4RK4A

Crystal structure of laci family transcriptional regulator from lactobacillus casei, target efi-512911, with bound glucose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
275
structure length
270
Chain Sequence
b'TGNIGVLVSRVTNPFFAGLFDAIERELHAHGYQVMITQTYDDPEAEERFLKQLKSRELDGVILASVEAPDRVMAVAKAFPGRVVVVNADVQIPGATSLVLPHYQATRDALDYLFNQGHRRFAYVSGGTISGAHHGQSRTQAFLDFMQAHQLLVAQDLLFGQIHTAKEGQAVGKQLASLAPNVRPDAVFTNSDEVAVGVIDSLLAADVKVPDDIAVMGYDDQPFAPFAKIPLTTVHQPVASMAAAATHELLKGLGRQVAQLHLSLKIRQSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LacI family
molecule tags Transcription regulator
source organism Lactobacillus casei atcc 334
publication title Crystal Structure of LacI Transcriptional Regulator Lsei_2103 from Lactobacillus casei, Target EFI-512911
rcsb
total genus 102
structure length 270
sequence length 275
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk4A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk4A01
3N53A 1PUXA 1BAPA 4KNYA 2FEWB 3IP7A 5JNSA 3HXMA 4KQCA 5IC5A 1ISSA 4ZJPA 4F12A 2PL1A 4N03A 5FBHA 1FFGA 3OQMA 2FKAA 5CNJA 3IPCA 2QR3A 4KRFA 4DN6A 9ABPA 1JX6A 1FQWA 4RY9A 1DP4A 3HVRA 1NXVA 3NBMA 3HCWA 1DCMA 3RVOA 1GCGA 3JPYA 3T38A 4EVSA 3G85A 3NHZA 3SG0A 3DLHA 2FVYA 4OATA 1USKA 2QW1A 4HNSA 4ETMA 3OQNA 1NXTA 1MIHA 3CFYA 1RNLA 3I42A 1ZAYA 2B4AA 3KTOA 3KG2A 4G0XA 3F6PA 1DZ3A 1NY5A 4WZZA 5C5CA 4PYRA 3QLUC 4RK1A 1YIOA 3H5LA 1P6UA 3ROFA 1NXWA 1JHZA 5B3JA 1T34A 1JH9A 1ZY2A 2WMYA 3TB6A 1PEYA 3T95A 4OTZA 2JBAA 1AB6A 4S05A 3KHTA 2VYCA 2E4XA 4Q7EA 3S99A 3CKMA 1KRXA 4LE0A 1ZN2A 2M1ZA 3HSYA 4PICA 3O1HB 4W5OA 4MRMB 3N0WA 5ABPA 4XXHA 3OM1A 5TQ0A 1DRJA 1RXEA 3H5VA 2WB4A 1DG9A 2FSPA 3O21A 3A3KA 4Z9BA 4W5QA 4ETNA 2WY2D 3FFXA 4NV3A 1BA2A 2IDMA 1NATA 4TMYA 2FQWA 1EHCA 3JS5A 2PL9A 1DBQA 4O1IA 2QV0A 2JK1A 3O2QB 4KK3A 2WJAA 2A9RA 1URPA 3QLVC 1W25A 4WUTA 3LTEA 5EWLB 1E2BA 2YHAA 4RK4A 3BREA 4MQFB 4DADA 3RH0A 3I5AA 4O1HA 1ZITA 4UHKA 5TPWA 4OLBA 2RJOA 4F8JA 3DGEC 2HSGA 3CTPA 4G0YA 3KYJB 1J56A 4Q6BA 4D6XA 3F6CA 3G1WA 3W9SA 5JNVA 4NQRA 5JNUA 1YS6A 4LE1A 1ZGZA 1YMUA 1E6MA 3KCNA 5IUNC 2FLWA 3Q15C 3OQOA 1D1QA 1LJUA 5C5EA 2L19A 4YCSA 3LKVA 3GA5A 3SY8A 1NXSA 5EWJA 3E61A 3QK7A 3HJFA 3H1GA 3NHMA 3SQNA 3TD9A 4N0QA 5JS2A 4N41A 4D6YA 3EJWA 3MQ4A 2A9QA 3O1IC 2PKXA 3H75A 3M6MD 1JWLA 1SXGA 4F3TA 4ZMSA 4L4UA 3H1EA 1WETA 2IOYA 3ROTA 3EAFA 2QZJA 1NXPA 3EQZA 2ZAYA 2IPMA 4G97A 3OLXA 1QQBA 4YWHA 4G0ZA 1USIA 3QEKA 1I3CA 2CHFA 1Z17A 2LUOA 5HQJA 1DRKA 4RWEA 2PUEA 2OENG 1Z13A 2RDMA 4F11A 2A9PA 3E3MA 2X7XA 5EWJB 1QO0A 1DC8A 1B00A 3L6UA 3OLWA 1VPWA 1QPZA 3C6QA 4G0QA 5KI6A 4H60A 2VUIB 2R25B 4S04A 3HV2A 4ZYLA 4MQFA 1D1PA 2PAFA 3H5IA 3LUAA 4YS6A 2QVCA 1SXIA 3JPWA 3CRNA 5EWLA 1D2AA 2Q5CA 4RU1A 4XASA 4MR9B 4MR7B 4MS3A 4PEVA 5BRAA 1ZGGA 4XARA 3EODA 5TPWB 4RS3A 5GOTA 4YGXB 5TQ2A 1Z25A 3N6VA 4JA2A 2A9OA 1P8AA 1GUBA 3LKBA 3MM4A 4MR8B 4G0PA 3M9XA 3O74A 3KYIB 5GQSA 2W42A 1EFAA 2F8SA 1ZH4A 4M88A 4W5TA 4KMRA 1QKKA 5IUKC 2H3HA 4HNRA 2LPMA 4MS1B 3D02A 3VNAA 3CZ5A 2AYXA 6ABPA 3KJXA 5JS1A 4NICA 1H9CA 2FMKA 3KKEA 5IEBA 4EGSA 4MS4A 2DRIA 1VRVA 4EYGA 1PNRA 1QP4A 3JY6A 4MS1A 2FN8A 5DLEA 5TQ0B 2WWVD 1AB5A 1QMPA 2NZUG 1ZESA 1KGSA 3QX8A 4W5RA 1QQAA 1Z2EA 2JB9A 1JFVA 2MSWA 3MIZA 2R47A 3A10A 3LOPA 4KVFA 2FW0A 1S8NA 2IYNA 4MR7A 4Z4EA 3LUKA 3RVKA 3GT7A 3O2JA 3KLNA 5T7BA 4YP9A 2JVJA 3CNBA 3HUUA 3T8YA 2LBPA 4YLEA 1JDPA 3FGZA 5HKOA 3OM0A 1RPJA 3FMVA 1PHRA 4GNRA 4MR9A 5DKFA 1L5YA 3IPAA 3RVPA 1EWVA 4Q6WA 1KMIY 3VNBA 2E4WA 2HJ9A 2WJWA 1LJLA 4MLDA 8ABPA 1CHNA 3SNKA 2L2QA 4Z4IA 1JYEA 4Z0NA 1Z16A 5CNIA 5BR1A 2VUHB 2GKGA 1FFSA 3CG0A 3N8IA 3Q7TA 2VK2A 4PE5B 3IP5A 3Q41A 5CNKA 2JVIA 4HYEA 1TMYA 3RVSA 3RVMA 3FFTA 3DLBA 4H3HB 5HSGA 4RKQA 3EULA 2HQRA 3H6GA 4G86A 1IIBA 4HNQA 3RQIA 3LFTA 4IMJB 3NNNA 3OLVA 1C4WA 4WXEA 1NXOA 1VKRA 3RVJA 1QNLA 4EY3A 1ZVVA 5EWMA 2M98A 1KRWA 4RK6A 4RXTA 4DQDA 2BGGA 3QELA 1NTRA 4IMIB 4QYWA 4N76A 1HEYA 3QEMB 3F73A 1CEYA 1XWWA 4IGAA 2R48A 1D4ZA 1C0EA 3IDOA 3L49A 1Z2DA 1APBA 4QYMA 4P98A 1JLKA 1ISRA 3MYYA 3T6KA 4EUKA 1OXKB 3BILA 4XAQA 2PUAA 1XHFA 3DZDA 2YHBA 2PUDA 3C97A 2RJNA 1YVUA 1JBEA 2ID7A 1A2OA 1JF8A 2ID9A 2F8TA 5F64A 2HQOA 3MMNA 4Y9TA 2CWDA 3KS9A 3HDVA 3H1FA 3KSMA 4RKRA 1DCKA 2GI4A 4JB2A 3LUCA 4FB4A 2QXYA 2E4UA 3LMKA 4RDCA 4LZLA 1K68A 5FWYA 4EVRA 2PUCA 3CG4A 2FXIA 2HPHA 1A04A 3KLOA 3I09A 3SM9A 5TQJA 3FFWA 2L17A 6CHYA 4LX8A 1TLFA 2N9UA 4RK0A 2FMIA 4TLLB 4IILA 7ABPA 5JNWA 3O1JC 3M9WA 3TX6A 1Z18A 3K4HA 1PNTA 1U8TA 4KPYA 4Z4FA 3N75A 5KQLA 2PUGA 1DBPA 2FEPA 2ZWMA 3CLKA 1SRRA 1DC7A 3Q9SA 4L85A 3BRQA 1A0OA 3CS3A 5ED4A 1JL3A 4FE7A 4IF4A 4LDAA 1P2FA 4OLAA 4P1ZA 2J48A 1ZDMA 1L5ZA 1NXXA 2B1JA 2E4YA 2I6FA 3OO0A 4TN5A 4WWHA 4KZKA 4RY0A 1JYFA 5DCLA 1ZHHA 3O2SB 4B09A 3GYBA 2FN9A 1U2QA 3C3MA 3N0RA 4RV5A 4RXUA 5CNMA 3LUHA 4XLTA 3TO5A 1Y1LA 1ABEA 3HS3A 4GPAA 1Z26A 2OQRA 2AYZA 3GL9A 2PE5A 2FMFA 4KFCA 2QVGA 3NNSA 4MS3B 2PUBA 4JASB 1JDNA 1U2PA 1M2EA 2O20A 1W9HA 3Q7SA 3R0JA 2L18A 2XDYA 2P4UA 1BDJA 4JP1A 4XFKA 1F51E 3OO1A 4PZ0A 4YV7A 1QP0A 5IEJA 1FSPA 4LRQA 1MB3A 5HM6A 1FFWA 2JRLA 5KC8A 3O75A 3MF4A 5IULC 2GBPA 1EAYA 4TLMB 1P6QA 1QP7A 2FQXA 2R4QA 4LDZA 4MPTA 1E6LA 4G0OA 3URMA 5FWYB 3QLUA 5BRJA 4NCAA 1JFTA 5IX8A 3A0UA 4MLCA 4MGEA 4RK7A 4KK4A 3BBLA 1U0SY 3K9CA 4ZMRA 3HUTA 3ILHA 2FLKA 3IP9A 3RVQA 2P9HA 4JB0A 4EYQA 3CHYA 3HO1A 3H5OA 1Z12A 2QSJA 3A0RB 4YRZA 2FEKA 4Z9AA 4MQEA 4W5NA 1R8JA 4F06A 3EDCA 3UKJA 3JTEA 3GBVA 1M5UA 3F7NA 5I4CA 5KQGA 5KWSA 3OLZA 3H6HA 1DBWA 3QELB 4D74A 2IPLA 1XHEA 3C3WA 4E7PA 1EWTA 5EWMB 5FWXB 2E4VA 1QO0D 1U04A 3LUDA 4WT7A 1USGA 4RZSA 3LUFA 2FMHA 3P9YA 2WRZA 3HM9A 3CZCA 2TMYA 2GX6A 2PUFA 5BQ3A 3B2NA 1E6KA 1TM2A 4KV7A 3LUGA 1MAVA 3NNDA 4MRMA 4Z4GA 4E7OA 2LIVA 5B3JC 3JVDA 1GLGA 3C3KA 5IBQA 4KQ9A 5KC9A 2IKSA 3QLTA 4NCBA 1D5WA 3GV0A 2MYNA 4MS4B 1JFSA 1PEAA 2MSKA 4N0PA 4ML3A 2CD7A 2PMCA 3I45A 4QPJC 1OXBB 1RXIA 2JBAB 5PNTA 5TPZD 5IUJC 1YS7A 4LE2A 5T3YA 1DJMA 3QLVA 4O5AA 2PLNA 4JOQA 1SD5A 2JCGA 1EWKA 5TPZA 1MVOA 3ILYA 4CBVA 1TJYA 1UDRA 2FTKE 2CHEA 3HDGA 1RZRA 1F4VA 2MSLA 1YK1A 3GWGA 4FE4A 4KREA 3SAJA 3RVNA 5KQMA 2GWRA 1RZRD 3RVLA 4QICA 1CYEA 1YK0A 3N0XA 4UHJA 1TVMA 1M5TA 3UUGA 3H5TA 4ETIA 1K66A 3GBPA 3QX9A 2NUBA 1LBIA 3IP6A 3JVIA 1M2FA 4RY8A 2RGYA 3DBIA 4H3KB 1DCFA 5JNRA 2QU7A 1YTUA 2NT4A 5E3JA 4JAVC 3LUJA 5DGCA 3FDFA 1GCAA 3HEBA 4MR8A 4YO7A 4ZPJA 3CU5A 3Q7RA 1LBHA 2MYTA 3GRCA 4EYOA 3OLYA 5TQ2B 4EVQA 2IPAB 2FQYA 3RVRA 3MA0A 1LK0A 1BDHA 2PJUA 4WXMA 3OMXA 3EQ2A 4MAAA 1MB0A 5FBKA 1ABFA 2HQBA 3EGCA 2LP4Y 1SXHA 4Z4CA 4OG2A 2JVKA 4G0MA 5FWXA 2V0NA 4MQEB 3HZHA 5D2CA 4N47A 1Z15A 3HK2A 1BDIA 2E4ZA 4Z4HA 4RSMA 4RK5A 4IRXA 2NZVG 4OBBA 5KQPA 1YMVA 4RXMA 2H0AA 3TMYA 3D8UA 4Z99A 5JNTA 3H5WA 1GUDA 2MYPA 3OMWA 5TE9A 2IPNA 1ZH2A 3UK0A 3QEMA 5DTEA 1VLZA 2KYRA 4YR7A 3DGFC 2MYUA 1BVHA 4MYRA 2NT3A 3BRSA 4EYKA 5CHYA
chains in the Genus database with same CATH superfamily
1KMNA 4YPOA 1F17A 5LB4A 1JR3D 4B43A 3C3XA 2RK4A 1T5BA 1Y37A 4QUBA 2XD4A 4XPIB 3HXMA 1P6XA 4RIFA 1F6DA 3IUNA 2WSYB 3R8XA 3COSA 4U39A 4DDTA 1N1MA 3FPJA 3N2ZB 2J3EA 3KU1A 4QBKA 1X70A 2Q6LA 2HA4A 4CF5A 1QVZA 2W48A 1ZJJA 3I73A 3HVRA 2ZYDA 4ZDKA 3SJCA 1E9CA 1F1BA 1GKYA 1ISJA 3CT6A 2PCJA 4GYWA 4MYUA 2OQVA 4QBHA 5JO0A 1E3WA 4J4TA 4RSHA 1W581 1IJKA 4J0KA 5ALHA 3NKLA 3ELBA 2LCFA 3D3JA 3PVSA 1GPKA 2EXXA 5DWDA 1NXTA 5FWAA 1CZRA 3GLFE 2B4AA 5FAXA 2OHOA 3F6PA 4AJHA 5ISMA 3JZAA 1QV6A 1S8AA 1XVAA 4WZZA 4MINA 3OE7A 2HCRA 2OR3A 5E2BA 1W36B 2QN3A 2DBZA 3IBCA 2Q99A 5AYVA 1G5TA 2ZRCA 4KQ1A 1X8XA 3NDIA 3ZYZA 1X1QA 2Z8XA 1EFUA 3EGIA 1PL8A 4OTZA 4BO6A 2ZRJA 4EEKA 3UANA 4Q7EA 2WHPB 4OGKA 5LNK6 1QO9A 3HSYA 5GZ6A 3O1HB 3WLQA 5LMZA 2MTBA 3B1FA 4DV4B 2CJWA 3G13A 4O6VA 4QNNA 2BHNA 3AHEA 4RFSB 4PG8A 5ABPA 3M83A 4KWTA 4ZYTA 2J45A 1YGYA 5K3CA 3OKPA 1XG5A 5E7QA 1PJ8A 3W2HA 1A8SA 1KP2A 1NI5A 1WNFA 3L9WA 4JKIA 3A1WA 2QP3A 1V5IA 2FZEA 2JGDB 5HGXA 1OZHA 2B5VA 4QU0A 3KQSA 1EGAA 1EHCA 3AEQB 3A7EA 4NFYA 5F2KA 3BIFA 3KCQA 4JP2A 2XLBA 4HGZA 4DQVA 3R6LA 4CKBB 3NAMA 1Q7RA 2QMUA 4UMDA 4CNQA 3VPHA 1XB2A 1E2BA 1RLTA 4RK4A 1CV2A 4M9UA 2GERA 1A2KC 4QJBA 2IS4A 4UCXA 1ZITA 2QAGB 2DMRA 3KUCA 4WKOA 3BF7A 3PRHA 4R3UC 1ONBA 1PG2A 4TQGA 1KJJA 1IB6A 3KYJB 3A6ZA 1HT2E 3GN2A 3JQ6A 4NQRA 4BX3A 2Q4RA 2QT1A 1OXMA 4NATA 4C6HA 3KYCA 1XMQB 2MR5A 1TVCA 3PUVA 3Q15C 5JT1A 3O4HA 1I7SB 4YUVA 3R1IA 1Y1SA 1K4YA 4Z53A 1F4PA 1GJRA 1ST3A 3AKEA 5LC1A 3SZUA 3ZU5A 5I5GA 5I7OA 4G1CA 3B2EA 1Q74A 4YAFA 3UBMA 1QHHA 3EVBA 3SFVA 2QI9F 1TTQB 4F3NA 5J43A 2ZRBA 1ZD5A 3AR5A 1NBEA 1JHQA 4M89A 4MV0A 5HK9A 4KR2A 3R0IA 1HQCA 1G6OA 4INAA 3WRYC 4ZYZA 2QZJA 5CIYA 2QRVB 3Q9NA 1QHGA 2GZSA 1MQSA 4PQEA 2Q3BA 2DHQA 1JKMA 2FWAA 3WWZA 3U7RA 2J7PD 4DAOA 5CB6A 4ZIRB 1VECA 4BVKA 3QEKA 1G8YA 2C78A 2JHPA 2I4TA 2IUYA 1R5OA 3I9NA 4YRRA 1RQ7A 5TVKA 3RS4A 2J7PA 1ADGA 5AVSA 1G8SA 3E5MA 3CZMA 1AF7A 4ZAVA 4R6XA 4N0EA 4OYRA 1OH5A 5CFOA 1Y4SA 3PZRA 5FTLA 2UAGA 2PH5A 3L40A 1GPDG 4NX2A 1UAGA 4DR5B 5JBIA 1Q5PA 3RK0A 1XYVA 3D7SA 2Y0BA 3E70C 2AFIE 4MVWA 4QBFA 4CKWA 4LF8B 2BFCB 4OH1A 2HFJA 2W2QA 4PS0A 4CEIB 4RS3A 1LPMA 4G23A 1ZYUA 4D4MA 4MYTA 2VPQA 4GVLA 2NWQA 3UC9A 2R00A 2A9OA 3OFKA 3EX7C 4R51A 1CLUA 2XUFA 3Q8LA 4A0SA 3DVLA 3JV7A 3ADKA 4RLFA 4X00A 2W6IA 1IHXA 4MCAA 2G5CA 4NI5A 1V3TA 2PKEA 1IUKA 2QMYA 4FOSA 5F1YA 5F3WB 1P7CA 1QDUA 2YYYA 3QVLA 4IIUA 3MJTA 3IQHX 4Y0NA 3IJ5A 5LJIA 1G3UA 1MDFA 1VRVA 1GGEA 3FYUC 4MW2A 5A3RA 1N75A 4R1UA 1JQ3A 2NU9B 2VPZA 1O94A 3E48A 3QBEA 3NHRA 2J0SA 1Y8CA 5HWSA 4DIUA 1G98A 3EGWA 4HLNA 4L8GA 2SCUA 2HA3A 3MTEA 4KOEC 4XWOA 2CDAA 2OLJA 1XDGA 1NJFA 3D54D 3L06A 1L1FA 5E6RB 2V1XA 4GYKA 1V47A 5LLSA 3VI4B 3PQCA 4RTLA 4HQOA 2IEGA 1TPZA 3FNHA 5T7BA 1GLVA 3CNBA 1TVKB 3A1SA 1A95A 1H05A 1YI0A 3RAEC 4HFRA 5IMBA 3AP2A 2C8KA 1NBIA 2C0CA 4JT2A 1FK8A 1IN6A 1PV1A 2JD2A 1L7NA 1QTNA 5D1NA 1AMNA 1ZD9A 4BNMA 3DAHA 1VG0B 2GFIA 3WMFA 4Y6LA 3OZDA 1X77A 1GL3A 2CLIB 4REQB 1Q3TA 1F0PA 1WS6A 2X15A 2XRFA 3PC4A 5G41A 5H02A 4MWEA 4BNDB 4CR6A 1ICIA 3DXYA 4Z4IA 1ESZA 3R3JA 3ENQA 4BNGA 3BL5A 1MH1A 1M6WA 3Q7TA 3SJUA 5CD1A 2PWYA 5CXSA 3EPJA 2NO0A 1AKRA 2WAAA 4Y18A 3HC7A 4MYCA 4L9AA 3SKXA 4TLEA 1Z0FA 1KI1A 1IXYA 3WSVA 1I4TD 3R7WA 3VR5H 2HQ1A 1C4WA 3D8HA 3WK6A 3CPSA 4DYHA 3E9DA 4Z0PA 1T8SA 4EYSA 3RVJA 5HKKA 3OM8A 1IDOA 2ZAOA 1W4LA 2H4HA 4AG5A 1P5FA 1T2DA 3FBTA 3IBGA 3B7WA 1ZRMA 1M6HA 3IUYA 4B7AA 3O4JA 5TF0A 4QBTA 5CH8A 1HY3A 2QYSA 3D7LA 1HEYA 3UT5A 1PQUA 4N5IX 3FF4A 3FMOB 1PWZA 1UBGA 3CY6A 1APBA 3GDOA 3G2NA 3WNVA 2H0RA 2OCYC 1IULA 4AKGA 3EB9A 4MRRA 4UULA 4EWLA 2Z4RA 1U5BA 3L8YA 3OF3A 3PQ7A 4F7WA 4PZUA 2WHEA 3H0CA 1EXWA 5U1PA 1KEVA 1VLHA 1II9A 5ALYA 3LS2A 4TVKA 1C1DA 1SVIA 3BH0A 1CQIA 4ZTBA 4Z4QA 2VSYA 1RLUA 1QP8A 4IDAA 3IE2A 1KDZA 1T26A 4A8TA 1KPGA 4QECA 3NM4A 3T1QA 2O8BA 1W34A 4V1CA 2I66A 1S2MA 1CUGA 4M8LA 4DLBA 4XM1A 3V9AA 5KJCA 4XJVA 1N3LA 3FSEA 4KO4S 1UDBA 4YJ2A 1VHQA 4KPYA 2BUAA 2BFDA 3W0LB 3ZY2A 4B85A 4Y9DA 2QZ9A 1WXWA 4JBXA 2AWOA 1UPXA 1DBPA 4WBNA 5EJ5A 4BO9A 1NMQA 5FI0B 2I4NA 3RTAA 1NKTA 3URKA 1SIUA 1FFYA 3SVTA 3VNVA 3HBFA 3W78A 1UMKA 3L4BA 4WWHA 4P22A 3T7CA 4C0JA 2XOXA 2W2OA 2EFCB 4UBIA 3W6OA 4D0NA 4RPGA 3K73O 2JRCA 2QVLA 4JV5B 3R0QA 1EK6A 2PZFA 2IYTA 2CHVA 2X9VA 3GLFA 2P0AA 3SSNA 3LZCA 2W7TA 3KOXA 1FJGB 1D4OA 3RRBA 1ABEA 1HTWA 1I4EB 2GRUA 1VPTA 3GL9A 1J8YF 2ZETA 1E5DA 2CXPA 2R6GA 4FWIB 4Q1DA 4WOBA 5GONB 3QFHA 4DSOA 1CUJA 4EI2A 1BFKA 3ICWA 4ZVVA 4NJEA 2VJMB 1BHJA 2BD0A 1XDBA 2QD4A 3BSWA 4DW8A 2P4UA 4BTVA 5FEUA 2WJHA 3G1TA 1W0JD 1IVSA 2QTRA 1MB3A 1GGJA 4O8CA 1ZS9A 1ULZA 2P4SA 2PAAA 4L4RA 1X19A 1JHOA 3DZFA 4R1LA 5DSZA 1KK3A 1PW5A 3ZWKA 1N36B 4I2NA 4NECA 3OZUA 2VBFA 4KXYA 1GZUA 4IOJA 4Y2GA 1Z68A 3PJGA 2DP4E 3IMEA 521PA 2MHCA 4G0OA 1AUPA 1V9LA 1THTA 1UPCA 4DBLE 1U0OC 4D9MA 5A4MS 5IX8A 4HMOA 9ATCA 2WZQA 4NOMA 3JALA 4D44A 3HXQA 4F5DA 3QMVA 3RQSA 2H2GA 4OXRA 4DR3B 3A11A 3EGXB 1YUMA 4IJKA 3K09C 4AROA 2Q3MA 3HUTA 3KOYA 3ILHA 2EW2A 4LYHA 3INRA 4U7DA 2GBLA 1UBOS 4JHLA 4BNWA 3DKPA 1VGRA 1Q50A 1TZJA 1R9JA 4YMWA 3RK4A 1GTMA 5JANA 4LFAB 4C0XA 2J46A 2QSJA 4DRXB 1A97A 1E2UA 2DXIA 1EVLA 1P4RA 3CH5A 4BNDA 2P5YA 2PJRA 5DF1A 2VRWA 3V42A 3RIMA 3GBVA 4DJTA 5JCOA 2ZWPA 1O9BA 5HDQA 3UPDA 3T5BA 1QOZA 4BOYA 3G8YA 5EJ9A 1SUEA 2JLRA 3P27A 1J97A 4QLOA 4BBAA 5C7LO 2HCFA 1YDWA 4Z2YA 5KNCH 3RKSA 1E0SA 3KAPA 4AY2A 1DIHA 2CNBA 2P2LA 2X8JB 3D7KA 1DAPA 2AG5A 1GFSA 2I1QA 3JQ9A 3RI3A 1KBZA 2GEDA 1UODA 2OHFA 4BUJA 1N25A 2B35A 1IMJA 3ZG6A 5L3SB 3IPLA 2ZRLA 4GYJA 1E2NA 5D00A 3L6EA 5JEDA 1KYTA 1E2KA 3E1KA 3FI9A 4IG4A 2XOKA 3B52X 4BY9E 2XQKA 3NXSA 2QM8A 4UCQA 5H0IA 2F55A 1AC5A 1H2EA 3G2QA 2A0WA 4HL6A 2AFHE 1ZKDA 4KEAA 1QKIA 2W6JD 1UFOA 1GKIA 1RHJA 3W77A 4R05A 2QTBA 4EO4A 4YRLA 3UMJA 1ZD3A 3DOHA 4NNJA 2IIVA 1QLHA 3IMCA 5K8JB 2IUEA 1PD1A 1YU6A 3OD1A 9LDTA 1MC1A 1MRZA 2JAQA 1PT5A 4JU9A 1ZU4A 4AURA 1ADBA 2X19A 3ROKA 4B17A 1DQZA 4JLWA 3HN7A 4R7TA 1C5KA 1GOTA 5KCMA 1EWKA 5BUCA 1EUZA 3KQMA 2NZ2A 1TJYA 4PX2A 3A1EA 3HY4A 5DXJA 3HFRA 1B1CA 2AXNA 2QL5A 2C7QA 1E2DA 3DMYA 1GVNB 3HCRA 4TV9A 3RVNA 2UZAA 4DG8A 1FTYA 1FFAA 1YB2A 1ZMTA 5JVDB 4BTEA 4EELA 2C9CA 1NULA 1YK0A 4RMJA 1AV7A 1N77A 4DIBA 4KX5A 1TA0A 3FLEA 2AFIB 4WD3A 4JNKA 3VU3A 1YU9A 2BAGA 3DOJA 4NZMA 5HFNA 1GADO 3I9KA 2WJJA 3E81A 3OIWA 4GI2A 4IV5A 1U8EA 2WBLC 1WUKS 3GRVA 4DRYA 1NQWA 3BA6A 1YF3A 5JIBA 1UL1X 2ZRIA 4PG5A 3ZE2B 4BNZA 4F2HA 1ESDA 2PDAA 2Y1DA 4K6MA 3JVIA 4TTPA 4Z54A 5AUOB 2NPOA 2DFTA 5K4AA 1V9CA 3OZWA 4UEWA 3UWDA 2ZSKA 3F49S 1VSVA 1W4AA 1E20A 2GILA 1ST2A 1BMQA 1UPUA 4ZPJA 2W6CX 1SZPA 3LFUA 4IXMA 1J42A 2MYTA 4FZJA 2HA2A 4KCGA 1I5EA 1DIRA 1KH2A 4QQFA 3AI1A 2J0VA 5TQ2B 3PICA 3TM5A 1NRJB 1SUDA 1KYQA 4KN9S 2OTCA 5EQTA 4YMLA 2BY4A 4BNJA 1MB0A 5IH3A 1SXHA 4TN1A 1H3NA 5JY6A 5FHQA 3HZHA 2GO1A 3NWJA 2FPSA 4HI0E 4LVOA 3RUHA 1KVSA 2RFLA 5SY6A 5GONF 2JARA 2ZBDA 1NLZA 3GRUA 4KG7A 1F20A 1MT3A 1ZO8A 2OZVA 4NBUA 5EKDA 5AUQA 3IJRA 1U6IA 2EZ4A 3NXKA 1RPTA 4V39A 3WWDA 1ZMRA 2W8ZA 1E60A 3STWA 3NONA 1Y33E 1R7RA 3QPDA 1TZKA 2YRWA 2Z3WA 4QYTA 4ALNA 3ZH9B 3K1JA 4JLMA 2E87A 3UMCA 1OLOA 3ZCPA 2KYRA 4QDKA 3ZOKA 3DGFC 1UBNA 2LTAA 1GKUB 1BVHA 2AZTA 4MVYA 1JLSA 2C2XA 2M6RA 2PRIA 4Z8YA 4EYKA 2D0IA 3C5CA 2LNDA 2A7XA 1L7PA 2AZ4A 2JIZD 1E32A 1NZJA 2O4CA 2P11A 4XTRA 5L6MB 5GINE 1LSOA 3GUYA 3WL5A 1LI4A 1FZQA 2GYWA 1SOUA 3LQRA 1XTPA 2HLHA 3HEAA 1EFCA 1J49A 1E2EA 1UT8A 2J9XB 5D86A 2PL1A 2ATIA 4GKVA 4KIWA 4I50A 4LCEA 4OXIA 4HFJA 3UGKA 1MV8A 4F93B 3T5CA 5CT4A 4L07A 5JFGA 4BN0A 1ZSNA 1UP4A 2CHGA 2WFZA 4G56A 4QRIA 1A1VA 2ZRNA 3AJRA 1XNRB 1C0LA 1OREA 3NHZA 3P9ZA 4A2QA 3DLHA 2MIIA 5EXXA 4JXJA 1RNLA 4M6WA 3IFSA 5C0OE 3V4ZA 1NY5A 3ZIAA 4Z51A 1XLUA 5FTKA 1HNWB 4MA0A 1Z29A 4IPTA 3RYHB 1JH9A 1QRSA 3UQYS 4FD2A 1EWYA 3D6VA 4TROA 2DJ5A 3JRNA 3PPWA 3RSOA 1L4LA 1CZHA 1TDJA 1KKLA 3RU2A 4Q4AA 5JXHA 5AW2A 5EZ5A 2HMYB 4ZK6A 4I7EA 1GTRA 4C0HA 2CUZA 3RJZA 1I2CA 5DYNA 1FX0A 2PIDA 4IFIA 3UPTA 1F2UB 1XA4A 4Z9BA 2M1XA 1M1NA 1PJZA 1RI4A 1UR5A 1PSWA 4K3VA 3QTLA 1T5LA 3D4PA 3GLRA 4RA6A 3TPZA 4FC6A 4B40A 1FFEA 3V5NA 4LY3A 5BSUA 1Y48E 2BM8A 3TQHA 3CUYA 5H9WA 2ZVJA 4QBGB 4D4KA 2IZOA 1XRRA 3REQA 3R0ZA 4P86A 3WJAA 1OFIA 1Q7CA 1U3FA 1YJAA 3DTYA 3UZUA 2VF8A 1M5RA 4DADA 1FF9A 1R0KA 1D6SA 4UHKA 3SR3A 1PKXA 1JI0A 5BN3B 1QIJA 1YVRA 2VKQA 2Y0PA 2HSGA 3EXEA 2HW8A 1I0IA 1KAEA 3F6CA 5HKKD 5JNUA 4M4SA 1ZGZA 3HCNA 2ZRMA 1SCUB 2FLWA 3RSQA 4Q3CA 4BP9A 4I5GA 3QTTA 2FOIA 4CHGA 4C87A 2BHRA 1LNZA 2XZPA 3MT7A 3U3MA 3PC8A 3NCHA 1QG4A 3BXPA 3SQNA 4H7KA 1OROA 4EX7A 3ZGNA 3AH8A 1GYRA 4RD6A 3DMNA 3KAJA 4CTNA 4ESHA 1GTJ1 1T4GA 3GXOA 4H77A 4HFMA 5ALZA 3VTZA 1XTVA 3OUUA 4RGVA 4AY3A 4ZMSA 4KQ2A 1JAIA 3CB2A 1HBJA 1NW7A 2R44A 5TARA 3VC1A 4F2DA 5B6PA 5AVYA 1FNNA 3GPBA 1O96A 3G7SA 4LBYA 4LRSB 4E11A 2PN1A 1L4YA 2EJVA 1H5UA 2GT1A 2Q21A 1F6BA 2VS1A 3WBKA 2YHIA 4ZN6A 3ICQB 4Z1MD 3MJVA 3Q0TA 4UUMA 1I3CA 4D4HA 1GV0A 1Z17A 3OUTA 4JYCA 2X5KO 4RVNA 2E21A 5ALJA 5JZVA 3P0FA 3ZJ5A 3DEYX 3F8WA 1NNSA 1IQPA 4M9QA 3N2YA 4LY9A 3WGLA 2ZIVB 4H60A 2B7CA 1OGIA 2CY0A 4LXQA 2YZ2A 4QJ5A 1Q6ZA 5KKAA 3ZHSA 2K5UA 4ZYLA 2PAFA 3ICEA 3ISVA 1C9EA 2FPIA 2R751 2X22A 2OK7A 4YS6A 1D2AA 1T4CA 4PIMA 3L7CA 3GJ8A 1ZVJA 1ZGGA 4AS2A 4DR1B 1X74A 2P0EA 4TTQA 1ORHA 1KJQA 2RGBA 2XUZA 1NJ5A 4JYZA 2VI5A 5DLQC 2VSXA 4AJPA 5TIIA 1QH1A 1FZTA 2I4IA 1EFAA 1JDSA 2HSDA 4A2WA 2JBWA 4NZYA 4ERXA 4D9NA 3NBZC 4X8HA 3BORA 2AYXA 5EXSA 2OGTA 1YZQA 3BGIA 3JZDA 2B61A 3KB8A 3KO8A 4CDNA 4RTJA 1YKGA 1OSNA 4L2IB 2ADOA 3CINA 2OUIA 2BJVA 1SH7A 3HWWA 3OZVA 2RB5A 1KZ6A 3IVCA 1BCSA 1NF9A 2XCQA 3LJKA 4IKEA 1AB5A 1Z7WA 2HO5A 3LY9A 4UDNA 3UAXA 4RF5A 4U0JA 1DIOB 3WE7A 4B6QA 4IVRA 2W4QA 2QIPA 3CQ9A 4XJTA 4JBWA 3MYRA 3BJMA 2QNIA 3M82A 1ESEA 3QW4B 3L8ZA 3UJHA 1Z6TA 4AZVA 3BE8A 5CVVA 4BO3A 3T94A 2HNAA 1CQIB 3AHDA 4EEZA 4DLPA 1PV4A 1ZL0A 1RCTE 2FKNA 4XQEA 4I1SA 5IBCA 4O2AF 3E3OA 2ZTVA 2J7KA 2A5FA 2ZJBA 4I36A 4IV0A 3N2EA 4IR7A 2IVFA 2O8CA 4YLEA 4D1YA 4I5FA 1HNNA 3KR1A 2QRNA 4LYJA 3IHWA 1EGHA 1XZFA 1GGVA 3ND8A 3DL4A 3VAAA 1EP1B 4GNRA 4RAQA 2Q50A 1CB0A 3VPFA 3SHOA 4GC5A 4NF2A 5CUQA 3RVPA 1Y63A 3HFJA 4Q6WA 1OYWA 1SHTX 1XKXA 4HH3C 4LX0A 4MCHA 1MX9A 3IAM6 3UHOA 2HJWA 1SKQA 1GA1A 2DFNA 2JANA 2XYVA 1UBFA 2YOHA 3CKKA 2FZCA 3KOUA 1A9SA 1ZLXA 4Y2VA 1W2WB 3UXYA 2GCNA 3RTEA 3RRYA 1Y3HA 2EZ9A 2YS6A 4NR0A 3SEFA 1D6JA 5JJIA 1BMTA 1KBOA 3RVMA 5IPFA 2BT4A 2D2VA 4Q34A 1E98A 3L6BA 3R20A 4LY0A 3PSHA 4X3CA 1IG3A 1U9CA 1CUAA 2XTNA 4MGIR 3TMAA 1NNLA 1K06A 1Z38A 4O2AB 4QFCA 4L08A 1A4UA 1C1XA 1H22A 3UG6A 3H19A 3TLZA 1CR6A 1OFUX 1EP2B 1SG9A 3Q2OA 1Q17A 4OM7A 3ONDA 2ZE7A 4FDLA 5BO5A 4EKIA 4FHGA 1Z6XA 1J24A 1U2GA 3PFNA 1KDYA 4DQDA 2OPBA 2Y2VA 3CB4A 4C08A 1DQNA 3A6JA 3IOBA 3T15A 4G63A 4REQA 3LF2A 5A3QA 4O25A 2WP8J 1VPVA 1PIWA 1UPBA 1D4ZA 2GB4A 2GETA 4MVCA 1MMFB 4PC3A 4ZO6A 5FO0A 2R8OA 3KXDA 4I08A 2JLCA 4H59A 4QYMA 1RRKA 1H4TA 2C77A 3CCFA 2PBRA 3RUIA 3BH6A 2YZNA 4YI3A 4QFMA 2PUAA 1UBHS 1PL7A 3GNSA 5T67A 4LDQA 1GKLA 1D2MA 4PHCA 2YHBA 3X2SA 4HS4A 2RJNA 5CBKA 4HS9A 5EJIA 1LQUA 1KXZA 3P71T 4Y9TA 5AKEA 5DP2A 4YXWD 2IOHA 4HUQA 1U9YA 1TIKA 2QUIA 4LY6A 1CNEA 3OZXA 4K6FA 9GPBA 2R6DA 1MQAA 2A84A 1ZOPA 5KX5F 3RBVA 4JOSA 5AJTA 4Y8VA 5DBOA 3Q5DA 2A3NA 4JD5A 5EJFA 1D9XA 2IE8A 3IPXA 3TZ6A 5BN4B 2DUMA 4WESA 4YT5A 1T3LA 2HPHA 1NYQA 4DMMA 1XZKA 1MAWA 2I76A 3L4EA 5TQJA 1JE1A 2O19A 4KYVA 4LX8A 2ZE6A 4IKOA 1OB2A 5BPFA 2OL4A 1MGPA 1O03A 2NO1A 2B2NA 4ND2A 3AHHA 3PFBA 4QXPA 3ZWDA 1I2DA 1HDRA 3I01M 5LXTF 3LPMA 2XT6A 5COQA 3V00A 3U44B 3P94A 3N8KA 1DKMA 1C3OA 1JWAB 2XUAA 3TN7A 1RFGE 1N6RA 4IF4A 4RORA 4WKCA 1FXWA 1VG1A 4XOUA 3L0OA 4LNHA 3B3JA 1I51A 3LVBA 2GBIA 2L0XA 3I39X 1ZDMA 2CJPA 2XCSB 1J5XA 3ZY3A 1AMOA 3MIIA 1YE3A 2G04A 1OH6A 5AM1A 5MF6A 3C1TA 4R0VA 1QDEA 1VSUA 1QJCA 3MJRA 3C3MA 1TO6A 3LUHA 4WNIA 1QK3A 3MOIA 1BIFA 5DCUA 3ZXIA 1Y1LA 3U39A 3HS3A 3WGIA 5K5EA 2A1TR 1QVRA 2C5AA 4PZEA 3F3SA 2DFVA 4L7VA 1TTTA 1FYEA 3SHTA 1DAEA 1A27A 4ENUA 3Q7SA 3EPLA 3F5SA 2ILVA 4P58A 3E9RA 2M9MA 1IY0A 3FGNA 1WXDA 2GCEA 3OA0A 1X7WA 3R41A 1UJMA 4NK4A 5F1PA 3TD6A 4LRQA 4GF5A 5JAZA 2VSQA 3AZPA 1AGRA 2JI8A 4FI3F 4PINA 2YBDA 2FE4A 1II8A 5EJ6A 1R5BA 3DVRX 2C42A 3LWBA 3WKCA 1NG9A 1LPAB 1CUCA 2AOTB 2XD9A 3DFMA 7REQB 1QQTA 1EA7A 1EYZA 2C9ZA 3KLBA 1Y7TA 3NOQA 4ZCMA 5CCBA 3JTMA 2AH5A 2CLKB 2F48A 1OIWA 4EPWA 2BLLA 2A5DA 2ASVA 4ZARA 3EW9A 4L6CA 2IZ7A 2DCUA 4C3ZA 3A6HA 3DBVO 3U9TA 5AOBA 1R4NB 4RK7A 1OXTA 1OXSC 4BFLA 5C5DA 1OBHA 5IVIA 3EXHB 3HYSA 5ALNA 2FFJA 3GFFA 3EIQA 2A5GA 1PJCA 2P9HA 3IA2A 3UUFA 4EYQA 2QN2A 1PDVA 3Q3CA 1CETA 4HH4A 4FJ1A 4ZCLA 3A0RB 2Q5HA 3M1YA 1Q0UA 2AKYA 3WGJA 4BJ3A 4RD3A 4IVPA 2XGGA 5CJPA 3ILVA 3QUQA 4UNRA 3ZDRA 2RC5A 3I5XA 3FWYA 2PLWA 1WZ2A 1DBWA 1PYDA 2O48X 3DZ8A 2Z2XA 4FYKA 4YPFA 1E58A 5IJ0A 3IUMA 1JDJA 1QMGA 2I99A 2PZMA 4WT7A 4MKRA 3W5HA 4YX9A 4IDCA 5DM0A 5AHWA 2FPMA 1CUWA 1GYPA 2WM2A 1Z6GA 4MV1A 2WRZA 2Z5LA 1L8OA 5IXSA 3IBTA 2IZ5A 1XZLA 3H3FA 4IYJA 2XR1A 3NC4A 3U26A 5IH7A 5TS2A 1UEIA 2HPZA 2ZB2A 2VPTA 1U6KA 1R4NA 3L07A 1DAIA 3EZYA 3HUEA 3P7MA 1D2HA 3SLGA 3LVRE 5KSWB 4YDRA 3JWJA 4C7KA 1DEAA 3CZ9A 1MB2A 1VYTA 3G5LA 1WW8A 3VPDA 1J25A 2NQ2C 3FPKA 3FYUB 1IM5A 1GEGA 1C4OA 2CXQA 1N5KA 2NV2B 3NBFA 2SECE 3S1AA 2A2ZA 2HRQA 1VL0A 2IHBA 4O0MA 5FNVA 1P5HA 1E1RD 4OUDA 3D6UA 1ESCA 3EFBA 3WB9A 3OY7A 1V1MA 1GEEA 5PNTA 3ZIAD 1JLLA 2DLCX 1FTGA 3LCMA 3QVWA 1U2DC 2JJ2A 2JAOA 4BVAA 4C89A 5AVRA 2YWDA 3N87A 2XZDA 4D8WA 1CVRA 2GM5A 4AL4A 3D0KA 4BWFB 1DCTA 2GF0A 3KWLA 1JBKA 3EFHA 4P7KA 3P9KA 2XE6A 4W9RA 2BMDA 1A9XB 4KDRA 3P1JA 4KREA 1YGPA 3PLAE 4Q47A 3TR5A 1DPFA 4BMXA 1CYEA 3N0XA 1SVWA 2HHHB 1PJLA 1NLYA 2YWXA 4OU5A 2P30A 4I55B 1NAIA 1GSIA 4OQEA 4LJSA 3SXPA 4C6SA 1T8PA 1TECE 1N8KA 1WSDA 3JVVA 4KQJA 5J4YA 2ZBPA 1E18A 4DR2B 4AS1A 1NYRA 2O2DA 4ZGWA 3IKMB 3L43A 1VJRA 2QMZA 3ESQA 3NTOA 1VHJA 2A78A 4TL8A 4U7JA 4HT3B 1CFJA 4PYQA 2TS1A 3L1UA 4Z6KA 3GJXC 4D8YA 2J6HA 2Q2QA 4WK0B 1Y0BA 3G3EA 5EKUA 4PGMA 2XAUA 2DFPA 3A6KA 3TLGB 5FPPA 3E7WA 1GQ2A 3GEGA 1EM8B 3BHJA 1N7IA 3DD1A 3FM9A 3K96A 3LX8A 3PHIA 4QYXA 4XR9A 1CLEA 4YALA 2NOAA 5CB8A 1ZOSA 3PDJA 4RBNA 4AKIA 3BFJA 4ALIA 5IASA 4XGKA 1GLNA 1R4ZA 3UMYA 1Z0AA 2AR0A 1L4GA 1QHYA 2GF2A 3GEIA 3P4XA 4IHKA 4Z4CA 4MQEB 1Z0DA 4EFDA 1OX6A 3TTTA 1W44A 4DDKA 4MIKA 3NIGB 1BFDA 4M1WA 1XEAA 1AXEA 3HK2A 2IOFK 1TCBA 4YCAA 5CVUA 3LA6A 3OKCA 3UOGA 4MH0R 3S8EA 2G80A 1S7CA 1RYFA 1Y8QB 1Q92A 3A9TA 3HR8A 1XZQA 5DP1A 1EDOA 5IRCD 4RIHA 3UIEA 3WHPA 3NPAA 4EHKA 4C20A 1FMJA 5NULA 4EPYA 3T3OA 2VVTA 4ZOBA 3R5KA 3WV5A 2EGGA 2VDNB 3OURA 1ZWKA 5TVGA 3TEFA 3TI7A 3HNRA 2EQAA 5BVHB 1SXQA 4M22A 1T29A 3OU7A 1RVV1 1YCFA 4D9CA 5L8VA 5MFZA 1OFGA 5BUSA 1UMDB 5K45A 2R4TA 3FF1A 1HLDA 4XYEA 2A57A 1C9JA 2J08A 2PZJA 4OB7A 5E6UA 3WYCA 1PUXA 2CLHB 4E22A 2F1OA 5IZ4A 3ZDAA 1K5DA 1BAPA 3LUPA 5JNSA 3QSYA 1R6DA 3X1XA 4KQCA 5IC5A 2BISA 2GZMA 5IKMA 4MDYA 3TQRA 4L22A 5HBGA 2EEPA 3JD2A 4RF3A 2BC9A 1X7YA 3TW0A 5TMPA 4KRFA 4PAWA 2OBLA 4RJJA 2YIDA 2JFBA 4TRRA 1LSUA 2XQFA 2BHTA 1DCMA 1ECGA 2IPOA 1WY5A 1HRDA 2CUNA 4BMVA 5A05A 1YZYA 4W7IA 4MKGA 5EZYF 3IOCA 2W8BB 3A6DA 4HQ6A 4O4IB 3TW6A 3VMMA 4ZVRA 4FOTA 5IFLA 1GFIA 2ANCA 1RYNA 2BEUB 1UKVY 3UOAB 2VTBB 3D7NA 3A70A 1QG6A 4HXEB 3H4TA 4UVEA 5G53C 2OAGA 4B75A 4JI1B 4IEIA 3COPA 3DDSA 4O08A 3CZAA 5H4HA 1I10A 2AN3A 1KKUA 1VIDA 2WWXA 1QZUA 1XCOA 1WV0A 2JBAA 2VNKA 1AB6A 1SHUX 2BRUA 3KHTA 2FP3A 2VYCA 2C20A 4L9SA 5DO9A 4PICA 2D74A 4HAYA 4H1TA 3GIDA 4MRMB 1L5MA 1IATA 5L40A 1RXEA 1TTPB 3DTTA 3WZ2A 3EZFA 2VDWA 3JCZA 4YQYA 2SKEA 2WY2D 4ND8B 3FFXA 4BQNA 5CFLA 2NGRA 3GD7A 2R0QC 4U0KA 1LRJA 3GVXA 3ZC3A 5C2JB 4EJ0A 4US2R 2EL9A 5T4BA 4MOWA 3OJEA 5D84A 1Q22A 4X65B 2Q7OE 2W00A 1Y34E 5AKHA 1FJ2A 1JFLA 2A9RA 4A8JC 1TM5E 3RYFB 1L7EA 3TSAA 5LN1A 2LW7A 1X1TA 2ZUFA 3I32A 4X54A 1AY0A 2D0DA 2HK8A 3HDTA 2CL5A 2G88A 1QKJA 2WE8A 3M5CA 3PUKA 1X1EA 4KBYA 3WK7A 2EKPA 4BC0A 4KMSA 4GHWA 1ZLYA 8OHMA 5A0TA 2WWTA 4JS0A 4Q6BA 5LP6F 4GPZA 4BDSA 3I4LA 3WG9A 3ZHRA 4EJ2A 3HZZA 2XNKA 4TKUA 5KYUB 3WMEA 3AC0A 1RM0A 3C4JA 3IEUA 4FLMA 2C1XA 2QT9A 2RGCA 4E3ZA 5C5EA 4HN9A 2G07A 4YCSA 3LKVA 5LD2C 1DO0A 1L5RA 1NXSA 1YI1A 5DBFA 3ZV6A 1XMVA 2DQZA 3PQ2A 4PLZA 1L5QA 2WTNA 3TD9A 4EDFA 1V9SA 2OZPA 4I4NA 3SYMA 2H5LA 2JGFA 1XZIA 3DMFA 1N57A 2CNDA 4LYYA 4S1WA 2A58A 3R44A 2Z9CA 4YMVA 3M49A 1GKKA 1HYHA 1W1IA 2HA6A 3LSTA 3SZLA 5J9FA 3WGTA 1WDTA 3UW3A 3DBHB 3VRHA 4GGMX 4N1AA 4E5KA 3DZGA 2OXEA 4E14A 4HK4A 3VDRA 3CF4G 5EY5B 3CH4B 2PUTA 4RH0A 2B7BA 3OETA 2ZU6A 5FPTA 4D8UA 3R3XA 4FU0A 1M2KA 1R0RE 2CK3A 3MRSA 4B0PA 2BIFA 2RDMA 3GO4A 2WPNA 2ODPA 3D6HA 1B00A 4MUAA 4EKEA 1YIDA 3MINA 1KZGB 3OQBA 2R25B 4C14A 2YMLA 1E7RA 2GZDA 4PSKA 1I8TA 1KGDA 4RJ2A 4BRWA 1OQAA 1KYIA 4JJAA 4E2ZA 4A8JB 4RABA 1FB5A 1NQUA 2WZBA 1WV1A 4EZEA 5FQNA 4OUKX 4UHFA 3Q9UA 1JT9A 3FNQA 4CQJA 2J9FB 2QD2A 4ZDJA 3W5AA 1PE0A 2RHJA 1F8UA 3PYLA 4AB1A 3LP5A 3PNBA 4FNGA 1QRUA 1LS1A 2J59A 3RYTC 4N54A 3W4KA 3WTCA 3I61A 5JHHB 3GFPA 1YBHA 4RPKA 3I6ZA 1YA8A 2KPOA 2DPGA 4PG6A 2UVQA 5HF5A 4QFDA 4BLPA 2QG9A 3LECA 1C14A 4A6XA 1W35A 2QGZA 4PRZA 5K3SA 4BKRA 4NJMA 5DM70 2A1UA 3C6KA 4DB4A 2RI1A 2ATVA 2BJWA 2QSZA 2QF7A 4FR5A 4RTMA 2EGHA 2WTBA 5FQOA 1TGVA 2C98A 4I0WB 1U1GA 4CODB 2PX5A 4MX8A 3QU9A 2AN1A 4MVJP 3R6TA 2JH9A 4F96A 2GEVA 3VR3A 1XJQA 2C7GA 1GCIA 1KSFX 1TB4A 4JX8A 4Q24A 1FUYB 3EHDA 5H7XA 5BY2A 1B8OA 5CLJA 3VR3D 2D6FA 1CY7A 3S1SA 4RETA 3A10A 1OF1A 1QVVA 2CBGA 2QQ5A 3GFGA 4TMKA 1GWNA 2FK8A 1EINA 2FETA 2HXGA 2JHAA 3VDNB 3ZWPA 3U56A 4Z2AA 3G23A 5H1YA 4OHYA 2HK6A 4TYQA 2YIMA 1JDPA 1THGA 2VF5X 3FGZA 4RIEA 3SYKA 1I6LA 4ZK2A 1XCMA 1JTEA 3CPEA 2FZGA 1TAGA 3QI2A 1RM3A 1L5YA 4MWCA 1JA0A 4LZAA 1V2HE 4EFLA 2FLVA 1P0FA 2E4WA 5IDWA 4D3ZA 1GNPA 3PFCA 1BH2A 4C06A 2P67A 2OO5A 5CIWA 5F2OA 1XZHA 2V8BA 1MFZA 4BLQA 5M29A 2H1WA 3AF4A 4BEWA 1N2XA 1N5DA 2BEKA 1GNSA 5F5NA 1U8FO 5CNKA 2QUHA 3DYIA 5T6BA 4N9QA 2PXAA 5HSGA 3TLAA 3Q98A 2KSQA 3UMVA 3QWAA 4MVJF 3CX8A 1YZNA 1XKTA 4KNVA 4M76B 3WDLA 4COOA 5A5FA 5BV2P 2M6LA 2PGDA 4FFRA 3K72B 1WJGA 2VUSA 1OLUA 1NV9A 5AVWA 1VCOA 5HUQA 1QNLA 4KE6A 4IKPA 5CW2A 4DR7B 4BEVA 1Z5NA 3CZRA 4IICA 1XXHE 4YECA 5DU2A 2ET6A 5GGYA 5IJ0B 1G18A 4RYDA 2X86A 3K20A 4DJ5X 1XROA 3AY3A 4QOEA 4RS4A 5LZ8A 1JEQA 4DQXA 1XLTA 2R66A 2VJQA 5CP8A 3DCIA 4UZSA 2AWNA 2O5RA 4UHCA 4TWIA 4M0PA 2FPGA 2WJ3A 2PS3A 2NXNA 5JASA 1XFDA 4DA8A 2FR1A 1KIMA 4AJEA 1A2BA 1JSCA 1Z2NX 2J67A 1R0ZA 4G41A 1V4VA 5ALIA 5TMBA 1E64A 3I6MA 2PBLA 4F6CA 3PC2A 4L51A 4CLRA 3AVYA 3DZDA 1G0OA 2FF7A 4JQOA 3RFXA 1K27A 1A2OA 2GJKA 5DGDA 3MMNA 2O1WA 4YP1A 2P6PA 1K8RA 1TQDA 3A25A 4WN9B 3RUDA 3T5PA 3A8TA 3HR4A 1KHTA 1YOVA 4ZHSA 1RIIA 2Y76A 1OILA 1ZISA 1N1DA 4CL3A 2PYIA 3P32A 4MHTA 4E03A 4HAUA 2X7JA 1F14A 4LVCA 4MUKA 2R6CA 4NU0A 3PHLA 4HSEA 5LA6A 5J4HA 5AI0A 1FIUA 4K6GA 2BGLA 3EZ6A 4FFNA 4XYMA 1K7SN 4B31A 3FH0A 4R9RA 4IM7A 1A7JA 1ONNA 4PLPA 3EMBA 1D1TA 3IGFA 2ZYTX 5E9AA 3CEHA 2HWKA 3EIFA 2LCQA 5KO2A 3C3PA 1J0DA 4PO1A 3AGPA 3FPEA 1JJAA 4D7AA 4FFPA 5A7GA 2I2CA 3AF0A 3ZBQA 2BGIA 3ZCXA 4DHEA 5I7WA 3NHSA 4D02A 1G38A 4FDAA 1ESMA 2PYDA 4JIMA 3H3XA 2HY7A 3VC7A 4H6PA 2BHLA 2VRBA 3D43A 3ODGA 3STHA 1PZGA 1OH8A 3QFSA 2AEMA 1W76A 4QODA 3R3ZA 4KZKA 3MCZA 1B42A 3K9GA 2QBYB 2HYDA 2QM7A 3R3YA 2VAPA 4M86A 1JKFA 1L0BA 1U2QA 2AI1A 4JHXA 7MDHA 5JVDA 4CL8A 4IJVA 1TCUA 1JKJB 1OE0A 2VJPA 2X0KA 2AYZA 5IU6A 4L75A 4URYR 5K8UA 3RF7A 4H1WA 2C4HA 2IE0A 3D2AA 3DA8A 2FSSA 4UM7A 4WACA 2GAIA 1WTCA 2DG2A 2DR0A 3KWMA 4FMBB 2EOAA 5DV9A 2A0XA 2FV8A 3KQHA 1W0JA 5TRTA 3T0FA 1PZEA 1W5FA 2WUWE 2XQIA 4LTMA 3CLTD 1GSAA 2N75A 4EGFA 5DHPA 3QHPA 1OZGA 3MS4A 2JCXA 1J7JA 2RKWA 2VJDA 4F9TA 1OYVA 4J2HA 2FFBA 4TV8A 3FTDA 4UAUA 1T4BA 1OVGA 5EHQA 2OHIA 4Z3OA 2COKA 4TYYA 1T3HA 1L8QA 3LT1A 1KS9A 2JHCA 1JEAA 3PC8C 4JT4A 4LJLA 1WVIA 3RSLA 4GXNA 4YJFB 3IULA 4UEKA 2WT8A 3HP7A 3D5EA 1A7UA 3VJMA 5BRJA 3QU2A 1GZ3A 5F9MA 3T4XA 1BN6A 5ILQA 1G8MA 2ILTA 1DRWA 3KT3A 1YA6A 4R1TA 1MIOB 2WPDA 2IEDA 3THSA 2IP4A 5AM2A 4XKJA 5FV7A 3NGLA 1QIEA 2DLDA 2QPOA 4LVUA 4F56A 3W3ZB 1WKBA 4MUHA 4ZI7A 5AXBA 2ZTMA 2YDYA 5HKLA 1V3QE 3RC2A 1JSZA 2MMGA 4BFTA 2AFVA 3V8EA 1R8QA 1YOBA 2Z2KA 3PGMA 2AZDA 3H1TA 2PGLA 2RHCA 2AMLA 3RAJA 3FNIA 2V03A 5JI2E 2ZANA 1EWRA 1XZCA 3OLZA 3OPYI 4PZZA 2ONZA 3WGZA 3HH8A 3PDWA 3U37A 2WIGA 3LPCA 2BGGA 3ZQ6A 2FMTA 4ETWA 1WEKA 1NF2A 1CY0A 2IYYA 3L84A 1WBJB 2G4VA 3RKUA 1NMZA 3QGMA 3FGOA 1EESA 1NY6A 4OV6B 1OTXA 3LUDA 3TEMA 1USGA 1HORA 1VA5A 4TL6A 1OASA 2BDEA 3BN3A 5GP1A 1PWYE 3GVIA 3RG8A 4WKNA 3ULKA 1T8TA 2DBVO 5KTMA 4BCBA 4KV7A 4RF4A 4UARA 3WQQA 2C2HA 2EF0A 3IT0A 4OLFA 4Q9AA 3NTLA 2W93A 3G2MA 3SD7A 3AM3A 3GR6A 4DTCA 3JVDA 1GLGA 2CVZA 4RCVA 1WZEA 1TU3A 2IKSA 3QLTA 3LDGA 1CZUA 4I8DA 3WL3A 3PWSA 3EUFA 1ZG3A 3H7AA 4FFMA 4G84A 4IY1A 4NCJA 4WXPA 4ZYWA 2QY6A 2CLFB 4D8VA 5TF4A 4J1TA 2HIGA 4QDXA 4AI6A 4EF5A 1ISMA 3UGTA 4HUJA 1RXSA 3PL5A 5KNLA 4BQOA 3R7BA 3H9JA 4CTOA 1EVJA 2AVDA 2YV1A 3ED5A 1DVRA 5F9HA 5JZBA 3T12A 3LCRA 2J9ZB 4CMIB 1N92A 3KSBC 3WIVA 1ZGBA 4JNCA 2D7JA 5AK4A 3I05A 2ZCJA 3CF2A 2FZKA 4QU9A 1PBNA 4Q1CA 4UM9D 3WWEA 1B0ZA 2H1CA 3F90A 3R7AA 1JPNA 1L8AA 1C9KA 3AJ8A 3LCUA 4HFNA 1WQ1R 2GWRA 3CX6A 2EWVA 5FBWB 2QSUA 6REQA 3IEMA 4O2BF 2JEYA 4F85A 1BHQ1 3W2EA 1L6IA 1I30A 2XNDD 4DBZA 1JR3E 4MGYR 4KIGA 5I7HA 4CF4A 2PEYA 4JVSB 2XUQA 1JDZA 4DAEA 5G0SA 3R8CA 2XNDA 5KTPA 2JJQA 1JVSA 3ZGYA 3S7TA 4DWVA 2HJGA 3INGA 4I5IA 2GFHA 3UPUA 4BLOA 3FUTA 4ND1A 3AEKA 2NZXA 1QZ3A 3B6MA 2O7RA 1DCFA 2CDRA 2O6LA 2WTMA 4YDQA 5BN1A 1VIAA 3LLUA 2GAJA 3GLHE 3ANSA 3NDBB 2ZUTA 4J07A 3UMSA 3K1AA 4EY4A 1MTOA 1EB8A 1JEEA 3IP1A 1XEXA 1E61A 4UEQA 3BAZA 1WMAA 3GCZA 3VOSA 2OE2A 3AR8A 4YJ2F 2HF7A 5KOJA 3FXAA 3VJLA 1OTYA 1RM4A 1SURA 1MEEA 2QD3A 3QY0A 2CZGA 4PX9A 3WKEA 4C03A 1GUZA 1IPHA 4QVKA 5EJAA 2G67A 2QX4A 1ITZA 3E84A 4WGFA 4QYIA 5AM4A 1Z75A 1Z2OX 4ER6A 1M73E 1JS1X 4K1LA 1KEPA 2ENWA 5EEHA 4CV3A 4F3RA 5KYYB 4QPCA 1E1QA 4IH1A 4E5YA 4D5GA 5GIPE 3BK1A 2AQKA 1HQDA 1M72A 2VT2A 3I8OA 3VI3B 5FL3A 1KVUA 3K0HA 4ZVMA 3N6XA 5HIJA 1R9GA 1QF7A 3D6JA 4RADA 1T9ZA 3TINA 4U7GA 2IY7A 3VX3A 5CCXA 4NH4A 2XMSA 1T2NA 3PJEA 2HV8A 5ERXA 1PUJA 4DGSA 5LWHA 1ONOA 3N2KB 4XUDA 1L4KA 10MHA 1QFJA 2K2WA 5E4JA 1JEQB 2HSZA 2VYQA 2IHZA 2BTQA 2QPAA 4G5XA 4KQWA 4RF2A 3LLSA 1I4DD 4V0SA 1FVOA 5EZQA 2HEGA 5FI5A 5CA1F 2R1TA 4EF4A 3C6BA 3O94A 2Y1KA 1XEXB 1DKRA 1QQ5A 3KBBA 1UINA 2DQYA 1WU8A 4ENVA 1FCJA 3FUUA 3WL6A 3FOZA 3FROA 4JFAA 4JLDA 4ZZ3A 2NUTB 1EZ4A 1KVTA 2H48A 1CF9A 2GSDA 2HWYA 3EC1A 3FJ1A 3KWJA 1WAMA 3K31A 4P3PA 4Q02A 4HAWA 4KGDA 5BSVA 4DLYA 1F9AA 3TLBA 5JCOC 2R1VA 3GAAA 4MPRA 1RWKA 4YRPA 1V37A 3DQPA 4J9VA 1NBWB 1T5OA 1T9GR 3LPAA 3RBZA 4PFJA 3VH3A 3OE1A 2BI8A 3CURA 1BX3A 4Y2JA 3V80A 1QM5A 5BN3A 1WF6A 1H69A 1KTIA 5BSMA 1BYUA 3F1LA 4MP3A 1L7XA 3GP5A 3SHVA 2BH9A 1GDHA 3NHLA 1B16A 4U2BA 3L8GA 4YJGA 3NWPA 1E7MA 2ZSJA 2YY7A 3I1YA 1OKKA 2L42A 3PXBA 1AUXA 4Q82A 5AKLA 4KAFA 4C30A 1VBFA 5M34A 1UC9A 2Q4DA 4ZT3A 3Q0EA 4GYYA 3BFVA 1HUQA 3E53A 4E33A 2KHZA 1VJ1A 3FPGA 3GEHA 4LCBA 4RSGA 3PCXA 1GN8A 4N3GA 1P2DA 3HGMA 5G4KB 3UMBA 4IV8A 2Z8YM 4I2VA 2EFDB 4MHOA 2HNBA 5AVQA 2AXEA 2OLKA 2XQGA 1JU4A 4LMPA 4Q3OA 2C3PA 2P6NA 2O8FA 1PEYA 3C85A 2A88A 3FSRA 4BKQA 1GDTA 4IZHA 2YN0A 1Y6JA 3CW8X 2X6TA 3AW9A 2W0MA 1AOXA 1AQLA 4Q4AB 2P4EA 4RA9B 1UQRA 2VNIA 2R6JA 3Q8XB 4PX5A 4C7XA 4ZQHA 1LV7A 2H7CA 5JZ9A 1O95D 2F1KA 3LHFA 2Q9CA 1S2LA 3FTNA 5C37A 4Y9SA 1G2OA 1Z5GA 1L5GB 4Q21A 4EZIA 1ISGA 2HX1A 3KZXA 4KI7A 1HSOA 4N5LA 5B2EA 2UYYA 2VYNA 3AJAA 5KYKA 4R9VA 3TH5A 3N7TA 4K86A 3KT0A 1YFKA 2VHXA 1Z3IX 1KI6A 4E1BA 4UU8A 3E05A 3OPYA 4FOOA 3S2EA 5I9IA 4C7OA 2H1VA 1UIRA 5LOVA 2HZBA 3LTEA 1TU4A 2NZYA 1J70A 1B76A 4QHSA 4OQYA 3EA5A 3C5EA 3HFSA 2EYQA 3I6IA 4GMGA 1CUZA 3IMGA 1S2NA 3AM1A 2GD0A 3ET4A 2P2CA 1HXHA 1H0HA 2BKEA 4D6XA 1Z06A 2GA9A 3KTAB 1ZJYA 3NDRA 1S7GA 3LLMA 4LE1A 5AVXA 2HZ7A 1QORA 3P2JA 4K9DA 3F97A 5BSEA 5LLTA 4ICIA 3L9XA 1B23P 3VHLB 1I5OA 3EJ6A 3HCPA 1R4MB 1UBMS 1RWWA 1DLIA 2QR5A 4UTZA 5FUYA 7AT1A 1DAOA 4FZRA 1EUCA 4KO3S 3HBNA 2FMUA 2EVWX 1RWMA 1KJNA 3MQ4A 1H4VB 4TV9F 5D7BA 4ZALA 4RY2A 5JSYA 3D8SA 2H4YA 3B53X 2QLTA 1X7XB 2FWPA 2R8XA 2DT8A 1XZPA 4EG3A 1WPGA 4OYLA 3BGVA 3EAFA 3MERA 1PJ2A 2EFGA 3TF5A 4ZQEA 3ND7A 4C2AA 3U0BA 2WFMA 3AETB 4X24A 1OJ7A 4XOIA 4XUEA 5C7IO 1FVFA 2YINC 1RP7A 4B45A 2VT7A 1NYTA 5JTTA 1P1RA 4M36A 5ETJA 1BCRA 5BSTA 2CHFA 3I28A 3DOUA 1SCQA 4FONA 4X8OA 4XYLA 4EGJA 3ROMA 3B6IA 1Z13A 1GRCA 4P3XA 3H9BA 4M0CA 3FWKA 4ODIA 5EWJB 5KYYA 1JEJA 3F7MA 3RSZA 4D0SA 2BZSA 5AVKA 3D31A 5LQRA 1RBYA 1Z0ZA 2RGXA 3LU1A 2Z57A 4IUCS 3ZW7A 5JEEA 1NMEA 4AO6A 5JPIA 5L3VA 3T7SA 2AIRA 2ZRGA 4DDUA 4XWTA 1DEXA 4LDPA 2XUOA 4LHVA 4MR9B 4PLFA 4WA8A 4E1VA 1X1SA 4QWWA 2P69A 3PNMA 3RYIA 2QG4A 4B7UA 1OLSA 3DKRA 2KX7A 3ZDCA 3M9XA 1LI5A 2LZ0A 1NW9B 4YMIA 4CKBA 3SHFA 3TLYA 4Y7CA 1GT91 1VSTA 1EK2A 2WSMA 3SC2A 1QKKA 1Y8AA 3FOBA 5IUKC 4N82A 3MD9A 3BF8A 1ZOOA 4P8RA 2QM3A 1C0PA 1L4UA 3SE7A 1DTSA 1XMXA 3AKYA 4HLDA 1PS0A 2XB8A 4JLVA 3VU0A 2FMKA 1HOXA 1M0SA 1Z6YA 1NA5A 4S12A 5JCZA 1TUIA 2QA5A 5EQFA 1XJCA 3QA9A 1QMPA 2FUG1 2O2HA 4R1QA 1SCKA 3D4LA 3L04A 3QHAA 3HY3A 4LV6A 4MI1A 5JCPA 4MW5A 2Y9MB 4NSNA 1DWPA 4HAIA 2G7ZA 5DBGA 2VTBA 5AKIA 2JLZA 3RIHA 4AM8A 1P4JA 4DR4B 4EATA 1HYEA 2R6AA 3QVVA 2PCLA 4KVFA 3U4AA 2Q0QA 3GT7A 2CYAA 2JFWA 3O2JA 721PA 1QC5B 2JVJA 3KYDA 2C07A 1KI9A 4DMRA 3T8YA 1JPJA 2LBPA 4UREA 3K6JA 3OFVA 1G8PA 3A4NA 4PNPA 4KJZA 3HR7A 2ZAMA 4ILKA 3B9RA 1AN9A 1YL5A 4LSZA 1NLFA 1BE0A 2WP0A 2ZIAA 4MUFA 1W94A 4JEIA 3UYLA 4YUYA 4HWOA 3R5JA 4BAUA 5BR7A 5ICMA 1U11A 3OQJA 4GL2A 3AJEA 5JV5A 3R5TA 4Q4JA 4AN1A 4MLDA 1GYQA 2V0CA 2Y68A 2L2QA 5K6AA 4NBRA 4JP5A 4TTTS 1CNFA 2AQHA 4U7TB 1DXHA 4FQ5A 1FFSA 1T1SA 4B6SA 4QGHA 3TL6A 4KLRA 2VK2A 5CM9C 5KYXA 3U81A 1I6MA 3UWSA 1OH7A 4G0WA 3EK2A 4LA4A 3ORFA 1ZN8A 4XQCA 3A6EA 3OP4A 4YPVA 3H6GA 2Q5LA 4II2A 1TC2A 2HWUA 3S44A 5HJ5A 1JVBA 4BVGA 5JRZA 1VZ2A 3U6KA 4R71A 4YRSA 5EPEA 4NAUA 1NXOA 1VYHA 3BFKA 3QEOA 5SZJA 4HNUA 1A8IA 4D4LA 4JYAB 3W6PA 4RK6A 3QXXA 3E4CA 2PPLA 1TGYA 1NTRA 4MROA 3WGNA 4Z49A 4EPRA 4K9RA 3U3DA 1G2IA 4CYMA 5CYPA 2O5CA 5C4IA 1JAZA 3O4VA 2YWRA 4KQHA 4LJ8A 2V7VA 3KKKA 1XWWA 4PLCA 2Q1WA 2VSNA 2CK3D 1VJCA 3L0PA 4V0RA 5AKKA 1HI9A 2GN1A 4D46A 1H1TA 2GN9A 2RONA 3C4QA 3T6KA 4DRXA 2Q6TA 2Y1FA 4YXWA 2XPCA 1LDBA 2ZREA 4K28A 1LFDB 1RIFA 4DV7B 5A5GA 2YWHA 1JEYA 1JF8A 1SKUA 2O54A 2NW6A 1ZM2A 3HWRA 4MMXB 4ND5A 1W19A 2QK4A 2O52A 1TKCA 3QBTA 4L95C 1RQPA 1CIJA 1EQUA 1A7AA 3NUZA 3E9MA 3ZDXB 1N3YA 1RJ9A 1UBSB 1SOWA 2W6JA 2JFHA 4QDTA 3I3SR 3HKBB 4Y2RA 1TUBB 1ZUWA 1J2JA 3MWKA 3MWEB 3JD3A 4Q0MA 5BT9A 2GZ1A 2YUIA 1NX9A 3F67A 1FEZA 5SZIA 2Y27A 4PZYA 4UAGA 1SOMA 3PWKA 4J91A 2BGWA 5LMCA 1UBTS 2XUKA 1SUPA 4L8FA 4M53A 1J0BA 1Y81A 2XF8A 1Q3HA 1QRRA 3BJIC 4URZR 3BXZA 3S2SA 5A3JA 5BW8A 4PCLA 2OG2A 3RNOA 1EG7A 3DZCA 3C5VA 3PR1A 5K1ZA 1DC7A 3DHYA 3Q9SA 3V4PB 4EPXA 4XIIA 4IZ6A 2V4UA 1ZUNB 4ZT4A 4FKMA 1PV2A 1XJWA 4ZP1A 5K3FB 1N0WA 3TEJA 2P91A 2J48A 1XXHB 3M33A 3PA8A 1GO2A 1NXXA 4B87A 3GJRA 4TN5A 3C3AA 1NW3A 2GHRA 4ZANA 1VPEA 4A4DA 3TKAA 5LQUA 3HA7A 3GLIA 3NRCA 3TKYA 821PA 1T35A 2OBYA 2IYUA 2WIFA 4FMCB 1KMMA 1T2FA 2DR3A 3M6FA 3N0RA 4PC2A 5LPNA 2G5PA 2KJQA 3DUFA 4LNAA 5FTNA 4D80A 3HU2A 2AGVA 4FTWA 4XLTA 3TNYA 3DEFA 4BNHA 5DNUA 4RULA 3I8XA 2CKMA 2PE5A 4CDMA 1EFRD 4L4YA 4DM7A 1VB5A 3OU6A 2ZYGA 4QEDA 4A8JA 4Z7OB 1N8NA 2AG1A 1ODCA 4RACA 3U3OA 1S89A 3RT7A 3WB2A 3GCXA 4NE7A 4ZZ2A 3TAXA 3SXUA 4MO9A 5JROA 2V3VA 1FP2A 4QRHA 3NS7A 3UA4A 2IOFA 2QL9A 3P9RA 4B71A 4DJDC 1D9ZA 3EQ6A 4DQ0A 5A6SA 5EHXA 2OA0A 3ILXA 2V7QD 4BX8A 3ZJVA 2BMVA 4ZCSA 1E2PA 1QS0B 1BD3A 4X1KA 1N2CE 3SJ7A 1UC4B 3W2IA 4NYJR 3CLHA 2O2ZA 4EG4A 2QQGA 4Y98A 4EARA 4KQXA 5DNWA 1BX1A 1E96A 1JYSA 1KDRA 4G8JA 4KGVA 4OSEA 1USUA 5EVJA 3V2HA 3ZDZB 1EK0A 5JC1A 5DYIA 3F3MA 4AMBA 2PZLA 5ALWA 2DGDA 4KKVA 4MGEA 5KVVA 3WNDA 3D5QA 1G21A 3BBLA 3R5XA 5ICCA 5K3OA 4A0GA 3MWJA 1SA0B 5BYJA 5K0ZA 3GP8A 4CL0A 1E7SA 2FH5B 1L7BA 1SB9A 2AR9A 3RSGA 2C4VA 1JI3A 4YCLA 4GXRA 4YAOA 2GCOB 4KRYA 1W52X 1WOYA 3GJ5A 4GBMA 4F7DA 3B3AA 2I33A 1OIVA 1J9GA 1NW8A 5GZ3A 3NHPA 1NL3A 1NVBA 2BJHA 2CLCX 3DDNA 3JQFC 1A9PA 2BBTA 1EUDB 1SA0A 3F5DA 2EP5A 3AHIA 4FT2A 5K0FA 4B80A 3RAPR 3QPBA 1NGSA 5BWNA 1KF0A 2H7VA 2NAPA 2OO5C 4RWZA 2OCAA 3QOXA 3S2GA 3SVZA 4WK2B 1AKEA 4JLJA 4P08A 3SZ3A 4GMDA 1XZGA 2EBFX 3KALA 3GK3A 2ODNA 1NR5A 3MJFA 5JBNA 4UBLA 1TKRA 1C81A 4TKZA 4JQYA 3GVCA 5MFPA 3WNQA 2GYVA 2ZE5A 2X1VA 5PGMA 5B3LA 2G71A 2BFNA 3KZNA 3I2HA 3T7RA 3WLKX 4LHWA 4HCJA 2PVCA 4CE6A 2CHQA 4D0RA 1UQTA 4P4GA 4DC9A 1VA4A 3GQVA 4G81A 3B48A 1B0UA 3HB7A 3T9CA 3IAM1 4J0IA 1N32B 1XPRA 2NXWA 3NT4A 3I9JA 2CL7X 3ZR4B 3I45A 1GARA 5BYAA 2JBAB 4NESA 4G8CA 4M55A 4MAMA 3S5JA 3CKYA 6NULA 2OHXA 3DW1X 2I0FA 3AL3A 1AIPA 1V7QA 3N8DA 3NOOA 1CY6A 3A1CA 1WQ3A 3WISA 2FEAA 5HS6A 3NT5A 3T5MA 3ZWQA 1GXSB 1BW9A 1C7RA 2GK4A 3IODA 3QFTA 2FK7A 2F62A 4WLOA 4GKBA 2B3TA 2J9GA 4ITVA 4WXYB 3T61A 1MENA 2R79A 3IXQA 2J3JA 2NSYA 2QW8A 1BQEA 2V7EA 3C8DA 3NKFA 3GLUA 5DW3A 2ZZKA 3IDZA 3IXMA 3KFVA 4US0R 2FZ4A 4PVCA 4ESVA 1E9DA 2ANBA 3QVJA 4CNBA 5HX7A 3LBAA 1MN6A 2NV0A 2YVLA 3CCCA 1JXOA 2CCGA 4Q48A 5G0TA 3QWIA 2WYUA 4XZ3A 2FFAA 2WAMA 3TSWA 4MRNA 4RGQA 5ICEA 1K66A 4R8RA 2YW9A 1OFVA 4BWGA 1Z4MA 2UXBB 1YBAA 2IHKA 3K3PA 3HKCA 1UMCA 3PDUA 5IT4A 1W46A 4AY6A 2A92A 4YRKA 3H18A 3VPSA 3AR6A 4PC1A 1MP0A 4ZI2A 1EVQA 4UHBA 1R0SA 1TFRA 2QM0A 3T4EA 3MJSA 4HZUB 4WPGA 4PWZA 2QTCA 3LY5A 3M4XA 5BOSB 4B6PA 2UZ4A 1CZLA 1U8YA 3OOYA 2J8ZA 4HEA1 3R7LA 2EZ8A 1UWLA 2CNWD 3H9QA 4CM8B 3PVZA 2DPMA 4NPCA 3ZLTA 1WW3A 1NRIA 2IEBA 1VMKA 3FDXA 2WPDD 3ICPA 4QRDA 4HDAA 1GQOA 5FBKA 3RAFC 2O2CA 2ZFUA 3IYLW 4WKGA 1JQLB 2OK8A 4G0MA 1ENPA 2HL6A 2IX9A 2QTZA 2V0NA 3LT5A 4O59O 2VXCA 2YX1A 2GPTA 4WNCA 3PUHA 4B3JA 1REQA 3Q2KA 4WH0A 4M7OA 4JA0A 2C0QA 3MJDA 3KDAA 2VBCA 2WVJA 2H5IA 3NV7A 1IM2A 3IRVA 1UPFA 3N70A 2B69A 4RQAA 3U7GA 4F6LA 4W8GA 1G9TA 4ZI7B 1E1CA 1N5IA 3PJDA 3V4OA 2OFFA 1OWLA 1KORA 2F43A 2BEWA 2X2OA 3K8ZA 3QYPA 5AHRA 2XKKA 3D8UA 4RM3A 4X9XA 4QOJA 2J9RA 2VDQB 2B8NA 5F2EA 3DVSX 3F4LA 2VH1A 1W7AA 5GTDA 4WBXC 3TDMA 1YO6A 2PMDA 4QQKA 4AJKA 4MWDA 1AUQA 1T91A 3CXUA 2O0LA 1MFPA 2YMMA 4FVTA 4BQPA 3B3QA 1X92A 2F64A 1M83A 1P33A 1XE3A 1JNXX 2Q3FA 4LE0A 3H05A 4FNOA 3TLGA 1AXRA 1RXCA 4BKUA 1WCIA 2JGLA 1V8BA 1VIVA 2HCJB 2WILA 4OKIA 4BMPB 5A4DA 2OBNA 1DEHA 2IZZA 3OPXA 3AUAA 3L7AA 1TEHA 1ZI9A 2J6IA 2GD1O 3FUVA 2CDNA 1ZEMA 4FEEA 4MW4A 2WNHA 1Q1QA 4OAOA 2WNIA 4RZUA 1R0XA 3L77A 1I3OA 1PJTA 3CSUA 2PT5A 3FSGA 3HB4X 1QSGA 4JXZA 9ABPA 4RPIA 5HIIA 5BR4A 1Z5OA 4TLBA 2QLJA 4FYWA 2BDTA 5JNLA 1UXJA 1GPH1 2QORA 4TGLA 3VKUA 1NBAA 1XTUA 1Z7EA 2H1HA 1BU8A 2JFYA 3LDFA 1HT1E 4ZOLA 4Q7KA 1IZ9A 3NYWA 4RUKA 4HNSA 1ZK1A 1IUPA 4KFRA 3WYEA 1CQPA 1A9XA 5SY4A 3JQBC 3EWAA 1QNFA 3KG2A 2XI4A 3VKGA 4DMCA 1FP1D 1J39A 3UUEA 1VL5A 1Q1AA 3LA8A 3A1FA 4FWBA 5CYOA 5KTKA 5L95A 4DA4A 4B46A 4X1IA 2XRZA 2DKFA 1J1IA 2XXAB 2A5JA 1WBBA 2POQX 4RHXA 2R7MA 1FMTA 1JQ5A 3UJPA 3WL7A 2XWPA 1JHXA 3S1LA 1PG5A 1UJNA 5LQAA 4ASUD 4OMUA 3W3AH 3KQKA 1K9VF 1ZN2A 4M1SA 2EG5A 2HT1A 3GJ0A 3K0KA 5J2TB 1WKVA 4JP8A 2OFXA 1ZL2A 3L6RA 3N0WA 2BBSA 3IUQA 4XXHA 5A7FA 4S0XA 2NU8A 1X0XA 1Z6PA 3TZCA 1V8PA 4TQ9A 3TFWA 2Q4TA 2BFDB 3T7EA 1YFZA 2VQSA 3LD9A 1O94C 2BMFA 2YMQA 3ZCUA 5CB4A 2OXTA 1SU7A 1NATA 1XZNA 3Q1KA 3ZWMA 2FQWA 2MOKA 3VAYA 4JSTA 4H6WA 1ZQ9A 1W5AA 1DBQA 2QV0A 2YUTA 4QZVA 4WN9A 2UYQA 4KK3A 4IZIA 1CQXA 1T4CB 4MXDA 1R9MA 1TCAA 1H8HD 3BD7A 1QGYA 3LCCA 4BATA 1DQRA 3KXPA 2FF5A 4N5HX 2C4KA 3ZK8A 1T13A 4MIYA 3QWBA 4OMCA 4KQIA 5FNVF 3KOWA 1E6UA 4F8JA 1P1FA 1OYYA 3I76A 3QE0A 3SZGA 4F9FA 4UFPA 1KYZA 4GUDA 3ZCQA 1U81A 4X1OA 1F3LA 4J76A 4R7GA 4GX0A 4FBMA 1K0UA 1LGYA 4BP1A 1E6MA 4IINA 2WVHA 2VZLA 3E4DA 3FUCA 4EMBA 3KEMA 1A8PA 4L16A 4GX1A 4G4SO 3WA7A 4LISA 4OP3A 4Q3NA 4FB5A 3OF5A 1C1HA 4QYIB 3C8UA 4ZOEA 2GN0A 4QPDA 4H6VA 3O95A 4YRMA 1X3LA 4OFXA 4WMLA 1Q0TA 1UDCA 1GUFA 1QYIA 3H75A 4MVJM 5DTIA 3HKDA 3TTYA 4YCNA 1R8SA 2WV7A 2NTYC 1CS4C 2ONKA 1XJ5A 2PL5A 2YZ7A 4LNUB 4ZAWA 5FUWA 1ZZEA 3BWMA 1IBRA 3O93A 1P60A 3V48A 4EJ6A 1PYOA 2FUG6 4AFNA 4OIFA 1ACLA 1DBVO 1NJ8A 4IHJA 4KN8A 4A0FA 3GA0A 1RXWA 2CV0A 2IS1A 1EAMA 2BCJQ 3LIIA 5AK6A 4Q3KA 1PFYA 3ETEA 3PC7A 4QJ4A 5EGNA 3UB2A 3WP1B 5EE0A 2JH8A 1RLJA 4BU1A 3GFOA 1ODSA 2PKQO 1V39A 5KI6A 1GR0A 1OC2A 2MSCB 2YFKA 4INPA 2HT6A 4LRWA 3G0IA 3TB4A 4AICA 4C5BA 4LXIA 4Y1RB 5D6OA 1D1PA 5BR8B 4GLFA 2NSDA 5EWLA 2Y77A 1F60A 1AU9A 3L3BA 5ER9A 4E5SA 1SXJA 3RYCA 4EMUA 5TB5A 5GOTA 3ZXYA 2R8ZA 2DPHA 2PNJA 5B12A 3AY0A 3UXEA 3QV2A 4L50A 2IF2A 9LDBA 1NQAO 5K9ZA 2XVZA 5K3FA 4UUOA 3SU8A 4BU0A 1A2QA 1Z2AA 2IXTA 3REQB 3A1NA 1HFEL 2B4YA 2OCBA 5LQMA 4IH4A 4V3BA 5TEWA 4GZ3A 1WDLA 1XL1A 3VMFA 3X1JA 2VCYA 3VNAA 4C5CA 3FVVA 5IXJA 3I9FA 2SCUB 3O6VA 3W34A 5IHXA 1AQUA 3CLRC 2D1SA 2A1UB 2GLXA 3BBPA 1MJGM 3OHMA 4I4CA 2OXFA 4NL4H 4EYGA 3WMGA 1J0EA 1A77A 3TOXA 5DLEA 3GLIE 3PYMA 1Z5ZA 3F2IA 1YQTA 5J47A 1H2WA 5DMXA 2CHUA 3IVRA 3RDPA 2BMAA 2H2IA 2INGX 3MJCA 4FSXA 5AK0A 5IT0A 3T3IA 4UCFA 4MW9A 3MK31 4A3SA 1Y9ZA 2ZJ7A 5F78A 3V7WA 1M6YA 4ZTUB 5REQA 3STUA 4NDNE 1FYXA 1KIAA 2PS0A 3NATA 2I3AA 3MLAA 1MG5A 2WHXA 4YJGB 4BMSA 1MV5A 1XCGB 2AEEA 2QB5A 3PNQA 4D25A 4XGIA 3TMKA 3DC2A 3DO6A 3DLTA 3MQFA 4U63A 1M2WA 3AK4A 2H07A 2WQZA 4GMKA 4U5QA 3BMNB 1A8UA 4KWHA 3FTFA 1WZIA 4AZSA 1KYWA 2IQ5A 4I1IA 1TM4E 4Q1BA 2YVQA 5A5DA 3JX9A 3X2EA 2AF4C 4DIEA 4TSFA 1T9CA 3D8TA 2W4MA 2YZMA 1OPXA 1JR6A 4AC9A 3H8WA 5CNIA 3NHWA 3CVUA 5JJKA 3GT4A 3W6NA 4BVHA 4UASA 4HMPA 4UQPA 2ZGVA 5CMLA 2QTVA 2JFQA 3OIVA 4CDRA 2HK7A 3QJ5A 1DFIA 1RRPA 4U00A 4DLZA 1HFJA 1DKQA 2VIIA 4DLAA 3TZBA 1BVRA 4M54A 4KSCA 2HA0A 4UW9A 2JBHA 1V1JA 3FNRA 1Q15A 1EX7A 4LQDA 4YAGA 5EGSA 2GLTA 4JMPA 4W7SA 2C88A 4M1EA 4C4ZA 1N7GA 2CNOA 2I2BA 2V7GA 3ON5A 3UJ9A 5KINB 1M6EX 3N2KA 4YO8A 2ATEA 2IYEA 4QO7A 1K5PA 3P9XA 4Q1VA 5IBPA 3PTZA 5MN6A 1C9NA 3L41A 2EATA 2YJ5A 1K75A 3NH9A 4QIHA 3T35A 4ALJA 4DREA 5F7OA 2PSDA 3Q8MA 5F3DA 1H2FA 3I2JA 2Z9DA 2DHEA 4XDHA 2RCYA 1K3UB 2UZ3A 1N6LA 1XT6A 3M6UA 1KK1A 1IXRC 3I6BA 1A9OA 1TK2A 2FSGA 2PSHA 1J23A 1E8MA 3BILA 5K0LA 3O8CA 4JCCA 2AFHA 5H4GA 1CQZA 1JU9A 1U8UA 3C97A 2SKDA 3CW9A 4I8IA 1QAOA 1R1DA 3N5CA 4UPVA 4C1BA 4KJXA 3R3UA 1OAKA 2P68A 2PL3A 4F9EA 1U0HC 1XCPA 2CMFA 2IW3A 5EOVA 3LO8A 4QVIA 3ADOA 3EBPA 4MRSA 1SUAA 1XC7A 3LC2O 4JB2A 1LLFA 4RLQA 4DWWA 3VNQA 1DINA 1Z8NA 3DE4X 3GP3A 4RD1A 1LPSA 2VPWA 1AQYA 5TDHA 1CK4A 4FDUA 2DU8A 2O1XA 1HDZA 2XQJA 3OVMA 3WBJA 2WA1A 4LCJA 4HGNA 1MXFA 4ARZB 2HEIA 1FDUA 3OZCA 4PZ9A 5A4AA 3AEKB 5D8DA 4RHFA 2FMIA 2JZNA 3SGLA 1FQKA 2PTHA 2O50A 1KSHA 1JZTA 3LCJA 4P4TA 1EU1A 2JASA 3K9QO 2LWIA 3KEFA 4LKOA 1KE2A 3ACBA 3V1TC 1Y7HA 3VNSA 5ILOA 3FYDA 1P75A 3DW3X 4R2LA 4B3SB