4RK4A

Crystal structure of laci family transcriptional regulator from lactobacillus casei, target efi-512911, with bound glucose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
275
structure length
270
Chain Sequence
b'TGNIGVLVSRVTNPFFAGLFDAIERELHAHGYQVMITQTYDDPEAEERFLKQLKSRELDGVILASVEAPDRVMAVAKAFPGRVVVVNADVQIPGATSLVLPHYQATRDALDYLFNQGHRRFAYVSGGTISGAHHGQSRTQAFLDFMQAHQLLVAQDLLFGQIHTAKEGQAVGKQLASLAPNVRPDAVFTNSDEVAVGVIDSLLAADVKVPDDIAVMGYDDQPFAPFAKIPLTTVHQPVASMAAAATHELLKGLGRQVAQLHLSLKIRQSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LacI family
publication title Crystal Structure of LacI Transcriptional Regulator Lsei_2103 from Lactobacillus casei, Target EFI-512911
rcsb
source organism Lactobacillus casei atcc 334
molecule tags Transcription regulator
total genus 102
structure length 270
sequence length 275
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk4A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk4A01
1RZRD 5EWJB 4Q6BA 2LIVA 2RJOA 4G0MA 4OG2A 1USIA 4RK7A 5FWYB 1DCFA 5IUJC 3LUGA 3MYYA 3OM0A 3HO1A 2IPLA 4XLTA 1QKKA 3HVRA 1FFGA 2VUIB 2B1JA 1P8AA 2E4WA 4RWEA 4D74A 1JFVA 2A9RA 3IPAA 1SRRA 3F7NA 4MR9B 2FQYA 4KPYA 2FSPA 4RK1A 1WETA 4XAQA 5IBQA 1M5TA 3H5OA 3GYBA 2TMYA 3O2QB 3KTOA 1CHNA 1EWKA 1USGA 1ZH4A 3HDGA 3TO5A 1M2FA 3LUDA 3R0JA 4FE4A 4NQRA 5F64A 1M5UA 3E3MA 5JS2A 2IPMA 3D02A 2B4AA 1NXVA 2CHFA 3I5AA 3HCWA 4TLLB 2JBAB 1JX6A 2WJWA 3LUFA 4LDAA 3H5LA 3MA0A 4F8JA 1JHZA 1A0OA 3CG4A 3DZDA 3KG2A 3CLKA 3C6QA 5CNIA 4ZMSA 1U0SY 2FEWB 3LFTA 2FEKA 1ZHHA 2PAFA 3BRQA 3HZHA 4RV5A 4WXMA 4YWHA 4RK5A 3GA5A 1EAYA 4EY3A 3JTEA 4KK3A 3RVKA 1QO0A 2NT3A 1NXWA 3O75A 3RVNA 3H5TA 2PUEA 1ZH2A 1YS6A 2OQRA 4PYRA 3SAJA 3HV2A 4QICA 2HQBA 5GQSA 4Z4FA 1YVUA 1UDRA 5TQ2A 4DADA 3KLNA 2N9UA 4Z4CA 1LJLA 4ZMRA 2CD7A 3UK0A 3H1FA 5CNMA 4P1ZA 7ABPA 1NXPA 1YTUA 2R4QA 1JBEA 5CNJA 3HUTA 4KQCA 4RY8A 4YGXB 4F3TA 4HNSA 1VLZA 4Y9TA 2GKGA 1Z15A 2MSKA 3S99A 4JASB 4KVFA 3C97A 5JNSA 4RKRA 3NNNA 3CZ5A 1KRWA 3K9CA 4MS1B 3T38A 3ILHA 3ROTA 1P6QA 1MB3A 3KS9A 5D2CA 3C3WA 3IP6A 5DTEA 2O20A 4XASA 3LKBA 4YLEA 1DJMA 4KRFA 2GWRA 2ID7A 1TM2A 3O74A 4OBBA 3N0WA 3F6PA 4H60A 3DLBA 3IPCA 4F12A 2V0NA 3DGFC 2E4UA 3I42A 8ABPA 1QQAA 3LUKA 3LUAA 1K68A 5KQPA 3RVPA 4IMJB 3EULA 2FN9A 2GBPA 2AYZA 1DBWA 4F11A 3QELA 3OLVA 1TMYA 1SXIA 1VKRA 4G86A 2GX6A 4RY0A 2PUCA 3JVDA 5FWXB 5TQ0A 3M9WA 5TPWB 3OMWA 1ABFA 3MM4A 3QX9A 1GUDA 3QLVA 3Q15C 3RQIA 3JS5A 1JYEA 1MVOA 1FFWA 1MB0A 5BQ3A 4KK4A 4N03A 4TLMB 1U8TA 3KLOA 3O1HB 4IRXA 4NV3A 2Q5CA 5C5CA 1E6KA 1KMIY 2FVYA 4XXHA 4OTZA 5JNRA 2JVKA 2I6FA 4EVRA 3OQMA 5ED4A 1YIOA 3VNAA 1BAPA 4FB4A 1LK0A 3EQ2A 1GCAA 3CFYA 4MS3A 2CWDA 1ABEA 1DC7A 4H3HB 4PZ0A 2WY2D 1TLFA 1T34A 1W9HA 2L2QA 1D4ZA 2NZVG 1JDNA 1RZRA 2FTKE 1D2AA 3EDCA 4B09A 1Z17A 1PEAA 3CHYA 1D5WA 3DBIA 3IP9A 5CNKA 3C3MA 3BBLA 4EYKA 4MRMA 3F6CA 4RK6A 1L5YA 4FE7A 5KWSA 3CG0A 4D6YA 5KC8A 2H3HA 4RK4A 1MAVA 2BGGA 3CNBA 1H9CA 1LJUA 4XFKA 3SG0A 1PNTA 5KC9A 3O21A 4HYEA 3HM9A 5FBKA 2PKXA 3OO0A 2W42A 3BILA 3GV0A 1K66A 2PL9A 1RPJA 3QLUA 4LDZA 4MPTA 4Z99A 3I45A 2IDMA 1ZGGA 5KQMA 1GLGA 1KGSA 2VK2A 2HJ9A 3Q41A 3H1GA 5JNWA 1ISRA 3KHTA 1F51E 4RDCA 2KYRA 2QVGA 5E3JA 3EJWA 3IP7A 4Z4HA 4RXMA 2PUAA 3HJFA 5BRAA 2R25B 2WRZA 4YCSA 1L5ZA 3GWGA 3FFTA 4UHKA 1DCKA 4PE5B 3A3KA 3MF4A 5TQ2B 5DLEA 3H6HA 4NCBA 5TPZA 1DBQA 4Z4GA 4JP1A 3OQOA 1ZITA 1YMVA 5KI6A 3P9YA 3UUGA 4G0YA 5EWLA 1OXKB 5C5EA 4EYQA 4ML3A 2FMFA 2A9PA 3MQ4A 4MAAA 2QR3A 4W5TA 1LBIA 4KREA 2H0AA 3GT7A 4G97A 2E4ZA 1DP4A 3A10A 3ROFA 3RVJA 4W5QA 2GI4A 1PNRA 4O1HA 3RVSA 2PLNA 2IPNA 3HUUA 1Y1LA 1DBPA 2YHAA 3CZCA 2AYXA 1JWLA 4MQFA 3HSYA 1XWWA 3KCNA 2QU7A 4LZLA 4LE0A 1XHEA 3CTPA 4Z0NA 1Z25A 3W9SA 1A04A 2VUHB 1S8NA 2JB9A 4MQEA 2P9HA 2HPHA 1P2FA 4MGEA 2E4XA 3HK2A 2FN8A 3IP5A 1XHFA 4N41A 2L19A 4N0PA 1YS7A 2JBAA 3KKEA 2P4UA 4CBVA 3QELB 1MIHA 2X7XA 2IOYA 2M98A 2R48A 3GBPA 3GL9A 2FLWA 1M2EA 5TQ0B 4IGAA 3QEKA 2FQWA 3N75A 4W5RA 1DG9A 1ZDMA 4EVSA 2MYPA 2MYUA 3SM9A 4G0QA 3TMYA 2J48A 1ZN2A 1RNLA 1ZGZA 2IYNA 3OQNA 3JPYA 2FMIA 3K4HA 2DRIA 3N0XA 4YP9A 2ID9A 3L6UA 1TVMA 4LRQA 3T8YA 4ETNA 2RDMA 3H6GA 3T95A 1YK1A 1QQBA 1NXTA 1FFSA 3HDVA 2FMHA 2L18A 2NUBA 4W5OA 4MLCA 5JNTA 3Q9SA 5TE9A 1LBHA 4MR7A 2FLKA 3QEMB 4RU1A 9ABPA 4RY9A 5T3YA 2F8SA 4OATA 2ZWMA 3JY6A 3QLTA 3TB6A 4E7PA 5BR1A 4MS4A 1QP0A 2QZJA 5IUNC 3JVIA 3LOPA 2JVJA 4YS6A 3G1WA 5KQLA 3CRNA 1NATA 3SNKA 3HS3A 4WZZA 4O5AA 3N8IA 1JFSA 1SXGA 3QX8A 4KFCA 3Q7TA 4JB0A 2QV0A 2VYCA 4MR8A 4MS1A 5JNVA 3GBVA 3EODA 4PEVA 1APBA 2MYNA 5CHYA 4N0QA 3I09A 3MIZA 4UHJA 2LP4Y 4H3KB 4RK0A 3SY8A 1AB5A 1QNLA 1URPA 3NHMA 1NTRA 4MYRA 2WB4A 1GUBA 1YK0A 4KZKA 3RVMA 3KYIB 1JL3A 3URMA 5DCLA 5HM6A 5IEBA 4KQ9A 5EWMA 4ETIA 5DGCA 5IULC 3NHZA 4RS3A 5IC5A 1ISSA 5B3JC 1DRKA 2CHEA 2FMKA 4RSMA 5KQGA 4EYGA 1Z2DA 3VNBA 3QLVC 3CKMA 1I3CA 2QVCA 3KJXA 2PUBA 3OM1A 4M88A 3LUHA 1PUXA 4IF4A 3UKJA 2RJNA 3RVRA 1QPZA 1BDHA 1A2OA 1U04A 1EWTA 4WWHA 5IEJA 3A0UA 3FFXA 3QK7A 3O1IC 3OLWA 2FEPA 4KV7A 4YRZA 5I4CA 2JRLA 4YR7A 1ZAYA 5EWLB 4L4UA 3CU5A 3HXMA 1NXSA 3FMVA 3LTEA 4RXUA 2LUOA 2IPAB 4ZJPA 4S04A 1SD5A 2WWVD 2PUFA 4ZYLA 2PMCA 3O2SB 2HSGA 3MMNA 5ABPA 3H1EA 1Z16A 2WJAA 1U2PA 1F4VA 4WUTA 1NXOA 1QP7A 1D1QA 1EHCA 4MQFB 4N76A 3E61A 3RH0A 5EWJA 3H5WA 3EQZA 3O2JA 4WXEA 1EWVA 1C4WA 5FWYA 1DZ3A 1JH9A 4PICA 4KNYA 4YV7A 2L17A 2QSJA 4NCAA 3TD9A 4G0PA 3Q7RA 2PE5A 1JLKA 1OXBB 3NNDA 1C0EA 3O1JC 3QLUC 1JDPA 4MQEB 4DN6A 4E7OA 1IIBA 1Z13A 3H5VA 4ETMA 3OMXA 2LPMA 1RXEA 3FDFA 4G0OA 4RXTA 4L85A 1DC8A 1TJYA 4MR9A 3OLYA 5TPZD 2WMYA 2IKSA 4WT7A 5DKFA 1SXHA 2F8TA 4TN5A 1ZY2A 4EGSA 4DQDA 2FQXA 5JS1A 1ZVVA 1QO0D 4LX8A 1E2BA 1R8JA 3KYJB 1RXIA 4EVQA 3LUCA 4Q7EA 1NXXA 2OENG 4GNRA 3TX6A 2NT4A 4F06A 4Z4IA 4JB2A 1JFTA 4IILA 5BRJA 4MR7B 1KRXA 3DGEC 2XDYA 4HNQA 1CEYA 4G0XA 3N53A 4LE2A 4Z9BA 5PNTA 4RKQA 1JYFA 3L49A 4JAVC 4MS4B 4JOQA 6ABPA 4ZPJA 1ZESA 1DCMA 3BRSA 4GPAA 3M9XA 4EUKA 1BA2A 3C3KA 1B00A 3OLZA 3F73A 2NZUG 1FSPA 1BVHA 4MR8B 4MLDA 3H5IA 3CS3A 5T7BA 4NICA 4IMIB 6CHYA 2JK1A 2ZAYA 3A0RB 4HNRA 1CYEA 2JCGA 5HQJA 4XARA 1E6MA 1NY5A 3FGZA 4MS3B 3RVQA 1VRVA 3D8UA 2PL1A 1Z26A 3IDOA 2M1ZA 1Z2EA 3G85A 3H75A 4KMRA 1BDJA 2PJUA 2A9QA 5EWMB 1VPWA 3N6VA 4G0ZA 2PUDA 3JPWA 3SQNA 4JA2A 1J56A 1QMPA 4Z9AA 5HSGA 2PUGA 4MRMB 1FQWA 4OLAA 2HQOA 4YO7A 4QYMA 5HKOA 1GCGA 3OO1A 4EYOA 2YHBA 3KSMA 2HQRA 3FFWA 5B3JA 4D6XA 5JNUA 1QP4A 3LMKA 3HEBA 5IUKC 1EFAA 1AB6A 2MSLA 2QW1A 2FXIA 3M6MD 2E4VA 3EAFA 4TMYA 3LUJA 3NBMA 1Z18A 5IX8A 4W5NA 4RZSA 1HEYA 3EGCA 3Q7SA 3DLHA 4P98A 1BDIA 2MSWA 1P6UA 4QYWA 4Z4EA 1Z12A 3OLXA 1USKA 4QPJC 5TQJA 4LE1A 4Q6WA 4S05A 2FW0A 4N47A 2JVIA 1PEYA 3B2NA 3RVLA 3LKVA 3BREA 1JF8A 2A9OA 1PHRA 2E4YA 5FWXA 2QXYA 2MYTA 3QEMA 2FKAA 3N0RA 5TPWA 5FBHA 1DRJA 2R47A 1W25A 1E6LA 4OLBA 1D1PA 3NNSA 5GOTA 3GRCA 4O1IA 3T6KA 2LBPA 2RGYA 3RVOA 3ILYA 1U2QA 1YMUA
chains in the Genus database with same CATH superfamily
1RACA 5EWJB 4IZOA 1LF5A 3VMMA 4LY0A 4RX1A 4U2KA 1NMQA 4C22A 4FMCF 1XTIA 4NVRA 2G5CA 1WVGA 1TAQA 1W0CA 5AOBA 2BSAA 2OQ2A 5HZHA 5LUAA 2VDWA 4MCIA 2VUIB 1YU6A 1QLHA 1WRBA 1ICIA 1XAHA 3PYLA 2QTLA 1JQ5A 2E4WA 3AJ9A 4RWEA 2Y27A 3A9TA 4KQMA 4C0QC 2XYRA 3TNJA 3U4CA 4BGDA 4RVGA 4EGCB 5T8KA 1PWHA 2O0JA 3E2MA 3U09A 2GN8A 3IPAA 1SOWA 2X9QA 4KO1S 4JGIA 4MR9B 5B55A 2GGSA 1HYQA 2ZE8A 2HFKA 4RPJA 4F84A 1NVWQ 5KYWA 1L5NA 4J29A 2FK8A 2Y67A 2ZEJA 2JARA 4Q21A 1N5DA 3G1TA 5ALTA 1U3CA 1UQUA 1PQWA 1KZ9A 4BDSA 5JJ5A 3KWJA 3A8TA 5EEHA 3TCKA 2WAXA 2HRRA 3VR3A 5AUQA 1K88A 2FSHA 2V7BA 1DSSG 2B4AA 3UC9A 4Q7LA 1F3LA 4HWTA 3IP8A 4MAMA 3TSOA 1R74A 1JLLA 1RYEA 1JHZA 1E2GA 1ZC4A 2QL9A 3JQPA 1VTKA 2REQA 4F9FA 4G0UA 4O2RA 4AG3A 4ISBA 2FEWB 1JDJA 1CR6A 2W4QA 2IFTA 3H8SA 4EIWA 2PAFA 4RACA 2ZR8A 2FF5A 3HZHA 3UOWA 4CM4B 2WUWE 5CJPA 2V8OA 4HVAA 1VIMA 4FWBA 5K0BA 3GA5A 3O2NA 3H2BA 1KS9A 3CNLA 5IKPA 2VKTA 4F6RA 1GAQA 1ML3A 1PX2A 1Y5RA 3H3XA 4Z86A 1T0UA 2F9FA 3RABA 2R4UA 4V02A 2YV1A 2NVBA 2PIAA 3A11A 4QICA 3C6XA 4Z7OB 3D6JA 4G5QA 1IBLB 1YVUA 4Z4FA 3CE6A 1EWQA 4JJGA 3W6NA 1NDUA 1C9MA 1Z7EA 3GN1A 1PR1A 2PNFA 2VG8A 2B1GA 3CCFA 4MV8A 4V3CA 4EABA 2ODPA 1I4EB 5LB4A 4CEHB 3O4FA 1W59A 2FPWA 4RE6A 2B4YA 1JEYA 2UXCB 3MPOA 3OU7A 5EI5A 3JQBC 4PLFA 1AU9A 4N8EA 2W90A 4Y2SA 3J81A 2E18A 3CZMA 2GCGA 1FP2A 3FYUA 1D09A 4V0KA 1Z15A 3H83A 2QN7A 3GH3A 1FUEA 2C3UA 5E7JA 4PU0A 4ZAWA 1C0KA 1FDIA 2GK3A 5KVQA 5L53A 2EKZA 4QJIA 4ZTBA 4CFYA 3CVYA 1BXGB 1P0PA 1M75A 3DKRA 3GEIA 4KO3S 4Y2HA 3GYGA 1B43A 1Z56C 5BV7A 3CZ9A 3WTBA 4DVJA 5CCBA 4BQPA 3LKBA 2BFMA 2CDBA 2W98A 5D6NA 3MRTA 2DJIA 3SFZA 5KJFA 4PQEA 2ZJ4A 2CJPA 1FNDA 1O8BA 2KX7A 3AFOA 3F6PA 4H35A 3MMSA 4U7WA 3UJPA 3VHXB 1PK9A 4AZ0A 3DGFC 4M7RA 2J9FB 4HAYA 4F3NA 3QVJA 4I4TA 5DTRA 3BWVA 1K68A 4QM6A 3DR5A 4LPSA 4DJAA 4Q0MA 1JPVA 1NVUQ 1G8SA 2IOFK 4FEGA 1Y6ZA 1HNZB 1NP7A 2NU9A 1D0SA 4NMWA 2WT9A 4MUGA 3WC4A 3WRWA 3QKSA 1C80A 3D5QA 4DWOA 2I7DA 3CO5A 2X1HA 1UC5B 1A9RA 4HX2A 3DYBA 2IEBA 2PFSA 4TZTA 2CN1A 4NBLA 4YJFB 5DISB 4KK4A 4J0CA 2EBUA 5IDQA 2VLIA 4MIYA 3QVTA 1CKEA 4MJLA 1Q1ZA 1YWGO 2OKGA 2Y0DA 1GVHA 3O1HB 3WNZA 5CFRA 1JHUA 4A23A 1SC3A 4UBKA 4QDXA 3THWB 1N3BA 1SC4A 1OBCA 3CUTA 2WIKA 5AKKA 2A2ZA 3RFUA 4MDYA 3RJ9A 2BT4A 1EK6A 1U1IA 4H27A 4S24A 3QU2A 4OI1A 3VV3A 4ER5A 2ZTUA 2J33A 4Y3UA 4MI9A 2CWDA 5KVAA 3CT4A 4IOJA 2RE8A 1ITZA 2F1RA 2MSCB 1W9HA 3SVZA 4RFSB 3ZY5A 2FPPA 3RIHA 4DR3B 2PYDA 1FJXA 3RIYA 2PK3A 1TKAA 2LWIA 1AK2A 3DL2A 4RVFA 3G68A 2QPOA 2V59A 3BYZA 1UR5A 4RVNA 1E5XA 3AY3A 3L4EA 3AR2A 4KJXA 2UUOA 2HBQA 1AQLA 2JJMA 4C2UA 2XQFA 3F6CA 5COQA 2A67A 2XI4A 2BM0A 4AC9A 3ZV3A 2H1OA 1T1SA 4MI3A 4HFMA 5F52A 3WKCA 3EDOA 2XKKA 2G4VA 3FAKA 2PLAA 5IDXA 5C7IO 1XPOA 5CEJA 1IUKA 1GT91 5FBKA 3H1AA 1QIHA 3GV0A 3NHJA 2D5LA 3MC1A 4IHJA 4YJGA 5J2UB 5IVHA 2IY8A 3EDRA 4GECA 3Q8WA 1I14A 3I9JA 5C8VA 5JMTA 2YYYA 1XRRA 2ZSEA 4KQIA 4A4DA 4N48A 1J06A 1OREA 2F3UA 3H1GA 4IDDA 3WADA 4TXNA 3TPCA 5EZYA 3C5HA 3EIUA 3D4NA 3ORYA 4ND6A 4M46A 3R5XA 4XGKA 4RM2A 4JC0A 3R74A 4ZJUA 3L6BA 1L8XA 2Z2KA 1W73A 5KTSA 3UT5A 4CQNA 1QRRA 3F4KA 4B9EA 5IFLA 1T8TA 3MG9A 3KU4A 3SMQA 1SRQA 2XOXA 2VWGA 1DINA 3KQYA 1EJ0A 5FEMA 1T5HX 1OY1A 2ETVA 4IEFB 5B2EA 3BSSA 1V1MA 4BQSA 1PFQA 4MDHA 2HY7A 4R1PA 3UUGA 1PG2A 4FS3A 1GSOA 1HORA 2CK3D 4MX8A 1UBLS 2UYCA 4L76A 4GXRA 1IEQA 4DLLA 1P91A 2O2ZA 4MAAA 5E1MA 3ZHXA 1Y9ZA 5T8KC 3AF6A 3T4PA 4GXTA 2C9DA 2PZEA 3FPSA 3M6LA 4PHHA 1D9XA 1N6LA 1J1IA 3A10A 4PPNA 5FOTA 1M2GA 1YDWA 2WM2A 4G2TA 1JAYA 4OXRA 2JAWA 1JT2A 3K70D 3LBYA 2AFHA 1E9VA 1JWLA 3AFMA 3G2HA 2WEKA 1P4GA 4MHTA 1CIVA 1XD8A 4UZFA 2RC6A 1LZKA 3NT2A 4JOBA 4S2EA 1TEVA 5LDDC 3QMVA 1HK7A 4L8YA 4Q6BA 4Z0NA 2QE6A 4YH1A 1RAEA 2OR3A 4FGWA 4OMUA 4CCAA 2HF8A 1QQ7A 2GDJA 2J3JA 2XTAA 2XUGA 1IZYA 3N7TA 2IZ1A 1N2BA 1XHFA 1Z2AA 1DO0A 5KNCH 1Z7YA 1PV1A 3OSUA 4C14A 4EG6A 2B7CA 4XSGA 3ZW9A 1GZSA 4WW0A 3R3SA 3JZDA 2B61A 3H3FA 1HOXA 2C4KA 5JBIA 1N25A 2EJTA 5LXTA 1IMOA 4PF1A 1DG9A 3WAJA 1ZDMA 1OX5A 3L0PA 4NZMA 5DLYA 3TW0A 4NCHA 3DAHA 3UTDA 3EK2A 4IUYA 3BH7A 4CETA 3AERB 3ID6C 3QYFA 2IC5A 3ESQA 1RPTA 1JQAA 2VC2B 3A4NA 3FXAA 3BB4A 3GBSA 3SOPA 2QPTA 2XMDA 1XGKA 5FH9A 3PPWA 4YCMA 4CG2A 1AD2A 2BKVA 2AW3A 1ZQ1A 4PG5A 4CR8A 1PR4A 1A8QA 1DUVG 2X8JA 1C1XA 1O9GA 1VCHA 4WBNF 5JRZA 3HZZA 3EZNA 4HDKB 2R9VA 2X0DA 4WCDA 2NOAA 1A5ZA 4TTAA 4ZVQA 2D2EA 4ODIA 2QBYB 2GLTA 2CT8A 3BTSA 2Q6VA 3PPIA 1LW6E 5HQ3B 5DHSA 2WJJA 3VPSA 3FYUC 2QLMA 1GEGA 2IIVA 3ENVA 3NEAA 1K2VN 1ONOA 1BN6A 1GPKA 3GAAA 2M32A 1R5NA 2OBXA 1GL9B 1U31A 3DOJA 3HL0A 1TZ2A 4G5HA 4GR5A 5HE8A 4DAEA 4OSPA 2KHZA 6REQA 2IBTA 1RQ2A 1XTKA 2XE6A 3ZU3A 4HK4A 3UXEA 1D2RA 3FLMA 3BBPA 4JSRA 1RAHA 1L4MA 4L22A 4WECA 4EECA 2H08A 5DM2A 2NTNA 3B1VA 1OLXB 3OZEA 2IDZA 3I5XA 1JIUA 4ZHQF 4FYJA 3Q85A 4LJAA 1KVRA 1URPA 3QXGA 4P36A 3S4YA 3DMRA 4ZXFA 1JG2A 2Q6TA 4XR4A 2XBMA 4MARA 3H05A 4M9CA 4OXKA 4YP7A 5A4JA 4YIHA 2VYQA 5AVTA 5I5EA 2X41A 5LP6A 3DFMA 4JWKA 1PR6A 3CLRD 4J8PA 3ER9A 4RENA 5L3QB 4OX9Y 2AKYA 4LWQA 5AM5A 1ISSA 3KD2A 3DEZA 4LQCA 2KE5A 4HZIA 3DEJA 3CN7A 3C4JA 2QMUA 4CXMA 3L1JA 3OEED 3JAMA 3G2LA 1FLVA 1DQPA 4Q4JB 2HXGA 4BX3A 3UPTA 1N6RA 1UZNA 1HF3A 1DT5A 1MPXA 2PKEA 2XZDA 4J49A 3B85A 3TZEA 1VSBA 3R4VA 2RJNA 1ID8A 2NV0A 3GVXA 2VJCA 5IJXA 1CSEE 3AW8A 2WICA 4REQA 5K99A 1SU6A 3UMRA 4IDHA 5DPMA 2Z6VA 4FPXA 2FPRA 4WDQA 4PZZA 4QGHA 4DLPA 2AXEA 3E4CA 1YKFA 3WDSA 1NZFA 2BTOA 4L4UA 2D1YA 4B81A 5CCEA 3ZQKA 2J0QA 3Q8XB 2AEFA 5T4EA 4XW2A 2QTFA 1QDLB 3ILSA 4HYTA 2QHXA 3H1EA 4OHUA 3SQWA 5FNVB 3HI6A 1R88A 2RH9B 3IMFA 1BHSA 5FBRB 3TOCA 3RPEA 2BJHA 1VHDA 2WU8A 5JMPA 1DTWB 1EB8A 2QE7D 5FUBA 3CLUD 2QNRA 5T3UA 4CIWA 1YR1A 3F98A 1Z0ZA 5E1DA 1P1HA 1K8YB 2YIMA 4JBNA 5EWJA 2OUIA 3GRUA 5HIIA 4HLDA 4BO4A 3PGJA 1R5OA 5CEEA 5K0FA 3MRVA 1R1DA 4M1KA 1A8HA 1L4UA 2A84A 2I29A 2RI1A 2QSJA 2FSSA 3AMVA 1V39A 1G64A 5AKHA 4BAUA 2I3DA 2IKQA 2NQTA 3DEKA 1KEPA 3IIMA 2SHKA 3I01A 4JCCA 4MQEB 1IUOA 1P1JA 4DM7A 1KQPA 1XR3A 3ZJ5A 4LRXA 2F8LA 2YOFA 3N58A 3W6PA 3MJRA 2ZI9A 2W7TA 2QRVB 3VSBA 1E3LA 1H85A 1WY5A 1QH8B 4E1BA 4AQYB 2ZCVA 4D0NA 4QBHA 1P7ZA 4XH9B 1NW4A 4YDQA 5CDHA 4MR9A 2GXSA 2VBGA 3QE0A 1KSGA 3T1OA 4D4MA 3FH0A 3C3XA 3K09A 1K6IA 2GAFA 5AVZA 3O9MA 3A6FA 2LVBA 3IUNA 4WT7A 3A6LA 3MHTA 1EG2A 1V6CA 4FOTA 3F1KA 2NV2B 5I9BA 1TW3A 1LX6A 4TKVA 3IAXA 1ZY2A 4EGSA 2OBMA 3THOA 2IOFA 2IHYA 2QT9A 1R8JA 2BZGA 5K0NA 2V58A 3H1TA 2WZBA 2BDEA 1WXXA 3K53A 1GZ6A 1XI2A 2WIFA 2DERA 1F8UA 4URHA 1XQXA 1SUEA 4YT8A 4R84A 3N0TA 3OKCA 1U8ZA 2R8PA 1E1RA 2VDPB 3RVDA 3RIXA 2O7SA 1IY9A 3N53A 4OHMA 4YJ2F 1DXOA 3FUTA 1JHRA 2V0CA 4IYRA 1GJRA 1UC4B 2R6R1 4JOQA 4MS4B 3OA2A 4QWWA 3DE5X 4ZGWA 3Q3VA 3SLKA 5HXAA 2HKIA 3FF4A 1UBJS 4RETA 5KINB 2ZU6A 1FUYB 5D3ZA 3L7MA 3C1AA 3AR5A 2XUQA 4GGOA 2HGSA 2E49A 3SIPA 3NVKI 1RFGE 3AUJB 4NDNE 3F6YA 6CHYA 1XYGA 1KYQA 2QJTA 3OMLA 4I3GA 5KKNB 3NWPA 1QFMA 2H29A 2O6HA 4CEHA 2HT6A 3EVTA 1DHTA 1JFFA 1SKYE 2QM0A 1P39A 1KYYA 1L7RA 2W6IA 2ZRPA 3GEDA 3I5UA 4JLWA 2FXVA 4WXYB 4YI5A 2H2HA 2F59A 4JLBA 4E4TA 5D7BA 3BIWA 3VH3A 4E31A 1I0IA 3A06A 2DTDA 3CEJA 3O90A 1IOWA 2EATA 2ID8A 3AXSA 3CX3A 4PM4A 5EHNA 1CUCA 5DSTA 4DCTA 4BVFA 1AUQA 4I1VA 2VRCD 3UUEA 3NALA 4RORA 2Y2VA 3NR2A 3WYAA 2HQRA 5JNUA 4CKCA 2R2GA 4OO3A 5KVVA 1CD5A 4D9MA 1XJWA 5JZMA 3PXEA 3NYWA 1XEWY 2E4VA 4HSGA 4O4IB 4W5NA 3DOOA 1PQUA 4OHVA 3N5KA 4KZPA 3VHXA 2PPVA 1YDGA 1M66A 1R8XA 4Z2YA 2YWEA 3R8XA 4ENTA 1ILEA 4KMMA 1Q92A 4O3FA 2TMGA 1SULA 2H16A 4XTCS 5K2OA 1BWSA 4TZ0A 2H0RA 4S05A 4LTNA 1W5TA 2ZRHA 3RKSA 4B3JA 1YCGA 3RS0A 1BCSB 1PHRA 2E4YA 3EDQA 4WAUA 3DFUA 2QXYA 4CGYA 4Y7DA 3LX6A 4A6DA 2WJ3A 4XPIB 2DLNA 2R47A 3AI1A 1AXGA 4Y1EA 1GQFA 1N6IA 2IS6A 2VAXA 3SC4A 2V7TA 1X2EA 5DM4A 1T4CB 4N9QA 3NJ8A 3L40A 4YPVA 4M87A 4F3KA 4F8EA 1R5JA 1SHUX 4L9RA 4H6VA 5HR5A 3NORA 4M76B 1SHTX 3U16A 3UIEA 3THWA 1U9IA 3AQ4A 1SA0B 3LUGA 1H65A 4YT2A 3F78A 4XD7A 5CM2Z 2YJ5A 4RQUA 1H5QA 3TR0A 4HWSA 5HS4A 5LQDA 6LDHA 4E5PA 5IRCD 3QU4A 2YYSA 3ZJUA 1ZJZA 3HVJA 1V41E 4OFWA 2YN0A 4U5XA 2I8LA 2QR5A 2G6TA 2OP1A 4EFNA 3D64A 4QGGA 4J4HA 4B3IA 5KYKA 1C8LA 1ZO8A 2OC4A 4E22A 4ACBA 2RAUA 2PUJA 4Q9JA 1XX6A 3EMBA 5EJGA 4I7EA 2EARA 3NNNA 1ZK3A 1CEQA 3HJNA 1XOIA 3PV0A 2C2KA 3NOOA 4IH9A 2R8BA 2IHNA 3T35A 1JVNA 1E1CB 5DE3A 1Q5PA 2ZB8A 1BS1A 5H1YA 2WSLA 1MEEA 4FFLA 2WIAA 1YQGA 2G3YA 3MA0A 4BUCA 5J2UA 3VH4A 5IANA 2WD8A 4D98A 1PS8A 1U8EA 3OU6A 1UT8A 1MO6A 4J0FA 3LG2A 4F4IA 5IJZA 4AJLA 2HA7A 4EATA 2X5KO 3S2IA 1T9DA 2YXLA 5JI2E 1J33A 2HRQA 4D96A 3KXLA 3MN1A 1X74A 4FEYA 4GVPA 1CNFA 2GN6A 4YMIA 3TFWA 2J4CA 4X61A 3O75A 3PWSA 1ACJA 4Y0VA 5CYOA 4DG8A 3B12A 3K2IA 3EHEA 3A7DA 1E1YA 1FP6A 2BOVA 2C00A 2XX3A 3DPIA 2QTMA 5DOZA 3T4EA 4QIHA 3S8EA 1G3UA 5AVSA 1DGQA 2M6KA 3UJCA 3FFBA 3UAYA 1YAHA 1HE5A 1I2MA 2GKOA 2GJSA 3G17A 4LHYA 4R6XA 4A2PA 1I94B 4K03A 4X3OA 3WSVA 1Y7HA 4HB0A 3UK0A 1NP6A 2PCJA 1UP7A 1XFAA 1DKQA 1QTIA 5CNJA 1KEZA 3ICPA 5ECGC 3EW9A 3WGVA 2AMJA 4L4RA 1QMGA 4CG3A 4D9GA 2ACVA 5ALOA 1JRLA 4CV0A 4Z7JA 3EAQA 2DUWA 1NVTA 4H7EA 2QXUA 4HOYA 4JYBA 4AJHA 4ZI7B 3W5DA 1G0OA 3ONNA 4ZO9A 4RHTA 5C4GB 3T3IA 1QRAA 2HNAA 1C1DB 3VO2A 1DJMA 4OKNA 3PJFA 1C7EA 2DUUA 2XAUA 4NYIQ 2IL1A 2W2KB 3AEZA 4QNMA 4L8GA 3RIMA 3I9KA 3RS8A 3VYUB 1GCIA 4NOLA 3IXQA 3C3EA 2JASA 1YA6A 2XTNA 3S44A 3GMDA 2PSSA 4WLFA 1TMOA 1QQAA 5ALPA 2WI8A 1G6HA 2FX5A 1PR5A 3TR5A 3HCPA 1VLQA 4K86A 1J9GA 4FJ0A 4WA7A 1J5EB 1RBQA 5I9MA 5DWQA 1H93A 1Y5NA 2GX6A 4QUGA 2PGDA 3N7AA 5AVJA 4ZYLA 2H1SA 4HUJA 2A3RA 2CBZA 3DFFA 2Y4OA 4WLOA 3UXYA 3JWJA 3LP5A 3U7GA 2O8BB 1EAMA 1EG7A 5HF9A 4N82A 3RS7A 1S9DA 3AERA 4MVWA 5DYWA 1KTIA 3NTUA 1MB0A 1LQTA 2C4TA 4MQMA 4PNPA 1K92A 1PLLA 2CVZA 2ZYHA 3GT4A 3KLOA 3VAZA 1J23A 3GELA 1XMXA 4LRSB 4BNLA 4RKEA 5FJIA 2B34A 5KNBD 3ILVA 4MW5A 2BZSA 3QKWA 1DEHA 2PV7A 3OURA 1UJCA 1KMIY 1IJKA 2EWVA 4NH0A 4P4UA 5A4DA 1W76A 1JSCA 3TGWA 1T2FA 3C8HA 3B5EA 3IJRA 2OFXA 1CUZA 1FVHA 4Z1OA 2WHQA 2CVPA 2PMDA 3GF4A 3E5RA 3BMNB 4HDOB 1NVBA 1Q3KA 2W8BB 5JCJD 2Q3FA 2HYIC 3MS4A 3PUKA 4WK2B 3H7IA 3BE8A 4XDHA 1Z17A 3D4LA 3CKKA 3GLKA 3NJ4A 5HBRA 4MWTA 3BTUA 1AKUA 2BJVA 2VEDA 3L4KA 1W2WB 4YRTA 3D3KA 4AY6A 1BJKA 1GVNB 2IHTA 4POAA 2GEUA 4MRMA 3TZQA 3W8NA 5JSYA 1OLXA 1VG9B 4XGQA 4OHOA 2O8NA 2EJCA 3ZGNA 3O26A 1AUPA 4GZLA 4LYYA 3QG1A 3GEPA 4PAWA 4Q1CA 3SG0A 1PNTA 1J5XA 1IN1A 3QWBA 1Y4UA 3ZDYB 5JR3A 1RJWA 1B6TA 4UJ5A 3HHPA 2VQSA 4PPQA 1L1FA 1HA3A 5B4UA 4B3FX 1HYHA 4NEHB 1Y1SA 2HJ9A 3RBZA 3NTXA 3UANA 1IBCA 1NLFA 1T9GS 2ZE6A 4QEZA 4MRVA 2BAGA 2XY4A 4CGZA 1R64A 4P0PB 1IZ8A 4NAHA 4IDOA 2IE0A 4Q4JA 2HMUA 2Q6IA 5ALYA 2WRZA 3VC3A 4B6JA 2O3JA 5JALA 1VPLA 1OZ0A 5E3IA 1N0UA 3SIRA 3D0OA 3VKUA 3WB0A 4TLDA 4PE5B 5A3QA 3KVOA 4LJ5A 2QTRA 3T4UA 4NCBA 1U9IC 1DBQA 3FNRA 3P9NA 3SMVA 1FU8A 1IAQA 1EHIA 1L5SA 1HH4A 4HX9A 4MWEA 1NX9A 3RIGA 3ENZA 2AOUA 3IIKA 5PGMA 4RTQA 5AXCA 1F9EA 4WPGA 4XJTA 1CUEA 1R8SA 3WRYA 1CETA 4G9GA 4MP8A 3WRXA 4W5TA 2H1WA 2RARA 3WYCA 4ENRA 3ETHA 4Y6OA 1HEUA 2ZIEA 3AUTA 1MJGA 2H0AA 4IVNA 1DP4A 2NQ2C 1VSUA 3X1YA 3E9RA 1KJZA 2D5AA 1NA5A 2NTYC 3PXBA 1DBPA 2PT5A 3N5CA 3PCTA 3EPPA 2Q3CA 3QBVA 4IZ6A 4ZP1A 5JVDB 4EGFA 3AKZA 1G8AA 3CRRA 4QL3A 2J9GA 4D9NA 2QMHA 1SELA 5REQA 3UG6A 3WNDA 1M8GA 2P9EA 1Q1GA 1VGRA 3HSSA 2XHEA 5CIWA 2JB9A 4MQEA 5DHUA 1WQ3A 1M33A 2HTFA 3GCDA 1VE3A 3DMPA 1V7QA 1L5WA 2ZIUB 4YP1A 1UM8A 3A9RA 4Q9DA 4CBVA 2QRVA 3CRW1 1LPNA 1QVAA 2UYOA 1BS9A 1EXWA 1UKZA 5JJCA 2VHJA 2ASEA 3GJ0A 1CR1A 1J8YF 2DBZA 5GP1A 4HXEB 4PG7A 3VGPA 3HJUA 3SQOA 3V4VB 1J7JA 1GNVA 1WX1A 2Q46A 2MYPA 4B3SB 1PGOA 1N1MA 2P2SA 4AJ2A 3I5YA 2VP5A 2YFHA 2DR0A 1ZR4A 3BL6A 2FMIA 5JQGB 1DMRA 2GBFA 3N0XA 1XSEA 5MFPA 3GFSA 2Q1SA 1GCOA 2ZIXA 4Z51A 4GOJA 2ZZMA 3RC3A 2B7BA 2FMHA 2ZRFA 3HB5X 3L7DA 3OPMA 5I7UA 1FE8A 3TQSA 1Y4SA 2JCYA 2VTKA 5CD9A 4YO8A 4S0ZA 3VYWA 4ZA2A 2GBIA 1O96B 2XTJA 3A1WA 3HJBA 4L9AA 5D3KA 2BM8A 4EY6A 2H0QA 5E2IA 3ZTWA 1E1MA 2HHAA 4KKVA 1I4LD 3UMCA 4V3BA 4NTZA 2ISCA 3OJOA 3ELDA 4NULA 2N3ZA 2YWJA 3MWEA 4MS4A 1MX1A 1OXSC 1OWLA 1ETUA 1LA2A 1YQ9A 2GRJA 1S2OA 2ZUBA 2C94A 3FUCA 3L8HA 2W83A 4HFJA 1CZNA 4P31A 5KS2A 5KNLA 2IT1A 3QX8A 3GLUA 3ZXUB 1QYWA 3WP0A 1QO9A 1VPTA 5ALVA 3R8FA 4QC2A 1VI5A 1DG1G 1ZXXA 2P6PA 3ZHVA 2BUBA 4H3KB 2GYVA 1TTQB 1QNLA 2R7NA 1JDVA 2DPGA 4L3WA 2FEOA 4RJJA 5FA8A 2WTEA 1JL3A 1OFUX 2VHYA 3B2QA 1S8AA 3O3NB 1TO2E 4QOHA 2O4UX 1Y3DE 3BWBA 3RM3A 1VKNA 3CLTC 4JJEA 5E7QA 3LHFA 3CVUA 2DEUA 1DRKA 2Z8YM 5IP5A 2D0PB 1AXEA 3V1NA 3AUAA 1T13A 1GZHB 1Z2DA 3L6OO 1FSZA 4UUNA 3U7RA 4EKDA 1BQ3A 3TBKA 5LL6P 2ODTX 4OYYA 1NMZA 1NZDA 2JAHA 1N9KA 2BUAA 2PANA 3KJXA 2YZ7A 4AMUA 5IJ9B 3PGKA 2JJ2D 1E96A 2QXTA 4C07A 1EUQA 4LSWA 5KHOC 2O5VA 3C39A 4UTZA 3BGIA 4LUCA 2YVQA 5AK5A 5ALKA 5I51A 2YDYA 1IUPA 5CT4A 4AECA 4BEBA 1OROA 1QJ4A 3IGFA 1QVRA 1M3SA 4WASA 3X1MA 5KWJA 3SSOA 4C6TB 1XTRA 3CF0A 3E58A 1C1YA 3HRIA 3SF8B 3HXMA 4W99A 5JISA 4L4XA 5ICCA 1RC1A 2B69A 4MGIR 5BSGA 2VDMB 4QTUB 4BVLA 1BCSA 5I45A 1X15A 2CFCA 5WRFA 3PEWA 1BRTA 4EA9A 3S2FA 4A0GA 3KSAC 4Y6PA 4NG5A 4XPIA 4LPKA 4BOYA 1NXOA 2AJ8A 3HBMA 4JJIA 1ZKDA 3GJ3A 2VS1A 4DR2B 1T4CA 2HIHA 4HRXA 1JEAA 2X5JO 3QMWA 4JT2A 4XDZA 4CR7A 4QAQA 3GUZA 4EI7A 2H7YA 4KTVE 4EUFA 4CL2A 1SN7A 3KQUA 3L82B 4HJRA 3HVUA 5TJHA 1NPYA 4QQRA 3SYRA 1OKKA 4L5YA 2ZBVA 2YVUA 4GVXA 3ENNA 3VR3D 4YMUA 5L7YA 2I9KA 3UY4A 2G4CA 1ZIYA 4UBJA 1U2GA 1RT9A 2LPMA 1UANA 1RBYA 2CB0A 3TJZA 3NMUF 4BLUA 4KNVA 3SDBA 3E9ZA 3I64A 5EA2A 5FUXA 4M98A 2AKEA 2QZZA 8LDHA 1KH2A 1TF7A 5LYJF 2XB6A 2QKYA 3NOVA 1Z5PA 1BEUB 4IICA 3VSEA 5KYGA 3M4XA 4JC4A 1ZM9A 2JF0A 5FLEX 5FWYA 2Y1CA 1D8AA 4MWCA 3ZQ4A 3V34A 1ZZGA 5H0IA 1ELOA 1JNXX 1YI0A 3EGXB 1RYBA 2FQXA 4EA8A 4M1OA 1HX7A 5H59A 3WKAA 4CG0A 1XZFA 5L4NA 2GAIA 3IBGA 5HW0A 3JALB 3G9XA 3VPBA 1OA1A 3NC4A 1KSHA 1N6NA 3DB1A 3NV7A 5FP0A 5HTKA 1XMQB 2EKBA 4ZQGA 2G9NA 3S7TA 3WRYC 5CDYA 1JFTA 2WD9A 3WRXC 4DYHA 3OZXA 3X1KA 4GI3A 5CYGA 3CIFA 4HPWA 4YAFA 4W9RA 4B6FA 4G0XA 3KLMX 4LE2A 2OL4A 2YICA 4A1OA 2P6RA 1MX3A 1WULS 4NWIA 4X7MA 2MINB 1QGED 2H5LA 1DCMA 3A1VA 3G5AA 3JQGB 4PFSA 1QRTA 1I2ZA 1RXWA 2R8OA 2FPOA 4BE9A 1E2UA 4ZO7A 1MD9A 4GPZA 3ZBUA 5DBIA 1KAHA 3FPHA 4NRDA 1VMEA 2IP4A 5DLPA 1MUUA 2HK6A 2PAAA 5KOYA 1NPDA 3UT0A 2IUEA 4K46A 2BR5A 4WK0B 2W6QA 1PT5A 4QUAA 4I2VA 4Q1VA 2ZVJA 3M4YA 5C46F 4DAOA 3LQ4A 5K3FB 1O2DA 2ONZA 1R9MA 2YZ2A 3D2BA 1G20E 2DMRA 2IOHA 2IYSA 1R5BA 2ZYIA 2CFSA 3ET4A 3HBNA 1GTSA 2WAYA 4N6OA 4EO7A 1WCXA 3C16C 1VPWA 1Z6XA 4V24A 5KYVA 2PUDA 4LF8B 3CR7A 1HE3A 2AQKA 3JRNA 3KQTA 4Z9AA 5FLKA 3V4FA 4EW6A 3FNQA 5GONB 4RF4A 2NSYA 3UMYA 2X9LA 2YC2C 1GQRA 1YDEA 4ZI7A 1XL0A 1H0KA 2NGRA 4AW9A 2XUPA 3VZPA 4RD3A 1C1DA 3MAGA 1CEEA 4M0EA 3WL8A 2W2KA 3DZGA 3M6MD 4BMXA 1E61A 3DO6A 4HN9A 1WCYA 1G21B 2SKCA 4X97A 3H2JA 4BB0A 3DLHA 1UP6A 2D3TA 1TM4E 4D97A 1I1HA 4LGYA 2AFVA 1Q19A 3QVOA 3R0XA 3ZE9A 1K1EA 3F47A 3P9XA 1OFIA 1W85B 1X7XA 2OCYC 2Q9CA 3GC6A 4TVOA 4AMVA 3N3BC 1I80A 4KJZA 2JVIA 5A0VA 3L1IA 2NYVA 3IELA 4NONA 2IEIA 2YJTD 3BREA 5TMEA 2BZ0A 3UOGA 4DCOA 1UIRA 5AJWA 1YTUA 1P2SA 2XRMA 4BWVA 3S81A 3EISA 4V2IA 1RJFA 4F9TA 1U7WA 3BIFA 2ZR0A 3KELA 4HNGA 3QHPA 4Z0HO 3K6SB 1FY2A 1RLTA 2RGYA 4G1MB 2WWWA 2P9JA 4M55A 4U7HA 4R8LA 3F3SA 3OPVA 1YMUA 1TD1A 4IX9A 4UMVA 5CJ2A 4Y2PA 2IXGA 4G0MA 4LY9A 4DG9A 1US8B 2EF1A 4LXIA 2XLBA 1J09A 1P61B 1RQRA 2V7EA 4JJZA 2DLDA 3ESXA 1C5KA 2QYSA 2VWHA 5F12A 3IODA 1BFDA 1UBGA 3DV9A 5IYZB 1XWFA 1ZMOA 1QGUB 5HE9A 2VT7A 4D5GA 2RGRA 2W8BA 3C8ZA 1T4BA 2OHJA 1LV7A 3EZ9A 1X1BA 2Y71A 1J8MF 2ZANA 1ESCA 1XZEA 2DFKB 1GGMA 1NMYA 2NO9A 3CZRA 3L0ZA 3PR2B 4NZOA 3O6VA 5EQTA 1RI5A 4HNHA 1ZRMA 1AUVA 1N2JA 2WYVA 4KPYA 2FN3A 3E1KA 2B82A 2O50A 1A7KA 3HA7A 1DQSA 1VJRA 3VKVA 1PFYA 4G2NA 4EL5A 2QX6A 1C3VA 4DOMA 4RSHA 5ALWA 1XDWA 2G0TA 3IBTA 3O7WA 1YBAA 5JASA 5JXJA 1M2FA 2VO1A 4TMFA 2F55A 3VM6A 3V7NA 1V37A 1TYZA 3VKGA 3OUUA 3KWLA 3EXFB 1RWBA 3LDUA 1CR0A 1BA3A 3FKQA 3DE0X 5L40A 4N54A 4FCVA 3C6QA 3AU9A 4FZ5A 2VJAA 1BO6A 4EY8A 3W3AH 3SS8A 2BIFA 3E18A 3FHLA 3BJZA 4ATNA 3DHEA 4WNYA 2GHTA 4QFBA 4KDCA 4EY3A 3LHIA 1G291 1NTOA 4IWNA 1Y1TA 1WTCA 2G1JA 4P7JA 4V03A 4DRXA 4K6CA 3VU1A 2QRLA 2FGKA 5DDIP 5IJ0A 1WP4A 1KDRA 4FGUA 1AM4D 2UZ1B 4BX0A 4X6XA 3E22B 1QHHB 3KPVA 3WLHA 3X1XA 3EIEA 3G2KA 4AUKA 3ECCA 4J1QA 1DQNA 1HT2E 2ENWA 3O3MB 4PWYA 2H4ZA 2Y68A 5DLQC 3D3QA 4ZQCB 1XA4A 1JQLB 1QIMA 1SWWA 2OD7A 2WF5A 2J1LA 3E6AA 1OX6A 2NXCA 3SSMA 3X1JA 4FGKA 1BVYF 5HCUA 4Y9TA 2MSKA 2RJ3A 1JG6A 2W00A 4IIBA 4K9QA 1FRNA 1LPOA 4PVCA 3VMFA 2IF0A 4TKUB 1X1SA 5AJXA 4M60A 1X14A 3WGLA 3H5AA 2G08A 4NYIR 3NEYA 5JVDA 1YBFA 2O20A 4BVGA 2G77B 4HH1A 3L7KA 2IIQA 3ZTTA 4ITUA 3ZW8A 4KRFA 3PITA 4BN0A 4X8LA 4WL0A 4DILA 4OOEA 4JVSB 2P5UA 5ARDA 4F2DA 4QJ3A 1XBTA 2AUNA 4JL8A 3T1TA 2B2NA 2WVAA 4E12A 1PJLA 1UXKA 1YOBA 2C5BA 2D13A 4GW3A 4JEMA 3KIPA 4YMWA 4BTEA 3U4MA 3DYIA 4AJEA 1QZ3A 4LS3A 1Q91A 3X2EA 3RVPA 1T5OA 2BFNA 1Y6GA 4II3A 1M67A 4P35A 5K3BA 1YQWA 4FFSA 3OHPA 1W36C 4JT4A 3CSUA 4XI9A 2OP0A 2GYWA 2NYRA 2WIGA 5IDYA 5IBRA 1ZD1A 3RC9A 2ZRAA 3HMQA 4AUMA 1HYGA 1LTHR 4BJHB 3IQEA 3MS7A 4Q1EA 2QYHA 1HT0A 1HDEA 2PT6A 4HZGA 3LL4A 4KXYA 4PQYA 5GV7A 4DSZA 4OGKA 2QTWB 1JYEA 4TWIA 3LW8A 1RKXA 3AHGA 4OEHA 2IHUA 4N03A 5BQ3A 5JRDS 2GZAA 2B1QA 4MZDA 1S7GA 2VPZA 2QTCA 1Q16A 2WU4A 4QXPA 4QUDA 1YQTA 4F9EA 2GK7A 3Q0IA 4C5CA 2GZSA 5HJ7A 5EIBC 1H2FA 1LPBB 4HLCA 4XVCA 5JNRA 4FNOA 2OQVA 3MEQA 2SNIE 4GPD1 1OI3A 2O06A 4LGMA 3T7TA 1MABB 3C3AA 5AHKA 4BU1A 4CKZA 1O96A 1BAPA 2V98A 5TY0A 1EA5A 3TG2A 3K2EA 1KETA 3ISJA 4DLWA 2VFAA 1X94A 4EENA 4PHTA 4I14A 3H9UA 1LB1B 2NZVG 2AXPA 1PGPA 2W6PA 3B6KA 3GLVA 4C1NA 1PFVA 2ORED 1M8JA 2DPHA 4AY5A 1O6ZA 1FZTA 5JAMA 4CW7A 1SU8A 4URVR 5ENDA 1MF7A 3DEHA 4TRMA 2DCUA 5CNKA 1EHYA 4XYLA 4A27A 1XJ0A 3TJRA 1JAHA 1CQJA 5DF1A 4JDUA 5A3JA 1DS6A 2BGRA 4EHFA 6PFKA 4KE6A 5I7RA 5KWSA 1CVRA 2R1TB 4PAOA 1LY1A 2Z2JA 4H7IA 3TRIA 3RU3A 1TQ4A 1RXYA 3ROQA 3GGCA 1SU7A 3KUXA 4OK5A 2BH2A 1XC7A 4K5QA 2ZETA 5C4IA 2H1VA 4MVJM 1IG3A 1HY3A 2Z2YA 1J0BA 1ST3A 4CN8A 2G9RA 5AIAA 1AJEA 1TK9A 4E2XA 5HNKA 2WFLB 2ZI3A 3GAZA 3F5QA 4YUVA 9ATCA 1QOQB 1F8FA 4KQHA 4V0OA 3GFBA 1JZSA 3H2HA 4E5MA 2EHDA 4UUBA 3BJEA 4OMDA 2PX5A 3EJWA 3CPEA 5KVCA 2FPIB 2P2YA 1JR4A 1CDZA 1VE5A 3T7IA 4ESEA 4ZI3A 2OB2A 2FQ1A 3ZZMA 1ISMA 4HWGA 4DR5B 2LDBA 3LBNA 5FOSA 4I6EA 3V80A 3K0AA 3A1FA 1Z63A 3RI3A 2X58A 4P7FA 4GZ6A 3IQDB 1PJ2A 2VUUA 3MF4A 3NXSA 4TWZA 2H00A 3IUYA 3S3TA 4D4GA 4R2WA 2O19A 4M54A 3BXEA 3P9YA 1KYVA 4C6TA 5AOAA 1B3BA 4CMHA 4PZDA 4RH3A 4TSFD 3LWNA 3CB2A 5B4VA 1BNCA 3KHSA 1SQFA 1RYFA 4KBFA 4Q01A 3A6HA 3HXOA 3T3DA 1DKLA 3AU8A 2JGJA 1LU9A 3FR7A 3ITEA 3Q3GE 4P4LA 1YZQA 3V2HA 1N6PA 1K4YA 4HG2A 1J7KA 3JD3A 4G36A 4IIJF 5H83A 3S2SA 4EAAA 4NEQA 2CF5A 3ROFA 3L0SA 4A8JB 1P1CA 2WWHA 4GOKA 3CO0S 1QO7A 3HG7A 4G0WA 2PV0A 1ESNA 2P62A 5BNZA 4ABTA 5CGZA 3LX5A 4FMCB 4G5GA 2QUAA 5JYEA 2PVPA 1AX9A 2QJRA 5G4KB 2OGTA 1G8PA 3C74A 4AN1A 1E0SA 2GM4A 2TRSB 4ZCMA 1YS9A 1Z25A 4KQ2A 4PSAA 4Q00A 1A04A 2PUTA 3AUXA 1IUNA 2QP4A 1N3YA 1P5HA 4NDZA 4PC3A 3VR5H 4BFYA 4BO7A 4JI0B 1PEKE 2CL0X 3TUIC 3I8XA 3DTVB 1P2FA 1FFHA 4UU0A 4Z9XA 2QVZX 4OU5A 4C29A 3F8TA 2ZJ6A 4OXQA 3ZNNA 2GJ4A 3KB2A 2M98A 4INJA 5KU7A 3N8GA 2VBIA 3OQHA 3OZAA 4D45A 1WEHA 2J3LA 2YS7A 4RADA 1OTYA 2N47A 4IGAA 2Y0BA 1F2UA 1ZICA 3AJDA 1DTEA 3I34X 1A69A 1VECA 4CT4B 2GF0A 1CRQA 1E1RD 1QR6A 3B7PA 4JUBA 3AB3A 3BCHA 1YZGA 1RMQA 3LLSA 3EGXA 4ND1A 1DC5A 5FBLB 4BYMA 2HCRA 2VYVD 4ALLA 1TVMA 3GOHA 1PSWA 5IPFA 4DM3A 1FTQA 3JALA 2IEYA 2HC9A 3FUWA 1UMDB 4FHEA 3OZFA 1G20B 3WHPA 2ZDGA 3ZCTA 2VHVA 5J4LA 4MYHA 4M9UA 2XKAA 3GLIA 4TZ6A 1WS6A 1WIWA 2L42A 5AW0A 8MHTA 2RHGB 2WA1A 4RY9A 3FCYA 2NN3C 1DKMA 2ZWMA 3BORA 4TWBA 4S3MA 4US2R 2FU5C 4KLZA 4NXNB 2WAAA 3BVPA 4DIUA 2W6ID 3U49A 4ZO8A 1W47A 3FTCA 3I9LA 3JQGA 3OTHA 3Q0EA 5DCYA 5H4HA 4RD1A 5DNYB 1EX9A 2H1HA 3IR7A 2GM5A 1VIDA 2IUYA 2PLFA 2VYCA 3AEKB 1YR2A 4QELA 2B0CA 5JO0A 2BDUA 3MJEA 1I7LA 3R7BA 2FX3A 1H3NA 1BD4A 3CIOA 4R9UC 4QWMA 4BNGA 4RCZA 1CB0A 5K3FA 2GEDA 5I5GA 2C7PA 5DH9A 1GZ3A 1V25A 1I3MA 3U4GA 3AVWA 2HHJA 4YUYA 3HCOA 2O05A 4ZANA 5GWXA 4BFCA 3NHRA 3I2JA 4QZVA 4KQ9A 4QDKA 1DV2A 1QTQA 5DGCA 4CIBA 5H7XA 2OV1A 3AP1A 4YQFA 3KKQA 4UZSA 1ULSA 3VYSB 1A9YA 1YL5A 5KX5A 5AJZA 3SICE 3N0VA 2KJQA 3PHIA 2ERXA 3R3ZA 1DCTA 2RHOA 2PUBA 4IF6A 3BFVA 1PUXA 2E48A 3L8EA 4NBRA 2UZAA 3FPKA 4ENQA 1IOVA 4DFDA 5FRDA 2ZVPX 4U6SA 1OFGA 4DDWA 1QPZA 1G21A 1V11A 3M1YA 4CKWB 2IV2X 3FFXA 1PJ8A 3QK7A 5KYUB 5JT1A 1U7XA 5I8PA 4GD3Q 2PRYA 1ODSA 1T3GA 4R8VA 3DLTA 2D5CA 4WXPA 3R9IA 3RK4A 2CE7A 1W85A 1JB1A 3C1UA 4HVTA 5ECYA 5IAAA 2BFWA 2YWCA 3LTEA 2SCUB 4RXUA 1Q1NA 2LUOA 3HNOA 1H4TA 3KJIA 3OKFA 3RTGA 1SD5A 1YE5A 4GZ3A 3ORRA 3EGVA 3U3KA 4X0EA 3JASA 1U28C 3ZX5A 5BWLA 5JDIA 1D6NA 1L3IA 3ABOB 1H2YA 2OZPA 1E62A 2FKNA 1F4VA 1P7CA 4MUEA 3QBJA 4OK3A 1Q7GA 2AN9A 4CM3A 5BQFA 3K6SA 3I83A 1EUCB 5IKEA 4GDMA 1YFZA 1LTQA 1VYUA 4UNIA 3WSWA 4M1EA 2WOJA 5HDBB 3N74A 4NS1A 3RH0A 3P7MA 1A8PA 1EVIA 1SXJA 4OFZA 1XRNA 1WQ4A 1KAQA 1PFWA 3NWBA 4HGOA 4HB4A 5TRTA 4I8DA 4NCAA 1EGQA 4X64B 3VYTB 1TUIA 4IINA 4RKYA 1C0EA 1KMCA 2WT4A 1MOPA 3GGPA 1E2NA 2CMKA 5IYZA 3FF1A 2EBHX 3DWGA 4ETMA 4FBMA 2RHLA 4J0JA 2AN1A 1WUYA 2XD4A 2C54A 1MC5A 3ZXXA 3NCHA 3H0CA 1GFIA 2IODA 3FSRA 2X86A 3NDRA 2B8TA 4KQGA 5D3MB 4AS3A 4BFLA 3DT6A 2JGFA 2GN0A 1SIOA 2UUAB 1KH3A 1VLMA 1OC4A 4H08A 5LIPA 3NI2A 3PTLA 1SXHA 3FMFA 3CKYA 2HU8A 3CF4G 1BMDA 3FRJA 1OVMA 1DOAA 1KZHA 5LWHA 3H97A 2WHYA 1P7WA 1AKYA 1CVIA 5EP4A 5K8UA 2WP0A 3KUDA 2DOKA 2AI2A 2W4MA 1O95A 1ZRNA 4XJVA 3EXFA 5GAJA 5A7HA 1AV6A 4KN5A 3DE2X 4F06A 5GOZA 4NZNA 1GA4A 3FCOA 1KERA 3CPSA 3RV3A 4DQKA 5BRJA 1NJ2A 4ZOAA 1J22A 4YBRA 2QRZA 4X20A 3GARA 4HNQA 1P7PA 4L75A 3Q0TA 4Z9BA 4N7RA 4O6VA 2PGNA 4DANA 3X43A 2YJ3A 4WOPA 1J2UA 2OAP1 4K40A 2JJQA 4WVFA 2GTIA 2OO5A 3AJ8A 4IIXA 5MDHA 4K7JA 1ADGA 4OJTA 2UZ1A 3Q5GA 2R6FA 2W6JA 3ODGA 3H5IA 3OZCA 3RS2A 3E22A 4MIKA 4C7KA 1E3TA 2FDRA 1UK8A 3A4YA 4ABYA 2WYIA 4X41A 3WIUA 2PR2A 2A57A 1B8UA 1QFYA 2PZKA 4TTIA 1PO7A 1P9RA 1XMPA 4K6KA 3R9XA 4WD3A 1Z26A 3R7NA 1L1QA 3VPFA 3NH9A 3B6MA 1AGPA 1CUHA 1QYXA 2I4NA 2W2LA 1W34A 4JMLA 4PIVA 5EWMB 5F2KA 1ZI8A 3SQNA 1ADJA 1GKIA 4MMYB 4WCVA 4PG6A 5FO0A 2HA0A 4FK8A 4IJWA 2A1IA 2UZIR 1DXQA 4TKUA 5H16A 4B33A 3DOHA 2HQOA 4C6HA 4PYJA 1HEIA 3L6DA 4MWZA 2WSYB 1E9CA 3KSMA 4Y1FA 3ZIUA 4C4SA 3G1UA 5EESA 5CBKA 4U2BA 5C5IA 1ZG3A 3TL2A 3TM5A 2QY6A 4AKTA 4EDFA 2FX2A 1C3OB 3EGCA 2O7RA 3D8NA 3MVEA 4JY7A 2ZYTX 4XKJA 5DHAA 5E38A 2EFGA 3MHPA 4Z4EA 1SCAA 4WLUA 2VSQA 1SM4A 2LIPA 3KTFA 3P27A 5KSPA 4XYBA 2WJHA 5EP3A 3GUVA 3QJ5A 4IHQA 4D3XA 1J2TA 5B58C 1EVYA 2J0VA 5FNVF 3AEQA 3B9QA 4OYHA 4QBGB 4XUDA 5E9QA 1P1FA 3VOAA 4B80A 4E46A 5IT5A 3RC1A 4FWTA 5AHXA 3BWMA 3HRHA 1H2AS 3MNFA 5GGYA 3WXBA 1ODLA 1G5IA 3ICWA 1RXVA 3WNQA 1ESMA 1J5PA 4FHZA 1QIDA 2IZ6A 4C89A 2ZU0C 3ESZA 2ZAMA 2VP4A 5INTA 2I62A 3I0ZA 1DDOA 5LNK1 4Q82A 4WBNB 2P79A 1MT0A 1XU4A 1ZGBA 2DPLA 2BISA 3GRCA 4AKIA 2WC1A 1GR0A 3BMOB 1V47A 2BEVB 1W48A 4ZT5A 5FWYB 4TV8F 3SQDA 1IPEA 4CM5A 8GPBA 4QULA 4KPEC 3IEIA 1KIMA 1BEEA 4DMFA 4F91B 3BL5A 621PA 2IPLA 2ZSAA 3B3JA 4J0DA 5I4BA 5ULLA 2BTQB 4A2CA 1F48A 1Q3HA 1K0UA 1MABA 2GD2A 3D3WB 2BI8A 1W4AA 2FZWA 2OOSA 3MJSA 3KSDO 4OH1A 1RQ7A 3TRKA 4NU6A 1TECE 1SNYA 2I99A 2P5SA 4UDNA 3C7TA 4YONB 2HPVA 5SY9A 2HRBA 4QGAA 2BBSA 3QW2A 5HUHA 1QS0A 2E21A 1XTPA 2QG9A 3ZDQA 2AHOA 5C51B 1SRRA 5E95A 2HH9A 2ZQZA 3ZZ0A 3ZD7A 5KYYB 1I5OA 1KTVA 4NATA 1G3RA 2XOKA 4MRNA 5LQJA 1WETA 4ZHQB 5KWVA 1X0XA 1QLJA 1KRWA 4QARA 3NM5A 3TAUA 5AW4A 4GI1A 4N4AA 4L02A 1UBCA 4MVJF 1FJ2A 1M5UA 4MS1B 4OJNA 3TWOA 5KOJA 3PVCA 3D02A 4XR9A 4Y6RA 3HZRA 4EL0A 2IIBA 1YA4A 4PXAA 2QRJA 1HYBA 1WSDA 2XQGA 1H69A 2VQDA 3EJ6A 1MNAA 2AK3A 2HO5A 1F5NA 1N9GB 2C9BA 2O2JA 4LCBA 4UFNA 4UNPA 1U0SY 3UC5A 2ABWA 4YRCA 5DX1A 3IHTA 2G72A 4QJBA 5JDIC 1ZXLA 2VHZA 3R3UA 3F5MA 2B7LA 3FKSD 1GG9A 5IAEA 3TZKA 4ZEVA 5CITA 4D92A 3SC3A 4UDYX 1IMJA 4PG8A 1OI2A 1Z75A 2FPIA 4WVLA 4QSHA 4LHVA 4DA0A 1CUDA 4E2YA 5BOSB 1CY0A 4PQRA 1R10A 4G24A 2CSUA 1YS6A 2ETXA 2Q21A 3L8MA 4H0NA 2PUEA 1B7GO 3LXXA 1SXJC 2PGLA 1K6EA 2FDCA 5FPQA 1L6RA 4BNHA 3KLNA 4B3CA 4CV2A 1T3HA 2GD6A 1ZK4A 3IKTA 5IJAA 3TS1A 4E6PA 5F3RA 1XDSA 5JDCA 1HE1C 1M10A 1YA8A 1SHJA 5BSEA 6NULA 4A15A 1JU9A 1V8ZA 2PSEA 1FEZA 4WDRA 3SZGA 4C7XA 1DBVO 1LJ8A 3BF8A 1R66A 3EY9A 4R2HA 4CMGA 3ASYA 3W5BA 4ZQEA 2OPBA 3T7EA 1N2GA 1AKNA 3ZNPA 3N2GB 2XXAB 4K9NA 4TVBA 4I4IA 1NF3A 3JW8A 5IWCA 5JCZA 4YMTA 4P53A 1OXTA 4A8JA 1SQ0A 4KQ1A 3QFSA 3SQLA 1KH1A 3PCXA 3T38A 2B78A 7AT1A 1B42A 1CXZA 1RWWA 3MTIA 4JOCA 3HDTA 2B3DA 3JU3A 4INPA 3WXMA 2SICE 5G4KA 3GW8A 4YY3B 4FR2A 3JD1A 2ID7A 2JLAA 3WB1A 1VYVA 2PUFA 3EZXA 3CR8A 3Q7EA 1U1CA 1O95C 3KR2A 5G1PA 3PIIA 4R01A 4QG3A 4Q15A 2YXPX 4H1TA 1SBTA 2EYUA 4WESB 1JDTA 3FWKA 4KFUA 4OFXA 4RPLA 5D1HA 2GBPA 1JIQA 4BRSA 3HBFA 1VQ1A 3OLVA 1KI3A 1P5JA 2DR2A 1XZ8A 1UBEA 4H77A 4TTRA 3CGWA 1P81A 2Y05A 1IYZA 2VBFA 3L7CA 4ZYZA 3OMWA 2WPNA 1GUDA 1FFAA 4I81A 3ZCXA 1AS3A 3P0RA 4W1SA 4AG5A 4G0VA 3JS5A 3RSOA 1I4TD 3BB3A 1ZRSA 4HS9A 4LJ4A 4BKRA 3NW9A 4EJ2A 4X6UA 1R15A 5M34A 2ZG6A 1UMDA 2J3DA 4NE9A 1J39A 1DWUA 1X1DA 4PS0A 4YJ2B 2CLMB 3E8XA 5CU7A 3STYA 4PLYA 1RPZA 1YIOA 3AM1A 2R85A 1MNQA 1PI3A 3L7JA 1D2CA 1LRKA 2P4HX 4XGNA 5B3KA 1GCAA 1E4EB 1HL3A 2WY2D 2JCXA 3LCVB 2FRDA 3R6LA 5ETJA 1B3RA 3VO1A 1T8WA 4HQKA 2HMTA 2VT2A 4MVJH 1LDYA 3VNRA 3EDCA 3E5HA 1SH7A 2GA9A 4XUCA 5HQTA 2GK6A 3UJ8A 1UK7A 5AHOA 1LW7A 2AOTB 1CG6A 1M8KA 1WHSB 4OBEA 5DIFA 5JNLA 1MFZA 1Q0HA 1E3DA 2WM8A 3BBLA 3MUNA 3WWZA 2YHUA 4DSNA 5CDSA 4EW1A 2FSUA 4LWOA 1C3XA 2NYAA 1RHQA 6YASA 3S29A 3IV9A 2BGWA 2V7XA 1A2QA 4CTOA 1CT9A 1HTTA 4UCXA 5HYVA 2R6DA 1PZXA 3VPDA 2XUOA 2YMMA 3BMXA 4MAFA 5H70A 1BH6A 1E0JA 3QP9A 4A6XA 4XRGA 2CUTA 2Y1EA 3V4RA 1FIUA 2ZIFA 4KOEC 1Z6ZA 4E3WA 1AMOA 2C31A 1J8QA 2F1HA 2WTMA 3KJQA 5TEVA 4BNMA 2I4TA 1Y9JA 1ZJJA 1KGSA 1YBVA 2ON6A 2CNLA 4YAOA 5BVGB 1J49A 2JIOA 2D2XA 1XZHA 3DL4A 3HU3A 1C3LA 1OBHA 2WJPA 3OQ6A 4HLUA 4ILEA 4PQGA 4RTRA 1P4AA 4M0LA 1LVGA 4CL3A 2G9ZA 3FI0A 1RXUA 2EZUA 3IUSA 4IGFA 3SDZA 3IE1A 4Y9UA 3PUYA 3I05A 1ZK2A 1EDZA 4EM6A 3EIQA 4YUWA 1U7TA 1VJDA 1RYDA 1WPQA 4UHKA 1J0EA 3DCYA 4YAJA 1M8PA 2V4UA 4EZIA 2I4RA 4D81A 2YHSA 4G5RA 4MUIA 4D8XA 2ZBDA 5DX8A 4CKWA 1RJGA 1ADBA 1KYIA 2J45A 5KYUA 2JFYA 2AFIB 3NZEA 4PC1A 1PL8A 3L1KA 4E09A 1OZHA 4JQZA 4D9HA 1GZ4A 1HXHA 2H8GA 2P91A 3SYKA 2SCUA 1E60A 2NU6B 4P5EA 1KMHB 1PEDA 5KNCA 3URKA 4C21A 2QRUA 3WA6A 1M73E 4EJSB 2E6KA 1TZBA 2D62A 1M1YE 1CEXA 1XD9A 4A8PA 5DW0A 4HVLA 1NQTA 1JZTA 2YX1A 3NTQA 1R0ZA 4XGRA 1PNRA 5DBOA 3DV2A 3FMOB 1EUCA 3WLRA 1YBMA 4QRIA 4D42A 3TECE 3G2QA 3QEAZ 1RP7A 2P3LA 5A5EA 2YV3A 4KGZA 5IJWA 2PZ8A 4FN5A 5JQWA 2B9VA 4B82A 5C52B 5I9NA 3DC2A 3RRBA 5J4YA 1UBHS 3DEIA 2JI7A 4IZHA 4PPYA 3ZHTA 2VPIA 4NCXA 3PSHA 2JK0A 1KMNA 4RUKA 2PQ0A 4JA0A 4D7AA 1TL7C 2H2WA 4E5VA 1ADYA 5BUZA 2X7XA 5D3MA 2FW9A 3O8OA 3ZWXA 4GR9A 4A0RA 2PD6A 5CDUA 5TQ0B 4V39A 3N75A 4Z1MA 4QYIB 1GY8A 1JXOA 5UKDA 1Q2UA 2BONA 2VXCA 4JVLA 2G1KA 2MYUA 2HOQA 1ZN2A 1PDWA 2YOHA 3BZWA 1W36D 1S2NA 1VL2A 4ND7A 5CH5A 5HCIA 2QJOA 1YR7A 2XMSA 1Z4MA 1DAPA 1ES9A 2WSMA 3D6TB 3E7PA 3MTGA 3GFGA 5LZ7A 2BHLA 4CM6A 5KOHB 3M9LA 1W1UA 4AULA 4W9MC 2OM6A 2IH4A 4ZT7A 1UJ2A 1DUIA 2R5NA 1QDUA 2EFYA 3KT6A 3MXTA 5LQNA 1QM5A 2FJ0A 2IGBA 3F46A 4P33A 4Q3NA 5TE9A 4COOA 1Z0AA 4X9XA 4YALA 5BMVF 3C5WP 4ZAZA 1CY6A 3E53A 3AW9A 1NUQA 1P1RA 1BU5A 2GZDA 3IOYA 1A9SA 3O1LA 4E7PA 1HR0B 3FETA 1JKJB 4A8JC 2GRUA 3BCUA 4W7SA 5C8YB 4EYSA 1XVTA 4O5AA 4R41A 1TTHA 2C1EA 3TTSA 2BVNA 3QPWA 2B92A 2IYUA 2A94A 3DWFA 1NUHA 1YQDA 3INRA 3Q7TA 2QV0A 3QVMA 4GMGA 4P2GA 5EIOA 4L0MA 5EL0A 3U81A 3CISA 4PZUA 2ODNA 3P19A 1XTUA 2I76A 3OCVA 4R1QA 3ZCRA 4I4NA 4QUEA 2AN3A 1FSSA 1QC5B 4RTKA 4LJ6A 4FEAA 4GBMA 5JARA 2XHZA 3JR7A 4PO8A 1YK0A 4EG7A 2BF7A 4ZYVA 2EKQA 1QPBA 3AI7A 5M5BA 2C57A 2O2EA 3MWDA 2IXTA 1U9ZA 1D0IA 2HUNA 3PKJA 5EWMA 4DMRA 3PKZA 3K7EA 1X7DA 2CYBA 3MERA 2VHCA 4GP7A 4FD2A 4X85A 1EGAA 4F96A 3EXAA 1JWAB 3LAWA 4XEUA 2I7TA 3QVSA 2W37A 2NVUB 3SJAA 4EYGA 2Z5GA 4YRNA 1I3CA 2JLUA 5EZQA 1B6RA 2O3QA 1NG9A 1LNQA 1LQ2A 2FZ5A 2D59A 3NBQA 5HF6A 3TTVA 2AK2A 3GMIA 2C2OA 3WICA 4DJFC 1AKQA 4BX9A 4AIIA 2P2LA 2X0RA 1C3OA 1YHZA 1G5TA 1TF2A 3GVPA 3K5HA 5THQA 1TJNA 3ZG6A 3OLWA 2VJBA 1RRGA 1Y63A 3GP3A 1XKQA 5H80A 4KE7A 3ICVA 3UG7A 1JZQA 4WJKB 1QF7A 1WMEA 4LNAA 3SJZA 3NHLA 4DSUA 1DIOB 1CUSA 4OQXA 1P0MA 1Q0RA 2FRDC 3EARA 4KXWA 4P32A 2CLKB 3ASUA 2IXDA 4M1SA 3DD5A 1UODA 5KYXA 1N2CA 3ED1A 3EHDA 1JA0A 3HP7A 2X76A 1IN7A 4WBNA 2VJPA 5F9MA 1N6HA 1AA6A 1R2QA 3CE9A 3HEMA 3N87A 4PIMA 1N36B 4WNIA 1CY7A 2V7QD 1VI2A 4B4WA 2BEVA 2PGXA 3COPA 3EQZA 3O2JA 4PC2A 2PWPA 3KJEA 4WXEA 3T5DA 3TE6A 3UFXA 2QGZA 4HADA 4MO2A 4PICA 4M0FA 4X6LA 5AI0A 1EFLA 5K3SA 4U8GA 4EFMA 4PFKA 4LECA 1RYYA 3DKIA 1SY7A 4GP9A 2FEAA 2J9YB 5EZ6B 1L5GB 4G5XA 1OXBB 4B1FA 4DN6A 3D3WA 3MTAA 1T29A 4S2UA 4TRRA 4D9IA 1KK1A 2DAPA 1JWBB 1JH8A 2Q2OA 2ZATA 3C87A 4Q9AA 5EXTA 1NZJA 3LWBA 3GPCA 3T9BA 4FWIB 4BRUA 2AG5A 4FSXA 1YCHA 2VAMA 4HLUC 4YB8A 1CULC 3GIDA 3HSKA 4CF6A 5KYYA 2X2FA 2WMYA 3KSZO 5ERYA 3R77A 4LBZA 1KFCB 3TKLA 1WW3A 2D4AA 4CIDA 1WV1A 5BUCA 2NW6A 1THTA 3LCUA 4NPHA 1XZPA 4YI3A 3QI7A 3UVEA 3S68A 2PL5A 4YREA 4YIKA 1IQUA 1X7YB 4MYUA 4LX8A 1VKZA 1AQIA 4DY4A 1OSNA 1Z8FA 3Q98A 3ETEA 1NYRA 1ZQ9A 2ICAA 1CF2O 1K8QA 1NI4A 1N9GA 3TEMA 1KZ7B 3LHDA 3A2LA 4Y6GB 1AHHA 2OBYA 1IK6A 5EXDA 1BXRB 5EMLA 4ZJZA 4O4JA 4PBRA 4B0PA 4U39A 4OHKA 3L84A 4DUGA 1TVCA 5BR4A 4QO7A 3M9XA 5BOSA 4K88A 2VUTA 4X8OA 4DC1A 3CINA 3FFAA 4DCVA 2W6CX 1XT6A 1Z07A 3L2OB 1B41A 2Q3HA 3S0JA 3QY0A 3KVNA 3THYA 4NICA 4JSTA 5HFNA 3BXHA 1UJNA 2Q3EA 3LZCA 5BN5B 1I24A 1Z4IA 1E6MA 4ZOLA 1U0OC 3ZJ4A 3TAHA 2FP4B 3CA8A 4JJ6A 2EYQA 2G1PA 5AOCA 1N33B 4UVGA 3V8MA 1UMCB 3FTDA 3N2GA 2GD1O 1LS6A 1OBOA 3DAYA 2WWFA 4OL0A 1P1BA 1Z5OA 4Q5IA 3T5CA 1OIVA 2C5GA 3FB1A 2WJ6A 1P44A 3H19A 2DQSA 3IOCA 3WBJA 2QQFA 5LOVB 2EJUA 3PHGA 5AMXA 1NF9A 1ZGHA 4QYMA 1M6HA 1COWA 5HKOA 1K3UB 3HFSA 1R9GA 1V8FA 3KZVA 3PLRA 1FQJA 4FDLA 3BAFA 5ALEA 3ZXIA 2ATIA 3L07A 3AF5A 3REQA 4BE4A 2Q3MA 1E2MA 2FXIA 3NKVA 5EQDA 4C4TA 4TLCA 4AKHA 3AM4A 2J31A 3IILA 1H23A 1AHNA 1QTNA 3LSYA 4IPTA 2NWQA 3BS4A 3NQ41 4GYJA 2HNBA 3S40A 4ZDJA 1XNQB 3NVDA 3PDJA 3P9CA 2CXRA 2OXTA 2WWRA 3E9NA 4WESA 1C7FA 2UZ3A 3AR7A 2IHBA 3FOFC 1UOEA 4Q6WA 2UYGA 1AG9A 3L9WA 2FW0A 3Q3EA 4G81A 4L1KA 3BX1A 4QJ5A 5EAIA 4EY7A 1D1TA 4KITB 3CM0A 4FFVA 1NONA 4R3UC 3RRYA 3OIWA 3VISA 4PXYA 4KFSA 2DB3A 3UMSA 2IV3A 1YGPA 2CDAA 1IY2A 5FBHA 4NQZA 4QOEA 2YR0A 3GJ8A 4BNYA 2QRPA 4Y2UA 3KT8A 5EHGA 3STWA 2VSYA 3DDWA 3KXPA 3EZLA 3ND7A 4OLBA 3G02A 3JYOA 4R7ZA 4IUCS 1O0SA 2XWJI 3FM9A 5TV2A 3K70B 1NN1A 2LIVA 2Q6OA 3PRYA 4D9KA 2WK1A 3ZVRA 3FI9A 4R9RA 1DCFA 4XLLA 1QQ5A 4O2BF 1QZTA 4D9BA 1WUJS 1R37A 4YJ2A 3RT9A 1U8UA 3ANNA 1Y82A 1QKKA 3PF8A 4DCNA 2XKJE 4ND4A 1NULA 3IO3A 2ANCA 3OF2A 1KRHA 5LLDA 1G60A 2QAIA 4ZZIA 3AG6A 2CXUA 4YP0A 2XT9A 2WWIA 5CFOA 4PCVA 2FPKA 2IIPA 3L5KA 4QUIA 3HLTA 1ETHA 2M1XA 3HXKA 2RGXA 3L79A 1HO3A 4CLRB 2R8YA 3BH6A 4RJ2A 3UAVA 3GGSA 4I1SA 3EBOA 2W22A 3HCAA 3EGWA 2QTAA 4KSYA 4MW4A 2OM2A 2XW6A 5LDGA 1G5FA 3EIOA 4JKIA 2QLLA 4W7IA 1J24A 2QEQA 2VZEA 4L2IB 4A5SA 1JEEA 3HXPA 2RB4A 1U3GA 4UU7A 1EFUA 2XDQA 5DM60 4XDGA 3GZNB 4WY5A 3JTMA 1UOOA 3HCFA 4EHHA 5HKAA 2I4MA 1UT5A 1RYZA 2FSIA 4Y9RA 3G0CA 5BVGA 2XVMA 3E9MA 3EG5A 2Q0XA 2AC7A 4YWHA 5FTKA 1M1YB 3HJCA 4L74A 1H4VB 2LW7A 2RCYA 4HRYA 4FGSA 2XWSA 3K4QA 4RPKA 2R3SA 1NG1A 1IN6A 2P67A 4RSRA 3RVKA 1L4NA 1OV4A 2DGDA 1I13A 2E0IA 3ANTA 2ODQA 4KUGA 3RTEA 1L7QA 1NT4A 1H9AA 1JYSA 2FAXA 2YQ4A 3RG2A 3H8VA 4M9SA 5D6OA 1NBOA 3HV2A 4MV3A 1TFRA 4MKZA 5BR8B 2DUNA 3B38A 1DBSA 1UDRA 2XUHA 3NDPA 1I9CA 2J4FA 4UJ3A 3WL3A 4ZHSA 4GVLA 1UBOS 4FXPA 4TUYF 4Z4CA 1XCBA 5JMWA 2AFIA 5FL3A 1JDZA 4OYLA 4CPDA 5AD1A 2R4QA 1I1QB 4UNNA 4YJHA 4CF7A 4DV3B 1LQUA 5JC8A 5K03A 3V3TA 2NU6A 4K9RA 1KMHA 1NR5A 1SVUA 2CGEA 1XL1A 2FUG6 4LKRA 2GKGA 4HWRA 2JIBA 2RGBA 1WMFA 2FI1A 3FE2A 4C7JA 2I66A 5DV9A 1JXMA 4EJSA 1W0JA 1F17A 2I0FA 2I6TA 2R44A 3AKDA 3CZ5A 1DV1A 2P1RA 1BWPA 3IKJA 4DZZA 5HM8A 3U56A 3C3CA 4E88A 5MGNA 1PG5A 5NULA 3V1UA 1V9LA 1T15A 1TO1E 1WABA 2V74B 3P0HA 4YHHB 1O6FA 4YLEA 1DKPA 1QG4A 4NDAA 4KNWA 2PKCA 4S1WA 3LWDA 2BDTA 2CDRA 5FD8A 2OEPA 2DECA 3CW8X 3TAXA 3EZYA 5HOEA 1GPLA 3JAKB 3CSDA 2ENUA 4LXYA 3N0WA 1KDTA 4TKLA 5MN5A 2A7QA 3OZIA 2MHCA 1REQB 3PQFA 1H1LB 2V0NA 2BMDA 2ATCA 3C5VA 4RHXA 3J81k 3H2IA 1GPDG 1CP2A 3PL1A 5FUYA 5LYJB 1SBQA 3P96A 4N7BA 4AVYA 1VKRA 3DE4X 4GLOA 4AJOA 4GQBA 4PLWA 3ZYZA 4UM5A 2ZWOA 2PUCA 3AEYA 3NHUA 5TQ0A 4KMOA 4QYIA 1WY7A 2C03A 2EQAA 1IXSB 3ZHQA 3Q15C 5BXQC 2EXXA 4C7VA 1TUBB 3N07A 1KO8A 4AURA 3G8CA 5AXAA 2VDKB 4MJXA 3UT6A 1FK8A 1SC1A 4PHGA 3RYHB 4B4UA 1SUCA 4Q24A 5KOHA 1G8JA 2Y99A 1PJBA 3G6WA 1PKXA 2GBLA 3KB1A 4LVOA 2HJVA 4LVNA 2P7HA 1QG0A 1NKSA 3WMXA 3LLCA 3X1WA 3B3FA 4E07A 1I3OA 5K0ZA 2YXDA 4JBXA 1CZRA 4UULA 2A6PA 2YZKA 2YBEA 2ZOSA 3F4BA 5C8YA 1JKJA 1UP4A 2IW1A 2W2VA 3T52A 2W2PA 1QRSA 4W9NA 3CNNA 1XZDA 3OJLA 5LBTA 3WDKA 3Q10A 5DMHA 3DBIA 2X9GA 5ESRA 2D1QA 4IDGA 3OIYA 4AJ4A 5JSHA 4MMZB 1BS2A 2CVHA 1QWOA 2YIDA 3CXRA 2WFAA 4CM9A 2P8JA 4CR6A 3CG0A 1X1EA 4UEKA 4RK4A 4WI1A 1O3YA 2JEYA 3K30A 1MFPA 4XIIA 1L1EA 2OZEA 5JSUA 3BD8A 1UDXA 1EYZA 1CZUA 1RWQA 2R1VB 3RSQA 1DDGA 1E4OA 2WD7B 3O21A 1RS0A 4M37A 5BP7A 1HURA 3PC4A 4LJ8A 4C3VA 3AHIA 2NO4A 2ZUSA 4DHWA 1JV2B 1ESDA 3HYNA 1XN4A 1KO5A 4FFPA 1SR8A 4N1AA 3ICQB 3LIIA 3OECA 4QM7A 3P32A 4N49A 4DA9A 4LYHA 2DG2A 1RW4A 3C7CB 1SVKA 4PNZA 3WYNA 1IB0A 3Q72A 2Z6QA 2C1ZA 2R25B 4AJ1A 3EVNA 1L5ZA 5ICEA 1DCKA 2AG8A 5KQSA 2JGNA 1QFXA 3TVDA 4TWRA 4FNGA 4C0HA 4A73A 1YL7A 1MVLA 4H3VA 2ECOA 3SZ3A 3R5SA 2YV5A 3DT9A 3LT5A 3HV0A 3EOZA 1VLHA 4RD2A 3A4VA 4BZPA 4G1BA 4EYQA 1TVKB 1SXJD 4FCCA 2P6NA 2GEJA 1IPHA 1LBIA 3OQPA 3QJYA 4LXQA 3U31A 3W8EA 1AQYA 4H1VA 3WJ7A 4TM8A 2VL7A 1L7PA 4L8VA 1B6GA 2KSQA 5AR1A 4IGEA 5CW2A 3NM4A 1GM5A 2ORWA 2ZIWB 3E7DA 4RQTA 3E84A 3P1JA 3DPUA 4ZKDA 1L4HA 2QQEA 3E15A 1GAEO 1YCFA 2QMZA 2KWIA 5F78A 5JYCA 3FLAA 3CZCA 2CXOA 3U9TA 5J4HA 2BHNA 3A3PA 3WK7A 5M29A 2ZT6A 5F1KA 2XUFA 1Q1BA 3R3YA 4RF2A 2P90A 4PAQA 3ZD8A 3GFOA 1RZUA 2BP7B 1E7MA 1PJQA 1Y3AA 1XPUA 1S9HA 3EFEA 4PAGA 3B1ZA 2RGUA 1P19A 3NIGB 2FUG1 2P6UA 2HPHA 3CR3C 5HFJA 1RYMA 3TH5A 4Q4AB 2FN8A 4O1MA 4S12A 1U1GA 3RASA 3SJBA 1FFXA 1YS7A 3TG8A 4ZVOA 2P4UA 1XWIA 3BWDD 2HWYA 3EQ9A 3W5AA 1GAJA 1MDFA 1NOJA 4BP3A 2WJGA 3PF9A 3WGIA 3TTTA 1FMFA 1UDBA 3KQPA 2QMYA 3ZW7A 2J09A 3IFSA 4TMTA 4ARVA 4TQ9A 5IC4A 3I76A 5ALQA 3AR3A 1IZ7A 3TLBA 1Z47A 2V6IA 4ETNA 1T5DX 3L6UA 1RC8A 1X7YA 3ZWVA 1YULA 2ZYSA 1X39A 4M1MA 5BV2P 3ASVA 1X9IA 1XNHA 1E79A 2HN9A 5I01A 2W0MA 2WKSA 2EZ4A 1JJIA 2Z57A 5LBUA 2QMEA 5CFQA 2X1VA 2Y1XA 3LCCA 3DAOA 4TXJA 4ZD6A