA 3STWA 3AF5A 4MMXB 3OX1A 4UCFA 2O2ZA 4YC7A 1EQAA 5TMEA 4Q7EA 2WSBA 4BFXA 1G8YA 5EZQA 2RC5A 1PWYE 3U7FB 4YCAA 2ZSEA 2IS4A 2FDCA 1RKVA 1M66A 1A69A 2D8MA 4IDCA 1UXIA 4JLMA 4E15A 1LPAB 1V3TA 2DU8A 3NT5A 1GXSB 2O20A 2QS9A 4M9UA 1NVKA 2XE8A 3R6GA 1KDZA 5J4KA 3GXOA 3NLLA 4O8ZA 4RA6A 3V4FA 3C6BA 2C4UA 2FDXA 2XE4A 1T9GR 3DAPA 4DKXA 3H2ZA 3UWMA 3CNQS 1FSFA 2C3PA 3MILA 3T7CA 1Q0ZA 1V8BA 2IDZA 1FYEA 3MMXA 5KX5A 3WWDA 2B20A 4LOHA 4PNPA 3V4VB 1DCMA 5IASA 3EVAA 4LJRA 4QXMA 2Q2WA 2RJNA 2WHEA 3EWAA 5I48A 1ADBA 3DMPA 4NENA 1BQ3A 4P3YA 3D2BA 2Q8NA 1RXIA 3QPVA 4MI1A 3SOZA 1KEWA 4DQ0A 3PPWA 2J5XA 3FCUB 3HDVA 3PCRB 3UB2A 4BP3A 1ZR2A 1BFKA 3JYLA 5CH5A 4PCLA 5F5NA 1TT5A 3C6YA 2PS3A 4MQLA 1PW5A 1UIRA 4WZBE 4YP9A 1L5KA 4DRYA 5FDFA 4WBNF 2BGNA 3O8LA 1H1DA 4LXQA 1Z0IA 1ZM7A 2N46A 4GMKA 3BCUA 5M2QA 3C3BA 3CONA 1T5LA 3O1IC 4PSDA 1EIWA 1S2NA 3EIFA 2WVHA 4BO5A 2F3PA 4OQXA 4QOSA 2FN4A 3ANSA 4MIYA 5TS2A 2H29A 5EQFA 4DNOA 3MNFA 1TW2A 3PP8A 3KYBA 1GA1A 1WMAA 4QO8A 2FSSA 3WBFA 5EY5B 2Z3WA 2ZTLA 1X1AA 3AIMA 1VLHA 4M21A 4D99A 3WL3A 5IVIA 2ACKA 1RKBA 2AG0A 3VHXA 4ZEWA 5AXCA 4AZWA 1BA2A 4QTTB 2D13A 3QVXA 1FJHA 1IAQA 3PUVA 1NVFA 1GXSA 5B1SA 3W5IA 4AL4A 1Z29A 2SBTA 1X7ZA 4D9HA 4D4GA 3AF4A 1Z5WA 1Y7IA 1VG1A 1L4KA 3ZCXA 4ER6A 3EVBA 5LD2B 2A7XA 1E32A 3P2YA 3PRKE 4COOA 3AFHA 1E1DA 4MWZA 2QY6A 3FGNA 2XVYA 3EIXA 1U4OA 3V8NA 4M0EA 2QVCA 1O4WA 4QJ4A 1HNXB 1GTVA 4DPKA 4YTEA 3KR1A 3TD2A 1OIXA 2BFDB 1CZKA 3WWPA 1W30A 1GL3A 1LFAA 2VEOA 3AU9A 4IGKA 2HM7A 1W88B 1DXYA 2JHCA 4QWMA 2AFHA 4ND8A 2Q50A 1R6VA 2XDYA 3FJOA 1YS4A 3I42A 3C1OA 4GQAA 4A7PA 5B6IA 5DTJA 3UCEA 4ZOLA 4E2YA 3U44A 3G89A 3E22B 2AC7A 1OWLA 4XX1A 1C80A 1H1TA 1USVA 4KIFA 6Q21A 2Y4OA 3SVLA 4E09A 4HLCA 5FIUA 2IV3A 1UJCA 1T9BA 1M6EX 3B1WA 1WMEA 3AILA 3PQ5A 2NZVG 5D1NA 3R5TA 3I9MA 2FKAA 4RK0A 821PA 3U26A 2B4QA 4TKVA 3G9TA 3BSSA 3KYCB 1X42A 3AP1A 1NTRA 1KZGB 2H0RA 3L84A 3KLBA 2M2IA 3UOWA 3A9VA 1QHXA 1I36A 1WEKA 4P9NA 1NDHA 4D0LB 5IABA 1T34A 1E9AA 3PXUA 4MJLA 1UT8A 4AUNA 3ZXIA 2AUMA 1JKJB 4IUYA 4Y6PA 2FPMA 5JTUA 3VR4H 4CDMA 1FBNA 3R44A 5FLKA 1WMSA 3KVNA 1EI9A 3RADC 4RU1A 5JNVA 1Z16A 4YPOA 3K0EA 5A71A 2GM4A 1QF6A 1SQFA 4FJ0A 2I7TA 1DAHA 3UMCA 1AKWA 3UV3A 2ZZMA 1B1CA 3K70C 3PICA 1AKRA 3WLSA 4Z1MA 1YC2A 1H94A 1RWWA 3RVOA 3JD4A 2MSLA 4FHGA 1AVTA 4OREX 2FKNA 3MCAA 4S1NA 1UADA 3BIOA 3VX4A 1SHKA 5IBRA 3FYHA 3MK31 3OP4A 3SIRA 1NSTA 3IEXA 3KNZA 4MNTA 2PDAA 4XQGA 3WJAA 4ZKEA 1F0PA 2H1OA 1V25A 4PYMA 4QAJA 5ERXA 1XPOA 1EX9A 5C7LO 4Y2JA 1IJFA 2C2ZA 3MOIA 4NLLA 1LTHR 4Z2YA 4EMBA 1DAFA 4QG7A 3R41A 4GHWA 1WPQA 2HR1A 2LGJA 4F56A 3MWGA 4HBZA 2YHIA 3CPSA 4ODIA 3HKEB 4G41A 4I4TB 2I5PO 5ES4B 2VWGA 1G1MA 4OQNA 1LBSA 1DFIA 3LKDA 3O84A 3QLTA 3FDXA 4IJUA 3TXYA 1QORA 2ZYWX 2GAOA 1WA5A 4J3FA 2EC5A 3A6EA 4P58A 5IEJA 2C9BA 2PH1A