1X9IA

Crystal structure of crystal structure of phosphoglucose/phosphomannose phosphoglucose/phosphomannoseisomerase from pyrobaculum aerophilum in complex with glucose 6-phosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
300
Chain Sequence
SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for phosphomannose isomerase activity in phosphoglucose isomerase from Pyrobaculum aerophilum: a subtle difference between distantly related enzymes.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Isomerase
molecule keywords glucose-6-phosphate isomerase
total genus 111
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x9iA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x9iA02
3J7AC 2E5FA 4LF9B 1JLHA 4DR2B 3FXAA 3J81A 2A3NA 4LF7B 4DV4B 4JYAB 3Q7IA 1C7RA 3T1HB 4X64B 4JI1B 2UUBB 2UUCB 2UXBB 2UU9B 2CB0A 4B3TB 4IVNA 4JI4B 1IBMB 1VIVA 2HHHB 1XNRB 3JAMA 4LZJA 3TRJA 5LMNB 2UUAB 4JI2B 2I22A 2DF8A 4LF4B 4K0KB 3QKIA 1MORA 1Q50A 4YHHB 4JV5B 5LL6P 3ODPA 1XMOB 2ZJ3A 5I01A 3UJHA 3FJ1A 3LJKA 1TZCA 4U6NA 5FLXA 1DQRA 1KOJA 1HM5A 1C7QA 4S1WA 5BR8B 2VF5X 4LF8B 4LFBB 4M0DA 2CXUA 2CXSA 4JI6B 3HJBA 1X94A 2CXOA 1TK9A 3C3JA 1I94B 1VI6A 4NXMB 4DV2B 4DUZB 2CVPA 2V4MA 4OX9B 3OOJA 1NUHA 1U0EA 1N33B 1U0GA 3EUAA 3T1YB 2J6HA 2CXTA 1NRIA 2XHZA 3KNZA 4X65B 2YVAA 2PUTA 3J80A 3FKJA 1J5EB 3BCHA 1T10A 1U0FA 1X9IA 3PR3A 2POCA 4YY3B 4JI3B 4NXNB 5BY2A 5LMUB 2PUWA 1M3SA 2O2DA 1N36B 4DV3B 2PGIA 2XBLA 2CXQA 4B3SB 3FF1A 4DR3B 2AMLA 1VIMA 4DV6B 2I2WA 1HNXB 1XMQB 4TOIA 4JI7B 4DR1B 1HR0B 3BJZA 5A2QA 1J5XA 4LF6B 4X62B 1G98A 3CVJA 4DR4B 3NBUA 4DV1B 2F4VB 3G68A 1JEOA 4KHPB 5IWAB 4GKKB 1MOQA 1IATA 4GKJB 2ZM6B 4X66B 2VQFB 3ETNA 1ZZGA 1N8TA 2DECA 2VQEB 1X9HA 1IBKB 1XNQB 3IFSA 1N32B 1GZDA 4DR7B 2X3YA 1VI5A 3M5PA 1GZVA 4LFCB 2E5LB 3HBAA 2UXCB 4DV5B 2CXNA 4EM6A 4LF5B 1IBLB 2Q8NA 4S12A 1HNWB 1FJGB 5IT9A 3JX9A 3Q88A 3OTOB 4B3MB 4AQYB 3SHOA 3TBFA 1TZBA 1JXAA 2ZJ4A 1IRIA 2CXPA 2O2CA 1WIWA 1X92A 1JIQA 4DV7B 4LFAB 1HOXA 2PUVA 2VF4X 4JI5B 1N34B 4DV0B 1B0ZA 1HNZB 4DR6B 2UXDB 4AMVA 2WU8A 4DUYB 4JI0B 4B3RB 4DR5B 2CXRA 4JI8B 1MOSA 1XTBA 3I0ZA
chains in the Genus database with same CATH superfamily
2P69A 1ZGHA 5BWOA 1XQWA 5E4FA 5AOVA 1N6PA 4R2MA 4LNUA 1C4OA 2B2CA 1NMYA 5IZCA 1V2HE 3BXPA 3OPYI 4INOA 2FSFA 3EH1A 2J32A 2EC5A 4ZVQA 1DUIA 1HUQA 3DBRB 5JPCA 3GLFA 1R9NA 2Q50A 1AVTA 1MFZA 3AVVA 4B45A 3L7BA 2FPPB 1YHYA 2FZ4A 3IEVA 4YMSA 2GESA 2ZWVA 4ZU3A 4CT5A 2DPXA 1YDMA 4YRCA 1U2DC 4BFYA 5IJ0B 5CFPA 3NEJA 3D8TA 4TXNA 3LQ4A 3NASA 3ZV4A 3SPXA 2KW5A 1IQ0A 3Q40A 4IHAA 3IEKA 3UWPA 1WPGA 1YJBA 2FN7A 3WB2A 1XYYA 2A1IA 2ZAMA 3ILHA 2Z2IA 1KSHA 4HHEA 2GI4A 5JCPA 4YPOA 2O54A 4IJQA 1T3ZA 4I5IA 4F6RA 3HADA 3M6AA 5THKA 4KITB 1XEXB 4IVPA 1HMPA 4LXQA 3M7IA 3QVGB 4ZQEA 1LDNA 3E4CA 4EO4A 3PA8A 2V5VA 1LPPA 4A16A 1X14A 2BW0A 1AS3A 4QQNA 4BEWA 2PK3A 1FSPA 8ABPA 1Y9EA 2ZJ2A 2BFBB 2YYZA 3T9DA 3FPJA 4GOLD 2VYCA 4A4DA 3H5RA 1II8B 5FUWA 1RNLA 4BN0A 4MR8A 3MJEA 5JATA 2R87A 1H5QA 2AZ4A 3IBFA 4KLNA 1BVUA 3IV6A 4I9FA 3T3GA 1C9JA 3PCXA 3EW7A 3JVVA 3EFHA 3KLMX 1NULA 2DWQA 2JFVA 3WWOA 5TMBA 5CB0A 5IVKA 5K03A 2O5RA 1JQJC 1XXHA 2VHQA 4PINA 1IXSB 2IOQA 4FI3C 3KQHA 4W9NC 3QVMA 5A0TA 3LUCA 2FQ1A 2MR5A 2NYUA 1Y6QA 3Q12A 3ZU3A 4B84A 2AX4A 1DC5A 1KA9H 1JQLB 3MT9A 2GAJA 1NFRA 4V03A 3NEPX 3TCNA 4E5NA 4X62B 2YZGA 3KPWA 4NJEA 4PGMA 3I1IA 1P73A 1X3SA 4IICA 4C7KA 1Y5NA 4BNXA 5ICSA 3DOJA 1YR7A 2CVHA 1PUIA 3REFA 4P7KA 3FNEA 3SXJA 3VU0A 1GFWA 5GQSA 3MF4A 5B7PA 1NM5C 4Y7DA 4LDRA 1JIUA 2AEFA 3TL2A 1SC9A 2DUJA 4EJSB 1C0PA 3VKHA 1PGNA 4AQ7A 2VJCA 2WMYA 2YHIB 1Q2UA 2X8LA 3A36A 3JQ9A 2C1XA 3OAAA 1K06A 3JR3A 1MBZA 3IPRA 3PWTA 4YLGA 3RC2A 5JSUA 1LRJA 4CT0A 4V0MA 2W2OA 4BASA 3I2IA 1J42A 1HQCA 2I1LA 3R5TA 2BFOA 3CINA 3DONA 1KDYA 2C96A 2W2KB 2PGLA 3ENVA 1HZZA 1RM4A 1SD1A 4GOND 3EF3A 3L8MA 2ZT8A 3SEZA 1E7QA 3KB1A 3ILSA 1EEXB 1FX1A 3OHPA 5DT2A 1T4CA 1ZL2A 4FFNA 4G07A 5JJIA 5F5XA 1ZJ6A 2XMSA 1I51A 5CYGA 2G1KA 1G21A 1SN7A 3FDFA 3T3DA 1SHJA 2JLYA 5CXSA 4QLAA 1TPZA 2RBKA 2JW5A 3H65A 3M34A 3KD2A 5DH9A 3RSOA 2PQ6A 3P0RA 1KPGA 4CI0B 3B78A 2EEPA 5CFLA 3PQ8A 2CD7A 2V3VA 2R68A 2R6R1 4PN3A 5CDFE 3GEIA 1ZRSA 2JCXA 1C8KA 5IT5A 2V3CC 2ZJOA 2G72A 5DHFA 5H4GA 2DFPA 4AXBA 3P0FA 2IYUA 3BZUA 3DFZA 5TSDA 1NLMA 1EBUA 3V4LA 3ZVRA 4B9EA 5KC9A 3KXPA 2BTEA 4RNDB 4MR7B 5JS1A 2PQ2A 4M98A 1MJHA 2HIGA 3DNMA 1CUJA 1P75A 1Y1QA 2QM0A 4B73A 4L28A 5KYVA 3HZRA 4RMHA 5TMEA 1ODJA 1TQ8A 1ODIA 4N7BA 1DKLA 5D2CA 1TO1E 3QYFA 3HCCA 4YRFA 5PNTA 4E5DA 2A59A 4DG5A 3PJEA 1MENA 1Y6GA 1P72A 4Q93A 4QXRA 4UE2A 1GLVA 3FBTA 3IIJA 3IPLA 1O9GA 2PGOA 5BR8B 1M83A 5J1TB 1DCMA 3DTVD 1H2BA 4JB3A 4UU0A 5IC5A 2YW9A 5B4TA 3SJZA 3SK0A 1Z6GA 1NV8A 3ID6C 1E79D 1MNQA 1XZEA 2WKRA 4WD3A 4AF7A 1XKLA 1TM1E 1JKJA 2X0NA 3FHCB 4QXMA 1Z29A 3RJMA 4OX9Y 4DZRA 2TRSB 1UPFA 3GUUA 4GYYA 2VHZA 5FBRB 4FMCF 2P9EA 2KLHA 5K20A 2PA3A 5FBHA 3CX7A 1SKYE 1G21B 4JP1A 1VE9A 4FMCB 1H5NA 1E9CA 4C20A 2R66A 4Z0NA 3CKYA 2O2DA 2VK4A 4YRKA 5IAAA 4TZKA 5I8WA 3N6XA 1CTQA 1T1RA 2HBYA 2GPWA 3PGLA 4KYTA 5CLJA 4RHTA 2OY0A 3IAXA 3VC3A 1T0JB 3V55A 4Z0TA 4RFLA 3MA0A 2G76A 3OE1A 2IYWA 1MAVA 1FDUA 3HCBA 1Y5LA 4NE7A 2AQIA 4L78A 2Q2QA 4FZ5A 4MRMA 3G3EA 1VJDA 1QGED 1Z5ZA 4IRXA 4D46A 1RWKA 4A8JB 3N0XA 4FC7A 2B3TA 1VMDA 4GQBA 3U7IA 1NE2A 1Q5PA 1UWKA 4WESA 5BR7A 4GKJB 1ZD4A 3AM5A 1T9AA 2O1SA 3WK8A 2ZIUB 3DDSA 2F17A 4CLOB 4D6XA 3DEAA 3VHXB 4DR7B 4DVJA 5KYNA 1N6LA 2B4YA 3K0KA 3DEIA 2B5VA 2PG3A 5EWMB 2HBZA 3V97A 4RH0A 3GHHA 3ILXA 3OCVA 3ROKA 3FRHA 5FOWA 4EGSA 2O2EA 5A4DA 1U9YA 4NZPA 4YRNA 5F23A 1W581 5HG0A 2QQ5A 1FFCA 1QO9A 1DQSA 2ZIXB 4L27A 1XVLA 3ZS8A 1AC5A 3IB3A 4PQRA 3RAGA 3PS9A 1W7AA 4GUAA 1I0IA 1QR2A 4Q3CA 3NIWA 5M3BA 1AMNA 3UC9A 4OQLA 4EENA 3ZV5A 5CU7A 1F4VA 1FDWA 3OX1A 4MLPA 4YRTA 4BB5A 1HG1A 2L69A 3BWXA 4DHEA 1QONA 1UQRA 5LLSA 2YCLA 2FPIA 4RACA 4GLBA 4OSPA 1IN4A 1DWQA 2EVWX 2IIBA 3L40A 4PHCA 5L4NA 1YFLA 4GBGA 2IWRA 4JJ6A 2Y6UA 1T29A 3I8SA 4ECAA 1DO0A 3FG9A 1YCFA 1OROA 4BQQA 3EIWA 1P4HA 3CEAA 3GYGA 2UU9B 2DFNA 3PC3A 4ER3A 1YVEI 1C30B 1EM8A 1NY6A 1EK6A 3KTAB 3M6WA 4QULA 2FLVA 2EQAA 1FP7A 4PZDA 4TL7A 4LRYA 3GFBA 5CBPB 1ONBA 4P3XA 3ZS9A 4UNQA 1EE1A 1SK8A 1P0QA 1I13A 2EFGA 5HMMA 4YHHB 2MSCB 1T9GR 1AUOA 1EHYA 4M9QA 4QRHA 4F1KA 4KIUA 2VDOB 3DPUA 4FNGA 4HZUB 2WJJA 2YNMC 3HRKA 2GF0A 3V3KA 4ZT5A 4I55F 2WBLC 4B2LA 4D92A 1RWNA 4ND8B 4NG4A 3RS0A 3SKYA 3UCEA 4E4TA 3DXYA 3P9YA 4HDRA 4EY7A 2BH2A 1Z8DA 3GRKA 1BEZA 3EBOA 1QK3A 2IEIA 2BTQA 3F2IA 4RD1A 4YP9A 4KUGA 4HP8A 5KYYB 2XVAA 5ALPA 1R27A 3NALA 3PLAE 2Q5QA 4QHYA 5DBEX 4K88A 1G55A 4UVDA 1G8AA 1CJMA 1G7CA 4P93A 2OCXA 4U7DA 3WY9A 2ZETA 5FHRA 4FPXA 3P20A 3B2QA 3G02A 1N57A 3TJZA 3W7BA 1XE3A 3DKPA 4PPGA 2YKGA 4XJSA 4ZDIA 1Y6JA 2Y27A 2YJZA 3FPCA 2H3EA 4JD5A 4UFPA 1PWXA 1J24A 1N5RA 1E9FA 2F1KA 3GAMA 4G0XA 4OI4A 3TCKA 4BP8A 1EI9A 3LT4A 2FLWA 4R1PA 5HDQA 5HJ7A 3KHKA 4LMPA 1R88A 1KH3A 1V2GA 1Q0RA 4XWGA 4WL0A 1BJKA 4CTKA 1G8KA 4G24A 4R8VA 1RT9A 4M0FA 3U7EB 1DJLA 1ZINA 3VVBA 3PFNA 3BICA 5AHXA 1IUKA 1SZCA 1Z4NA 1ZO8A 3GBSA 4S05A 2M6SA 2QLJA 5BN5A 3CURA 4J3NA 1TOAA 2C9ZA 1P0FA 2J4DA 3HP7A 3D1LA 5TX7A 4N6NA 4NE2A 1H69A 4KV9A 5AKKA 1TX4B 1ZX1A 2QXYA 3AETB 4UDOA 5EJ6A 3ZU6A 3B1XA 5KKNB 1FUKA 2REQB 1CJVC 1TJ3A 2VA9A 3EVAA 2RHWA 3AIKA 3TR0A 5CBPA 1TZKA 1LH0A 1CY2A 1T1GA 2RIPA 4QICA 5EQTA 1SK9A 2H1RA 4B6RA 2VHVA 3GMTA 3ZBTA 3N2GB 1M2NA 2B6HA 3SX2A 4BV8A 4B8WA 1Q20A 1CZLA 3HCNA 4B6OA 3JQAD 4ARCA 3K1ZA 3RVRA 3W4KA 4AWBA 4TT3D 1D6NA 4OP2A 4F84A 4WQMA 2KYRA 1N2SA 5JEDA 2EWWA 4OQYA 2IZ0A 4OLJA 2XNCA 2ZEJA 1THTA 2Z0MA 3COPA 1YUNA 5FOQA 4RYLA 5IZ4A 2GB4A 3DL0A 3OOHA 4CEHA 5E6SA 4Q3NA 4NLLA 1RZUA 5KYYA 2H51A 4JP8A 1L7QA 2X0IA 3QV2A 4HVLA 2QLLA 4ZRMA 3UUGA 4YONB 1AIPA 1DU4A 3IODA 3MGBA 4KKVA 3CRW1 4CMKA 3KQVA 1E7YA 1UK8A 2ZAGA 1X86B 3PI6A 3H2SA 3QUTA 3PB3A 4B4OA 2XX3A 3HJFA 2DU8A 4IXDA 5JAIA 2GXUA 5EHXA 3KO8A 3URKA 5IHPA 1NQVA 3CSDA 1BX1A 4NBVA 3GFTA 1UPAA 4YLYA 2Y3IA 1SVKA 1CQXA 2O0LA 1HFKA 3U9TA 5HX7A 1MIOA 5JS2A 4M7RA 1CUWA 3KAJA 2MMGA 4FM9A 4J75A 3QXSA 2WPDD 3WLQA 3OSUA 3DBLA 4I55A 4K6CA 3R76A 1J2UA 3DTVB 1XZMA 1ZYUA 1F8FA 1G8JA 1KMHB 4JLKA 2R00A 4LTDA 4UMVA 3B38A 3OZEA 3S4YA 3SWWA 2YN2A 1YZYA 2X3UA 4AVYA 5L53A 4Y6SA 3ESCA 1JWAB 3KOUA 2GN4A 1JILA 4JBIA 5C2JB 3DZCA 2GJKA 4X45A 4DS3A 1R8QA 4LJ9A 3P2IA 4OMFG 1I3OA 3MWEA 3KQLA 1AHNA 2QSJA 3OKPA 4RH1A 1KOJA 1O4VA 2GPTA 2ZCVA 3BD7A 3PJGA 4UC0A 3RIMA 4NYIR 4OU4A 1M5TA 4LFBB 4H3VA 3FUXA 1J1IA 1Y42X 5ALJA 2OFFA 5IM4F 4R2HA 1Y37A 1ZK1A 3H5VA 4HLUC 2QNRA 4DLYA 4DV2B 3C8ZA 4C0QC 1Z9BA 2DFVA 2WWXA 1RYNA 1PF7E 4OB6A 4F1WA 2WIFA 3BZWA 2ZUEA 4PVCA 3CXUA 1W30A 5JH7A 4HDNB 2YVKA 1UL1X 2FN9A 3LY8A 2CCGA 2DWPA 5EXPA 1OUMA 1JDZA 3FNGA 4X24A 3CZQA 2RGGA 1LY1A 3K09A 1HDYA 1PD1A 4TRMA 2JIZD 3I01M 5T41A 4B87A 2DWOA 1G3IA 4L0DA 2X6QA 1PKXA 3VYVA 1V8OA 4Q66C 3HVIA 3RSZA 1GNVA 3KR2A 3H5IA 2C2WA 2QMZA 1R0LA 5JSHA 1ML4A 2EZ4A 2QMQA 1YZUA 3DFKA 4O4HA 3EXHC 4PZEA 3NTQA 2ZJBA 1AGRA 2CLEB 2PMFA 3EN0A 3E3OA 3PQ7A 4X63A 4UBOA 3TLAA 1XF9A 2RSLA 5F2OA 2ZFUA 1HL3A 1KYZA 1MC1A 4C6SA 4C2AA 2XVZA 2R6ZA 1H2YA 2ZE6A 4AYWA 4C21A 3I6MA 5KYXB 5DTRA 4B46A 3PQDA 4YAKA 3LU1A 3ADDA 4IBOA 4II2A 4XPZA 1MU0A 3GCWA 2XTNA 1G20E 2GKOA 3P2YA 2JGFA 2HIAA 2IVFA 4JDPA 4EY8A 1J9EA 3CLVA 3SZLA 2P5YA 5D3QA 1SOAA 1QYCA 4OOFA 1UM9A 1ZP6A 4MPTA 7YASA 2HA2A 1QYDA 1TFRA 2H7CA 1VJGA 3JAWB 3NHMA 5CVCA 3HR7A 3DTNA 7MDHA 4CXMA 5LQRA 2WA2A 2HK8A 3WYFA 3MWEB 1YE8A 1IQPA 4CF7A 2JCYA 4HN2A 3TRHA 3THRA 2N1BA 4CGZA 3C3AA 4MUFA 3ZWMA 5K01A 3VR4A 2W8BB 1W8DA 3RFTA 2A88A 4MIEA 2IYFA 3F9RA 2IYEA 4FZ3A 1W85B 4KN8A 5I4BA 2HMUA 1L3BA 2WAOA 3DVAA 2PSDA 2CZGA 4Z7OB 2FW1A 1WKVA 1A7JA 2K4MA 3GC6A 4XLLA 3RC3A 4MCIA 4ZV4A 4DLNA 3AJ9A 2AUMA 2IPOA 4WLNA 1VMEA 3D2LA 3TZLA 1GL7A 1N1DA 2BEWB 2O57A 4YT2A 4RESA 3ORQA 3EMBA 1I2CA 4I4TA 3A9TA 2X0DA 3QE3A 4KU4A 3ZIAA 5CEFA 2UUBB 4R01A 2OUIA 3AP3A 4B5KA 1NQTA 1MH1A 3RAJA 2C82A 3TFWA 5HCNA 3VZSA 3N74A 3SKXA 2AFVA 5DYYA 1A77A 1QSGA 2GPSA 3WHPA 1VLZA 3MNFA 2C84A 3RUPA 4F4JA 2W22A 1JDNA 5A3SA 2QY6A 2J08A 3MSCA 5F12A 1M54A 2NVUA 4U2GA 3FJYA 1G2PA 2FJUA 3KPYA 2FG7C 4PG6A 1A5AB 1B93A 1D1PA 2FMKA 3O2JA 3HCEA 2E4AA 3KQWA 4Z49A 2ANCA 4A3SA 3M6UA 4K3VA 1FZTA 3X1DA 1QIJA 1EINA 4G4IA 5L3ZA 5TV2A 1TJ4A 1XZJA 1I2DA 2AXEA 2Y4NA 3K6KA 5AKLA 4GPBA 3W5VA 5KTKA 3U49A 5ECDA 2BFEA 2CJXA 1Z0JA 2VPYA 5EE3A 3DLIA 4FR5A 4QFMA 1V1RA 3HACA 5BV1A 3B52X 4BQSA 3RGGA 3K70B 4FE3A 2BP7A 3TIGA 2FZ5A 2YDXA 3E9RA 1BKDR 1BW9A 1FOEB 3EUAA 3EX7C 2DXIA 1VHTA 3JQ9C 5TLSA 5EE0A 2O4CA 2YBDA 1KO4A 3K8ZA 3W8FA 1EWVA 2JFBA 3LP8A 4GP9A 4LX8A 1LC3A 3D59A 4DT1B 3W5DA 1EFKA 2HRQA 4WZAA 4CM9D 2VPXA 5TQJA 3L82B 3QEKA 1W29A 4AY5A 1PZXA 2IODA 3HB5X 5JG7A 5LU8A 2EOAA 1CX9B 5AR1A 3TUIC 4ZFNA 1LDBA 2VSQA 4ZT7A 2HBQA 3LBYA 10MHA 3DVAB 2BFFA 5HNKA 1ENZA 3CCFA 1EB8A 3OH8A 3JWHA 4ZI7B 2JCBA 4D82A 1R8SA 2EX4A 4EMUA 4RJTA 5JXJA 1UXJA 3H0CA 1ZNYA 2ZR8A 3BDAA 3QLVA 5CT4A 3ECCA 5FUVA 2JJ2D 4WK4B 4WBNF 5HKOA 4LQLA 1M8GA 2GZSA 3IX7A 1FUEA 1G8HA 1P4RA 2XA9A 5D5HA 2HU8A 4D45A 3AY0A 4KXFB 1Z4LA 2PD4A 4WKNA 1RXCA 2R48A 3FNIA 3LHKA 3VU3A 4K8RB 4PZLA 5KX5B 4KHPB 1YHZA 2Z4SA 2NPIA 5TE9A 3CWZA 1SHLA 1XKQA 2JFHA 1HGXA 1N0IA 5LPNA 3UMMA 1U3CA 3ETCA 3MVEA 3O3NB 3IKVA 3HN7A 1K0UA 4AS2A 4J76A 5BQFA 4OHVA 4JJZA 4AO8A 3FGNA 4NV3A 5DYNA 5JBIA 5KSOA 5B4UA 4AZ0A 5C4GB 1KS9A 3G2IA 1ESNA 4RHUA 2C9DA 4F2GA 3VSBA 1GTL1 3QITA 2CY0A 1PGQA 4EHAA 1P33A 1ESZA 3KBBA 2W83A 5A5GA 4L9AA 1V3TA 1WHSB 2WOOA 3K1TA 5ER9A 3UV6A 2OORA 4OHCA 1ZRNA 1DIBA 1H6BA 2H57A 4QYSA 4BEVA 5K6RA 3T5PA 1J21A 1D6SA 1CS4C 1QPGA 2JVKA 4PX3A 2CDBA 3I3OA 3HCPA 3SVZA 2CFRA 4DV0B 2TMKA 1GT6A 2PSJA 2Y1CA 2AEJA 3LCJA 4EKIA 3AHCA 2XB9A 2C8KA 2P6NA 4XEUA 5I7FA 1X15A 3AEKB 4HAUA 2HQOA 3EIQA 1PJBA 4KJZA 1BXRB 2NSHA 1ZHFA 3SAJA 2DF8A 1XUOA 2Q1UA 3IEPA 1Y82A 3CO5A 3EDRA 2RHHA 3T1TA 2OFWA 3CLHA 3V4OA 1D4ZA 3C74A 2CUTA 5LFAA 5ALQA 4AJ2A 1EP3B 1MVNA 4HB3A 4ALMA 2JI9A 2BE7A 3V8RA 2PQ0A 4KQFA 5AIBA 1L3IA 3ZWOA 1YB7A 2JD2A 4L2IA 4R41A 5JZ9A 3K35A 1FU8A 3NOOA 3OURA 4IJKA 1X7XA 4RJIA 4KGDA 4ZCMA 3EQ7A 1WKBA 3O21A 3DZGA 3Q3HA 4IZOA 5FTWA 3VMMA 3WDKA 4RTSA 3U31A 2FMIA 3NRCA 1BYIA 4Q3DA 4EH1A 1UC9A 2P77A 4YYZA 3HQ4O 2IF0A 4EEXA 4UULA 4HEA6 1IXZA 4G65A 1A4RA 3O7WA 1ULBA 1RQXA 1FUYB 1VPEA 2H8GA 2X7JA 1NWHA 3C97A 4QBIA 2DH5A 4KJXA 5EIWA 5ABPA 3DAGA 3ZZNA 3CMMA 2R751 3ZWQA 4QDUA 1KVSA 3BQMB 3OM1A 4FTWA 2QN1A 4R6WA 5EY5B 5KI6A 1Q2XA 5DXAA 2ECOA 3CBQA 2FUNB 1Z5OA 2VSYA 1HH4A 1FTSA 2JHCA 2VTEA 2XT0A 3BWVA 1XHFA 3F5FA 1GRQA 1LPBB 1Y8CA 4KIWA 5I7OA 1N5LA 1LS1A 3VAAA 4F7DA 2VSNA 2RI0A 2WHEA 3MAAC 4EG6A 8AT1A 3QVTA 5A4KA 3ETLA 4LGCA 1LBEA 2ANBA 2X23A 2CBZA 4GOKA 1LTHR 1WZNA 5CHYA 1I1OA 4HK4A 3NXKA 4G2NA 1G3MA 2DQZA 3C45A 3NTXA 1K4KA 4HDMB 4PW0A 3QG1A 5DBGA 1FVOA 1XO1A 4J1NA 5LNK1 1ENYA 1VKHA 2Q6IA 2ID9A 2W00A 1DAOA 3MXTA 4H6PA 4FGWA 5EZYA 3UJ6A 4CBVA 4BKPA 4DWJA 7MHTA 2ZI7A 1QH8B 1SR8A 2VOJA 3A3NA 2IZ6A 3L92A 4FCTA 3QUBA 4UTOA 4Q4JA 6GPBA 3L77A 3A9CA 3K6JA 2JAWA 2QLBA 1Z45A 3IJRA 5JMWA 1MB3A 3BSYA 2CVOA 3O91A 3L0IB 4XOUA 3R7FA 1PJ3A 1Y3IA 3G5LA 4RZIA 3WHKA 1EGAA 3QPAA 1O97D 2Y8EA 1QF6A 4M49A 1KI3A 3S27A 4L2IB 4DZZA 3T5CA 1WKCA 4KRYA 4MGKR 4MCAA 3E1GA 3SDZA 4DSOA 1NBHA 1VIAA 5AFSA 4XASA 5AVUA 1ULUA 3B9BA 1X42A 1FDVA 3MYRA 1XEXA 3E0XA 2RHBA 3JYLA 3M5DA 1JR2A 4GI7A 1M5UA 1L4GA 4K2AA 1P9LA 2FHPA 3AF2A 4KVGA 4FU0A 3FNBA 3WZ2A 3A11A 1UBHS 1J7JA 3QIVA 1JP7A 4Q19A 1FQKA 2UUPA 3LFHA 1G17A 4L50A 2OBNA 1E7MA 2WZQA 4FSHA 4YQFA 3TBFA 4N5DA 3WSWA 5EP3A 1TZBA 2NTNA 2QTCA 1DIRA 1O5IA 3D4IA 3LECA 3OZBA 3Q9LA 4F38A 4RLHA 1WXWA 5JNUA 4N9WA 1O1YA 3DEJA 1L5SA 4P31A 1J22A 1MF7A 2VF4X 3V3TA 3WIEA 5KQLA 1P4SA 3UJDA 1SFRA 5HS6A 3G89A 1KI8A 4FWIB 4OXNA 1JPUA 4RPLA 4JLSA 2NP7A 1JFVA 4BO2A 4JOQA 3A9VA 3JQCA 5FUXA 2CYCA 4G0MA 4Y2GA 4QHTA 3R1IA 1JU3A 2JS7A 2QTZA 5IAJA 3THXB 4M6WA 2NSDA 4C1BA 2WB4A 2I1QA 4H27A 4BP9A 2JJQA 4M4SA 4CLXA 1UC4B 5EZYB 5KNCH 4G0VA 3W7AA 1EP9A 1IN5A 3N59A 2GFHA 1ZOLA 4KQ2A 1L4FA 2JAPA 1QGUB 2D74A 3H7IA 1A4XA 1NP7A 1C3XA 4W7HA 4CDMA 2ZSAA 3Q9NA 3WGYA 4C0KA 2OT3B 2WRZA 2PKQO 1PD0A 1YC2A 2ZRKA 2QW1A 7ABPA 2PBRA 1GPYA 1P7PA 1ZR2A 1Z5VA 3ZXXA 3C8HA 1QVRA 4ZGGA 4MPJA 1QHXA 3SFVA 1PSDA 2ODBA 4GICA 1NLZA 4ROTA 2PUEA 4JXXA 4PX2A 1NGSA 3VR2D 3KUKA 1FMLA 3FGOA 2LVBA 4CKBB 2O8FB 1WDLA 1WY5A 4QGHA 1KFEB 5HIIA 5C3UA 4DN6A 5D5QA 3W5AA 1TYBE 4G0ZA 4GRDA 3WDMA 4UVEA 3TS1A 3IOMA 2YASA 4AYXA 4Q39A 4I4TF 1L3CA 3P4YA 3ABRB 3CN9A 4GNKA 3H3JA 2B25A 2IQ5A 3CPSA 1N3IA 4LKOA 4R1MA 5J2TF 1NVVR 3AB3A 2JARA 5K8VA 4DMUB 1JEQA 5AK3A 4OUDB 3UVEA 3TDKA 1ECCA 5CAEA 3MWYW 3JAKB 3A04A 4UCQA 2MMCA 1MNAA 5LQSA 4DCNA 4KQWA 5LDDC 3IEIA 1KZ7B 5EGSA 5FLKA 2ZRHA 3EHDA 3OZXA 2Q1XA 4DQXA 4ZAGA 2Z6VA 2ZWIA 3L6RA 5CFZA 4WOBA 1TLTA 4YDHB 3HL4A 3VO1A 2EWVA 2GZDA 2HSWA 1PR4A 3FGZA 2HRRA 4RLFA 4UHHA 4F4DA 5EHIA 3U4GA 4Q4LA 4B35A 3ZHQA 3G0HA 3CIOA 3CVYA 4FYJA 2ZPAA 3FCXA 4K6GA 4X92A 1S8FA 4YPFA 1HR0B 5JWOA 3B7WA 1ZN2A 4YT8A 1QQBA 3OQJA 5LZ7A 1NW5A 5DBOA 2Z5VA 4KIJA 1HURA 3GLFB 3DBIA 4KYUA 3DBVO 1NJ1A 2H08A 4IXMA 4OF4A 5AIAA 5FPPA 1DBVO 1FDOA 4OBWA 3MWLA 3JD3A 4UBJA 2NV2B 2CHEA 1YVUA 4HGNA 3B3AA 4JSRA 4FDLA 2H85A 3D6VA 4B83A 1P7CA 3QE0A 4QLBA 5DFAA 2O2ZA 2XUAA 1LBQA 2P9JA 4QTXA 4FS3A 3OTHA 4NH4A 4RQUA 1PU2A 1ZH2A 3M3PA 4YEDA 5KAMA 3W4IA 1NLYA 3QV1A 4WIAA 1F48A 2WV9A 3KQNA 5J2UB 4H7HA 1WPRA 5HM6A 3CNHA 3MMXA 3O75A 3N76A 4D9CA 4F3TA 1P0PA 2GJAA 4YTEA 5BO5A 1JT2A 1FBNA 3B8EA 1O97C 4EW1A 1PQPA 3ZHUA 3LSTA 1NW3A 2BONA 1ZW6A 3C8MA 1SQFA 3NVAA 3PXGA 4TTAA 5IKMA 1GLNA 1M1UA 4N3BA 5ITZB 2A1TS 1YR1A 3I53A 2GKSA 4G97A 4H18A 4OQQA 3AI7A 4K1XA 1KDVA 3FAZA 2JFYA 5E4TA 3RT7A 1EZZA 2VDNB 1KYVA 2H06A 3FFBA 4ONEA 4QFDA 4JYCA 1U2SA 4RSRA 3DOFA 1LD3A 5EJEA 3NANA 3BFPA 3TTXA 5IX8A 2DHCA 3EWAA 3OT1B 2GTPA 1WB6A 1Z0DA 2ZS9A 2COUA 1DEXA 4PG7A 5KTNA 1NI5A 1TF5A 1XRNA 1Y9DA 1QC5A 2QAGB 2Q6KA 2A9QA 2CDCA 3QMMA 4IRMA 3KXDA 3D2BA 4K9MA 1P5RA 5HILA 2ZBDA 4MYCA 5ENZA 5KDLA 2HSJA 3O9ZA 4EKNB 1KQFA 5ED4A 3VC1A 3MRSA 5KVQA 5AHRA 1UXGA 3P0EA 3FUTA 5JSKA 4KQGA 5IK2D 5HIAA 2Q5LA 4J6FA 2PBZA 1EUDB 2J3HA 5DHUA 4XUDA 3BE8A 1HZJA 5C1DA 4O29A 1JA1A 3ACDA 4WXPA 3CUYA 4L8LA 1O5TA 3E61A 2EV9A 1RJ9A 1XRSB 4EUKA 2J3JA 2Q5CA 3T35A 2J7PD 2VLIA 4AMGA 4RK0A 3SIPA 5A0FA 4E46A 2I7TA 2QYSA 3OJEA 3BXZA 4YMVA 2EQ5A 1MJFA 3MGGA 4AZ3A 4MRRA 1E62A 3F71A 5I9BA 3SGLA 4YWHA 3F49S 3PPYA 5AVQA 1XX6A 4U9UA 2AXNA 1Q16A 3CSUA 5D01A 5HZGA 1KP3A 3UKJA 2A3RA 2W2KA 2GM9A 3M1LA 4TTSA 5JT1A 2JI6A 3JQFA 2EDAA 3NX4A 5ALFA 1DFGA 1FK8A 1SCUB 4JUIA 4ITVA 3FKJA 2DPMA 1J2EA 1K66A 2F43A 2QT0A 3HV2A 3NNSA 3Q6MA 4MUHA 4QSMA 1WNTA 2LUOA 2ZB8A 3KLNA 4CMAA 5LQAA 3E03A 1KFJB 1MA0A 1SZDA 3GDFA 3IXMA 3D8NA 3EVGA 3U2QA 3ZKWA 1NIPA 3GF4A 2I6TA 2FG6C 2YV2A 3FNFA 2E55A 2XB4A 4CF5A 5IHXA 2EKPA 1M1ZA 1NBEA 2GN1A 2I87A 5CVEA 4YCCA 1GAXA 3LO5A 3A9UA 1AV6A 4HH3C 2GF9A 2H0RA 4ZEMA 4YX9A 3VDXA 4C4XA 3I0MA 1O95C 1PYGA 3VDNB 5BYKA 1J1UA 5B1DA 1SJ9A 2W90A 2IHZA 2OUKA 4HAZA 4ZVVA 1CR4A 1JIIA 1NDUA 4H1TA 5DSTA 3UXEA 3VR6A 1FRNA 5CB8A 4AJHA 3QUAA 1ESMA 3JVDA 5H3LA 2E85A 3UIEA 4IOMA 3BRCA 4XLZA 4IZIA 5AJVB 3U7FB 4B85A 1K8YB 4ERNA 3L4BA 1Z6YA 3CB4A 4ZGWA 2IUYA 1AG9A 1ORDA 2WP8J 5ECGC 1XZQA 3I4LA 3U40A 1DGQA 2P78A 4J94A 3BRSA 5LR6A 3GDWA 5EC8A 1Q7CA 5E7MA 5IDQA 1KQPA 4MA0A 5IAKA 1WXEA 1A9YA 4MZXA 1TK2A 2FVXA 3E53A 3BT7A 3L9XA 1Y7LA 5ALLA 3V4SA 2ZS7A 3KSZO 1E9AA 3O4VA 2O23A 2ILVA 1ZSYA 4TVBA 3HPQA 5FOXA 1KY3A 3IKTA 4ARVA 3R74A 1XB2A 2GARA 4QGFA 4YRBA 4Z7JA 1ZW1A 1L5VA 3VV2A 1E5LA 3LWBA 3OD1A 1S3IA 1JPNA 4RSHA 3UENA 4UHDA 3LY9A 2EZTA 1W5EA 3C6ZA 3RRMA 1QX3A 3Q7QA 3LUFA 2QL6A 4I8DA 1QUEA 3PX7A 1WUHS 1JFSA 2P9GA 1GTMA 3Q10A 4FOOA 3WGIA 4X64B 5F51A 2WJZB 4A26A 2OYRA 4CKXA 1NQXA 4EHDA 4D4GA 2QBYB 1XAIA 2BGKA 1PZHA 2VNHA 3UA4A 4MJ7A 1QKJA 1AKQA 4CYMA 3TOXA 1ISGA 3D0RA 4M7PA 4C0SA 2YIDA 3GVXA 4PY2A 1YCGA 3TIVA 4TXLA 5HR5A 4D56A 4MV0A 1Z2AA 1ECBA 1SGWA 3R7NA 1K98A 4K6KA 3W9UA 1SVWA 3N70A 2PO5A 2Y77A 1F17A 3JQAA 4LNHA 1HA3A 1EP1B 3I9LA 4EKYA 5BUCA 2NGRA 3TJMA 3TNDA 4N6GA 5A04A 3MS7A 4JVLA 4L76A 3BTOA 3MFYA 4DCUA 4HADA 4I5GA 1VBMA 1ZKMA 1EU1A 5E3JA 2CDNA 4YWJA 3TOSA 3WYDA 4RPGA 5LOVA 1IUOA 2AFIA 2YY5A 1OFTA 3OOWA 5IUKC 1G6OA 3VOSA 4WBNA 4GOJA 4RHFA 3P4UA 2VJMA 1CJTC 3OPXA 4CEHB 5AM3A 1OZAA 5WRFA 1IXRC 4BO6A 1F8UA 2Y0BA 2H2HA 3T0FA 1DJQA 4ARSA 1S02A 5DI9A 1YA4A 4ARZA 1D2RA 2YBEA 3NHZA 4UCFA 3AFNA 3SBEA 4F0JA 3GPLA 5EPEA 4QEZA 1NYTA 3BMNB 4HPJB 3I5YA 3B48A 2YHBA 3JV7A 1EK1A 1NF8A 4LZAA 2PPLA 1Y8RA 1BOOA 4INZA 4H7IA 1M3SA 3CIFA 3SS8A 1FFDA 3H2JA 4ZZ2A 2AOUA 3AW9A 1THMA 4B3HA 3UMFA 5JCJA 2JAUA 2O2YA 3O74A 4TOIA 4XM0A 3LF2A 5DM60 3DBLB 2DQKA 2Q62A 4CKCA 3DV0B 3RQSA 1IN8A 2PH7A 1NF3A 5A5EA 2V1XA 1C30A 3MOGA 1P91A 2JLZA 5I9MA 3DHEA 5FAKA 4B2IA 1TYEB 1C50A 2XADA 4J0QA 1BMFA 4LXXA 2INGX 3GI1A 3GJQA 2GEKA 1FDIA 2IA5A 2BEUA 3B6KA 3PFIA 2B30A 5HMLA 2XNDA 4CHGA 4M0CA 4GL2A 1NG1A 2EW2A 2RGDA 2WFAA 2QE7D 3OCWA 2GM3A 4GR4A 1XZLA 2CNWD 4J90A 4Q3OA 3T06B 1CRPA 2PT5A 3OPYB 4XUGB 3CNEA 3D7SA 4MUBA 4D9EA 4P3PA 5BR1A 4LV5B 3DMNA 4XGQA 3GLUA 1LTQA 2EIXA 5DNUA 3L0ZA 5BWCA 3HBJA 4EB8A 2GPJA 2Z8YA 2E87A 3MFQA 4UOEA 1CRLA 1KQ3A 3C8DA 5FA8A 3DMRA 2C9CA 4TMTA 2IHBA 1ZOOA 2QL9A 4H4DA 1XTKA 2WYWA 4U9IS 4XEHA 3SFTA 3P32A 1N8NA 2JDIA 3MMPA 5JAHA 1U0RA 1Z6PA 3EBPA 1JBQA 1X1BA 3KOZA 1KI7A 3NOQA 1OU0A 3B89A 1WCWA 4JFAA 4ZHSA 4GMGA 2AYYA 1NNI1 4LISA 2A9JA 2NZXA 2IYPA 3M33A 1GQOA 1KYXA 3TQOA 4E7PA 3IQZA 4K0RA 3MAJA 3I73A 1DAGA 4JLJA 5AXBA 4FGZA 3RHZA 2ZI9A 4V1CA 3B7PA 5CFQA 1XD2A 4BRUA 4KFTA 1XVTA 2QD5A 3EXG2 4DARA 2IDJA 2UXBB 3LBAA 3CLKA 1NJ6A 2AOUB 4NDAA 3GRUA 1N9GB 1D6JA 3A1SA 1WUJS 2JHGA 2OZPA 4BIMA 1NP3A 5ADWA 1UK7A 1ZH6A 2HLPA 2WF9A 2YY6A 4LJ8A 4BU1A 1UFKA 3HDJA 4UBKA 4UTNA 3TPCA 3HXMA 3ZTWA 5EVJA 5BN5B 2GMWA 1OHHA 4GW3A 2FWRA 2RGUA 3LUDA 1IY9A 4H77A 4HPWA 4MWGA 5E7QA 4V0OA 4B47A 4ZI7F 3SZ3A 2PQMA 2EAUA 3DJYA 1KL7A 3UK7A 3JAWA 4E07A 5B1YA 5BSHA 4JENA 3E8XA 1NFFA 4BUZA 3KAKA 2REQA 1HYEA 1SCQA 1MJGM 3GMSA 1TYAE 4Y0VA 1OC2A 5IG2A 2ZRQA 3D6AA 3AJDA 4RADA 4Z1MD 1L8XA 3HKCB 5IKEA 1ZONA 2ACEA 2GCNA 5JD6A 2WTUA 1VPDA 3Q4GA 4NNPA 3LX6A 2G07A 1MT3A 2GCIA 3JZDA 3I6BA 4Z1MA 5JCXA 3PQ4A 4YIKA 3S68A 1N3LA 2Q0XA 2Q46A 3H9EO 2H1WA 4ZAVA 4R9UC 4YYEA 2DTXA 3KEOA 3AUJB 3MTIA 4AUMA 4F3NA 1JFTA 4ZP1A 3H1TA 4BVGA 1EVEA 4JC5A 2Z83A 4F2PA 1Y1PA 2E3JA 4PYQA 1RIFA 2PEYA 3K94A 2ZSIA 1XCPA 4Z9BA 5E8JA 4YRMA 4RENA 4GS5A 3B9PA 5IU6A 1C0EA 4UMEA 5E6SB 4JX9A 3K1JA 4G1VA 3DF7A 3L7AA 4HAOA 4C14A 4QOFA 1U1FA 5EIEA 1OKKD 3D5EA 3ZI7A 4C78A 3E22A 4GBJA 1LUAA 2AOTA 3NG1A 4GEKA 2JB9A 1AXEA 3HB4X 4IINA 4W5WA 3ED5A 5EKDA 5CT8A 4GYKA 3HRIA 1VLHA 5KJCA 5AT1A 4K9DA 1YB2A 2X7HA 4GX1A 5B7QA 4W5OA 3QXHA 1B8OA 1NXWA 1TUEA 4CM4B 1EP2B 1P7ZA 1POWA 1GQYA 4PONA 1E6MA 1Y1KE 3LXMA 3PVCA 4IIVA 4RQTA 1FYVA 5IN4A 4IOJA 3VR4D 1OTHA 2FMHA 1F8YA 5BW4A 4TYNA 4CMCA 2OOKA 1GQRA 4GDFA 3A6HA 5AOCA 1QHHA 4RHXA 3DTVA 3EIFA 4YMTA 1F0KA 2E9SA 4RPIA 1KMHA 1Q17A 4BBAA 2VP2A 2QT1A 1LI7A 3SR0A 4CKEB 1OZFA 3W3AH 4ENRA 5KINB 4I3FA 1RZRA 3CNOA 3S8YA 5C53B 1GRCA 1XA4A 2AH5A 3OEEA 2PX4A 4KREA 2DUWA 4S12A 2ODTX 3ZW7A 3BXEA 4ZV7A 4US2R 5D87A 3Q88A 3ZXSA 4R1QA 2WSYB 5JS8A 1J4AA 1C2TA 4YRRA 3AILA 2P4UA 3ICPA 1CNMA 2Z1MA 1CRZA 1C7FA 5FDFA 2P6RA 1C7ZA 3VUEA 2WMDA 3FM9A 4RGYA 4KWHA 4KUEA 5FBKA 1ANKA 1B00A 5HK8A 1W96A 4BC0A 4RGVA 1K8XB 3HMKA 3P27A 1KXJA 4GC5A 3EF0A 2ZBGA 1NVWQ 4G1MB 5FO0A 3DAHA 2GBCA 4CL0A 4GSKA 3DKKA 3J7AC 1VKJA 3HGTA 1F14A 1NUQA 3RBZA 1X1SA 1JXMA 3RS8A 1AMUA 3EMDA 5DEOA 2VT6A 4O3FA 1KK1A 1BZYA 3T1HB 1J8YF 3FRIA 3JALB 4RV9A 3OCYA 4TXJA 4JI4B 3UJ9A 1DLIA 3P2OA 2HHHB 3F6CA 2AR9A 1LRKA 2PJUA 2ZBUA 4WXHA 5DGTA 5TF0A 3SYLA 4CJXA 3KJGA 2C94A 3FSRA 2ATCA 4JITA 1Q6YA 4FWTA 1NDHA 4D9GA 2VPQA 3CH7A 3FBGA 1CHDA 2GD6A 3AVYA 3ILYA 3M8KA 1D2AA 2XUJA 2PT9A 3E9YA 1UMCB 1V35A 3GP5A 4RK6A 4H0CA 5K3FB 1VHLA 3ANXA 4EB6B 3IC5A 4RIGA 3GARA 2OFOA 4GPEA 3FDJA 4OCZA 4BMXA 4BU0A 4MIOA 4IHJA 2ZZNA 1N6OA 1S4QA 2QP4A 2NO1A 2I33A 5C35A 2GM4A 3ZIDA 4KR0A 1EB9A 3DLAA 1VGVA 5K99A 1DX6A 3CPHA 3MLAA 4TWBA 5HEKA 1U3DA 1CLEA 1QTIA 3FYUB 2ZK7A 2P67A 4Q1DA 4C0JA 1OAKA 5AJZA 3GT4A 1G2IA 1I10A 2CFIA 3ND5A 3FR7A 4D3DA 2O2XA 4DRXB 1JEYB 2OZKA 4G4SO 5DRTA 1PDVA 2DBYA 4L8WB 4D99A 2O0HA 1EXMA 1BXRA 1NMZA 4NYJQ 3R8FA 3TB4A 4HMPA 4QTTB 1RZRD 4WZBE 5AJUA 4H35A 1ZMBA 1NVTA 3K30A 1AHHA 4NCIA 4IGFA 1K7SN 1NW9B 2XXAA 2CJWA 3DKRA 1XDBA 3GRCA 4NI5A 5B55A 1CP2A 2HOQA 2W6CX 1XN4A 3SE7A 3WNCA 5HIKA 1TJNA 3QLEA 2LWIA 3CVXA 1QH9A 3L7OA 3X3HA 1HFWA 1P18A 2A5LA 3I30X 3R44A 2JC3A 3FI0A 2QPOA 1T2VA 2BM8A 4MRNA 5DOVA 1ZU5A 1Z6TA 1TQ6A 4AUKA 2C0CA 2FPUA 5BQPA 4MVJG 3M2PA 1N4DA 1EUZA 4D98A 3MJ4A 1P3Y1 2M6KA 1O3YA 2ETVA 4Y2SA 5B3JC 4OH1A 1PL8A 3VSCA 5AJYA 1JE1A 1G9XA 4F5WA 3IMEA 2IW1A 1OKKA 5CT5A 3VR5A 5ALRA 1BVYF 2H4ZA 3A1TA 4D9KA 2C7VA 1A96A 2OBYA 4O6VA 2OYSA 4KFRA 1VLLA 1CDZA 1XRJA 4N82A 3Q2IA 1FUUA 4PU0A 3PYLA 3I42A 5E1MA 3BD6A 1NBAA 3QU7A 3OX2A 4RS3A 2W6PA 3ASVA 3LDFA 4D3YA 1E61A 2P27A 3ASUA 2WIGA 1KO1A 1ZM9A 3FFXA 4X6LA 4YJ3A 3UMJA 1GGVA 5JWHA 4GD3Q 5K0BA 1WZEA 2QGFA 2QR5A 3CJTA 1HE5A 2R7AA 1MZVA 1YASA 3PZBA 3KQQA 3DYVA 3TINA 4BHTA 3DLHA 4RFVA 4R2IA 4H60A 3ET4A 4U00A 4G5RA 3X1JA 5SV2A 4UARA 5KDOA 3I39X 4BGIA 2GEJA 4Q48A 2XDQA 4O8CA 1F6BA 4X00A 1R0SA 4UTPA 5FNVF 1P9NA 1T4GA 1J09A 3VR5H 3IP6A 4NU6A 1JYSA 4ENTA 4A1FA 3T7IA 5I9LA 1EIWA 3OJWA 4ITUA 3WSTA 1P8JA 4IIYA 2JA1A 3CKKA 1SULA 3JD4A 5AW5A 2G4LA 4BQEA 4F8YA 521PA 3HXOA 4LX0A 1D9XA 2B94A 1Z0UA 1ACMA 5EUQB 3E3AA 2G80A 2PE5A 3H5OA 1NFQA 3BXHA 4BX8A 3IRUA 2DJ5A 3SXUA 3WWPA 4KWCA 3H4MA 1CQWA 4NATA 2HSZA 2C2XA 5ERXA 4JLVA 4C4YA 2FFHA 3DMYA 3ADOA 5E9WA 4TMWA 4L8FA 2CGEA 5L4SA 1QU3A 4PSKA 1DKUA 1MUUA 1ZU4A 2NVBA 1YI0A 4L75A 5TF4A 5JNSA 4LC9A 1BE1A 5LBIA 2IYLD 4KQCA 5K3BA 3ZDDA 5FLEX 1KY4A 3UV7A 1Z6ZA 4JA0A 2ONJA 2XWBF 4B7CA 4NNJA 1RBYA 1YCDA 1XL1A 2FW8A 4B44A 2VP5A 4AZ0B 3NHSA 4E33A 1SVLA 4KLAA 4RTMA 1WBDA 4OQDA 1O96B 1W0JD 3AL2A 3RG8A 1SB8A 4Q03A 3AR9A 1BMDA 2EG9A 4MVYA 3QVOA 3RBVA 5CB4A 5JQGF 3R6TA 3HXTA 4WBSA 5JLAA 3D4BA 5E3HA 3V1KA 1BGWA 1UBFA 1SHZA 3QUCA 2OHVA 5F7OA 4LDAA 4I6EA 2R2AA 2WJ6A 3THXA 2F00A 2HMYB 1WTCA 1GYRA 1ZSNA 3RNOA 3ZGYA 5HYVA 1JDBB 1TM2A 1C3JA 2JEOA 4U7JA 2COKA 1VCMA 3OQIA 4I81A 4M46A 3VKUA 5CDHA 3G17A 4IXTA 1OREA 1UMDB 4XSHA 1AS0A 4NFYA 2YJ3A 1T1IA 1BMFD 3KUDA 4ZXFA 5DXFA 3ZGZA 2O2HA 2G1JA 3H3FA 1TZ2A 5EE1A 5ILQA 1AA6A 3E1KA 4TS1A 3T94A 3VR0A 4AROA 3A10A 1ISHA 2Q2NA 1IJEA 3V4FA 1L4HA 4IHQA 5DTQA 1VMIA 1AUVA 3A27A 1OX5A 4EG0A 3EPRA 2V9PA 3HH8A 3I23A 3WKDA 3ZDRA 3W6NA 1GGJA 1V7CA 1MOQA 1L5FA 2X9LA 4IHJF 4HUTA 4FOTA 2QUIA 2I99A 3TYXA 3SLRA 4COOA 1E5XA 1YZHA 2XKJE 3IOYA 2YIMA 5G4KA 3QVGA 1N32B 3SXUB 1VECA 1VMAA 3HO1A 1SXJA 4JP5A 3HNOA 5F3RA 1II0A 1X2BA 4HD8A 4OBXA 3DO6A 2PZMA 4AJKA 1PW7A 3E6AA 2BFBA 1MABB 4NU5A 2AW5A 4R0VA 3SOZA 4C05A 3IAHA 1L4KA 3GFQA 4YJ3F 1GU0A 4HAXA 2PX0A 4PLCA 4M9SA 4TKZA 2FW7A 4CLRB 4IHKA 3CR8A 2H54A 4IIFA 1ADCA 3MBOA 1JDTA 1SG0A 4IIJA 4DLTA 1LLUA 1L1RA 2I3DA 5D6OA 1QFYA 4HNQA 1DRWA 3AOEA 3PNKA 3QTTA 1TC2A 3GPBA 1G7TA 3MCUA 5ARCA 4D44A 1FMJA 4QOGA 3AEUA 3LQFA 4PRKA 1M6HA 4WKPA 4RVSA 1JI0A 4GPIB 3EGDA 4DW8A 1SBIA 1PEDA 2QGZA 3V00A 1JLHA 1GNRA 4CM6A 2NT3A 3KQKA 3IBYA 2YWDA 1BFKA 1ELOA 4N40A 4PO3X 3EQ8A 1XYGA 1A50B 1OLSB 1C9NA 1SAYA 1SPXA 3H4VA 4NOJA 2R7LA 4OIFA 5IS2A 2J31A 4XAQA 2J5BA 3RQIA 1JHZA 2R47A 5FWXB 1X8XA 1EEHA 2X5NA 1V71A 4ERXA 4B3JA 4JYZA 4AKGA 2VJKA 4EJSA 1E0KA 1A8PA 2RKBA 1XJQA 3CVUA 3HKEB 1JDJA 1P0IA 2RGNC 3G0IA 3ZE7A 4F45A 3ONFA 1YVPA 4FMDF 3W04A 2D1RA 5AD1A 2EQBA 3EGCA 3IQWA 5EIOA 5J2UA 3EXIB 1XTTA 1O08A 3GOHA 4DC9A 2AGVA 2VIIA 1R8YA 2J87A 2M32A 2ZJ5A 4S1WA 1YTUA 3TKAA 3FUWA 3AJ8A 1PS8A 3OWOA 3E35A 3QOXA 1DJNA 4YRGA 1UBNA 4IILA 1IIRA 4Z99A 1DPFA 2FWIA 4EVQA 1GFZA 4HO1X 2B8TA 2LDXA 1V16A 3ZCRA 3AHHA 1RWVA 1E3WA 4H17A 4BKMA 1ODTC 3QX8A 1A95A 1CUEA 4DNOA 3K2BA 2AWOA 1VJRA 2QRHA 1RI1A 1G63A 2Z2XA 1SQSA 4HL6A 4NCHA 4P54A 3WWZA 3Q72A 3WICA 1R6AA 4AT1A 4L6AA 4A7PA 4LHEA 5A6SA 3FX2A 3RUFA 1IULA 4CF4A 5KTMA 5FPQA 8LDHA 1CJSA 1YE5A 2I54A 2EXXA 2IEYA 2BHLA 2PMBA 3LRTA 1CZNA 4I1VA 2ZR7A 4GSLA 4QPZA 3WIOA 1M2OA 1XZBA 5A3VA 1ESCA 1UBTS 3PGVA 1H6AA 4IO0A 4JI7B 3ZLBA 1F6WA 2G5TA 4GDMA 1PG5A 5SYMA 1UOEA 1B74A 3ZX5A 1K92A 4X6XA 1UBJS 1GPJA 1UJCA 2Y92A 3EG9A 4RF2A 1R5BA 3UM9A 1WY7A 1P1FA 4MLZA 3RH0A 2D8AA 2FWBA 1I5RA 3LUGA 1NX6A 5EJFA 3SZMA 4MVJI 1X7HA 3L6BA 4M0UA 2ZRLA 4J7CA 3RSLA 5BSVA 3C1UA 3R0XA 5FWXA 4P81A 4S1VA 2DSNA 3RVMA 3U7QB 1HV8A 1B6GA 4TLBA 4DM3A 3GIWA 4CTMA 1RWBA 1V1MA 4RIEA 1QQ5A 2JFUA 4C7BA 2C00A 1G4HA 1UJNA 3WFIA 3KKKA 2Z5FA 3RSQA 2QM3A 3RFXA 2Z2KA 1XDGA 4PXYA 3IHKA 1ZFNA 2VTDA 3S6JA 4HXGA 4KHZA 4NARA 2W2PA 4I19A 1AD2A 4OYRA 3ZW8A 4BLWA 3T1QA 5I9IA 3HYNA 5K9ZA 1NNEA 4RFSA 5EJGA 3OIUA 2PJZA 5FTJA 3R5FA 5KNBH 3NVKI 5AJHA 2FMFA 2I8CA 4ZC1A 2HV8A 2F43B 1A8QA 1EX9A 5ALNA 3L1JA 4JNCA 2Q9AA 3GD5A 4FQ7A 2VTBB 1SHTX 1A1VA 3IV9A 3R3HA 3BF8A 2KQUA 1RFLA 3BIWA 4GZ5A 4KQEA 5U4XA 1Y3HA 3T9AA 2CNNA 1IFXA 5KCZA 4RK5A 4GLOA 1VJ1A 4KRGA 4OJNA 2I2AA 3S5JA 3SF8A 4CPDA 1YRAA 2I2XB 3D6HA 4FGSA 3FKQA 2PV0A 5TEWA 4W5HA 3OM8A 2P9FA 1K3FA 1L4UA 3GGPA 4AI6A 1ZN8A 4RQBA 3WXMA 4XWWA 1X39A 5FV7A 1O0BA 3U4AA 5KOHA 2DBZA 1CIVA 2F9LA 2HCTA 3T38A 4A0HA 1C41A 1NPYA 2GJ9A 3HA5A 5HF6A 2UVPA 5AOAA 4IDCA 5F35A 4MQEB 4RTLA 5FT9A 2DHDA 2B21A 2Q49A 1ZD1A 2VZEA 1WDTA 3A0UA 3F8SA 1MIHA 3IH5A 3OWHA 4JWKA 1PR1A 2BRUA 5FQNA 1PQWA 2GBGA 3EQZA 1PV1A 4L4RA 3ZNPA 1DC7A 1FIUA 2K7ZA 3TLKA 2G67A 3H2HA 4GPAA 2ZIXA 1V1MB 1IK6A 2PU7A 4BNDB 4RW0A 3C3JA 2BHRA 4HEJA 4M83A 5P8WA 4PGAA 5EXDA 2OENG 1U11A 3I1FA 3ZE0B 1VG9B 2HU7A 2HQSA 4BEBA 2RGRA 1ZEMA 1GPMA 3LX5A 5AUQA 3PC8A 1FDTA 2O8BA 2ACWA 2FPIB 2J0SA 2OO3A 3A2KA 3WR5A 4F4UA 1B8UA 3K15A 1KYWA 3TB6A 5CRIA 2BM0A 4WCFB 4DRXA 5HFNA 4WUVA 3TG2A 2DEUA 3HE3A 3QBEA 2QORA 3PX2A 2CL6X 1RJFA 2J9ZB 3O9VA 2XEXA 3NUQA 2BGNA 1Y5MA 2GN0A 1UJMA 4YO7A 2X7XA 2ZKIA 5EWLB 5LLTA 1WW2A 3ZVNA 2BFDA 2MSLA 4O8ZA 1PK7A 2GPBA 2NX2A 4MULA 4UTZA 4XR4A 4ZVLA 1AU9A 2Y2UA 3QMVA 4TN5A 4JA2A 1PT8A 3D6JA 3QLUA 4YCAA 3HMQA 3T7KA 4QJ4A 3LWDA 4EL5A 3T4PA 5L51A 3L5KA 3H86A 5IABA 3DYIA 4NS4A 1VBNA 4DYVA 5I4CA 1ZK0A 3K31A 2FPOA 4MV7A 5AUNB 3F74A 2HW8A 1QANA 1GQFA 3GLHE 3LYLA 4WECA 1U80A 2BCJQ 1S2IA 3OLQA 4FR0A 4PIMA 2XVXA 1HK7A 4MKZA 2YQ5A 1EUDA 1EXNA 1GPAA 3E18A 4HQNA 4OHKA 4MQEA 4NENA 1VI5A 4AFNA 3ZCVA 1T26A 3W9BA 4C7MA 2JK1A 2LKCA 2ZSUA 3O92A 3T6KA 3HB9A 4CM7A 2AFIB 3ZDBA 1EUQA 1ULAA 3CUSA 2C9BA 3F9CA 2O7SA 3OPMA 4X3CA 4D97A 1Q0UA 1N7JA 1IZ7A 3ZEIA 2BR5A 4AY3A 2Q5OA 2VAPA 2GEDA 1JB9A 5ELMA 3Q0IA 1TW3A 4P3NA 4QO8A 4IG4A 4V02A 4LJLA 4ZRDA 2A0XA 3IQIX 4KSYA 1CZKA 4PQEA 4DJJA 3E5RA 4A2CA 4NECA 4DMHA 4Q12A 8ATCA 1E4VA 2K6GA 3P0IA 4KE9A 3IVGA 2ZYHA 3FPGA 4KK4A 4QELA 3WAKA 4FB5A 1ZI8A 3NW9A 5KTOA 4CV0A 1I7DA 5EKXA 1P1IA 2ZAIA 1RAAA 1N78A 3ICEA 1NM5A 2QV0A 1TECE 1JHAA 5LJLA 3EODA 1ULTA 5A4JA 5CTJA 3ZKWB 3GNQA 4K6MA 3U44A 1G4AE 5I9TA 3DWGA 4K9QA 2C4NA 1C9EA 2PX2A 1W0JA 4QDJA 3UPUA 1PFWA 3JZMA 3QGMA 1Q1BA 3CC8A 3QI2A 4ITRC 4R7ZA 4ZVOA 1FX0B 2H31A 2G6BA 2VZ8A 2YC4C 3L6OO 3NU1A 3P9KA 3AI3A 1N0WA 2FWMX 3FZQA 3D7RA 5BWBA 2V65A 3GFSA 4CEJB 4YK7A 4RO0A 5CUQA 1KERA 3UJAA 1QWOA 1S3FA 2WDZA 3FYCA 2DPYA 3ENWA 1MX3A 1KNQA 1KU6A 3LVBA 4JQYA 5TRTA 4BGEA 5JBQA 3LQ1A 4J49A 5CXXA 3P7MA 4MPDA 1HM5A 3SMVA 2B37A 2QVYX 4BYMA 4AX8A 4KP7A 5CIQA 1SWVA 3W7VA 5BVHB 4LKRA 5CDUA 2NXEA 5B30A 1NXVA 1Y4SA 2AR7A 2Z8XA 3FAKA 2IZ5A 3MG9A 4U7HA 3NT4A 5B1EA 5KTTA 1ZXBA 1TCCA 2D2FA 3ONVA 2ZSKA 1G3UA 2EP7A 3AJAA 4F5ZA 5I6DA 5FOVA 4BNJA 4L4UA 4ZZIA 2ZANA 4IPTA 3WRXA 5BQ3A 2QVCA 3V8VA 3U6BA 1LWOA 3NOXA 1WP9A 4J43A 1TYCA 1VE7A 1WE2A 4QUDA 4UEOA 3LUAA 5DASA 2Y1KA 4DM7A 4PAGA 1E9EA 4M1YA 4Y1RA 2ODPA 1US8A 5HS4A 3G9UA 1E9RA 1HTWA 4KOEC 5K6AC 4BQOA 1TCBA 2VP3A 3DEKA 1WZ2A 2I3ZA 4H7KA 4QOHA 5GINE 3FYSA 3F90A 2FPGA 1UFVA 4TLEA 1FLNA 4J2TA 4G84A 2GK7A 3ZHVA 3IKLA 3THSA 2H5LA 2IH2A 2R9VA 4M9ZA 4QUGA 4U8HA 3ANSA 4WSOA 4XUEA 2YYAA 1RWWA 4HDAA 4LOJA 5EZQA 3H18A 5KU7A 4EL0A 1UJ5A 2QY9A 1FY2A 2DY1A 4XM1A 2OYCA 3ISVA 1V5FA 2HREA 2GCEA 5BV7A 2NO9A 3QSYA 2OHOA 1FX0A 1K8ZB 1P0MA 1T5IA 2JGDB 4O0LA 5TGDA 3UT6A 2VQEB 2DLCX 3DB1A 4HN4B 4B3IA 3NKVA 5FI3A 5ULLA 4YRZA 1AMOA 4JSYA 4EPVA 2GH1A 2AHOA 4ZO7A 1T8WA 1U99A 3R3YA 3DR5A 2X5KO 4IDEA 2PSHA 4F9FA 3C4VA 2FE4A 1QF7A 1U2DA 2P68A 4FNAA 2Q6OA 2R6HA 1Z07A 1UAYA 3JASA 2KS6A 3PP8A 1GUDA 4BNGA 1P2DA 3SHOA 4UHJA 1NKSA 4NBUA 1M1NA 1REQA 3IAAA 5ILGA 3T3MB 2C1EA 2GBLA 2HJSA 2JAHA 3AC0A 3W8NA 4AL4A 4DCTA 4BVLA 2OXEA 1WIWA 7ADHA 4MIKA 3R9WA 1M34A 4PANA 1O87A 1X7GA 3OTIA 1KJNA 1KZ6A 1LSJA 4D9JA 3LRXA 1E2NA 2C3MA 3BQNB 4WV3A 1CBUA 4XX1A 5B57C 5KNBA 4HBGA 4KFSA 5B1IA 3KEQA 2V74B 4Z0HO 1FS4A 4O2AB 2IHNA 3U3JA 3UOWA 3OQ1A 2AC4A 3T0IA 5EESA 1IOVA 3FZNA 4WKGA 2PMEA 2XMBA 3NP9A 4QQKA 1KF0A 2QTTA 5B58C 1Q21A 4QU8A 4K5QA 4U3JB 2ZKLA 4NMLA 4G0YA 4CQJA 4ISCA 4HDCA 3K5PA 5GP1A 1QHHB 5SYNA 4K0KB 3QKIA 5DKFA 2JATA 1J2JA 1TA4A 2YICA 2QAGC 4OHUA 5DV9A 1XWWA 3RS7A 4A23A 3BWMA 3PWSA 1I2MA 3PDJA 3AUYA 5BNFA 1QAOA 2EBWA 3ZUPA 2A9VA 2XRMA 1KPHA 4FCCA 1G5PA 4G86A 5IDVA 4UAGA 3NT2A 4X1KA 1KHTA 2ATXA 4UAUA 3QPWA 5JZVA 3LKDA 3FOCA 5TQ0A 3ZCTA 2CXSA 3A2LA 4M1ZA 3HA3A 1T13A 3EAQA 1WQ3A 4RA6A 3RK1A 4BBJA 5K51A 2FE1A 2XE7A 2C4HA 1Z5WA 3JASB 2IZOA 5GM2A 2XWJI 1JR3D 3LE8A 4ZOBA 3SU8A 1QHNA 1WUIS 3BZBA 1QOQB 4KDRA 4EA8A 3GT3A 1PL7A 4UPEA 5KVCA 1PNVA 3KQYA 3N7TA 4O2BA 3C5CA 1ZIPA 3ASZA 3EDYA 3VMFA 3O4RA 2QTHA 1Q7TA 4RSMA 2W0SA 4RF3A 4L5JA 3L6CA 2I65A 3UAVA 3GLRA 1KYIA 2QTMA 3C3MA 5M2QA 5G40A 1KEKA 4KPFC 2Q7XA 3ET5A 4E2ZA 1N6HA 2J67A 2PUWA 2C2ZA 5J5VA 3TSOA 5K8CA 4FHFA 1DTEA 1VCOA 3LOUA 5KVVA 3IDSA 1L7BA 3UUWA 4MVJF 3P2EA 5LIRA 1VHQA 3L79A 2BRUC 2JCGA 4WAUA 4E08A 4BX0A 4HT3B 2HA7A 2J07A 1NONA 1VXOA 1E77A 3CVJA 4XTCS 6AT1A 3ZYCA 3BN3A 4ZU1X 2GT1A 2EKZA 2PWYA 4IFTA 5A5DA 1TLFA 1NMQA 4RVNA 4YACA 1R4AA 1ZNWA 3HGMA 3CH6A 3IR5A 5FNVB 4EWLA 3M4XA 2CL0X 3NBMA 2R1VB 1HSZA 2ZJ0A 4K6HA 4UPVA 1S8AA 1KP2A 2J0VA 2A8YA 2JANA 3HBAA 2ACKA 4MEAA 5KYUB 1SVUA 5BYAA 1YDEA 4EF4A 3P9PA 5I7VA 2HA0A 2HFKA 3EPKA 1IWPB 1W52X 3PFGA 1M1YA 1H4SA 1ZLYA 2JEZA 4BZPA 3ESRA 4KO3S 1ZJ4A 3L7LA 2BGGA 3T3OA 4JLAA 5LU9A 2WQ7A 2GERA 2C78A 4UFNA 2WFZA 3EK2A 3VR1A 2HLHA 5FLXA 2X9VA 3RFCA 3FKSA 2XQFA 4N5MA 5C5EA 2O19A 4I1RA 1JIQA 1H4VB 2ZTSA 4HVAA 1TGVA 4RC9A 5CX4A 4DPMA 4UXHA 2QW0X 1PI3A 1JKFA 4EF6A 3IOBA 2BGMA 4MJLA 5KNDD 5TMDA 5I5GA 4CUKA 5CA1A 4ER5A 4YFVA 1R4MB 4WZBB 4DLLA 5CFMA 4K03A 3ZNOA 4L5IA 4M3NA 3IHTA 4B7ZA 1B73A 2W2LD 1HDOA 2LXNA 3B5EA 3PTZA 4RXMA 2GKGA 1JVSA 1GGHA 3ZTYA 3LTEA 2IUEA 4MARA 3EH2A 4OQFA 3K6RA 3S2ZA 5JMTA 3S8EA 4XOIA 1VP3A 3M6LA 4PQYA 3LBNA 1OWNA 1XQVA 4ZYZA 4HNVA 2PZKA 3CF0A 1BN7A 3E7WA 4B3FX 3LMKA 3LQKA 4O5OA 2HR1A 4HN9A 4IZHA 2UUAB 2RJNA 4UM5A 1D4AA 5I7AA 1ZVQA 4CM4A 4IUYA 1QYWA 5C9ZA 4ICIA 4F3CA 3N2ZB 1S3GA 2NZUG 1V25A 2ZREA 2R84A 2VUUA 4FBMA 1C8VB 4XQGA 4P0TA 3IDZA 1M2KA 1R4NB 4L6IA 4BFXA 4RWZA 5JAUA 4M1QA 3V4PB 3QF4B 2E6KA 4F91B 3V1TC 1BWQA 3NFYA 3T9CA 2CEKA 3R20A 4Y2XA 3QWFA 4ZOCA 4HDKB 1O58A 3IIEA 4YRJA 1T9DA 2HSEA 3BM5A 4IH4A 3N8HA 3ZWWA 4NXMB 4J1QA 1K2WA 2V5AA 3PE4A 2N0SA 4XVQA 4AY6A 1ZGAA 2V8BA 2W93A 4LZPA 3KKOA 5F1YA 2P7HA 1WL8A 4EYQA 4IY1A 1EM6A 1MC8A 4EUSA 1OGJA 3FDZA 3BFJA 2B8NA 4JJGA 1BHJA 5LWHA 4JB2A 5T3YA 3HB0A 2JFXA 1EAMA 2OK8A 3SMQA 1GDDA 4AJNA 1SWWA 3DVSX 1KWGA 5CA1F 5AHOA 1XKTA 3OI7A 4QZVA 5M04A 4QATA 5JY6A 4LE0A 4BS9A 2ZROA 5CA1B 3ADPA 4LCBA 2P7IA 2WKSA 1UDWA 4XSVA 2XZLA 5CFNA 1O95A 4PXAA 4I50A 3U37A 1GEGA 5TQ2B 4TTPA 4C5BA 1MV5A 3RU7A 3R23A 1WD7A 4JLUA 4O4IA 5AHWA 4EJ6A 5AW1A 2Z6QA 2GK6A 4PLHA 3OY7A 3UCXA 3ZGLA 1FE8A 2VI5A 4MMYB 3K96A 4W6ZA 1XVIA 4I0WB 2GBIA 2EG5A 1DFHA 4EKGA 1M5RA 2XTZA 3DCJA 2VCHA 3QKRB 4JUAA 1Q7RA 1I24A 2BBTA 2OAGA 3OJ0A 3OECA 1GU1A 4BN5A 2B7BA 1PTJC 4NP6A 2OSBA 3IFSA 2R5FA 4TV8B 3DKVA 4HB0A 4OOEA 1R4NA 5G0VA 1QHYA 3IP7A 1XMIA 3Q7SA 4H15A 4XPIB 3D54D 2NO6A 3FPLA 1HNNA 1BN6A 3QF4A 1MG0A 2AZMA 2OQRA 4K9RA 3VPDA 3AUUA 1VSQA 3B9QA 3GYBA 1DWUA 4BKRA 2P11A 4IHJB 2ZAYA 4BWYA 2WTXA 4ND2A 4DMLA 1A7KA 3WLSA 2Y67A 2W2VA 3JRWA 3F9IA 2HK6A 4P08A 3DNFA 4HDMA 4CV1A 1AHPA 3AM3A 3EMVA 4DIDA 2WWIA 5FBWB 2QHXA 2QMYA 2YZ7A 3W8EA 5KEIA 1G19A 4E2FA 3SQXA 3CF6R 1RS0A 3C48A 2H6EA 4JI0B 1YQTA 4KAFA 5DWDA 5LBTA 3U7JA 5K0FA 2F9FA 5JJBA 3RKRA 2QROA 5J4KA 2CJFA 1Y9JA 2ZBEA 5SZJA 4RD3A 1MLDA 2YV1A 3LO8A 5FORA 3SEQA 2HTFA 4NF2A 4ARAA 1LLQA 3VUFA 1LBTA 5JTTA 3ETEA 2WPDA 2ZIGA 3IVMA 3UWOA 3JTMA 3UG6A 1UIRA 4GI5A 4FP9A 3WNQA 1NUPA 5JZSA 5ISMA 2JIDA 2HSDA 1ZHOA 1Q74A 3I9V6 2JCVA 1YZVA 3RGWS 4FBGA 1BQEA 1JKMA 3GW8A 1PV4A 5KNDA 5KVSA 3HSKA 2JH8A 1CULC 2CCKA 1YDWA 1V5IA 4IMRA 4LSGA 4W1SA 4EYSA 5BPHA 3V2GA 3EQ9A 3PF9A 4I9HA 3NHKA 4W7SA 3ZLVA 1PJCA 3GLHA 3LZDA 1PFYA 4RD6A 2WI8A 4TWZA 1DJOA 4L9WA 4L51A 4CIVA 1M72A 3VPHA 2R8EA 1HTTA 3DQZA 3QLJA 1DG9A 4MWZA 3OE7D 4P4SB 3ZWKA 4DNQA 5DYIA 2PCJA 2R8BA 3TPZA 3V80A 3AIOA 2F1OA 4MTCA 1XHEA 4JLPA 4YAWA 3OQPA 2XMZA 5DF1A 1EDBA 3ZD7A 4FMDB 5ALMA 4CM1A 5HP4A 1NUSA 2Z57A 3SM3A 4ALIA 1FLAA 2V97A 4F97A 1UC8A 3LUBA 3OEHA 3R3XA 5K3AA 4NEGA 1P2VA 3DQQA 3D6NB 2WE8A 2Q3HA 3SQLA 3AMVA 3K70D 4L5BA 3HEBA 4NXNB 1E2QA 4QT0A 1I36A 3O8LA 1F7UA 1QIKA 4DBLC 3K4QA 3TRIA 5ALEA 5DPMA 4GEGA 2Y68A 1SIOA 3CLRD 1QS0A 2GJ8A 4R8LA 2W0MA 3OF5A 4TL6A 4F5YA 5JSZA 1KTVA 1XBTA 3UMGA 1XLTA 1LJUA 1Z15A 3FFAA 2KMLA 2O6HA 3AM1A 1WB4A 2NP6A 4D8VA 1FP4B 5HOQA 1G98A 2B4KA 2GVDC 3VGPA 2ZU6A 1TCVA 2A4MA 3HKEA 1NVXQ 1T6ZA 2B98A 5HKBA 1CNFA 2H7XA 2IE0A 2IPNA 2P41A 2ROQA 4MHSA 2P0YA 4E1BA 3KELA 2GLUA 2Z6UA 2WSLA 2YL2A 5KOIA 3V8NA 4DA7A 1H2WA 2FSSA 3QWAA 4AWXA 1WQ1R 2ZGVA 4O1MA 2BPOA 4ZQCB 2P65A 3CZ5A 3DHYA 1THZA 5KKCA 3BGOS 3P96A 2XCRB 1OJ7A 1EJ0A 2B1RA 3BK7A 2DHQA 3TSWA 1VL8A 3VISA 4YMGA 1VG0B 1IJBA 1XXLA 4QYTA 1YCHA 4WNAA 4YCDA 5HF5A 4F6LA 2DFDA 2J3KA 1UAGA 2HWKA 2I4MA 1FPMA 2SCUB 3C24A 4GR9A 4KSCA 5DLYA 1GYQA 1T36B 1YONA 4FGJA 3CLSD 1EGQA 1E58A 1HKUA 1KJ8A 2QOEA 3IERA 3OZDA 1QB8A 4O5AA 4P4SA 3TEFA 5BV2P 4HDSA 3KZ1E 4C2BA 1PX2A 4Q9JA 1IAQA 2RGAA 4C08A 5L40A 1JR4A 3V32A 3U19A 1Z56C 1QGYA 2IGTA 3ELYA 3FYHA 5HCUA 1PS9A 1TKBA 5C1IA 4B3BA 2W8ZA 3I9OA 4TROA 4YDRA 5PGMA 2R3SA 2TYSB 3CLUD 3O7MA 3USES 3ZWPA 2X41A 4UTRA 3H0KA 5FWNA 3JQGB 1EK2A 3JCZA 4QPCA 3QHAA 3GXBA 3U3OA 2OC4A 2CHFA 4KG7A 1G66A 4GHWA 5AM4A 3TRDA 4D8UA 1FQWA 3ZW9A 5KCMA 2HJHA 4B2PA 5C1PA 3RYHB 4ZZ3A 4KDEA 2YYYA 3CKMA 2BY4A 1JF8A 2QG6A 1JG2A 3H1GA 4YECA 5H5JA 3ZDZB 4PZYA 2Z9BA 2GNPA 3ZCPA 4AG6A 4ER6A 5K3SA 3Q3IA 4BV3A 4F8JA 1GJRA 3DV9A 2BF4A 3OM0A 3Q1KA 4QNNA 3T7AA 4BFCA 1W2WB 3RBAA 1RPJA 2VJOA 5T5QA 3O31A 2PA0A 2AJBA 2X3FA 1E1NA 1BDBA 3DEYX 3PL5A 4PYLA 4QE3A 2VRCD 2W71A 1Q19A 2RE8A 1LJLA 1DKQA 1NBWB 1L8QA 2QVLA 3M1AA 3M6FA 4OMDA 3OX3A 1DCFA 1KRHA 2PL9A 3PUJA 1J06A 4Z51A 5KPJA 1UADA 2ZRPA 4W99A 1Z22A 4EUEA 4JOBA 1TUBA 2VYQA 2FWAA 2D54A 1QLWA 1R0BA 3M83A 1E8MA 1I3MA 4H3HB 4C6TB 4IS3A 5ENVA 3RNLA 5ERYA 2YMLA 3DKIA 3WX0A 2NSLA 4FKBA 1GCGA 2XEDA 1ONSA 3BWDD 1QKIA 1V8FA 4V0NA 2VUIB 3BB4A 1F8GA 5BN4B 4CU5A 3QFHA 5AO9A 3RO7A 1GKKA 3EXAA 3MIIA 3K0HA 3PRKE 4D57A 5K0GA 4CVNA 1HT2E 2VTBA 4L8YA 1KY5A 5DVZA 3AFIA 4NWIA 5LXTF 1TFUA 3DZKA 4FBLA 4D7AA 2GLTA 3L8YA 1I2ZA 2D2EA 4CEIA 3VKWA 5ITSA 5AJTA 1K89A 3O8DA 2J7KA 3TD2A 3UYKA 4UM9B 3FPHA 1V26A 3Q9UA 3UHAA 3RADC 4JEHA 5F64A 1QC5B 2QAGA 3GJYA 3QMWA 2IH4A 1SBTA 2QG9A 5TT0A 3R7SA 3BCRA 1NJ5A 4PC3A 4N8EA 2GN6A 2OHGA 1R0XA 3LD9A 3MUEA 5DRYA 4ZIRB 1L5QA 5FA6A 5KOYA 1E7WA 1P61B 5A4MS 2XUFA 5LC1A 2CVFA 1U2GA 4IJVA 4I1PA 1HX7A 5UKDA 1RYMA 5DSXA 1X1TA 2AE1A 3X44A 2WYOA 5GAJA 3CKLA 5GM1A 2VFAA 3LG2A 1Y33E 1L5WA 1PK8A 3MLEA 4OK3A 3G2HA 1T4BA 2VATA 3BCUA 4OAPA 3B3QA 2IV7A 2O0KA 2O52A 3DE5X 2O07A 4WXEA 4Y9TA 4ZO4A 5BMVA 4JR0A 5LZ5A 2NZYA 4HRYA 2PUCA 5H3CA 4OYHA 1OJLA 3FHTA 2UDPA 2FF5A 4RAQA 1KARA 4AZ3B 1UXOA 4QTYA 1SIBE 2VH1A 4GPZA 3JATA 2QRZA 3VOAA 3O8RA 2C7GA 4DRYA 1W0KD 4QYMA 1YDGA 3ZY2A 1MJ5A 1U3UA 1J9GA 2QRVB 4ZVUA 2I9KA 1P29A 2VAVA 4YUZA 2VH2A 4KOAA 4RXUA 3WTBA 1AKNA 4RPJA 4WADA 2V54A 2G1AA 1JHOA 1YFJA 4W5NA 3AEQA 3G2NA 1NVGA 1HWYA 3RTBA 4DV7B 1V4VA 1SHKA 1EPUA 1MD9A 1E3WB 1GLGA 2KPOA 2TMGA 4E94A 4O4JA 3UHPA 4NEHB 2C29D 5IZCC 3ZD8A 4I7EA 2I7DA 2B1IA 1Z82A 3EZYA 4G0PA 3DE0X 4H3SA 5CXQA 3WAGA 3FZGA 5IARA 4DLVA 3ZDXB 3GPCA 3GGOA 3LKBA 4WASA 1PJLA 1TD9A 1Y4DE 2UZ4A 2IYSA 3AUSA 5BNIA 2QUZA 4JYAB 1JHQA 3UW3A 3OT4A 1H22A 3H2IA 3RREA 3OVMA 2CNWA 5EQDA 5JJ5A 3DSRA 4L3OA 3K20A 4Q9NA 2XNDD 4MWSA 1SUEA 4OO3A 4RUKA 5D00A 4OI1A 1EVQA 4KYIB 5BWMA 1LF0A 3RJZA 3AESA 2H00A 3CZCA 3Q7PA 4M21A 5BW5A 1Z0IA 3I4FA 3PNLA 4JX8A 4OJQA 5GOZA 4D74A 2F3UA 5TEVA 1UKEA 2C5BA 3VNBA 4IUDS 1E32A 1FXWF 5CNJA 4TYWA 2XUDA 4UQLA 3K73O 3QH4A 1YNOA 2C2HA 4M60A 4L6CA 4MQ4A 5F52A 1NBMD 1NOKA 4F85A 2F8TA 4OREX 4LHWA 3VDMA 1XPOA 2NTVA 5H70A 3LNTA 4WLUA 4A6PA 4CLHA 4PO1A 3MWGA 1N5KA 1Z08A 3DLCA 1T3HA 2G9VA 2WUWE 1O2DA 1WPQA 2IOHA 4KBYA 3VQTA 3SHVA 1PFGA 3HYTA 1EVIA 2OKGA 4K6FA 5B2FA 1K88A 2PGNA 1YXMA 4GG1A 1RTTA 4OQMA 4R1OA 4ZREA 1FDRA 2IXEA 3U4IA 1WW3A 4IDBA 5CNIA 4BMOB 2Q3MA 4ZEWA 1HQDA 2WTAA 3RLFA 4KCGA 2I80A 2Q07A 3MCZA 4P83A 1SXHA 2ECQA 2J9RA 4C4RA 1FJ2A 1TADA 2R6GA 3IP9A 3BMCA 3Q6NA 5YASA 2F1JA 3UH1A 1Z36A 4DIMA 4F7WA 2QBYA 3LT1A 3ZYZA 4GKAA 1AK2A 2IOYA 2ZDGA 3ISTA 2VZ0A 1Y7IA 1YRQA 3SHWA 2GM5A 2Y2VA 3DAPA 4IM7A 4ZGBA 3A1UA 4OGLA 1W73A 4BMYA 3ICWA 4LJAA 2EJVA 3NORA 4PFJA 4V24A 4BMSA 3VJLA 3AXTA 1KEUA 1BVHA 1JQKA 4PCLA 4IO1A 4R9NA 4UJ5A 1J33A 5FFMA 3THOA 2PUHA 2EYQA 3T1VA 3FSJX 5FLYA 3RIYA 1HDGO 2CHUA 2WIKA 1VSTA 2VHTA 1N2XA 2P35A 1PR5A 1CKEA 1SOVA 1XKXA 2QN9A 4GT1A 4MSUA 4MGHA 4S2EA 2AUNA 4BVHA 3B8HA 3DA8A 3GLSA 3DB2A 1L5RA 3ENQA 2RARA 1ISPA 1LPOA 2XGSA 3DYBA 3MJDA 4YAJA 3SYMA 4EDHA 5K4HA 4CLDA 2ZRNA 4DV5B 1OX6A 3ABSB 2NUTA 4EB0A 2VWGA 5T4EA 3WRYA 2XRFA 3NHJA 1GQQA 1WDMA 3TLJA 1Q44A 1YZLA 2FW9A 2JBHA 5JALA 5LQNA 2ZUFA 2OA0A 4S1TA 1YMUA 4X41A 2ZRAA 2VL7A 3C3EA 3ESBA 5BSMA 3T7DA 3IE1A 3KHTA 3I2YX 4I99A 4RXTA 4XWAA 3SJAA 1T4MA 1N2CA 5D1HA 4ZAXA 1PVVA 3RJ9A 3UANA 1R6TA 2H2DA 5GONF 5K8LA 2BWJA 2HA5A 2YC2C 4IQ0A 4EJFA 2GLXA 4XUCA 4Z7NB 3L1IA 4JR2A 5LP6F 2KM1A 1U4NA 3ZHOA 2VPZA 4ZHQA 2PH1A 4ZKEA 4KNYA 4QGBA 3EZNA 4DY4A 1RI2A 1XZFA 1AUXA 4NZYA 1PAUA 4XJVA 3NAGA 3P9NA 1R6VA 3VGJA 2B9EA 5GV7A 1YGYA 2AJCA 1S8OA 3AIIA 5D7NA 1U5BA 1H4QA 1UOPA 4EBFA 2VYNA 3NPAA 4H3KB 2D5AA 3IS3A 3AF0A 1FQOA 4HNAB 3SHFA 1SXIA 4NCJA 2J0UA 4QFBA 4MAAA 1X80A 3KE8A 1Y3CE 3S2YA 4EA9A 1C1DB 3R2JA 5LQDA 2O7QA 3DOIA 5E6RA 1YF3A 1WB9A 2C7OA 3ZQ4A 3B5JA 3QI7A 5AVTA 4KVZA 4DF3A 4KNVA 1OLUA 1PR2A 1OLOA 4GOXA 2ZJ1A 5AKIA 1L4EA 1T9CA 2Y93A 2I4IA 3IESA 3KWMA 2JAXA 1OIVA 1VKRA 4GPD1 4R84A 5F1OA 5U4QA 2FWPA 3VH1A 2AZTA 2F62A 2YFYA 2QM8A 3WLRA 4BCDA 1PZNA 3KV3O 3X1KA 4HNHA 4DDWA 2ZXUA 3FWKA 1D09A 3MJSA 4R6XA 1M34B 2N42A 1P9WA 1W4AA 5FRDA 3ZTTA 1T0PA 1KFBB 1QIEA 1F6DA 1R64A 2ID7A 4X65B 1VPTA 1JWBB 2GUGA 4AXXA 1IMJA 3ONWA 1ZMRA 3GVIA 2BEKA 4RD2A 5KWSA 3Q7EA 1TDJA 2C8VA 2ZUCA 4KGXA 2EGUA 1SVOA 4QDOA 4N5HX 1WDKA 1CB0A 3SVLA 1BE8A 1Y9ZA 3F7NA 3PGMA 4TKVA 2Q1YA 1X70A 3PSHA 5DGIA 1XDZA 4P2GA 3AX6A 4H2DA 5IYZA 3SOPA 1QZXA 4BVJA 4Z4GA 3PQFA 5HZHA 2G71A 1RQNA 2WF7A<