4RK4A

Crystal structure of laci family transcriptional regulator from lactobacillus casei, target efi-512911, with bound glucose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
275
structure length
270
Chain Sequence
TGNIGVLVSRVTNPFFAGLFDAIERELHAHGYQVMITQTYDDPEAEERFLKQLKSRELDGVILASVEAPDRVMAVAKAFPGRVVVVNADVQIPGATSLVLPHYQATRDALDYLFNQGHRRFAYVSGGTISGAHHGQSRTQAFLDFMQAHQLLVAQDLLFGQIHTAKEGQAVGKQLASLAPNVRPDAVFTNSDEVAVGVIDSLLAADVKVPDDIAVMGYDDQPFAPFAKIPLTTVHQPVASMAAAATHELLKGLGRQVAQLHLSLKIRQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LacI family
publication title Crystal Structure of LacI Transcriptional Regulator Lsei_2103 from Lactobacillus casei, Target EFI-512911
rcsb
source organism Lactobacillus casei atcc 334
total genus 102
structure length 270
sequence length 275
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk4A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk4A01
3M6MD 2PMCA 2OENG 5EWLB 3C97A 4FE7A 4OLBA 5IUJC 3N6VA 4E7PA 4LE1A 2FN8A 2RJNA 3RVPA 4PZ0A 2CHEA 3HCWA 1YS6A 2R25B 2MYTA 4IMIB 4MR8A 2HPHA 3P9YA 3O1IC 4TLMB 4ETNA 2PUFA 3OQNA 1VRVA 3R0JA 1DRKA 2FKAA 5GQSA 4F06A 2JVIA 2GBPA 3UUGA 1URPA 5KC9A 2WJWA 1ABFA 2PJUA 3EGCA 2RGYA 3SNKA 3FGZA 1MAVA 1DP4A 4YR7A 3CFYA 3IPCA 2PUEA 1B00A 2CHFA 1VLZA 3H5VA 3ROFA 2FEPA 2YHAA 1I3CA 1C0EA 1SD5A 2M98A 3IP5A 3LTEA 2PUBA 3JPWA 1GUDA 3QEKA 4NICA 4G0QA 4N41A 2JB9A 3BRSA 4MS1A 3CZCA 4Z99A 2RDMA 3OLVA 3QEMB 1Z17A 3A10A 3TMYA 1A0OA 5KC8A 3DGEC 3T38A 3GV0A 4FB4A 4MPTA 2RJOA 1ZAYA 1NATA 4L4UA 4D6YA 4MS3A 4N0PA 5TPWB 2HQBA 4LE2A 5TE9A 4EVSA 5TQ2A 4KV7A 4W5TA 3B2NA 5TPZD 1E2BA 2OQRA 2JBAA 2A9PA 1CHNA 3O74A 3DGFC 3GWGA 4LDAA 1MB3A 1ZITA 3D02A 1U2PA 1BAPA 3FFXA 3H6HA 4YP9A 5JNRA 3QLUA 5DTEA 1ZGZA 3C3KA 4Z4EA 1Z2EA 3JPYA 5DKFA 3BILA 2LBPA 3JTEA 3N8IA 5EWJA 5KQMA 1RXIA 1MB0A 4KNYA 1KMIY 3MA0A 2HJ9A 4G0ZA 2BGGA 1D4ZA 1SRRA 3TX6A 4YCSA 1NXPA 4WUTA 3K9CA 5FWXB 4Z4HA 3HS3A 1YIOA 1QP4A 1AB5A 3O1HB 1PUXA 4MS3B 3HV2A 3JS5A 4HNQA 5KI6A 5TQ2B 2F8TA 4RSMA 3I5AA 4N47A 3LUFA 1L5ZA 2P4UA 1M5UA 2E4XA 3Q9SA 2O20A 4Z0NA 5BQ3A 4PICA 4MLCA 3QX9A 3G1WA 4XASA 4OTZA 3MMNA 4RXTA 4CBVA 1JFVA 1JYEA 2AYZA 5EWJB 4KREA 1JDNA 2FQWA 2J48A 5BRJA 4M88A 3KKEA 2QVCA 1A2OA 3KLNA 2I6FA 5KQLA 3QLUC 1FFGA 1YK0A 4G0YA 1JF8A 1ZH4A 4WT7A 3F73A 4YRZA 3CZ5A 5EWLA 1QQBA 4WWHA 3NHZA 1TVMA 3OMXA 3EQ2A 2H3HA 3L6UA 4RY0A 3GYBA 2MYUA 4QYWA 1Z2DA 3KS9A 1QMPA 5I4CA 3HUTA 5F64A 3K4HA 3HK2A 3SY8A 4RV5A 1PEAA 2TMYA 3QELA 2L19A 4YLEA 3JVIA 2XDYA 1C4WA 3CS3A 1D2AA 3CG0A 3FDFA 4EYOA 4O1HA 2HQRA 3T8YA 1DCMA 4NCBA 2JVKA 3E3MA 3LOPA 5ABPA 4JB0A 1ABEA 3CU5A 1LJUA 3BREA 3GT7A 1M2EA 2CD7A 1GCGA 2FQYA 3H5IA 1LBHA 4O5AA 3HDVA 4OBBA 1ZN2A 4PE5B 4ZYLA 2LIVA 2QVGA 3QEMA 4G0PA 3KLOA 4Y9TA 5IX8A 4F12A 5ED4A 5CNMA 4P98A 3OM0A 5PNTA 2ZWMA 5IBQA 1M5TA 4W5QA 1U0SY 4IF4A 4OLAA 4ETMA 3C6QA 5TPWA 5EWMB 3DBIA 5IULC 1EHCA 3N75A 1ZHHA 1EAYA 5BR1A 1MVOA 3OQMA 2A9OA 1XHEA 3H1GA 3QELB 4IGAA 4EUKA 4PEVA 3DLBA 4KQCA 2FMIA 2PUGA 3GRCA 2QU7A 6CHYA 4HNSA 2GKGA 1LJLA 1H9CA 3RVLA 3Q7SA 1GLGA 1NXVA 1XWWA 1EWVA 1JX6A 3OLXA 4IILA 3T6KA 4TN5A 1AB6A 2B4AA 3M9WA 4Z4IA 1QO0A 3LKVA 3O21A 1BDIA 3HO1A 1A04A 4L85A 4G97A 3OLZA 4N0QA 4WXMA 2A9RA 3CKMA 4G0MA 3MYYA 4IRXA 5FWXA 2MYNA 4ETIA 5D2CA 2A9QA 4NCAA 2YHBA 4Q6WA 4RKQA 5T3YA 3HVRA 3HSYA 3N0XA 4KVFA 1Z18A 3C3MA 3KCNA 4MYRA 3HUUA 4Z9AA 4Z4GA 1JH9A 1U04A 2JRLA 1YMVA 1Z25A 2E4UA 2JCGA 3UK0A 1VKRA 3LUDA 1DC7A 1DG9A 4ZPJA 4LX8A 2VUIB 3L49A 2FSPA 1D5WA 3H1FA 3KJXA 3VNBA 1JFTA 2X7XA 5IUNC 1BDHA 4YWHA 2FQXA 4S05A 2F8SA 3H1EA 1CEYA 8ABPA 1YMUA 2IPLA 2JK1A 4RXUA 2R47A 3G85A 3OLYA 3O1JC 2WRZA 5JS1A 2PUAA 1F51E 4RS3A 3LUKA 4N76A 3LMKA 1DRJA 1EFAA 1W9HA 5HQJA 4XFKA 5JNVA 2KYRA 4Z4FA 4E7OA 3N0RA 4EVQA 2QZJA 4MAAA 1U8TA 2PKXA 5KQGA 3O75A 4QPJC 3FMVA 3IP6A 2M1ZA 4EY3A 4EYQA 4G0OA 5CHYA 1DCKA 4DQDA 3IP7A 4F3TA 4XAQA 3NHMA 4RK7A 1YS7A 1TLFA 2MSLA 4MS4B 4KMRA 4JAVC 3VNAA 3CTPA 2WJAA 3S99A 2GX6A 2FXIA 2E4YA 4NQRA 3HDGA 2NT4A 5HKOA 3LUCA 1NTRA 1PNTA 1YK1A 2QV0A 1Z26A 1VPWA 1JDPA 3ILHA 1ZH2A 4OATA 4HNRA 2FTKE 2JVJA 1Z12A 3KTOA 2FVYA 4RK5A 4D6XA 1DBQA 3JY6A 2E4WA 3GBVA 2WMYA 3MF4A 1RNLA 3RVMA 1QKKA 2PAFA 1F4VA 2LP4Y 3MM4A 3OM1A 2PUCA 5FBHA 1L5YA 1RZRD 1ZDMA 1JYFA 1E6MA 2IYNA 2Q5CA 3NNNA 4KK4A 4MRMA 1BVHA 1CYEA 2PL1A 4GNRA 5DLEA 1YTUA 5T7BA 2E4VA 5TPZA 5EWMA 3QX8A 3HM9A 1W25A 5HM6A 1WETA 1LK0A 1BA2A 4RK1A 1SXHA 5KQPA 3A0RB 5IEJA 1S8NA 3HXMA 2ID9A 4RK6A 2NUBA 4ZMRA 3OMWA 4RU1A 4PYRA 2R4QA 1RXEA 2FLKA 1NY5A 2GWRA 1SXIA 5TQ0B 4ZMSA 3CNBA 4OG2A 3CHYA 4RY8A 5BRAA 3Q7RA 4W5NA 1XHFA 4S04A 3H5OA 4YV7A 4WZZA 3EULA 4B09A 2VK2A 2IKSA 1K68A 4MGEA 4MRMB 4Q6BA 3SQNA 4RDCA 4EGSA 1EWKA 3OO0A 3URMA 5B3JA 3RVOA 4QYMA 3SG0A 1NXTA 3KSMA 5FWYA 5HSGA 1U2QA 1JBEA 1FSPA 1FFSA 4F8JA 1ZY2A 3D8UA 4Z4CA 3NNDA 3IDOA 3RQIA 4KPYA 1DJMA 3LUGA 3TD9A 3O2QB 4IMJB 3I45A 3RVRA 4NV3A 4Z9BA 3T95A 3OQOA 2W42A 9ABPA 3MIZA 3Q41A 4RK4A 1BDJA 3BRQA 2L18A 3DLHA 4YGXB 4TMYA 2CWDA 2FN9A 2FMHA 4G86A 1PHRA 2P9HA 4ML3A 3RVNA 3O2SB 2PUDA 3RVJA 3TB6A 1DBWA 3EDCA 3RVKA 1TMYA 2V0NA 1QP7A 3FFTA 2QSJA 1Z13A 1APBA 5C5EA 3I42A 1RZRA 2LPMA 4F11A 5FWYB 3H6GA 2MSWA 3NNSA 1USKA 1Y1LA 1QPZA 4RWEA 1KRXA 3FFWA 4JASB 2IDMA 1QP0A 4MQFA 4LDZA 4MS4A 4D74A 3KHTA 2PE5A 2VUHB 1QNLA 4YS6A 2MSKA 3MQ4A 5B3JC 3LKBA 1Z15A 3CLKA 4MR9A 1FQWA 3H5TA 1JL3A 3F6PA 1K66A 4JOQA 3IP9A 1ZVVA 3CRNA 1FFWA 5CNIA 4EYGA 5E3JA 3RVQA 2FEKA 1P6QA 2WB4A 4FE4A 3TO5A 2AYXA 4WXEA 3HEBA 3NBMA 4MR8B 4TLLB 4H3KB 1JWLA 4YO7A 2NT3A 1R8JA 3Q15C 4Q7EA 1JLKA 1SXGA 1JFSA 1TM2A 2DRIA 1D1QA 4MR7A 3ROTA 4H3HB 1DCFA 4HYEA 3DZDA 1EWTA 1P6UA 3M9XA 4KZKA 3RVSA 2FEWB 3CG4A 3GBPA 1IIBA 3QK7A 3HZHA 4EVRA 3LUHA 4MQFB 4KRFA 2IOYA 4GPAA 1TJYA 4MS1B 4EYKA 5JNSA 4W5RA 4MR9B 2PL9A 1ZESA 2L17A 2NZUG 3H5LA 2R48A 2ID7A 3EJWA 1DZ3A 1JHZA 2WWVD 1PNRA 2IPNA 2B1JA 1DBPA 3IPAA 3QLVA 2PLNA 4QICA 1E6KA 5FBKA 3SM9A 3Q7TA 1YVUA 5DCLA 5TQJA 4W5OA 2L2QA 4RKRA 4O1IA 2VYCA 3HJFA 2IPMA 1NXXA 2HQOA 3GA5A 1USIA 2MYPA 1USGA 3F7NA 4MR7B 4G0XA 4RZSA 2JBAB 5TQ0A 5JS2A 5IEBA 3KG2A 2FLWA 1UDRA 1RPJA 2FMKA 1HEYA 4XXHA 4DN6A 1ISSA 1E6LA 4UHJA 3OLWA 2HSGA 4MQEA 2IPAB 3C3WA 3EODA 5IC5A 4P1ZA 4KQ9A 3LUAA 2N9UA 2QW1A 1GCAA 1OXKB 1NXSA 1P2FA 5GOTA 3W9SA 3EQZA 4XLTA 5JNTA 1QO0D 1ZGGA 1P8AA 2E4ZA 2LUOA 3EAFA 1Z16A 3GL9A 1M2FA 3LUJA 2ZAYA 1NXOA 5JNWA 1J56A 6ABPA 4N03A 1T34A 5DGCA 1KGSA 2QXYA 5IUKC 4LRQA 4MLDA 4DADA 1ISRA 1MIHA 3JVDA 3LFTA 2NZVG 3N0WA 1DC8A 5JNUA 1NXWA 3KYIB 3I09A 4UHKA 1OXBB 2GI4A 3QLVC 4JA2A 3A3KA 2WY2D 2QR3A 1GUBA 4LE0A 3UKJA 4RY9A 3OO1A 5C5CA 4MQEB 3E61A 4KK3A 1PEYA 3H75A 3N53A 5CNJA 2FW0A 3KYJB 4JB2A 4XARA 1LBIA 1QQAA 3H5WA 5CNKA 4JP1A 3A0UA 1KRWA 3QLTA 1D1PA 3F6CA 4LZLA 2FMFA 4RK0A 7ABPA 5KWSA 3SAJA 3O2JA 3RH0A 4KFCA 4ZJPA 3ILYA 2H0AA 4H60A 4RXMA 3BBLA
chains in the Genus database with same CATH superfamily
1RAFA 4GUDA 2YV1A 3SQXA 3QHQA 2JRCA 2AH5A 3BXHA 1CXZA 3HJGA 2DKNA 4FC6A 4D3FA 3KT6A 2J7KA 1BIFA 1POWA 1VPEA 2D2VA 3GFTA 4GX5A 2I4OA 1G5PA 2D5AA 1AH2A 3AUKA 3PC8C 3I2FA 5D5HA 5CX1B 3JQ7B 3V4FA 4AN4A 1VE9A 4M4SA 4DR1B 1XCMA 4XQGA 7MHTA 2N42A 2CEKA 3R0JA 4S1PA 4ZI3A 5FA8A 5EJIA 2AX3A 2EFDB 1E0KA 4MRPA 4KPUB 3SOPA 3TTYA 3I2YX 4MPRA 1YZQA 4NOLA 2FZVA 2HLHA 2NU9A 3BN3A 4MV0A 2DTXA 3HB1A 3PR1A 4Q1EA 5CURA 3TQCA 4N5MA 3VR6D 3WFIA 1AKTA 1T4CA 2G70A 2OPHA 4UM9B 5I51A 5LQCA 4NXNB 3G5AA 3EIWA 4OH7A 1O6GA 3MLEA 3LTEA 3IP5A 2XTNA 1P8JA 2W8ZA 4B46A 3BUSA 4I81A 2ABWA 3TRJA 3AEKB 2JB9A 3EARA 4PVCA 4TXHA 4AJ1A 1OXUA 1Y63A 3OUTA 3W4KA 5JFOA 1D0SA 3L79A 1THTA 4QAQA 4QBKA 4M89A 2PKQO 2F9MA 1O5TA 1FS4A 2YVUA 3OPXA 3RV3A 3K9NA 4M1QA 2AQ8A 3HCRA 4DR7B 2GDJA 2O8DA 1C8VB 4HAUA 4CQLB 4J76A 4XFDA 4WDRA 4DMUB 3SMVA 4FSXA 1O95D 1Y6FA 4A8JC 3CVWA 4N0DA 3B2NA 4IEFB 5EJ2A 5TPZD 2B8TA 3LDHA 3KDSE 1T5IA 3K0KA 3NOXA 5ALYA 4U1RA 2G80A 1E2MA 3D6HA 1FB5A 4E70A 3O84A 1J21A 2QV7A 3D3QA 5T4BA 4Z4EA 3ZCUA 4YI5A 3FNFA 2WSBA 4A36A 3N8IA 3WJ2A 2PQ6A 2WF7A 1KMIY 1GPLA 4KNYA 2GEUA 3TI7A 2VP9A 4TROA 4O4IB 3VR2A 5AOVA 3FHOA 5EKXA 2PNJA 4DXHA 1WZCA 2C7VA 4JT9A 4UDYX 5FI1B 1FUIA 3HBJA 1QH8A 1A76A 1B93A 4B4UA 1VXRA 3QXSA 2AJDA 5B4TA 2LIPA 3RYHB 3JQBC 2JFQA 4RQAA 1E9RA 3A4IA 3C41J 4JI5B 3P2EA 4XJVA 3I5AA 1G7TA 1TRKA 4QDXA 3AOEC 3STYA 3V34A 5F1OA 1E6UA 2R68A 2FETA 4PYQA 5CT6A 1EE9A 1GZUA 2EX1A 2FY8A 1QHEA 2FPLA 3INTA 1ZP6A 5TB5A 1KMNA 4QRHA 2ZRCA 1S4MA 2FSFA 4F4UA 1GKIA 1NF9A 2CMDA 3AUJB 1XCPA 1PFWA 3U4CA 2G0AA 1NQTA 1FTQA 1N7IA 3QX9A 5FI5A 2CZQA 3UJDA 1RHJA 4LDPA 1MDFA 1V45E 4Q48A 1ZRHA 3AX6A 4DLNA 3I5MA 4NZYA 4R1SA 3BKWA 3ROPA 2VL7A 3OZFA 3L7JA 2R3SA 4QJIA 5BRJA 5IRCD 1G7CA 1RC1A 4O2AB 4KIJA 3LK6A 4TVKA 3T1QA 3TUJC 1AZSC 5LL6P 1EUQA 1T2VA 1VB3A 3NUQA 3BMCB 2QXTA 4RHFA 5TIIA 1TD9A 3G89A 1XXHA 1VLHA 3PHLA 1JG2A 2PFGA 3IERA 5F9MA 2QN7A 2VSOA 3K1JA 5A02A 4BVAA 4PNHA 5I01A 3NHZA 3HWWA 4LNAA 5KHLB 1Y48E 1PKXA 4UULA 3LQKA 3MJDA 2XZDA 1U9CA 1ULHA 1PZXA 3JQFA 4PC3A 5G3YA 2C5HA 3F5SA 4RQUA 3DEFA 2X5JO 4A4DA 4F6CA 2V5UA 1XZNA 1KDRA 1J33A 1GZ4A 3ND9A 3RIHA 5IJWA 5KO2A 4YRCA 3EOAI 1C3LA 3NH9A 2I29A 5HFNA 1K3TA 1NPTO 3KYCA 1VHJA 4FKMA 1RRKA 3PFCA 5ULLA 1T6BY 4GZ6A 5DSZA 4C7BA 1F1JA 4C0QC 1NYQA 1OWPA 4O2BB 4NCBA 4MNTA 1OC2A 2BUCA 3IILA 5B4VA 2XECA 1WAMA 4IHKA 1QFYA 2EL7A 3QG1A 1KEUA 3KEFA 1WZEA 5FOXA 3S2YA 4MVJH 2WSYB 2ZJ7A 3E9RA 4R40A 2A5LA 3F5DA 5LCXA 4BGIA 2OZLB 2Q3DA 3KKLA 1IPFA 4U3JA 4JBHA 4HV4A 4GL2A 3NT2A 2Y66A 4AQDA 3VC1A 4EHBA 4KWCA 1ZUWA 4HQ6A 5A0FA 3RRZA 4FNGA 3WRVA 1FYFA 3I83A 5K6AA 2NU8A 1GNSA 4PZZA 2XQGA 2IXFA 3ZW7A 2F6RA 1E98A 4HR7A 3H2BA 4G5QA 4R7TA 4ROTA 1HQCA 3IRVA 3ANLA 3IUSA 5IJZA 4DUZB 2XVXA 1PVDA 1ADYA 2OKCA 3H1GA 4AMVA 2QTVB 4ZI5A 2VKTA 1UXGA 3RUIA 2VHXA 1J06A 3Q5EA 4R1TA 4A0RA 2WJ6A 2QU7A 2NZYA 4TVBA 3DE2X 5TF4A 3RBVA 1C9NA 1U7DA 2RHBA 3TM5A 4OHFA 5CYOA 3ENVA 3HB4X 3P9QA 4H08A 5GWXA 5JD4A 1PQUA 1V5GA 2AW5A 4OXXA 4RJTA 1U0BB 4XDYA 4OQLA 5F3DA 5HWSA 1BDIA 4EW6A 2ZYGA 1Q50A 5IS2A 4LK3A 4YC7A 1CEQA 1UXIA 2RAUA 3WMWA 3CKMA 3FYTA 1OXSC 3BMXA 4NHEA 4QULA 3OLQA 5FWXA 3HDYA 3NAGA 5D2CA 4NCAA 3I2KA 2YHBA 2OMKA 3HC7A 4EZBA 3HSYA 4FK8A 2IV3A 3CBQA 1D2CA 4OUDB 1WV1A 1V1MB 3DLAA 2AD5A 3EGDA 3Q98A 3W8EA 2XGGA 1KBQA 2A5YB 1UXJA 2FPRA 2FSPA 1DPGA 3AI1A 4KXWA 4P3KA 2Y71A 4UVDA 2H1FA 1PFUA 5JCJA 1WSDA 1MHTA 3H3JA 1NTOA 1JQDA 1K9SA 2ZSIA 3ND7A 3UZUA 8AT1A 2QZ9A 1IXYA 5BQPA 1VI2A 5FFFA 2RK3A 3GIDA 2VZLA 1C3JA 3EIUA 2E85A 4BVHA 1Z5WA 3TZLA 4BVKA 4WRRA 1KDTA 4YONB 2O2XA 3EDQA 3KL2A 4IDAA 4K9OA 1DRJA 1B1CA 6AT1A 5EQJB 2K5UA 5JNVA 1EFAA 1PD0A 3JZMA 4UMVA 2ATVA 2IY9A 2QW8A 3A7DA 1ZGHA 2XCLA 4GGMX 1SIUA 1WDTA 3FNIA 4M1SA 4ZVLA 2I9PA 4AYWA 4ZZ2A 1M6VB 1XTRA 3MUFA 3OQ6A 4ZANA 1ZK2A 4J75A 3N70A 2XMPA 1M54A 1UMDA 1PQWA 2IUFA 5KBYA 1NVWQ 3RODA 3T7KA 3DYVA 3IB6A 2CLKB 2XYPA 3ZZMA 3KFXA 1MVNA 1S1CA 1HNZB 2BEWB 2VAVA 4MDHA 4WECA 4L3WA 1I4LD 1MX5A 5C9ZA 1DG1G 4DA4A 2IGBA 3IX7A 1WF3A 5AM5A 3V8QA 2POCA 1IHYA 3B53X 2I1QA 1W4AA 4E3ZA 4Z51A 2IDKA 4U7PB 3HZZA 5L3SA 4FYKA 4XVQA 4CXMA 3DM9B 3DZHA 1UZLA 2WJVA 3FBTA 2DGDA 1UJ6A 3BMQB 2JGRA 3L46A 1N0IA 3D7NA 5E0KB 4ZAGA 1Z12A 4F3YA 1UBUS 4JJFA 4D6XA 2BY4A 1CJUC 2Y1CA 3C3EA 3W06A 3VKVA 2FR8A 2E4WA 2PMWB 1D2NA 4JMPA 3WLMA 3W5JA 1KEEB 2HKIA 2W6IA 2BGWA 2CDCA 2XAUA 5FBHA 4KGDA 2CVPA 5NULA 1ZDMA 4P5EA 1NSTA 4ODIA 2ZUWA 4TZ6A 1A4XA 1AMUA 5IXSA 2FK8A 4X6XA 4XSHA 4BBJA 1H3NA 1QRRA 2IF0A 1KI3A 1ZM4A 1AQNA 3HKBB 2J3EA 3I04M 4K0RA 1FX1A 1W25A 2B4RO 1RKQA 2CDRA 5DNDA 3KQHA 1CNEA 2HCRA 2OILA 4TWJA 5LNK6 4W5WA 5JSFA 1RP7A 4OK3A 3WWEA 4QXAA 2EZ9A 3EWIA 1F7VA 2ZI4A 1J9ZA 1UBSB 1AKEA 4N8DA 4Y2TA 4HDNA 2Q4TA 4DM4A 1M2WA 2C95A 4YJKA 3BL8A 2ZT8A 1C7JA 3FCYA 5CXQA 1XZLA 3UFXB 3UWMA 3ROQA 3MUNA 4QEKA 2YRFA 2R65A 4NP6A 4OJTA 3U3JA 3UTCA 4ZMSA 1KY5A 4Q4AA 5T67A 3VYWA 4AJJA 2P27A 5EZYF 4OG2A 5AVUA 5AKXA 1R7RA 5MDHA 1TVKB 1WPXA 3GD5A 3UPUA 5EZ6B 1JR4A 4FNMA 3LYHA 3A1VA 2F1IA 3AR4A 2QY9A 4I6EA 3Q85A 2H2AA 4IIGA 2EGUA 4M8IA 1XQXA 3MWYW 4NNOA 1K68A 4MVJE 1S8OA 3TTVA 2EBFX 1XMOB 4GNKA 4JJEA 3ZY3A 4GE0A 1CJCA 1FK8A 2XCQA 3CCCA 4RZXA 1NVUQ 2P7IA 3GJ7A 3LX4A 4JCOA 4BBAA 3V3TA 1QFZA 1DKRA 5AMXA 4D3ZA 2R5NA 4EHFA 1MW8X 3IMEA 4AJPA 4IG9A 3V3KA 1VHTA 2QR5A 4AY2A 3PPVA 2X1VA 2O3SA 5LYYA 4B4OA 3LWDA 1YU6A 1T1JA 1JLSA 1CE8A 1Z08A 3AEZA 2QPOA 1QH1B 1AZTA 3VTAA 2PVPA 1B2LA 4J0KA 3KUXA 3EGOA 4GSLA 1CIJA 3AILA 4TMYA 4B3JA 3HB7A 4TZKA 2FMHA 2MSEB 1I94B 3SBDA 2WP8J 2WHXA 1E64A 1L7RA 1T4BA 3SNHA 3V8NA 5HXAA 1VQ1A 1KKMA 2PGXA 3TRKA 4JLSA 4XTRA 4PYJA 1NW8A 1Z13A 3IAEA 4CNQA 2QL9A 4N0EA 1SCKA 1ADCA 4M0KA 1JR3E 4UXHA 3IUQA 2OXIA 3ZGVA 1Q2XA 2LV8A 2VYND 2ZVJA 3G8BA 2OAEA 3R5KA 5LYJA 1P9LA 3KJQA 2H2FA 1II8A 4HNAA 2G0NA 1NQWA 4Z5XA 2AC2A 3GGOA 4UD6A 2YN0A 1IY9A 2GXUA 1P2VA 1ZFNA 4MS4A 4U7WA 3AVQA 4F3KA 2ST1A 1PLLA 2VUHB 4UDNA 1UH5A 5JZSA 5IM5A 4E30A 5KVQA 3KXDA 2P62A 4QC2A 1HMYA 2R8OA 2DPYA 2VKQA 4MR9A 4JODA 4WEOA 1Q16A 5A3SA 1JA1A 2FUG1 2A0YA 3FNEA 3IP9A 3CRNA 4O4LF 3PQ7A 4P3YA 1FRFS 4HTFB 1SA0B 2CNNA 2GCIA 2WB4A 3F3KA 3GJZA 2A84A 4HZUB 4TLDA 1WB4A 4P4SA 2C8KA 4IZOA 3ZQJA 4DTIA 2GUWA 1FSFA 5JVDF 2EWMA 4Q37A 1QG6A 5G02A 4LV6A 4QOSA 2AWOA 4H0FA 4KUGA 4I2NA 1PQPA 1JFSA 3ZV7A 4P5PA 1FZTA 1DBVO 3B38A 4AIIA 1R74A 1PU2A 3H6KA 3VAZA 4AO6A 4F4IA 3ZS9A 2PS0A 4CT4B 1FY2A 4MGIR 3BDIA 4FMDF 4AZ3B 4K9NA 3OP4A 1QM5A 1U5AA 3PWTA 4PG8A 5IAEA 3NDIA 3N07A 4JC5A 2ADOA 3A04A 1TCAA 2V96A 2WM8A 4OKIA 4QKQA 3Q8WA 2QRGA 2F64A 1JPNA 4KMSA 2HK6A 5I5EA 5CJPA 1PR6A 1J6UA 5L3ZA 1I1HA 1CY8A 1E9DA 2JHCA 3H5LA 2JAPA 2G9NA 1G42A 2DU8A 2NP7A 4BLVA 4LTMA 1DBPA 1O94A 2PLNA 4WBNA 4MKXA 2CXNA 2IYOA 1UPAA 3UB2A 4E21A 4R9NA 3Q7TA 4HRVA 2X0IA 3ZIAD 4KXXA 4CQMB 1CY6A 4BNJA 4F9TA 1KI7A 4N48A 1YA6A 4NI5A 3F46A 1JJ7A 3CA8A 1NLMA 2MYPA 1OE0A 1OBOA 4G0XA 3NTQA 2J0UB 1LFAA 4JLAA 5IEBA 3D5QA 3CM0A 4JHLA 5LQRA 1UK8A 2DKOA 4WN9A 3RREA 3F78A 2TMKA 3HO8A 5AK4A 3OCZA 4UHJA 1W1IA 3RPEA 1JEJA 5FPQA 1DXOA 3IMFA 4B6RA 2YIDA 2G40A 3IEXA 4IIVA 1CR1A 3UAOA 4DY6A 5E2IA 5LDDC 5J59A 1CUUA 1NXSA 3IQGX 5K8LA 2BN4A 1WCIB 1V4NA 4TVSA 5I7FA 1ESCA 2AXEA 4UNIA 3IJRA 5CIQA 6ABPA 4O02B 3GLHA 4L8LA 4P7KA 4RD4A 1IIRA 2CFRA 4CPDA 3KKOA 4B3DA 4DSZA 3LFTA 2QZSA 1FU4A 1YWGO 3CLSD 3N0WA 2HJSA 4RJJA 2YNMD 2DUMA 3AVWA 3GFGA 1YIDA 4D4HA 1JKJB 1NOIA 3RAPR 2DETA 1XZEA 1X3LA 3BCSA 4JC0A 4YRLA 4B9EA 1JAYA 3E7FA 4CM8B 3QLJA 1KU0A 2ZS9A 5C5CA 2PLWA 3WQQA 3PFGA 3X1YA 5F12A 1Y0BA 3VH2A 4C08A 4XVUA 4E5SA 2FW6A 3FJ1A 5DM1A 1ZK1A 2FPMA 2AG5A 2X1HA 3IXQA 4N3AA 3PXGA 4DYVA 1D2EA 4WL0A 2J87A 3AB8A 3QLTA 1SC6A 3O9MA 2I03A 1IDN1 4INJA 4X6LA 4RD1A 1NPYA 1XA3A 3GRKA 2XJ4A 4QASA 4A8PA 1U90A 1IZ8A 3MT0A 4ZDWA 2MCFA 1I13A 1CDZA 1M7BA 1Z0ZA 2ZVDA 3PUKA 4TMXA 4ZJPA 4H60A 3CMCO 3E9DA 2OENG 1WPGA 3ULKA 1RI3A 3IULA 1LLDA 3AYXB 2WQ7A 1E5DA 3FTCA 5DW0A 3AR7A 1TIKA 1RU3A 1XALA 5ECYA 3R5FA 5HIJA 5DM70 1VJTA 1CUCA 4HQRA 3HCWA 2R25B 2P1DA 1QZ3A 2QBYB 1WUHS 3ANSA 4JOCA 3HWSA 2H06A 4EKDA 3SN6A 2G83A 1C1YA 3E9ZA 4G23A 1PFVA 1PWHA 1J1IA 1T26A 3L40A 2XYVA 2G4VA 1AU9A 2NO5A 4IHJB 4PNPA 4RF3A 1L5HA 3TNFA 2X5XA 5G4KB 4NG5A 3V1UA 1TJ4A 1VKHA 3PGLA 4N9QA 5BNIA 4BMOB 3V9AA 4KQMA 4NH4A 4CCYB 2IS4A 4KUHA 4ZALA 3P20A 3BT7A 3FRJA 4GBGA 1HURA 3KV1A 2UDPA 3G2JA 2LE0A 1SCAA 3BMOB 4UCQA 1Z17A 4A8JB 5I6DA 3TMYA 2IHKA 3X44A 2OQ2A 5I9TA 3JR3A 1JHXA 4US0R 4YRMA 4KLRA 5CA0A 1OT5A 2ZJYA 3R7LA 3I62A 5TPWB 1BH6A 1NULA 4R0NA 3HCDA 2WG1A 3BGVA 3FTFA 1PWXA 2QNIA 4HB4A 5AD1A 1OTXA 1NNSA 2FSHA 3G2KA 2CGEA 1M83A 1UADA 4MPPA 3FHLA 5DNEA 2QWXA 1RXCA 1YHZA 5E95A 1KXJA 5JNRA 1HZZA 1TM7E 2JIOA 2Z0MA 4JVLA 2HD4A 2RAFA 4X94A 5SYMA 3ZHBA 3BQMB 3DEKA 1R0SA 1N6IA 1TZBA 1SXJA 4GRDA 4UVHA 5B2EA 6REQB 5H0IA 2WHYA 2HJ9A 3THXA 5HIMA 2ZJ4A 5JJLA 3LXRA 4WK4B 3S28A 3BIWA 4RO0A 5JI3E 1CZUA 3RWOA 1NF8A 3WHIA 3E8XA 2I55A 3UHAA 4NCKA 1J2UA 3MOSA 2YIJA 3O8QA 1ICEA 3G6WA 1MABA 2UZ1B 3BZUA 3P5BA 2Q4BA 4BKRA 1WXXA 3HG7A 3OZAA 4N5DA 4NQZA 3RBAA 3DXYA 3DJYA 5ITWA 3MRSA 1C9DB 4LV5B 4RVNA 5BV8A 1IBRA 4Q03A 4RKEA 4CM9D 2EATA 1UFQA 2FUKA 5KVSA 1EUCB 2ETVA 3L8MA 3DE4X 3DQQA 4IDGA 4PICA 1RWVA 3ICVA 4TUYA 2VHZA 3ZHUA 4BV8A 4HQ0A 4E6PA 1QU3A 1LLUA 3Q3GE 4IQ4A 4MWCA 2UZ4A 1UMCA 2V5VA 5JIBA 4QU0A 5A4DA 3WJAA 4PZEA 2O0MA 1F7UA 1M0WA 2WUFA 4CMCA 4DCMA 2JAXA 2AXPA 1KEKA 4DDVA 3EFHA 3T1VA 1KS2A 3GPIA 2ON6A 3ZH2A 2Y0PA 3E03A 3DWIA 5T6MA 2PGIA 5IJXA 4KNWA 2WKRA 3CZ5A 1T3HA 5K6RA 1QQBA 2HRQA 3PIIA 1EXNA 5TS2A 2ZXEA 1F2UB 2RB5A 2ZG6A 1EK1A 4LVOA 2GM5A 2VHCA 2AOWA 3B3JA 2FN4A 3EQ2A 4RY0A 5JFGA 1WXDA 5JFTA 2P78A 1JIKA 3UMFA 4U4AA 5CBPB 2BGUA 5ALWA 2B0CA 3D0QA 2R8ZA 3KS9A 4B80A 4KQWA 5IVKA 2FLVA 4Z9XA 4MW6A 4BB6A 3TOVA 5LP6F 3SSNA 5ADUS 4D9JA 3DEYX 2YQ4A 3D4IA 3QKRA 2Y0DA 5FI3A 3DWGA 3RVDA 4CIWA 3GRRA 1ZJ5A 2CMFA 4R7ZA 5ITZA 4WK6A 4K81B 4O1HA 3M4XA 2I7TA 4IOJA 1OYYA 1K3UB 2WHEA 2P9TA 3HJTA 3VFDA 5C8YF 1NJFA 2C31A 2B98A 2R8EA 3CH6A 5BN1A 2CD9A 4KXUA 3ZR4B 3I9NA 1MF7A 2HOQA 2A9FA 1GCGA 2I2CA 1HPLA 1ATIA 2XRYA 4G0PA 4M1ZA 5ALHA 2IEZA 2JIZA 2UZ0A 2UYYA 2RK6A 4C0SA 3U6KA 1Z33A 5IXJA 1KTIA 1KEWA 2JGKA 1C9MA 4MEAA 4X63A 3FAZA 5KOJA 4EY8A 1DL5A 2F43A 1D4OA 3C6QA 2ZIVB 3BFPA 3KAQA 4FYVA 4LPSA 5AUQA 3UW3A 4KITB 2HDWA 3I6BA 1HY3A 1U9YA 4JT8A 3LT0A 4TXLA 4NYMR 3LIIA 5FP0A 4UTRA 2O2IA 3FB1A 4WEQA 3U09A 5BPFA 1UKZA 4ZZ3A 3C48A 2G6BA 2L82A 5JWRA 4QFMA 2YZGA 3RRYA 4E2YA 3O8LA 2QHXA 2WLSA 1WLSA 4IV8A 4JFRA 4QA9A 1TTTA 1MLDA 1Q74A 4LWQA 4MW9A 3DEIA 4XGNA 4NG4A 4L2IA 4H1HA 4JL6A 1EWVA 2I4NA 3LHIA 3WAGA 4Z4IA 3T3MB 2IIPA 5D7BA 3VO2A 4E2FA 3O83A 3UH0A 2GNOA 1JALA 3BIOA 3H2HA 3ORQA 3R2JA 3RR2A 2PL3A 4EGQA 1CX9B 4G0MA 3MYYA 3P0RA 4G8DA 5AI9A 2FFRA 4HSEA 1R5JA 1GQSA 2PUJA 4LEIA 5H9WA 5K3OA 3NIFB 2EYUA 1AURA 3QKUA 4Q6WA 5T3YA 1MPTA 4KYVA 1SC9A 5ENZA 5LFAA 4YXWD 3U5TA 5HKKD 3C3MA 4Z4GA 1ZA2A 3HN6A 1JH9A 2QTWB 5CJ2A 3HGMA 1CYDA 3K05A 1COWD 1J8FA 3EEQA 1E60A 4LX8A 3SBEA 5IDXA 2XWQA 1PT8A 1R9NA 1TFUA 4GOMD 3FPKA 3O4JA 4GX1A 2DFPA 4HD8A 5ALUA 1MC1A 2LTAA 1IJEA 2VBCA 2X0DA 4C0XA 3K6KA 1BHQ1 4AMYA 2HH9A 5TVKA 2EG9A 5BMVF 1SXPA 2IPLA 4MV4A 1Q1QA 1DV2A 2X6RA 2G4CA 1V7CA 3AUTA 4QGFA 3EDYA 5CFRA 5JS1A 3MTIA 1M8PA 4GRIA 2W4MA 2FH5B 5I8ZA 4HUQA 4WY5A 1PL7A 4JFAA 2JA1A 5KU7A 3BE4A 3N0RA 2EJUA 1O9GA 3GMTA 4Q4HB 4B7CA 1X6VA 3TDKA 3P0EA 2WTXA 4MAAA 5EGSA 4TKMA 4ZOLF 4KAAA 1H3EA 1AV6A 3WGTA 1QRSA 1I2CA 1R0RE 3MILA 1IG3A 4G0OA 1DCKA 1XCLA 3C3JA 4XLZA 1AQJA 1V6CA 5A0TA 8ATCA 1AHIA 1YS7A 1TLFA 2C4TA 2IS2A 2ZRNA 1ZM2A 4NTZA 2VHYA 1WWKA 2PWBA 1QVAA 2ORED 4YUVA 3EPJA 5DGTA 3FTDA 2XSZA 5GJBA 5H8WA 2P9YA 1J1UA 4KCGA 3LCMA 2V45A 2GVDC 3ICWA 2FU5C 1L6RA 4YQYA 3TIGA 4YV2A 4JB8A 1ZISA 3TZEA 4K87A 1L5KA 4OMUA 3RK1A 1L1EA 4JGGA 3RT7A 2QLJA 4LGCA 4TWIA 4TV8F 3WLLA 4RHTA 4GFDA 1VPWA 2V8BA 3W6NA 1T5LA 1J1ZA 3RI3A 3ZE0B 4DGQA 3CE9A 4G9BA 2ZYRA 3EIOA 3MK31 5IT5A 1V8PA 2EQBA 2CJWA 2NSJA 3B1FA 1TGVA 3U49A 1C9EA 2ZR0A 1NT2A 3P4XA 4HSGA 3LNTA 4P92A 4R8VA 2KBEA 3ZW8A 3D8RA 1F4VA 5KOHA 3EVZA 1YCDA 2CEAA 5CA1A 1JTVA 4FGWA 4W8HA 3W6OA 3NONA 1M0EA 2X14A 1N7GA 5LOVF 1ML3A 4TMFA 3QWBA 3OQPA 2PL1A 3VKFA 4CZ2A 5LVAA 5CDYA 4BVLA 1KC3A 3UB4A 4L7QA 2P68A 2BSQA 3CRMA 4M0DA 2OCGA 1OKKA 4RTOA 4PAMA 2IOQA 5EZ5A 5BN4B 4Z7OB 4R71A 4MV9A 1VECA 1M73E 5T6BA 1IDOA 5EPUA 1FLVA 5FHRA 1MQAA 1Z2OX 4LC1A 4KSBA 1F2TA 1O6CA 1V5WA 3I6ZA 4L8VA 5THXA 4R51A 5NLLA 4RK6A 1G64A 2EP5A 2F4NA 2BHLA 4EUSA 3WHPA 1Z7EA 3HH8A 1W94A 2H2HA 1BWSA 3D3WB 3BULA 3Q7IA 1E3TA 5BSEA 1KERA 3KZXA 3LNCA 3CNBA 4ITVA 1H05A 4OD0A 5AM2A 3DOJA 5FTJA 4B09A 3BE8A 1TVEA 5IAKA 2HU5A 4R5MA 5DBIA 2O8FB 4LHWA 1U1FA 1WHSB 3MNFA 4NBTA 4F8EA 5A62A 4EECA 1QKIA 2XUDA 2AFHE 3T9CA 3QVLA 4KGZA 4JLBA 1T5HX 2D2FA 1JBEA 1E2DA 4HJRA 3CW8X 1C29B 4NPCA 3F8SA 1TU3A 4FFDA 3R3ZA 5TARA 2A9KA 2EV9A 3EG9B 2H17A 4PCVA 3Q1KA 1DJMA 4KPYA 5B4UA 4H17A 3SXJA 3LK7A 4QTZA 5EIBC 1L7NA 3ZHZA 2OSBA 1ONBA 1U6KA 2PAAA 4B4WA 1G8KA 5G40A 3WIUA 3QZUA 4HNVA 4P0TA 1Q7EA 4KR9A 5A06A 2BL4A 1V16A 4R3NA 1RFLA 1Z0FA 4LF8B 1HT1E 1YI1A 2BR3A 4XIJA 4OQZA 4PQGA 3SYRA 2NAPA 3DDWA 2DERA 3UYKA 5E3IA 1NJ5A 2GZDA 3O82A 5CXUA 5KTTA 3OE5A 4IGFA 2VNKA 3WGJA 1H6BA 1SVUA 1GV0A 4MI6A 4BX8A 1WKVA 1XYGA 3D3JA 1NQUA 2TECE 4LNHA 4REQA 3AH8A 3TL6A 5THKA 4PW0A 1Z0UA 1AS0A 1A7AA 2Z2XA 5FBRB 1G5IA 1OIXA 4JC4A 4A2QA 3MS4A 1GUFA 3E70C 4XRRA 1LRKA 1SG9A 2V7PA 3DFIA 1I7LA 1T2NA 1VBMA 3N2IA 4JYCA 4W7HA 3N7AA 2WTNA 1DDGA 1X1TA 3TOSA 5B3JC 4QVIA 3RIYA 3AG6A 3AR3A 3JATB 4J4BA 1RHQA 3VV2A 4UEWA 4MJXA 4EBBA 2FEKA 3WFJA 5K45A 2RH8A 4WY2A 5K8VA 3IKTA 1BKSB 5K09A 1QV9A 1EZZA 4M1KA 1IC6A 2BFBB 5JPCA 4CIBA 2FRVA 3JQGA 1ACMA 1G2IA 4IWXA 2JG3A 3LQFA 1PR0A 4YLGA 2H31A 2C9CA 2JKYA 3GQBB 4XJXA 5FBQB 4GVXA 1BGXT 5CLLA 2FCRA 1QGOA 5SZHB 2PZJA 4FI3C 3I0MA 1NMZA 2EEZA 3RC3A 2GOYA 4JLVA 3W1VA 3IR5A 3A1EA 5E7MA 5I9BA 1KI6B 2XUHA 3G0BA 3C3AA 1M7HA 2B3DA 2PH3A 3IBTA 3MVEA 1XZMA 4MTLA 4OHKA 1GIAA 1E1DA 3KKZA 5J5VA 3SHTA 1EVQA 1U7HA 2BF7A 5ELMA 1UKCA 4A6PA 4A0HA 4JSYA 1CUXA 1V48A 4KQ2A 5SYAA 2HA3A 2L17A 1P9NA 3W0LB 2PIDA 3C5EA 4WCFB 5ALGA 1F6BA 2XE7A 2AFHB 3KYBA 3L18A 4CI0B 3K70C 2ZIEA 4ZEOA 2PJRA 1FYDA 1TM3E 1IL0A 1IONA 1SHZA 4IUCS 1ND5A 4UFNA 4O3FA 5DCLA 2QN6A 1W48A 3UIEA 2WW8A 3GJ0A 2JAQA 2R62A 4W9NC 2PXAA 3PHJA 4Z7JA 3I52A 2NYUA 4XR9A 4U7DA 2ZI5A 4ALLA 3CLTC 1IXKA 4JJKA 4E4TA 5I7WA 2NYRA 3ZE2B 4N01A 2KM1A 4J6FA 4HB0A 5FI0B 1UDRA 5A3RA 3IAM6 1RWQA 4NAHA 4OP3A 2HPZA 2DSTA 1TUIA 3QEJA 4XI9A 1NP6A 2IU6A 2HSGA 4INPA 4XB6B 3SJBA 1W36D 1XVVA 2CNDA 3C3WA 5JCZA 3EK2A 5JD6A 4MGHA 3AJEA 3V42A 1YZTA 4KQ9A 1DIBA 1UJNA 2HLDA 4GI5A 1WMBA 1IXRC 2NO9A 3OQIA 2G88A 2BGRA 3QG5A 4X71A 1XTPA 4JI8B 4BV2A 1WNFA 5GOTA 2P3QA 4ACAA 4EA8A 3ITEA 2BFOA 4EHNA 2BMVA 3ZNPA 5IJ9B 1Z2CA 4TTTS 2QP9X 3CEJA 3QKIA 3KUDA 1DWUA 4BNLA 3PICA 2D8AA 3DO8A 3LDGA 1T34A 3C4JA 4G1EB 2XQFA 4LW8A 4WKCA 2P6OA 3FB4A 2D0OB 3H1AA 3DKPA 5GONA 2Z2KA 2MR5A 3HVKA 4JB3A 3SFZA 1NXWA 3KYIB 1QQTA 1Y80A 3AYZB 4UU0A 1ULUA 1L5OA 4LC9A 3FFAA 3R7NA 2AEFA 2FPKA 3OUUA 5ILGA 1EJ6A 4ZYWA 4ZZ0A 3FPHA 2VA8A 1X2BA 4EA9A 2WIKA 2WQZA 2LVBA 2YCLA 2ZZMA 2VRCA 1LPAB 2W6JA 1YZVA 2WIBA 4RCYA 4UBNA 1OI2A 1CP3A 4RC9A 1PJAA 3OUZA 2BMAA 2VP5A 2FPWA 3N2KA 3PUHA 4NCIA 1NVKA 1ZJJA 2GYUA 1N5IA 2P9GA 2XTJA 3A9WA 5DE3A 5IAAA 5E7QA 1F0PA 1KK1A 4FEEA 2NZ2A 3WNZA 4BVEA 3WE7A 3DOHA 1P5JA 2VK1A 3WLFA 3ZWXA 4U39A 3VHXB 3W2HA 1JN0A 1QX3A 2Z4TA 3UYLA 4GM4A 2GHRA 3HDQA 4KN6A 3FBGA 2P9FA 1T9DA 2AZDA 2CXRA 2C9MA 3Q10A 4HDRA 1NN3A 1CUEA 2WG0A 3N6VA 5IUJC 4OLBA 4GR4A 4TKVB 3WYCA 2ZITA 4RIEA 1E3EA 3X2EA 4D56A 4X7RA 4UBJA 5A7HA 1P74A 1AK2A 4IQ8A 3ZWVA 4IMIB 4QU8A 4XEHA 2F00A 5BSKA 1KZ7B 3GNLA 3GPBA 4U2KA 4WOKA 3DE1X 4P32A 4DTCA 2O8EA 3W5AA 2H1WA 2ZIXB 2GBPA 3FLBA 3QE2A 3UUGA 4DIOA 1REQB 4OHBA 4K7JA 4BNKA 5L6LB 1CNFA 4FOSA 4ZCLA 1EZ1A 4LA4A 4B2YA 1B00A 3KIPA 1HG1A 3UENA 3DFFA 1Y4AE 1YZNA 2M98A 4FLMA 5DMHA 3T12A 2P9BA 5LU8A 2UYOA 2O48X 2YICA 1RAEA 2VDRB 1ESNA 2CFTA 3F9IA 2XNHA 4Q12A 3TKYA 5KC8A 5EOVA 1E2QA 2L42A 3BJIC 4UU1A 1Z5PA 3EQ8A 1R5NA 2Q3BA 4P4LA 1LPPA 4MKRA 2VEDA 5HOQA 5FOVA 4DMFA 3DZ8A 1POXA 4DIUA 1G1MA 5KQSA 1ZIYA 4D0GA 3AUFA 1LI4A 3CT4A 3KDPA 1L5RA 3GEHA 4MI1A 5HJ2A 1FVXA 4L0QA 3L4SO 4ENRA 1ID1A 5DASA 1U9IA 4QUGA 1XMXA 4FGKA 4LDAA 4W5JA 1ZITA 4DT1A 2VXOA 4MV6A 3WKBA 1BAPA 3M89A 5CVDA 4YP9A 5K3FB 2Q0XA 2JFUA 1CF2O 1W47A 1ZGZA 2HBYA 1DIAA 3C3KA 3I6YA 3IQEA 3JPYA 4FLFA 2FUNB 4LJYA 5EIFA 1ZO8A 1IZYA 4G24A 1NBME 2R1TB 4FMBB 2Z56A 1JI3A 2O0LA 1UBRS 1XCJA 2AJTA 2JFFA 4G0NA 1J8VA 3ZDCA 4ZVSA 4WUTA 3E5HA 1G3QA 3GR6A 5A5FA 5EJ4A 2Q07A 5AVXA 4IIJB 1E63A 4YB8A 2C2ZA 2QRHA 3G2HA 3MB8A 3SK0A 4BCCA 1SVWA 3OC6A 3WGKA 4ALKA 1FX0A 4KXFB 2EFEB 3T41A 3H18A 2ZRPA 3NRBA 1IZ9A 1RACA 1LDMA 2QKYA 4QE3A 3EGXA 3FSRA 1AGXA 1ZMXA 3SFVA 1YASA 2YWFA 3DPIA 3BJEA 3EBOA 3F5MA 3AL2A 2ZRKA 4UNSA 1KFEB 1P9WA 3CV3A 3VHRA 5JQGA 1CLUA 4ZOQI 1L7OA 5JHHB 1Y9AA 4OKNA 4PHTA 3RRNA 1SFRA 2V7UA 5CB8A 1XIVA 2RFLA 3Q4GA 3KQVA 3V48A 4AO8A 5JXWA 2Q3JA 2IZ5A 2LCIA 1RXSA 2C61A 2ZYWX 3SJUA 3QKSA 3A28A 4LJKA 5TMDA 3ERCA 1JDNA 1YXMA 2J48A 2PNFA 3HYTA 6PFKA 4IHQA 4L9RA 3KKEA 4M88A 3SEQA 2OORA 1SKQA 3OT4A 5KYVA 4UUBA 1DLIA 4ENPA 4MVYA 1BVHA 1ZJ4A 3G82C 1BYUA 2PH1A 3GAZA 2ZTVA 4HTAA 2AOXA 3F73A 2WWIA 4AZWA 1B0ZA 2ZYUX 5LPNA 2IPXA 1K8RA 5BWBA 3DD1A 4UHHA 1L4YA 2W6QA 1KK3A 2IHZA 3AEQB 3UMJA 3JTMA 3D54D 1TVMA 2VSXA 4FT4A 4HFNA 2H3HA 2JNWA 1VC2A 1DHRA 3GYBA 1Z2DA 3QENA 2OKGA 3E05A 1KARA 4EENA 1MV8A 4EF5A 4LXXA 1OFGA 2DT8A 4B7ZA 2OFWA 4BASA 1RS0A 2AE2A 1Q83A 2BFDB 3PJFA 2VBFA 2VPWA 2XNDD 2XGSA 4MH0R 2Y1EA 2OR3A 1L7BA 1U2RA 2QNBA 3CG0A 3H7IA 4B0PA 2NVWA 2TMDA 3FWZA 4UCWA 3MJHA 4CGYA 4YQZA 3EWNA 3OE7A 1Q5PA 3LA8A 4IDHA 1QOZA 3FUTA 4ENUA 1AO3A 1BQ3A 1NW5A 3HN7A 4XB2A 5IPFA 4BDTA 5KMGA 2DZDA 4IXDA 1LBHA 5LZ2A 5K0TA 3THYB 3CEHA 3HY3A 4KDRA 5ED4A 1R3DA 2Z6AA 2D1RA 1QRAA 2RI1A 1AD2A 3FUVA 4P22A 1U81A 4Q9NA 5CNMA 3STWA 5IKOA 2ERXA 3G8CA 4D79A 4DC9A 1X94A 2IHTA 2CB0A 4E32A 1WZNA 4JS0A 4G9EA 4MVJI 2ZM6B 1G7RA 5CGQB 1VGRA 2ZRBA 1YQWA 3CLRC 4I3GA 4EL0A 1G8GA 2OGZA 2RHTA 1M1YA 3IAXA 2GTIA 2CDBA 4RA6B 4U2CA 3QFFA 1LSSA 4NFYA 1F0NA 4CG1A 1UDAA 1GTMA 2Q29A 3NBFA 1PZHA 3MTAA 4QGAA 3A06A 1W75A 1SVIA 1Y9JA 2JATA 1YQQA 1ZH6A 2YOHA 4NOMA 3GLGA 2AV6A 2O7RA 1G8JA 2JFXA 3AGPA 3QVOA 4K9RA 3ZCQA 2ZEJA 1XDWA 2C97A 2PUTA 2XDQB 3OLXA 2RKBA 1RBZA 1LW6E 4JK3A 5CXSA 3TDMA 4BO2A 3Q8MA 4LAFA 1VL6A 4JLDA 1J2TA 1X42A 1FNDA 1NX9A 1BH2A 1ULZA 4QJ5A 1B74A 5AIAA 5GPBA 1V8OA 5IC4A 1RLIA 2Z2ZA 1M6YA 3VGPA 4CLRA 4G63A 3SF8B 1CK4A 1NA5A 4KVFA 4NZ9A 2O05A 3FYUC 5JPIA 4CTJA 5TRTA 1UIMA 1YMVA 3HCPA 4ZVVA 2P2SA 1KY2A 3ZNNA 1VKRA 3OT1B 2XQJA 3F6YA 2PMEA 3SS8A 4XE5A 4OGKA 5KQRA 4ZTBA 5DX1A 4ZKDA 4Y9RA 1K86A 1GD1O 1B8VA 2ATXA 1TJ3A 2FQXA 4G25A 3ZU6A 3LGSA 3RABA 4BS9A 4UNNA 2FP4A 2WT4A 1F9AA 1P5RA 2NPOA 3HP7A 3LY7A 4UU7A 2KHZA 4XJTA 5H02A 2ZUFA 2FHPA 5H3HA 4TYWA 1LLCA 3HXKA 3MGGA 2SKCA 3GOHA 3UVEA 4FC7A 3NHUA 4INOA 1MC5A 1UK9A 3UJCA 3ADKA 1XRRA 2WTMA 3ZK8A 1O96B 3N8NA 4C0JA 1H5QA 2X0JA 1UFKA 3AFOA 3QTLA 5I8WA 1GWNA 1KVTA 4XX0B 5GIOE 4LS3A 2BFFA 3K5PA 4KXNA 3P26A 3EW9A 2QEQA 1I36A 3IOEA 4C0AC 1BHSA 2F7SA 1W76A 2HRBA 2PX2A 1Z68A 3E4CA 3PPWA 4KQ6A 4ZYTA 1W59A 3KJIA 2OXRA 1BXGA 4F3TA 5DN6D 4EI2A 3KT0A 1V5FA 3MBIA 2VYFA 3DKKA 4N3NA 3ROGA 2HUPA 3IKMB 3PA6A 3U4AA 4LBYA 3L7LA 1HRKA 2CDNA 2V7XA 2FXIA 3AJDA 5E7JA 2ONYA 1PYGA 1EGVB 2XKKA 5DHAA 4EPRA 1CS4C 1QTIA 3UG7A 2OGTA 1SBCA 1XMSA 2VAXA 3BB4A 2G06A 2FZ4A 2AOTA 3DAGA 1XZCA 4U7HA 2GD0A 1DLJA 4PPYA 4PAWA 4YJGB 4XD7A 3E27A 4EIWA 2HV8A 3Q9LA 1MXHA 4P2GA 4ZCSA 3T3DA 3PKZA 1W73A 3GBVA 3AF3A 3UJHA 3ZIDA 4CUKA 4DUGA 5JZ9A 3QU2A 2F55A 1OU0A 4LY3A 4DBVO 3ZW9A 3DXXA 3HR7A 1EX6A 2W2VA 3IIKA 2OESA 3ON5A 4NYIR 1UDXA 3G5MA 1X92A 4TKZA 4BKQA 1WNTA 4NZMA 4UTNA 3DBVO 1QYWA 1PAUA 1P1KA 3KTFA 1SR8A 3RBXA 3DMHA 2X23A 3QH4A 4FKZA 4RZ2A 3TQOA 3WHLA 3DYBA 1RQGA 3ILSA 4EMUA 1KEPA 4YHHB 2H0RA 1GL6A 1Y7PA 2VTVA 4HFRA 3CRZA 4LYAA 5D00A 1Y7IA 4AULA 1G4AE 2I3GA 2PEZA 1XPJA 3CUYA 621PA 3B3FA 3VU9A 1WETA 3D43A 3WMGA 5AKZA 3PUVA 2PKQP 5FCDA 4B40A 2OO5A 4IIDA 2C5SA 4LOHA 3DMNA 1O0CA 1W5AA 2QPLA 3B78A 4DL9A 3OMWA 4BQQA 3PHCA 4DIMA 5DYNA 2FGJA 3RIMA 1ZHOA 1SD2A 4L4YA 2UXCB 5J2UB 1H1TA 1U9ZA 4BNMA 4ZI7B 2WHPA 3PV0A 5JZOA 4YV7A 1QGUB 2WJYA 3SYLA 5A9TA 3QQ5A 2WZBA 4N65A 1XNQB 1XZPA 3LHKA 2OBMA 1ZMRA 1E96A 3OO0A 3DTVB 1I3KA 2WFMA 4U6QA 1NG9A 1E8NA 1PEDA 1C4OA 5LXTF 4PG7A 4EITA 4S3MA 1HKHA 1ZVMA 3A1UA 4F8JA 3I1JA 2PEYA 3KSUA 4H6XA 4TMWA 3R3SA 3PVSA 4C4SA 2CSXA 2ZP1A 2E82A 5KHOC 1VOTA 3ABRB 4IFIA 4CKEB 2CV0A 1V2GA 3QUCA 5AVZA 1KYTA 1GCIA 4QQFA 4JP8A 5CMLA 4UNRA 5BV1A 1D8TA 5IDYA 1PVOA 1J2RA 2I4TA 1A9XA 4JI2B 1GYQA 3MERA 3QOWA 4FWTA 4PRLA 3KD3A 4CR7A 3KU1A 1RTTA 1QORA 2GSDA 2V7WA 1K6MA 2Y9PB 2FW8A 3RVJA 2QVYX 4E88A 2IH4A 2RGEA 2IXEA 1OGIA 3TRDA 5EJ7A 1SVLA 3NAQA 3L43A 3NP7A 2I2WA 5DHTA 2OOSA 1I4OA 3O6VA 4RORA 3MXOA 3PNKA 3PK0A 4LWPA 1YZGA 3VX3A 1XI2A 1KDPA 1TYAE 2B25A 1F48A 2RGDA 5AKJA 1M1XB 3TZ6A 2A9JA 3L8DA 1JPVA 1SVMA 4TL7A 4ZC1A 1JTEA 1RI1A 1STOA 4JASB 1EFTA 3W9BA 3LC1O 2FW9A 2HMYB 1P7CA 1NKSA 1W0JA 3CW2A 3KHTA 4JP2A 1YH3A 5CB4B 3NYIA 1WU8A 4YMTA 3JYPA 1JBQA 2WVGA 2F1KA 3VR6H 5I7OA 4DUYB 4LKOA 4EB0A 3HXPA 2HHCA 1HDOA 4HRYA 3L8EA 3TPCA 2ZBFA 4PQEA 5L3VA 4Y9SA 3L05A 2PA0A 4CG3A 4E94A 4JMLA 8LDHA 1F8GA 2E49A 2HV9A 4W6QA 2ZXFA 5EP1A 5CM8B 1V4BA 1PJQA 1CS0B 4UEQA 2AMLA 1BA3A 5AO9A 4FFBB 1M8GA 2QQFA 2Z1DA 4JBYA 4LYYA 5C35A 1DCFA 1GARA 1SMKA 3ZHOA 4NONA 2RAVA 1JHVA 2Q0SA 2AW3A 1QK5A 1RWBA 1P39A 2RHLA 2RSLA 4NATA 4I2VA 3RU3A 5IFKA 2PX6A 4I4TA 3K70B 2ZRAA 2BM0A 1NFRA 2XCIA 1YJ5A 2ZRHA 1PR4A 4DCGA 1LK5A 1OA1A 2PWAA 4BKOA 4EBFA 3H5AA 3HUDA 1RM0A 5I7UA 1FNCA 3ORFA 2FUCA 1EPUA 4MIKA 2FSVC 4BJ6A 4F3NA 1J8YF 1UBCA 4UTPA 5JYDA 3FCCA 2V7QA 2W6OA 3GGJA 3EPPA 3EC2A 3QLVA 1H9BA 2YV4A 1JDZA 4YRAA 1E4EA 1N77A 1H22A 2OP0A 1YVUA 2P40A 5B3KA 1KMQA 3FOBA 4CMEA 3HCNA 4L5YA 3P0JA 1KETA 1HDRA 1MJ5A 2L2QA 3E1KA 3GFQA 2IPMA 3BIJA 4BFSA 1GPBA 3GA5A 1E3WA 4BTEA 5B1DA 1Z74A 1S1MA 2GESA 3DH0A 4CF7A 3WLAA 2WWHA 2AQIA 1UBNA 3UXEA 1AQLA 3HYSA 3RYFA 2IZ6A 4ESVA 4MIYA 4MV7A 1SWVA 1UXHA 5HR5A 1Y3DE 2GA9A 1ZOOA 4YFVA 4QL3A 3Q8LA 4KV9A 5DULA 4KX5A 4QDUA 4IVNA 1YVDA 2H1HA 1ZSYA 1OZ0A 5LA6F 4QDKA 4B48A 1UIRA 5CT9A 1DELA 1RXYA 4HEQA 4CV2A 1HSZA 2J45A 4NFHA 2EP8A 3OU6A 1JDSA 2FPIB 4AICA 2EFYA 4IIXA 3DLPX 4J90A 1OBCA 1YJQA 2WZDA 1GCOA 3IT0A 2ZVPX 3L7BA 3NALA 1FFHA 3T15A 4JLWA 1MXFA 1PUJA 3GJXC 1SQ0A 2EIHA 5ILQA 4IEEA 2VJMB 3A3NA 3PF8A 4GYWA 4EG7A 3HEAA 4FS8A 1AKVA 2IXTA 1MJGA 2WD8A 2PPVA 2P6MA 4X64B 1OXBB 1YQGA 2GI4A 2QR3A 4PSVA 4LE0A 4Z9FA 5AH0A 4U2FA 4BFYA 2GYYA 3QEAZ 4IKEA 3TXYA 3OO1A 4GUAA 1L7DA 3MFQA 4DV5B 2SKDA 2OAGA 4RTKA 3A37A 2QVZX 3U6BA 1D1TA 4DJAA 3M6UA 2HDNB 3CPHA 1X80B 2GYVA 3T1NA 2OV1A 2QMQA 3EAGA 2BBSA 2G04A 2ILTA 2WFZA 3MWKA 3HPRA 3ONDA 4V0LA 3NT5A 1U99A 3DG9A 4GPIB 2YFQA 4RZUA 1VLJA 4PLVA 1PR9A 1A7JA 3WWZA 2JLSA 1O9HA 3O8DA 4RXMA 4EW2A 4DLRA 1RYZA 1J5XA 3D9QX 3RWMB 2VC2B 3HYLA 2CLLB 2C07A 2CMGA 3W34A 1RHKA 4NH0A 1XTTA 2ISSD 4OO3A 2XB9A 1CSEE 1X7XB 3DF7A 4MR8A 4NPAA 5HQTA 1XPOA 3O1IC 3KOUA 4S0ZA 4M9CA 3JQAA 1H6CA 2FMXA 3SYTA 2GRUA 1OI7A 5SZKB 1T6YA 3PGKA 2ROQA 4B6FA 2Z57A 2PQ2A 3EGCA 1C7ZA 1YSCA 3NWJA 6ADHA 3P9CA 2HBQA 3JU3A 1QBKC 4C01A 5U1PA 2GILA 4MRAA 2NM0A 3MWJA 2PUBA 1FLDA 5I7HA 1W4BA 2O9JA 5HKBA 2WM9B 2HSEA 3BRSA 4Z4QA 3HM2A 5HRCA 1K5DA 2H1SA 2RCYA 3MTBA 1A0OA 1EXWA 1R4MB 5BWMA 3OOYA 4WNCA 1LI7A 3A1CA 3MWFA 4KR3A 4L8WB 1NF3A 4KACA 1NUTA 4U8GA 5JRZA 5K03A 4ENWA 1MO6A 4D6YA 2Q4EA 3CR8A 1BX3A 3EDRA 4MS3A 4N0PA 1GUZA 2C99A 1R12A 1KQNA 1EUDB 5LP6C 4QATA 4C5CA 4FOPA 3TCXB 4BNDB 5EE5B 4NEHB 5T3UA 2BHRA 1CT9A 1ZUIA 2F2TA 1E9FA 1VYVA 2EL9A 2X1MA 1WBJB 1QR6A 2GVNA 2X8JB 4QT4A 4MQLA 1R0YA 4M8SA 4KI7A 4Q3CA 1NUPA 1M74A 1KYYA 1QIIA 1U94A 1WO8A 2XI4A 4NF2A 2FG5A 2HA5A 3BILA 3EMKA 4EVIA 2QQ0A 4Z0TA 3G2LA 4LHVA 3FNBA 1Y3HA 2YIMA 4Q4LA 4EJSA 2BGGA 3KLMX 1RJEA 3I37X 4M9XA 5IN5A 2F1RA 4OH1A 3K9CA 2ZUEA 1JB9A 2GFHA 4I8IA 3HS3A 3N2GA 1V5EA 2ZAGA 4E5VA 1VBNA 1QP4A 4H7DA 1GPDG 1HYGA 1H2YA 2QVLA 3C3PA 3R5TA 2D2IA 4Q3LA 3PC2A 3SIWA 1DOHA 1JI0A 1Z0KA 1AXEA 1Z8DA 2G8NA 2QTZA 4LYGA 3P2JA 5HZHA 3UOGA 2CHUA 4RQBA 3ZBTA 1SIOA 2EF1A 2QZZA 2QYHA 3CSUA 4KOEC 3WGGA 3WRXC 1NOKA 2VPZA 1TU4A 1M10A 1P73A 5ESDA 4BUZA 2ACVA 2EBUA 1JHPA 2C2XA 5IAJA 5AM1A 2BUAA 1BE1A 4KQGA 5TNXA 3VU3A 1Y7TA 4KZPA 2E4AA 2XYHA 1Y5IA 2PKRA 4LSZA 3IQDB 1TW2A 3SZ3A 2VDMB 1VPVA 1Y6QA 1GP2A 3ESZA 4JI3B 1OXMA 4EO4A 5LD2C 2YMLA 1U0FA 5EWJB 3USZA 4G0WA 3FKSA 4LI0A 2Y1LA 1EVZA 4RDIA 5E6SA 3C7DB 4YP5A 3TAUA 4L9WA 4DCOA 4UUNA 4CMGA 4E1BA 1H3FA 2PS1A 2QVCA 3BGOS 5DYTA 3ZCTA 1R5OA 2WU1A 3PD7A 4JROA 1KYQA 1I4DD 2XA1A 2V74B 1DKOA 3KR1A 3MCUA 2O2GA 3ST7A 3T5DA 5HHTA 4JXJA 3T3EA 1B15A 4GMFA 3KQPA 3EH2A 3I6QA 3WJ1A 3WYEA 1I1QB 4HT3B 2IF2A 5JH7F 1USUA 3BL5A 4R1PA 2PH5A 3M2PA 1P4HA 1T8RA 4Q9KA 5ADHA 5L53A 1UMBA 4C4PA 2ZB4A 3VZBA 5FEUA 1PEAA 1HQYE 2MIIA 4TV9A 4YH1A 1WCV1 1W5TA 2HT6A 2YXBA 4P7GA 3UXHA 1X70A 3AK4A 5DF1A 1LTHR 3RFFA 2XDAA 4G9GA 3L1UA 5BSMA 2OM2A 5JAQA 4ZEMA 4OQYA 2CLIB 4P8RA 2PGOA 3OFJA 1X74A 5AK5A 2KBFA 4JUIA 2HJGA 3NBKA 1XTJA 4LZAA 4S1NA 2XMCA 3H5IA 2HQ1A 3AEKA 4L08A 4OBBA 2WFLB 2Y9MB 3GDFA 5EE3A 3S1AB 4L02A 2AMFA 4D80A 2D4HA 2QMOA 3BH0A 1RCTE 4HVTA 1EXDA 4TQAA 3ZDDA 3M83A 4G41A 4G4IA 3E5NA 5CCDA 5LZ9A 3DE7X 4EHKA 3CX3A 1RYYA 1UOQA 2OV4A 2G5CA 1J4AA 5JBQA 1A69A 2PCJA 1GPYA 1JJFA 2FHSA 4ZCQA 1FVOA 1A98A 3UBMA 2YJTD 2RG7A 1J2EA 3D2CA 4GX0A 5BR1A 3BSFA 4PQRA 5HQ3B 3DLBA 5JYBA 2FMIA 1N78A 2VH1A 2DBVO 2IZ7A 3EB9A 3W1EA 1U2GC 4XYMA 4A03A 1YZYA 2FK7A 2PUFA 2P9CA 3QTTA 5HZGA 4LYDA 1A8SA 3PJGA 2JLZA 1UDBA 3I92A 4REOA 4L4SA 5F2OA 2Z9CA 2AN3A 5AM4A 1DT3A 3H9EO 1E3MA 3FYUB 1FYVA 4M7PA 3TQHA 1JT2A 4G97A 1XJQA 3U3MA 1WZIA 3ZV3A 3GP8A 5DLYA 2ZIFA 4NZZA 3VR4A 4EG4A 3KTAB 4AW9A 3JQDA 2YJ3A 2VI5A 4FHZA 4EY6A 1RBQA 1W93A 1WQ4A 4QRIA 1DU4A 1CUAA 2O0HA 3QKWA 2Q3CA 2P41A 1CUZA 1V25A 4ZXFA 3SZLA 4LJSA 4A0QA 3W9YA 3ASVA 4C03A 4J1TC 1EAMA 3FTQA 5EQFA 2QQEA 3L49A 4G5XA 4WA7A 4R2JA 1D5WA 1CCWA 1DX9A 2FFQA 4FW9A 3KJXA 5EZYB 5L6MB 1YO6A 4YCBA 3OX2A 1O0SA 2BMEA 1K88A 3LAWA 4UBKA 4C1NA 4D82A 5SZJA 5IK2D 2Z6UA 4YP0A 2WSMA 4N7BA 1XTQA 2Y6VA 3RJ9A 3A6LA 3OWHA 5TXGA 4XWOA 1QXSA 3T99A 5EIEA 2ODEA 2JI4A 2J0EA 1TK9A 4REMA 1HFKA 3OZCA 4ENTA 2V1XA 3EXEB 4F1WA 2PT7A 1YVPA 3U19A 4AUNA 1T9CA 4ZGBA 4O2AA 4X1KA 3I2JA 4RVCA 2PO7A 1NRJB 2ECOA 4RADA 3WXMA 3BMCA 5KQGA 3RAJA 3KJFA 1J24A 2WWRA 3CVJA 4LOJA 2IP1A 3HHEA 2VWPA 1XJCA 2B83A 3T4XA 2C94A 3S3TA 1M72A 1DC3A 1SURA 1XC7A 2OFXA 4AJ2A 1GHTA 1UBJS 4U6SA 1D7OA 1SIBE 1N0UA 2DHQA 3CTPA 3RUFA 3S99A 5J1TB 2ORIA 3AWDA 3QMPA 4HH0A 1XWFA 2CXSA 2V7VA 1EH5A 3THWB 3K5IA 3W8RA 4BGEA 1TUBB 5MN5A 3K8YA 5D87A 1JQJC 1MRZA 3E22B 1G59A 3VYSB 2QRVA 3KQQA 1QH9A 3Q2OA 4BJHB 4CKCB 4BKPA 3NTXA 2O8NA 3ME5A 1G18A 2XMRA 1J9GA 4QT0A 4UMFA 1PS8A 2W4IA 4FT2A 3RSLA 3BD6A 4WESA 2FWAA 4YCDA 1TT5A 2WMYA 1OV4A 2R7KA 1TL7C 1XQYA 2I2DA 1OX4B 3FGPA 3DBOB 1KJWA 3F1LA 4MYSA 4I36A 3L0IB 1ZIXA 1CZRA 3AJRA 1CW2B 1PCXA 5JVDB 3WK6A 1CYEA 1PWEA 1RQPA 2W2KB 1RJ9B 2ZJ5A 1KR5A 2WD7B 4F46A 5JXHA 4JR2A 5JZMA 2I2FA 3L0DA 4B8WA 3NAMA 2IP4A 2QQGA 5KNDA 3V4RA 5FA6A 3BE6A 3ADPA 4RK1A 1L7PA 1YHNA 3RYIB 4ZGGA 1DTSA 3E0XA 4GVPA 3SS9X 2BH9A 3TWOA 4D1YA 3HJAA 3TR5A 1KYVA 3COPA 3M82A 3F4KA 2LGJA 4E03A 3N6RA 4GQBA 2HYIC 1NY5A 4FHGA 3UMMA 1RBMA 1AKNA 1E6EA 1R66A 2Y0CA 4KLNA 2ZJ6A 4L6IA 1Y4UA 3D0OA 1RAGA 1WW2A 3UK1A 4DCNA 4CKXA 5KWIA 1CNMA 1TLLA 4FGJA 4H3SA 3CZQA 4QFBA 4Y0AA 4ME6A 2UU9B 2QRUA 3QNMA 1LPSA 1U1DA 2GD1O 3AESB 1YUNA 4TKUB 4EHJA 4F9GA 4HZGA 3TQSA 3I32A 1NXTA 4MKZA 1DUIA 3GA0A 2KS6A 1KQPA 5FWYA 5HG0A 1GVHA 4B47A 5CEEA 4BNHA 1JS1X 1I0ZA 1X13A 5IU6A 3R9WA 4O4JF 3DDSA 3I53A 1TECE 4TPKA 2GRJA 4BLWA 1FP1D 3LWZA 1LF5A 3PNQA 5EJMA 1S2GA 3BWEA 2AUMA 3AR6A 2QX6A 4MQ5A 4ZTUB 1K6IA 3U81A 4DMMA 4W99A 3S5JA 1RLJA 3U1TA 3MTJA 1Y5MA 2QE7A 4FHCA 5BUCA 4YUZA 4X8OA 3E3LA 3TZQA 4HGQA 2P9HA 2WF9A 3NDJA 1LCIA 2PS9A 5IHPA 2OECA 4DIBA 4TL9A 4UW9A 4FYHA 4YEDA 4CFZA 3AMVA 2CHGA 2ZKIA 4PV7A 3AVYA 1NN0A 3K9GA 4UM7A 3GPLA 5C5EA 3DFKA 2VZ0A 2OLKA 1Y9DA 2I8LA 4LSMA 4ND8A 1DKPA 1QANA 4KJXA 4ZU3A 3LQ2A 1QNFA 3UMGA 1ZU4A 1LU9A 3VR3D 1KH2A 1QH0A 1T3LA 4U9IS 3WGNA 1QF7A 5KNCA 2YY6A 1JJIA 2HIAA 3BWCA 5J2TB 2IDMA 2IGTA 1JG4A 4OLHA 4IQ0A 4URHA 1WUIS 1YF3A 1GL7A 1QF6A 3EDOA 3WV5A 1FQOA 4W5HA 2RGBA 4DRZA 13PKA 1LWNA 1JHOA 4GP7A 1H2RS 4AN1A 2JZOA 1I6KA 1T5BA 1XAJA 3HEBA 3ENQA 4JXXA 1WS6A 1HT0A 1NURA 4FFSA 3BMQA 2VLBA 4G07A 1KJQA 3OH8A 1JZTA 1PGNA 4TQGA 5FO0A 1LPNA 2CK3D 2C00A 5H3LA 1MX1A 3H17A 3IO3A 3MMPA 3ROTA 5JZBA 3GCGA 4H3HB 4MROA 5KX5A 1GDHA 2DWUA 3H9CA 3UK7A 3WIOA 3G68A 1DJNA 3OQ1A 2DQ4A 5CFOA 4L72A 1IIBA 1W581 3B60A 3TG2A 3NVMB 3LH5A 5IW8A 3RS2A 3X1WA 4QXPA 2O19A 5DXJA 1PX2A 3SZMA 2OB1A 2IOYA 4KQJA 4PSKA 1IUOA 1KQ3A 1RWPA 2XXAA 1BD3A 1M2OB 4GRAA 4MKFA 2C4HA 3A9UA 3HKBA 5J5CA 4EMSA 1G20B 4IDPA 1U80A 4OJNA 2GEJA 3OHPA 4OBWA 2WT9A 4Z0PA 1PNOA 4QICA 4YPVA 1OX5A 3NUZA 4ZPXA 3K0AB 4Y1FA 2PH7A 2ZJAA 1VJ1A 3RF6A 1T1IA 2C5EA 2ZM5A 1D2RA 2PUHA 2W43A 3EW7A 1EBUA 1VHWA 2C42A 1DSSG 3VPBA 3C5HA 3P27A 1TVKA 3B2EA 4IJ6A 2XLBA 4X1YA 1TQ6A 5KYKA 5AXCA 1TEZA 8MHTA 3E1GA 5ECWA 1P9OA 2FWNA 1I10A 5LC1A 4ZYZA 2BFEA 4I1OA 1LW7A 4UNQA 3FSEA 3T61A 3WRYC 4BO6A 3INRA 4JI4B 3P9NA 3LC7O 4R2WA 2P67A 3NHWA 4BTVA 4JOBA 3W9SA 1KO1A 2AKEA 1GZ3A 5JNTA 2OLEA 1Y1SA 3SXUB 5KKCA 5IVPA 4O3MA 1W85A 3BF8A 4P6VF 1WMFA 2IYVA 3D7SA 2EG5A 4M53A 1JDTA 1YS4A 3HSSA 2VDKB 2XNSA 2QXYA 3M8KA 4II7A 1QH1A 4OFBA 5CX4A 3WTBA 4EGCB 1MIHA 2OB2A 4L15A 4UUOA 4KLZA 4P7JA 3SQMA 2EDCA 1TRHA 5TEWA 5JNUA 4YROA 1OWMA 4NZNA 3R7DA 1O97C 2BKXA 1GY8A 3AI7A 4L5CA 3UXYA 4AK9A 2ZS8A 5D51S 5G4LA 4ADSG 4XYLA 3ETNA 5SZIA 4WCDA 3GJYA 3T7TA 1U31A 3FVQA 5CB6A 2J41A 4B7UA 4MQEB 2NWQA 3TB4A 3W8FA 4MOWA 3E61A 3HDJA 3B6KA 5E0OA 3ZY2A 3U2QA 5GTDA 1FF9A 4MI3A 3RG8A 4BO9A 3NIWA 3CNQS 5TQVA 1IMOA 3NM5A 1KRWA 2G63A 1VZ2A 1H1LA 5M7EA 4WFQA 4MB0A 2YVAA 3SSAA 3OQHA 4PN3A 5H80A 1WHTA 3A6DA 2QM3A 2P6PA 1JAIA 2ZRGA 1W6RA 3IVGA 3T9AA 3UJBA 4F85A 1H69A 1QGDA 3WZLA 1C8BA 3VVBA 2XXBA 2QROA 5CDGA 1LGYA 1H0SA 3ZHRA 5JR3A 4A2PA 3R5HA 2R2AA 3ZZNA 4HTFA 1XVTA 3IVAA 4DDUA 1R6BX 2D1QA 3AHEA 4HZUA 3SHFA 2ZQ5A 4O0MA 5HP4A 2IY7A 3UOWA 1JFFA 2HPHA 3RTGA 1QGZA 2BBOA 4TLMB 2NVOA 4KFRA 2AT1A 5BN5A 1Q91A 1UXOA 3ACCA 5F5LA 5F77A 2V8OA 2P0YA 3SX2A 4B74A 4JYZA 2RGYA 4C6RA 1C8KA 1GZVA 2G8LA 2OY0A 3CFYA 2OHXA 2H63A 3OPQA 3P8ZA 3U3OA 3VU0A 2QRQA 2XAAA 2WJ3A 2XZTA 4RCVA 1QG2A 4IINA 1SD5A 5EJ6A 4WV3A 3OM8A 5AVYA 4COKA 5DRYA 5ALIA 2FV8A 3QEKA 2CNKA 3IBFA 3ZQKA 3CZCA 5LP6B 1V8DA 4FOLA 1AIPA 2WG2A 4MICA 1NW9B 3V33A 3WQHA 1PG2A 1OILA 2VO1A 2VS1A 6NULA 1M76A 5IF3A 1QTQA 2Q2NA 1ACLA 3NRCA 4X97A 3TOZA 5KTKA 1RZVA 4AG6A 3BYZA 4Y1EA 5TR9A 4P31A 5EI5A 1RIIA 4ZDIA 4UOEA 5CRIA 4D81A 3JQCA 1GUYA 4LE2A 1Y3IA 4YT5A 3TPZA 4CQMA 4E4YA 5C8YB 4R31A 3NHYA 3BK7A 2XYRA 3VYUB 1TNDA 2FG7C 9MHTA 3O3NB 1TXGA 2J0UA 1JH8A 5IFLA 3ZV5A 2Y2UA 3VZRA 1RWKA 4LHXA 1TO6A 2O4CA 3D4BA 3O8NA 5ERXA 3MGKA 4GC5A 3LBFA 1OYOA 1RWWA 2CNWD 2CF6A 3GUVA 4H7PA 3A2MA 5DKFA 2VYVD 3EYWA 2C2OA 2A1TS 2HRCA 3MHPA 4MUIA 2XF8A 4P5DA 4J91A 1D4ZA 2REXB 5DJ5A 4EP1A 5T8KC 2K2WA 2ZRLA 3D2AA 1DJOA 2ACEA 4I1YA 2AHOA 3U7IA 3PXDA 3II6X 1U4NA 4QQ8A 1U3FA 3R5XA 3CIFA 3FDZB 5CYGA 4J16A 1GQYA 2HF9A 2XEXA 4K3VA 5TQ2B 2GGSA 2HCTA 2PXXA 3QGMA 5TGDA 5AM3A 2F8TA 3AKZA 1Z39A 2YMPA 3ED5A 4EA7A 1VB5A 4OP2A 2IWHA 4L50A 3PWZA 1JKJA 2WU8A 2GJSA 1N4AA 3ZKAA 4B4DA 3HTXA 3DV2A 4JHXA 4UHCA 2Z6QA 2A7QA 4WZ6A 4ONEA 5ICGA 3HKCB 3PNSA 1SU4A 2ZSKA 1R9GA 1W88A 3L2OB 3CGWA 5H70A 4AY4A 3N2YA 3U7GA 1T91A 3FSJX 2H7YA 4KREA 2XWJI 4PHCA 5JLAA 5DCWA 5C8ZA 1XEWX 2FA9A 3KQWA 3I2HA 5EIWA 1ZNQO 2AJCA 4GBJA 3QLUC 1T9GR 4KMMA 4JGBA 1O89A 1JSZA 1Z6PA 3MUOA 3IUEA 3RADC 1CEXA 2WZQA 4WT7A 4ZN6A 4B2PA 4XD2A 4RZHA 1GSIA 1VJGA 5BMVB 4FDLA 3IAUA 3PDCA 3IXLA 4TYMA 2W70A 2Z9DA 3PFBA 1Z4MA 4NNJA 1VHLA 2A58A 2IXGA 2BE9A 2MYUA 2PN1A 5EHZA 5I4KA 3TR0A 2QBYA 1K4MA 3WBFA 3EQ6A 2H08A 3EGVA 2G25A 3HMQA 4HLQB 3EZ7A 4EO9A 2H8GA 3WLHA 1OLUB 4R1MA 2FPXA 1MJNA 4E08A 5G1OA 4ESOA 3NO4A 4RUKA 4YMHA 1G8AA 1IM8A 1I32A 1AKUA 1C4WA 1E61A 1XT6A 3FZQA 3IDAA 3OTIA 3SC6A 2QIPA 2WABA 3TVTA 1QQAA 3RG2A 2HK8A 1WKCA 2HXGA 4A6EA 4CCYA 4Q9JA 5BT9A 1LJUA 1FQJA 1MFZA 5FUVA 4HLCA 1VYUA 2WNIA 4YFYA 4J0HA 2FW7A 4D8YA 4JIGA 3BMOA 1W19A 2ASEA 4ZRMA 1KTVA 1NX6A 1UAGA 3OPYA 1FTSA 3IOYA 3RC8A 1HT3A 3HB9A 1JG7A 1WW3A 3FZEA 4GLBA 3IBCA 2XQIA 5CH5A 3OTGA 2C1XA 3M7IA 2ZWMA 1T0UA 4MQUA 4EB3A 1KMHB 3R0QA 4GPZA 3F2IA 4TV8B 2O8BA 4W1RA 1T0PA 3DV0B 3RU9A 5TPWA 2OOKA 1HR0B 3G0HA 1B73A 1D0VA 2JDID 2VBGA 3QU9A 2Y99A 3IH5A 2JIQA 3MUEA 4JZKA 3TW0A 2GPNA 4JKIA 2MWMA 5DNWA 4CLOB 3UUFA 4JBWA 5LBIA 2I4LA 5C8DA 1LWOA 2JIDA 3DE0X 3SICE 3V2GA 2B5OA 1ZW1A 2A4MA 1DEXA 2PJDA 3CNHA 4QFDA 4N49A 4XOIA 1AOXA 1JR3D 1M6NA 2EBWA 2YV5A 2YZKA 3L1IA 5BWNA 5LOVB 2YWRA 3K2IA 3CX6A 5MFPA 1A7KA 5AW8A 2W8BB 2B4AA 3HLKA 3QFSA 1OWNA 3H2GA 1E5TA 2HBZA 2CYAA 3D6VA 3ZBPA 2P91A 3PGVA 4PLZA 3OLZA 3U39A 3KQTA 3ASUA 4AMUA 5GADl 5K0ZA 1XKTA 3BMNB 1B6GA 4IRXA 4YRGA 3LWBA 3SYMA 4B75A 5BURA 1PT7A 3K1YA 3F6BX 4RPHA 4C7XA 2HU2A 1SH7A 2AEMA 1I8TA 4TTSA 3TSAA 1OR8A 5FPHA 2HIMA 1FJGB 5FIUA 1XEFA 1GRVA 1XMPA 2IXAA 1E2PA 3PL5A 3ZWKA 3MW8A 1SK8A 2Q0QA 4TMZA 5ESXA 3K0FA 5L4SA 4Y2QA 2G07A 3W2FA 1Z45A 4DCSA 1OKKD 1SBTA 2YWXA 5H16A 4BNVA 4EAQA 5JCOA 1HGXA 1Y81A 5H3CA 5AVKA 1EUCA 1CEYA 3OPMA 1QGAA 4BKMA 2H9AA 1W5SA 3BSSA 4KRGA 3E82A 3N8KA 2FKNA 4NLLA 3V7FA 3O1JC 5D3ZA 3V1KA 4PFJA 3SVZA 2EVWX 4TMVA 4C05A 1PTJC 3EXIA 3F0TA 2JI6A 5ELXA 5ANRB 1W9HA 2KYRA 2AFIE 2XVYA 4JN6B 3QI2A 4HPJB 2NXCA 4HNUA 1DEOA 2FUEA 3BEOA 4G5GA 5JASA 4TUYF 2WWYA 1SG6A 2VAWA 3A2KA 5ICEA 4QBGB 4I3FA 4DDTA 4K6KA 4N3BA 1JVNA 1W2WB 3AFNA 4PVDA 4QPJC 1NP7A 4US1R 4WK0B 1CETA 1MQSA 2IUTA 4P3PA 5B1YA 4MVJP 3EIQA 1A4IA 3KQUA 1R6AA 4MGYR 3BC1A 3U44B 4HUTA 3LQ1A 4C7OB 2WU3A 4BMSA 5CBPA 1Z5NA 3G9UA 4K1XA 4UJ5A 2P90A 2Y92A 4I55A 2OXTA 1EXVA 5JCXA 3M2TA 2WAXA 3GHYA 2ZWOA 2VF5X 1C30B 4L22A 4MUNA 1IB0A 1JR6A 2BZ0A 2W2LA 4WA8A 2KLBA 3STVA 2BC9A 4IAOA 3ZXUB 4CE6A 1XZKA 3DR3A 3NVAA 1JDPA 3C3CA 1ZRMA 3AETB 3DUFB 3ZXIA 2FVYA 4JV5B 3WA6A 1IJFA 4R9VA 3JY6A 4HC4A 3KVNA 2MHCA 4FJ1A 5LZ8A 3RVMA 5HJEA 3LW8A 2PUCA 1JWBB 2AL7A 3JVVA 4G6ZA 4GDMA 1YGYA 4IV0A 4PFQA 1LTQA 2EKZA 1R15A 4F4FA 1SUIA 1MRNA 1PR5A 1X3SA 1DADA 3N8HA 1Q12A 3PRHA 4TYNA 2ZJ3A 1JDBB 2J08A 1PL8A 4Y0NA 4QDJA 1XDGA 4RVDA 1FDVA 4QDOA 2I71A 2KQUA 3OEHD 4OGFA 1H8HA 3OETA 4OHYA 1OFHA 1PYDA 1VSUA 3Q8XB 1X7GA 1DNPA 1QUEA 4NFSA