1X9IA

Crystal structure of crystal structure of phosphoglucose/phosphomannose phosphoglucose/phosphomannoseisomerase from pyrobaculum aerophilum in complex with glucose 6-phosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
300
Chain Sequence
SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords glucose-6-phosphate isomerase
publication title Structural basis for phosphomannose isomerase activity in phosphoglucose isomerase from Pyrobaculum aerophilum: a subtle difference between distantly related enzymes.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 111
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x9iA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x9iA02
2ZM6B 1XTBA 1IBKB 2VF5X 3FXAA 4LF4B 3Q7IA 1TZCA 3PR3A 4JI5B 1MOQA 1JIQA 1IBMB 1IRIA 2PUWA 3HJBA 5LMUB 4JI4B 2UXBB 5IT9A 2CXRA 2PUVA 5FLXA 1N36B 5IWAB 5BY2A 2O2DA 2ZJ3A 3UJHA 1VIVA 4EM6A 2X3YA 2O2CA 3FKJA 4AQYB 1GZVA 1TZBA 4LFAB 2A3NA 3Q88A 2F4VB 2CXPA 1U0EA 5LL6P 1KOJA 2CXOA 2WU8A 4DR6B 1C7RA 3M5PA 4S12A 4S1WA 4KHPB 3FF1A 4DV6B 2I22A 1U0FA 1XNRB 3OOJA 1HNWB 4JYAB 1HR0B 4B3RB 1U0GA 1IBLB 5LMNB 1MOSA 2CVPA 1X9IA 1Q50A 1X92A 2XBLA 2PUTA 3C3JA 3QKIA 1GZDA 4LF6B 2V4MA 4LZJA 4B3SB 4DR2B 4AMVA 4DV3B 2UUBB 3SHOA 3J7AC 4JI0B 5A2QA 2UXCB 4NXNB 1VI6A 3J80A 3OTOB 4DR4B 4YY3B 4M0DA 1TK9A 1WIWA 3CVJA 3JAMA 2ZJ4A 4DV2B 3T1HB 1IATA 4U6NA 1N34B 3KNZA 2I2WA 1HOXA 4X66B 1MORA 1X9HA 2CXTA 1I94B 2CXUA 5I01A 2DECA 3T1YB 1HNZB 2XHZA 1J5XA 4JI3B 4DV7B 1VI5A 4X65B 4JI7B 1N32B 3BJZA 3TRJA 1XMOB 2CXSA 3BCHA 1JLHA 4DUYB 1VIMA 1G98A 1HM5A 2AMLA 3LJKA 1NUHA 4DR1B 4GKJB 2E5FA 4JI8B 3IFSA 4LF7B 2PGIA 1N8TA 1T10A 4TOIA 2VQFB 3I0ZA 1J5EB 4LF5B 3G68A 4JI1B 4B3TB 2CXNA 2UUAB 4B3MB 4NXMB 1XNQB 4LFCB 1JEOA 1X94A 1JXAA 4LFBB 2VQEB 2J6HA 2E5LB 1ZZGA 2Q8NA 4DUZB 2POCA 1M3SA 4DV0B 1FJGB 1N33B 2UXDB 4DR7B 1DQRA 3J81A 3HBAA 2CXQA 4OX9B 5BR8B 4K0KB 4DV5B 4JV5B 2VF4X 4LF9B 3ODPA 4GKKB 1XMQB 1B0ZA 3EUAA 4YHHB 3FJ1A 2YVAA 3ETNA 4DR3B 2HHHB 3JX9A 2DF8A 4X62B 4LF8B 3NBUA 4DV4B 1NRIA 2UU9B 1C7QA 2UUCB 4JI6B 4X64B 3TBFA 4JI2B 4DV1B 1HNXB 4IVNA 2CB0A 4DR5B
chains in the Genus database with same CATH superfamily
4Z8YA 4BAGA 1R3DA 5B4UA 3PR3A 3KAKA 1R9NA 4V0NA 2NZ8A 3BWDD 1T1RA 3S2IA 5ITVA 2K87A 3CO5A 2WTXA 2QNBA 4ZI5A 1R6BX 2ODQA 2JAPA 3EODA 4Z86A 1WBBA 1U3GA 1FVHA 4X44A 4YAJA 1I14A 1KI7A 1ONNA 1SUDA 4NOKA 4PG5A 4RL6A 3BSWA 5TARA 2O7QA 3DVRX 5B58C 2X5NA 2NAFA 3BWEA 4TL6A 3TJRA 2PRIA 5ABPA 2CV2A 1LJ8A 1PNOA 3FPGA 1KOJA 2Q3BA 3T4EA 5E1MA 2W2LD 2PT6A 3W5AA 1U4SA 1HA3A 3A4YA 3D6AA 5LPNA 1HORA 1T24A 1CJBA 1IL0A 1RXSA 4PAOA 1Q7GA 3NC1C 4I1VA 3D02A 1YRLA 3KJXA 4NJEB 4BLQA 3N2GA 1C7IA 4JJ4A 4ISBA 4YLYA 1KZHA 4C7BA 4WCVA 5EJ9A 2I6TA 2WF8A 4R2WA 5ER6A 1N2CB 1Y5RA 4NJMB 5EJ8A 1U8EA 2ZLBA 1VP9A 4R9UC 4KLZA 2CVPA 3V1YA 4RTNA 1QP7A 1Z16A 4A0GA 3DV0A 2LV8A 3PFCA 4WNAA 1C9NA 1BE1A 1OFVA 2QRVB 3C3MA 1R0WA 4HJRA 3U7RA 2R751 1Z0KA 1USGA 2V7TA 3E3OA 4J03A 3PXXA 1YCFA 3EVZA 1H2EA 3ZJVA 1KAHA 2BM8A 1T6XA 2BM1A 2NXEA 4L7VA 2VHXA 3MCZA 3RFUA 3STXA 3J80A 2AJLI 2P0EA 3MJRA 4IG9A 9GPBA 1DIBA 4WVFA 5ADWA 1N2XA 2GQ0A 3OX3A 4OL9A 3WISA 2B8TA 3G8YA 3RWBA 4XYGA 1I7LA 4RHFA 3RQSA 3EPKA 2AGVA 3C15C 2J7PA 4M53A 2VTEA 5H68A 5DT2A 5IVKA 1JZSA 3ZWOA 3YASA 2ZBPA 2EP5A 1RPAA 1Y9DA 1OT3A 4WOCA 5KDDA 5DM60 1K7CA 1N6LA 2G7ZA 2PWYA 4HBZA 2GM3A 1PP4A 5KQMA 2V74B 3W8NA 1X7XB 2NADA 5FBHA 1PSDA 4OTZA 4W9NA 1NL3A 2G5GX 4INJA 3QYJA 1KSGA 3VO9A 3TI7A 2FU5C 2GERA 2C61A 3IOYA 3AFOA 3DM9B 3EZ2A 1ORWA 2FFAA 4B0PA 1XPUA 3LX8A 4E22A 4WAUA 3LX4A 4IJ5A 4LZNA 1TPZA 3PVZA 3QQ5A 3GEIA 4YN3A 2XF8A 5A9SA 2O48X 2RI6A 1F1JA 3FRJA 3ZZTA 2NUPA 4BFYA 2WD7B 4GZLA 2JLWA 3ICQB 5HCUA 3H2BA 1E4EB 2EWMA 2Y1OA 1E8MA 2WD9A 2XAAA 2ZIFA 3Q12A 4HFMA 4INOA 4P5DA 2CNOA 3BYZA 4KLCA 4KQEA 3NHSA 2VJNA 2CJYA 3ZOZA 4E5KA 4D99A 5KOIA 1P1RA 5FQNA 3LLMA 4MWSA 2RARA 2QJOA 1YVDA 4LDRA 2C7VA 2C2WA 1XVIA 5AIAA 1KKUA 1SQ5A 4GYWA 1HKUA 4FDMA 1Y3DE 4M4SA 1ZJWA 4CF6A 1FW8A 2JLSA 3EVFA 2ZTSA 4E7OA 3PWKA 3FCXA 4OREX 2ONJA 5EPUA 4AT1A 1Z0ZA 5KVSA 1N2GA 1EXMA 4WT7A 5JBQA 2F67A 2OO5A 4XASA 3PGKA 4OB6A 2JJ2D 1A9XB 1NZJA 4V0OA 3KQKA 2QTVB 4I36A 1GPWB 4ZTUB 4J4BA 1M7HA 2CMFA 1CWUA 2WIDA 2CVQA 6ADHA 4GR4A 1ZH0A 3QQPA 4CLEA 1ONBA 2ANCA 1N4AA 5IVPA 4P92A 1TM2A 1YASA 2DBQA 3BGDA 3L8FA 4BNIA 4PYJA 1GHTA 5K8VA 1Q83A 2VUUA 1DKOA 3BIXA 4JITA 1SVUA 2AOTB 4LQ4A 3VR3A 1R0RE 4JBNA 4ETMA 1BXRA 1NNUA 3K4HA 4MMYB 1EWRA 2GCEA 2HUPA 3MFQA 2W2LA 4FQ7A 5JCPA 4L5YA 3B60A 3P0EA 2LWIA 1L7XA 5CR9A 5IAKA 4O4LF 2CXPA 1V8DA 1LRJA 1PJSA 3F5DA 3ZGNA 4DLZA 5JIBA 4QRDA 2NTVA 5MFZA 3BB1A 3CPJB 4BS9A 2H5JA 1ZW1A 2UYQA 4KXVA 4NDZA 1ZN8A 3DEHA 3VBEA 4C2BA 1BE8A 2H48A 5FWAA 3RF7A 3QBDA 4B45A 5DU2A 4EHLA 3RVRA 2PN1A 3UJAA 2MR5A 2UZAA 3IE1A 3LP6A 4BO5A 4IZOA 2WUVA 3K8ZA 3W5JA 4GLFA 3ICEA 2QUBA 3OQIB 4P7GA 2Q45A 3AI3A 2Z4RA 2XRZA 3O8NA 1W36C 4G0WA 1QGZA 3TIXB 1G7TA 3F4KA 3QVMA 2PJRA 4HWSA 4KNYA 5FNVB 3DH0A 4KIFA 3PL5A 4BX0A 2LDXA 5B64A 4FWBA 1J09A 3RC3A 1TEXA 1TF2A 4M0DA 4ZCLA 3LSYA 2EZ4A 2Q3HA 2V7QD 3HBMA 1T1SA 3EBPA 3ITDA 2CNBA 4GIBA 3TNYA 4H4DA 4WFQA 1SUSA 1DWQA 2V1XA 2XTMA 3LWBA 1QE0A 2I78A 1YFJA 3OX1A 3UMGA 2AOUB 2ZUCA 4ZP1A 5IJ9B 4X1KB 5KSZA 5LOVA 4CI0B 1J21A 2QRGA 3FKSD 5I51A 2EFCB 4H15A 2RSLA 5E1BA 3UW1A 3V4ZA 3FFAA 1U3DA 1PG5A 4HNUA 1UPUA 1PWZA 5JXHA 3C7KA 1Y4UA 4Y2UA 5LQDA 4MTCA 1ETHA 3AMVA 3NBYC 3L0IB 4HLUA 3IFSA 5CVVA 3SR3A 1PSWA 3UK0A 3VSAA 3WMRA 5AW0A 3RBAA 1N8TA 4DA4A 4QC2A 2VWPA 1D4ZA 1TVKA 1SIWA 2EL9A 1J9ZA 2XMRA 4QT0A 4NQZA 4RTLA 1B43A 3R0JA 3HB4X 1X94A 3L8ZA 4B7CA 3GDFA 1X8KA 2O7VA 2R7NA 1E32A 4NBSA 1CUYA 2ZATA 1QZZA 2E6UX 3QNMA 4OB7A 2G1PA 4BFXA 2VPWA 4BAZA 1FP4B 5D5QA 1KRHA 1XZNA 4QELA 3M4JA 3SJZA 5JS7A 2JGMA 4OK3A 4U00A 4MR7A 1E7MA 2BFBA 4B43A 4Q15A 1T8WA 3S1LA 1MJGM 3JRNA 2YXNA 1VMDA 1BD4A 4QZVA 5K0JA 1N9ZA 3D0RA 3EUAA 4PYMA 5FOWA 1Y9ZA 4KDFA 1SU4A 4OP1A 1VSBA 3WYGA 2YWHA 4EG0A 3EPLA 3PKZA 3KK0A 2JJ2A 3CF0A 3HL4A 4GX1A 3N8HA 5I5EA 3B52X 4FYYA 1QK4A 2JIRA 1S3IA 2OXRA 2ZQ5A 3KZNA 2HI0A 4EKNB 1WZUA 4JELA 1SUPA 2C57A 3I5AA 4YI5A 2Q4DA 2JFXA 4ANFA 1W2GA 3RG8A 4ZFNA 3I23A 1NVKA 3L9WA 2EVWX 4MUIA 5CX1B 5LQMA 3H4TA 4Q4CA 3RAJA 1U9IA 2LIVA 2W8ZA 2VCEA 2OV4A 2BTEA 1X1EA 3KEQA 3O1IC 3VUFA 4AZWA 5F2NA 1UIRA 2PE5A 1N1GA 3UJ9A 3BZWA 1XA4A 1TQ6A 4GDFA 2O2DA 2C2YA 4CLDA 5EPEA 1UBMS 1GNQA 1UIMA 2ZYRA 3RRZA 3R76A 3QKUA 1TM1E 3WGMA 1A4UA 1GTSA 2PS9A 2J7KA 4LJ4A 5I9NA 1GSOA 1IVYA 1NN3A 4Z8XA 2X1HA 1JILA 3B2EA 4F3CA 3FZYA 1OBCA 1O87A 1W25A 1XQVA 1JQ5A 5JG7A 4QJ3A 5L7WA 1AT1A 5JECA 4BNTA 1CU1A 1C8BA 3ZJTA 4BIIA 3ZWNA 1MX3A 1ABBA 1ITZA 3KQSA 1MO6A 2P5YA 4EJ0A 2GKOA 2QJTA 3M2PA 4IAOA 3V55A 2CLCX 2IYSA 2M32A 3OQMA 4LOIA 4WK4B 4TVBA 1COWD 1DG9A 1QG4A 3KE9A 4TRJA 3VZSA 5LUAA 4IHJF 2FPSA 4K26A 1TQHA 1X38A 1AS2A 1FP6A 1RNLA 4KLAA 1CEYA 3EIXA 1R9GA 2V7QA 4HWRA 4KTTE 3IVGA 2WNHA 4HTAA 4DY4A 4ZU3A 5C8YF 1J8MF 4FDLA 3HDGA 2AEFA 2WUDA 2AZMA 4NYJQ 4UVGA 2VP6A 1ZOLA 2E4VA 4IDOA 2QN9A 2G9NA 3U49A 1XEAA 5AK4A 3Q6MA 4P5EA 4W7IA 5E3JA 1YTLA 3A1NA 2XMBA 3FKSA 1SPBS 2VN8A 2C3PA 2XUGA 3MD9A 3TK1A 3K92A 3NDBB 1OV6A 2AUMA 2W2PA 3BMNB 3KJFA 2A5FA 4HDSB 3QEOA 1PNVA 1Q0RA 2RHMA 4IQ0A 4FBMA 5HF5A 3NW9A 2B7BA 2BFCA 4N49A 5BN3B 4BQEA 1I2DA 4CQNA 3NHUA 5B3JC 2E2WA 5ED0A 2G71A 1PJRA 1ZUNB 2E21A 4Q4HA 3R20A 4KJZA 1FEZA 4WOJA 1L1FA 3JU3A 3HKCB 3LC0A 2FK8A 1FQOA 4YRBA 2NV6A 4ITVA 5DPMA 1GL3A 2CXNA 3EVGA 3ONVA 4F85A 2F55A 5HW0A 2O3UA 1U65A 3KPVA 3B38A 3L7KA 4GOMD 4WOKA 5A05A 3KL4A 3DMDA 2PKXA 1TK3A 4HDQB 2I4TA 1M1YB 1X19A 2O2SA 2EZUA 2POCA 5HF8A 2CYCA 3O74A 2AFHB 3MOIA 4FHZA 5JLAA 5A02A 1JAYA 1S2DA 3HU5A 4FOSA 4GYKA 4ZQEA 4WJLA 3JVDA 3X2EA 2WFMA 1XWWA 2Q4OA 5B3AA 1XROA 4PE5B 3BUSA 4E0BA 2QSYA 4K6MA 4OXKA 2I9KA 1NX6A 1XKLA 3G0CA 2XECA 1BMDA 3IBGA 4LI3X 4N0PA 1PJQA 5KDLA 5A5FA 2FMTA 3PZBA 1ZIXA 3FNGA 1MC8A 1SOAA 5ALYA 4E30A 2BD0A 2N46A 3RADC 3AVUA 3TM5A 1II8A 2PJZA 4KWEA 4OD0A 2DBRA 3FRIA 1VXRA 1LRLA 4G1CA 5T6MA 4UBKA 1RW4A 3JQBA 4WLVA 2BSAA 2JAXA 3C7AA 4LWZA 3ESXA 4ND6A 5KJCA 1N7GA 3GA0A 4IZIA 2ID8A 4Z3OA 2CD9A 4LS3A 3U0VA 2RHTA 1O58A 1HNXB 4OXIA 4KR9A 3RUAA 3IDAA 2YZNA 1CJKC 1DKLA 4Z49A 1XQ1A 3H1FA 1B15A 1I1NA 1IBMB 3KLMX 3ZZUA 1R8SA 5JDCA 2XUOA 4RQTA 3L82B 1G8JA 4IVRA 1A9SA 3AM3A 3QLUC 1Z8HA 2FSVA 4YRTA 5AUOB 3MIZA 2CLIB 2Q1WA 1NVDA 1ORIA 1J0BA 4WKCA 4PYRA 3SZUA 4GKBA 2D5AA 1H85A 4EM6A 1GTG1 2G25A 5ES3A 1Y7IA 4UAGA 4EX7A 1C0IA 4ZVKA 4ZHQF 5KZMB 1Q0TA 2RK6A 2Q6TA 1UZAA 3OZDA 1DBWA 1FNNA 4TGLA 1QU2A 4BECA 4F8EA 2V4UA 4GXTA 1EWYA 2F8SA 5ITZB 1ZHHA 1UEIA 1DOHA 3MT0A 2FMUA 4R2HA 3AESA 4J3FA 1YHZA 2QIPA 1UM8A 5A3SA 1ODIA 1ESEA 4KXLA 5DJ5A 1I01A 5I8ZA 3L40A 3T1VA 1MN6A 5DLQC 1COWA 2LIPA 3FNRA 4OKIA 4AZ3A 1MEEA 2QLMA 2YY5A 4R8RA 5LQUA 2JKVA 2R2AA 4IDGA 2P9TA 3LQFA 2IYLD 4BQPA 1T0BA 1YL7A 2DRIA 2E48A 1UBGA 3NDPA 5CIYA 1RJEA 5BWLA 4FMCF 4JJ8A 1WG8A 2A4MA 2OAP1 1UFVA 2PD6A 3MTJA 4FSHA 2C2KA 2CL5A 4LI0A 5BWMA 3WTBA 1J22A 4IV0A 4KWTA 3UM9A 1L5VA 3MCAA 3K1AA 3LT2A 1R37A 2NU6A 4RKRA 3L49A 4YMIA 1DMSA 5AKKA 4Z7JA 4H4EA 4I66A 2OQVA 3UA3A 1P77A 3IKLA 1QTNA 4MJ3A 5ITSA 5J43A 1FFDA 2C7PA 4C7JA 3C4JA 2R11A 1KOFA 3WZMA 1H3FA 1N7HA 4TT3D 3WZ2A 4DUPA 2AKEA 4DQLA 5EAIA 2P78A 2VZ0A 3JQAD 2YICA 4M3NA 4RZHA 2HDOA 3IELA 3I9MA 2CZGA 1PSZA 3JY6A 2JKYA 4IKOA 1VIMA 3ETLA 4KP7A 4Q3BA 1FS4A 1HDEA 4QUIA 3QWFA 1NJSA 1M2OA 2B7CA 2DWQA 2P6NA 1P7ZA 2R8PA 1RJWA 3JSXA 4KZKA 3L4SO 3ZHYA 3W8RA 3ZD7A 4LF5B 3I0ZA 1LW7A 2XIQA 1TYZA 2Y2VA 2XB9A 4OL0A 5KVAA 2HA0A 2CLDX 4AJEA 4XWWA 3GARA 1VG0B 4QPZA 1M1NB 4GS5A 3DE1X 3VH2A 4CTKA 2AYZA 3PSAA 2D0OB 3GR6A 3KKLA 1AV7A 3FMOB 3LYLA 2ZBQA 3EAQA 5FJIA 3UO8B 3ZHBA 3DXZA 3CZMA 1U7OA 3WB1A 3DTYA 5LMCA 3C6KA 1ZUHA 2WYVA 2Z3ZA 2BI4A 1NUPA 3OWHA 2X1LA 1ZOOA 3OM8A 3K9QO 4WCDA 5FH9A 4CVNA 3UCEA 1ZCAA 1TVEA 3B12A 4R05A 4KPEC 3A28A 1EESA 4RH0A 3ZG6A 3MXTA 4CQJA 1DSSG 1CETA 1RCFA 4L4ZA 1KWKA 1LNSA 2QY6A 3K5WA 3E35A 4A03A 2QW8A 3N8NA 3AQ4A 1YI1A 2WSSA 3SIRA 4RY8A 1HE5A 1TJYA 1E1MA 4MLZA 4RSMA 1G291 3K5IA 3TTTA 1QGOA 2IRWA 5CEEA 4N5IX 1CVIA 2QZSA 3BJEA 3QPUA 5J63A 4KQ1A 4C76A 1KP3A 2D2FA 3ADKA 1FLAA 3BSSA 1SY7A 2Z8YA 3BH0A 3STTA 2OBBA 3WLIA 2XADA 5IK2D 3PKIA 4PLWA 1GFWA 3TW8B 2IEZA 1O6ZA 1OWPA 1X42A 2Z6VA 1ISGA 2ZS7A 3Q5GA 1WDMA 4HAXA 3ZXXA 2V7PA 3OZRA 4LSMA 5CA0F 5HUHA 4AZ0B 1RKXA 3CMCO 4OAOA 4UU1A 5K0EA 3IR7A 2D7DA 1E18A 2AS0A 2HEIA 4M6WB 4WECA 3UK2A 4BQNA 3U5TA 1ENOA 3RJ9A 1V11B 1V3TA 3MJHA 5ALUA 2FVXA 3GHYA 4WFKA 2CMDA 1WCYA 1XMPA 5CBPB 5IULC 1QTQA 1M8GA 3WOVA 2VL7A 3RPEA 1P19A 4C0SA 5IU6A 4XJVA 2H9AA 1YR6A 4IZHA 4MRRA 4O2LA 4AO7A 4LECA 4Z51A 4IMRA 1EUDB 2HM7A 2QUKA 5FWYB 3G1TA 3KKQA 5EQTA 4YP9A 2D1YA 3RTCA 1RRCA 4BEBA 1QVVA 1GNSA 1PUJA 3SQDA 4HQOA 3ZZMA 2EDAA 1ISRA 2OQIA 2AZ4A 5EMMA 4IMPA 3PHCA 4L9WA 5I8WA 5KHOC 2GHTA 4FZ3A 2Z57A 2YRFA 4G2TA 4WLEA 3RYFB 3ZN2A 2Z04A 1RP1A 1HURA 4MCAA 4ZPXA 2CWWA 1AZWA 2QKYA 4LNUA 1X1SA 2HADA 3ES9A 3L07A 4YVFA 3ZDEA 1RVDA 5KQRA 4D6PA 3KE8A 4DNFA 2MSCB 2QS9A 1SCIA 1SVWA 3IODA 4R8SA 2GZSA 4XTRA 5DX1A 2XYVA 1MB9A 1HE3A 1BVRA 2J33A 3A9CA 3CB4A 4HEA6 1HMYA 2PH3A 4BRUA 1L7RA 3DVSX 1XPJA 1QOPB 3JQAA 4CV0A 4AWBA 3G2JA 2P41A 2QF7A 1FTWA 3VKUA 2X9LA 3GLTA 3NHWA 4RL4A 4OQ4A 1E9EA 2BJVA 2B1RA 4NU0A 2BGIA 2FE4A 5K3AA 1B7GO 4K9RA 3SWWA 4M89A 3F6YA 2NXNA 2PRYA 1D2CA 3E8XA 3VPGA 4JI8B 2VP9A 3ASVA 4BE7B 1U8CB 4RDCA 1SXJD 4PIPA 1T10A 1E1QD 1KBQA 3EWIA 4RLHA 4XQ9A 5ERYA 4EHFA 5MF6A 4E5PA 4EL0A 5JYEA 4R1LA 2FYTA 5IM5A 4BZXA 3UPUA 4J94A 1E3EA 3K8OE 1IUKA 4I9FA 5F4ZA 3RYHA 4RH3A 1G5QA 3TGPA 3DVQX 5ICCA 2WHYA 2PSFA 1MV8A 4Q7JB 2PS1A 2A35A 3D5TA 1VKZA 2HX1A 3L7JA 4IIJF 3E82A 4WFIA 5EJ6A 3JAWA 1EUCA 2FPGB 4UZSA 4FFRA 3KXIA 4IH1A 4JVMA 3GEPA 1V6SA 1N33B 1AQIA 4KBFA 4ZDJA 2PQ6A 3GZTB 2X4IA 1VZ2A 4EY7A 8GPBA 4W5NA 1RYNA 3I52A 2B8EA 3O3NB 4M0CA 4WXEA 2WQ6A 1QDLB 2NO9A 3CKMA 2UDPA 4F4HA 1DU4A 2PUCA 1Q7BA 2R84A 3FOEC 5I7HA 3BMCA 1GU7A 2ONYA 4OVKA 4EHDA 1JQ3A 1HLFA 3S7ZA 4TL7A 3GPCA 3C8HA 3QJYA 3VR2D 3HXOA 4MGEA 1X9GA 3ZNNA 4LX0A 5GP1A 1ZIPA 1NF8A 3H9GA 1NXPA 1XCLA 4PZDA 4ZAVA 1A8IA 2Y76A 4QO8A 4QJ5A 1SZJG 1MB0A 4RPKA 3S68A 1T5OA 4FZRA 1HNNA 5T6BA 1Y37A 3LA6A 4KVAA 4X84A 5ALHA 1G8HA 1GN8A 2G76A 3VDXA 3QKTA 4YROA 4MQBA 1VE3A 3OZFA 2JI7A 3AB8A 4ALJA 4CODB 4R9VA 1OLXB 1KOGA 4Q01A 3R40A 4WGFA 1JXOA 3GA7A 3EIOA 3I5XA 3EA0A 4QE3A 3FZEA 2WFAA 4BLTA 2RE8A 1X1DA 3FGOA 3LYAA 1TUBA 4QVKA 3WK8A 5CW1A 1CT9A 1P18A 4N7JA 4RA6A 3P9SA 3NUZA 3OY2A 1C4XA 2N0SA 5LSAA 2DFPA 2RGNA 2RH9B 2R60A 2WYUA 3Q2KA 2GK4A 4QU8A 5FT9A 5TEWA 3COZA 3UJ7A 4EGSA 7GPBA 4OFZA 4KN8A 4NLLA 3PFWO 3M6AA 1ULZA 3SHQA 4CHTA 3WWPA 3PEVA 1ZD4A 2CDCA 2TYSB 3LGSA 3QEAZ 2AJDA 3PWZA 1OR8A 4K1LA 1UK9A 4TMFA 3G0IA 1U5BB 3TTXA 2HR1A 2EQAA 3NGLA 3O73A 3BBLA 1E2GA 4UZFA 5LN1A 2AFIB 2QVCA 2D00A 3IUBA 4RHCA 3WRYA 1XELA 3Q7SA 5KC8A 2CMKA 4N47A 4AMVA 1CY7A 1ZCFA 4BQSA 4RA9A 4IZ6A 2CEAA 3RWOA 1BJKA 3AIIA 3ETCA 1J0AA 5DK4A 4ZAYA 5FWDA 4ZAGA 3LRTA 4HDOB 3GCWA 3TLZA 3VU1A 3CUUA 4ZZ1A 3K9CA 2BLNA 3TW6A 3GP3A 4MVJH 2DPXA 1PJAA 2DULA 2PGDA 3FDFA 1V26A 2YWGA 3CZ9A 3SDZA 3WWEA 2BFFB 1U7XA 3Q8KA 3FTDA 5I01A 5KNCA 1A7KA 1JN0A 1FTYA 2VBGA 4KE6A 3KFLA 5EFOA 3U7JA 1G3UA 2QY9A 2IW3A 1PE0A 2VAPA 2P9FA 3CX6A 3LSTA 5GZ6A 5AW9A 3ZK7A 3GT4A 1EFUA 1Z68A 4ECAA 1KFEB 1FOEB 1JPJA 3FPBA 4FUTA 4YV1A 3RJZA 1SXJA 1PTJC 3TDMA 2Q50A 2GLXA 4ZQCB 5C81A 5JD3A 4KSBA 4B74A 4UHBA 3WWOA 3NETA 3WNQA 1ILEA 4PAWA 4KYUA 4UM7A 2KWIA 1FXWF 2BCEA 4JI1B 1KJYA 4GSLA 1P4RA 4UPEA 2ENWA 1MOZA 2R1UA 1ZDMA 1ZLXA 2IXAA 4ALNA 3WRXC 1DZ3A 3FVVA 4F7DA 1JDZA 3JSAA 3W3AH 1IG3A 5GVSA 4CL8A 4AUKA 3ZJUA 4JROA 4M0KA 1XD2A 4F2WA 3QA9A 1V16A 4UAVA 5JCJA 2IGBA 2N47A 2BKAA 4D9CA 4P35A 2FB9A 3N70A 2H1IA 3QOXA 5LB2A 3STYA 4JL8A 4DVGA 3I9OA 5CM8B 1DAEA 3CINA 1G0NA 2W2KB 3QWAA 5DNVA 5BN4A 2G9UA 4F2HA 2JFYA 2Z1DA 2FW1A 4C0WA 1S2MA 3QUQA 1NU8A 2Z9DA 4JJEA 2ENUA 2WZQA 4QGAA 4HGRA 4M22A 3D3NA 4Z4HA 3H5VA 1I2ZA 2QUIA 3M9WA 1MA3A 2PLNA 1TTTA 2W2OA 3RGGA 3SZ3A 4IDPA 4ZO9A 3HDHA 1ML3A 2PQ2A 1OB2A 1ZISA 1YGPA 2I3BA 2ZRBA 1PJLA 1MZPA 2PZLA 3AJDA 3SFVA 3LT4A 3RNLA 4HG2A 4E1BA 1R9JA 2C4VA 4OI1A 2J9XB 3FB4A 3A06A 1G7SA 4ITRC 5YASA 4XRGA 1PV4A 3GD7A 4XD2A 1B4DA 5BRJA 2XCTB 1WJGA 2ZE5A 3EVAA 4TMWA 3A0UA 2IUSA 1GUYA 2R2GA 2IV3A 2IK8A 4IIEA 3PUWA 2J0UB 3W7VA 5BRAA 1K9SA 1QNLA 2OMEA 2Q6OA 3AUAA 3UCXA 1ZD3A 2NOAA 3M5WA 3WDMA 2G7MC 1T2NA 4PZ0A 1NMSA 5JEDA 4TLCA 5GM1A 3CZ5A 3ETGA 3ETEA 1EK5A 4DHEA 3A9TA 3IMFA 1YT5A 1KS2A 1Q1ZA 4RTQA 5I4KA 1T35A 2ECOA 1J2EA 2Q5QA 4FWTA 2RB5A 3I8SA 5F9FA 4CKCA 4LHEA 3DLTA 4NAHA 1I5RA 1N5RA 1YQEA 4PVDA 3U80A 3W9SA 1HX7A 1ZUD1 1YWGO 3KB6A 1XZGA 5C5DA 4RV4A 4Z9FA 1DIRA 2IY7A 1C9KA 2BGNA 2ZT6A 4N7MA 2A0UA 3GBPA 4I8XA 3BIWA 4IXMA 4G9EA 4UM8B 5A71A 1ZIOA 4FDVA 1QQ7A 2Y99A 1EZZA 2C5EA 4Q93A 2HL6A 2LTAA 4XXHA 4TYWA 4L76A 1FJHA 3DB1A 2FFBA 5IH3A 3JARB 3X3HA 4RU1A 1Q91A 2YC2C 4TUYA 3V80A 1RYMA 2O4CA 4ZO8A 2ECQA 1PJBA 5DHSA 3EXG1 4ISCA 1SCUB 4ZEOA 5D6OA 5HM8A 1BA3A 1R0YA 1W94A 2YWEA 3PA6A 3WNDA 4KI7A 3SBEA 2EKPA 1Y6ZA 4TV9F 3KP1A 1SH7A 4PBSA 1W5TA 2CXSA 1G2PA 3RSQA 3WWZA 3SDBA 3A4LA 1LS1A 1OZAA 2GZAA 1V8FA 2WVHA 1N0VC 3E1KA 3MUFA 4YJHB 5F2EA 4MUNA 2OLJA 1JYEA 1GXSB 2QG6A 3OM9A 5AD1A 2BR3A 3GPDG 2JGRA 2C8LA 5FFNA 2Q4EA 4LVOA 1OLUB 3HCEA 1P44A 5FFMA 4CTOA 4HO1X 3O2JA 3MPUA 2DH5A 3MINA 4G2NA 4TWBA 4AF8A 3ANLA 2ZI5A 1ZMOA 2AW3A 3HRIA 5AR1A 4DQXA 2VP2A 4I5GA 3QWIA 1BXKA 4IS3A 4RK1A 4UTRA 1YNSA 2XGSA 1G4HA 1SXJE 2YYYA 3PHGA 5T8KC 4EYOA 4D5GA 5DGHA 3WK6A 3PI6A 5JJCA 2OO3A 1XJ0A 4P33A 1DEAA 2Z8YM 3GLFB 2B2NA 4Z4CA 5AUNB 3TRDA 3FRHA 5JRDS 3NTRA 3ZNOA 3GJ0A 4KFTA 3GF4A 4KR7A 1N75A 1QFMA 4JP5A 2G9ZA 4G0ZA 3LUAA 1PX2A 3WKCA 1XEWX 3LFTA 3T5CA 1PR2A 1LDMA 2DG2A 4CEJA 4OQNA 1BA2A 3ZGOA 1YCGA 3OC6A 1Q1AA 2AJTA 1ZNZA 4ND8B 1RI4A 1YZ3A 1UOEA 4A36A 3A1TA 3WGNA 1TW2A 3KT8A 5E7QA 2R8BA 3GJSA 3OZBA 3O7WA 4FNAA 4HQRA 2CVOA 2XUAA 1SUWA 3HBFA 4O4LB 5A04A 3KFVA 1JT2A 3BRCA 1T3GA 3H8JA 1D0SA 1PT9A 3DYBA 4Y6LA 3A7EA 5BYBA 2FRDA 4KN9S 2FPPA 1Q7RA 4DB4A 4UQOA 4CKWB 4HEJA 5HTKA 3R5FA 1RAHA 2I3DA 3PGVA 5BSTA 1CR2A 1RHMA 3G5MA 3VX3A 4CMCA 5D86A 3DWEX 3RANA 3JQ7B 4CKXA 5EJ5A 5B1DA 2J1LA 3ZCUA 5E38A 1WXHA 5CH3A 3ADDA 5FUMA 2AMFA 1XALA 3FF1A 3COSA 4HRYA 8ADHA 1SAYA 4GLBA 3U3KA 1XAHA 3U4GA 2VQDA 3RI3A 2W11A 3PCXA 3IUQA 1X7ZB 4OBXA 1OW3B 4NBNA 1W59A 3N58A 3RRBA 1UC5B 5IKMA 5F73A 1Y9AA 3E9MA 2EFHB 2BMDA 5CJPA 5CNJA 2QP9X 5EMKA 3TB4A 4CW7A 5KWJA 2VUSA 1ZH2A 1TMKA 2O05A 3VXKA 4R3WA 8MHTA 1R18A 2O3TA 2YRXA 1ZZEA 1SVKA 3BK7A 1TZKA 2GBPA 3I4FA 4LZLA 2A1UB 3BRQA 4JOQA 4CV3A 5L3QA 3H87A 5A4FS 2K2WA 3GJ7A 3MLAA 2O2ZA 1Q77A 2C94A 3QX8A 4YDSA 4C5AA 3EPJA 2ORIA 5BO5A 2I2FA 1ZVKA 2VXCA 3S2YA 3PIDA 4V3CA 3ROFA 4E14A 4MR8A 4EBBA 5LQCA 2UVQA 4J91A 2BBWA 4I5DA 3TQRA 1DBRA 1PL6A 1EK0A 2Q1TA 4K9OA 3KJZA 4OQDA 2VJPA 4QUHA 4BV9A 4CTJA 2AQ8A 2C9OA 4YCCA 1T8YA 1XNHA 4NFSA 3ET4A 4QQNA 5CDGA 3ESQA 1S8FA 2Q2OA 4WINA 1S0UA 3TCXB 4S0XA 1MHPA 1GZSA 1KVUA 3QBTA 4DB2A 2ZJFA 3MJVA 1Y5NA 2B4QA 1EVIA 2X8WA 3KPJA 3KR9A 2I2CA 2PH7A 1RD4A 1L7DA 4J0FA 4NE2A 2AYYA 3KLBA 3SY8A 1TPYA 4D7AA 3AERA 3EXEA 2BE7A 1I4TD 1J33A 2UZ1B 3BXOA 3G68A 3L0BA 1QHHB 4Y6QA 2EX4A 3SK0A 1QWSA 4URVR 5JRZA 1CZLA 2JFNA 3VPBA 2GYVA 4B46A 3BQ9A 1UAGA 2RD2A 3D1VA 4HRXA 1T4GA 1Q6YA 3QELA 2X0FA 1XLUA 3BWVA 4M1EA 3IH5A 3SICE 1G21B 3UATA 5A7HA 2DEUA 3Q3CA 2ZYAA 4Q82A 4WY8A 3TINA 4C4OA 4FINA 2Z83A 3G8CA 3G8DA 3GRCA 3CZRA 1QCDA 3R3ZA 5KYVA 3U40A 4Q3NA 2I91A 3HLKA 3G2KA 4IBOA 4RMIA 5LVAA 5KSWB 1X87A 2OFWA 1EQ2A 1I2AA 1J70A 2VKQA 3P5BA 1LLUA 1BWQA 1PVVA 1EGMB 2YY7A 1E6MA 4LZOA 1ZGBA 2C7BA 3FJ1A 2MMCA 3LQ2A 5JDIA 4L8GA 3FR7A 4EGAA 5FAKA 2HIMA 3T7EA 1R66A 3RAEC 4YV2A 4OQEA 1JV2B 3RV3A 2WLSA 3KTOA 4PCVA 2ZIAA 2B5WA 5ARCA 1YV9A 3DE3X 3BTSA 3DZCA 3PIIA 1KGDA 1ZN9A 5JISA 4Y2PA 5E0KB 4EKIA 3PDHA 4MDHA 4OHKA 2VO1A 2YWXA 3HP4A 2FOIA 2C9CA 3TOXA 1U2GA 5KVVA 4NPHA 2XE6A 2VT7A 2E55A 3KVNA 4YCAA 1JJFA 2P4QA 4DEXA 4DSAA 3FSGD 1KZ1A 1QLHA 4KKXB 4JN6B 4TYYA 4PXSA 3BX1A 1AS0A 2B8WA 1T5HX 1YS4A 3HB9A 3KKPA 1C9JA 4X91A 3SYRA 5AUQA 3AKZA 2AEEA 3QFCA 1BN7A 2C5BA 3BMOA 4JUCA 5DK6A 3DLBA 2VI5A 1IQ0A 1K63A 4L1KA 4Z1MD 3Q72A 1TT5B 2IFTA 2YIJA 4PBTA 2HB6A 3TRIA 1OVMA 2BT4A 3E15A 1EGQA 1IY2A 2PS0A 1Q57A 2Z9BA 1L8LA 4CF3A 1Y34E 2MSNA 1DC5A 3CX7A 1X6VA 2XQFA 1M8PA 4I8DA 5FPSA 5CG2A 1E79D 4R8KA 4QATA 1ISJA 1XA0A 2EF0A 2ZTUA 2H00A 4HADA 4IHJB 2BEUA 4IXDA 3CW2A 1GJRA 1E89A 3HLYA 5B2EA 1SCNE 4DLAA 1NT4A 1PZFA 3ZDRA 4QKQA 3O95A 2W4IA 1I3KA 1JTEA 3CNEA 3EEBA 1HV8A 2OEPA 4YCMA 4CXMA 1PK8A 1T6ZA 1MO3A 4GEKA 3WK7A 4HFJA 4UW9A 3VYWA 4Z6KA 4FLMA 3ZLBA 1ADJA 1I24A 3AC0A 3BD6A 5K6AA 2I7CA 3T41A 3VH1A 1VYUA 1ZGGA 3P9YA 1BU5A 2FZEA 3WNBA 1EUYA 2MYUA 5JJIA 4HH0A 1RLMA 2H18A 5I9SA 2WSLA 5TQ2B 1K3TA 2BP7B 1J2JA 4QBGB 5ESXA 4EF4A 3G5TA 1TMGE 1UFRA 1X9HA 1JAHA 4AU1A 5J23A 5IG2A 4G1MB 1WTCA 1X15A 2ZSJA 4NNOA 2GBLA 3P52A 4RS3A 2YHIA 2ROQA 3IQWA 3T6KA 2A4KA 2HHCA 4JEUA 4IDAA 3CRQA 1RYEA 4E7PA 2G5TA 5C7OO 4IIVA 2XCUA 4W8HA 1X80B 3H0KA 3KSBC 5F2OA 3OZGA 1QH0A 3L7CA 4D57A 2NU8B 1JEJA 1EFPB 2AKYA 3AR3A 2OXCA 2BFAA 1USUA 5DI9A 3GFBA 5JAPA 2A58A 1C9DB 3FPJA 1DJQA 1RPJA 1XAIA 1EFRD 2EAUA 1HT3A 2XYRA 5I9BA 1D09A 1OH8A 1Z88A 1TL7C 5C5CA 1JG7A 3MMSA 2QN6A 5M5BA 2V8OA 3E2IA 5HWSA 3WQSB 2ACVA 4P08A 3U4AA 4EA8A 3ISTA 2UXDB 3REQB 1JEQB 2EATA 2H29A 1HYQA 1NRXA 4DR7B 3DKRA 5JH7B 1E9FA 1F2TB 1G18A 1K8RA 1GFIA 1NU6A 3WBFA 2X9GA 4QGSA 4X1YA 1TM3E 2R7MA 3NLLA 5FL3A 4UHCA 3B9RA 1U2ZA 3AINA 2QGNA 4XOUA 2HHHB 3JX9A 4FCWA 5I7EA 2JFQA 4F4UA 16PKA 4IDEA 4S0ZA 1IM2A 4F2GA 4DDHA 3ONWA 1M2KA 1OGYA 2I62A 3K2QA 1ODTC 4DLUA 3PLRA 3W79A 1QH8A 1RXIA 5IVIA 1LUAA 4KMOA 1JDNA 4ALMA 3Q7QA 4B6JA 5BURA 1EA5A 2HCBA 3DGFC 3TZCA 4DMUB 5IUJC 3TN7A 3KCQA 4R84A 5LXTA 2DZDA 3VBCA 2WBLC 4CI9A 4RK7A 1LBSA 3OSZA 2JW5A 4C4AA 5U1PA 2XE7A 4HNGA 2V7XA 3WLRA 1QHGA 5HOQA 3DR5A 5JSHA 2VHCA 3KVRA 4GO1A 2DM6A 1N2BA 2DFLA 3ID6C 4L8WB 2AC2A 3L0YA 5JHHB 1H4QA 5I7UA 2QR3A 3MERA 1W1IA 5DBOA 3RYIA 2HIAA 4EHHA 5IX8A 4EMUA 6REQB 3N6XA 2GEKA 5FI5A 1JPUA 2CKMA 4N40A 4YA6A 3Q8WA 3RS7A 1DL5A 3DPSA 3MGAA 1XXHA 4BJ6A 4PU0A 4A0HA 1E79A 2FWNA 3N6RA 4JB2A 3RVQA 1M76A 1VPDA 2VK2A 1CJTC 1F8GA 1KJWA 5CNIA 3ENWA 1JALA 3K9GA 4GMDA 1NAIA 4CCSA 3IEPA 2UZ3A 4MW4A 2QIOA 4P7FA 3LU1A 3SZLA 1RE1A 4RGQA 5EHZA 5IKOA 2IH2A 4POAA 1IQPA 1EEXB 4G0QA 2H7CA 2E5WA 2IHYA 4AO8A 1SOVA 3VJLA 1JYSA 3PQEA 2KSQA 4BMNA 2VSYA 1T2CA 4GUAA 3H17A 4PX3A 2G1KA 4RO0A 1K6XA 4Y2HA 3VC3A 1JEYA 3RC2A 3ZE0B 2GN4A 4WXPA 2D4HA 3DL7A 3A1CA 1ECJA 1KVTA 1P9OA 1TNDA 5EJMA 1AQNA 2ANBA 4M54A 2GRJA 2JGFA 2VDVE 3CVJA 3ECSA 4GI5A 1MT3A 3LDAA 3LY5A 2Q07A 1V8ZA 4RK4A 3CCFA 4U6NA 2KBEA 4D9HA 3DBRA 1I8TA 3PLAE 5K3BA 2VWHA 3IIEA 5KWIA 3HADA 4RKQA 1BHQ1 2GXQA 4G37A 4NCKA 3RNOA 5ADVA 1U7WA 3QEMB 3SXPA 3EW7A 1N32B 3C5EA 5ICGA 2I7TA 5BV7A 4LOKA 1LZKA 1UODA 4DWJA 2P69A 1AZTA 2BGLA 3SLKA 3CIFA 1FDSA 1Z6QA 3MWLA 3INRA 1YJAA 3EZLA 2O7RA 2GLTA 2YVKA 1VLVA 3RT1A 5DYYA 2NSLA 3WL3A 1E4VA 1T1EA 2QTMA 2VSFA 5AJUA 3AFGA 3WLQA 3QKSA 3ANXA 2L19A 2ODAA 4ETNA 1U2TA 2G72A 4LRQA 2IWHA 2B4AA 1H5NA 4GXRA 2VTVA 3CH4B 1O95D 2HCTA 1NLFA 1W93A 3RJTA 3RSCA 4E31A 1EXDA 1MXHA 2G1UA 2HMUA 1G4AE 1V2HE 2SKEA 2IEBA 4OSPA 3D81A 3AP2A 4F9EA 5A4DA 1LV7A 3RREA 5K9ZA 3OPYA 4XDZA 1U02A 4MKXA 5BXQC 3LOQA 4HAOA 1N0UA 1NXWA 1UPAA 2JJMA 2V3WA 2VRNA 3D54D 4CN9A 5J2UF 3K0CA 3BXHA 3OQPA 1B3BA 1ECBA 3NWPA 2OSVA 3P0FA 5EGNA 5KNDD 3N2ZB 3PX7A 1EGHA 3R5TA 2C92A 5TVKA 1K5PA 1L5MA 2D5IA 4LV8B 4YLEA 1IN8A 1FUIA 3ZGYA 4DNQA 3UAVA 4MVJP 4JA0A 3I83A 5ALVA 3OWXA 4IVQA 5D7NA 1VIAA 5I4IA 4IRMA 2WILA 3PX3A 4EMSA 1AM4D 1NR7A 3G9TA 4D25A 3U26A 3AHIA 3SSNA 1QB8A 2ZREA 3IHLA 5BXYA 4N5MA 5ED4A 1C3EA 2GTPA 4CMEC 1YRBA 2X6RA 3A31A 3BWCA 2BDUA 4QYIB 1J06A 1OGJA 1RAFA 2Z43A 3IIJA 3PRHA 4GC9A 3SIXA 1UDAA 4ZOBA 5C8DA 2ZU6A 1S2LA 3PJDA 3WLAA 1UMCA 1VHTA 1RHRA 3L06A 1DAHA 3QLVC 4OSOA 4TPKA 4E2WA 5BVHA 4F1JA 3J81k 5KX5A 1ADFA 1FXUA 3MGCA 2VSNA 3QI2A 4BKUA 3HNPA 5D1HA 3GOQA 2ETVA 3CWZA 1T91A 4KGXA 5FL7D 4GG1A 1NC1A 2QLNA 2ZRGA 1U2RA 4YBZA 1GPLA 3RC8A 3RS2A 1X7YA 4MULA 1VHWA 5GPBA 1M2HA 1JAZA 1EFVB 1ESDA 4U2BA 2FR8A 3OMWA 2NZUG 1TGVA 1IN6A 3FVRA 1X9IA 2PPVA 1NW6A 3KQWA 3AETB 2XBLA 3T9BA 3TBHA 1G64A 5K09A 4A82A 4DRXB 2F3UA 1T9CA 3E7PA 1XXHE 4KYIB 1UKEA 2FEXA 3H2KA 3T4PA 5CITA 1PGNA 1V9SA 3KV1A 2W2TA 2HCJB 3KB8A 4N12A 4Q7MB 4WY2A 5CDFA 2VZ9A 1IRXA 1C1HA 1SELA 2R7LA 3KR0A 3NC4A 3H5TA 1F9EA 5FD8A 4YFYA 5HEKA 1HFEL 5B7QA 5AVXA 2PUAA 5ANRB 5AT1A 4NV0A 1ELOA 5KAPA 2FPIA 2XZTA 3FOBA 1DQNA 1ENZA 3W6NA 3JQ9C 2WIKA 4OYLA 4HDRB 4BUCA 1ZK0A 2LZ0A 4UATA 2J8ZA 2PX0A 4FDTA 4MW1A 4D8YA 2G08A 4L95C 4CKBA 4MB0A 4X65B 4Q9AA 3R9WA 4H2DA 2GO7A 2VEDA 3IR5A 2H16A 2L82A 2OVBA 5GGXA 1Y6RA 3GFQA 2HZ7A 1T1IA 3WJAA 2Y2UA 4Y2YA 3D2BA 3FSRA 5GJBA 4H7HA 3HA5A 1B16A 2JJYA 5L4LA 1F6WA 2J59A 4DRYA 4ERNA 1I36A 1OMOA 2H0QA 2UUAB 5JNRA 1WEKA 4U9IS 3LX6A 4P7BA 1QSGA 2DFDA 1J6UA 3EFOB 3PX2A 3WHIA 4A91A 3ZDBA 1O95A 3AXSA 3THXA 1FFXA 2DUNA 1U5CA 2P27A 3GLQA 4JQOA 4PW0A 3W1VA 5M29A 1KQGA 1W9HA 3VA7A 5DKFA 4W5QA 4HEA1 3VISA 3FPAA 4KO3S 2FSGA 3OY7A 2GTIA 1QGED 1YA8A 3RIYA 3TG2A 2WICA 2NP6A 3OI7A 3A7DA 1P0IA 1V47A 4QAQA 1OF1A 1UMBA 3MYRA 1ZJ6A 3DOIA 4O1MA 2QR2A 1FMCA 4YAUA 4HAVA 1EQAA 2HA2A 2NG1A 2W71A 3D1JA 4P1ZA 5F1KA 5ILOA 2W48A 2WWFA 1E2KA 2AYXA 5DTRA 4AXBA 5C3MA 2WQ7A 2QQ5A 1E9DA 4EHJA 3HKEB 2ZDHA 3TBFA 5BNFA 1A8SA 3H86A 3LPNA 3OFSA 4AZTA 3O0DA 4TLLB 3NTQA 3OIYA 4JGGA 3CJQA 3EPRA 3KEGA 4AIRA 4F6RB 1ZL0A 4MIYA 3D3WA 3ZQ6A 1CG6A 1NW7A 1WKCA 1BCRB 1TCAA 1VHDA 1MTZA 1OAAA 3IRVA 3RK4A 2NUTA 4BLVA 1U0JA 4CFSA 5A03A 1T0HB 3NIGB 2TMDA 2AR7A 2ZIWB 1TU3A 3A9WA 4H08A 2AG6A 2NUBA 4UFOA 5PNTA 3DLHA 5HJ7A 4CT4B 3SQXA 5DSZA 5H9WA 4LFAB 1H1TA 1W9MA 2EP8A 2PO7A 2PT7A 2AQHA 3HS3A 2F4VB 3ILHA 5LL6P 5FL7A 5KNDH 1GR0A 2QVGA 3KKMA 4PTZA 4WZAA 3OT5A 2ZIEA 3SFZA 4B17A 1FDWA 3V2HA 1CF4A 2F43B 1XRQA 4NEGA 5H8WA 3AOEA 3GNQA 2CEKA 4G84A 1KGSA 3AW9A 4CR8A 5K8TA 2HF8A 4D3SA 4F91B 3OSUA 3OOJA 3WGQA 1DFGA 2Q0XA 5DNEA 5EZSA 1SKYB 3S4YA 2YVUA 5KKAA 1EJ0A 4BNYA 4TWRA 1XDSA 3LQ1A 3QU2A 4O25A 4CBVA 3DOJA 1W85A 2BOVA 2C1EA 2CLMB 4AC9A 4PCUA 3ZY6A 3OCYA 1FYVA 4D46A 2UXCB 2Y0BA 3WJ7A 1L8XA 1SUFA 4IKPA 4E5VA 5JAMA 5G0SA 1RQXA 1ES9A 1ENYA 4ZKDA 1I2MA 5ALJA 5BNTA 4I50B 3O3CA 1V1RA 3K4PA 4F3TA 5AKYA 1J9EA 2ZKIA 2OO7A 1EX1A 3PWSA 4QSHA 5AHXA 3ZJYA 4BVBA 4D6YA 4F38A 1DOAA 4R68A 3LBHA 4JJKA 2ZJYA 2GEBA 3UPDA 5K2MA 4ZOQI 5CDFE 1A3CA 5BQOA 4EHNA 4JJZA 1A2OA 1PL7A 2J4CA 4FYKA 1DJPA 5EL0A 4B4KA 5EJ2A 2D2VA 4X93A 2YV4A 3NJ8A 3E9YA 1R6XA 3F46A 3QVOA 1AJEA 1NM5C 1SEVA 3UTCA 1E92A 3HFRA 3KJEA 4O2AF 3OEHD 5FTKA 4ER5A 1RACA 1JIJA 1GAEO 5ECGC 2B0JA 4ARSA 4L16A 3SIWA 3QG1A 1U7HA 1SQGA 2XGMA 4RELA 3ZJ4A 3KSUA 4K9MA 4HMPA 2FZCA 4AJ2A 1B6RA 1M6HA 4TXLA 3H9BA 2DSNA 2DBVO 1WPQA 1A5BB 2GWHA 1GU0A 1M34B 3A27A 3FZNA 3HH8A 4TQUS 2OYRA 4DV6B 1IFXA 4GRDA 3Q3JB 1WO8A 3C4QA 4GZ3A 4BX2A 3R1IA 2A57A 1Z33A 3R3SA 3TEMA 3TGLA 4YO7A 3KQPA 4PQRA 2CC2A 4D0LB 4KR0A 2PJUA 3DQQA 1FYEA 4DKJA 3I6QA 1TKAA 1C9EA 2Z30A 3FOAA 4LXHA 5LZ4A 3QYAA 2YZ7A 4U2DA 4OLAA 2UUCB 1XK7A 2XRFA 4GZMA 1TLTA 1NJFA 2IF0A 2YH2A 3BHJA 3ZTTA 4BVLA 3WAGA 2Z98A 2ORYA 2DBYA 3IT1A 2AMJA 4YGXB 1A82A 3UGKA 5FV4A 1AE1A 3ADOA 4HDAA 4PM4A 5JSUA 1A4RA 4ZRMA 4HP8A 3FUUA 4ARCA 1BMQA 4R40A 1JIQA 1B42A 2V7UA 4BB0A 4CETA 2OSBA 1AXGA 1NPTO 4L08A 2HSJA 4YCLA 2H5LA 2G83A 4D1YA 4DUGD 1C9MA 2SNIE 5C7YA 3KETA 1Y6QA 2SCUA 1BGVA 4HNAB 4IINA 5IUNC 4X7BA 3ZYCA 4J2OA 5GMOA 3OAAA 5EIEA 2FJPA 3B8EA 4CM8B 1L5QA 2VH2A 4LWOA 3ZHRA 3ONFA 4EUKA 1EXVA 3HQ4O 2NPIA 4X85A 1CUIA 3AHFA 4XWTA 3WVNA 4EB0A 3NDRA 5KAMA 4TV8F 4G5RA 2C7QA 5E4YA 2Z6QA 1MJNA 3VZPA 4ZI7A 4G86A 3KWFA 2V6MA 2ZBEA 4Q9KA 1PAUA 2WKPA 1CERA 3G0DA 2V7VA 2WE8A 4FM9A 4NEHB 1SVLA 3ABSB 1WDWB 2QR5A 2CUKA 5FV7A 1HH4A 1Z5ZA 5F12A 3LA8A 4BAUA 4CM1A 4CTMA 2P75A 5JVDF 1CR6A 2OYCA 4QECA 3DD1A 3KSAC 2EIHA 3DJFA 5CB0A 3BHNA 2OQ2A 1K88A 1G6KA 4PRZA 2D2EA 3DGEC 3VNBA 5KYUB 2JAUA 1AKYA 1C14A 2CFSA 1EE9A 2E82A 1YB1A 1K7XB 3DR3A 4HGZA 2AC4A 4GVPA 3W7BA 4JLDA 4HYEA 4DCMA 4PN3A 1X70A 1TA0A 1PWXA 1YOVA 2AWOA 1P0FA 5LYJF 4O4HA 3V42A 1P72A 4N3CA 1XZQA 4QRHA 5TT0A 3HZHA 3CZCA 2MYNA 4IJWA 5DFAA 4B2IA 2HLNA 4C30A 1JQBA 3ANSA 4KQIA 5BWOA 5GZ1A 1TUEA 3MTQA 2WFLB 3QVKA 4JC4A 4ROSA 4ZAWA 4J16A 1DRVA 4LJRA 2Q27A 3A6PC 3CBGA 3KG2A 1KFKB 2G0TA 4UHDA 1CS0A 3LCCA 2GM5A 3OFKA 3OOHA 5DXFA 1VG9B 3OEHA 5KMGA 1UUFA 1H05A 1NF3A 4FZJA 4EUEA 3AFIA 2C03A 2I1LA 1T36B 3WZLA 4YXWD 3D4IA 5FLYA 1G3IA 2VA9A 2JGIA 1W44A 3HKBA 3JD1A 1FNMA 1B93A 1CZRA 4J43A 3PEFA 3QBVA 3S1AA 5I8PA 4M36A 5CT8A 1F48A 3X43A 3IBFA 2BLLA 3H5IA 5TGZA 2GPWA 2G8NA 4MI9A 2W6ZA 4AJ9A 2IPNA 4LX8A 3WB0A 1EJBA 2HWKA 1CZOA 1FX1A 2C9MA 3EXFB 2AI1A 3UENA 3NDJA 4W82A 1H0RA 5E8RA 3HJFA 3OX2A 3RVLA 2NZJA 3KDPA 4OUDA 4DPLA 1C0LA 1BNCA 1G3MA 1TOAA 4XVUA 2BYTA 2PH5A 1BH2A 2P79A 2PAAA 4DEYA 4BKOA 2RAVA 2YXLA 2A9JA 1WU7A 2BF7A 2I4RA 5LZ7A 2PNJA 3ZXUB 1N6OA 4N54A 3HZZA 1YFLA 4MKGA 2DETA 1T6NA 1G2IA 1TUGA 2H4HA 1U8TA 2QP4A 3GLHA 2A9QA 1LY1A 4LV6A 4MYSA 1QP8A 2J5BA 1WPRA 4QTUB 1E1NA 1U7TA 2WYIA 3BWYA 5BR1A 4X24A 3GZNA 4XWOA 1TC2A 1WXFA 1XTJA 3GJZA 1D4OA 3AVVA 4DUGA 2COEA 1ZNQO 4JLKA 1NQUA 2MU1A 1WXGA 3L7BA 1U7ZA 1H93A 1NVUQ 1TQ8A 1SC9A 3B3JA 4ZYYA 1Q2UA 3GUHA 1VA4A 2FFHA 3F6BX 1SKMA 1ULBA 2BY4A 2V03A 3ZWDA 5AVWA 3HVUA 2DPLA 3GRPA 5SZIA 2IHBA 2JANA 3GIDA 3BQNB 5E6SA 4EPRA 3BDVA 4MS4B 1HDOA 4QGGA 4BNNA 4EOGA 2IYWA 2W42A 4R1TA 1NOJA 2HMWA 1WUYA 2C31A 3T7IA 3HVJA 3I8OA 3K72B 2OC4A 4XFKA 1CRPA 3VNAA 1NLYA 1JLLB 4IYJA 5FXMA 5B3KA 3K6SA 3IOEA 4RHEA 3LWZA 2QYHA 1EM8B 4P7JA 5B4VA 4GGPA 3ISVA 2FMFA 5JPIA 1NW5A 1T9AA 3GFFA 4JMLA 4D3XA 2XUQA 3UMYA 2X7HA 1BE0A 5IJXA 4HEHA 5AH0A 4BWYA 4XE5A 4PGHA 4GX0A 5TPZA 3PHBE 1KQFA 2EG9A 3CIOA 1H8ED 1CQJB 4YNBA 3FGPA 1JR3D 4IO1A 3U17A 4ZJUA 5TF4A 4AJHA 4PX5A 4FOTA 4UOQA 2ZJ4A 1LTQA 3QHQA 2PSJA 3CMMA 1R9MA 4QJ4A 4YRKA 3LE8A 1DQSA 2I87A 2PUHA 2JCYA 2LPMA 3LF1A 3MJ4A 3P2KA 4IIUA 3RF6A 3GJXC 1EI9A 1UWVA 4DBLE 1OAKA 3A4TA 3U3ZA 3CVWA 3QE9Y 3LUPA 5FWXA 4PY2A 1LVHA 3EWAA 1PFYA 1VL5A 1WLSA 4DLTA 1A9TA 4UKDA 2BV3A 1JEEA 1OXBB 1F9AA 2YX1A 3D1LA 5IBRA 1FSGA 1O03A 1SJ9A 1RWWA 5DO9A 4E2ZA 3ER6A 5HRUA 3QH4A 4OOEA 3S0JA 4EAQA 1SZPA 3Q6NA 1NZFA 1PUXA 2W6CX 4XIJA 4E1VA 1T5IA 4RVSA 1LLQA 4RMJA 4LZPA 5JW6A 1YDGA 1GYPA 4OP2A 4JUFA 3ZDQA 3ZLJA 3MF4A 5AXAA 1JDUA 3MBIA 3QE3A 1JKJB 2JGLA 3OF2A 1EG7A 3PL1A 1S7CA 2AN9A 4UU7A 3ZWQA 2I65A 3T1NA 1MAHA 1N4DA 4ALKA 4DUZB 1BJTA 3KALA 3DZKA 3TSAA 1KEEA 1ZD9A 2IPAB 1ND6A 3K8QA 1AGYA 3U4HA 1HXHA 3D8UA 4O08A 3LUBA 4CMGA 3FHLA 3HCDA 4X00A 3NVKI 1VG1A 3D2AA 1XVVA 5DOZA 2H08A 4ZOAA 4ES6A 1I9GA 3CLSC 2N9UA 3D8TA 1UBSB 3V3KA 2ZUSA 1UBTS 4W6QA 2WD8A 4U2CA 3ZHXA 3VO2A 1D03A 5BV8A 3JQCA 4DIEA 4ZGWA 3PF8A 4KDEA 1V1MB 3P9ZA 4FUQA 3UMSA 4E46A 1TAUA 3N0TA 3WICA 3PHLA 3AB7A 4UTZA 1H2WA 1WXWA 1UWKA 1D8AA 2O2JA 4L28A 1UBNA 1HK7A 4A23A 2PV7A 4UNPA 4AJOA 8AT1A 3FROA 2BR4A 1MCZA 4J4HA 1J0CA 2G4VA 3NKVA 2W6QA 3IAXA 1J24A 3PNKA 3SHFA 1KMHA 5I7AA 5BN5A 3NIBA 5IYZB 1D5CA 4NL4H 1VJCA 2O0MA 5JPDA 1AVTA 3RCBA 4DM4A 5FOUA 4PEVA 3VKVA 4L4SA 4TTJA 3GLHE 3QE2A 1IIRA 1GTVA 2QJWA 4Y1RA 3VZCA 1BX1A 2LGJA 3LH5A 3T1OA 1M5UA 3PFNA 1W75A 4FMBB 4PTLA 5LWHA 2YYAA 3BEOA 1XRLA 4BNJA 5JTUA 1VKNA 5HOEA 1DC4A 3OX4A 4WTOA 1JHPA 3BJRA 4YJFB 5ES4B 1H3NA 1R0LA 3P0RA 5DNDA 3GROA 4CU2A 1GUFA 5E4TA 4B44A 3VDRA 3RBXA 3EEQA 3OZ7A 2QL6A 4DF3A 4MPDA 2M9MA 2VR1A 3L05A 1E2PA 3V46A 1ZJZA 4BTEA 3RFTA 3OTHA 4W5OA 3R3JA 4C07A 1WW2A 3BDAA 2ZUWA 4KDRA 2FXVA 1GG9A 3O5AA 4MX8A 4RSHA 4C6TA 2QOEA 3DL0A 1AK1A 4D8TA 1H8EA 2P77A 5EXPA 1DJMA 5BSEA 2QE7D 1JR3A 1NBOA 4MRSA 5DTJA 4B85A 5I4BA 3I9JA 4CF7A 1KVQA 1T9GR 5DHPA 2D5BA 2VOEA 2D5LA 1SXGA 4DA6A 4DTIA 2R8EA 3TS1A 4FQ8A 5B1YA 2PU7A 1YNOA 3LFUA 1NVEA 2B4YA 4D8WA 3UHFA 1L9XA 2F9FA 1BS1A 3L1IA 4R5MA 4RESA 1PG0A 3P2YA 2XT9A 2A67A 3TKLA 2V59A 4JLBA 1H1LB 1SBQA 5G0WA 1HL3A 2B30A 1NVBA 3WV4A 3B1KA 3DE4X 4F5ZA 4Q9IA 4DKXA 1UAAA 3H1EA 5ALXA 5B7GA 2QW1A 3AFHA 1AKRA 2QBYB 1KZ4A 3FTPA 2CDRA 3CURA 2JCVA 3K9BA 5EZ5A 1B8VA 5BNIA 1NW4A 2M98A 1RKQA 4L9RA 3MJEA 5EJAA 1BFDA 1GEGA 5L4SA 1YB6A 2F17A 3ZGVA 2VRCA 2XDWA 4ZQHA 3AH8A 4JQZA 2EX1A 1TFRA 3F6EX 4YAFA 1OOEA 1UEXC 2C4UA 2I6XA 3AEQA 1FMJA 3IOCA 4MR9B 3DXFA 1YRYE 3FBTA 2MYPA 4KRGA 2R97A 4GICA 4N0DA 3U62A 2OHGA 5TDHA 1GT91 1ZMTA 3LUDA 4KIGA 2IEYA 3PR2B 4B8ZA 3U44A 1RWVA 3DTVD 4AKSA 1JE0A 3EFEA 4FW8A 4L74A 1U1IA 5IHPA 2QSJA 3PK0A 1RP7A 4XPIB 2GN6A 4OXRA 1ABEA 1RC0A 2OR3A 3ZDZB 3H5AA 1J99A 1ZA2A 2HJ9A 2Y1FA 4B32A 4AUNA 3N2NA 4HSGA 3KYCB 3O92A 5JD4A 4QM6A 1S02A 1P17A 5TB5A 2JLZA 3TVTA 3IMGA 1KH2A 2OGWA 3OZWA 3TIFA 1XC7A 3DDSA 1Y3CE 3F96A 4MHSA 3ZW8A 2IYXA 3LUJA 2GD6A 3C70A 3PFGA 4EYSA 3GBVA 3HZRA 1M6NA 2GVDC 3HWX1 2VJKA 1BRTA 1Z28A 2JRCA 3F7NA 3JWHA 5EPOA 3ND5A 3WFZA 4QDUA 4KO1S 3FOFC 3NGMA 2IELA 2DB3A 2EHDA 5EI5A 1KAMA 1E3QA 4MS1B 3OPNA 3LYUA 1MXFA 1UJNA 2AI3A 4YDHB 1NRWA 2RCNA 4F8JA 3I2IA 4UJ3A 4UVEA 3ZU4A 2O8BB 2CD7A 5A3VA 3QU9A 1FDIA 2ILTA 4J4TA 1DMRA 1IK4A 1LF5A 2XGOA 3O9ZA 2QRPA 3K09C 2ZI3A 3U7EB 3TRFA 3RKSA 1U1CA 5ALWA 1RI5A 4DT1A 3DO6A 5ALOA 9ATCA 2Q3DA 1V71A 1QHYA 2WB2A 4ZO6A 4YYEA 5HUQA 4L3OA 1Y1KE 1JHOA 2RGRA 4OGWA 1PD0A 1Y4AE 4PPNA 1BOOA 5DM4A 5J2TF 3KR1A 4B71A 2VHWA 2PA3A 2QD5A 3L04A 4OGLA 4D74A 3E9EA 4BX9A 2QE7A 1QV6A 4Y2VA 1SUIA 4LDQA 3WLOA 5KYXA 1I2CA 3JQ8A 4F84A 2E4UA 1LX6A 2XTNA 3OLZA 2B83A 4LJYA 3MB8A 1LZLA 2W6NA 3SJ7A 1B6TA 4JUAA 3LTEA 2Q29A 2GK3A 3N7AA 3BS4A 1DBQA 4MQUA 4UCFA 1LPPA 4A2QA 3C8DA 3OTOB 4YEDA 1A72A 2J5RA 4LMAA 3RIHA 2ZRIA 3Q1KA 4MV5A 5TMEA 1T9BA 3WB9A 3T1HB 3PEYA 5E7IA 3QLTA 1RLTA 1XYVA 2QLTA 4FGSA 4HKTA 4TTQA 5A6SA 9MHTA 1VI2A 3T9CA 3WGUA 2E1PA 2XJ9A 1GCIA 2OLKA 1P1HA 1BC5A 2ZSUA 3T9AA 3VHXA 2IYPA 1FYXA 1MP0A 1W88A 4CCYA 1EEHA 3GAMA 4EY4A 4MVYA 5ICSA 2HT1A 1RRPA 4PGGA 2BGWA 1JR3E 4ZT6A 4JHXA 1AKVA 1YZKA 5G41A 3UH0A 2EV9A 2CGEA 2O2XA 1RI1A 3R4VA 5CTAA 3MK31 2FG6C 3NM5A 3PJGA 5E1DA 1C30B 1CJUC 1K6JA 1Y5IA 1P5HA 2GT1A 3B6EA 1NP7A 4HDMB 1C81A 1Z0UA 3M6VA 3A6KA 4BO0A 1ZNWA 3K6RA 1ACJA 4HQLA 3CTMA 4ZMSA 1IUOA 1GN9A 3DBLA 1NBHA 2NSHA 3DTVA 2EKDA 4DLKA 4MWOA 2FGJA 1T4DA 5HZKA 2I33A 4JEHA 2V9CA 4XZ3A 4X3CA 3IAM6 4MYCA 5KREA 4E32A 4IUYA 2QMYA 2TSYB 4MGYR 4AKGA 4U8HA 4AD8A 3BORA 4AQ7A 5GVRA 5J2UB 1FJGB 1L5RA 5H70A 1DE0A 3HVHA 1Y8CA 1V3UA 2O57A 4U7HA 2CKDA 2OBFA 1OJLA 3DT8A 3ZWYA 3HBAA 3FPEA 4OHMA 2JIMA 4YT5A 3RJ5A 3WL5A 4YRZA 5JXWA 1RM3A 1UM9B 5TQJA 1B0PA 1ZRNA 2H7XA 5C4IA 1XMQB 3IR6A 2R3SA 2DQZA 4UHJA 1NI4B 1KDPA 1HFJA 3OQ1A 1G20A 3GXOA 5EE1A 3DP9A 1YB7A 1KYVA 2ID4A 3BULA 3O21A 5LQJA 1KY2A 2VFAA 4BVAA 3NIFB 4EW1A 1N6IA 5SZJA 5C51B 2G06A 3THWA 1IEWA 5JXJA 1HDRA 4Z4FA 4MQEA 4GFDA 4QQFA 3F2VA 2CNWD 2GHIA 4NNPA 2G36A 4ETIA 2VJMB 2VHJA 3E5HA 3BD7A 3KJQA 4DMRA 2VOJA 1WUTA 1NASA 4BJ1A 2BCJQ 1TK2A 3IP6A 4ZCQA 3QPVA 3LPAA 2BMAA 2IY8A 3U7QA 3WXMA 3MFYA 4L75A 1T9KA 5I6DA 3HA7A 1CHNA 1UBKS 2VYQA 3DLIA 1C9YA 2X4DA 4HQKA 3CG0A 3JWIA 2IJGX 4HZUB 1WP4A 3U7FB 4D4KA 3ND9A 3UWOA 4IEEA 3ZHVA 3ZR4B 3ICCA 4C06A 8LDHA 3JZIA 1PHRA 3R0IA 2PD3A 5FO0A 4LCJA 2EARA 3RFCA 2XUDA 2Z0MA 4JJAA 4ER3A 3B36A 1O5OA 2VZ8A 2ONKA 4GZ5A 1JXMA 2P5UA 2VT6A 2XOEA 4EVIA 1P4AA 1P4JA 1R6VA 1L3CA 1OPXA 4B6QA 3JQGA 2OZPA 3SC6A 4YRFA 1UANA 3ENNA 4I55B 1U8XX 1YQ9A 5F51A 1QPGA 2AZTA 1ORTA 1TTHA 4HAYA 1NJ6A 2YINC 1V6CA 2GVZC 2PD4A 3N0RA 1XMXA 2I55A 3PWTA 1FP4A 4MPTA 3VJMA 3KUXA 3GPBA 5D3MA 1FFSA 4HUQB 3ECAA 2FN3A 3BSFA 4Q1VA 1OPRA 3O4VA 3UG7A 4EEZA 2QJRA 4AN0A 3OIVA 2JEZA 3ZE6A 1DT5A 1ZK3A 3Q9NA 4PPYA 4B3HA 2J3JA 3CPSA 1Z4QA 2VSQA 1O9HA 4B9EA 4ED9A 1P2TA 1KEKA 4NFHA 4YMWA 4D81A 3P71T 4DQUA 4OXXA 2QUZA 3OF5A 1YBFA 4GM4A 3AL0C 3UB3A 5DCYA 1T6YA 2V5UA 4KPUA 4TLDA 5LQAA 4KPYA 1UP4A 2XDQA 3VYVA 1MORA 2G80A 4ZT2A 3IPRA 4Y7CA 2NNWB 1GA6A 2WWRA 5IAEA 4CQMA 3IEIA 3U2QA 1FB5A 1YMVA 2CXHA 1XZCA 2W4QA 3O47A 4TN1A 5E7MA 2WOOA 4YRDA 4CG3A 2Z09A 3HRKA 3A6LA 1K5GA 1LBIA 2CCKA 3ZE8A 1JR6A 3ILSA 1UXIA 4WBNF 3DOFA 2GD0A 1JG1A 1KFCB 5IM4A 5ALTA 1QIEA 4KV9A 4EMTA 2YRWA 4XUEA 4F3KA 3H5LA 4RTSA 3OQOA 2R79A 1GYRA 4R1UA 2FPKA 1K5DA 1SCQA 1N7JA 1RYHA 4ZQGA 3ZHZA 4JH0A 4J29A 3IP9A 4IIXA 5LD2B 5FTLA 2Z3VA 1DKRA 1SRRA 2BFWA 2NWQA 1JU3A 1AUPA 1RT9A 3NZEA 1CQIB 1SBCA 4A27A 1PHPA 1GCOA 5TS2A 1TEZA 2QD1A 1DQRA 1GFSA 1QYXA 1NBIA 1YO6A 2FSHA 2QZ9A 2WHPB 4GR9A 3NR2A 3VMFA 2HV9A 3AU9A 3IB6A 4JKYA 1IN7A 2VHQA 1KAQA 3OIWA 2C3MA 2F9MA 2NUAB 3QG5A 2FEWB 1UBFA 2FV8A 1CR4A 2E37A 3GCZA 4DMHA 1F2UA 3NHLA 4ZT4A 3CPEA 2HWUA 4X3PA 3WP1B 4F72A 4F4FA 3I61A 1G5TA 4FJ2A 4ADSG 4DA8A 4M0FA 2BRUA 4YO8A 1X8XA 4JI2B 4I1SA 4CEIA 1D8TA 2R8YA 4IOMA 4J0KA 5T4HA 5IKPA 2J3LA 4O4IB 3DCIA 3ZCSA 2AN4A 4RIIA 2BM9A 4H0NA 4WK0B 2GF9A 2FMKA 2XNDD 4PONA 3SFTA 4B9AA 4QG3A 2ARKA 3GMDA 4XIIA 4C3VA 4JI4B 4JC0A 1FTSA 3DZ8A 4G1BA 3S2GA 3SAJA 2P3OA 1G20E 5LQRA 3FYUA 1ML4A 5FADA 4LK2A 5A0FA 3SG0A 2VBCA 3TR6A 4O8CA 5IWAB 1N36B 2WZDA 1OX4A 2GASA 3EWSA 2Q1XA 5BT8A 2R6DA 3KHUA 3NBZC 1JIIA 1G3RA 4LSZA 1KK0A 5FPHA 1WR8A 3WHKA 1WSWA 1LBHA 2IYNA 2BEWA 1T3TA 5D7BA 1ZQ1A 3HABA 4G5YA 4BASA 2HPVA 5JO0A 1DJNA 1ZC3A 1ODSA 2OHVA 2V7WA 4XLLA 4C5CA 5K4AA 4DJFC 4TSFA 2P9EA 3F5FA 2PFSA 3GT7A 4DDMA 1Z2NX 3LAWA 3JQDA 3RH0A 1T8UA 1WMEA 2IF2A 1HBJA 3D7KA 2R6HA 4QUBA 5HQ3A 2IHNA 4COOA 2A9KA 4EKYA 5AKEA 4NFLA 3W90A 3P9NA 4GOND 4RLSA 3TPZA 1I1OA 2DPGA 3D59A 2IOYA 4MUFA 2QENA 3EIHA 1JJIA 1N0WA 3L41A 4TSRA 2OTCA 3IEMA 4ZCRA 3HU3A 2EJUA 3D3JA 4PC1A 3A05A 5AW1A 3EK2A 5EE9A 4MUAA 3VSCA 1LBTA 2M6RA 2BMVA 1FX0B 3GK3A 3HY3A 3AYXB 3O8OB 1KJ8A 2BM0A 2NO7A 5KCMA 3S28A 3CR7A 5IMSA 2P5SA 1LBEA 4WLFA 3LX5A 2A78A 1G7RA 3PQ5A 1OLOA 3N2IA 3OTGA 1NFRA 3T5DA 1BAPA 2WDPA 1RI2A 1L7EA 4RHYA 5IW8A 3I34X 1O96B 2FPUA 3PNBA 3SGLA 1UPXA 3K2BA 3HJAA 4O2AB 1WTAA 4OM7A 4RD4A 2XR1A 2I4OA 4X7PA 4GPTA 5AJXA 1E2JA 3KD2A 4XWAA 2PS3A 3TIVA 4BUZA 3NQ41 1JLKA 4NWIA 4NJOA 2AKAB 1LPBB 5C8XA 1W36D 1AH2A 1DKMA 2GXAA 1T26A 1Z4JA 2FWAA 3NIWA 3AY0A 3B20A 3BL6A 4F6LA 4B3MB 1UT5A 1QC5A 3V34A 2HJSA 2OBXA 3IDOA 4RXUA 4F11A 4EELA 5AQ1A 4J90A 2ZYIA 4YRLA 1Q19A 3GWZA 1EFLA 1Z34A 1N8KA 2DHRA 2IUEA 3ROTA 3SQLA 1S3FA 4JBLA 4ZYLA 3EGDB 1N8NA 4I4TF 1AHIA 1LK0A 5HNKA 2VG8A 4UBLA 4XX0A 3GEHA 1I5OA 1QQTA 1RJGA 3THOA 3IQDB 1IE3A 1RQPA 1T8PA 3NOOA 3ETJA 3H65A 4AK9A 1YHYA 3N87A 3WMXA 5B36A 3GRKA 3CONA 4ZV4A 2XEDA 3R6WA 3HKDA 3NPMA 1L4BA 2X8JA 4XUDA 4WJZA 4E5MA 2ZXFA 4B76A 2ODNA 1CR1A 2P40A 3OLWA 1V1JA 5JSQA 4C08A 4D9MA 5JS6A 4FC6A 4RHXA 3KUCA 4BLUA 1HT2E 2NP7A 2FQ1A 3R3WA 2RG1A 4Y2RA 4K46A 3R7WB 5HP4A 3U56A 1I6KA 4W4TA 1J39A 1U7DA 4MRAA 1BYIA 3LF2A 1E1CB 1Z8DA 3UHOA 2DFTA 2VDUE 1IXRC 5DBFA 3GXBA 3BHMA 4B4WA 1KSHA 1JDJA 5EKSA 3FLAA 1JDPA 2ZSKA 3VYRB 1HEYA 2PUVA 2A14A 4LYEA 3RU3A 3MWDB 1XNJA 3WDKA 5TPWA 3NKFA 3QXCA 3FWYA 4YV7A 1GA1A 1TXGA 3EMDA 1FK8A 3HJUA 4KRYA 2UYHA 1KJQA 2ZJ6A 5JAHA 5LFAA 4TV8B 1LX7A 1UKCA 4GRIA 5FBQB 2D3WA 5KS2A 2QRNA 3SZGA 3HU2A 1ISHA 2GUWA 3L3BA 3RROA 2CFTA 3O8QB 3WS7A 2HGZA 4L2IB 3DLPX 1GKYA 1QGYA 2ZULA 3KDSE 1GARA 4RMNA 3V4LA 1PFVA 2BJWA 3HI4A 1B2RA 1ZH4A 4Q9HA 1WDTA 4YIKA 1M1NA 1PRYA 2AG0A 4YR7A 4FJ1A 5BVGA 2EYQA 4V1CA 1AGRA 5KCZA 1GZHB 2GBFA 3OEYA 4RIHA 4IDCA 5HFAA 1V7QA 1Y48E 2H1RA 2ZW9A 3HCWA 3K0KA 4H3SA 4X6UA 3O1JC 5LYYA 3W6ZA 2BHTA 1A9RA 4XVHA 4DYVA 2BMJA 5JCXA 1O54A 1A7AA 2UVDA 4INZA 1A9PA 1IN4A 1BW9B 1OYYA 2YVQA 4XI9A 3ITNA 5K0LA 3UMCA 2JI4A 4RD1A 3FNIA 5BW5A 3A10A 2H2AA 4JI0B 1G1AA 2P9JA 3BFKA 2PGJA 2IZ6A 3I9V1 3A14A 3KZXA 4DADA 1DC7A 3EXIA 4NYMQ 5ESRA 1US8A 3PGLA 1LC0A 1RJ9B 2PX2A 2WPDD 5EY5B 4ZWNA 2JASA 5B1SA 3T7AA 3UBMA 2WP8J 3LGAA 4EFDA 5EJGA 4FYWA 5IDVA 1NN0A 5FUYA 5J47A 4LBZA 1JEDA 2H3HA 5ER9A 1A4XA 1BO6A 3IE0A 4GAEA 1AB6A 1NURA 1F5NA 4OHVA 5DP1A 4ZVOA 3HSKA 3ZZ0A 4QLOA 4XM0A 3UV6A 4MVJM 3FBGA 5EMJA 2CB9A 4AJ4A 1NTOA 2I4MA 4QD3A 1J8VA 3HNRA 1H5UA 4DCUA 3FTQA 4MDYA 1YDMA 3LJKA 2PUGA 4A10A 3LUCA 3F7MA 2R68A 4KI0A 2HBRA 4FFBB 2EFYA 3ZPXA 2IU4A 4EYGA 1BXGB 2FF5A 4X8OA 3AVXA 4RUKA 4ENQA 3VKWA 1U2DA 2YS6A 5KDOA 1FMFA 1L5SA 4I5IA 2X9NA 4X95A 2HQBA 5EP1A 4XB6B 4O63O 3GPLA 3LIPA 1ZZGA 1R8XA 4P4GA 5BN1A 2OZKA 1VOTA 3UWKA 4ZOLF 1L7BA 4K9DA 1E63A 1G8PA 1SO8A 3AEKB 3AM5A 1L4UA 1SVMA 2H8KA 5COQA 5KEIA 2C1ZA 3R9KA 4ZZIA 2X7XA 2QM8A 4WCFB 4HTFA 5EWLB 4LJKA 4WK2B 3LVBA 3ABRB 4HNQA 4PYNA 2AF3C 2VNHA 5H3HA 3SEFA 1MEJA 4UUQA 3PSHA 1JNXX 4FYPA 3UK6A 3OOWA 3GDGA 1VKJA 1JKIA 2JCXA 2VDKB 4LVUA 3ML1A 5HMMA 2JJ1D 1BXZA 2LCIA 3OT1B 2P9BA 5H5JA 3B5IA 3HDYA 2OCPA 2VJAA 3HR4A 4UEOA 3HL0A 3C3XA 5EVCA 3T5MA 1OU0A 4MS3B 4JYBA 2I6GA 1AZSC 4KIWA 1R6UA 1M2EA 2Z2JA 5IKEA 4POOA 4BN4A 3P7MA 3QUSA 3D7NA 3UMFA 4N3BA 4ZZ3A 3M2TA 1ZWKA 5EUBA 4UVIA 4G23A 1LBQA 1JHAA 1Y33E 3V6LA 4BFUA 4F6CA 5CB4A 1Z6GA 2IPMA 2NIPA 4MW5A 3E22B 4W8OA 3TLYA 2D1QA 4PIVA 3N53A 2C82A 1J42A 1ANKA 2YV5A 2ZYVX 5E3HA 5EZYA 5IXSA 3PPYA 2WJJA 5I45A 3GZ4A 4K3VA 3LW7A 3ORFA 3WIOA 1BDMA 2IQ5A 4XIGS 4DIDA 4D26A 5E1OA 2QTWB 1K8ZB 1FA9A 1OZFA 1PW5A 2POQX 2WWVD 1F5SA 3UICA 4BLWA 1AURA 4RVCA 2HMSA 3VVBA 4V0RA 2OENG 5JPCA 1V5IA 4MKFA 1VL8A 4OM8A 4E13A 2F1OA 1TE2A 4G24A 1FUEA 1SD2A 1VJ5A 2MINA 3K9NA 4JLUA 2IEDA 4KO2S 1BROA 1GRNA 4NH0A 4Y9RA 4C87A 4I7EA 5LQKA 3UYLA 3TLGA 3FOWA 4YCNA 3OZVA 3AVTA 2QD4A 3IHTA 3VPAA 2H52A 4MYRA 4YYZA 2QRZA 4F71A 1ZPDA 2GPJA 1L7MA 4IIBA 5JMTA 3JATB 4GM0A 4YJ3A 4URZR 1XZ8A 2JARA 2ZB3A 4JT9A 5F23A 1DKPA 4L73A 3CLHA 3PDUA 4TS4A 4X1IA 4O8ZA 1OI3A 4QUKA 4XUCA 4QVGA 4XLTA 2HHJA 4R69A 1FQWA 1I3OA 2HIHA 2Y1DA 1UOOA 2KMLA 1MC4A 4H3HB 5CDTA 1Y8QB 4G0NA 2K2QB 3ZS9A 5CB8A 3E7WA 4P3PA 1K9VF 5AVVA 2V9PA 4FCTA 4MK4A 1IC6A 3DF7A 3W1EA 2C9ZA 4KTVE 4C5BA 5B5SA 4WQMA 4C2TA 1L7PA 4ZOEA 2PYIA 3T06B 3UC5A 3OZTA 4NCAA 3VNRA 3GMIA 1IUPA 1N5MA 2BKEA 1U94A 3WI7A 6GPBA 3A9UA 1ZR4A 2XGJA 1QRSA 2GN8A 5HKOA 2ILVA 4IJVA 1I80A 4NZYA 2OUIA 3ESYA 3UT0A 1IY0A 4BTVA 5EUMA 1SUEA 3WLTA 1N5LA 2P2DA 2V6JA 5AVUA 1Y1RA 1XFDA 5DI3A 3L7AA 3ZE2B 3PDJA 4XR4A 1XDWA 1ZD8A 1HDYA 2ZB7A 1RHQA 1K08A 2WT4A 1CJVC 1T0UA 3CW8X 3NORA 5DTEA 5LA6F 4AMBA 5AVTA 3SJBA 1FUYB 1ZN2A 4AMZA 1L4GA 5T8KA 5CK5A 3LCUA 3QITA 3FNFA 3LCMA 4REQA 4Z0NA 4PHCA 2AF4C 3OIGA 5EXTA 1MAUA 5AW6A 1VLMA 1Z5PA 2FHPA 4KLNA 4AP9A 5JEEA 4D9IA 2QX7A 4E11A 2AFIA 4LYAA 1L4MA 3AX6A 3QNWA 4KWIA 3UUEA 1OWOA 4S2UA 4GR5A 3S6JA 1V3QE 4ZXFA 1A76A 1FFBA 2I4IA 1SCBA 4IV8A 3IAAA 3OKCA 4MUXA 3U16A 2R6JA 4EAAA 2GZDA 3A6EA 3E7DA 3HDJA 2R96A 3HGMA 3CNQS 3L8GA 2OFXA 4A8HA 1RI3A 2Q7DA 3ZVLA 2OCAA 3GAZA 2HSDA 4DC9A 4XM2A 2B6NA 1PX0A 2ZSIA 4OLFA 1CUJA 3D0QA 1K8XB 4LQCA 4V3BA 3JV7A 4ZDWA 2EQ5A 3ROKA 2JFFA 2VHVA 1B3RA 4D9GA 1WHTB 3FWNA 4LOHA 5FDFA 5K8LA 3IS3A 4X6YA 3RIGA 2IP2A 2J08A 2HLDD 1CRQA 3O8DA 4Z4GA 2BHLA 4HATA 1H9BA 4WXYB 1VL2A 1AK9A 1VDZA 3KCNA 4M1WA 4BLPA 2Z95A 2CSXA 1NVVR 5KSOA 1SC3A 1HWYA 1XCPA 2AV6A 1NZDA 2Q3FA 2IIBA 2Q5OA 2W43A 4H1TA 3UB4A 3OKAA 1M10A 4K7JA 3GQVA 1YDHA 4EB6B 3AW8A 3MCTA 2COKA 1IOVA 4JXKA 4PXYA 3RIXA 4A8JC 1I32A 3SMVA 4XTCS 2RGCA 3LDUA 3O38A 5TEVA 5KTNA 2W7TA 3EZXA 3G49A 1PK9A 4R41A 3LHKA 4BDTA 1C7ZA 1SQ0A 4WCFC 4ZOCA 2Q3EA 2K6GA 5LMZA 4MRNA 1IZ9A 2YHUA 3V8MA 1QU3A 3OCZA 3WL8A 4KUGA 5HDQA 1U0SY 5G0UA 3IA2A 3ONEA 5J5VA 2XX3A 2AEJA 3L0DA 4MRMA 5CLIA 3NWOA 5DBHX 5EJIA 4BGUA 2JK0A 4RKWA 2DY0A 3BE4A 1B2LA 4LN1A