4AF8A

The structural basis for metacaspase substrate specificity and activation
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
345
structure length
332
Chain Sequence
b'SLITQLCDAGQLADYVGLGWLNAVSSQPYLVQALGLQPPPRRVDVDAAFRDAKGLHGHQPWVATPLPGQTVRALFIGINYYGTSAALSGCCNDVKQMLATLQKRGLPINEAVILVDEDNFPGRTDQPTRDNIVRYMAWLVKDAKPGDVLFFHYSGHGTQCKSRKYDQCIAPVDFQKSGCIVDDDIHKLLFSRLPEKVRLTAVFDCGHSGSIMDLPFTYVCSGGEQASGTPHMKRIREGNDVLGDVMMISGCADEQTSADVKGSTGAGGAATQCITCMLMNNQSLSYGKLLIETRDMLKRKRFKQVPQLSASKAIDLDQTFSLTEFSVDRSIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METACASPASE MCA2
publication title Crystal Structure of a Trypanosoma Brucei Metacaspase.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Hydrolase
total genus 111
structure length 332
sequence length 345
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12660 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4af8A00
4AF8A
chains in the Genus database with same CATH superfamily
1F6DA 1WULS 4PTYA 4BN5A 1BVUA 2ZUEA 2RKOA 4BCDA 1CUCA 2P9FA 2XB8A 3GX1A 1NVBA 2IYVA 1BDBA 4TYQA 1W4ZA 4UDOA 3UJAA 1WB9A 1VE9A 1RLIA 3QPWA 3WDLA 2Y1OA 2DUWA 2JZCA 4GXQA 5FLKA 3EF1A 2VTEA 1B1CA 3KOZA 2PRSA 3O3OB 4AROA 1LJUA 4BNWA 1IJKA 3I52A 3NWJA 3C8ZA 4RF3A 3RADC 4LFBB 1E98A 1HQKA 1Z06A 2WG0A 2IXBA 2EERA 1F4VA 3PUVA 3ZGNA 1WDLA 3A6ZA 1W0CA 5KYYA 3AR6A 1KSJA 1RHQA 5DTIA 4U2CA 3EXHC 1TGYA 4LRXA 4H15A 4NZZA 5JCJD 3PVSA 1G21A 1N8TA 3OF5A 3B53X 3OG9A 3PC8C 4NZMA 5JNWA 2COKA 2B1GA 2PXHA 1P5ZB 3K1TA 4YT8A 3E3MA 2B69A 4N47A 4B48A 2JIDA 1UKEA 2WUFA 4BX8A 4QD3A 3KCNA 1DKLA 3KJGA 2XITA 1FK8A 3I28A 3L4BC 2IELA 1JDVA 2PKEA 3QUBA 4XJVA 1LDYA 1CYDA 2DWQA 1I5RA 4NL4H 5B58T 3X1MA 3U6BA 2HTEA 4ZPXA 1RAFA 4F8JA 1NX9A 4FX5A 1YVDA 1DQNA 2R6JA 2IZZA 3USZA 3KFXA 2VOJA 4LZNA 1N7IA 3O2SB 1MJ5A 3QUCA 2HMVA 3ONVA 4TWIA 1GP2A 2Q8QA 2VSFA 3EGXA 4FDLA 3ZJ4A 1Q21A 5AKHA 1ZL0A 2J3HA 5EE0A 1VCOA 1C3OA 2A9RA 1GU7A 2O2XA 2C1EA 3WFIA 3W3ZB 3ZXUB 1NASA 5GIOE 2IOFA 2A78A 1XL0A 3F8TA 4TZTA 3ICOA 4B81A 1SNYA 2DOKA 3VJKA 2WV7A 1V6CA 1K3TA 1Q92A 4DXAA 3E1KA 3D6TB 2I03A 4DLXA 3KKEA 2C5LA 2VDRB 3LPNA 4IDCA 3OA2A 2ZIWB 1U8TA 5KYUB 1OGJA 2Q3EA 2YYSA 2AG6A 3G2HA 4IDQA 4QICA 1IJEA 4WN9B 1EUCB 2JBAA 4ND6A 3DV0A 5T8KA 1SU6A 2H59A 3GN2A 3EEYA 3IT3A 1T8SA 4A0RA 1XDBA 2FWNA 4AF8A 5MHTA 4ZZ2A 4S0ZA 2CVFA 3K2QA 3L7AA 2HMSA 3LX6A 4IGAA 5HS4A 1I1HA 4ZYYA 1GG8A 4FFNA 2J09A 1B6GA 4KBGA 3SICE 3IMFA 4KGDA 3DKIA 1MOPA 2PVSA 3KD3A 1TKRA 2I4TA 3GGOA 4JYMA 5AJYA 1K1EA 1RU3A 1P5FA 1XP8A 3MOIA 1PYOA 1R0RE 2WRZA 4FQ7A 1SCBA 4UEQA 2IOYA 4MLPA 3AZQA 3WLHA 1X7XB 1VB3A 5THKA 4TTVA 2BUAA 5F51A 1K97A 4JUCA 5KQGA 4FFWA 3RE1A 3V33A 3N2ZB 1BHQ1 4OHUA 2Z8YA 5F5LA 2XCRB 1RRVA 2VDMB 4K6MA 1RXCA 1Z63A 1LQUA 1BWPA 2OBXA 1FDSA 1AX9A 1WLSA 3RS2A 3H8JA 2FR0A 2VYNA 4KWHA 4PLCA 5THXA 1U7OA 1UBKS 1J07A 1YRLA 2K6GA 1US8A 2WR8A 1MABA 1FE8A 9ATCA 2V9CA 3KPVA 4JLSA 3O8OB 1BOOA 2IEZA 2O9JA 3LPDA 1FRFS 4JEMA 5EE5B 2WU0A 4GXRA 4HGZA 1JHUA 4NU5A 5GAJA 4B2PA 1T5DX 1ZC4A 2FVXA 1ZM4A 3DYBA 3E0XA 3EXG1 5CTJA 3W5JA 3WLOA 4A9AA 1PK7A 4LY9A 1FLDA 3QU2A 3HUEA 3K9NA 1JAIA 3AV3A 4PPQA 5CFQA 3SHOA 2HSGA 5DBEX 1W2GA 5A6SB 5D86A 5EMKA 1ZH4A 5HF6A 3SJUA 3A37A 3U1VA 3KQOA 4BAZA 2HC9A 4Y9RA 1U3GA 2GX6A 3DZ8A 2A0UA 3HDVA 4JYBA 4TM8A 1LTQA 3MCVA 3F7MA 3R0XA 1TKBA 3Q6MA 1G5FA 4P35A 4CETA 5FO0A 3TDMA 4AJ4A 4MKGA 1NKTA 1VKHA 5PNTA 4HNGA 4XOIA 4XM1A 1QV9A 5CX4A 4MHTA 5ALOA 5CB6A 1CETA 2XE7A 3Q11A 3LWBA 5KC9A 3VHQA 4EMUA 3L18A 4BKOA 1BKSB 3BQNB 5SZIA 2P4QA 4I3FA 2HJVA 2IYWA 1TKAA 4AWAA 2D8MA 3U13A 1QU3A 1ECBA 1OZ0A 1XJ5A 2QTRA 3C87A 4PFKA 1Z0DA 2Z2YA 5IVIA 2C9OA 3G7SA 4OU4A 2QX8A 1PKEA 1SCJA 3UGTA 5F3WB 3E7PA 3WYGA 2XF2A 4EENA 4NBLA 4R1MA 3H86A 5AJZA 1QLHA 2EKDA 5L3VA 1Q0PA 2O7RA 1TW3A 2BLNA 5KDOA 4WKGA 1KDZA 5TC4A 4DWWA 2GZAA 3DZDA 1WUKS 2XWBF 3ETJA 4RXTA 3ZK9A 1R5BA 3BGSA 3DPIA 4H3HB 1LRLA 3M1LA 2QI9C 3MMZA 2C98A 3A36A 2ZKLA 1JG7A 1ZLYA 1ZWLA 3PPWA 4NS4A 3SC3A 5IASA 4DGSA 1EFAA 2FVYA 4UW9A 3BWDD 3MVEA 3KQKA 4EHFA 1O58A 3B60A 1WDTA 1EFCA 2HLDD 5EOVA 1E9FA 3Q5DA 3CR7A 1Y3CE 4XARA 2P8JA 4F9EA 2Q5HA 1J0BA 2IFTA 3I5XA 1NQWA 4ENQA 1YMUA 5IJ0A 2OTCA 4PQRA 3C98A 3ONFA 3VKUA 2GCOA 3K05A 1SUPA 4RHUA 4XYGA 3WB1A 2PR2A 2QTBA 1PJTA 2I0FA 1E2KA 1J9EA 2H9YA 1WW8A 4MIEA 5JR3A 1F8FA 1QRTA 3K96A 5FPSA 3TSZA 1LSOA 4D0SA 3NJRA 4BKMA 3E22A 3FWYA 1NNI1 1M2OB 3FCUB 1MGOA 5EINA 5TS2A 1OTHA 4URVR 3EDQA 3T8YA 3FOFC 1ZU5A 2VVTA 1UIMA 3K1AB 3TZEA 3K0AB 1MLDA 1IRIA 1YHZA 1RWMA 2Q8NA 2W2MA 2GZ1A 1XBTA 2VA8A 1G3IA 3PUJA 1XAJA 2OV8A 4M53A 5GP1A 4KQJA 3GT7A 1NONA 1CUEA 2F4NA 5JAQA 4YP1A 3WGZA 3GLHA 3CCBA 4V24A 2YXEA 1CUBA 1MRZA 1ZJ5A 2DFPA 2Z9BA 1Q16A 1XMXA 1XD2A 3HGTA 3IUYA 2GXUA 5C31A 2X5OA 5AOVA 1SKUA 4FGKA 3DSRA 4CN8A 4F21A 3EXFA 5C8VA 4MEBA 3KQNA 1W30A 1MBZA 5IZCA 3W9YA 1BCSB 4WNIA 5E2AA 1SZPA 3STUA 4URUR 2FQYA 3GQBA 4EA8A 1GZDA 1RMYA 1RWBA 1AUXA 1ZDMA 2HA6A 3FOAA 5YASA 4CEHB 2A30A 3AEXA 4UNNA 2X2OA 1K8RA 1MOQA 1SCUA 2WTEA 2FU5C 3H97A 1SG0A 4IFBA 5ALDA 1Z0SA 4NAVA 5J2TA 1QTIA 5ARCA 4XXHA 1P0QA 4BGDA 4ZU3A 4MS4B 3FRHA 2ZT5A 3GCZA 3BIFA 2L19A 1X42A 4JI7B 4HVLA 3F6SA 4MUHA 3RVDA 4J6FA 4EB6B 2PK3A 1J24A 1DKRA 4Y6PA 4FEGA 3LCCA 4UAVA 5IP5A 3T3MB 3IRUA 3AFIA 3PUZA 2N42A 3MGCA 5KWEA 4GMFA 3WYEA 2F17A 2WYWA 2BZ0A 5BPHA 1H2AS 3MGBA 5BMOA 4I8DA 1Y3AA 2Y9PB 5EWMA 3FHTA 2CFIA 3FPHA 2JHAA 4Y9TA 5FTJA 1P60A 4W5RA 5K51A 2BFMA 2I55A 4Z1MA 4ALKA 3EUFA 3G5UA 4KCGA 3IEUA 3RR2A 4OOEA 2WF8A 3EVAA 4HZUA 2BOVA 5K0NA 3INTA 1O96A 1T6NA 1LA2A 1ZNYA 1R37A 1QIMA 3KXLA 4HKTA 3WLNA 5IDXA 3UB4A 1F3LA 4FCVA 4TQGA 3GF4A 2O52A 4GOOD 3Q72A 4N7MA 3OUTA 4E1BA 1Z0KA 3FE2A 1GN9A 2H2DA 3HVJA 1J8VA 5IS2A 3TNJA 4YPFA 1WNTA 2CXTA 5KNCA 2QVCA 5HW0A 3MOGA 1KJQA 2G9VA 2NXWA 4JLJA 4L50A 2NG1A 3LT5A 1XTZA 3VUEA 4BEJA 1LK5A 1W0KA 3CX6A 2AZTA 1C7JA 2WF5A 5G0SA 4KLZA 2B8JA 4RLQA 4AQYB 1JX6A 2DU8A 1E9SA 1QYVA 4ZDJA 4LRWA 3TJMA 3EF3A 1V71A 4M0KA 3DB2A 2HWYA 3R3WA 2C9DA 3IXMA 3JS5A 3GFRA 3HKBA 3P0JA 2OOKA 1HQCA 3C6XA 5CYFA 3JV7A 4Y2JA 4ZVMA 4L3OA 4LBVA 1PTJC 2C58A 3H1TA 2QZ9A 4BKRA 1ZAYA 3Q7SA 4E3ZA 5AHWA 2GBFA 1PZFA 2J3MA 2OGTA 4I5FA 1PI3A 1TM4E 4HB2A 3NHYA 4MCAA 4PXSA 5TEVA 3J7AC 5JRZA 2W93A 4CG3A 3U56A 1G7CA 1N2SA 4PGMA 5LN1A 3DLBA 4CQNA 2ZAMA 3ACBA 4YCJA 3W78A 1DQRA 3KPUA 3N7TA 3ODPA 2XVXA 3OCCA 4YH1A 3AJ9A 3V6LA 3RFCA 3BAZA 5CYPA 2F1OA 4AIIA 4WOPA 4K3VA 3RDPA 2WQ6A 1QKIA 3A31A 1IWOA 3LWNA 4ENTA 1OWNA 2HCBA 4MDFA 1XP5A 3D0QA 1ZFNA 4TTTS 5B53A 3K4HA 5PGMA 3ZE9A 4TMWA 4BP1A 1R8JA 3KB8A 1SMKA 2Q6IA 4CKWB 2V74B 3VO1A 4FPXA 2GB4A 4MRMB 4V2UA 4YROA 4AJLA 2FEXA 4EI7A 1NRJB 1ZN9A 2HIAA 4FYWA 3JQDA 1XEAA 1EPUA 2CN1A 4LYYA 3W6NA 4WNCA 2R751 1JQKA 4HAYA 4LYHA 3CNOA 2XMDA 2G06A 4NARA 4OGKA 1UPAA 2NZUG 2YCBA 2UZ0A 3B7WA 4MQLA 4MXDA 1PEYA 3TVYA 2GTHA 1R0ZA 1Q74A 3FVWA 1AGYA 1T2NA 1QBKC 1P2BA 5L3QA 3W9SA 3EIQA 1PBTA 5TPWB 3S3TA 1GT91 2J67A 3H18A 2IIVA 4QODA 2GS9A 4UARA 2GZDA 4JT4A 2CNKA 1H8HD 2GBLC 4J3NA 4F3RA 1DAMA 2P27A 3PFKA 5ER6A 3T7DA 3HCDA 1TE2A 1B00A 2AQHA 2XOEA 2QRKA 4L85A 1R8SA 4D9IA 2POQX 1K5PA 2E37A 1AHPA 3P19A 3GFPA 3HFSA 5AK0A 1SVUA 5D3KA 2WBLC 2Z9DA 3BCUA 3Q5EA 1BNCA 1FOEB 2K5UA 4L4SA 3V1KA 1NR7A 1FFCA 4NV0A 2Q4OA 4XUCA 1HMPA 1NVDA 4PX5A 5JANA 5JBIA 1RLTA 1COWA 1VMEA 3QQPA 1QK3A 1KI2A 4EQZA 3G0GA 2O2GA 3EARA 4J4HA 5FUBA 3M8KA 4L6IA 1WRBA 5HJ7A 2ZRJA 4QXQA 1NMXA 3G8DA 4HUQA 4NMXB 1C7RA 1MVOA 4MR8A 3T5GA 3VR2A 4X1IB 4EI2A 2OBNA 3PWTA 2JASA 5E6UB 3I2GA 2JI6A 5JNUA 1J25A 1VMDA 4S35A 3AVTA 4NV1A 1KYWA 3TLKA 1K0FA 5J3JA 2V98A 2FPLA 3CVJA 3QBVA 6NULA 3CZPA 3O7WA 1IJFA 4NJMB 4CM8A 2AMYA 1E2JA 1XJWA 2P6NA 2HXYA 1Y5NA 4OBEA 5B6JA 4WCVA 2XIQA 2JCVA 4WEQA 3W7VA 1GDDA 3PVCA 4HDOB 5REQB 3MT0A 2C7GA 3BXEA 5IFLA 3KZNA 3GAFA 2Q0HA 4IDBA 3O2NA 1JN0A 4DQKA 2B7LA 2BH9A 4L07A 3NHJA 4ALMA 2QRVA 2VIIA 3HEMA 5A4JA 3EC1A 4KQCA 1T9BA 2VHYA 4R1NA 1EK2A 3HFJA 4KVFA 1LCIA 1DQZA 1PE0A 1YR7A 2KYRA 4OLFA 3U37A 3DMPA 1O8BA 4HNHA 4KI0A 4M7OA 2DR2A 2G8NA 3L7MA 3SMVA 1Z4NA 1OIXA 4KX5A 5AM3A 5L9AA 1IBRA 5BSVA 1LLDA 1EVJA 1UPCA 1RYZA 3D6HA 2BBSA 4N0DA 1NI4A 1TQHA 4GBED 1BFDA 4M6WA 3ZCRA 4UNIA 3HB4X 5IN4A 4GMKA 2C0QA 2AX4A 4Q3LA 1LBSA 1H8EA 3KZXA 3IDQA 3DDZX 5AVKA 3WGQA 4ER6A 1V7ZA 1TADA 1W0JD 3BT7A 2RBEA 4KJXA 1HE4A 3W3AA 3HDTA 2B2NA 2QUIA 2B5WA 5KVCA 2D2XA 3FDFA 4ZTZB 3CUYA 2WAOA 3AXSA 5AKYA 3IVXA 3ADKA 2KLHA 4EFMA 1CY7A 2B2XA 4QXRA 2W0MA 4EECA 3RRFA 4G4IA 4RX1A 5F7OA 1RYHA 1OXUA 4Q4HA 5GONB 3RH0A 2RARA 4G0PA 5T8KC 3X2EA 2EEPA 2J45A 2V54A 3VHXA 2HH9A 4WRRA 3DW1X 3RRNA 2QRZA 1JS1X 4KRXA 4EB3A 5KWSA 2GLXA 3VKVA 4DCOA 3JD1A 3HP1A 1R4NB 4R3NA 2RK6A 3KHSA 3KYBA 2NPOA 3GJXC 1TJ4A 2PM8A 3RS9A 3WOVA 1J0XO 1UC9A 4WUVA 4BRUA 4FHEA 4OYLA 1AVTA 4INPA 1L5LA 1J1UA 3D2BA 5KYNA 4CKBA 8ATCA 5HA5A 3EODA 4QLBA 1RVDA 1U7PA 1ULHA 3ESXA 2I80A 3G1WA 3PRYA 5EGNA 3TLYA 4LNAA 1P7ZA 3O4JA 5CCXA 3SZRA 5ALLA 1IVSA 1CQJB 1GLNA 3HMQA 4RPIA 4TV8B 3EDOA 3WGGA 4B4VA 4KR7A 4XASA 3GN1A 4EF6A 4GUAA 1GL3A 4LXUA 2X5NA 4PVDA 4ZJZA 1Z4KA 2J5KA 3EDYA 3KEQA 1I0IA 4S24A 4ZHQB 3M1YA 4ND8A 1FY2A 4KW7A 2H57A 3LRXA 1K3FA 4F3CA 2BC9A 5FO1A 1A9TA 1B73A 1H9AA 3C5EA 5EMLA 3EGWA 4IINA 1XLWA 5F1YA 4A8HA 4DNPA 3HZRA 1DFIA 1GUAA 1KMNA 2DSNA 4TSRA 4B6SA 4F86A 3ZBUA 1TMOA 1VKZA 3AG6A 4J16A 4O1IA 2C2HA 4XJSA 1YA6A 3P8ZA 2QR3A 1DU4A 3RYFB 4HGPA 4KC0A 3MFYA 4ZT4A 4PPGA 4GVXA 1CULC 2Q1SA 9LDTA 1E3MA 3TN7A 2C92A 4RE5A 5ECYA 3UMMA 4NFHA 1M67A 3IEKA 3V1NA 2QAGB 2RBGA 3PXDA 1ODJA 3EEBA 4QYTA 1KA9H 1OJ7A 2AI1A 4QC2A 3DEKA 2PUEA 1UXOA 2QU8A 4IVQA 4Y2YA 3ZY2A 4LXIA 1FMFA 4P33A 5JWRA 1R6BX 2F3PA 1V8PA 3T4PA 5HUQA 5ITZA 1ZA2A 1X13A 3L3BA 4JP5A 4X93A 1PHPA 2ECPA 2ZWPA 4G0QA 2C0PA 1FW6A 3A25A 2R68A 3QF7A 3ZWPA 5GZ1A 5K3EA 4R05A 4QPDA 3WDSA 3I72A 2E4VA 1A2KC 1KJZA 3H2IA 3O8OA 2RI6A 2ZUDA 4CG2A 4ECAA 1U3DA 1W49A 2EZ4A 2GPTA 2O3JA 3Q2IA 2FPKA 3O4FA 3NAGA 4FMDB 1PGQA 4LJYA 4DV0B 4ZIRA 3UC5A 2EWWA 5CEEA 1M83A 1RJEA 1VSBA 2Y68A 1IN7A 3O90A 5LZ7A 3E4DA 1Q0SA 2DF8A 5ALKA 4LWOA 4XVHA 5EIAA 1KWGA 4S2UA 4G97A 3AR7A 1NMZA 1XWFA 2GCPA 2ADOA 2IIBA 2PZFA 3TD2A 5M29A 1MGPA 3OZFA 1QHHB 4YJFB 3CKKA 3C85A 5H3LA 3RT1A 4XSVA 3ZWCA 1H1LA 3U7RA 3HYTA 4XE5A 2WM9B 4HYEA 2B21A 2PWAA 2PX0A 4GR5A 3B48A 3FG9A 1CY6A 4M76B 4BFSA 4YXWD 1PGNA 2WZBA 3W2EA 2NZVG 2W6CX 4LIPD 5KKNB 4I4IA 3OHSX 4I9NA 1ZP6A 2ATIA 1A8UA 5G4KB 5A5EA 4RMIA 1E18A 5IF9A 5H16A 1UBMS 1TCAA 1JFRA 4QT0A 3RBXA 1OGYA 3HXLA 3E8SA 3D6NB 3N05A 1L5YA 3COWA 1XNJA 4UBLA 3URMA 1EGMB 2HY7A 4CXMA 1YMQA 1KXZA 3FIUA 4RK1A 4W7IA 3C4JA 1P73A 2DQYA 3OQPA 4MKHA 4RPKA 4UBMA 5AK4A 3UMBA 1CS0B 3DUWA 3DOOA 5CXSA 4ARBA 1W93A 4KFUA 2EKQA 1E3QA 1Z56C 4QE3A 4A0QA 4BMZA 3TW0A 4FW8A 3VPCA 4BFTA 2HNAA 4IGFA 4YJDA 1YV9A 5AUNB 2JW5A 3VZBA 1VPVA 5LBTA 2JFPA 1N6KA 4M8NE 2IOFK 3IKVA 4UASA 2Q1XA 1Z5OA 3KXIA 3FFWA 2J3KA 3KNZA 4YBRA 5LJLA 4PFQA 1IPEA 2CD9A 2HHAA 1Z7BA 5E7MA 3KV1A 1EBFA 1YHYA 1CZLA 4KQHA 3S8MA 3WIBA 4CFZA 2C9MA 4MLZA 3ESAA 1H2XA 1PG2A 2RJNA 4LI3X 2QM8A 2XW6A 3RTCA 5IZCC 3AGQA 2O6LA 2JVJA 3W6PA 4RZUA 2V7TA 4Z9YA 4IZOA 2K2QB 1MQ9A 5GONF 4ILKA 2QBYA 3ZV6A 3SZGA 1O95C 4BFXA 2V1XA 3SHQA 4ZYWA 1O89A 1KC1A 3DBRA 1G4UR 3NHLA 3PX2A 2A5YB 3GA7A 1G6KA 4G9GA 2BEJA 2VJOA 3DLTA 2P62A 5EKTA 4JVNA 4XD7D 2VS1A 1XPOA 3F98A 5CH8A 4F2DA 5DGTA 3A4MA 4FBGA 4P34A 5E4FA 4CV0A 3K1AA 2CW5A 1RM4A 4OK3A 3PR1A 3NH9A 3OQIA 4CIAA 1VE6A 2C3OA 4HX9A 4JJ8A 5K3FA 3MWYW 2BY4A 3HGMA 1I3NA 2WD9A 3NBAA 2REOA 4LZPA 4ZVPA 1OIVA 3BM5A 3R7NA 3ABRB 3RVRA 1NBOA 2JJYA 2IPNA 2PIAA 3F4BA 1RBMA 2QPTA 4AUMA 2AOTB 4TV8F 1L7AA 5I9NA 1SZJG 2WJ3A 3L8MA 3ZU3A 4DT1A 4F9FA 2BI4A 5U4XA 2I65A 2SICE 1D5WA 1RYDA 4NYJQ 2MT9A 1GAQA 1XSEA 3PQ7A 1BCSA 1NF8A 3EXEB 4RJIA 1ZD1A 3SP1A 4WZAE 3BRCA 3PA8A 4ZHQF 2OA0A 5CLHA 2O8CA 5HFAA 1ZI8A 3JALB 4HFNA 5BWBA 2FWPA 4BBAA 4H7DA 1JMKC 4FYHA 1N9GA 3OZTA 5C1OA 3N0WA 1E5XA 2NU6B 3CG0A 4KVGA 2XPCA 2Q5FA 5E1MA 5HJ2A 3TH5A 1T3LA 4BNDB 5L40A 1KAGA 1NVUQ 4FQ5A 1KIFA 2FZEA 2IODA 3EVCA 2H2HA 5KTTA 4MS4A 3QVGA 3INNA 4KR3A 4WKCA 4UUPA 1HG1A 1GZ5A 2YUTA 4EG7A 3BGVA 3EZ2A 4DR6B 3N2KA 3JWJA 3QBTA 3M6MD 3SHTA 1QGOA 4GM0A 5AKKA 721PA 3HEBA 4M1KA 4ZGBA 4B0OA 4W7SA 3K35A 1GPBA 1X7ZB 2WW8A 3D6JA 2BFNA 4W82A 5AJVB 3FYUA 4W9NA 5ALTA 1EIWA 3OZWA 1U0GA 2GEBA 3INGA 2R4TA 4TYYA 4V0RA 4MWGA 2ZIZA 1E58A 1T8PA 2FRVA 2D5CA 4C7BA 2FYTA 5F7XA 5E95A 3A70A 4QPPA 3U7IA 4C29A 3E9RA 2DHRA 3E8XA 4M1WA 3TNDA 4ZEMA 1ZICA 2EF1A 3H9GA 4FMDF 4IIJB 1CR4A 3EPPA 4I6GA 1P1HA 5C8DA 3L7CA 1NW9B 2HNKA 1IZ7A 3L79A 2BFBB 1IUPA 3EE6A 3DXFA 2P8SA 1PJSA 2OBBA 3DGEC 3HDHA 3L1IA 4LTMA 5FPHA 1MG5A 2FWBA 3V1YA 1AHNA 3H04A 4RSMA 2OCIA 1JV2B 2NVUB 3UATA 2H92A 1JPNA 4MVYA 1W36B 1MF7A 1W5FA 1I7PA 4HQRA 1SHUX 3ANXA 4NDZA 4PZEA 3QU5A 3PCXA 5JU6A 2YRXA 3GYBA 1MC8A 4DQLA 1R6XA 2PCJA 1K6EA 1Z5PA 4DLSA 3PI7A 3QV1A 1RI5A 5EP3A 1NJSA 3KOXA 4X9XA 4PICA 1T2CA 3T34A 3PNVA 2OENG 3ENVA 5AKLA 3AETA 1XCLA 4QUIA 2PE5A 4KI7A 1Y7TA 1XPJA 1KSGA 3IXQA 1A2OA 4WINA 1ZMRA 1EDOA 2B4TO 1L5VA 4US1R 1Q7EA 2I29A 3CKYA 2RIRA 2EL9A 1ZC3A 2VYQA 5LZ5A 4CTKA 1P8JA 1NBWB 2QENA 3CHYA 1HOTA 1LK7A 4E30A 1MVLA 1QGED 2ZJOA 5AVJA 4F85A 1CY1A 1EAYA 2CNDA 4IF6A 5CR9A 2Q9BA 1W59A 1ZK3A 2BD0A 5LJIA 3NALA 1QM5A 5JZBA 2VBCA 5KNCH 4PW0A 2JBHA 1HI9A 1JPJA 5FEMA 2C2XA 3L7IA 3I34X 1VRWA 1Z8FA 5DK6A 5G1NA 4DLRA 4G85A 5FIUA 4YGYA 1DTWA 2WVGA 3EN0A 2FOIA 2PSSA 2ZRCA 3E2IA 2PSEA 3EIOA 1UT8A 3L0PA 1RPJA 1OTXA 1Y6RA 1EXNA 3F5QA 3H9EO 3A3YA 2NM0A 1QP7A 4JLAA 1LTKA 1T4DA 3FR8A 4IIEA 2ODNA 5AW9A 4KUEA 4TLBA 3OWXA 4ZK2A 1ZVQA 2ZATA 1UH5A 4CKWA 2VSOA 3EGIA 5K4GA 2GMWA 4MRMA 4Q4AA 3DEAA 3OC0A 2GD0A 2DT8A 2Q4BA 1U8XX 3TPFA 1AKEA 3KXPA 3QTTA 3IJPA 3AWDA 4A2PA 5BUQA 4YAIA 3JAKB 3LKZA 4D45A 5LWHA 5D6OA 2Y1LA 4JBGA 4WX2B 5B6PA 1JKJB 3QSGA 5GGXA 5INTA 1Z35A 1WZCA 2ATEA 4C4SA 2BV3A 1DC6A 5HRAA 1FF9A 1UBOS 3OFNA 2KWIA 4G3XA 2DEUA 4ANFA 4ZCIA 4BVEA 4N8DA 1K0UA 3JR3A 4QULA 4LRQA 4YRCA 5IAOA 3RC8A 5B1HA 4V0LA 2A59A 1FDTA 2QD4A 2G36A 3CYFA 3LE8A 5JDCA 3NVDA 3UUEA 3VH2A 1PYDA 5A2GA 3BKXA 1Y6ZA 2P77A 1KEEB 5J59A 5M34A 3CLHA 1JJFA 2OV6A 4JS0A 13PKA 2B78A 2O8DA 4HXEB 1WZUA 4CMHA 5JFGA 4FIDA 1MO3A 1XI2A 1ZD2P 4WLEA 1U04A 2BBOA 1G41A 2Q0XA 1E1MA 1EH5A 1W1WA 3SOZA 3WGYA 3WKAA 3WWPA 3FDJA 3N76A 3NBZC 1SC4A 3NH6A 5IW8A 1TM2A 2FPGA 3AEZA 1NW3A 4LRYA 5EXTA 4EPVA 3AF1A 3PXGA 1HLDA 1DKQA 1FUYB 1QZ3A 3KVYA 5E6UA 5DULA 4Z7QB 2XTMA 2EJVA 4JCOA 3CUKA 1L1QA 1QQ6A 1SUDA 1C1DB 2P2ZA 4GX0A 4MIYA 1MJHA 3H3JA 4S2EA 3C39A 2M6SA 3EEFA 4RMGA 4I1YA 4A2CA 2HNBA 4FCWA 5B1YA 2QTHA 4HI0E 3NT4A 4MQEB 2C7OA 4K7JA 3V2GA 4HSEA 4DZRA 3KZVA 3EUEA 4ZZ1A 1J06A 1FDIA 1XQ1A 4X24A 1VPTA 3QWIA 1P4HA 3T06B 5REQA 3V4LA 1MMFB 2PRJA 4FHDA 4HAXA 4HRVA 3D7MA 1S9HA 3F67A 3GNLA 1JSZA 5CBKA 4N9WA 2WU1A 4MW2A 2HSEA 1T6ZA 8AT1A 1P72A 1X1RA 4V0MA 5JTUA 3UGJA 2GZRA 3F4KA 1KMMA 3LUGA 5ARBA 4WZAB 1XQ6A 4IDEA 4IUDS 4K81B 1RLOA 2A14A 1QHEA 4GWKA 1SR8A 3IA7A 1U2PA 5L4LA 1RZVA 5DTMA 2OR3A 2Q2WA 4A8TA 4RHFA 4G0WA 3BIJA 2CL5A 4KXNA 1BDMA 2PBFA 2DPYA 2HBQA 3OPYI 1KOJA 3VYVA 1GZ7A 1B26A 1K6MA 1WHSA 5HZGA 4I1RA 4BLQA 2P0EA 1CX9B 4TKUB 1P3DA 1YS9A 3PFIA 4ZEXA 1ZD3A 2OB2A 3EFHA 5G0UA 2YIVX 1Q3HA 4R1OA 1V7CA 2YZGA 1HQYE 3NO4A 3CZ4A 1G8HA 1Q11A 3V6MA 4A5SA 1QIEA 4HADA 3RJ5A 4CTJA 2WT8A 4RJKA 1SZCA 4JDPA 3NTVA 4B32A 1DBWA 2ZSHA 1TYEB 4XZ3A 1UEJA 1FVXA 5HRUA 2ZS7A 2A88A 1XD8A 3KLPX 4H27A 1QUEA 1RXEA 3RRZA 4Z99A 1MG0A 4QATA 5I7WA 3FTFA 2ZIFA 4X3CA 4ZVKA 4F72A 4J16C 3M4XA 1P5RA 3HKEA 1B0PA 4FFSA 2GJAA 1R4NA 5A03A 1Y3HA 3NP7A 3UK1A 1SC9A 4CIDA 1C8LA 2EHJA 2FZKA 4L9AA 5FBHA 1Y3IA 3SCZA 3KFLA 2GZSA 4V3BA 5AYVA 1UF9A 1XTRA 2P6PA 2OHHA 3CF0A 1Y5LA 2WF6A 1N92A 1AQNA 1X15A 2PG3A 3AK4A 2G1JA 3H2HA 1LNZA 4WI1A 4QXAA 3B3AA 4Y6GB 4CM5A 1JYEA 3W3AH 1UJ6A 3RCBA 1CQJA 3WKBA 2P9YA 2V58A 3WWEA 3QKRA 4TV8A 1LU9A 2AFHE 3QXGA 4TRRA 3U3RA 4ACBA 1ESNA 1JXOA 3LT2A 3H5OA 4MR7B 1PJ4A 7ADHA 3MT8A 1WAMA 3K6KA 2DBQA 1UWLA 5MN6A 4KYUA 4O2LA 4ZHQA 5BQFA 3R77A 1XEFA 3LJKA 2C9YA 5AVWA 3B5JA 2DQ4A 2XUZA 4RSGA 2NO6A 2XZTA 1P2DA 1K89A 2E82A 2XA2A 4TX1A 1YS2X 2YC2C 1Z08A 2BBWA 2I2WA 4J3FA 4OF4A 1NXQA 4O29A 3ZH9B 2IT1A 4MIKA 1QLJA 1FSSA 3BHNA 2QW8A 1SO8A 1X3SA 1WMBA 1DCMA 2NO5A 2PUWA 4CWAA 2IEAA 3MQFA 2H3EA 1GL6A 3RO7A 2IKSA 3KKMA 1TFUA 4QU9A 4PZAA 5E6SB 2BI8A 2TMKA 4HUTA 3SQNA 1NXVA 5AVOA 3CBQA 3PRJA 4QOFA 3PXEA 4XVRA 2A1TR 4BQSA 5HIAA 1FBTA 2BE7A 4R1LA 2Z09A 4RNDB 3RK1A 4RF5A 2CL0X 2R1VB 1XVAA 5HZHA 1AN0A 3JQCA 2OAEA 3QW2A 1X1BA 4M36A 4BMOB 1HNXB 4JKYA 4ZO8A 2CNOA 5ALVA 2HWKA 3P71T 3PNOA 3T7TA 5AI8A 1C29B 3I1IA 3NGMA 3DC2A 4HL6A 1NBME 1DINA 1GCIA 1TAGA 1BCRB 2VPXA 4FZ3A 5DPMA 1U1FA 2DB3A 1KH1A 2QLBA 3GI1A 2O0HA 3PUKA 4YT5A 5DI3A 5KNDD 2YWDA 5BSEA 2AN3A 1T1SA 1T5HX 1NC1A 2H4FA 4DB4A 3FWPA 1KJIA 1RZ3A 1L8AA 2QDXA 3QVTA 5LMZA 1SEPA 1DCKA 3U7GA 3A05A 3VVBA 4KWTA 2F7SA 1JDBB 1FX1A 2NZ8A 4LISA 3R3JA 2JAUA 5DGXA 3LW7A 3ZCQA 2XWPA 2IHTA 3KUUA 2IOQA 1XNQB 3UBTA 3FVQA 1A8PA 3RKSA 5JALA 2A5GA 3HVIA 4GPTA 1KEZA 1L7QA 1SUCA 3EFOB 4ID3A 4BO3A 2WPDA 2V0NA 4G6ZA 3OKAA 3THWB 4PTZA 4NPHA 1DC4A 1T10A 3VDRA 4CLXA 5GJCA 2W6JD 5I5GA 2F55A 5D1HA 1U8ZA 4ZT3A 1U8UA 4JU9A 5EMNA 1WJGA 1FZQA 2XXJA 2VDWB 3VQTA 1GVNB 4NYIR 5KO2A 3MJCA 2GAOA 3VYWA 1B76A 4IMRA 1UJBA 1SBYA 1UP7A 1RWWA 3U44A 3NC4A 4I9UA 1QOQB 2G7MC 2CK3D 3P45A 4L2IB 1DAOA 1CS0A 4TWBA 2CXOA 4MPTA 4OG2A 5JH7B 4OHZA 4EY3A 4DV3B 3UV6A 3PGKA 3FSEA 3U7JA 4BMCA 5TMEA 3MGAA 2EFGA 3QHPA 3VR6A 5DNDA 3DYIA 1U98A 3B8EA 2IU3A 5SYNA 1HYEA 1Z47A 2WZDA 5C5IA 5BW5A 2SECE 4G01B 5GY7A 3H2GA 3SQLA 1ZH8A 1NXWA 4RAQA 1S2NA 4DDTA 1XDUA 3MJRA 1TLFA 2V6IA 2ENWA 3O6VA 2YBDA 2H29A 3LLMA 2W11A 1V39A 2W2QA 3DEZA 2CXXA 3EVGA 4GP7A 3F4LA 3T7AA 1UPUA 4WXEA 2V6GA 3WB9A 5F98A 2HMAA 3AJAA 3UFXA 4BVLA 2FY8A 4AYTA 5A3RA 3IKJA 1ZONA 5F2OA 1Q17A 1WDMA 4OQEA 1V1MB 4ZQCB 3LSTA 3RFUA 1BN7A 1FU8A 1OREA 1AGRA 1CSEE 2CF5A 4RH1A 2FX5A 3PJFA 4Y1FA 1LTHR 1UKZA 2JJMA 1LKZA 2PL5A 4YUAA 1GRNA 1ZGHA 1HE2A 1E99A 2FMFA 1Y48E 3PQ3A 3QPBA 2ZT7A 5DM0A 1YOBA 2HTFA 5C1DA 4DABA 2BAGA 1D2NA 2NUTB 3GQVA 2PRZA 4WZZA 3X1YA 2I87A 2O19A 1JHOA 2OESA 4YRSA 4Y1RB 2XVZA 3OOHA 4NYMR 1IY2A 4ND4A 2H2GA 3ZWKA 3ZIDA 4FGSA 5CCDA 1QV6A 3TG8A 4IQ8A 5ELXA 2X3FA 4EY7A 4Q01A 4YAEA 1YB4A 3U48A 4LXHA 1Z15A 4MA0A 1CUFA 1R4AA 4Z3OA 4N0MA 3NYRA 3ETDA 4W9NC 4MARA 4DW8A 1USVA 2C95A 1Y9ZA 3K2IA 3ZWQA 1DJNA 5F9FA 1OLXB 1XTJA 4PG5A 2B83A 2AXQA 4KXYA 2NV0A 4GSKA 4IMIB 3ET4A 4UBIA 1MAWA 4KLNA 5L95A 2P4SA 1ENPA 3EWSA 3DBVO 3ISJA 2G07A 4LKOA 4X90A 4HXFB 4QSHA 5LKAA 3IAS6 2X13A 4M1ZA 2GVDC 4U00A 1FDUA 1TI7A 1P3Y1 4UUBA 3TUIC 2FMUA 2GI4A 2NU6A 2ODWA 4EF4A 4IVPA 5EJ5A 3U7QA 4R54A 3BQMB 4YALA 1OI3A 5IYZB 2XYRA 1BWRA 2RI1A 5KWJA 2GM9A 3PB3A 1PR0A 4H31A 2EXXA 4BNVA 4D3ZA 3A4NA 2IYAA 2P7IA 3A2LA 4RE6A 4U7HA 1R9NA 2A0XA 2EX1A 4M1OA 1G8FA 4QHYA 5KEIA 5BN4A 1YVEI 1PGOA 4TKZA 4H1UA 4NAUA 5KJFA 2FR1A 2I2XB 4JX9A 3KSAC 4JJ4A 4COKA 2PYDA 4RKFA 4FYXA 2LCIA 3DUFB 3P0RA 4HCJA 3KHKA 1G2QA 5AW6A 4JB3A 2V4ZA 4I55A 2GYWA 1C3LA 1F2TA 2AFHB 3E9ZA 3SEAA 1PJ8A 2IBSA 2B30A 1MD9A 1U5BA 5C51B 4QVIA 4QUEA 2EW8A 2VR1A 1CE8A 1T36B 1XVTA 4JGGA 1KVSA 1OTYA 4G5XA 4IWNA 4TTSA 2HJHA 2W8ZA 4UATA 5E1OA 5EIXA 1MO6A 1QG6A 4AULA 4URWR 4KMOA 2BM8A 2F8LA 3KYJB 4J1SA 2FUEA 1WZ2A 4XX0B 1Y6QA 2VAXA 2HW8A 3CR3C 1BX1A 2WWRA 2IITA 3P9ZA 2IF0A 1FVOA 3COJA 2HOQA 2G82A 2LZ0A 4FDTA 2JIBA 1WCWA 4TWRA 2BDEA 3BN3A 1PNRA 4Z86A 3EZNA 4I4TB 1XCJA 2OFWA 2ZXFA 3PDCA 2HZBA 1KAQA 2PANA 3PQEA 3Q0IA 3S1AB 1BZYA 3MB5A 2AG1A 1PLJA 2C57A 1D2RA 3HP4A 1VBNA 1A5AB 2FZWA 3IUEA 4WEOA 4YFYA 3DAOA 2IU6A 1FUKA 1DWUA 5DOZA 4E0BA 5F7ZA 3D2AA 4EKIA 2JIOA 3AIIA 1D1PA 1TJ3A 4KHPB 1DAEA 2NU7B 3GUVA 4M83A 4ZAWA 5JI2E 3OIVA 2ZI9A 3NP9A 4BCCA 2AMLA 3K30A 3H1GA 4RFVA 5I9IA 2Y77A 3CBGA 5CYOA 1CJCA 1WL8A 1SM4A 1XR3A 2QP4A 3D6AA 3OPNA 1R4MA 2EHDA 1I2AA 2GBIA 3MJSA 1OFHA 1DXYA 4LTNA 5AT1A 3X1DA 2CF6A 3KZOA 4P53A 1C9JA 3PNLA 4RQTA 4N4AA 1G6Q1 1QX3A 2B3DA 1I4EB 3WMGA 1ZITA 1P9OA 1UBUS 2QQGA 3HS3A 2CE7A 4IRXA 4CF3A 1JWLA 3WYAA 5JH7F 4QEDA 2IUSA 1NHGA 2JFXA 4ZZ3A 1TAQA 4J9UE 5IPFA 1QC5A 3M81A 2BKXA 1Z36A 3G2QA 3OPVA 4XTCS 3WLFA 2QD3A 4EHAA 3M4JA 3R3ZA 4AJ2A 1ZCBA 3GG9A 5BN5A 5JS8A 4TMZA 1Q7TA 2F1HA 4WK2B 4DV7B 2FF7A 3FTNA 4IDNA 5JDCC 1G38A 3C3AA 1E9BA 1XQWA 2KE5A 2PA0A 1EZZA 1PZNA 1ZHHA 3A1FA 3FRJA 3IGFA 4Q4CA 1QP0A 5LLDA 2ZK7A 3TIIA 4U7FA 4Y8VA 3SG0A 1I32A 2XTZA 2ZTLA 4H18A 3L7JA 3G2KA 3ZZ1A 2CNBA 4TZKA 4XEHA 4IICA 4XIJA 1CZKA 3DZIA 1K6JA 1QHFA 3LU1A 3N2YA 3PYXA 4KAFA 4XIYA 1F0NA 2TMGA 3JWHA 1DX6A 3DZKA 5L7YA 4Q7MB 4ABYA 5C1BA 4MV7A 1SKQA 3I9OA 4MVJE 2IDMA 1XRJA 1YFJA 2R8YA 5M04A 4XWGA 4ZVLA 5AVYA 2HD4A 3IP8A 1TAHA 3CW8X 1X38A 2VTBA 1MVNA 2EFHB 2HYIC 1A88A 1BDIA 2WM2A 3OSUA 4PN3A 2KPOA 1RRFA 1V9SA 3DWGA 3F8SA 3QKWA 4QG7A 5U4QA 4ZEVA 2CXRA 3OQ6A 2VWPA 1BQEA 3BSFA 5JFTA 3OI7A 2V6MA 1N8NA 5BVGA 1V47A 3AM1A 4X00A 1FRZA 3KT3A 4C4YA 1G0OA 4LDQA 5JNSA 3IJRA 2WWWA 4RZXA 2VYVA 5CD9A 4I1PA 1N8SA 3QIVA 1WNFA 1KEEA 2FJUA 2VEDA 4AKGA 3PC3A 4HMPA 5BR4A 4G0MA 5K6RA 3I0ZA 1NQXA 4Q3BA 1GDTA 1HETA 4ARUA 3GRZA 1ELOA 1TM5E 2WINI 1YRHA 1JDPA 1NQOA 4ZTBA 4RTPA 4WKBA 3T1OA 4CEIB 4A92A 2WNIA 1M2EA 3M0EA 3OX4A 4OH7A 2JAXA 2BLLA 1IBCA 1RP1A 1P17A 1W4CA 2PTHA 5D00A 4TS4A 1OFUX 3ASUA 5IYZF 4YCDA 1XHLA 2GPJA 2X0JA 4F4CA 3FWKA 1KO8A 3D59A 3SPXA 1M1ZA 4P7BA 3WIVA 2P79A 3RU3A 1JI0A 4GDMA 3PLAE 5DFAA 2ZQ5A 2JLBA 1W19A 2J0UA 4RH3A 2DC1A 1HE5A 1XA3A 1GU0A 1TYDE 2W2NA 4GSLA 4OHWA 3ZUGA 1SQSA 3KWMA 4A2WA 5KJCA 2F4VB 1JVNA 3CLSC 4U6SA 4K87A 4NVRA 3H5LA 4HOYA 3S2GA 2QL5A 4BMYA 2RDMA 2E21A 1J0DA 1U2EA 1PFWA 3I9V6 4NI5A 4H0NA 4Q3EA 5D87A 3ROFA 1F3OA 4BNLA 1APBA 2OXEA 2GSDA 2HMUA 4EFDA 3KYCB 5KAMA 2IV7A 1CIJA 1BJRE 3PA6A 5LYJF 4B6QA 1ZH0A 3DOIA 2PLNA 1QS0B 4ABTA 1ZJ4A 1K8XB 4DM4A 1E4EA 1U90A 2OD7A 3Q9NA 4KXQA 1JLHA 2D1SA 4TRNA 2EV9A 3C3KA 3ANYB 4KN5A 5DCUA 3BFVA 5EXEA 1IRXA 3JQ7B 1FFBA 1QZZA 5E7JA 5LUAA 3VM6A 1QK5A 3NBUA 1TCBA 3QVSA 4MYHA 3T54A 2XT6A 1A98A 5FQOA 4XSHA 5P21A 1SKAA 2QEQA 3BSWA 1JA0A 1J22A 1GR1A 1NI5A 2Z9CA 3QPUA 4GZMA 5A3SA 4UM5A 3VXKA 5BSTA 2VNSA 3T9CA 4NCNA 2C1ZA 1TKCA 2VUIB 4NE9A 3QIAA 3ZU5A 5KHAA 2J0SA 4HNQA 1NLYA 1ZCAA 2F3SA 4I4TF 3ZVLA 2NYRA 2GFQA 4PAMA 4DY4A 5DWDA 5DXAA 1N2HA 1A9ZA 1EEXB 2CBZA 4UPDA 1OFGA 3GDWA 3AIKA 1BKDR 3CSSA 3PRKE 4RO0A 4UM9D 1T9CA 3JAMA 1GFZA 1HY3A 1WE2A 3UQZA 2BZSA 2PX5A 4WY8A 1N3BA 5BV2P 1FMJA 1DJMA 2BM0A 3VDQA 2AG5A 1M0TA 1XDGA 2Q3FA 1GNLA 1I0LA 3HSYA 5EPUA 2DH5A 5BR8B 1YRQA 1VSTA 1G5RA 2YWFA 2ZQYA 4CQLB 2Y1GA 1S8AA 2JFQA 4XEUA 3ZDRA 2Q1UA 1JAXA 3IJEB 4AX8A 2X14A 2Z95A 1R15A 2H31A 3HN6A 4CE6A 1P7CA 4CLDA 3K6SA 4ZO7A 3MJEA 4A91A 3JARA 2FQQA 3HR8A 4FYYA 4HWOA 3RAJA 3FPCA 3GIWA 2XQKA 3W2TA 4AO6A 5ADWA 5ES4B 1JT9A 2VHVA 4W9MC 1BHJA 3HL4A 3RODA 3QMWA 3TMKA 4JC5A 1XX6A 4ERNA 5JO0A 1ST2A 3L6UA 4FTWA 4JDUA 4KYVA 4L08A 4TKVB 1P1CA 3TRFA 1PJAA 4GPZA 4ZZ0A 2RD2A 2XSZD 2EFCB 1XKQA 3Q8XB 5B2ZA 3ZHVA 5HOEA 1E2MA 2C3PA 1PNQA 3FBTA 4DARA 1LQTA 2DBYA 4HGYA 3KELA 1OXBB 4N3CA 1FB5A 4X1KB 4NHOA 5IM5A 4QWWA 4DCUA 5KMGA 1LFAA 4LEIA 3A1DA 2OQVA 2C4WA 1D6JA 1QTNA 1V8BA 1A9RA 1ZM3A 2NXJA 2O0JA 3IT0A 3UCXA 5CEJA 1G2IA 3LFHA 4WXMA 1Z25A 3CPHA 5GZ6A 1P0PA 1Y8AA 3N8KA 3I04M 4JHXA 1KYVA 2A33A 4AZSA 2HPVA 4FFDA 1A9SA 1OOEA 3OQBA 5J63A 1FDWA 1XDDA 2CXSA 5IDWA 3I45A 2AYZA 1AGPA 1VMKA 2JHCA 4JROA 1R3DA 4HO1X 2AYYA 1AB6A 4DKJA 2FG7C 1IFXA 3OZRA 3JVUA 1XEXA 2Q1WA 3MOSA 3WGVA 2R1VA 1FNCA 4AJKA 2HK6A 4GNKA 3TSCA 4AM8A 3DE0X 2G4LA 4PNHA 2Q62A 2DHQA 4KOEC 1UPTA 4J76A 4UHEA 4WECA 3FMGA 2UZ4A 4MGZR 2VTDA 2ZYUX 1HNZB 2VWGA 1HZJA 1AV6A 1HYGA 4K2HA 1KHTA 1VGQA 1BCRA 1X92A 2IX3A 3DT9A 1BJTA 3T61A 4EDFA 2YYYA 1KRXA 2VT3A 1E1QD 3AM3A 2ZZNA 1IBLB 5CLQA 1I0ZA 2W4MA 4L02A 4MQBA 1UAGA 3KQLA 2ONZA 2QPLA 2RAPA 5FTMA 4AYXA 4CCSA 4C76A 4PXAA 4C05A 1R8QA 1MNAA 3QFCA 3NC1C 3BD6A 1OYYA 3FSRA 4M8LA 1KI9A 1ZPDA 1N3IA 4KDFA 1V48A 4B33A 1DEXA 4BLOA 2HQBA 5J4VA 4GZ6A 3OCYA 1IMOA 3DAYA 4QEKA 5KNBA 3SBOA 5LNK1 2FRXA 1SD5A 5FOXA 2Q1YA 1ZXBA 3GPCA 2OC4A 1UKVY 3PGLA 5F4BA 2YMMA 3OJ0A 4EGCB 4R2IA 5A4IS 1O97C 1ZIPA 3H4TA 2QGFA 2WU3A 1XOIA 1XIVA 1Z17A 2UZAA 3ZI4A 2AEEA 2W6IA 3NDBB 1PWYE 4QA9A 4FHFA 3BMQB 4UC0A 4BVAA 2YWBA 2OM2A 3AF2A 3TD6A 2VXBA 3BEDA 1KJ8A 1E94E 1S0UA 2HRCA 3LDFA 2B8TA 2IYQA 4FDAA 1Y7PA 3DFMA 4EG0A 4PONA 3K6RA 1CLEA 1CQWA 1NSFA 1Z8HA 3AOEA 1P33A 3ROKA 3DLHA 1C9NA 5L8VA 1ATZA 1O5IA 2HF2A 4L2IA 4QXOA 1VLQA 2HIMA 1YK1A 3UY4A 1DHTA 1NE2A 2NQ2C 1H4TA 5AW2A 4OGWA 1L1RA 2PGOA 1SBTA 4UOZA 1IHDA 5AI0A 4EPTA 3N0TA 4X8OA 3M9XA 1Z62A 4YDRA 2ZP1A 5BYBA 4OIMA 2O7VA 3VNAA 2GPYA 1YBHA 3R20A 1JXAA 2W00A 4I4CA 4P31A 2ZYTX 3ZV7A 1Z22A 2MOKA 3NDIA 2QLFA 4A82A 4AZ3B 3VNBA 2PS0A 5HEKA 1KNQA 5A4FS 4B79A 3K70C 3TLXA 3LX4A 3SQOA 4DJTA 1BSVA 5DM60 4PBSA 3D6FA 3F8WA 3QJ5A 4GC5A 3ZY5A 5MN4A 5SICE 2BGMA 1Y33E 2GZHA 3K4QA 2PGDA 4LSMA 3EA0A 1VE7A 3L77A 2X1VA 5F1OA 3M6FA 4BKPA 2ZUFA 1HMYA 2VWHA 4XWTA 3VO9A 4BX0A 3K9CA 3M6XA 4P80A 1CIPA 1QDLB 1RIFA 4YRQA 1TO6A 3IV6A 2OO3A 3BJZA 2DWUA 2COEA 3OJCA 4KIJA 4N82A 4OMDA 4Q9JA 4CM4B 1V41E 3LQFA 4AF6A 5A0VA 3B1ZA 4F38A 3OZUA 1JBQA 3UHJA 3U60B 3VR6H 1IBMB 1SA0B 4W5NA 4JI6B 4YV0A 3K8QA 2GN2A 4RQAA 4F93B 4JP2A 4MV1A 1G2OA 3WGIA 2WFZA 1TC1A 3IAM1 1OZGA 3ZK8A 4YJHA 1MX1A 2NVBA 5IK2A 4MI9A 5ILOA 2Q0QA 5G1PA 4FJ1A 5CU7A 5ILGA 3WTCA 1EFTA 3I6BA 3E82A 4A8JB 3LXRA 5A06A 2A1TS 2L42A 3WB0A 1EXDA 3F0TA 2FPUA 3U39A 2WVHA 4IXNA 2XY4A 1L7VC 5KQSA 2VNJA 2FI1A 1BROA 4IDPA 2G0AA 1I7DA 4BJ1A 4J0KA 2B99A 4E14A 1CHNA 3HU3A 4Z8XA 1N0UA 1GSHA 2CHFA 3LP5A 2AEMA 3MLAA 3QUTA 3IEPA 4I1UA 5I7OA 1OW3B 2M32A 4HATA 4JIGA 2ISSD 3TUZC 5IYZA 3REGA 4LDRA 2WWTA 5CFNA 2PGAA 4ZAGA 1IIBA 3HHPA 4L0CA 3FLEA 1ZMTA 4MUEA 2QS9A 4G2NA 3BMXA 3K32A 4KNVA 4LBZA 1P9RA 4L8VA 4ZN6A 3H87A 3ZTYA 1ML4A 1KJJA 5I4BA 5LSAA 3K9FC 1ZGJA 5CBPA 4HTFA 3I5AA 3SR0A 5HTKA 2XNJA 5K3OA 1NYQA 3KM0A 3WZMA 3IIKA 1RPNA 3KEMA 2XYPA 4R2HA 3F6PA 1F8YA 3U4IA 3ERCA 1JU3A 4OSOA 1YFKA 2C7BA 5DHFA 5EQJB 1PJZA 4X85A 5FPYA 3CFYA 4D80A 2NUAB 1C9DB 3WYDA 1E4OA 3E7WA 4DM3A 2AFHA 2PKYX 4HQLA 4L0MA 4S1WA 5LYJA 1RZRA 5IWAB 2LDBA 4IKEA 2ZAIA 4V1CB 2XE8A 4PLZA 4IV0A 4ICIA 1YOVA 1E9CA 2AW3A 4PYJA 3IMEA 4D26A 3GMSA 1QPZA 2ZGVA 2YVKA 1KY4A 4BB6A 2O2SA 3AF5A 4JNCA 4OP1A 5FI0B 1QCDA 4PHTA 1QV7A 2OILA 4Z4HA 4MVJF 1R7RA 1FTQA 2G77B 4RA9B 5HF9A 4C0AC 2BH2A 3BXXA 3HM2A 4EW6A 1ZEJA 2AJCA 3MM4A 1T0PA 4MDYA 4P92A 4DA8A 3CISA 1UMCA 3OUUA 5U9CA 3QLJA 2BTOA 3UOAB 4CDNA 3Q4GA 3L0YA 4FOSA 3CH7A 4ITRC 3G88A 2X0NA 3MMPA 2G6BA 3CS3A 1KE2A 1G55A 5TE9A 3JYQA 3P7MA 4G81A 1DT5A 4ZI3A 4PC7A 4X1OA 3GAAA 2CV1A 3ET5A 5EZQA 1H4QA 4DMRA 1W4AA 4RD6A 2Y6VA 2WJZB 1YE3A 2JFWA 1GGEA 2YMQA 1P80A 1TJNA 4LE2A 4HLCA 4YMSA 4F60A 5A0FA 4EYKA 4UQOA 2FPWA 2O3QA 1EFLA 1WCYA 4DMCA 3OUZA 4K6HA 4P7GA 1ONBA 1TU3A 2G83A 4TQ9A 3KU4A 1WMEA 4NMLA 3VPAA 4CYMA 4EQ6B 4ZA2A 4DYVA 5UKDA 2YV5A 1UDXA 3LX8A 1EFDN 3H05A 3GZNB 2ZDGA 1JAHA 4C3OB 4UM7A 4QTUB 4N54A 1PSZA 4PQEA 3V8RA 4QIHA 1JTEA 1H0HA 5DXFA 3I8XA 4O2BB 1BEUB 1WLYA 4D41A 4NZOA 1XG5A 2X8JB 3NUZA 4M1SA 4TXHA 4EFLA 2CV2A 3TD9A 3GEPA 1E7QA 2FFQA 5C5CA 5ER9A 1JIXA 3NHZA 3AI1A 3TZBA 1EJ0A 2D6FA 1V5IA 5JJIA 2JBWA 1RM0A 3CB4A 4JP1A 4DIFA 3BWEA 2GOYA 4PQGA 3FOEC 1KRWA 4HLDA 1E3SA 1UDRA 1UL1X 3TINA 5GM1A 1SOMA 2XGGA 3I04A 4E88A 4HVCA 2Y2UA 4L5AA 3THYB 3UA3A 4O3MA 4H77A 3SI7A 1BH6A 5EVJA 4G5FA 3SFTA 5HWSA 2G0NA 1JIQA 1ECLA 1GN8A 4PZDA 2RHDA 1QQBA 421PA 3GBSA 4ROTA 1CQPA 3HYSA 1PT7A 3TUJC 4XI9A 3TSYA 4A0HA 2J48A 2XCOA 3WNQA 3O4GA 4JYPA 1A5ZA 3NGLA 3LCVB 4MKXA 3LCJA 1KF0A 3DNFA 2WG2A 3P9YA 5I3CA 5E8JA 4YJKA 4LVNA 3GEEA 4QUAA 3R40A 4R7TA 4J0DA 3RV3A 4UQLA 5EE9A 2ODAA 2XAAA 4RZIA 1ZN7A 3HVUA 1XQVA 4NZPA 5DF1A 2FQWA 4PCAA 2F59A 3H5WA 3D7KA 3RVPA 1W1UA 5EJEA 1MDBA 4G5QA 1U4OA 4PR3A 3CPJB 3WLRA 2DHCA 1NMSA 3K9WA 3M3DA 2GRAA 1M1NB 2R62A 4I1VA 4KR2A 1ZGBA 2CB0A 3IUJA 3BXGA 4O6VA 3SKVA 4LOJA 2XCUA 3FDZA 3UAGA 1WBBA 3RTAA 1GPJA 1FNMA 2JEYA 3HMKA 3S8YA 2Q4EA 4XGIA 2GCGA 1FP2A 3MW8A 3DXZA 5CA0B 2E55A 4HJXA 4AJPA 2R84A 1SVOA 3I05A 1P9NA 4JFAA 2YFKA 1J1IA 1GOTA 5DBFA 1PZMA 4DCPA 2JH9A 5E2BA 6PFKA 4J03A 3CVWA 3GFBA 1HEUA 1CPYA 1G4HA 3WP0A 1HTTA 3N2GA 4LC0A 5A9RA 1Z29A 2PWPA 4Z4CA 1CNEA 2YN2A 1QCYA 1TTHA 3CVOA 1DKMA 3MB8A 4Y6RA 1NULA 3DVAA 1TQDA 1YZGA 3QVWA 4KWEA 3IURA 4DQDA 4CV1A 2RGRA 4QDJA 4HFRA 1DBVO 4N40A 4RBNA 1XZPA 4XUEA 4RK5A 4DA4A 3WJAA 1ZUIA 1DQSA 1XTKA 4QU0A 1DADA 2AK3A 5BT9A 1RHRA 5FNVA 3FKSA 1ZESA 2CE2X 5DYIA 3TAUA 4M9SA 4YI5A 1L1EA 3CG4A 3GEMA 2NO7A 2I3ZA 2P4HX 3IP6A 4IDFA 5DRYA 4ZVNA 3LO5A 3TG2A 3EOAI 2JGRA 4G8JA 2HA7A 2G3YA 3QFHA 4K88A 4GYWA 3LQYA 2PZKA 5LFAA 2W90A 1C0LA 1OA0A 1JFFB 3ZE2B 1BG6A 1K3UB 4EEKA 4L8FA 1Y4UA 3KYCA 1PV1A 2IU0A 1HX7A 3FFAA 1P4RA 2IV3A 1TUBB 2WJPA 1O0BA 1S1CA 3GJSA 3KPWA 1GGVA 1IHXA 2VBIA 3OX2A 3DVLA 3IVRA 1UT5A 5B3JA 3CZCA 1QTRA 3JQ7A 9MHTA 3O9VA 3AVQA 1PHRA 4QDOA 4TV9B 3L8EA 4C87A 1U9IA 3HABA 4PRLA 3M5CA 3BUSA 2QTFA 1GYRA 3FHLA 5LXTF 1WQ3A 1TLLA 3DZJA 3IPYA 3KL4A 4S1TA 3GLRA 1XAHA 5DX0A 3QOXA 4DBZA 2I6TA 1HZZA 5EMJA 4BNGA 4LQCA 2UAGA 1CRLA 1GPKA 4UHKA 3V7YA 4BGUA 1L8QA 4YONB 2O2HA 5B58C 1IY0A 1EUQA 4D3FA 3ZBTA 4ER0A 2WTAA 3RHZA 1Q7RA 1BE0A 3KVRA 2DX7A 2BEUA 4B4KA 1ML3A 2VHCA 3H6HA 3ZPXA 1RYFA 2J9YB 1C7EA 4HMQA 1HNNA 2D74A 3HA7A 5DHAA 3FD8A 4H2DA 4AMZA 3QOFA 3VDMA 3FR7A 2WJYA 3IPLA 3OD5A 4L5CA 1CQIB 1WTAA 2QTLA 3B89A 3VDXA 5K4HA 1PL7A 4WOBA 3QA3E 1TM3E 1SIOA 4KEAA 4GSYA 1EZ1A 3TLZA 2PR7A 3AUTA 3QP9A 4PV7A 4EGJA 4CEJA 1XWIA 1C0KA 3E70C 3HU1A 2Z2XA 3WVNA 4U5QA 4BLWA 2DPXA 2ZSFA 2AMFA 4LDAA 4LFCB 1MAUA 2FZ4A 3A1VA 3BHJA 5H9WA 1JHZA 1QAOA 4YPVA 1GCOA 1V2HE 4MV9A 1TJ5A 3LYHA 2DVMA 4CLRB 4BASA 1N77A 3VKHA 4KR0A 4O2BF 4BMNA 2MINA 2XI4A 4LE0A 1MQ8B 3C3DA 4WQMA 3G17A 3I6MA 4X54A 3MK31 4BU1A 5JADA 3AM4A 5F3DA 5I7HA 4OUKX 1WXEA 1T1RA 3M6VA 4MGYR 2GN4A 4AZ0A 1Q7CA 1Z39A 3GCGA 3JWPA 1AKRA 3VHRA 4FB4A 1XZNA 3WGOA 5LVAA 3A10A 4US0R 1F2VA 3GVHA 3MWEA 4GYJA 2BP7B 4KFRA 4R40A 3W06A 4EB0A 1AS0A 3BF7A 3L6RA 1C1XA 5KYKA 4M55A 4DOMA 4XJTA 1KPIA 1O94C 3DEHA 1M1YE 3PQFA 2IPOA 3O8QB 3OE7A 2N1MA 2OGSA 3PUXA 4I1OA 4RV5A 3PUHA 4KIWA 4XDGA 2HK7A 3KK0A 1PGPA 4KLCA 4MW7A 1R2QA 5BQ3A 2IXDA 1X2EA 4NU0A 5EZ5A 8GPBA 1CF4A 1NL3A 1F6WA 5CDGA 1RQ7A 4NZ9A 3ZKAA 3R7WB 3CNQS 5BWMA 1GR0A 2ZB3A 4D4LA 1EFVB 1OI7A 1U0EA 2CXNA 3GLTA 5JATA 3OEHA 2PT9A 1RCUA 2VT6A 1L3IA 1Q57A 5EIFA 1U7HA 2R6FA 2ZYWX 1YE8A 1ZL2A 1J2RA 2GXSA 3GLQA 3PHGA 4PLYA 4QO7A 1M6HA 3UMYA 1P9WA 1YIAA 3DBOB 1SXJA 2JI4A 1BXKA 1GL9B 1SOWA 1JW9B 3B5IA 3GRRA 2DGDA 3ME5A 2VQFB 2R9VA 1XMJA 4BLRA 3MNFA 4CKYA 5CA0F 1K8YB 4YWJA 1Z12A 3ICQB 1HWYA 4A0FA 3ICEA 1YZLA 2XNDD 2AQIA 1TEXA 4NDAA 1ZH6A 2ECFA 1M6NA 3LA8A 1POWA 4F3NA 1KIAA 1CRWG 3AOEC 4E33A 4YO7A 4MVJA 4D98A 4NH4A 1PDVA 1VHWA 2CBXA 2ZT8A 3ZZNA 5ADHA 3UB3A 1WIWA 2D2FA 2V7PA 4M0CA 5FI5A 3GLIE 4B3GA 1V35A 2V6JA 4G4SO 1MIHA 4RWEA 3T5MA 3ZS9A 5KTKA 4IQFA 1J42A 2Y0PA 2XMRA 3FUWA 3R5FA 1HDCA 4HDMA 4M86A 5F35A 1TNDA 1KJ9A 2C5AA 3A9TA 3U1BA 2H1IA 1O1YA 2J3EA 3UBMA 4Q02A 4GL2A 1T25A 2N75A 2V0GA 4MV5A 1LI4A 1C2YA 2PJDA 1C80A 1YU9A 4M9CA 3EHDA 4MW9A 4AB1A 1NF2A 4F8EA 4Y7DA 3GUHA 2QQ0A 3KSRA 3OEYA 3GRFA 2RGGA 3QKUA 1NVEA 1BRTA 3VBEA 1OAOA 3R7LA 3MWDA 5CPBA 2CLSA 1P2SA 2MYNA 2XAUA 1UMDB 3QU7A 3RGWS 4UUOA 2X8WA 5BW8A 3DBLB 3VMFA 1HF3A 3FGNA 4TV9F 5A5VA 1MXFA 3LQQA 4HY3A 4D4MA 3DAHA 3SC4A 1VCMA 2DUJA 3DXXA 4GLLA 1DX4A 2GO7A 3JWEA 1IU9A 3MTAA 3MEQA 4FDUA 4OXXA 4ZYVA 4JL5A 5KNBH 3DVRX 5A9TA 1Y5RA 2AE2A 2ACWA 4RSHA 4ARSA 4DJFC 4EELA 2OQ2A 2VATA 1TMKA 1V9LA 1W88B 2OCYC 2EC5A 2WIBA 1SBCA 2O5RA 1JEAA 4JNKA 4OIFA 4WCFA 4B73A 1Y4ZA 1NVXQ 5DWQA 4F84A 2JFGA 4RIFA 3ZVNA 1J8QA 1XA4A 3DT6A 2HA0A 1MC5A 1E61A 3BRSA 3CUSA 3MPOA 3P9NA 4JLBA 4LDNA 4M88A 4UUAA 1K66A 4BECA 3UG6A 3NMUF 3RLFA 1YQWA 3QVLA 4GDFA 4QLOA 1PQUA 2XKAA 4CF4A 2XYGA 3ZHTA 1GD1O 5TQJA 3USES 1W4BA 3VAAA 1CUVA 1UC4B 1WUJS 3H17A 3Q3JB 1POXA 4UTXA 5HHTA 2PBZA 2BONA 4B3HA 4MX8A 3AO0B 1DG3A 4HNSA 5EJAA 2YNMD 4ZVTA 1JJVA 3EC2A 3LVRE 2R87A 4C3VA 3SIXA 2MMCA 2W7TA 2XXBA 5BNZA 4LFAB 3PE4A 4MWCA 3E8MA 4ZJUA 4Q3CA 3RVJA 5EIBD 3A1UA 3FPGA 1OI4A 3QV2A 4K3UA 3P2OA 4URYR 3ULKA 3CM0A 4C2BA 4OI4A 4MHSA 3ZGZA 3E9NA 1SVMA 3IBYA 3NHAA 4BMXA 1HPLA 3ZQKA 2FFJA 1I13A 2VNAA 3CT4A 5IJXA 5BSWA 2DBZA 1ABFA 3UJHA 1RJ9B 3O26A 3RVOA 2I9PA 3C3PA 3LOQA 3P2KA 4BZZA 3PFWO 5CAEA 1QRSA 3F5SA 5FBWB 1EX9A 1F8UA 3ML1A 5CNKA 1QB8A 4WOJA 2QG6A 4RTMA 2ZR8A 3HU2A 3LC7O 4JVSB 4N0PA 4AN1A 5KKCA 1KK0A 4F3KA 1VLMA 2NYAA 2VO1A 3T3NA 1G7TA 2OUKA 2W8BB 3HCNA 1YC5A 1RM3A 5ANRB 2V7XA 2YDYA 2O07A 1C7ZA 5JAHA 5E6RA 4G41A 2C2MA 1ULAA 3MPUA 4TWZA 3KVNA 2CC2A 2HIGA 5K05A 2W2LD 1YQDA 1ADJA 2J7PA 1HTWA 5FX2A 5B57C 4JVLA 4Z53A 4P93A 4I19A 3U3ZA 4QGGA 1XDSA 5DM2A 3ZD7A 4N48A 2ODQA 4J91A 1EHIA 1ORWA 1RADA 1SVKA 3KIPA 2RJOA 1JDJA 3D7NA 1EU1A 2PX3A 4LXYA 4MWTA 3D6VA 5KPDA 1OKKD 4TMXA 4RIGA 1EE2A 4YAUA 1J21A 1GADO 4AMGA 1QH1B 1KAEA 1HT3A 2B92A 1S2IA 3L9XA 3ZC3A 4M7RA 2LNDA 4WLNA 5SV2A 3EBOA 4QNNA 4BUZA 3PQ2A 4HEJA 2M1ZA 3WFJA 5JAPA 5K8VA 1I4DD 3F3YA 4PO3X 4V1CA 1ZWKA 1YB7A 4IDDA 3BK1A 3C1OA 3KPJA 2NU8B 3UHPA 2P6MA 4JWTA 3EW9A 3D2LA 4K86A 3C1UA 3OCUA 1K7XB 4MS1B 4N0EA 4RL4A 5EPOA 1SPXA 2V0CA 4ND5A 4G23A 2JLAA 4LWPA 4F0JA 1M1YB 2NAPA 2ZIUB 1DQYA 2E6UX 2V6BA 1KR2A 1V45E 3GJ8A 2R66A 5LXTA 3R41A 2XDQB 1ODLA 4EHNA 3Q2KA 3IPAA 1R0LA 5CB4B 1G60A 4R6XA 2O05A 3D4NA 2PKQO 3N87A 1TZKA 3EDMA 3IBGA 4HYYA 4J0IA 4G0YA 3SE7A 2ZUTA 2L17A 4AG3A 3DE6X 4EYSA 1ES9A 4OLHA 3O3MB 2HA3A 3L1HA 1AKTA 1Z5UA 2P5SA 4LGVA 3BOSA 2F1IA 4NOJA 1P3JA 1OQAA 2YYAA 1E3WB 4JJEA 3AJEA 2V3WA 2VP9A 5DIZA 4Q03A 4DA0A 3C3BA 4ILEA 1FP4B 1P1BA 5D3MB 1JFLA 1IQUA 3RSCA 4E6EA 1NLZA 5DNCA 2A1UA 5KKAA 4Q3KA 4D57A 2VF5X 4BV2A 4EUNA 3ETGA 2BI7A 4G09A 1OKKA 5ELLA 1E7MA 2W83A 3EIHA 1ZYUA 3HUUA 3PFBA 4LYDA 4EBFA 4EYGA 3NYQA 1DARA 4ZCTA 1P5HA 1A4XA 5TJHA 1GRCA 4Z3DA 4D9JA 5KTSA 4A27A 1VJCA 3UJPA 3AYZB 3AHCA 5ALHA 1KYTA 4DUGA 2W71A 3EB9A 3K1YA 4XCVA 3VPHA 4D9FA 3G5AA 1GGNA 1CEXA 5EKUA 2WM3A 2BMVA 4ZCPA 1UANA 2O1SA 1M75A 1PS9A 3U4AA 1LWNA 1QGAA 1V1RB 2H2FA 3GLIB 4X65B 3I2JA 3ORFA 4MI3A 3W0LB 2ZAGA 1YIDA 2WJHA 1EP9A 2RGBA 3K16A 3M82A 4PZCA 3MQ2A 4DMUB 2Z4TA 4ZCRA 1E4VA 4DQVA 3TX2A 1HKUA 2UVQA 3U3KA 3ZIAA 1ZX1A 1VHLA 5ETJA 1NVKA 2AOVA 3L1KA 1X7YB 1K9SA 4MWDA 5ALZA 3CURA 2J9FB 2XUPA 1W8IA 4REMA 5AVTA 1CUWA 3AVOA 2OHIA 2YWGA 4JXJA 3GFVA 2GKGA 2JIMA 5EZSA 2RSLA 2QRJA 3WYCA 4PIVA 2BJHA 4F3TA 4XWWA 1S4MA 2QYSA 5FV7A 3AKEA 4LPSA 1TMGE 4NBRA 1U0SY 3FKQA 2XNHA 4I81A 5KTPA 1JEYB 4KPYA 4EGQA 2L2QA 2O8NA 3FWNA 5JJLA 4DS3A 3EQ6A 3AI7A 1TM1E 4JP8A 4OMFG 3OURA 3VZPA 1M10A 1EFPB 5AQ1A 1BGXT 2Z6AA 1P7WA 4JEHA 3AVWA 4WTOA 3RNLA 1VHQA 1Y81A 2B1RA 3U4QA 4QWMA 3JQAD 2BFPA 3KQWA 4K9OA 1J39A 2Y1FA 1FS6A 4YCNA 4FQ8A 1PK9A 2OXIA 5CFPA 1XQXA 1Z6PA 3SSMA 3UCFA 1P44A 3N5KA 4OVKA 3U9LA 4FINA 1ZOPA 5FLYA 4EITA 2A9PA 4URXR 2MIIA 2NNWB 1DX9A 2I54A 3QKSB 2VDPB 4B75A 3VISA 1MX9A 2ABWA 4HAZA 1AKYA 2H1SA 5FA6A 1YB1A 3KQSA 4DJEC 1TCUA 1RQRA 1YJAA 2AK2A 2CVQA 2H85A 2IYOA 2X7XA 3ELWA 3QXCA 4NATA 5CA0A 4KO1S 3LUAA 1IPFA 5TPZD 3KOMA 3LY5A 3T35A 5LPNA 4FR5A 1TVMA 1X80B 1MJFA 4RYLA 4BTLA 1DQPA 3FTPA 5B3JC 1SXIA 1EG2A 1CB7A 1C4OA 1QCZA 1U9IC 4JR0A 3KE9A 5EWJB 1LPPA 3EAFA 3CXRA 1EWRA 4LNUB 2YN0A 3I9NA 3UT5B 2ZDQA 3FA2A 5AK3A 1FFYA 1XRNA 2Q4TA 4Y1GA 3X1JA 5IKEA 1KH2A 2GERA 2CFCA 2XCSB 2HIHA 1SAYA 2B25A 1C7QA 3SIRA 3DE7X 4J1NA 2B7CA 5AP9A 1Y5IA 2PL9A 4RLFA 3AWIA 3WC4A 2J30A 4QUGA 4EG4A 521PA 2WZQA 3ER9A 4MYCA 2O5EA 1HH4A 5I4CA 4O4LF 4DIKA 4RHTA 1L5MA 2GVZC 3K31A 3OZIA 3T94A 5FOUA 2CCJA 1N78A 5B3LA 5KJEA 4TVKA 2ZBDA 5JSFA 1L8XA 4LHZA 4CHGA 2QDKA 2R1ZA 2AQ8A 4Q9NA 3L92A 4YMLA 1RAGA 2WUEA 4CLOB 3I4CA 4BFZA 2PNJA 1LW7A 1VQ1A 3O91A 4LJRA 3GCDA 3TYXA 1OB2A 3C48A 4BV8A 4TV9A 1D2CA 1E62A 1ZO8A 4RCVA 3UJ7A 5EVCA 5F33A 5KTOA 4L73A 4U9HS 3ANTA 4KV9A 5LP6B 1GPLA 3EFBA 2BVNA 5DLYA 4Q39A 5DHPA 1LLFA 1OBOA 2O0MA 3CLUC 4JVOA 1E1YA 5AKXA 3C6YA 1IBSA 1CFJA 1FDRA 4IVRA 2KSQA 3AT1A 1UP4A 2PGIA 1PD0A 2P9JA 5HIIA 2ZANA 4RVCA 2QQEA 3PKIA 1RWXA 4X6XA 1NPDA 3WI7A 3N70A 1WP9A 4QPZA 1CQIA 2GO1A 1THTA 1F1BA 5AKJA 4B43A 3ND5A 4MI1A 2WIJA 3GVCA 1E3DA 3K0SA 4POOA 3ITKA 1I5OA 4UM9B 3DS8A 1RWKA 5JMOA 3PDJA 1KORA 3OPYB 4BFVA 5K0FA 1RYBA 5FUVA 1EA7A 4BVJA 3NTRA 1JH9A 3DE2X 3ZCVA 3RVMA 2VLIA 3BH7A 4N18A 1HDZA 1GO2A 4IZHA 2BPOA 4RL6A 2EWVA 2QL9A 2JK1A 3I5YA 3A4IA 2IE0A 2X1MA 2D7JA 3Q3CA 4GQAA 4ZVQA 5T57A 3FCSB 5B7NA 1E0JA 5ESDA 3WMWA 2IXTA 5HPYB 1PVDA 3F6CA 5ALIA 1P45A 2E4XA 2C8KA 2XD4A 4EHDA 3KTAB 1GQFA 4C0SA 1K27A 1FQJA 2R7NA 5IM4F 2VDQB 4ITVA 4C0HA 2CHGA 1SXJC 2OLEA 2CZCA 2HRBA 4L95C 4NHEA 1QHGA 3LBNA 3EIFA 3GL9A 4O4HA 3GRUA 4C78A 1E66A 3EOZA 1I1QB 3GJRA 2G1UA 4NABA 1MO2A 3PTZA 3RC7A 3TL2A 2BP7A 5NULA 4Q4LA 4WESB 1O57A 4RK0A 5I6DA 1TO1E 2B4RO 2BGUA 3PPYA 4RGQA 1DHRA 1QONA 3R5TA 5E7IA 1G0NA 1LD3A 2VWQA 3NJ4A 4OI1A 4DDUA 1E92A 4RFSB 1EBUA 1OHHA 5FP0A 2ZIAA 1THMA 2EKLA 3EWIA 2CCGA 1KMHB 3PC6A 4KPGA 4Q6BA 3KPYA 3S55A 1CERA 1VJTA 1XYYA 3IE2A 3PJRA 1LH0A 5AOAA 2I9KA 1VM6A 4MV3A 4OAOA 1DRJA 2QJFA 4GVLA 2EEZA 5KI6A 2I6XA 3MBIA 1UC8A 4PZPA 1ZUWA 4O02B 4CMCA 4NCBA 2NUBA 1N9ZA 4PXYA 4BAUA 1OXXK 1QRUA 3P4YA 3NTUA 1EWYA 1NUQA 2GCNA 1XRRA 5JSZB 1DDOA 4BGEA 3UXEA 1W85B 2HHJA 4ZK6A 3ER8A 4NBWA 4RCZA 2VNKA 3JZIA 2YVAA 4M54A 4MKZA 4MUMA 4XIGS 1ODCA 5FI1B 2D1FA 6ABPA 4MUGA 1YGYA 1OAOC 5DLDA 4TMKA 4D8XA 4ISBA 2Q5OA 3K7EA 1JSLA 4RVSA 4UNPA 2EGGA 1EXMA 4AS1A 4LW8A 1XMVA 3TW8B 4KNYA 1TVEA 1X8LA 1GPNA 4X63A 2J3IA 1RBYA 2FE1A 4C4RA 4IRUB 5TSDA 3ZHRA 3U0VA 3PQCA 1P8AA 3RIHA 1INLA 4GECA 3ZU6A 4NFSA 3CSDA 3L6CA 2C8JA 2GF9A 5JMWA 4RTRA 1EEHA 3SBXA 1LGYA 4C7MA 4NONA 2CSXA 4QUKA 1A9QA 1MFZA 3KWJA 2ZE8A 3SK0A 3AUYA 4WCFC 4BC1A 1W4LA 1QQ7A 3CNEA 4MV6A 1XZLA 2WHYA 4MWEA 5FLEX 4PNPA 1R9JA 3ZE7A 1RQNA 2NADA 4B3BA 3LDAA 4C0XA 3NWPA 4WK0B 3OX1A 1GG2A 4INZA 2H7VA 3QVXA 5CDHA 4E12A 2R86A 3DMDA 5DOVA 2APJA 2NSJA 3BGIA 4ON9A 1E6WA 5B37A 4C4OA 4D9NA 4LYAA 3AUJB 2VJMA 1JQ5A 1RFLA 2VJQA 3CT6A 1CT9A 4C6TB 1A9OA 5FBLB 5JTTA 2RKBA 1YCHA 1VKNA 1QIKA 1IATA 4MVJH 1ZVMA 5F77A 5JSYA 1MCZA 3U17A 7AT1A 2IYRA 1SURA 1PV2A 1KZ7B 4YJ2F 5LZ2A 3D9QX 3DBLA 3QE3A 1ZBDA 2C88A 3A1CA 1BN6A 4RM3A 5K9ZA 3B7GA 2JD0A 3B8HA 1JE0A 4BLUA 4J7XA 1I7LA 1NIJA 4JJKA 4AF7A 1T2FA 4HNRA 4PG6A 4WVFA 4PZZA 3S2ZA 5LP6F 2AN1A 4GZLA 3WL7A 4A6XA 5JIBA 2PJUA 4WW0A 3WGKA 1RYEA 2WV9A 3KL2A 3F7OA 5KQLA 3GRPA 1W88A 5I8ZA 3DAFA 4F7DA 3WGMA 4PPYA 3AHEA 3ZJTA 1PVOA 4PAGA 5CH5A 3BCRA 2WVAA 3CEJA 4P4GA 2AZMA 1D4FA 3TL6A 2CMDA 4A8JC 3U4GA 1BJKA 4QBHA 3W5VA 3D8RA 5IVKA 3D1JA 3OOYA 1KOFA 4X6UA 3ZD9A 5FWYB 4KXUA 3UJ9A 4MV4A 3VU9B 2EBWA 4ME6A 1NW7A 2OORA 3H16A 3ZYZA 1U6IA 3EG9A 3LY9A 5HGXA 3OJLA 2ZAYA 3EAQA 5DGDA 3T5PA 1BD4A 5KVSA 3QENA 3E5NA 3HA5A 1GTJ1 2JEZA 3DDNA 2OG2A 2ZVQX 4L5IA 1CZHA 3G1UA 2YYZA 1T6XA 4LF6B 5L6LB 3OTQA 4I50A 5CIWA 5TXGA 2QJOA 2FDCA 2NP6A 3RI3A 3IR7A 3P9KA 5DHUA 2YJZA 3MJDA 4Z7NB 1TTTA 3KBBA 2AOWA 2EW1A 1QWOA 3BK2A 3J80A 1U2QA 2Q5LA 4UXJA 3HNRA 1N1MA 3KXKA 5EG5A 1TUIA 3I1FA 5HQJA 2QR5A 1MOSA 1HDGO 2WKRA 4TLDA 4CM9D 3BORA 4F4FA 3BHMA 4KUGA 1PSWA 1RJ9A 3DDSA 4DEVA 1ZA1A 1IOVA 2Q0SA 3A04A 1Q19A 3I32A 4FS3A 4I08A 3KT0A 1XFDA 3B3GA 2DWOA 3CCFA 3HYLA 4UE2A 2JGIA 4UDXX 1AIPA 1Y1PA 3OOSA 1P77A 1GZ3A 1V6AA 2IEIA 4JLVA 3VOAA 1O54A 2H1FA 3Q7QA 1NJFA 3KR0A 2CFOA 4XGRA 5ECDA 2ZCJA 3C1AA 4CIWA 4NYIQ 3RM3A 3A6GA 2UKDA 4ZD6A 1QFSA 3SLKA 2W8BA 4BYGA 1KBOA 4MVXA 2IS6A 2IYXA 2C59A 1UZUA 1Y9EA 4U9IS 1B8UA 1IAQA 4PG7A 2OM6A 4XIFA 3EGCA 2ZUBA 1CDDA 4PR0A 3ZR4B 1HLFA 4BQFA 4YRLA 4KX3A 4OQDA 3CRQA 2D2IA 2CDBA 2H4XA 1YDFA 4DYHA 1M73E 1EWVA 3OX3A 3V48A 5K0ZA 4GI2A 1H4SA 3O21A 3C6QA 4XPIA 4REQA 3OY7A 1GPMA 1PNOA 1XUOA 4KFSA 4QXPA 3BRWD 3K3PA 1U3VA 4AMUA 4E2ZA 2WFLA 4GBMA 1KI6B 4JN6B 3ZXYA 4D9CA 4YC7A 4DBVO 3GLFE 3CJTA 2ZSJA 2VHUA 4HNUA 4O4LA 4W8GA 5JV5A 1B1AA 3P9PA 2QD2A 2I4LA 4UEKA 2ISQA 3ON5A 2GEDA 3HCCA 3PC7A 4AC9A 4DLBA 3H11A 1ZSYA 1GIAA 3HJRA 2JAOA 2V7VA 3TIVA 1MEEA 3KHTA 3SE0A 1XYGA 3R74A 3SHWA 5TRTA 3ZVRA 1V11A 5LQRA 1CCWA 2OXFA 3VR1A 4J1QA 2YJGA 4L15A 3SSNA 3TZHA 5BVHB 4C4XA 1NQ5A 1QYCA 1YS1X 3A9WA 3CLTC 1EK6A 1FBNA 4HRAA 2AKEA 4FFRA 3J7TA 2IJGX 3C3JA 2UZ3A 3I0NA 1NW4A 1ZOLA 3VA7A 3UUFA 3H1EA 1T91A 4ENWA 3JASB 5IF3A 4NYMQ 4GM1A 4I2VA 1PR3A 1K7SN 3I6QA 3JQEA 1D7OA 1OU0A 4XR9A 5T5QA 2XQVA 5LBUA 3RSLA 2XT0A 3C15C 3RW9A 3KJNA 1M8KA 3ICPA 2WQZA 7MDHA 2VQSA 4EY4A 1VG0B 1YDMA 4WLVA 4C2UA 2NNLD 4B3RB 4I4NA 1WXGA 1CXZA 1AQIA 3V2IA 4OH1A 2YHIA 1ZVKA 2RGXA 4OEHA 1BYIA 3ZKWB 4TLEA 4IG9A 3FUVA 4KNWA 1UJCA 3DO8A 1FMLA 1RYNA 2FPXA 3IVAA 5COQA 2PA3A 5AI6A 1SUIA 3V32A 4X91A 1E7WA 4BGIA 2PGLA 5KVVA 4YQFA 4PPNA 1R10A 2A84A 2FHSA 2Q3MA 4HDKA 3UT0A 4DSUA 2O1WA 1OI2A 2Z2IA 1IQPA 1LBQA 2ZUSA 4FHZA 4OQLA 1OVGA 4R31A 1AS3A 3A9SA 2F8MA 3OECA 4GLFA 4KREA 4FJ2A 1F0KA 2ZWMA 4NC9A 5DISB 4I3HA 5FWNA 1EQ2A 2YJ4A 2Z4RA 4MV8A 3WAJA 2FPSA 5AKEA 4UZEA 3RAEC 4XB1A 2EL7A 3E2PA 1NTOA 4HNAB 5ALGA 5EHGA 4IEFB 5E8RA 4LF7B 4EUKA 3RUCA 3A8TA 1K75A 2IXAA 3R3VA 4FVTA 5C53B 4M0LA 5EUBA 4NENA 4MJ7A 1NVTA 4AP5A 1X1CA 4CMKA 2ZB2A 5IM4A 1EAMA 2XWJI 3KDAA 2WHQA 1E0DA 1XCOA 2E85A 2PLRA 2WTMA 4U7WA 2VEOA 3O2JA 2JL1A 4OAPA 5IDQA 1QAMA 2WP8J 1DJOA 1D4AA 1UK7A 3C74A 1GKUB 2I6UA 1W5EA 2PBLA 3M89A 5D7NA 4B6JA 3FGPA 1Q1BA 3GLGE 4P4NA 1OF1A 4M0MA 1K9VF 2CJWB 3WKDA 2C4MA 4C7OA 4ZU1X 1MB2A 3ZZMA 5CT8A 1Z2OX 1QGZA 5IXYA 2XGOA 3VU3A 2JLYA 4D0RA 2IHBA 1HFWA 5C8ZA 3F97A 3HCFA 3D7SA 3WLKX 3WK6A 3EMKA 3DTVD 4MQFB 1A9XB 1E77A 3M3HA 2ZE5A 4QNMA 3D31A 4QDKA 1QTQA 2VAMA 2I1WA 3WMFA 4BNZA 4BUJA 4JFRA