4RK4A

Crystal structure of laci family transcriptional regulator from lactobacillus casei, target efi-512911, with bound glucose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
275
structure length
270
Chain Sequence
TGNIGVLVSRVTNPFFAGLFDAIERELHAHGYQVMITQTYDDPEAEERFLKQLKSRELDGVILASVEAPDRVMAVAKAFPGRVVVVNADVQIPGATSLVLPHYQATRDALDYLFNQGHRRFAYVSGGTISGAHHGQSRTQAFLDFMQAHQLLVAQDLLFGQIHTAKEGQAVGKQLASLAPNVRPDAVFTNSDEVAVGVIDSLLAADVKVPDDIAVMGYDDQPFAPFAKIPLTTVHQPVASMAAAATHELLKGLGRQVAQLHLSLKIRQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LacI family
publication title Crystal Structure of LacI Transcriptional Regulator Lsei_2103 from Lactobacillus casei, Target EFI-512911
rcsb
source organism Lactobacillus casei atcc 334
molecule tags Transcription regulator
total genus 102
structure length 270
sequence length 275
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk4A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk4A01
4HYEA 3LUJA 1GLGA 4RK4A 3LUCA 5CNMA 5TE9A 1QMPA 3H5TA 2DRIA 3JPYA 5IBQA 2QSJA 2PAFA 3N53A 3Q7TA 5FWXA 1SXIA 5F64A 3S99A 4LE0A 2OENG 5DTEA 5IX8A 2P9HA 3EDCA 5E3JA 3OQOA 5IUJC 3I45A 3QEKA 4MYRA 4N0QA 1U04A 4EVRA 4RV5A 1APBA 3FFTA 3JS5A 3TX6A 4O1IA 3ROFA 4OG2A 4PICA 1YMVA 4XXHA 3T38A 1TM2A 3SY8A 4YO7A 3H6GA 3G1WA 1NXXA 1P6UA 4MQEA 4G0ZA 4IRXA 1UDRA 1QO0A 3QLVA 4JB2A 2HQOA 5CNIA 1XWWA 3ILHA 5JNUA 3DLHA 3C3KA 1MB0A 5DKFA 2HQBA 2WJWA 2MYPA 2WMYA 3GYBA 1Z13A 4MS4A 2E4ZA 3TD9A 3W9SA 4D6YA 5IUNC 2R48A 5EWMA 2NZVG 4W5OA 4F06A 4NCBA 4G0OA 2IKSA 2MSKA 2MSWA 3GL9A 5JNRA 1CHNA 3OO0A 3RVPA 2V0NA 4RKRA 3QEMB 4YWHA 5HQJA 2AYXA 2JVIA 4OATA 3BREA 1ZGGA 3LTEA 2FEPA 2LIVA 2J48A 3R0JA 1Z17A 1DRJA 2PUAA 1U0SY 2IPNA 4RK6A 4UHKA 5JNSA 1RXIA 1USKA 3EQZA 2JB9A 2HJ9A 2NZUG 3LUGA 4YR7A 1VRVA 1NXOA 4W5NA 3SG0A 3URMA 1D1QA 4N47A 2GWRA 1YIOA 4HNQA 4HNSA 2PE5A 1LBHA 5ED4A 3VNBA 1ABEA 1DC7A 2CHEA 2M1ZA 2WJAA 4ZPJA 2NT4A 3MYYA 5JNVA 3H5LA 4H60A 3RVRA 1YVUA 2JVJA 4L4UA 4OTZA 3RVNA 3HO1A 3BBLA 1E6LA 1QP7A 1ZH2A 3QELB 5EWLB 3RVLA 4KK4A 4WT7A 3NHMA 2L18A 3CTPA 3E61A 1DG9A 3G85A 4HNRA 4XLTA 1NXSA 2A9QA 3Q9SA 4NICA 1QP0A 1H9CA 3B2NA 1ZHHA 5BQ3A 1DCMA 3O2JA 4IMJB 5EWJB 4KZKA 9ABPA 3I09A 3O2QB 4Z4FA 1JL3A 1BA2A 1MIHA 3LMKA 2L17A 3M9WA 4O1HA 5FBKA 4KK3A 2QW1A 1KRWA 2RJNA 2MYUA 3N6VA 2ZWMA 3O75A 1JYEA 2WB4A 1Z2EA 3LOPA 5IULC 3C3MA 3UKJA 1PEAA 2PUFA 2FTKE 4OLAA 2A9OA 1TLFA 4JAVC 1Z18A 3IP5A 4Z9BA 2LPMA 2NT3A 2QV0A 4RU1A 5C5CA 3H5VA 1DCKA 1MAVA 1PHRA 1XHEA 3EQ2A 3LUAA 4JB0A 5IC5A 4Z4EA 2QXYA 2IDMA 2LBPA 3T8YA 2PUGA 4NCAA 1Z15A 1ZH4A 3OLWA 1I3CA 4EYOA 1JWLA 1AB6A 4N41A 1DZ3A 1P8AA 4ZYLA 3CZCA 1U2QA 3KYJB 1EHCA 3QEMA 1PEYA 1E6KA 3FDFA 2Q5CA 5CHYA 3NBMA 4F8JA 4IF4A 4N0PA 4MS3A 1VLZA 3LUDA 1S8NA 4PZ0A 4P1ZA 2JK1A 1P6QA 4MRMB 2PUBA 3Q15C 1JFSA 3LUKA 3HCWA 1QPZA 1L5ZA 1AB5A 1PUXA 1E2BA 4PE5B 4YCSA 2FQWA 2JCGA 1LBIA 4L85A 2MYTA 3EGCA 2GBPA 1A0OA 3OM1A 1R8JA 3LUHA 3JY6A 3O1HB 3Q7RA 4MS1B 2TMYA 1QKKA 3H1FA 4F12A 5T7BA 1ISSA 4RXUA 3I5AA 4E7OA 3HZHA 1JLKA 2FSPA 3CU5A 4YS6A 3KCNA 4EYGA 1EFAA 2E4VA 1JDNA 1OXKB 3MIZA 4H3HB 1NTRA 2BGGA 3F73A 1L5YA 2OQRA 3H5IA 3OQMA 2FEKA 1U8TA 2ZAYA 4LDZA 3M9XA 3N0XA 4RK0A 3F6CA 1EWKA 3CRNA 4G0YA 6CHYA 3A10A 1Z2DA 1LK0A 2CHFA 4RSMA 3HM9A 4Q6BA 2FEWB 4B09A 4JA2A 2PUEA 4LE1A 2B4AA 5GQSA 4D74A 2FMHA 4RWEA 1JF8A 1NXWA 4LE2A 3RVJA 5DGCA 2H3HA 3L6UA 3H1EA 3KHTA 2FMKA 3O1JC 1LJLA 3JTEA 3L49A 5GOTA 1BDIA 5FWYA 1FFGA 2CD7A 2ID9A 4QICA 6ABPA 2L19A 1A2OA 3MMNA 2N9UA 4KV7A 3GBVA 4TMYA 1RPJA 4QPJC 4Q7EA 5TQ0A 3UUGA 2PLNA 3QX8A 4MR8A 3DLBA 2VUIB 3IPCA 5TQ2A 3EJWA 1QQAA 1TVMA 4GPAA 5TPWA 3GBPA 3HDGA 2R25B 1NXVA 3JPWA 2LP4Y 3OO1A 4IGAA 2MSLA 2E4UA 4RKQA 2JBAB 4MQFA 4MR7A 3HS3A 1LJUA 1JFVA 3UK0A 1M2EA 1GUDA 3DBIA 4MLDA 4Q6WA 3HJFA 4LRQA 3MM4A 4JOQA 3CHYA 4W5TA 2IPMA 3JVIA 3IDOA 3T95A 2WY2D 5TPZA 1USIA 2PL1A 1ZGZA 1DBPA 3OLZA 4ML3A 3H5OA 5T3YA 3QK7A 5ABPA 5FWXB 4N03A 5KWSA 1ZVVA 2ID7A 2QZJA 1DC8A 3GV0A 4Z4GA 3VNAA 5HKOA 1DRKA 1NXPA 2WRZA 2P4UA 3Q7SA 3F7NA 4WXEA 4NQRA 3H1GA 4WZZA 3IP9A 5D2CA 5KI6A 4WUTA 4N76A 1NATA 3CG4A 3MF4A 3OM0A 2JVKA 3HEBA 3KLOA 1YK1A 3C3WA 4D6XA 3RQIA 2QU7A 4ETIA 4QYWA 3GRCA 1JYFA 3TO5A 4MQEB 5DCLA 4O5AA 2PUCA 2I6FA 2QR3A 2YHBA 3CLKA 1ISRA 4FB4A 2YHAA 1KMIY 2O20A 1ZDMA 3H75A 5TPZD 3RVQA 5BRJA 4RK5A 3LKBA 1JH9A 3NNSA 4YGXB 4TLLB 4F11A 1Z25A 3HV2A 4MS4B 1GCGA 2FN9A 4G0MA 3HDVA 4RS3A 1RXEA 3ILYA 2LUOA 5EWMB 4MR9B 4Y9TA 2WWVD 4RY9A 1Z12A 1F51E 3IP7A 4ZMRA 5C5EA 3QX9A 3C6QA 4YV7A 3A0RB 2RJOA 4G97A 1VPWA 3FFWA 4E7PA 4LZLA 4TN5A 2FQYA 4H3KB 4KPYA 3FMVA 1ZY2A 3HSYA 2PKXA 3OQNA 1F4VA 3FFXA 4JASB 3BRQA 5KC9A 1FSPA 3HXMA 1E6MA 2A9RA 2VK2A 4RK7A 4EVQA 2QVCA 1FQWA 3O2SB 5TQJA 2VUHB 3C97A 3A3KA 1A04A 1D1PA 1ZESA 2CWDA 1OXBB 1NXTA 4EYQA 3N0WA 3K4HA 1D5WA 2IYNA 3CG0A 3GWGA 2H0AA 1DBWA 4G0QA 1GUBA 2W42A 4IILA 4KVFA 4EYKA 5IEJA 4XASA 1NY5A 4ETMA 5KQMA 1EAYA 5I4CA 1MVOA 2E4YA 2FN8A 2FW0A 3QELA 5EWLA 7ABPA 2B1JA 5KQLA 3BRSA 1J56A 3CS3A 5CNJA 5B3JC 2QVGA 4KNYA 3EAFA 3RVOA 4GNRA 2MYNA 3H6HA 4XAQA 4MQFB 5JS1A 1FFWA 2HPHA 2XDYA 2FMFA 1K66A 2PMCA 1EWTA 1VKRA 1D4ZA 4MAAA 3TB6A 2M98A 3RVKA 1WETA 2AYZA 3N8IA 5EWJA 4Z9AA 3ROTA 1QP4A 3N0RA 4KFCA 2PUDA 3RH0A 2PJUA 2FVYA 2RGYA 3FGZA 2GKGA 1JDPA 2FXIA 2E4XA 4TLMB 1ABFA 1GCAA 3HUUA 3SM9A 3KS9A 4LDAA 4EUKA 1T34A 1JHZA 2HSGA 1SRRA 4W5QA 2L2QA 4KQCA 2IPAB 5CNKA 4KRFA 4JP1A 3O74A 3CKMA 1FFSA 3I42A 3Q41A 3KYIB 3OLVA 1BDJA 5HSGA 3SQNA 1M5TA 1K68A 1QQBA 1ZN2A 3KG2A 3RVSA 4S05A 1BDHA 1RNLA 1USGA 3D02A 3QLUC 1DBQA 1URPA 1ZITA 3O21A 4OBBA 4RDCA 4MR9A 4CBVA 1CYEA 1D2AA 1U2PA 4DN6A 5KC8A 4G0XA 5B3JA 3NNNA 3F6PA 4LX8A 4S04A 3EODA 4RK1A 4MRMA 1KGSA 4PYRA 2GI4A 1Z26A 4MS3B 1YMUA 3MQ4A 2JRLA 4KQ9A 3DGEC 4YRZA 4YP9A 4MGEA 3LFTA 1QO0D 4Z0NA 4Z4CA 3KKEA 1RZRA 4MS1A 3HK2A 1DJMA 1SXGA 3LKVA 3JVDA 8ABPA 1EWVA 2RDMA 3KJXA 2GX6A 1Y1LA 1YS7A 2FQXA 3DGFC 4ETNA 1MB3A 2A9PA 1CEYA 4MPTA 4G0PA 4RXMA 4RY0A 5HM6A 1IIBA 3BILA 5FBHA 1DP4A 1JFTA 4RY8A 4ZJPA 2HQRA 1M2FA 3QLTA 4UHJA 3TMYA 3IPAA 4P98A 2IPLA 5IUKC 4DADA 1SD5A 3KTOA 5KQPA 1B00A 3OLYA 4M88A 2R47A 1W25A 3KLNA 3MA0A 4YLEA 1TJYA 3QLUA 3KSMA 3K9CA 3H5WA 3OMXA 5DLEA 4XFKA 3O1IC 3EULA 3E3MA 2KYRA 3D8UA 3RVMA 1PNRA 4Z99A 1RZRD 5PNTA 2FLWA 1P2FA 1JBEA 3HVRA 5IEBA 1M5UA 1YTUA 2FLKA 1XHFA 1C0EA 3OMWA 4ZMSA 4OLBA 2FKAA 3LUFA 4EY3A 4W5RA 2F8SA 3CNBA 5KQGA 1SXHA 3NNDA 5JNTA 3CZ5A 3HUTA 4FE4A 4IMIB 4MLCA 2R4QA 4NV3A 5FWYB 2FMIA 2X7XA 3GT7A 3NHZA 3OLXA 3GA5A 4DQDA 2F8TA 4WWHA 3P9YA 5JNWA 4EGSA 3A0UA 3IP6A 2E4WA 1PNTA 1ZAYA 1HEYA 3M6MD 2PL9A 3DZDA 3T6KA 5TQ0B 3SAJA 4QYMA 1KRXA 4RXTA 3QLVC 4MR8B 1W9HA 4G86A 5TQ2B 1C4WA 5BR1A 1DCFA 1Z16A 2IOYA 4XARA 4KMRA 4EVSA 2JBAA 2VYCA 1YS6A 4PEVA 1BAPA 2NUBA 5JS2A 5TPWB 4FE7A 4RZSA 1QNLA 3SNKA 4WXMA 4Z4HA 4F3TA 4Z4IA 4KREA 3CFYA 1BVHA 5BRAA 1JX6A 4MR7B 1YK0A 1TMYA 3N75A
chains in the Genus database with same CATH superfamily
1XZFA 3CX7A 2FU5C 1AU9A 4GRIA 3SQOA 4QRIA 2HWUA 3KOOA 3C24A 1B0AA 1CJSA 1NE7A 1AH2A 1MC5A 3KHUA 2BGRA 5KX5F 3E48A 1CRQA 1TU4A 4JIMA 1O3YA 1TQHA 1GRRA 3JATA 5ITVA 4B4UA 1HL3A 5DTEA 3WKBA 2AOUB 3OQOA 3N0VA 4G26A 5ERYA 3EF3A 1M1YB 3FR7A 3QEKA 2W70A 3AFHA 1L9XA 4KWTA 1QB8A 1APBA 1PL6A 3N05A 3EXHB 4TL6A 2HU8A 4CR8A 4O1IA 3L7YA 4XPIB 1C7ZA 3IOBA 1SVNA 2BFFB 2H17A 3Q8XB 3DL2A 3X2FA 4YLYA 1E4OA 3QEOA 2WM3A 5HS6A 1VKHA 4MA4A 3GFBA 5G0WA 4MB0A 3PD1A 4U2EA 4IW3B 4RDHA 4WNAB 2X4LA 4G09A 4HWPA 4DCVA 4EJ2A 4XB1A 3KZ1E 4MV1A 4G0ZA 3SS8A 3DOHA 4AF6A 2B1QA 4ND7A 3AJRA 3WIDA 1T1SA 1UZMA 4H15A 4D9MA 1G7TA 2G1KA 1KPHA 4G8BA 1PV4A 3E6AA 5I9NA 5DKFA 1MB0A 4ON9A 4PSVA 2EW8A 2HQBA 4FFNA 4L3VA 2WYOA 4LJSA 1MFZA 4F5WA 2ZCUA 1Y8AA 3QKTA 3UFXB 1OJLA 5JFGA 4CMEA 2DUWA 2DTXA 3W9SA 1WP9A 1WY7A 1RABA 3J7TA 3GD7A 4EG7A 2P27A 4EY4A 4ZAGA 1ZONA 3D7SA 4HVCA 1NQTA 5LBUA 2DWPA 1QC5A 2AMJA 5AM1A 5FFNA 3THXA 4EG3A 5F1KA 8ATCA 2OYRA 1OX4B 5B58C 2PKCA 1RZ3A 1E18A 2AYXA 2JVIA 2XQGA 3BREA 3BSSA 3KM0A 4CKCB 4EHLA 2CXNA 3NWJA 4QFDA 4QQRA 2CUKA 1Z28A 5A5GA 5EP4A 1TAHA 1M83A 3RHSA 4B3BA 4F46A 5FYQA 3SX4A 2X9QA 2XNDA 2AI2A 1JQDA 3K20A 2GAAA 2OAP1 1OWPA 5HDBB 3EQZA 1DEOA 2KM1A 3LUPA 3EEQA 3NHJA 5F4ZA 2IYZA 2A3RA 1J0BA 1BHSA 2AVNA 2PXCA 3Q2OA 1VRVA 4B79A 3FKJA 4Z0TA 1LFDB 2ONYA 1A5ZA 1PG5A 1PJ2A 4D3YA 4YCMA 1DGQA 2I3ZA 2BDUA 3FMIA 1FJHA 4UPEA 3LPMA 2REOA 4FOOA 1LBEA 2C7OA 1FQJA 2J5XA 1E3IA 1FX0A 1G41A 1XTRA 3H2KA 4IIBA 5E6SB 2ZUTA 3ZIUA 2AVDA 3GLVA 3H9CA 1QG4A 2ANCA 2C2MA 2I5PO 5BXYA 4PCUA 6REQB 4PPYA 3D0RA 3H8WA 4D8YA 5EN4A 3HO1A 4X1KA 3P1JA 1NNLA 4Z0PA 4ME6A 2IXFA 5EWLB 5DNWA 1QAMA 3AG6A 3EDQA 4P38A 5HK9A 3OE1A 1CJUC 4JBHA 3UAGA 2NU7B 4OIMA 3T5AA 1SC1A 1MAWA 2P78A 3KV1A 2LNDA 3C3JA 4OOFA 1ADBA 1U2ZA 3ZDCA 1H9CA 3CX4A 1E9BA 1ODCA 4KZKA 3A3NA 3EOBI 4EW3A 4YRMA 2JHGA 1IOWA 3W4IA 4KIJA 4H0CA 1VYUA 3GLIA 2O0MA 4ACAA 4LSMA 3AVVA 3GAMA 4LHZA 2A5YB 1NZDA 2JDID 4KK3A 1X7XB 2AN3A 3S29A 4Q9AA 3RWMB 5AUPB 2EX1A 1Q95A 3HB5X 2HSJA 3PU6A 4R68A 5J2TB 4N1AA 3IO5A 4G07A 2HJSA 4IHJB 2P4SA 1FP4A 5FD8A 4I9HA 4UJ5A 2F1RA 4WE3A 4F86A 4L57A 1WJGA 2ACWA 3PUJA 4DGSA 3D8NA 4C7KA 3THWB 3Q0TA 2VATA 3SI7A 2VDOB 1U7XA 5IKEA 1JWLA 4N41A 5F2OA 1YQEA 1YL6A 2OB1A 5ADHA 2CHGA 4UHBA 1E1RD 2B3DA 1T9HA 5EVCA 1ZGCA 2H2DA 2JLRA 3UCFA 4YPOA 3JAWA 5E1MA 1WKCA 1T6ZA 2FRXA 3QWFA 2Q0HA 4LHWA 3RS8A 5FTMA 5E38A 3WYDA 2BEJA 3U37A 3VKGA 1I4DD 1RRFA 2ZR7A 4N0PA 4W8HA 4BC0A 3OU6A 1FU7A 3AHJA 1WZEA 3M6VA 2NTJA 2VPQA 3VC1A 2I9PA 4WZAE 4D9JA 5J1SB 3NUGA 3LOUA 3WJ2A 4ZFNA 1JFSA 2QM8A 1QPZA 3V8BA 1L5ZA 2C8KA 4RAOA 1PUXA 4UNRA 4FHZA 2GWHA 1XMVA 3A26A 5F7ZA 4D79A 2QTWB 1LBIA 1NUHA 2J0EA 4M8SA 3N2ZB 1OTXA 3R5JA 5E9QA 2A1IA 3K0CA 3JY6A 3WV4A 3NMUF 5IANA 3Q7RA 3CUYA 5KJFA 3TZEA 1WBJB 5DBEX 1QKKA 4Y2XA 3UB3A 1UC8A 3G6WA 4MGYR 4UM5A 1AKTA 4E7OA 4L6AA 2QHXA 2ZU0C 3CR3C 2FSPA 3LL7A 4G84A 1IWOA 2Q8NA 3SYLA 1V5FA 2W5UA 1FDWA 2QJTA 2I1QA 3F4BA 4CF4A 2PL3A 2C82A 1U8UA 2XRYA 2ZRCA 1L5YA 2XEXA 4X54A 3OQMA 5LNK6 1A82A 2JZNA 1P2GA 1U8TA 3BTSA 3MFQA 4OLFA 4XIGS 3WXBA 4A8TA 4ZI7B 3LECA 3DF7A 1VM6A 1B0UA 4ZZ2A 3DJYA 1G66A 1XDDA 2NW6A 1ZGAA 3A58B 2D13A 6CHYA 5JADA 2B1IA 3FTPA 3KQKA 1E2KA 4Q6BA 1NVVQ 4WFJA 3MHTA 4LHVA 2IC5A 1C7RA 1LQUA 2NVOA 3H19A 4S0ZA 1K2VN 3RTGA 3OE4A 4I19A 3VSBA 3TTYA 4WBNF 2UYCA 4OJYA 3S2UA 2VLIA 5LBIA 4C0KA 3ZKAA 2Y1FA 1VDZA 4X65B 2Y66A 1XJ5A 2GPAA 1CVLA 3HKDA 4B8WA 2Y76A 3KHTA 3Q5DA 4GNKA 4DJDC 2VFAA 2XRFA 3O8DA 1SA0B 4ZMBA 4DMLA 1VA4A 1WUHS 3D7KA 4YRLA 4F72A 3PNSA 2ID9A 4MROA 2QUKA 1MAUA 3GN1A 4UPVA 2HNKA 2W2TA 3SNHA 5IJXA 4EIWA 1OB5A 1US8B 3NBAA 2X58A 2HDOA 4BJ6A 2ZZMA 4TKLA 5TQ0A 1RE1A 2OG1A 4KI0A 2UYHA 4JB3A 5E7QA 1MG5A 1ZRMA 4OREX 1I30A 2IOQA 3LBNA 3SKXA 5L3VA 3RAJA 3QVGA 2ZLBA 1TTQB 3SJUA 4JXXA 2JATA 1U2GA 4B6SA 3BC1A 2FW1A 2SICE 1O54A 5CURA 4H1UA 1I7NA 4C7XA 4D46A 3JRXA 3OT5A 4Q82A 2PKQO 4AWAA 4XQ9A 2JLAA 4IGKA 3K31A 2A9FA 2MSLA 3DVAA 2EJVA 2Y77A 1H8EA 1PHPA 2X2EA 3L7AA 5BWLA 1UPFA 3IAS1 4I2VA 2X7HA 1KI4A 2O2JA 1L7VC 3LOQA 4YCCA 1LV7A 3CLSD 1A9PA 1O97D 5HRUA 1UPTA 2O23A 4WN9B 1E1QA 1KU6A 3LU1A 4XVCA 1G42A 4K9NA 1FF9A 3OIUA 1AKYA 3A27A 4YX9A 5KSWB 1G59A 2NIPA 3IDOA 4GOLD 2IBSA 2IODA 4JWTA 2EFYA 3CKKA 5CT9A 1TMOA 1M34E 2E0IA 5BYJA 3STVA 1C0IA 1A1SA 4Z5XA 3IIEA 5ABPA 5FWXB 3WBKA 1N2JA 2MHCA 1THZA 4KJZA 2Q9UA 3EVDA 4G25A 4G85A 3L1KA 3Q7SA 2FSVC 4HQRA 7REQB 5I45A 4I6GA 1S2GA 2IGTA 3KIPA 4XUCA 3GELA 4YCJA 2VDVE 3L7LA 2APJA 2BD0A 3UH1A 3W1EA 3O83A 3RYIB 4MYTA 4YDRA 5B4VA 4FJ0A 5ITSA 1T5DX 2CDNA 4J0KA 3U17A 4B4WA 3MPUA 1QG0A 2IK8A 4DM4A 3TSZA 4DC9A 3WQRA 4LF6B 3BYZA 4P3PA 3KR1A 1J33A 4DV5B 2QDKA 2VHWA 1YK1A 4WDQA 4ENRA 1KZ9A 2HV8A 2YBEA 1R37A 3E70C 3QPCA 2C9ZA 4E5NA 4GBGA 5AT1A 4OQ4A 3VYRB 5BMOA 3A6PC 4UAVA 3AT1A 3KB1A 4AWXA 4BVLA 4BTLA 5KCMA 3DDSA 2XD9A 5C7IO 4R9UC 3FTCA 3UHOA 4JX8A 1TZBA 4JCOA 3GLUA 5DXJA 3QX3A 2IUFA 4R2WA 5G4KA 4J6FA 2OZLB 1FU8A 1T6NA 1N4AA 4F11A 5KYXB 2P5YA 3THYA 1GCGA 4BP8A 1NMYA 1ZNWA 1DEKA 1H2WA 1YDHA 4ZT7A 5B1SA 3ISJA 3Q3JB 2H0QA 4RS3A 1PTKA 1MF7A 1U94A 3HDHA 3WP1B 2BE7A 3MRSA 3RR2A 5C8YF 5KU7A 5T4FA 3IESA 2JFGA 2NMVA 3WFJA 4EI7A 1TC2A 1YWGO 2BEVB 3LYHA 4KAFA 4RVHA 2G09A 3EVBA 3QVLA 3A6JA 2ZR9A 5UKDA 2Z6QA 1VGQA 4G81A 4G97A 2Q7OE 3JQAD 3T9EA 1E9RA 1ZM7A 2IKQA 3RYHB 4LTMA 4I8XA 3UWKA 3GLGB 2ZXEA 1C2YA 5EKXA 5GONA 2QY9A 5GM2A 4WQMA 3ZWMA 1SXQA 1TAUA 4L8WB 2W83A 2O2CA 2NACA 5AWFC 1XEWX 5LOVF 2CFTA 3SKYA 4C4PA 1W47A 4LHYA 1N3BA 2CL6X 2ENUA 1R64A 1QIJA 3G9QA 4J0IA 3MERA 1WW2A 3GMTA 4PLTA 4CNQA 1EVQA 4CT4B 1MDBA 4D9HA 2CWDA 4EHJA 4U2DA 3P2IA 1U0NA 1X42A 1TM1E 2WZBA 2PGLA 3NETA 1H69A 2H0AA 1WA5A 2LZ0A 1M74A 2GHQA 3G9UA 3D9QX 4J0QA 5HKKD 3DL0A 2X0FA 2PWYA 1MVOA 3ZDYB 5FTNA 1VGRA 2IVZA 2QX4A 1KMNA 2QVGA 3JVEA 2VC2B 4I55A 2REBA 2J5QA 3OTOB 1PCXA 4AUNA 3S1LA 1HLFA 3IQIX 4H27A 3OD1A 2C8VA 3RVKA 1F5NA 1FW8A 1XQ6A 5EWJA 1AN9A 2NNLD 1O6CA 3DA8A 4HH0A 5JISA 2Q1TA 1RQGA 3LNTA 3BK2A 4P3XA 1BIFA 2PJUA 1DXQA 2QPLA 3FGZA 2G0AA 1Q17A 1U4SA 2FZCA 2NPOA 4X0EA 1K7SN 3T7JA 4TYWA 1WW8A 2PSSA 2G5CA 5LQKA 3ND6A 4LDAA 5ISMA 2H1FA 4DR1B 1UIRA 2IYXA 4DA8A 2I7XA 3I6MA 3G0HA 4G4IA 2TYSB 1ZC3A 5CLGA 4KQCA 2IPAB 3N58A 3UOGA 1YRWA 3MMZA 1Q83A 2BMFA 2JARA 5JQGF 4D9KA 3ZGYA 1ORHA 4J7UA 4XGNA 4Y6GB 3WJAA 1D7OA 3N2EA 3R7WA 2QDXA 1WMFA 5AHOA 5A7HA 4RJTA 4Z1MA 3O8RA 1MP0A 3HI4A 5DW3A 1ILEA 4Z2YA 1O1YA 3RSLA 2HGSA 3KRTA 3QLUC 1ZITA 1YDFA 3O21A 4X24A 3A25A 5DM60 1PZHA 5INTA 5JAOA 3DM5A 2GPTA 221PA 3T4EA 1DX4A 2A30A 2R8EA 2ZRGA 3RSOA 2CMKA 5CYPA 5KC8A 2AFIB 1LRLA 4Q9DA 2CLHB 2E49A 1UH5A 4FX2A 4J9VA 4MRMA 1KGSA 3KAJA 4UAJA 4B7ZA 4F92B 5HOQA 5IDXA 4BMPB 4V0KA 1LDNA 4AZ3B 4KE6A 4QJBA 3TG8A 2GARA 1JDBB 3A6FA 1AF7A 5EPOA 1CR6A 5BSHA 3R6WA 4RTLA 2QTHA 3RS3A 3MTQA 3VR4D 2GHRA 2QM7A 4I0WB 4FQ8A 1N6HA 4IOLA 4I3FA 3TKYA 4KRYA 3IQFA 3JVDA 1NVWQ 5TMPA 2ZG6A 3QNUA 4I8DA 5CFZA 4D3ZA 1YBFA 1YS7A 2HB6A 3Q6IA 5SZKB 4OHBA 4J3NA 1MB3A 1EG2A 2NZWA 1CJBA 4HDOB 4QOFA 5H83A 3TIGA 4MUAA 1S2NA 3PL5A 4OVKA 4J7CA 3RI3A 1FBTA 2JC3A 1EA7A 2C94A 2EL9A 4ZJPA 3FWHA 1P5JA 1HDGO 2NAPA 5MFPA 1GPH1 1GGJA 1W0JD 5JLJA 1RCUA 1TTPB 2Y1XA 5IZ4A 16PKA 2V8BA 3KLNA 3MA0A 3SR0A 2Y71A 5CU7A 5ADUS 4RTNA 1BMFD 5IAKA 1KBOA 1LQ2A 3H5WA 2IEAA 4FZ5A 3MWDB 3AKEA 5BN5B 5CT5A 1FQKA 1AK1A 1R0RE 2OGZA 3CB2A 4HLCA 3KOYA 5FFMA 1SRQA 3I34X 3KL2A 4NRDA 3R9XB 3GLFA 4PLVA 5TXGA 2JF0A 1N75A 3O38A 1XZAA 4MKIA 1JQJC 2NSLA 2YJTD 2YV4A 2ETXA 3TLGA 4CW7A 4RLFA 2Q4EA 3C5VA 5CTJA 2JFPA 5DYWA 2ZIFA 1P1KA 3WS7A 1O9HA 1IUOA 2PZEA 2ZYSA 4A8JC 1V8PA 3N2YA 3ZDAA 2Q45A 4H7IA 4O2LA 1UJ5A 1A5AB 2Y0EA 3NU1A 1FRFS 2WC1A 3P0IA 4FHDA 2VZ0A 3B3JA 1ID1A 3P0RA 3P9YA 2ZJ5A 1XALA 1YBHA 3AOEA 1UIMA 1ZD2P 3ETLA 5E0KB 1TU3A 3I2GA 4C0WA 2FUG6 2B98A 1I3LA 5BPHA 1YUNA 3NHPA 2O8DB 3HFSA 5JYDA 2F3SA 3RRJA 3P4UA 3AEQB 1M6HA 3E9YA 2WICA 2FP3A 4F5DA 3PSHA 1SXJB 4ZZ1A 4HB0A 4E46A 1VFNA 1K5GA 3A2NA 1CUDA 1WPQA 2I4NA 2QR5A 2GD0A 1WDLA 2RGEA 1VJ0A 2VYCA 4MJXA 2PBZA 3TNLA 1CUJA 3SK0A 3V4SA 4F2HA 1TJ5A 5EQTA 2GM9A 5TGDA 1V3TA 1ZI8A 2CLEB 3GQVA 3FF1A 1A77A 2GHIA 3Q10A 2DG2A 3PKJA 4PGMA 4V0OA 3WLPA 5L45A 1WQ4A 2V6MA 3G6KA 4P93A 5A7FA 1UJCA 1VPLA 4WJZA 1HQDA 1RAGA 4QOIA 3NJ4A 1KSGA 3E5HA 1BKSB 2HD4A 2B4QA 5SV2A 1V5GA 3HWX1 4WNIA 4OB8A 4IGEA 5IBQA 5JSFA 3U26A 3UKOA 4IDBA 4GI7A 4IQGA 5KC9A 5GGYA 1D07A 4AD8A 5BPFA 2G83A 1T13A 3VAZA 5IUJC 2DFPA 4MYRA 2QG9A 3I8XA 5EEGA 2HADA 4PQYA 1JG7A 1JW9B 3QYFA 4TYQA 3ZX4A 4C6RA 5AQ1A 1V3QE 2H0RA 2R44A 3RABA 2LW7A 2WP8J 4ABYA 1GYQA 1NI3A 4JH0A 4A92A 1OV6A 3DEZA 5EE0A 5JC1A 2IS1A 3O03A 4OG2A 5BW8A 3RAGA 1WCIA 2D2XA 2PEZA 4RM2A 4AS1A 5FF9A 1TM2A 3ZXUB 1IK6A 3U4AA 3AERA 1G98A 3U3XA 4MVXA 1JLRA 1KO7A 4R8MA 2LIPA 4UTPA 4B3JA 1IDOA 2ZIZA 4I9FA 3KVRA 5JI3E 3ENZA 4FR2A 4JMLA 3ESDA 1UDRA 2G25A 3A1CA 4CG1A 1GUZA 3R40A 1QU2A 2NUTA 2GCGA 5K51A 1TNDA 1YRBA 2EFEB 3FY4A 3JWPA 4IYRA 1L3BA 4RF5A 4ZN6A 4EX6A 2F6RA 2PUWA 3EE6A 4GI5A 5L6LB 4DR3B 2BM1A 3T7SA 4O4IA 5LBTA 1Y42X 3C8DA 3MJFA 5HGJA 1EHIA 4D6YA 4Q7JB 1CY1A 2A0UA 2VWGA 1EVEA 3A70A 1L4MA 2NZ2A 3AFMA 3HEMA 3K1YA 4HVTA 4JOBA 3CNNA 1C3JA 3FNRA 3RF6A 3RTDA 3QH4A 3TRDA 4BZPA 4I9GA 1Z6QA 4A0QA 3PGJA 2MDTA 3F9CA 1DJLA 5KX5B 1XRJA 1H3EA 4R6WA 2VP0A 3USCS 3OIGA 1WPXA 2J4FA 2PZKA 3P0EA 5LN1A 5A0TA 3OQPA 1NUSA 3EVTA 3PR3A 4HRXA 3GGSA 4ND2A 3WK7A 5IHXA 5AOBA 1MOQA 1NFRA 3TOXA 2CCGA 1JMVA 1BQ4A 4EFMA 1STOA 2QRNA 3P20A 4BAZA 1OXTA 2OILA 3PGMA 5BV1A 5EUCA 2ZUCA 4EHKA 1Y9AA 1TF7A 3JQGB 4FYMA 1K3UB 1QDLB 4K2AA 3RYTC 1P0CA 3L93A 2I99A 1FDIA 2JGIA 3FWNA 1KP9A 2ZYGA 4ZI2A 7REQA 4F84A 5CCXA 4QC2A 3FLBA 3I37X 2BELA 2GEDA 2Z9BA 3URMA 3TH5A 3ZWPA 1W85B 5D3KA 2GN1A 4WV3A 5DMHA 1BMQA 2YJGA 4QFCA 4HTAA 1PS0A 3PRKE 4CM9D 1YT5A 3PFWO 4EFDA 1M1XB 1NFQA 1NVXQ 4FOLA 5JJBA 1PYGA 4EO9A 2WF5A 3LHIA 3VZBA 5EUBA 1RAHA 1AS0A 4KK4A 3ZE8A 2WTNA 3GLRA 4PHGA 1J0CA 4DPMA 1N4DA 1PZEA 2XXJA 4PSDA 5TARA 4E5DA 2BCJQ 3BTOA 1C7IA 3GU3A 5K05A 3VA7A 3OT1A 3JSXA 1GFIA 2KMLA 1T1EA 3MFYA 4RQBA 1R6VA 1VSTA 2O4UX 2ZTLA 3N39C 2RGAA 1UF9A 3PQFA 4M7RA 4LK2A 1AY0A 1QLHA 4Y0NA 3C6MA 3PUXA 2NTEA 3LPCA 1R0XA 4QG7A 2IXEA 1XNRB 1GYRA 4LJ4A 4F6LA 5KVQA 2QX7A 1B76A 3G02A 1T3TA 3PWZA 2AN5A 5TIIA 2R8YA 4EZBA 1SHLA 2YASA 1BQEA 3WGYA 1FL9A 1TGVA 2WB4A 2ZVPX 5ALLA 3WDMA 4KL8S 3UMRA 4E14A 3CNEA 5K9ZA 4EA8A 1F1JA 2O57A 3JYOA 4EHFA 3EB9A 2LPMA 2P67A 2QTFA 4ZO7A 2C4WA 3N07A 4UE2A 1R9NA 3NDRA 3UVEA 2WILA 1KBQA 3G2MA 1DQNA 4UCXA 3GMSA 3PVCA 1WWKA 4CTOA 2NO5A 2ZRQA 4PZ9A 1UM9A 2AI1A 2G5GX 2J9GA 5DJ5A 3QU9A 1WUYA 4H4EA 4HS9A 5FTKA 1GKIA 4N3CA 3R5KA 4TXLA 4DWWA 3IALA 1FUIA 1SD1A 3DEJA 3JQ7B 3KJGA 3Q2KA 4NVRA 1YOBA 2ODNA 4Q24A 1RLTA 2ZFUA 3GLTA 5F2KA 5H68A 5DP1A 1BRTA 3V8VA 4PYOA 3QEMA 1PEDA 1QFYA 3EN0A 4EAQA 3SWWA 1PE0A 1E6KA 2R97A 1SU4A 3X1DA 2WSSA 1X7GA 4MDHA 3UJCA 4UTNA 1VSQA 1XZ8A 2HO5A 1A4IA 1QRAA 1BXGA 1P6QA 3MUNA 4CFYA 5LMUB 3ZHYA 3KJEA 1PT5A 3SDZA 2XDAA 1TKAA 3WMXA 3GGGA 1GGNA 3PDUA 4JENA 3SIPA 1RBYA 3DLCA 1QRRA 2W2PA 1J2TA 3C16C 1QPGA 3KYDA 2GXUA 3H99A 1JTFA 2Y0BA 2XNJA 4CKEB 5C1DA 4GQIA 4JFAA 4QUIA 2AKEA 3HTXA 1PJZA 1U0EA 3A7DA 4MS1B 3SIRA 1XFDA 1ZHFA 3L92A 4F12A 1PFUA 1T8RA 1C9MA 1KZ1A 4NQZA 2R1TB 3HZHA 4BP9A 1WCWA 2X5KO 3KR0A 1GZVA 5HCNA 1WKVA 1LD3A 1GNQA 1L6RA 2N3ZA 2B2XA 2E4VA 2H2WA 3N76A 5K8JB 3MIZA 5CDYA 5LLSA 1ESCA 1UZLA 2GD1O 4URXR 1F1BA 4ZCRA 4X7PA 2OQRA 5HR5A 2ZU6A 3S2IA 4IX9A 1F2UB 3FAZA 1QX3A 1WG8A 5A1JA 1SCUA 1BE6A 2B4RO 2YDYA 1G20B 1KYTA 2WSBA 2BLNA 2E7ZA 4OB6A 4S2UA 3X44A 3F1KA 3KXPA 3MWFA 2CLOB 1AGRA 4HC4A 4HGNA 2FOIA 5CVUA 3HM9A 1N2GA 4Q1VA 4DMUB 2O8BB 3W8EA 3KUUA 1RFLA 2FEWB 4WCFB 1PIWA 4ZT5A 5IHPA 1CLUA 2IXTA 2GAIA 4LE1A 3U7GA 2CVFA 2PUEA 4JT8A 3K1JA 5ER6A 4RJ2A 4Y1RB 4D74A 3BAZA 4W7HA 1ZD8A 1HETA 1S7CA 3A8TA 3R7DA 2ZXUA 1SY7A 1G6HA 2HUPA 3QTBA 3LXXA 5BMVA 5DI9A 1VIVA 1LTKA 1KFKB 3CT4A 3FN4A 4GOOD 5DXAA 1GG9A 2BBOA 1OQAA 1UK8A 4HNAA 3AEKB 3AYZB 2FW8A 1ZKMA 4M1WA 8ABPA 3LCCA 1N57A 5EMJA 1SQ0A 1VHQA 4QT4A 3S1AA 1ACMA 3CM0A 3AV0B 4HADA 2X4IA 1FYXA 3RSFA 1YAHA 3JQPA 1ISMA 2HC9A 2O9JA 1E8MA 4IDDA 2QMUA 5EIXA 2C3PA 4EKGA 3N3BC 4ZAXA 5THXA 1NQUA 1NWCA 3VSDA 1UODA 2IHUA 5BVHA 4YBRA 1JHAA 1E0DA 1GRCA 1NXVA 5IT9A 2YWCA 3JPWA 4TMZA 1L5MA 3AV3A 2R6DA 4IGAA 1N32B 1W59A 3ZCTA 3HBFA 4DDHA 1YFKA 3U2QA 5TT1A 4B76A 3MBIA 1NR7A 5JJLA 2D0IA 4JZKA 1FCJA 4KBGA 3F7OA 1E2LA 1RXSA 2AYYA 2GGSA 2AL7A 4WY5A 3IUMA 4WBNB 3CHYA 5CD9A 2HCFA 3MJSA 4CZ2A 3D2LA 1DQSA 5J5AA 1R4AA 1KMQA 2UUPA 3U7QB 2R9VA 1AM4D 3GZNB 3T4PA 1UBTS 1KEKA 3QFFA 3F4LA 5HW0A 2D1RA 2QX6A 1R16A 1SC3A 3M89A 4II7A 5HMMA 1QUFA 2J5KA 2ZRIA 1F6BA 3U3RA 5EUQB 3PX3A 3QKIA 2W00A 2PS0A 1Q1AA 4OGGA 3WLMA 2H7XA 4PO3X 3IMFA 3ROQA 5DHSA 3V33A 4AXBA 2RH8A 5C81A 4AX8A 1KQGA 2WDZA 3K0EA 4RVCA 4C0QC 1XI2A 5JJIA 1FSSA 1LPOA 5D2CA 5TEWA 4QFMA 4XIJA 4PGAA 5KMGA 2J9RA 1XJCA 1T4CB 3QPVA 3HEBA 1DFGA 5L3QB 4P9NA 2IYTA 5A4AA 4QYWA 5LDDC 1K0UA 5LU8A 1DX6A 1XDBA 4NMMA 3ZQ6A 5BNTA 4DIOA 3AY6A 5THQA 3CVYA 3KQHA 3OOEA 4Q4AB 3SMVA 1VL2A 1OKKD 1SOMA 2AH5A 2OCDA 2YHIA 1PW5A 4HZIA 3ML1A 3UENA 1FS5A 2VP4A 1NJSA 2QUZA 3CLRD 4OQQA 4KBYA 4FK8A 4FXOA 1ELOA 4MTLA 5HK8A 4EFLA 3W1WA 2H18A 4LMAA 4RDIA 3VNUA 4G8CA 1S01A 1JBKA 1DKQA 3UHPA 1WSBA 4NCJA 1CB7A 1BH6A 4RIEA 2ZATA 3ELDA 5CGQB 5B53A 1J39A 3MGKA 4RIIA 4PTYA 1V45E 1UKBA 5ALQA 3DCJA 3EWSA 4DHWA 2YVKA 1X94A 1EUDA 2HXSA 3P9KA 4U2KA 5A06A 3SICE 4DB4A 5DHFA 4UCWA 5CUQA 2MU1A 1VPWA 1SZPA 1ZYUA 3AQIA 2R00A 3EQ6A 4NZOA 1OXXK 3FMVA 1ZY2A 5H02A 2WG0A 1WF6A 3EYWA 4POOA 2VI5A 4PCVA 2QN2A 4M1OA 4TMWA 3A3KA 3I9OA 3EXAA 3E2MA 2BGLA 2MMCA 2P91A 2C57A 5EEHA 1D6MA 4KIWA 3KQPA 1BE8A 4JU9A 4YRPA 5EJEA 1OSNA 5ALEA 1EAYA 3IQGX 1N8TA 2YJNA 4BNKA 5CXUA 3QELA 2H7VA 3GVXA 2IYAA 3NIDB 4RLHA 5FPHA 1GPUA 2AUMA 4ISBA 3H86A 1FSZA 1ZN9A 1DIHA 2C04A 3LHDA 1SBNE 1N5OX 2HPHA 3FLEA 4X3OA 2P9QA 3KYCB 3KC2A 1KAEA 1VKRA 3AFGA 3T61A 4U2BA 1DPFA 1GZ5A 4IJUA 3U16A 1J1ZA 4YCNA 1VE1A 5C8YB 3FIJA 3L8HA 3EIHA 4WFIA 2W2LD 3GAFA 2IYLD 2ECQA 1NP6A 3ABQB 3D6HA 3L77A 2DPHA 3FPHA 3PHGA 3HYTA 5CVCA 1WXWA 1RQXA 4HGPA 2WTAA 2X1LA 3AL2A 5DWVA 4UHFA 3UIEA 3A3OA 1FTYA 1V11A 1I7LA 2VDWB 3FLMA 5FL7D 3THSA 2ZTUA 1LC3A 1C1YA 3F74A 3K2QA 3GQBB 3RE1A 3SM9A 3C6KA 2A2ZA 1IK4A 1SRRA 4PS0A 4ZQIA 1GQOA 4WADA 4OHPA 5T3UA 5LOVB 5ARDA 3MJVA 2VO1A 2FN7A 2Y9PB 3B8EA 3DMTC 4I36A 2FSSA 3DFFA 1EXWA 2IV2X 3AKCA 1CR2A 3BGDA 3MCZA 3TNFA 2I8CA 3C45A 4QDXA 3DYVA 4TV8A 3OQJA 1EFUA 1TCUA 2HQ1A 3R0XA 3WDSA 4QM7A 1M67A 2AA3A 4LGYA 5FRDA 3A14A 1DNPA 3IJRA 1DIAA 4HI0E 4OQEA 4YMWA 5CYGA 3GIDA 5KOHA 4YUZA 2AMVA 3ER6A 1XXLA 1W5FA 2CXTA 4FMCF 1Z5NA 1OA0A 1FZTA 1KMHA 4ZO9A 4F4FA 4PO8A 4RANA 5JIBA 4B6PA 2VDRB 2YFHA 5LMCA 3FPJA 3EODA 3Q3CA 1II9A 4RK1A 4D98A 4S04A 4QLOA 3W7VA 4FINA 1G64A 3BK1A 2XKAA 5JYEA 1LQTA 3IC5A 3L6RA 4YAEA 1C3LA 3GRPA 3TLCA 3EPPA 3WNDA 5CK5A 2UZ4A 1Y8QA 2TECE 3EZYA 5AK4A 4ZHQA 1UT8A 1P91A 4H7KA 4BV2A 4MRSA 3MWJA 3RNLA 5CM8B 5AVXA 4RTPA 1E3SA 2HBYA 2Y68A 2Q3FA 2VWPA 2NV2B 3WRWA 4NYIR 2Q4TA 3FVTA 3TD6A 4IY1A 2XB6A 4RKYA 4YJ3A 4GXRA 3AXSA 5C8VA 4DNOA 1IUNA 1T2DA 1ZZGA 3FX2A 4ARSA 4JJEA 3WI7A 5E8JA 4ZTBA 1Y48E 3U3MA 3WMEA 3AM1A 5JQGB 5L9AA 1A7UA 1OLSA 1X86B 1YE3A 2VRCD 3I73A 4RY0A 1EQ2A 1I10A 4A6DA 1R5NA 3B6ZA 3ZS9A 1E94E 2C03A 3QEJA 2HMVA 3LLVA 3SQXA 2FPKA 4KXLA 3WMFA 3IAHA 2WBLC 1NM5C 2OLEA 4B73A 4PNZA 3COWA 1EFVB 2P4EA 3TMYA 5A9TA 2GKSA 3LX8A 4G24A 5AW0A 3AHEA 2IX9A 4ND3A 4XDYA 5BSEA 3HCBA 3OLYA 1EP9A 2GEBA 1KI7A 2PZJA 3K0AB 4U39A 2IA5A 1TJYA 3MYRA 4YLEA 2X15A 1DV1A 2H5IA 2BISA 1S8FA 2OP0A 1Z35A 4TTIA 4CF6A 3DVLA 4ZGBA 1IH8A 4LZZA 4GMFA 4M9QA 2P6OA 4FIZA 3V8NA 3OZWA 3W34A 1XHFA 5HGXA 4OLBA 3DS8A 3MD9A 1HYBA 4HUQB 1P4HA 1J9ZA 3NNDA 3DULA 5LZ4A 4UUBA 2AG0A 5DYYA 3QOFA 4JBIA 5LD2C 4RZ2A 5GJVC 4WJKB 3DT8A 1IPHA 1PGQA 1TF2A 1WM1A 3QTLA 3ZNOA 1Z7EA 1ANKA 1PNTA 3DD5A 3Q7PA 3KLMX 5FOSA 4AICA 4HNTA 3IUPA 3AUTA 4RYDA 1EK0A 3FB1A 3ZE1B 2BJHA 3AFOA 3D7NA 2OXRA 3R8XA 4BLVA 5FX2A 2DFKB 3QWAA 4E32A 3G2OA 4BXOB 2WIJA 2JBAA 3BZWA 1Q91A 1XFAA 3RDPA 1MZPA 3DTVD 2GYYA 3RU9A 4L2IA 3DHVA 4CMEC 1QNLA 3B7GA 5FNVA 4N5DA 4F97A 3LA8A 3PEFA 3CFYA 1QHFA 2EZTA 3MIIA 4IG4A 3U4MA 4V0LA 2V0GA 3IBCA 5EJGA 2VXYA 3MTBA 3SYNA 3SDSA 3KELA 1QMPA 1IFXA 2O0LA 2QJRA 4J43A 3SS7X 3UTCA 4FM9A 2ARKA 2IH2A 2WQ7A 2AIRA 1VGVA 1RQRA 2WJ4A 3DKRA 2QSJA 1P8JA 4FKZA 4RCVA 4ID3A 4OHFA 4ADSG 4F5EA 3S99A 3T5PA 1RRPA 4QATA 3TW6A 5IX8A 4I5DA 5J4KA 2WKWA 4MVJH 5K1ZA 1MMFB 4AT1A 1OV4A 4MJLA 2WTUA 4ARAA 2DB3A 4RE6A 5AM0A 1TCVA 5L6MB 4GWGA 4MKHA 5ED0A 3VH4A 4G5XA 5JJCA 2C7VA 3T3DA 3B51X 4IJ6A 4MX8A 2J46A 1YU6A 2IQIA 1ORTA 2YWJA 3QHAA 4L50A 3AH8A 1L3CA 2R6AA 2ZULA 4DRXB 1D4AA 2XNSA 1CWUA 4KSBA 4ZDWA 2O8FA 2XGSA 1NRJB 3DMGA 4BUCA 4U2GA 3BA1A 3IODA 4H0FA 3U1BA 3Q3VA 5CW1A 3SEFA 1QQ6A 4BNLA 1U99A 1W34A 1KSFX 2FETA 1QO0A 3VAAA 4EITA 5JCZA 4XJSA 1YR2A 3KEGA 5E2BA 4EA9A 4NOJA 3ZV5A 5I7SA 3QI7A 3KO8A 2WD7A 1PX0A 5T4HA 4ZQGA 2IU4A 2AJCA 1TCBA 3Q5EA 5K0LA 1NVUQ 3R9IA 3EFHA 4F3KA 1U6JA 3H5RA 3HA3A 3SBXA 4CEJB 2QT1A 1K1EA 3L7NA 5AW8A 3TAUA 1ZIDA 1ZIYA 1Q1QA 2NSHA 3NDIA 4XGQA 1MEOA 2C5EA 3EZXA 4NCIA 2GERA 4I3GA 4L0CA 5K7SA 8MHTA 2XVZA 5DHPA 1T5HX 4IO0A 2VSXA 1JJVA 3U3JA 2GBLA 4A7PA 4NATA 1AV7A 2V4UA 3CQ9A 4BNHA 2WV9A 3TM5A 2BFCA 3HB1A 5ETJA 3I1IA 4MH0R 3B6EA 3BJIC 4GMGA 3S44A 4W99A 4TUYF 1F20A 3ZDFA 3FNFA 2EGGA 4MHOA 2O8CB 3PEVA 4MKXA 1G8FA 4Q02A 2X77A 3LUGA 1B0PA 2A5FA 4MW5A 1TTTA 3UZUA 3PVZA 4NWIA 5I7UA 3T3MB 4ZU6X 1GITA 2FX2A 4UULA 3NC0C 4N47A 5KNCD 5HYVA 1OFIA 3HFGA 3E3OA 4PANA 2II6A 4RD2A 1AXRA 3K30A 3HKBB 5TF4A 2VN8A 4B8YA 3B6JA 3HU3A 1U0JA 1KY4A 4XGRA 1YFLA 1VHJA 2FWNA 2YH2A 4AG6A 3HXLA 3PUKA 3C39A 3OUUA 2ACVA 2GS9A 5FTWA 3VUEA 3X1WA 4WT7A 1M7BA 1ZUNB 1EM6A 1SZCA 3PXGA 4BEBA 1M1YA 3AB3A 3C5CA 3G1UA 1ESEA 5HQ3A 1ULSA 3REFA 2A9QA 3EXHA 2Z9DA 3GUZA 3T5CA 3ULKA 1QP0A 4XWAA 1IN5A 1KSJA 3OIYA 4CL2A 3ADDA 4BO8A 1E1CA 3GJXC 5DBIA 5AK6A 2JI8A 3JQRA 4TWRA 2QMHA 9ABPA 1A8QA 3K0CC 4WNAA 1MIHA 1K9SA 2ZYIA 3P97A 3RVBA 4BV9A 1KY2A 1MH9A 4PLPA 3DFZA 3RT1A 4R2KA 3WFZA 4EARA 3LP6A 2X9NA 5H4GA 1XCPA 5ALNA 4EY5A 3O75A 4X62B 1YGYA 2VJBA 1G5TA 3OTQA 5DNCA 5FYDA 2NAFA 1E9DA 2FTKE 5HBRA 4JDUA 3G7NA 1EE9A 2ZSEA 4TTRA 4Z9BA 3ZWYA 4BEWA 4WCVA 3OBIA 3VZRA 4JB0A 4CMIB 4BFLA 3HJNA 2WLSA 3B3GA 4UFOA 3DXFA 5LQSA 1MO6A 4NHEA 3IEUA 4GPTA 5C7OO 1VE6A 5ALRA 1XTIA 2GRAA 4EJSB 1R3UA 4MW1A 1EFKA 3ZI4A 4DV7B 4BPBA 3B53X 4P33A 1S3FA 1JWAB 1JI0A 3KU1A 1GPBA 2GF0A 3TE7A 1TD9A 4JSYA 2AV6A 1Y8RB 2I87A 4MUEA 2WZCA 4ENSA 5KJ1A 4JVSB 1PT7A 1Q3KA 3TFQA 4WLOA 3U49A 2VDJA 1E5VA 1ZL2A 4J1SA 3RSHA 1A7KA 4ZVUA 5JSZA 1HFJA 3GGDA 1RWOA 1AB5A 5HILA 4QYXA 1CJVC 1M0SA 4CL3A 1PR6A 3N2GB 2GEKA 2FZLA 4ND6A 5DEOA 3SXPA 2N0SA 3EGOA 1KJ8A 1QLJA 2V6FA 2H9IA 3GT4A 4HWRA 3W79A 1QSGA 3OTHA 1J2JA 4UHCA 2OZKA 4MA0A 5E6SA 1VZ3A 3GDHA 3MT8A 1E3WB 1U7DA 2ATXA 2D1TA 1HMYA 2Z09A 3GCXA 2F1KA 1U2GC 2ENWA 2VQSA 3L18A 2J3MA 4NMLA 2IYSA 3TBKA 1KWGA 3SYRA 3MMPA 3L06A 1OXKB 1FTGA 1ZGHA 3LT1A 2FLVA 3DBRB 1WRBA 1N6LA 3LWZA 2VEOA 3H0EA 5J40A 1QV9A 3HCDA 3U7JA 1YRHA 3FTEA 3O8OB 2NU7A 3C3PA 4NJEB 3AMVA 1EWKA 5EJFA 3ZD9A 4CU5A 2F9LA 1L7XA 4FC7A 4BQPA 1Z3CA 3H2SA 1DKLA 2RG7A 2MIIA 4BN5A 2FH5B 5CGZA 4BNMA 1H8HD 3ND5A 2HA4A 2BMAA 5DGXA 1NRXA 4JI3B 2CZCA 2H3HA 3L6UA 1UINA 4U9IS 5GV7A 1X7XA 4D43A 5K99A 1BWSA 3QYPA 1XLWA 4LF4B 3A28A 3JTEA 1VBMA 3RASA 3WL3A 4MDFA 1PK7A 4X44A 2PGDA 1E4EB 1KK3A 2ZI5A 3FUUA 3K5PA 5E7JA 3UJ8A 3DOFA 5EIEA 2PGIA 4IHJA 3VYSB 3KUCA 4FHEA 1PZXA 3OZTA 5JMWA 1YR6A 2AQIA 4OMDA 2BEUB 2WHYA 5BSUA 1K88A 3H16A 4B9EA 5DNUA 3HR4A 1NL3A 3EJWA 3NOQA 3HFJA 1YZFA 3HP4A 1BOOA 4GZMA 4P7BA 2QJOA 1QQAA 3DV0B 4DWVA 4ND5A 1BKDR 1OFGA 4FYKA 2Q21A 1I3NA 5CX1B 2XLCA 3L40A 4YY3B 1XLVA 1T15A 4IVRA 3AIMA 4MQFA 4BGVA 4AQYB 3SF0A 4UXJA 1SUSA 3LWDA 1P81A 2W2NA 4NXNB 2XGJA 3OWOA 1ZSNA 5AMXA 3H2GA 4KLAA 1ULUA 4XGKA 5FAXA 3MM4A 1MO3A 1FEZA 2RFLA 3BQNB 4WKNA 2HCTA 4QA9A 4ZRMA 2OAQ1 3GFRA 1ISJA 1TM4E 1E1LA 5HEKA 4TSFD 3DLAA 3W8NA 1FVHA 3FDJA 1KXJA 4FGSA 4KCGA 3U13A 1X14A 3L7DA 2BMDA 4PG4A 3UCEA 4HGRA 2Q1XA 4RVSA 4N4AA 1SUAA 3IKTA 4HPWA 4NXMB 1YDEA 3IHKA 2J4CA 4Q03A 1I14A 3B12A 4CCAA 4ZQFA 2BGWA 3PEEA 5HKOA 1Q0ZA 4ARZB 4YMVA 3K1AA 1CUWA 1W44A 2P4UA 4DR7B 3JASB 3JWJA 1UC9A 1RM4A 4XM1A 2P75A 4UNQA 1VE3A 2PKWA 3AHIA 2SHKA 2P6UA 2YOGA 3IP8A 5E1OA 3LTNC 4D9GA 1TIBA 1IN7A 4ZI7A 1NATA 3LP8A 4GPBA 5CDUA 3LJKA 1EH5A 1G4HA 4N49A 3KLOA 4FTWA 3RQIA 1WSDA 1YR9A 2QY6A 1BHJA 2GOYA 3JVUA 2DMRA 2EP5A 5I6DA 1P5RA 4TTSA 4QYIB 3FSGA 1O95D 2OXFA 3DBLB 2A88A 2I6FA 3L0YA 5HIKA 1ZOSA 1L8OA 1TOAA 3KALA 2AZXA 3KZCA 1KMIY 3J80A 2JH9A 2PJZA 1L5QA 2VAPA 5DX1A 1MB2A 4PHFA 3ABRB 4W1PA 4HEA6 3AM4A 1G60A 4N6OA 3WKAA 2C7QA 1YQUA 4N3BA 4BZQA 1CULC 1S0UA 2FWRA 5JH7F 1AGNA 1JQKA 2IIQA 3U0VA 4BE9A 2EL7A 4ZDIA 1CQJB 3SDBA 2HV9A 4YTEA 1JIVA 7MDHA 1WU7A 1T2NA 2FFAA 1US8A 2GETA 4PGFA 1MEEA 1UXIA 3K0HA 4HMQA 5K45A 2XZOA 1L7OA 3PDIA 4OKNA 4ASUD 4YV7A 2C7GA 5FPKA 3Q6NA 3KZKA 5C7LO 2JLVA 1N5DA 2IX3A 1JHYA 3P9NA 4X6YA 3SBEA 3KOXA 1E9EA 2FQYA 4N82A 1K7XB 4NY1A 4YMLA 5BWMA 2B36A 3F46A 2V7GA 1GM5A 4EOGA 3WE7A 3VISA 1GU7A 4KGDA 2DFNA 1L9KA 2GK6A 2A9RA 2VK2A 3FPAA 3L8YA 4WRRA 5FO0A 1FQWA 3ZX5A 2CV2A 4MQ5A 2BI7A 2C97A 9MHTA 1DBRA 3GGPA 4M0LA 3DLIA 2VK1A 3WWPA 5A05A 3R3YA 4KN5A 2I4LA 3CG0A 4WN9A 1C9DB 5BV7A 3H9UA 1IE3A 2W6IA 2WABA 3TW0A 1OU4A 1V1RA 5KQMA 2XECA 4IFBA 4MZXA 1LK7A 3MUOA 2QMEA 4FGKA 4YHBA 5AM3A 2B1JA 1RWVA 3BRSA 5CYFA 2C98A 4KQKA 1DKPA 1T0BA 1GZDA 2VTVA 3H6HA 3SP1A 5JS1A 1UXKA 2H06A 5ALMA 3GP8A 1PYOA 1GEEA 4WLEA 2PMCA 3ETHA 3TTUA 4MAAA 3TB6A 1JPVA 2VSQA 1WETA 3AFNA 5KNBD 1RXYA 1X19A 1CBUA 2ZUBA 3QBVA 4C0SA 1QP4A 4K40A 3RYIA 1EGHA 4Y2YA 3RU2A 5BW4A 3PDCA 3D8BA 3RWBA 1L5KA 4FYPA 5BOSB 2ZTMA 3I2KA 1OLUB 4OSPA 5EJ7A 1RM5A 2IUSA 5JPDA 4NH0A 4C4ZA 2WVAA 3IAXA 4IEFB 3TLBA 4FLMA 1Y6RA 4CM7A 2L2QA 3Q85A 2BSXA 4PLYA 4EPVA 4YRSA 1GQFA 4MUMA 1N6NA 4Q1EA 2WQ6A 1HXHA 1OLOA 4TT3A 1QANA 3TB4A 3I42A 4FEGA 2JLBA 3TJRA 3UV7A 3EZ2A 2CNLA 2I1LA 2OZLA 5K3FB 1SBZA 4YP1A 4JJGA 4KGVA 4KQ1A 1Y33E 5COBA 3J7AC 2VKQA 3ZIDA 4ZARA 4S05A 3UG6A 5DB4A 3EJ6A 5B2FA 2VJKA 5M04A 2VBIA 1XDWA 3SN6A 5J4YA 2QG6A 4KR2A 2A58A 2PANA 4P4SB 2VDUE 4MW0A 1I2CA 1JDUA 3EF1A 1YU9A 4U5QA 4EG6A 1NN5A 1TEVA 2W4MA 4EMSA 3GGCA 2A7QA 3E3NA 2BEVA 2I1WA 1OFUA 2GN0A 2O7NA 2DP4E 3OF3A 4OFBA 4TL8A 5EVJA 1V1MA 4OXIA 3I5XA 4RDXA 2QMOA 1R66A 2O8EA 2X14A 1SU7A 1XELA 2PGXA 2Q2VA 2QTAA 4I5FA 2GESA 3M3DA 3OFVA 1VIDA 4D57A 4ANFA 1UT6A 4DUGD 4HEJA 2GPWA 4HUTA 3E9NA 1Q1GA 1G6Q1 3LUBA 3W90A 3DB1A 3C8HA 3GP5A 1AF4A 1WABA 2ZB8A 3L6EA 3K8QA 4GKJB 4ITUA 4P08A 4B7XA 2FCRA 2UYGA 1ZICA 3KQWA 3DE4X 2PR7A 4HNVA 4RPHA 5FLXA 4DV4B 3IBTA 3ORHA 4HEHA 4RPCA 3EUWA 5J5VA 4FP9A 1MT3A 3QMVA 1IIBA 3JYHA 6LDHA 1RCFA 4MQ4A 1XDGA 2VBGA 1Q1EA 1JXAA 2VUSA 1EPUA 3F90A 1MHPA 3I1YA 3SFTA 3TL2A 5I4BA 4GBJA 3OQHA 4CM1A 1ONBA 1CCWA 1XCJA 1Z4LA 4MSUA 4P98A 4PTLA 1Z7GA 1HDXA 3ZCXA 3OE7A 1W25A 2FDCA 4FMCB 1CY8A 3VYWA 2QMZA 1KS2A 1N2ZA 5K5EA 2EARA 5ECWA 3AP2A 3G2QA 2PRJA 3HYLA 3H4TA 3YASA 5C34B 3O9VA 4FOTA 1LA2A 5FI3A 1IJFA 2ANBA 3PNBA 3ETJA 1S1MA 2NADA 4HNGA 2FPXA 3H18A 4QL3A 4C29A 1YZLA 5DYIA 4TXHA 1SKUA 2OBLA 4UU7A 4CM4B 2ZW9A 2B8TA 3V1YA 4IHQA 4NABA 3FWPA 5TRTA 2WJIA 2EJBA 3DHYA 3GBSA 1XSEA 3JYQA 4MLCA 3NHZA 3WVNA 1QBKC 3C48A 4ERXA 5TB5A 3IEVA 2WKSA 5DXFA 4DEYA 3KT3A 4CQLA 3KTAB 3M6MD 2QYTA 1BGVA 1NDHA 1GSAA 1O96B 3ZQKA 1T3HA 2WM9B 4D8WA 1HOTA 4MR8B 5I7HA 4NFSA 1HH4A 1JKMA 1FNBA 3P19A 4D2IA 1Z16A 3MEQA 2OXEA 3BSYA 1YUBA 2I2FA 4XARA 1T25A 4R8RA 3DLTA 2HRZA 3ZDEA 2EBUA 1FNNA 1YR1A 2HO4A 2HBZA 3GFSA 3JZFA 4UBNA 3S4YA 4A16A 4ZYVA 4NBVA 3ESAA 4IDQA 4BTEA 1T5OA 5FTJA 4ZC1A 2B7CA 4MEBA 4PWYA 4PX3A 4FDVA 5F9FA 1CE8B 2UVPA 3OOJA 3CPJB 4J0CA 2WVJA 4LFCB 3LUCA 3QM1A 3NC4A 2GN6A 2WIAA 5DNVA 4KXQA 2ZM6B 4DFDA 1BEZA 4H08A 3D64A 3A1EA 1D2RA 1Y1SA 2QXTA 3D4BA 4LE0A 2P9HA 3VOTA 3OIWA 4H2DA 4UPDA 2ZSBA 4JL6A 1GD1O 5G2OA 1B26A 2Q62A 2YIMA 5JWHA 2FJUA 4KG7A 4G4SP 4V0MA 2QD5A 1KR2A 3ISTA 2P5TB 1UJMA 1ZOLA 2FPIB 3KKNA 1ZCFA 2HMTA 2O2HA 1VG8A 4UTOA 3UK6A 4M60A 1K6MA 3VR6A 1LDYA 4Q7LA 4EFNA 4EG1A 3X1KA 2H85A 3SYTA 4E5YA 1SG9A 1Z0UA 1Z74A 2JI4A 3IAM1 1N7HA 2VJCA 5BN5A 3L1HA 3MWDA 3GG9A 3I2JA 2L0XA 1LSSA 1JU4A 2B94A 2ZIXA 3EWIA 3HHPA 1GDDA 4MKGA 4BZZA 3AM3A 3NTXA 2IHVA 3PC4A 4YMHA 3MOIA 3VR3A 4M4SA 4P80A 1XLTC 3GYBA 4QULA 1O03A 4Y6PA 2VCEA 5MFZA 4E5KA 1VYVA 2R8RA 4IOKA 3K2IA 5JUWA 3H5NA 4W63A 5EWMA 3AF0A 1Y9DA 2IKSA 1NDQA 4A0FA 1TLTA 3OZEA 5LZ7A 2RB5A 5JNRA 3ZQUA 2V0NA 1CP2A 1H9AA 1KKUA 2GEUA 2G7ZA 5FEUA 4BKMA 5BVGB 4OGWA 3DE3X 5J58A 2O8DA 1XNJA 2J48A 3DKPA 1J5EB 2JJMA 1YQWA 2I4RA 2QTMA 2DF8A 3IUYA 1CPYA 4CDRA 2VH1A 2CJWA 1DKRA 3DR5A 3WK8A 4E09A 5K09A 2FPUA 1U8XX 5F78A 2A86A 2HJVA 1XTSA 2I2BA 2QL5A 1Z6GA 1SBQA 1TLLA 1QYDA 2ODPA 2XNKA 3EISA 4Z1OA 1YUMA 4IZOA 2OOKA 2XUZA 4I81A 1TI7A 5H5JA 3TAXA 4U7FA 1A4RA 1EE1A 2C78A 3G2PA 5LMZA 3R7FA 1VCIA 4ND8B 1VBFA 2F4NA 1XPRA 1RZVA 2M1ZA 4KDCA 2GUGA 4MVJE 5FADA 2ZYAA 2KLBA 5LA6A 3UXEA 2PFGA 4Z51A 3PI7A 5KJ6A 3O4GA 4L4UA 4BY9E 1T6YA 2X0NA 1Y9JA 3K9WA 1TF5A 4E1AA 3KYBA 3RREA 2L18A 4ENQA 2QV7A 2XDWA 5BN3A 1H94A 3G85A 4B7UA 5CH5A 4YA6A 2PV0A 5AI4A 3HBLA 3IOEA 4XLTA 1OLXA 5CT4A 1PI3A 2GBCA 2QMYA 3A11A 3AP1A 2YICA 1H0RA 1FDVA 2J3QA 1SUCA 4JITA 3SZLA 4CKBA 1J0AA 2IYRA 5AKLA 5FUQA 3K16A 4X1YB 4IMJB 2Q6TA 4IJ5A 4QXQA 1Y1TA 2VYNA 2YYYA 3K9LA 4WLNA 2C5GA 3VPCA 1E8NA 3BRCA 2FPPB 2YR0A 3HN6A 3WMWA 3IA2A 2K87A 3PHHA 4QQ8A 4W7SA 2BZGA 2EDCA 4EQ6B 1DOZA 1T8PA 5JAMA 1QF9A 2RHWA 4TUYB 1XMIA 4L08A 2B34A 3N6VA 4O0LA 2FP4B 3L7KA 3IQZA 4TSKA 2WJHA 1G5QA 4QBKA 4JXZA 1P2UA 1GDHA 3K6JA 4CMCA 4A0GA 5HBGA 1RQLA 2QZ4A 1DCKA 3QG5A 4UDNA 3G5LA 3I8OA 5B1YA 1FX1A 1PWZA 1Y6FA 3SJ7A 4WVFA 1X1EA 2XNHA 1UK9A 1ZMBA 1EP3B 1QCDA 4ODIA 3I1FA 2E5WA 1J6UA 1W88B 2QUJA 4NE9A 4UE6A 4RPKA 3TI7A 2FRVA 5IC6A 2G63A 4EX7A 1H2BA 2CBGA 3ED1A 2G9RA 3GXOA 4XM0A 3NBMA 2VCHA 1VLZA 1Y3DE 4C3UA 3ENKA 2VQFB 4P1ZA 1OX6A 5I9LA 3KWMA 2OWEA 3INRA 4ZVPA 3GUYA 5CEEA 5KQSA 3GY0A 3I58A 4XUDA 1V4NA 4BNTA 2OM2A 2QKYA 3FZQA 2PUHA 1YZNA 5ITZB 2FQWA 3K9QO 4K88A 2H2IA 2I7TA 2W71A 1JIJA 2Q6KA 2ZXFA 3AR4A 3G79A 1BXRA 4IVPA 4M9SA 3U44A 2F48A 2L82A 1I13A 1J0EA 3LAWA 4KACA 3WGZA 1GTRA 3QFSA 1Z2NX 2I6XA 2AUTA 4QVKA 5F9HA 2WHPA 1KQ3A 4BWGA 2XQVA 3IEPA 2O19A 3G9TA 1LPPA 5JASA 2POQX 3CU5A 1LF5A 1OI2A 4GE0A 1QVVA 3ZHQA 2QEQA 1O58A 1M66A 4OIFA 2Q50A 1D2MA 2AFHA 2PZFA 2V65A 2FFJA 4M9RA 3DOIA 1AUXA 3LCMA 3IQWA 4E5PA 1XF9A 3PNLA 2AEEA 2EGUA 3R8FA 3NIWA 4PG7A 4PVDA 1XU7A 5CFMA 3PX2A 3NTQA 4F3NA 1RTTA 1GFSA 3NT2A 4C14A 3GCWA 1WUTA 2WWTA 5CB4F 1M34B 4CGYA 3MWEA 1KQNA 2P2LA 2H4FA 3UHAA 1DIOB 3CW9A 4AMYA 3W78A 4PYJA 2E55A 1QE0A 5DNAA 1AK2A 3RRNA 1X1AA 3UAWA 1JEQB 2YRWA 2Q4DA 4X20B 1JXQA 3G0BA 4DABA 3TGLA 3PFBA 4W9MC 1T0PA 2IL1A 1Y80A 2PT5A 8OHMA 1DO0A 4PPNA 4MNTA 1BS1A 4E33A 3M2PA 4OQDA 4L51A 1JEJA 3QMMA 2VRWA 4L6IA 4Y9DA 4BVGA 3SSOA 5IVDA 3MMNA 5TT0A 4DR5B 4WY2A 2TMDA 1ULTA 3ER9A 4QPJC 3ZU2A 1FPQA 3TFWA 3IDAA 3AILA 4GXTA 4DS3A 3KR9A 4WZBA 3JQ7A 1OF1A 1TVMA 3S2EA 4UFPA 5KTSA 1HA3A 1TYDE 2N1BA 3G2JA 1GXSA 3VZSA 3ANMA 3PB3A 3P9SA 4V0NA 1NSYA 1YXMA 4C7JA 3CNOA 2F43A 4F9FA 5AKZA 2ODEA 1PZFA 2PZ8A 1M2EA 3V3KA 1GUDA 4CDGA 4EKDA 3H1BA 4Y2GA 4OA8A 4F0JA 4EG4A 4KITB 4N8SA 1NMSA 1J1UA 2ZP1A 1EX6A 4MXDA 5M29A 5BP7A 5DPMA 2I0FA 4K9DA 4B71A 2B1RA 4KYTA 1SG6A 1Q74A 4I2NA 4UNNA 3MQ2A 4OQNA 3TQTA 4DCSA 3ZV7A 2QZJA 2J9XB 5LLDA 2OZEA 1DRKA 3PTZA 5AHKA 2V03A 4E51A 1CR0A 1HPLA 3H3FA 1NWHA 1MJGA 1W0CA 3EG9A 4FLEA 4P0QB 1QWOA 1DJNA 4C20A 4RTOA 1D8AA 1IL0A 2HK9A 3S2FA 4N76A 3MF4A 3L8ZA 4ZEWA 2B9VA 2GZMA 3CWQA 3AQ4A 2PA0A 1RYEA 2ACKA 4OA5A 4PX2A 2Q1WA 5KWIA 4DC0A 1Y4ZA 5CLHA 4L5YA 4MV6A 2J07A 3BMQA 4NESA 2AC7A 3GFPA 1I4EB 3I53A 1EXVA 2XOEA 2V55B 1P31A 2G07A 1YE8A 3O8QB 2DHQA 3DZKA 3M33A 4KLZA 4Y1RA 1ZDMA 2R1UA 4F9TA 1J2RA 5IF9A 3BT7A 2ZAOA 2PCJA 5BRJA 2CF6A 5IWAB 1CFZA 1ZH6A 3A9UA 3TKAA 3LC7O 5EG5A 2ZRFA 2NXWA 4HTFB 3RC3A 2W6OA 1G21E 1X87A 3TX2A 3NCTA 2PD4A 2VNKA 1I5OA 2NVUA 3AEKA 4G0MA 4CCWA 2HWKA 1V9CA 2BV3A 3BGWA 4MUNA 3NZEA 2X5JO 2BW0A 2NYVA 4LI3X 1KAMA 1ZRSA 4NV0A 3JRNA 5C32A 3HYCA 2X0RA 1CUGA 2IYEA 2I03A 1H93A 1SIUA 1E96A 1K9VF 2RJOA 1QFXA 3CLTC 2J3JA 1X7WB 3AIOA 4BKPA 1N25A 3VGPA 1D0SA 4Q01A 4JC8A 4G8DA 1PKXA 3DDHA 2B7BA 3DHWC 3BBPA 4IXTA 1Z36A 3OLQA 3UYKA 3FWYA 2QVCA 3ZXYA 3GIWA 3AF6A 3DDWA 3C97A 3OZXA 2CFSA 3VYUB 2IEIA 2ZJBA 3PUIA 3WL8A 2DECA 3BXZA 4GKVA 5GGXA 3ICEA 3I6BA 1DBWA 1CY4A 3WHIA 3HZZA 4RY2A 2YMQA 3OCZA 1O2DA 5THKA 3VDXA 1ST3A 3BH0A 2UYQA 4V03A 2CL7X 5IZCA 1C80A 4QE3A 1INLA 1IEWA 3RO7A 2XUJA 3U7QA 5GMOA 5CD1A 3AVTA 2FRDA 5LNK1 3EAFA 3M6AA 4BX0A 1DL5A 2GN4A 5IAAA 3R7AA 4JOCA 3FNBA 4NU5A 4UOQA 3RC9A 2Y1EA 4P3NA 4F2GA 5JBIA 5IJ0B 2AZTA 4WKPA 5JH7B 5K3BA 3ZDDA 4B2YA 3VU1A 1LDEA 4JLAA 1KYZA 1KARA 3ETCA 2INGX 3SSMA 3WG9A 1GNVA 2FMTA 1LVHA 1UFVA 3GRFA 3I62A 4FSHA 1IY0A 1PGNA 3GYGA 4XQ0A 2IITA 4ZAZA 2FXIA 3QY9A 1M8JA 2GMWA 1PWHA 3SE7A 5CYOA 2QPAA 2XGGA 1GA1A 1QIMA 2RK6A 4TLMB 5L3QA 2QTGA 1J00A 5IVKA 3C0KA 3N7UA 2BMJA 1DHRA 2MINA 2X9GA 1DIRA 2ZVDA 3KEFA 1ECCA 5SY9A 3RCBA 1HORA 3HR7A 4QBFA 4QTXA 5BY2A 4Y30A 4S0XA 2P2YA 4Q4AA 4P31A 3CKMA 2ZGVA 2IZ1A 5F7XA 1WL8A 4L28A 5DMXA 2ZIWB 5AW2A 3UGTA 1Z6XA 3DB2A 3T4XA 5B7GA 4Q3NA 4S1VA 4GL4A 2G88A 2DBZA 4LRYA 2BI4A 3X1YA 4U4AA 5E6UA 2Q2OA 4JROA 3HLTA 1RP7A 3HWSA 3KT6A 5DWDA 4L8YA 3RAEC 1MORA 4DLSA 1ZQ9A 4K9QA 4IR7A 4KX5A 3SM3A 3S28A 5AVVA 1T5IA 3VR2D 3GFVA 2OUIA 1ISPA 3NJ8A 4LGCA 1GAJA 4PYRA 4X3CA 1KBZA 1RIIA 4JL5A 4JUBA 4AZWA 4EHIA 5KHOC 3ADBA 4HDKB 4IP0A 4QQKA 4JR1A 1G9SA 3EXEA 1QR6A 5T67A 3I9FA 4RQAA 2OSBA 1EXMA 4LVNA 4LHSA 5ALXA 1JVSA 5H16A 1N78A 3MJRA 4GZ3A 1L1RA 2H5LA 3FJOA 4EB6B 1BEUB 2NP7A 2O5CA 4U6SA 3K32A 3HDJA 3T1HB 5JCJA 3R3HA 4M1ZA 4MWDA 3GVHA 3TBFA 1Y3FE 1MBZA 3B5IA 1ZCAA 4RD1A 5BSRA 5TQVA 3DXYA 1NF3A 4XWWA 2ST1A 3IAS6 3UFBA 2VPWA 4RA6B 2WJJA 1VMIA 3B8HA 2OPBA 3JAKB 4G0PA 1GSOA 1COZA 4WMLA 1JFTA 2OQVA 4UM8B 5DGHA 4NC9A 4KXVA 3TLKA 4JXKA 4DLZA 4YI5A 2DUNA 1U1CA 2WTXA 4TKMA 4B9AA 2V5UA 1R6AA 1JJ7A 1U3VA 3SIWA 5KNLA 4CF3A 4D9FA 1GCOA 1H85A 3COSA 1E1NA 5TSDA 1AKMA 4HK4A 5CG1A 1BS9A 1SR8A 4MV8A 1ULBA 4IKEA 4MGZR 2QAJA 2VF4X 2YXEA 2WPDD 1Z4KA 2FZEA 4EP1A 1VP9A 4LG1A 3S68A 3OEED 4O4LF 4D5EA 4J0DA 5ARCA 1G19A 1LV8A 3WK5A 2NYUA 3SQDA 2Z4RA 3GQBA 3TTSA 3WMGA 5ESRA 4QJ3A 1C0EA 3MUFA 3LUFA 5EKUA 4IJWA 1IZZA 1KI6B 5EAIA 1UOOA 2R6JA 3AVUA 2YXLA 4MW9A 3SJBA 3UC5A 2F8TA 2FMUA 4RBNA 5DRYA 3NRCA 3UK1A 4ZJUA 2VR1A 4WWHA 3AU9A 4RL4A 2GDJA 2ZJ6A 3IP6A 4UD6A 4FBGA 3AU8A 2OESA 1NVFA 2POCA 3SXUA 1KYIA 2A5GA 1CC1S 3DZDA 3I9KA 5FJIA 4ZC8A 2AKAB 1T5LA 3SAJA 1EUQA 4EK9A 1C4WA 1B23P 2IBMA 1K8YB 5JJ5A 2P68A 3L02A 1S4MA 2O07A 4PVCA 4RAQA 3UYLA 1VLVA 2ALJA 4AO6A 3ACCA 3WZ2A 3VR5H 3W4KA 1ZI9A 3OQIA 4J16A 1ND5A 1GKYA 5CJJA 1TUEA 2FZVA 4Z4HA 4RX1A 3BIOA 1V0JA 4NG5A 4W8OA 4X3PA 3PZBA 1F0NA 3U31A 4KFTA 2R6GA 3DDZX 4E94A 3TNYA 4X6XA 2K2WA 4RK4A 3GDFA 2PBFA 1YIDA 1XNGA 3LRXA 4BNYA 4MVJG 1DQYA 1XD2A 4DQXA 4DA9A 5JD5A 1AE1A 4DLUA 4TM8A 4DBZA 2R751 2PBRA 5KDOA 2GBLC 3PNOA 4R1NA 2ESRA 3RJMA 1L7RA 5AJUA 2IZ7A 5IK2D 4QQFA 2YFQA 3QOXA 1UOPA 1X74A 5WRFA 3CEMA 4DCMA 1Q0LA 2OXIA 2H57A 4NFYA 1ULAA 1GL7A 1U63A 1A4XA 2QRMA 4YC7A 4FW8A 2J9FA 3QHQA 1I4LD 2QX8A 3MRXA 4X9XA 4BNUA 4YV0A 1L4BA 4ZVSA 3TSAA 1W0KD 4J9UE 3RRYA 3A1VA 3P7MA 5GONF 2J3LA 5FL3A 3CRMA 1NXXA 4UEOA 4MQEA 2BF7A 3DSRA 3PT5A 3IDSA 4FDLA 1OX5A 2YZ7A 2Y05A 5DHQA 1NVVR 4B7CA 1KKLA 1GG8A 3G17A 4XKJA 3TNJA 3ILHA 3NGXA 4RPGA 3EIOA 3FJYA 4FUQA 2QJWA 1U8EA 4F96A 5D1NA 3ZQJA 4IZ6A 3OFND 5ICSA 3TF5A 5JEEA 4CGZA 3GJ6A 1SOUA 3VPBA 1Z13A 2VG8A 3JQFC 4U8GA 5LQJA 1J8VA 4AZVA 3EXHC 4HUQA 3WSTA 1PG0A 2NZVG 3JQCA 5IABA 3FSJX 1A8UA 2XVYA 1GPJA 1SUDA 4CL8A 3CZAA 3VOSA 3GG2A 4R84A 2CNWA 2A78A 3LY5A 5EHIA 3CO5A 4XWOA 3IMCA 1JNXX 1U0SY 2CL5A 4HH4A 5HZHA 1EEXB 1M2GA 1XVTA 2V58A 2G5TA 4FT2A 4JC4A 3ZWVA 1IULA 3BKXA 3U6BA 4IWXA 4XSGA 1FY2A 4R1MA 4ESHA 2VDLB 1H0KA 4LJLA 4E12A 1T8SA 5FLEX 4YR7A 1CFJA 4NNPA 1NXOA 2WJYA 4H7DA 4QHYA 1WP4A 1B1AA 4W5NA 2JDIA 3GMDA 2PGJA 3PICA 4OUDB 1MLDA 4DW8A 1BVYF 4O2BF 4W9RA 1LBHA 4RVNA 2OBBA 1DC7A 4YBZA 4KHZA 1AKNA 4GYYA 3AXTA 1ECPA 3KFXA 2G82A 3FTFA 2IP4A 2GZ2A 1Z8FA 3L04A 4KJXA 3BBLA 1R4MA 3T15A 1ONPA 1TZCA 2GT1A 3LBAA 2XDQA 2C9DA 3FB4A 4UBMA 4JBLA 4UM7A 2DXIA 4N0MA 4EGQA 5JDIA 3H8VA 2PTHA 3OJEA 5FXMA 5K0NA 3FPGA 3GF4A 1E1RA 1XT6A 2FE4A 1REQB 3GLHA 4IPTA 5LIPA 1B14A 2J33A 1R6UA 1M6EX 2R6FA 2FX3A 1MKYA 3EH2A 2OLJA 1MO4A 3CZQA 2FF7A 2AG5A 2W0SA 2HJHA 1UKVY 4OJMX 4AJNA 3A05A 4UQPA 2RKWA 3IKVA 1DMRA 4E2YA 2EBWA 2H4YA 5AD1A 1ECFA 4G9EA 4HXGA 3O4FA 5I9IA 1E3JA 2FPGA 2GM5A 3ZBPA 3WAJA 1EUYA 1RXCA 1AGPA 3ICWA 1UUFA 4ZYXA 2AN1A 1P3Y1 5CDGA 1JYEA 3V2UA 3C3MA 1JALA 4NPAA 5DP2A 3IP5A 3E7XA 3U19A 5CEJA 5AI6A 4NJMA 2Q6LA 3OJOA 3GRKA 2PZGA 2VUTA 2PGAA 4WGGA 5IC5A 4UATA 3UA4A 2FUG1 2XCIA 4ZJYA 4CEJA 1XPUA 4R51A 3P4YA 1ZH4A 3HXOA 3HN2A 5EMMA 5H9WA 2FY8A 3OCCA 2EW2A 5B36A 1CF9A 2EZ4A 3G23A 2KJQA 3DUFB 1Q19A 3PC3A 4MWSA 1I2MA 4Y2PA 3PHJA 5EIHA 2FPRA 1EZZA 3ILVA 3D5TA 1OYWA 4LZWA 4CKYA 3I9JA 3IYLW 4IF4A 4QQNA 2VA9A 4D4KA 4MHTA 5EE3A 4MVJD 4XEHA 3K92A 2GYVA 4TTJA 1W8DA 2YINC 4F21A 5DU2A 3B6MA 4CJXA 3REOA 4TWBA 3HCWA 3CEPB 4DB2A 2FFBA 4MTCA 4V2UA 1T6XA 2FN4A 3U5TA 3RS7A 2P65A 1HO3A 4QARA 3ZW8A 1Q57A 3A9CA 2WYHA 2DBVO 1RYZA 3L41A 4HNHA 3LUHA 2QYSA 3QOWA 3FNGA 1G0NA 1ACJA 1YCDA 2B9EA 2DPXA 2QN6A 3S70A 5BYKA 5T7BA 1FP7A 1RHQA 4AJEA 3GLQA 2BFPA 2PFKA 2QI9C 3CF0A 3HKBA 3NB0A 4YS6A 4J0EA 4EYGA 4ZYWA 4AROA 1JDNA 3AVYA 1DKUA 2RBEA 4RZQA 2GK7A 2VJAA 4JGBA 4PINA 3SOZA 4JI2B 4XFJA 5A02A 3BXOA 1RJFA 4C3VA 1D7AA 4RK0A 4L9WA 2PXHA 1A3CA 1R9JA 2P2ZA 3HVJA 5JMTA 2A9VA 1J8MF 1GTVA 1LI7A 1R6DA 1N3YA 3RGGA 1USVA 3GEDA 4PGGA 4P54A 4P83A 1Q7EA 3K5HA 1N8NA 3Q1LA 2FMHA 3RVJA 1LI5A 3PQCA 2R8PA 5EERA 1T2UA 2CHVA 3A1FA 2FMKA 3X1XA 2PRYA 1VCMA 3OECA 4HQOA 4RTRA 3L49A 3GH3A 4QELA 3O8NA 4Y2UA 5J59A 1B8VA 3DE1X 1W581 3O31A 3LWNA 1M2NA 4BU0A 1CIVA 3NPAA 5DM0A 5HJ5A 1G2OA 1RPJA 2QQ5A 3ZWKA 1V4BA 1L5NA 4CKWA 4IXMA 3DLBA 4C2AA 1RYDA 5FCDA 2NYRA 3L0OA 5DW0A 5TQ2A 3RUHA 1F8FA 3E22B 4U5XA 4M0PA 2J5BA 1ZCJA 5FBQB 2O5VA 4XYMA 5LM3A 3DEKA 2EDAA 1FMFA 1Y8RA 3OO1A 5K3SA 1GCUA 1R0CA 1K7CA 4MGKR 1G5FA 4L02A 3KQSA 4YQEA 1JFVA 3O3NB 1XCGB 2CSXA 4Z9YA 2EFGA 5FBRB 1H1TA 5CB4B 1TAGA 2YV3A 3A1WA 3KTFA 1TIPA 2C4MA 1U0OC 1FTSA 1N5IA 2ZK7A 4OU5A 4YP7A 2GXSA 4GRDA 3JSAA 1Y1RA 3N2GA 3RGWS 4CDMA 1PX2A 3LHKA 1YGPA 2C2GA 2H2AA 3RHFA 5DM70 1V8FA 4HF7A 3RAFC 5JFTA 2HMUA 2IVFA 1CR1A 4DSAA 2GJSA 4BFVA 2R5FA 3W3ZB 4WX2B 5T3YA 3H17A 5JAPA 2GCNA 2JIQA 1E3WA <