3QWIA

Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with nadph and coumestrol
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
260
structure length
260
Chain Sequence
YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords 17beta-hydroxysteroid dehydrogenase
publication title Structural studies on the flavonoid inhibition of a fungal 17Beta-Hydroxysteroid dehydrogenase
pubmed doi rcsb
source organism Cochliobolus lunatus
total genus 105
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwiA00
1E3WB 5T5QA 1R37A 2QZ9A 3ZV3A 3CZMA 2DKNA 3D4OA 4CQMD 4KZPA 1PL6A 4EITA 3KTDA 5K0ZA 5KNLA 4UULA 2D5CA 1A7AA 3KB6A 5L7TA 1F0YA 2Q2VA 3PYXA 1CEQA 4UAGA 2DAPA 2FP4A 1EBUA 3MJEA 5G4KB 1R4MB 5KVVA 1H6CA 4PVCA 4XQEA 2O4CA 1JKFA 2FPIA 2IEBA 3CMCO 2NUAA 1WZIA 3P2OA 4RQUA 5TC4A 5I9NA 2VHWA 2C5AA 1AHHA 1GAEO 5IXSA 4CLDA 1SO8A 1DFHA 4NNJA 5C3MA 1AE1A 3PFWO 1E7YA 3MJ4A 3DTYA 3LU1A 3H2SA 3L77A 3JQ9C 4DC0A 2OBNA 3ROKA 1GCUA 1H0KA 2NU8A 3PFFA 2AEJA 4PG5A 4RZHA 3VH4A 4G81A 2F1KA 1IY8A 3NV9A 4DQVA 4AJKA 3ONDA 2GUGA 8ADHA 3K96A 4J1QA 3DHNA 2XF8A 4XYGA 3ZWXA 4EBFA 3HDYA 2NNLD 5L51A 4DYDA 5IDYA 2O7SA 3VPFA 1E3LA 3RUHA 4U8GA 5FWNA 1IHXA 3EVNA 3BXXA 3I6QA 4XRRA 1T25A 2X0IA 4MJLA 3JD2A 4ALIA 1BW9B 4Z3KA 4GX1A 3QVSA 4ZRMA 4R16A 3GR6A 5GY7A 1PGPA 1XA0A 1ULUA 3DZGA 1ADFA 3ADOA 3H5NA 1WNTA 4F46A 4EUFA 1N2SA 4CJXA 1UDCA 1R66A 1M6WA 3PHIA 1ZIDA 4INAA 3JQAB 4WCFA 3BMNB 3N74A 2FHSA 3GNTA 3OETA 4FSHA 4RPJA 5CHEA 4AVYA 4YAJA 4I08A 4N18A 2J5KA 4MOWA 2WTBA 4J9UE 2QIOA 4L8VA 4HFJA 1HSOA 1ML3A 4YCAA 1EFLA 2Q50A 2H6EA 3A06A 4K9DA 3LC1O 4YJGB 3VVCA 1Q7BA 1V6AA 1ADGA 2NVUB 2Y0DA 1SCUA 4FN4A 4J0FA 3GQVA 5BR7A 1N1EA 1O94A 3RUDA 4DVJA 2P9EA 3C7AA 4Q3BA 4R5MA 1E6EA 1G0OA 1PJ4A 3PI7A 2PKQP 1GYPA 3WGGA 2B5WA 3HADA 5FFFA 3R3SA 3ZWPA 3DOJA 1KVRA 1PQWA 2X7HA 1HYGA 4WNIA 3M1AA 2EG9A 1PS0A 1W73A 3DBRA 1ZO8A 5HA5A 4IDEA 3L07A 1OAAA 1CJCA 4IMPA 1DLJA 1GFSA 4PRKA 5G4LA 3H9GA 5ILGA 8LDHA 3MZ0A 1QKIA 3JCZA 2WDZA 3UCEA 2HRBA 4AJPA 4OKIA 3WBFA 1I2ZA 3ZWBA 4A5OA 1LUAA 3QE3A 4A73A 5CG1A 5ITWA 2BKAA 4ND1A 2HMUA 1PJLA 2QYSA 3G49A 3LC7O 5I7FA 3D3WA 2J6IA 3GOHA 4KDFA 3S2FA 1VM6A 4BGIA 4N54A 3I9JA 1Y8QA 5JMWA 4LGVA 2Y0CA 4JLWA 3C1OA 3S2EA 2YV3A 3AY3A 4Q3NA 2JAHA 3L6DA 3D5QA 4CMCA 4K1LA 2I9PA 3TSCA 1E0DA 5ILOA 1XU7A 1C3VA 4QTZA 1O6ZA 5DULA 1NFQA 2J3IA 4YB8A 2WJPA 4NPCA 4I9NA 3LSYA 4BNTA 1E1LA 2IZ0A 5KIAA 1A7KA 4RDHA 3WSVA 4BV8A 4ROSA 4JP3A 2GN4A 3WMXA 2PGLA 3KETA 1M76A 3OIFA 3DBHA 2CDBA 4LRSB 3U4CA 5JO9A 2EF1A 3BHMA 1GZ6A 4IXWA 3UUWA 3D7LA 4YTEA 4ZU3A 1ZJZA 1UAYA 3MJSA 5T57A 3F6YA 3TOXA 1AXGA 4KWHA 3X2FA 4BO4A 4CMIA 1HZZA 1YL7A 2UUOA 3MJTA 2O3TA 3IMFA 3PGXA 4DPLA 1A4UA 4L75A 3H9JA 4EJ6A 3INRA 2J3KA 1PZEA 4IDFA 1Z45A 3WYEA 3AM3A 1YH3A 3UICA 3SBOA 4BKUA 1DC5A 5DOVA 5L3ZA 4RVFA 1NAHA 1NXQA 2CVZA 3RUCA 1I8TA 4QO8A 4WEOA 3OJLA 3OFSA 1XR3A 3HHPA 4CLRB 2JKVA 2ZTVA 2H9IA 2V6MA 3N7UA 1BDMA 5ER6A 4BGEA 2Q3EA 5IN4A 1T4DA 1ZJYA 5ADHA 4WKGA 1O89A 1TT5B 4HY3A 1YQDA 4ILKA 4PVDA 2CF6A 1NAIA 1WDMA 5ENDA 1WXDA 1XQ6A 2E48A 1QV6A 5KJCA 1HKUA 1K0UA 2Y99A 4JBIA 4IJVA 2PNFA 4DUPA 3WTBA 1N92A 1NASA 1YO6A 3ICPA 3FSRA 1NYTA 1HLPA 1DEHA 2PZMA 3PIDA 2NU9A 3RIHA 1UZLA 3IL2A 2P91A 2PR2A 1N8KA 3W8DA 4KOAA 1DB3A 1DLIA 3L9XA 1PZFA 2OO5A 3ZNPA 4BNFA 4E6PA 1ADBA 1ONPA 1Y81A 2Q1SA 3H9QA 4TKMA 5CG2A 4O0LA 4CM7A 2C20A 2NVWA 5L45A 5A9RA 2P4QA 1SZJG 3BMCB 1LEHA 5AYVA 1NFRA 4M86A 1QR6A 3GVPA 3JYNA 1UZMA 5BNTA 1YBVA 2FN7A 3CPSA 4KP7A 3HDHA 2GZ2A 3I9OA 4GH5A 1QV7A 4W7HA 1U5AA 1ISJA 3DFUA 4W82A 2FY8A 4K6FA 2W2KA 1JW9B 4OQZA 1WLYA 3JYOA 2WSBA 4KQWA 5ICMA 1J6UA 4MIYA 3JQEA 1F8GA 2JD1A 1ENZA 1EUZA 1A71A 1YL5A 4NBTA 4TWRA 3UN1A 1PGQA 3GG2A 2CDAA 4YJFB 3AI1A 3TZQA 5CDUA 3ZCXA 5C37A 2W4QA 2B4RO 2EKLA 1GUFA 1PWZA 1I2BA 4FFMA 3QVOA 1XWFA 1X14A 1YOVB 4LMPA 2E82A 5DP2A 3PTZA 2P4HX 2B37A 5I7VA 3LQFA 1PJQA 4D44A 2OUIA 3DMYA 4A10A 5ICSA 3AI2A 2DLDA 2FRDA 4LCJA 1O8CA 2YW9A 3O4RA 4PLZA 5TNXA 5A02A 3Q2KA 4HBGA 4WE3A 2AA3A 4R1TA 1I3MA 1K5HA 5HBRA 2DTXA 3DL2A 3JQGB 3PQDA 3TQHA 3WJAA 3E8XA 3MTGA 4NK5A 1E7WA 2X23A 3GZ4A 4U7WA 4F45A 3LZ6A 1Q2XA 2JJYA 2Y1FA 1HT0A 2Q99A 4HKTA 3SLKA 4YACA 1E1NA 3NJ4A 5AXBA 4Q3EA 4HNHA 4EZBA 5JC1A 4NQZA 3HSKA 1E7SA 2WD7B 3DAPA 3AWDA 1HE2A 3AU8A 3GDGA 2VT2A 1SAYA 2V7PA 3JQ8A 3QLJA 1P0CA 1U3WA 4K26A 2EKQA 2HJSA 1I33A 3WQRA 1U2DA 1VJTA 3ZZNA 4MVJM 4DPKA 2GASA 2VHXA 4N5LA 3H6KA 4PCVA 1YDEA 3NYWA 3OJFA 3PXXA 4XEHA 2Y1CA 3KYCB 2DBZA 1JU9A 2V6GA 4ZD6A 2EGGA 1XDWA 4WEQA 1NPYA 2DPHA 3V2HA 3I9KA 4N7RA 3RFVA 5JY6A 1E92A 1MP0A 3O8QB 5I8WA 4J90A 4FFPA 3ZU3A 3FBTA 2I66A 2A4KA 1D1TA 1KVUA 1I30A 1GQYA 3A4VA 1DIHA 3PJGA 4LN1A 4IXTA 1HDRA 1XQ1A 1IZ9A 4J7CA 4I9HA 4BNIA 4E0BA 3ABIA 1LX6A 2FSVA 3AM4A 2IZ1A 2ZKLA 3G17A 5T8KA 1B7GO 1V3TA 1RYDA 3GZNA 3ONFA 3OH8A 3D0OA 3CXRA 2XPCA 3IP3A 2DPGA 4IDBA 1EMDA 3NT5A 4OSOA 1NPTO 2ILTA 3DBLA 4U0JA 1YBMA 1KETA 2Q4BA 4XIYA 3FBGA 3Q1LA 1B8UA 2DT5A 2VZ8A 1I32A 4BMSA 4BS9A 5L40A 1ZZEA 3F1KA 3H9EO 1Y1PA 4TRRA 4ITUA 4H15A 3RD5A 4B4WA 1KY4A 4GLLA 2O48X 1M66A 3WGOA 1WPQA 4M87A 4NHEA 1QYVA 3V2UA 4II2A 3DC2A 1FDVA 1WAMA 4OSPA 4QX6A 1UDAA 1O5IA 2Q4EA 4O59O 1PWXA 1H6DA 4OXKA 4WNCA 4XQ9A 3C85A 4Y9DA 4F3YA 3GMSA 1PGJA 2HK7A 4E32A 3F47A 4BB6A 3D1LA 5B12A 4PLPA 1FF9A 4NFSA 2DTEA 3D5TA 4TROA 1QRRA 5T8KC 5A03A 3ZHZA 1VL8A 3JQ6A 3FRJA 2VN8A 3I23A 1BXGB 1T2EA 2B0JA 2R00A 4XKJA 3ZWAA 4R69A 5DCYA 1SMKA 2J8ZA 3JQDA 4YT5A 5TIIA 2EXXA 4BO1A 3ZWOA 3AFMA 2I3GA 1ZK1A 1E5QA 3TL3A 4AJOA 3GUYA 4XRGA 2SCUA 5LDGA 5DCUA 4IPTA 4Y67A 5ER9A 5HS6A 4FB5A 5CDTA 5TLSA 3JQAD 5LDHA 1PJSA 4JNKA 1U3UA 1YJQA 3NJ8A 3EZYA 2QYTA 2D5AA 3IJRA 5HRUA 1CETA 3AK4A 4ND5A 3U4HA 4YYZA 2R00C 3B6ZA 3D3EA 3JQ7B 3L6OO 4XB1A 5G0VA 3JYPA 3R0IA 4WGGA 2QHXA 1P31A 1NP3A 1DAOA 2VUUA 2O3SA 4LSMA 3BAZA 1ZW1A 3AUAA 3DHEA 3U49A 2AG8A 2RHCA 5CDGA 2PH3A 1NBOA 3B1JA 4PG7A 3E48A 3ZHYA 3BMNA 3BIOA 2HQ1A 4IQ0A 3CSDA 1QLJA 5CEJA 4XGKA 2BLLA 3RU7A 3S2GA 2Z1NA 1IL0A 3ZV5A 1C1DA 1SNYA 2G17A 5LCXA 3ZNQA 3EYWA 4YAGA 1K89A 2PLAA 1PR9A 1Z82A 3GAZA 4PG6A 1B2LA 1ZEMA 2FR1A 3JQCA 1RJWA 3HFSA 5DBGA 1L7DA 2JFHA 3ON5A 5AOVA 3ZU4A 3NTOA 3E03A 1KBZA 4D79A 1LNQA 4UVDA 3U62A 2PD6A 2WWRA 4DLLA 1UXKA 3PHJA 1T2DA 1F8FA 4CPDA 3NUGA 4M49A 4RCVA 3DDNA 1KVQA 1UH5A 3PWKA 3U5TA 4R3NA 2PTGA 4J9VA 4BNGA 1H94A 3ETGA 1LDYA 3H8VA 4NU5A 5TT1A 4A27A 4CV0A 1LC3A 2GF2A 2V65A 3ZI0A 3I1JA 4MPDA 1U7HA 2NTNA 3K5PA 1PJCA 3K6JA 4E2YA 4G65A 2UAGA 3I4FA 4GSKA 1BWSA 2HDHA 4ZICA 4XYLA 4UVHA 4B79A 4OMUA 4JK3A 3S55A 1R4NA 1P45A 4JJIA 3M2TA 4JBGA 1OFGA 5KVSA 2PZJA 1ZK2A 4IS2A 2DQ4A 5T6BA 4J4BA 4CM4B 5A9SB 3U09A 1U28A 3UKOA 5TJHA 1E3EA 1M75A 4KUHA 4DQUA 4H16A 3PJEA 4CM9A 4RF4A 4E5MA 3NTRA 2VYVA 5CPFA 4W99A 1CQIA 3BYZA 4GBJA 4NBWA 4FJ0A 2RHRA 2VTEA 3PZBA 5DZSA 3WWYA 4BNXA 4OJNA 1I3KA 2VWGA 4O1MA 3E9NA 4CM8B 4MP6A 4P4GA 2HSDA 2E4AA 4O5OA 1AGNA 1O0SA 4IGFA 1FXSA 2YYYA 1PS8A 2RBEA 2WE8A 3RAJA 1KS9A 1CF2O 4PZEA 2X9VA 4GX5A 4YA6A 1GY8A 3U0BA 5CEFA 4TRJA 1LSSA 4IJKA 3WJ7A 2V6BA 4DMLA 3MTJA 3V2GA 3WGTA 2GPTA 2HO5A 2DBQA 4Y6PA 1G0NA 1Y9AA 1YDWA 1V8BA 4RVGA 1P1JA 2Y68A 4GQAA 3SXPA 4IJUA 2IYOA 9LDBA 4J1NA 4YT2A 1LLUA 5JLAA 3EMKA 5F5NA 1G6KA 1I5RA 3OA2A 1X1TA 4U5QA 1LQUA 4D0RA 1BVUA 1JA9A 2LDBA 1NHGA 4R54A 3AJRA 4URFA 2NU7A 3DHYA 3OQ6A 1V35A 3QY9A 4XQGA 3VZPA 4YAIA 2CSUA 2CZCA 2J3HA 3I9NA 2VRCA 4CLOB 4H7PA 4GI2A 4YPOA 1PQUA 4Q3AA 3QJ5A 2I67A 2C5EA 3BZUA 1LDEA 4L4XA 5CFZA 2TMDA 5I7SA 3WWZA 1UXHA 2WEKA 3RU9A 4CL8A 1QYWA 4N5MA 1YVEI 4EW6A 1UAGA 1TT5A 4R5HA 3RC1A 2YDXA 1Q1NA 5HWSA 4YQZA 2CF5A 3H7AA 3G1UA 4LSWA 1KERA 3QW2A 1VJ1A 2DUWA 3ZN2A 4E2WA 2HMVA 4NMHA 5IFLA 3KOUA 3AUSA 1X0XA 3KYDA 4HFNA 2YHUA 3JQ9A 3U3XA 1SBYA 3F9IA 1S6YA 4EJMA 3DMTC 4QSMA 2ZK7A 4BO7A 1GPJA 2EP5A 3ORFA 4B7XA 4WLNA 4KTVE 4FIZA 3BTSA 3GGPA 1N9GB 2ZATA 2O3RA 4R9RA 4D3SA 3GK3A 4DBVO 4CQMA 4YEDA 2FOIA 2IE0A 5BNFA 5TS3A 1QORA 3B1FA 3AY7A 5EERA 4XR9A 4I8XA 5L53A 2BFAA 3ZWMA 2YHIA 4BO6A 4BKOA 4RVHA 3HFGA 1QYCA 2VZ0A 5A3JA 1UP6A 4NFHA 4L0QA 1KEWA 4LVUA 4D45A 1R12A 1I0ZA 1I24A 4R9SA 5CP8A 3PVZA 3SJUA 5GZ1A 1ZK4A 4BGVA 2A92A 5JAIA 2EP7A 3AM5A 3MWDB 3TZCA 3P7MA 2A9FA 3GRPA 1IZ0A 1H2BA 2BGKA 4XCVA 3UXYA 1MV8A 1E3SA 1MFPA 2HMSA 4S1VA 4NJMB 5TJ9A 4YJFA 2AXQA 2BH9A 5JAQA 4Q3DA 3QSGA 1SPXA 4BVAA 1U8XX 1MFZA 3NGXA 3DEYX 4NI5A 5H81A 5K6AC 4TRNA 2YV1A 3FCOA 2UV8A 2ZTMA 4CLXA 1TA4A 4CMJA 1C0LA 1MG5A 3QVXA 3INGA 4PLCA 4YWJA 5EL0A 2JFGA 2NQ8A 1Y7TA 4CLHA 1NQ5A 4PLGA 3ZV4A 4MIOA 1BGVA 5JFOA 4PLWA 4NG5A 1VL6A 3K2EA 1Q0QA 4U6SA 4Z0TA 1XHLA 1ARZA 3AI3A 4OIMA 5HS4A 3E9MA 2VHYA 4BNZA 3WBBA 2G5CA 2JD2A 3Q2IA 4Z9YA 4QECA 1Y8RA 3UF0A 4FR5A 1ZKMA 1O95A 3WNVA 3WLEA 3PRJA 4WK6A 4L73A 3VH1A 3ZWVA 4CMAA 3OSUA 4HV4A 3GPDG 2Z95A 3AFNA 2X22A 4IINA 4FPXA 1CYDA 5I8ZA 3B20A 1OZAA 1BMDA 2D59A 2EJWA 1ONNA 4ZHSA 1E6UA 2ZJ0A 4GGPA 2A94A 1B15A 4FW8A 2D3TA 4EDFA 2AQKA 1DFGA 3O26A 2EERA 2TMGA 3V8BA 2RAFA 4JJFA 1ZH8A 2EWMA 4BUCA 1PQPA 4D3DA 5EINA 4BO3A 3WIEA 3FD8A 1E1MA 3DB2A 4OGWA 1GEEA 2P5UA 1JAXA 3P19A 3IKTA 4AJJA 2D2IA 3AW9A 5G0TA 4OL9A 2O2SA 2J5RA 3QVWA 4K28A 4MDHA 4PLFA 1ONOA 3FNHA 3GDOA 4CLEA 3T4XA 2GN9A 4CV3A 3RUAA 3C1TA 1EQUA 4XJSA 4MVJH 1XG5A 4FC6A 3BTVA 2AHRA 3KZVA 4UUPA 1MGOA 3O38A 4IQ8A 3OHSX 1MXHA 4FGSA 4LVCA 4J1SA 3TRIA 2NVBA 3BMOA 2OBYA 3F3SA 4D3FA 1NR7A 4CQLB 1E5LA 2NM0A 4ZN6A 4DTIA 2J3JA 4XIJA 1T1SA 2GNAA 3CKYA 2EW8A 1PGOA 1ENOA 4FFLA 5DCWA 1ZSYA 3GVXA 4RVUA 1W0CA 1ZK3A 2CUKA 3NGLA 5FYDA 1RM3A 4PZDA 2X5JO 2X9NA 4M55A 4RDIA 1JKJA 2RIRA 4QQRA 4LW8A 4BKQA 1YB5A 3LLSA 3FNEA 4XYEA 1QXSA 5FEUA 2PH5A 3B1KA 3OMLA 4U6QA 3BMQB 3C8MA 2QG4A 3HQ4O 1MXFA 5C7OO 2R6JA 4J43A 1VLLA 4GKVA 2AG5A 2Y1EA 4RQTA 2P5YA 5BSHA 5FI5A 4BNWA 1HDYA 5B4TA 1B8PA 2AEFA 1HDGO 3HWRA 5EJ2A 5TQVA 1NVGA 4FFNA 1E1KA 2WE7A 2O4UX 2X58A 3WGIA 2HLPA 1Z74A 3GNSA 6ADHA 3TFOA 3WXBA 4C7KA 4YVFA 4EYEA 1WZEA 4DGSA 1DFIA 2OL4A 1BXGA 4GGOA 1LTHR 4ALKA 4ZJUA 2IEDA 4B4VA 3ITDA 1D1SA 3B70A 3DXFA 1VSUA 1JVSA 4FBGA 4UUNA 4GWGA 4BIIA 4BO5A 3VKVA 1ZUD1 3TPCA 3KEOA 1ULSA 1C1XA 2H63A 4HWKA 4J0EA 1MUUA 3E18A 5A5FA 2OORA 3PDJA 3UVEA 4ND4A 1NHWA 1OBFO 2BELA 1CWUA 4P4NA 1OI7A 4I5EA 3GEMA 4BNLA 4JIGA 3HB4X 1P44A 1U3VA 1MX3A 4Y8VA 1QMGA 3D64A 1EVYA 3PYMA 4I9UA 1TB4A 3KSUA 4O63O 1KEUA 4NBVA 2BI8A 3OEWA 2DBRA 3ANLA 3TWOA 4R51A 3CMMA 2JD0A 3WX0A 2G82A 4Z9FA 2W2LD 3TFQA 1R0KA 4ALJA 1ENPA 4FCCA 3IUSA 4PLVA 2EW2A 2EV9A 4E2XA 2VQ3A 2VT3A 2ZYGA 4I1IA 4L4RA 3M6IA 1VKOA 3I5MA 2FZEA 2GN6A 2VOEA 4RVDA 3WQQA 3DZKA 2AE2A 2VNAA 5IF3A 1Y6JA 1PJBA 3CEAA 3RSHA 4YDRA 5TT0A 4BMVA 1NWHA 2BFPA 2C82A 3RC2A 1R0SA 2NQTA 2I3AA 3WTCA 1ZBQA 2QRJA 3W8EA 5G0UA 1Z7EA 4A26A 3ENKA 3I4CA 1U9JA 1X7GA 1JAYA 3CUKA 4IUYA 4Q3CA 2B83A 3WGHA 4ZQGA 4GVXA 4CM5A 1OMOA 1LQTA 3NEPX 3FPLA 4MKXA 1EVZA 1G1AA 1Y5MA 2X6TA 2NSDA 3IIEA 3ITKA 5J23A 1ZXLA 1SEPA 4CR6A 2PA3A 4AJ4A 1HZJA 2PGJA 2QW8A 1LDGA 4M8SA 1UJMA 4OAQA 2CFCA 5JAMA 2C2XA 2OHXA 3I9MA 4YRAA 3EGOA 2WYUA 5MDHA 1HRDA 3EW7A 3HZZA 1X7DA 3LLVA 4QFCA 2XAAA 3FTPA 3KRTA 1CERA 3RASA 5JDIC 1M2WA 4PG4A 1IULA 1GD1O 2QZZA 2Q45A 4WLOA 4YRDA 1VPDA 1EK5A 4IBOA 3NDRA 3UFXA 1TVEA 3ZWNA 3ZW9A 4D0SA 5F1OA 1UZNA 4MVJI 1U5CA 2ZCVA 4DREA 1R6DA 2ZQZA 2OP1A 1HYHA 1V3VA 1DIBA 4WCFB 3DZJA 3HE3A 5DP1A 1B26A 2WMDA 1XYGA 2IRWA 4J16A 3GF4A 2YFHA 2ZB8A 3VH3A 1CQJA 1EUCA 3ZU5A 2JCXA 4L4SA 4ZQFA 2H5LA 4KUEA 3GT0A 1EE9A 5CDYA 4UEKA 1GU7A 2I6TA 3R3JA 1I10A 1K3TA 5JSFA 3C7DB 4RLSA 5F5LA 1EDZA 4PZCA 4TSKA 5DDIP 3CTMA 3GH3A 3LC2O 4OXYA 1LDNA 4E5KA 4TZKA 1SEVA 1HWYA 1BHSA 2VZ9A 3STHA 2VOJA 3ZGYA 5CDSA 4CLOA 5KWEA 1HE5A 3DBRB 4Y6SA 4BNUA 5IDWA 2BD0A 3JSAA 1SOWA 3GVIA 2Q1WA 5MGBA 1A5ZA 4YJHA 4DIBA 4F6LA 4N5NA 4OOFA 3QV1A 3PZRA 4E30A 5KCZA 3GA0A 4WECA 1RWBA 2Y1DA 2YZ7A 3HB5X 5IZCC 2X9GA 4XWYA 4IDGA 2PY6A 1EZ4A 1A4IA 1SOVA 4J7XA 4IIUA 1YS4A 5AXDA 2GD1O 1ZEJA 1CDOA 4YBZA 1E3WA 4LCEA 4GPD1 4TRMA 1U2GA 3D3WB 2VTDA 3V5NA 1WMBA 4IDCA 3SJ7A 3ULKA 3DOCA 1FDUA 3V1UA 4RZIA 4YXFA 5GZ3A 4S3MA 3A14A 3VZQA 2NADA 2P9CA 5K9ZA 4MVJP 5G4KA 1GZ4A 1LBEA 1R4MA 5KVCA 1LLQA 3SLGA 4W7IA 4GVLA 4AJEA 3EUWA 5HTOA 4EJ0A 4OH1A 2B35A 4ND3A 4CODB 4DPMA 1N9GA 1PL7A 5JMPA 3IKVA 1LDMA 1VL0A 3U9LA 2OP0A 3FF4A 4MIEA 3DBHB 3GUCA 3WOHA 4HNGA 5KJ1A 3K9QO 2PGDA 1FDTA 2EKPA 6LDHA 1F17A 1U7TA 1U3TA 4MKRA 4YT8A 2HK8A 1K6XA 4B8WA 4CMIB 4ONEA 3VOSA 4GX0A 2ET6A 3COSA 1LI4A 2GYYA 3JTMA 2NU6A 2VYND 3EK2A 3OF2A 4CMEC 2JCYA 1BTOA 1VE9A 1LSJA 1GPDG 1LA2A 1B16A 4GMGA 3U4IA 3W8FA 3CE6A 5THQA 1A9ZA 4II3A 4RJTA 3EHEA 4PFJA 2DFVA 3W4IA 1I36A 4Q39A 1HEUA 4R3WA 3SEFA 1P74A 1HF3A 3DWFA 4NU6A 2O3QA 3PEFA 4C4OA 4BO0A 3RFXA 1IPEA 3WDSA 3BHIA 4DC1A 1BW9A 4QT0A 1TXGA 2C2YA 4GX2A 3PPIA 5L95A 1HDOA 4DBZA 5JE8A 3U4DA 2VUSA 3DZFA 2FPPA 3L6EA 5G2OA 2ZB4A 3L4BA 2DC1A 1GYQA 3RC9A 4QFDA 3WFJA 1XGKA 2EGHA 1LRLA 4E31A 4JCOA 2XOXA 4B3JA 5G0SA 7ADHA 2GN8A 1D7OA 3JQAA 1Z75A 1EQ2A 4FJ2A 3MOGA 3NKLA 4CUKA 3I6IA 1D4FA 2Y67A 4DLAA 3DONA 3QWIA 3ENNA 5CPBA 1M6HA 3ZWCA 5JO0A 1TLTA 1YB1A 1DC4A 1EFKA 2AEMA 2O3UA 2WYVA 3IUPA 4BNVA 4NBUA 4WASA 1PEDA 4BNNA 4IS3A 3C1AA 4YJGA 2I99A 2VNSA 4ND2A 3W1VA 2X0JA 1DHTA 4WOKA 1T26A 2NVUA 3JV7A 1H9BA 4TVOA 4XJTA 1JVBA 1P77A 4RPGA 4UEOA 4UVEA 3JQBC 4YJDA 1K6JA 1P33A 4WCDA 4X54A 3T7EA 2JCVA 1HDXA 4KWIA 3L4BC 3ZV6A 4AFNA 1F12A 4Y6RA 3I9LA 2GR9A 1DHRA 5A04A 3E5RA 1VJ0A 3VTZA 4RPHA 4NZ9A 1NR1A 4BOYA 4IJWA 3GLQA 4CMGA 5JCJD 2PD3A 1MB4A 2DTDA 2W2KB 1WMAA 1O9BA 4ALLA 4MVJD 4YQYA 3OJ0A 4KQXA 1DC3A 2DU8A 4FOSA 1FK8A 5A1TA 1PJ3A 4J91A 3TZHA 1ISMA 3MEQA 3VKUA 5JC8A 4E13A 5KVQA 4EGFA 1Q7CA 1DIGA 3I3OA 4AJNA 2QQ5A 3E9QA 2B4TO 4CM1A 4AJ1A 3AOEA 1UP4A 4ESOA 1L1FA 2W8ZA 3JD0A 3T7CA 4AJ2A 3KYBA 5B37A 2OGUA 3HN7A 4FS3A 4UUMA 1WVGA 4OYRA 4YT4A 2I5PO 4UREA 1ISGA 4K6CA 1UR5A 3JYQA 1FJHA 4LRTB 3FI9A 5JCXA 4BO2A 3DZIA 3PJFA 3UW3A 2ZYAA 1D3AA 3QWHA 2PFGA 4JJGA 5A05A 3KLMX 4BKPA 3BMQA 4XDZA 3WR5A 1IB6A 4UVGA 2BGLA 3TZ6A 4WLVA 3AOEC 5IAAA 2E49A 5BSFA 1DBVO 3KM0A 5A06A 3GEDA 1CIVA 3FHLA 1LSUA 2P68A 4BMNA 3HDJA 5C7IO 1VI2A 1SB8A 3FWNA 3JQ8B 2FPGA 1T4BA 4L76A 1U4SA 3KV3O 1ZK0A 1ISHA 5KJFA 3DMTA 4RPKA 3IC5A 4WPGA 4Q9NA 3ASVA 3ROQA 1DJNA 4CLRA 3PK0A 1JLLA 3DZBA 1YL6A 2O7QA 5GMOA 1TT7A 5I7EA 2WYWA 2Q2QA 2R2GA 2HJRA 1AHIA 1NVTA 2IYPA 1J5PA 4JP2A 1B14A 4E2ZA 1HETA 1BRMA 3RJ9A 4Z6KA 1YGYA 4J1TA 4J2HA 1KC1A 1C0PA 3JD3A 1SB9A 1ZCJA 1VRWA 1NQAO 2YV2A 3ZWYA 1WP4A 3TZKA 5KKAA 4M89A 3EVTA 4UVIA 2Y0EA 4DA9A 3C3XA 4R01A 1ENYA 3EY4A 5ITVA 1J0XO 1NX6A 2Y1OA 4NR0A 2ZQYA 5IDQA 4LK3A 4WUVA 5DN9A 4OXNA 3GZNB 3ZWWA 5B1YA 2CVQA 4A03A 4IM7A 1DO8A 3GDFA 1NFFA 2GDZA 1GQQA 4CL3A 3PQFA 4KUGA 4QUKA 1P1HA 1DIRA 4WJZA 5JPIA 5JYEA 1Z7BA 3DBLB 5TRTA 4AL4A 1KIFA 4WLEA 2GSDA 3H5RA 4HX5A 5K6AA 4FC7A 4R1NA 3BMCA 2X1HA 3LT0A 3SC4A 4NDNE 3KEQA 2OZPA 4R41A 2HMWA 3NDJA 1RM0A 3HG7A 4HFMA 3TDKA 4B7CA 4BNKA 1PZGA 3GY0A 4UEJA 1NPDA 1PJ2A 4MVJG 1EBFA 3UGKA 2BFOA 3GFBA 3F46A 1P0FA 4ZQBA 4CMHA 4RF5A 4E21A 2GO1A 2VHZA 2Y93A 3O9ZA 3GVHA 2PV7A 3QP9A 1BG6A 4BHTA 4IMRA 4RL6A 3AOGA 3D4NA 4XB2A 2YDYA 1GCOA 2OOSA 1HLDA 2C59A 3GMDA 4CR8A 3OIGA 3LF1A 1NQOA 4B3IA 1PL8A 4JN6B 1YOVA 4DRYA 3EC7A 3WGZA 1HL3A 4AICA 5L4NA 1Y9EA 2Y66A 3WIDA 5F3RA 2GZ1A 2ZB3A 3PLRA 2AQIA 4IIVA 2Q1UA 1XELA 4J7UA 2YUTA 1XEAA 2QRKA 1DRUA 4KTTE 1LJ8A 1DPGA 3RKRA 3L0DA 3PIIA 4B4OA 4RPLA 3KUXA 2DVMA 3WNQA 1HTBA 2DM6A 4ZRNA 3JQGA 3KO8A 3RKUA 4DXHA 1MLDA 4MP3A 3TOZA 3CZRA 4BNJA 4BQPA 3F4BA 3OIDA 5IN5A 1H6AA 2Q49A 2YQ4A 5BSGA 2CMDA 5L4SA 2BMAA 4XGNA 3ASUA 3FN4A 3LDHA 4L74A 3RJ5A 3F4LA 3IQDB 4Z3DA 5JY1A 1JTVA 1Z73A 5L7YA 1Y5RA 1KOLA 3VDRA 5T64A 4Y98A 1GDHA 5U1PA 1YJ8A 1N1GA 4J4HA 1WDKA 2WD7A 3WGYA 3EDMA 4GLOA 3WGQA 5IJZA 5CEEA 3C7CB 3T4EA 4BNYA 4M54A 3F5SA 3ROMA 1C1DB 1LRJA 3RUIA 4BNMA 2QX7A 2VWPA 4KDEA 2EIHA 4EI2A 5IXYA 4FQ8A 5LC1A 5JW6A 5DBIA 4GWKA 4LMRA 1N7HA 3K8ZA 1MG0A 1ZSVA 3KYCA 1LXCA 3F5QA 5B4UA 5L4LA 3RCBA 3PYLA 4CUJA 1QLHA 3C24A 3G79A 2HK9A 3KLPX 4NIMA 2XXJA 3KSDO 5F1PA 1A72A 3RVDA 4BGUA 1CRWG 2AE1A 2FR0A 2HMTA 4WCFC 2X0NA 3TL2A 3BA1A 1H93A 3O8QA 3RBXA 4ID9A 1LDBA 3M2PA 4CR7A 2HKIA 1F06A 1IPFA 1U1IA 1H2HA 4XQCA 3WMWA 2V6FA 3O03A 1X1EA 2ZTLA 4WOJA 4G2NA 4KMSA 4FD3A 1R4NB 3PHLA 3HNPA 5TGDA 2IZZA 5H82A 1Q0LA 3VZRA 5KTKA 2X0RA 1HDCA 3H4VA 1E7QA 3NT2A 3X2EA 4W9NA 4DQXA 3TJRA 5JNLA 2AQHA 2O3JA 2NTJA 1UXGA 2O50A 5ES3A 2UVDA 4OOEA 4EEXA 3LT4A 3K73O 2G1UA 1QSGA 4GAEA 4RF3A 1I01A 4DMMA 5AXAA 1NNUA 3IS3A 1Z6ZA 2NV6A 1RKXA 3UH1A 2D0IA 3NRCA 4D46A 3SC6A 3OBBA 1X7HA 1PU2A 3PWSA 1C0IA 2DFDA 2PWZA 4CM3A 2X5OA 1P1RA 4MVJE 4MP8A 4TMFA 2NACA 1UDBA 2VWHA 3G1TA 3ETEA 4DWVA 2PZLA 2FR8A 1PJTA 1ISIA 2GZ3A 5EN4A 3H2ZA 1GZ3A 3IJPA 4JBHA 5IG2A 3ZW8A 2RH8A 1QG6A 3AUUA 4W9NC 3W4KA 1OC4A 4W6ZA 4BO9A 3RBVA 1MC5A 3H9UA 3Q6IA 4G5HA 5FF9A 1LU9A 3G0OA 1L7EA 2Q1TA 2YQ5A 4O6VA 5EESA 1SC6A 3WSWA 1NWCA 1PR3A 1PX0A 2VHVA 3K2BA 3QQPA 3VVBA 4TZTA 1IYZA 1NTOA 3E6AA 1HE3A 3GVCA 3FPCA 2HCTA 3QVTA 1DOHA 1FMCA 3QWFA 4RF2A 5U9CA 1RYEA 1U8FO 1N7GA 1ZXBA 5C5IA 2GGSA 3PQEA 4CV2A 4EUHA 4ZQEA 1DJQA 3KBOA 1D8AA 5IDXA 3ZU2A 1HYEA 4E12A 1DSSG 4JXKA 1E3JA 5U4QA 4I5DA 4B8ZA 4RLHA 2B36A 3BTOA 1X15A 3JQ7A 4IZHA 5FI3A 5EIOA 3LT2A 4XD2A 1B3RA 3GAFA 1E7MA 1XKQA 3IP1A 3ZH2A 2I76A 3FNFA 2PKQO 3RROA 2CNBA 2EHDA 1LC0A 3Q0EA 2G76A 1GUZA 2C07A 3KYDB 3CH6A 3ST7A 2G0TA 3VHRA 2IXBA 1DDOA 2HRZA 2X86A 2JFFA 2Y1GA 3W6ZA 4L9RA 2RCYA 4GL4A 1KEPA 3S1LA 4ALMA 3WQSB 5JBIA 1V9LA 1EEHA 1KVSA 1R16A 2A35A 2GCGA 2BI7A 2B5VA 2W2LA 3K92A 4CV1A 3LT1A 2W90A 2YFQA 3HJAA 3RQSA 4CQMB 3HN2A 1ZFNA 5CAEA 3DFZA 3R1IA 5A3VA 2PK3A 3VPGA 5F1KA 2HUNA 5BT9A 3TF5A 2YHIB 5JDIA 1R15A 1BSVA 2P9GA 1EUDA 3WB9A 1U4OA 3M1LA 2PD4A 1KVTA 4M1QA 1V0JA 2POQX 1R0LA 2GERA 1WWKA 4XDYA 3VTFA 1VC2A 3VPXA 3GEGA 3NT4A 3PHGA 3FWZA 3GFGA 4JQCA 2CDCA 2D8AA 4FJ1A 3OICA 1OOEA 1ZNQO 2X4GA 3DTTA 4CM4A 5A9SA 4WLFA 3PGJA 4NJOA 1J49A 3RWBA 1HDZA 2CVOA 4RGBA 2BFMA 3V1YA 4A7PA 4R4JA 3LVFO 1DRWA 1NM5A 2ZTUA 3EZLA 4PN3A 4P8RA 1Q0HA 3HDQA 3JQFA 3MOIA 4FFRA 3IOYA 2O2YA 5G0WA 4D43A 4D7AA 4CM8A 1BDBA 2I65A 1UP7A 5DOZA 4E33A 5T67A 4YAKA 1FDWA 1S7CA 1W4ZA 3WS7A 2JAPA 1GV1A 4Z0HO 4TKLA 2VCYA 1E7RA 4QEDA 4PLYA 1M67A 4RV9A 4I5GA 3NTQA 1YXMA 3GHHA 4DYVA 1NQTA 4NH4A 4BKRA 5A5EA 4D42A 1Y8RB 4AJIA 5COAA 3H3JA 5DNAA 3VC7A 3JYLA 3ROPA 5COBA 3DQPA 1RPNA 5I9MA 1J4AA 2W98A 2H1SA 4E3ZA 3ZNOA 3VZSA 5IZCA 4IDDA 1KEVA 3JQFC 2XXBA 3JD1A 5JXWA 3F1LA 5EQDA 1GEGA 2C54A 2Z5LA 1P1IA 3ONEA 3ZHXA 5I9LA 3WG9A 1YWGO 4IDAA 1EE2A 4HXYA 1RM5A 1B3BA 2C0CA 4ZA2A 3SVTA 2D4AA 3UOGA 5KJ6A 5JDCA 3VDQA 1C14A 1HSZA 2FMUA 3E1KA 1DAPA 4XX0A 5TSDA 1PS9A 1TEHA 1A27A 1QP8A 3I52A 1ZVMA 4A2CA 3RBZA 1YB4A 3WYCA 2C7GA 1GL3A 4P22A 4BB5A 4QXMA 1QYXA 1DC6A 5BNIA 4GSLA 1HXHA 4WLUA 1GTMA 1WDLA 5A4DA 3ADPA 5KKCA 1T2AA 3PLNA 5TX7A 5L7WA 1RM4A 1Y8QB 2J5QA 3N58A 1LLDA 4IZIA 2FZWA 3BTUA 3VH2A 3ZHBA 3MJCA 1K2WA 1LRKA 5H83A 1AUPA 4CMEA 3BMOB 1JDJA 4ZVVA 5BSEA 4B4UA 1BXKA 1H9AA 1XSEA 2BHLA 1K6IA 4OHUA 5JDCC 7MDHA 4HUJA 2ZCUA 5HM8A 5AQ1A 2VRBA 3OJOA 3LF2A 2AW5A 3GGOA 4A0SA 1I3NA 4YRBA 4GKBA 1UXIA 3E82A 1EDOA 4FFOA 1H6BA 3S2IA 1W6UA 3ZDFA 3VPHA 1NVMB 1AN9A 1ZMOA 2CY0A 4RORA 3KXDA 1GUYA 3H65A 5COQA 2IXAA 2OFPA 1XCBA 3MCVA 5AVOA 2JHFA 1P9LA 1QYDA 3P5SA 3IAHA 4XGIA 2YJZA 4MO2A 3GNQA 2E6UX 2RH4A 1EVJA 4U0KA 4W4TA 4TVBA 2UYYA 3OEYA 3H5AA 5DT9A 5GZ6A 3KVOA 4F6CA 4OKNA 1JWAB 3W6UA 4E5PA 1H5QA 3ICCA 5TF4A 2D1YA 2X8LA 3RUFA 4NJMA 2O23A 3D4PA 4PLHA 3GG9A 1T1RA 1XIVA 3G3EA 2OXIA 1E6WA 1LLCA 5B4VA 4JROA 3DZHA 5KJEA 3UAGA 2VYNA 3GPIA 4R1SA 4TQGA 5KOIA 3NDIA 1T2CA 3HUDA 3VPSA 4D41A 1W8DA 3OQBA 3MJVA 5DF1A 3WYBA 2NTVA 4JGBA 3JQBA 4OO3A 3GC6A 1T2FA 3KHUA 1C1XB 2C29D 4P4LA 4RVSA 4XYBA 3AU9A 2HU2A 3UHAA 1I3LA 1AXEA 3A9WA 3AY6A 3Q9UA 3PDUA 4DLBA 1PZHA 3AUTA 2BGMA 1OC2A 3EAGA 3QRWA 4HADA 1ISFA 4PG8A 3OQ1A 2HAEA 3K31A 1XU9A 3QWBA 3RC7A 3INTA 2X5KO 3PWZA 4OM8A 3K30A 5THKA 3DAFA 3WFIA 3WICA 4FDAA 1DXYA 1EVIA 1V3UA 4C7JA 1P1FA 4P38A 3GHYA 3OJEA 2UDPA 5EQFA 3TN7A 2B4QA 4CMBA 3L9WA 3QWAA 2B69A 4JX8A 2PZKA 1DIAA 4E5NA 3TNLA 4QO7A 4B7UA 3OP4A 1WW8A 2BF7A 2IDZA 1BVRA 3FTNA 3GRKA 4BQRA 5A9TA 3V1TC 1IUKA 1GYRA 2FWMX 2WD8A 4BNHA 3FR7A 4CMKA 3RI3A 3JD4A 1PGNA 3GN2A 1FDSA 4R1UA 3PJDA 1T24A 1GQ2A 4AG3A 1ID1A 2P2SA 3DBVO 5AXCA 1E77A 4R68A 2QRLA 1IHYA 3I83A 4FOOA 2Z1MA 3QIVA 3UCFA 2Q2WA 4GMFA 4AJLA 4OQYA 4J2OA 3DOOA 1ZMTA 3ANMA 5EPOA 3RFTA 4ALNA 1YE3A 1LSOA 2Q46A 5JS6A 2IODA 4UUOA 2BRUA 3GN1A 2FSSA 4NFYA 3OM9A 3WLFA 1BXZA 1KC3A 2GRAA 1ZSNA 4J6FA 4MKZA 4Z0PA 1PIWA 4IY1A 4Z9XA 1ORRA 5JCJA 1F14A 2EJVA 2NLOA 4XZ3A 4ZQHA 4CM9D 1KYQA 1VSVA 4HFRA 2VYVD 1B8VA 4EUEA 4CM6A 4MVJA 3ETDA 3LK7A 4H3VA 1MA0A 1TI7A 3H3FA 4CQLA 3NX4A 4J4TA 3BHJA 3E5MA 2AQ8A 4LISA 1IOLA 4J49A 4FGWA 2JL1A 1UUFA 4E4YA 3IDSA 1YKFA 2PKRA 3LYLA 1HE4A 1XLTA 1P1KA 5JAZA 3QHAA 1KY5A 2LDXA 4PIVA 3UCXA 3CINA 2ZIZA 3L4SO 1E3IA 1P3DA 3FNGA 1IE3A 3S8MA 2F00A 3ANNA 1YQXA 3VAZA 1GV0A 2YY7A 3W4JA 4B3HA 5C7LO 1YONA 2ZB7A 2DUUA 2WM3A 4PGFA 4IGEA 3Q3CA 1GR0A 2Y05A 1JQBA 4AJHA 1UXJA 5L9AA 2VWQA 1X13A 4RO0A 2E37A 1YQGA 1YBAA 2AMFA 4XYMA 5DBFA 3GGGA 1YRLA 1JWBB 2JHGA 3MWEB 5F21A 2GLXA 4BV9A 4DIFA 4E5YA 4MVJF 4HP8A 2VRCD 5ENVA 1X0VA 1ADCA 3A1NA 5IZ4A 3QA9A 4YR9A 4NBRA 3CIFA 2OMEA 2UUPA 4I5FA 4EEZA 3Q11A 4PLTA 2ZYDA 1JKIA 4PRLA 4YAEA 5EMHA 1MC4A 9LDTA 5JYDA 2DBVO 4CUZA 4BO8A 3DAGA 4DIOA 1GADO 1B0AA 5BQFA 3P2YA 4NK4A 1VKNA 1I2CA 3OECA 4XA8A 3R6DA 3A28A 3DR3A 3FR8A 3Q9NA 3ZNNA 1DRVA 4MINA 3DO5A 4BL5A 1N5DA 3KSZO 2EEZA 4IQGA 3RUEA 4YJHB 1PTJA 2CD9A 4DL9A 1Q7GA 4J3FA 1C0KA 2VUTA 3PP8A 4XR4A 3NAQA 3SX2A 2C7VA 2NWQA 4ZGWA 3PHHA 1EK6A 1JN0A 3OA0A 2ZJ1A 1PSDA 1A9YA
chains in the Genus database with same CATH superfamily
1E3WB 3U1TA 1R37A 1Q3TA 1DZIA 5EE3A 1KAMA 4W63A 3SX4A 1KK3A 1U81A 4RZ2A 3STWA 1XE3A 3QSYA 4KZPA 1PL6A 3MD9A 2N1MA 3INNA 5KNLA 1RWKA 2FYTA 1J2UA 3GCZA 5A3SA 4KIUA 3H5LA 3IOMA 4BDTA 2BHSA 3PXBA 2D5CA 4OI2A 1A7AA 1SBTA 1DQNA 3KD3A 1ZM9A 3LQ4A 5ULLA 4UAGA 2Q2VA 5KVVA 1SQ6A 5L7TA 2DAPA 5C5EA 5G4KB 1JXAA 5K0JA 4W5JA 4KBFA 2O4CA 1OXKB 2FPIA 3KJNA 3EPJA 3P2OA 5EHQA 3K8YA 1IC6A 4RWZA 3TEFA 4RQUA 4DCNA 2XITA 4F3KA 5ELLA 5I9NA 1XMPA 3TR5A 3HBJA 1RWMA 3GXBA 5HJ5A 3FDIA 4NWIA 1P7CA 4KAXA 4WBNF 4C0BA 2FTKE 4NNJA 1A1SA 1IM8A 3Q1KA 3R0ZA 3PFWO 4Z7JA 1ZPDA 1G8AA 3OX1A 1Q91A 3WYFA 1RKVA 3DNMA 3DTYA 3LU1A 1WUJS 2BAGA 3E9CA 2QMHA 3GLFA 5AIBA 2H7VA 2OBNA 1GCUA 2NU8A 2AEJA 4PG5A 4RZHA 3CVWA 2D62A 2Q2NA 4YMWA 1NQVA 3WL4A 2VAMA 4B45A 1PE0A 1H0SA 1SCDA 2FF7A 3AF2A 3GYGA 3NHBA 3OQIB 4C7OB 2OD2A 3B78A 1IWOA 3KTAA 3U7QA 3PTAA 2AD1A 3DHNA 4XYGA 5KSPA 1WV1A 4QWMA 2G8NA 3NYRA 4NE9A 4X44A 2ZRMA 3QV2A 2GHTA 2SCUB 1W0KD 3HGMA 3L0OA 5AOAA 5L51A 3DD5A 3OJCA 5JT1A 4JC0A 3OY7A 1OASA 1G98A 5DI3A 1Y3AA 4GXTA 1ZUNA 4L6IA 4Y9TA 1SVWA 2FZLA 4HLCA 3KQYA 1QPZA 3JD2A 3AHEA 2XWPA 3PNLA 4JDPA 2XYPA 4TV9F 2X1VA 4ALIA 2DXIA 3AMVA 3HSSA 4X1OA 1GCGA 3QVSA 5AHOA 5AKXA 4ZRMA 5K0BA 4HQNA 5CCBA 1PGPA 1XA0A 3H5NA 1G5FA 2C4KA 2WTEA 9GPBA 1S01A 1DKNA 3TAHA 2HHCA 2IF0A 4QRHA 5AK5A 1Y33E 4M9CA 3IURA 2NQ2C 1KZYC 3KR9A 1QG0A 4INAA 3BMNB 3L06A 3IJ5A 2RGUA 2VT6A 3MB8A 2FHSA 2ZTHA 1T5SA 2NYVA 2ZPAA 3ANTA 3GNTA 1MO2A 3LECA 4FSHA 1UC9A 4RPJA 3AETA 5J2UA 2IDMA 2MU1A 2RD2A 4MCAA 2NO5A 1I4WA 3K9NA 1B76A 4NV1A 4UPDA 3ZHVA 5ITZA 2G04A 2VDMB 1HSOA 3ND7A 2VEDA 4YCAA 3F73A 3IEPA 4INZA 1ZOPA 1NT4A 5ALRA 2RGBA 3LC1O 4YJGB 1EM8B 5EVCA 3VC1A 3VVCA 4ZYXA 1E1CB 2H16A 1UBUS 3QEMB 3H17A 2PNJA 2P9TA 4FN4A 3GQVA 4IUBS 5BR7A 1N1EA 1T9GS 4WH0A 3WHLA 2HREA 5AQEA 4LGYA 2WT9A 3IP5A 1N2XA 3GOQA 4QUBA 4C2BA 3PI7A 4ZVKA 1GYPA 3WGGA 1E0JA 4HVCA 3PT9A 2AFHE 1BN7A 2XW6A 3AVTA 1GDDA 2P3SA 2V5VA 1FJ2A 3KFXA 1CZNA 2F8LA 3AF3A 3LGAA 1J7JA 4YAWA 3MCTA 1PS0A 3DBRA 5KNCA 2IYXA 4G0YA 4NMMA 5HA5A 1VPEA 3G9XA 1ZH0A 1OAAA 1CJCA 3JVVA 3L07A 1M74A 4IDEA 4IMPA 1QPBA 3H9GA 4L6AA 2IY7A 1YIOA 5G4LA 3G8DA 8LDHA 1VMDA 3IAEA 6ABPA 3O0DA 1F0KA 3GGSA 3P20A 4FQ7A 2Q5IA 1YZNA 4AJPA 3AZPA 5F1YA 3VHXA 1I2ZA 3S5JA 2JFPA 3OQOA 3IHLA 3QE3A 4A73A 4AKHA 3GXOA 3EIWA 4GOJA 4XIIA 5EZYF 3VYRB 3S3TA 1JNYA 5KNBH 5EY5B 1PJLA 1YZVA 1F0NA 1GLNA 1GU1A 4XX1A 3G2LA 4JLAA 4JQYA 1POXA 1H8HD 3HI6A 4N54A 3I9JA 1SIOA 4RELA 1KR2A 4LGVA 2Y0CA 5BO5A 3C1OA 1NW5A 1BJTA 2ODQA 2QTVB 2I6UA 2YV3A 3AY3A 2H11A 4Q3NA 4AZ0A 3ETLA 4KH0A 3FROA 3I0ZA 3K9CA 5BWNA 4K1LA 1WHSB 4XJVA 3TSCA 5KYTA 2C1XA 2HBQA 4WDQA 1XMOB 1BWRA 3LSTA 2J3IA 5DULA 1UK7A 4IHJA 2VNHA 4NPCA 1E1LA 1JXMA 2IZ0A 5KIAA 4R2LA 4K0KB 4PFKA 4RDHA 3WSVA 1BOFA 2FK8A 2Q6LA 1W0JD 1H2YA 2Q1YA 2Z3VA 3MBKA 4DLXA 2AOTB 2XLBA 2PGLA 2P78A 1TJYA 1M76A 2HA5A 2XYGA 3DBHA 3ACBA 3MT9A 2CDBA 3NWOA 4R31A 4LHXA 4XCXA 5IM4F 1PHRA 1HDIA 1X9HA 5K8IA 1A4RA 3K9BA 1G59A 1S2GA 1EXMA 4HI0E 1M2JA 5EE1A 3MJSA 3TOXA 3F6YA 1NZDA 1DUVG 1FNMA 1YR2A 4FIDA 5KOYA 4DN6A 3ECCA 3HJTA 2UUOA 5CA0B 3OQNA 4DPLA 2WJHA 3T54A 4D98A 1GZUA 2KBEA 4EJ6A 3RSFA 2J3KA 4X64B 3NAGA 1Z45A 4NF2A 3L0YA 3WYEA 2FEKA 2I2BA 2Y2UA 2FPGB 4UJ3A 3CRVA 4F4HA 1NAHA 2J0VA 4J0IA 5CYPA 4ACAA 1NXQA 4NAHA 2CVZA 1I8TA 1J24A 1D5WA 3N0XA 2IV3A 4OA8A 4ZCSA 2A57A 4QU5A 2WHRA 4NAUA 4QO8A 3U40A 4D9IA 4BPRA 1A9XA 4M37A 1UIRA 1OILA 3AESB 3BL5A 5D3MA 3ZE2B 2ILVA 1F20A 3QEAZ 2ZTVA 2VS1A 3SGLA 4W5QA 1YFLA 2CBZA 3D6AA 1GL7A 4UFOA 5ER6A 3OIYA 1P80A 2Q3EA 3JWPA 5HE9A 3RODA 2QN3A 1TT5B 2CXNA 1EK1A 5DHFA 1L3IA 1BOOA 3WYAA 1O08A 4A8TA 1PDWA 3H1EA 3RS8A 3TVDA 3REOA 1OHHD 1O57A 2XZOA 3LUAA 2WJZB 3HP1A 2CLLB 1FU8A 2OCLA 2PKWA 2BJWA 4JBIA 2J7PD 5FXMA 2QNIA 1VHDA 1G4UR 1L7MA 5EJ7A 1N92A 1YO6A 3B82A 3AVXA 4YV7A 2IC5A 2QW0X 2QRPA 4NBSA 3NEJA 3M4XA 2FETA 2PZMA 1I7QB 1N2IA 5KB3A 1N5OX 4B80A 3PIDA 2VTKA 3HWWA 3RIHA 3NCTA 4C06A 3OOEA 4D4GA 2ZRJA 1U90A 3BDAA 3DFFA 3W8DA 1SXPA 4KOAA 3PRHA 1C1HA 4QYWA 1ZZGA 4NYJR 3PNKA 3ZPXA 2FZ5A 1DKPA 4FW9A 1AA9A 3I1FA 5CM2Z 1UADA 1JE1A 1RI1A 3ZNPA 4DDMA 2RK6A 3DBIA 4ZV7A 1Y81A 4WY8A 2OXTA 4KGDA 5CG2A 4V39A 4FKMA 2FGJA 3WSTA 4IDPA 2C58A 1XD8A 1LEHA 5DBOA 3LLMA 1TTHA 1L5LA 4OFZA 3E3AA 3TLYA 2EQBA 1K7XB 1UZMA 4KP7A 1B0PA 2GZ2A 4B9AA 5KX5F 4XWTA 5C35A 2ZW9A 1MABB 2XZLA 1XNQB 1IQUA 1CY6A 3DOIA 4HX2A 2W2VA 4Z4EA 2WPDD 3KZOA 1PDOA 3C41J 4H08A 1XQYA 2FMXA 3MCAA 4GOLD 1WLYA 1AKVA 3DAOA 4QU0A 2WSBA 3F8WA 3VU9A 4BYGA 5I5EA 4BVEA 1ZHFA 2JD1A 3GRAA 1MDFA 1EUZA 2ZSEA 1A71A 1G19A 4AMUA 1AGYA 2C1EA 5ERYA 1QZUA 3AI1A 1H0HA 5C37A 5TE9A 1EWQA 2JGNA 1ORIA 3B8HA 3C6MA 3AEUA 4MUNA 3A1WA 4MW6A 3EDOA 1GUFA 1PWZA 1I2BA 2B2CA 4RGVA 4DEXA 1UINA 1XWFA 5CBKA 1NLZA 2H52A 4NCKA 3Q15C 3QM1A 2E82A 1UJ6A 1TC2A 5DNCA 3E5HA 3PTZA 4YBRA 5I7VA 1L5VA 3LQFA 2ZSJA 3ESQA 1DAFA 3I9FA 3RHTA 4D44A 2Z30A 2Q3BA 4LCJA 1O8CA 3O4RA 4OLAA 5A02A 2NP6A 3QU2A 4IFEA 4O4JB 4WE3A 2GK4A 2QOEA 4R1TA 4EJSA 2Y6VA 2IEZA 1SU8A 3KTFA 1XJWA 3PD7A 2XT9A 2XMGA 3JQGB 3N2GB 2VAXA 3EYAA 3K3PA 3MTGA 4NK5A 5DHTA 4U7WA 4F45A 3LZ6A 1Z0SA 4H77A 1AA6A 4IOJA 4RNCA 5DIFA 1HT0A 1M34B 2AUNA 3PPVA 2Q99A 3PNYA 2CFSA 4KHPB 3SLKA 1DNPA 3G5MA 5HDBB 4CKEA 2D5BA 4B5KA 5C52B 1GZVA 3OLCX 2DEUA 2E2WA 1A50B 1XTRA 4Q15A 2YVAA 3WB1A 4Q18A 4A6EA 1C0EA 5KWIA 1DELA 1TA9A 1EJ6A 1GNSA 1NKVA 1OZGA 1ST3A 4KE8A 4MQBA 4NQZA 3F2IA 4QEZA 4A6PA 4DLZA 4JH0A 1E7SA 5BMOA 3NWPA 4EW1A 3S1SA 3AU8A 3GDGA 2C78A 3LXRA 3E9DA 3ESRA 3OU7A 4EVSA 1P3Y1 2MYNA 2ZT7A 5HZGA 4K9QA 1YR1A 1CDDA 1L4MA 4B34A 1I33A 3RE1A 4N0PA 1HNXB 3PEVA 2QM3A 5E2AA 4OUDA 3EXHB 3CLUD 4H0FA 2NPIA 4JLDA 3HCEA 1HT1E 4KXMA 2XCIA 3AHCA 3QVMA 1UKEA 2C7QA 3NYWA 3OJFA 2H85A 3PXXA 4Q4JB 3U19A 1CQPA 1JB1A 3MT7A 5ESDA 1V7CA 4FHEA 2ZIEA 4NZZA 2PZ8A 1FJXA 2DBZA 4HQRA 2PUEA 2Q3JA 4DJJA 4TL8A 4WEQA 2QUZA 4LKOA 1WABA 2G1KA 3D0RA 1NPYA 2B82A 2DPHA 2FEPA 4DM3A 3I9KA 5FL7D 3DP7A 4Y0NA 4YAFA 2P6PA 3VR4D 1GHTA 4I50F 2GBLC 1CP3A 4TYQA 3ZE8A 2Y1XA 2FN9A 3IQFA 3LDAA 5BNZA 1XF9A 4WKBA 4FFPA 2ZG6A 3DT6A 3FBTA 2MR5A 2QY6A 3VJLA 4KODA 1C8BA 4HB2A 1ZI8A 1H2RS 1DIHA 3PJGA 4LN1A 2QE7D 1QP4A 1TZBA 2AJBA 1IATA 1RQ2A 1HDRA 2ZIUB 1XQ1A 1Z4JA 1IZ9A 2HJHA 3FUXA 1GL9B 1WZCA 1EH5A 4I9HA 1KO5A 2Z5GA 2Y6UA 1LX6A 1S2IA 2LR0A 2DJIA 1DCTA 1N2OA 2IZ1A 2ZKLA 5T8KA 1O4VA 2R97A 2N3ZA 3OO1A 4UKDA 2FSHA 3D0OA 1Z4QA 1AC5A 3MGCA 2XPCA 4IDBA 4QQKA 1XV5A 3V2IA 5D3ZA 5FBZA 1T8UA 5FUWA 5GP1A 3FGNA 4U0JA 3GA7A 1KETA 4XIYA 4BFYA 4DMCA 4MYUA 3Q1LA 1B8UA 2VZ8A 1E2KA 3RRJA 4BS9A 5L40A 1ZZEA 2Y9MB 3CLUC 1KMIY 1UT8A 2VDOB 4H3KB 3EDQA 4J0QA 4H15A 1B6RA 5F4ZA 2O48X 1M66A 1WPQA 1WVMA 1QYVA 1Y3IA 2ZDHA 2XUGA 3V2UA 4RV4A 1WAMA 1O5IA 3I8SA 4LY3A 4WNCA 1IY0A 1H6DA 4XQ9A 4Y9DA 4F3YA 1ZVKA 5K4HA 4DR2B 2XQVA 1XKLA 3OZAA 4BB6A 2GVDC 3OFJA 3BSFA 4TSRA 4PGHA 4PLPA 3VNBA 5A03A 1QRRA 1CUZA 1L5HB 2CDNA 3WLAA 3OZIA 1VL8A 4EPVA 4DV0B 1DQRA 4NVRA 2F3SA 1OTYA 2ZBRA 4LHWA 4G0VA 2H1VA 2QP3A 3I23A 4XM2A 3I8OA 1Y1QA 3W1WA 2B0JA 2R00A 3DDOA 2C5FA 1V47A 4FUQA 3ZWAA 2JLQA 1Z6GA 1CY7A 2CJWB 4NZOA 3RLFA 4G26A 3CKKA 2ZQ5A 1YZUA 3TFWA 1UT6A 4RAQA 1XDDA 1VDMA 1IQ0A 4DIMA 4GZ5A 1YR9A 2QYHA 2CK3A 2Q2OA 2YOHA 3H0CA 3I72A 4YP1A 3OQIA 4ZOQI 2AX3A 5JNWA 2VATA 3HJFA 2X76A 2AEEA 3GUYA 4WTOA 4NG4A 3RO7A 1XA4A 2C3PA 3AF0A 3WL5A 2SCUA 4XRGA 1G5TA 5BN4B 1QTQA 1XJQA 3DXYA 3IPXA 4XUGB 2A5LA 3AG5A 5LQKA 1C3OB 1PJSA 5TLSA 1RVV1 2GJSA 3NJ8A 4JXZA 3V46A 2DMRA 3TRFA 3IJRA 4XCQA 3SC3A 4JHLA 2FA9A 2REQB 3U4HA 3VR2D 5KYKA 3BXFA 1VIYA 4K6MA 3M4JA 3SLRA 2ZAMA 4Q00A 3T5MA 3ED5A 3GLSA 4LSMA 1YRBA 2IVZA 1V48A 1DG1G 1ZW1A 1VOTA 4FEGA 3AUAA 3DHEA 4MMZB 4P1ZA 4PR0A 1SH7A 4CEJA 2WUGA 2RHCA 4MW0A 1M7BA 2E85A 2PH3A 4PRYA 3CNEA 1UKZA 2YXNA 3H5VA 3KZ1E 4RDCA 4U1RA 4DKJA 3E48A 3ZHYA 3BMNA 4AKGA 8OHMA 1EUQA 2CXTA 3GPBA 2NO6A 4QVIA 3HR8A 3IBGA 1AK9A 3KZKA 4RGYA 5JJLA 4Q01A 4CE6A 3Q3HA 3KOZA 3ZV5A 2C3UA 2ES4A 4IIHA 4ZI7B 2BFFA 2DULA 4BVHA 1AKYA 1K89A 3O90A 5KKNB 5E4YA 1Z82A 4PG6A 3J7AC 1X7WA 2FR1A 5EGNA 1R0ZA 2PU5A 5DBGA 4HDKA 1E1CA 3JATA 3NTOA 3F7OA 1WW3A 4EB0A 2XDQA 4C7MA 1WMEA 4EA7A 1X86B 1F8FA 3QBVA 4GYKA 4CPDA 1RBQA 4RCVA 1IEXA 1KP9A 1SKYB 3DDNA 4RK1A 4C1NA 4EPRA 4LGCA 3BFJA 4R3NA 2GHIA 2CLSA 2GFHA 1H94A 2PTGA 3ETGA 3HO8A 5T4HA 1LDYA 3M3HA 3NONA 4Z49A 4NU5A 5J59A 3GA5A 4F71A 3QE2A 2PXHA 4P80A 3E9EA 2M6LA 4RVCA 3ZI0A 2ACWA 3I1JA 4B31A 1Z62A 4MPDA 2QTFA 5LL6P 3K5PA 4LUCA 5MN4A 3K6JA 1RRGA 1J21A 2WKRA 1LFAA 2HDHA 2P2LA 2AFRA 1L7QA 3HL0A 4UVHA 2W8BB 4B79A 3AEYA 5EIBD 4N5HX 4OHPA 4Q3OA 4H6PA 3TDMA 3OY2A 1H2XA 2XQIA 3RTBA 1R4NA 1NTRA 3S55A 1VIVA 4OBWA 2RGGA 3LY9A 3OOSA 4JJIA 4ZU6X 2XX3A 4JBGA 4CIXA 3S1AB 4QLAA 1NMEA 1KQNA 1I1QB 3PE3A 5KVSA 5BUSA 2DQ4A 4GOKA 5F51A 2YX1A 4J4BA 3IDOA 1TUBB 1Z0UA 3WLNA 4CKXA 3LWNA 3JAWB 1E3EA 1T9CA 1KK1A 4DQUA 1JYFA 1Z38A 3PJEA 1SHJA 4N82A 4OKSA 4CM9A 1MVNA 2XB2A 3EIFA 3AVWA 2QTVA 4PYLA 5CPFA 2V8BA 1JLMA 1N7IA 1E79D 4W99A 4WVLA 3AUFA 2H2IA 2VTEA 3SYTA 3PZBA 3QYJA 5DZSA 3L84A 1ZLXA 2BW0A 1G21A 1I3KA 4O1MA 3E9NA 4D57A 1QFXA 1SHTX 2VDPB 4BLQA 4MJ7A 1T1IA 2EFJA 4O5OA 1NLYA 1QYIA 2W0SA 2Q6IA 3QEBZ 3RWMB 2JCGA 4PXYA 1RMTA 2OAGA 3ZLTA 2GXUA 1HFEL 1QIMA 2J9FB 2WE8A 4U39A 4MQ6A 4KXWA 1ZNXA 1CF2O 4RBNA 4DSTA 1F6DA 3EFOA 3CE9A 4DCMA 4ZCMA 1ZU4A 3KL4A 5JWOA 1CUCA 4JSTA 4OATA 1PTKA 3WJ7A 1XNRB 3ELDA 2V6BA 3MTJA 3WGTA 2UYOA 4LTNA 5JD6A 1USWA 2DBQA 2NZ2A 2VZLA 1D4OA 4ESHA 5BWOA 1HR0B 1GPKA 1Y9AA 1V8BA 3PQ8A 1KI6B 2UZ1B 3AIIA 1LWNA 3A31A 1JPJA 2ONKA 4IJUA 3SXPA 4ENWA 3R76A 3W5BA 4XIGS 1XZQA 4ZEXA 3QFCA 2IE8A 4J1NA 1LLUA 1IXZA 1LF0A 3MUEA 2CFRA 3BAFA 2MDTA 3QPDA 3B2QA 4P0PB 4TS4A 2OY0A 3NAZA 3SZRA 4URFA 3AJRA 3K1AB 2KM1A 3QY9A 4XQGA 1V35A 3LUKA 3VZPA 1UMKA 4K6GA 4MJXA 4ZV9A 5K3BA 2PSJA 5K0SA 1JZTA 3OTOB 4M46A 1O03A 2VP0A 2XKBA 3IEXA 4GI2A 3OLQA 1PQUA 2G9VA 3FCUB 4FSXA 4KSBA 3PENA 4PTLA 4AYXA 5D86A 5FV4A 2I67A 2D7CA 2VDWB 1LDEA 1EP9A 1AMOA 2TMDA 5I7SA 1PFQA 1YHNA 3AXSA 4E5SA 2O5CA 4CFYA 2WEKA 1L4UA 2XD4A 3H83A 1YVEI 4ZGGA 1PR1A 3GQBB 3KPJA 4PN7A 1TT5A 1Y7LA 4R5HA 3RC1A 1C3EA 1GITA 2H4HA 2HI0A 4ILEA 1Q1NA 1T5LA 4QGBA 4WAUA 3RK4A 2IYNA 3UMMA 3H7AA 2V7UA 4UBNA 4UXIA 3B6IA 1I3CA 4Q5IA 1UF9A 5D84A 5T4FA 2F64A 3GD7A 4OHKA 4IF4A 2NMVA 2I03A 1Y7IA 5KTYA 1D4ZA 1NR5A 3G89A 2R6GA 2QRGA 1PRYA 3JQ9A 1NE7A 2VBFA 3NVAA 4L8YA 4PICA 4P3KA 4EJMA 2DFNA 5KWVA 5HCUA 2GT1A 2NO9A 4GVPA 1GPJA 4LFCB 3RK1A 3THWA 4BPBA 3HCDA 3QA3E 1U6JA 4B7XA 2YWCA 2R5WA 4WLNA 4KTVE 3SF0A 3ZY3A 2KLBA 4OQPA 1KP3A 4CKBA 2VTBB 3ZEAA 4F5DA 2X8AA 2ZATA 1WE2A 2FW1A 4FDLA 5A7HA 1C4KA 4UCQA 3S2YA 1D2RA 1E69A 4G1FA 4YEDA 2IE0A 5EQTA 3OZ7A 4MH0R 2FW9A 1BWPA 1SWWA 3BCUA 3FPGA 3SYLA 1XTZA 1MOPA 2FEAA 4AZSA 2IS6A 2G7ZA 2JGFA 5EERA 1MZVA 3A3YA 2BFAA 3ZWMA 1PK7A 4N0DA 5CW2A 3VR6A 3ZHTA 3A0RB 3H2KA 4U7TB 5P21A 3PHBE 1Q1GA 4MWDA 3EZFA 1VLMA 4RVHA 3JWIA 2W6OA 1QYCA 2Z6UA 2VZ0A 5A3JA 2ZZMA 4NFHA 4D45A 1KEWA 2RGEA 1FFXB 1R12A 1I24A 1MRNA 4R9SA 5BSVA 3C3CA 1GFIA 3ISJA 1ZK4A 4KJZA 4BU1A 5GZ1A 1YA4A 4ZT6A 4F3TA 3DE3X 4FZVA 2EWVA 5JAIA 3EVDA 3BWVA 3RS0A 1RLIA 2GHQA 2A9FA 5DTMA 1XVVA 2XMCA 1VLJA 2GHRA 1VKZA 2ZLBA 3ANSA 3AYZB 3GJQA 1G55A 4INPA 3IUEA 3M1IA 3MIZA 4LRXA 4QPJC 1ECGA 1HG1A 2ORYA 4ZO6A 3UAWA 1NIJA 3WQHA 3Q3JB 2AXQA 4J0CA 3LUFA 2JBAB 4B3BA 1H9CA 3ZDQA 1TMYA 2QR5A 1MFZA 3AO0B 3NGXA 3DEYX 5H81A 4TRNA 4ASUD 4KBYA 3FBWA 1VG9B 3KDPA 2GI4A 3B5JA 2W37A 3QU9A 2HRQA 5D6OA 2EX1A 1BRTA 1ZLYA 4L3WA 3LXXA 1MG5A 2PX3A 1DS6A 5I4KA 4EB3A 3SI7A 1FFWA 5EL0A 1L3CA 2XNHA 1NQ5A 2WF5A 3ZV4A 2A0XA 1Y3CE 3HC7A 4ML3A 2AMJA 2C03A 2F90A 1BGVA 4N48A 4HSEA 3E70C 4N5DA 4NG5A 2P9QA 2ZJ2A 3DOUA 4DQLA 3K70D 2B8WA 3AI3A 4K9NA 5ALOA 3AUYA 3GROA 1LJUA 4YALA 2VHYA 1Z2OX 3LHFA 4I1RA 5H9WA 2BE7A 2BMVA 2OFXA 1EVEA 3PE6A 3Q2IA 4QECA 1Y8RA 3UF0A 1AN0A 1XZMA 3O0TA 2KS6A 1O95A 5CVCA 1JJAA 3WLEA 3W5CA 1E6MA 3BWXA 5F7JA 1U94A 2EFGA 4OIFA 3F3YA 1EFVB 1XAJA 3H1BA 4AURA 1B00A 3SKYA 1CYDA 1UPAA 4GI3A 4QNMA 3B20A 1EFCA 1FRZA 2I4RA 1RNLA 1BMDA 4IUDS 4UD2A 3T9DA 2D59A 3GLGB 5JJIA 4ZHSA 2HT1A 4JL5A 4WA8A 3N0TA 4NCXA 3LVQE 4ZYWA 2P6MA 4GGPA 1B15A 3ZY5A 1SIUA 3EMBA 4FW8A 4QXOA 1GZHB 5JROA 2AFVA 2BZGA 4HDSA 3V8BA 4H4DA 3DF7A 3MPOA 5IULC 2BGWA 1PQPA 2CKDA 2BSAA 4D3DA 1EWTA 3WIEA 4NEHB 1P2BA 3DTVD 3OZRA 4JQZA 4F5ZA 1MB2A 2OSVA 1U0EA 4J3NA 2RGNC 1XN1A 2ONYA 2HUPA 2P5UA 3EFBA 4KMRA 3TKLA 2W2PA 1RR6A 3DW3X 3NATA 721PA 5IUJC 1ABBA 2W6ID 2DLNA 2YWJA 4OL9A 4A6XA 3QVWA 2IHYA 2ZAOA 3NEYA 4PLFA 3R44A 2BJHA 4OI1A 2Q5CA 3TRKA 4B6PA 3I8XA 3GDOA 4CLEA 3T4XA 3K70C 1RIFA 3WLQA 3PE4A 1UWLA 3WIBA 1Y98A 2KX7A 1WIWA 2CHVA 1Q6ZA 3E3LA 3AR3A 2FAXA 3CURA 4RIHA 3ID6C 3LQ2A 4RTKA 3DAHA 2C94A 3O5AA 2C4HA 2VNJA 3E3OA 4IQ8A 4BZXA 1C81A 3L7OA 2J0QA 1SVKA 4B73A 4JFAA 3TRIA 5CB8A 4R2WA 3BMOA 1DMSA 3G6WA 4TLMB 2FPSA 1CZKA 4CQLB 1E5LA 4D3FA 1KIAA 1REQB 4XIJA 2GDJA 1U9CA 2GNAA 5TMBA 1JHYA 1XI2A 2EW8A 2O8NA 5DGDA 1ENOA 4RVUA 2GJKA 2B9VA 3I0MA 1W19A 1ZK3A 2AI2A 2ZI3A 2X4IA 3KOYA 4WJKB 3PVCA 4KPEC 1KEEA 3NDBB 4X60A 4OYLA 1CRQA 4MAAA 5K1ZA 4EHKA 5HKKD 5BQPA 1EIWA 1QXSA 3D6NB 2PH5A 1BROA 2HBZA 2O2CA 1G8MA 3DUWA 4U6QA 4JUBA 3UUEA 2YKGA 2QG4A 1MXFA 4HVLA 3H87A 3IXLA 2I6XA 1E2PA 4J43A 4UM9B 2GSWA 4NOKA 3SN6A 3E8MA 2Y1EA 1T1GA 4IH4A 2EFDB 3ZD9A 3MRXA 4MHTA 1N25A 4N41A 3TE6A 3ZZUA 5FI5A 4A5SA 3EIHA 3A7EA 2DH5A 2X3YA 2C5LA 1HDGO 4TWBA 4Q21A 3PC8A 1H1TA 3KZXA 3PX2A 4HYYA 1E1KA 2WE7A 2O4UX 2WC1A 1Y3HA 4S1WA 1Z74A 2WUDA 4C7KA 1GP2A 5HQ3B 1N3BA 4LOHA 1QQ6A 3FTDA 3HRKA 3IAM6 3JAKA 4S1NA 2WV9A 3EZ2A 2OL4A 4E1VA 4Z4CA 2F67A 1U0FA 4RZQA 4ZPJA 3B60A 4I8IA 2GUWA 1SG9A 3DQQA 3JASA 2HV8A 4B4VA 4TS9A 4QDOA 3DXFA 3L41A 4ZAZA 4E2FA 3GJ8A 3EVEA 2AJ8A 4MQUA 3IP9A 5B1HA 5TMDA 4XWWA 1WBDA 2HYIC 4I7EA 1JQLB 4H18A 3IUQA 1XRQA 2ZUTA 5SV2A 2OGZA 2D0DA 3WL3A 2HF9A 2H63A 3N1UA 3B5IA 2OORA 4P53A 1AG9A 4Q37A 3IPRA 4C01A 4GWLA 4ND4A 4ZMRA 2VK8A 2BELA 5AVSA 3T5GA 3BZWA 2HJWA 2LBPA 1OI7A 3PT5A 2LKCA 4P4NA 2LE0A 2VEOA 4TT3A 5EEGA 1SELA 2REQA 3X1KA 5ED0A 3LE8A 1U3VA 4EDHA 1EVYA 5K3EA 4BLRA 1DWQA 1TB4A 4EG4A 5BQ5A 5J4VA 3KSUA 4MRVA 2BI8A 1WQ3A 4QGSA 3DEAA 2FSGA 1SUAA 3D7RA 1IOWA 4MRPA 3CMMA 4QTTB 4WMLA 3S40A 2VJAA 2ZOSA 5CCDA 2CNDA 3O92A 3RS3A 3H1PA 2ZRDA 1OVMA 1TQ6A 2G82A 2W2LD 2ZVQX 4Z9FA 4LE0A 1JMVA 1OZHA 2CFIA 3G5LA 3Q7EA 5DO9A 2VLIA 5E0KB 1GOTA 5AVVA 1OIXA 1FFBA 1OWMA 3KKKA 4MR8B 4KLAA 4QOEA 3G0GA 4IOMA 2EV9A 5MN5A 4BNDA 1CUBA 1OGJA 3NR2A 4L4RA 2Z43A 2WUEA 3M6IA 3E58A 1VKOA 1ZA2A 4OG2A 2BDUA 2VOEA 4RVDA 5HKLA 2Z57A 4D9MA 1XA3A 2VNAA 3P4YA 3WRYA 1ABFA 1C7ZA 3WRVA 1HH4A 1NWHA 2XLCA 1P4GA 2APJA 3FFAA 3IAXA 4MYSA 4DQ0A 4HS9A 4TV9B 4FMBB 3BFKA 2NQTA 3RADC 4C2UA 3O8OB 1A69A 2AFIB 2DWUA 2WSMA 4JUIA 1GNRA 2VPXA 2AZTA 5G0UA 3MTIA 2XB9A 3D2AA 2XI4A 4K0RA 2WTUA 3HYLA 3NM5A 4ZQGA 3EMDA 1NQXA 4CM5A 1G8PA 1OMOA 1SKBA 1LQTA 1EFUA 1U0GA 3NDPA 3TQFA 2IIQA 4NOMA 3K0FA 1SURA 1MQ9A 2RBGA 4XEUA 4DMGA 3C98A 2AI1A 4EMSA 4G86A 2W8BA 1PNQA 1ZJ6A 3I2KA 3ILHA 2DFLA 4Y2RA 4CCYB 4EW2A 3VO9A 3L8MA 2JHAA 2PA3A 4EY8A 3M33A 4UHKA 5DSZA 4HNUA 3BE8A 5HFAA 3RM3A 4B3RB 2PGJA 2OC4A 5DLYA 1OH8A 3SQLA 1LDGA 4OAQA 1UJMA 4NYMQ 4ON9A 1TRHA 5LXTA 1GG9A 2CHUA 4HUQB 2C2XA 3LLUA 3FHOA 3N5CA 5C1OA 2OHXA 1DQZA 3I9MA 4G0MA 5FL3A 3JAWA 4RTQA 1E5TA 1KXJA 1WXIA 1BCSB 3D7MA 5EPEA 5JEEA 4H3HB 1CERA 1SG0A 2ADMA 2ZYWX 5JG7A 1GD1O 1IULA 1T4GA 1IBSA 1RHQA 2BFBB 2XIJA 3L6RA 4G8CA 4GPBA 5LQNA 2IH2A 1W44A 3S8EA 5E4JA 2V1XA 3HRHA 4URZR 1TVEA 3ZWNA 3LNTA 3OFNA 1A95A 1BMQA 2FE4A 2EKDA 1PV4A 4MVJI 3IP6A 4AMZA 2ZCVA 3PXCX 4C88A 2GJ9A 4LNAA 3AP2A 1R6DA 3PNBA 4WINA 1IONA 3GFQA 3L7LA 2VYCA 4G9GA 5A0VA 1B0UA 1Z0JA 4PIMA 4TXMA 4WCFB 2X3FA 3A4TA 3QVUA 1R5OA 3Q10A 4IQFA 3FSJX 4DVGA 1X3SA 4ZDKA 3IXMA 3A25A 1D9ZA 4Q4CA 3OEHA 3NP7A 1U8TA 1DV2A 2ZB8A 4KNWA 1G16A 1TM5E 2G28A 3ZU5A 2RHOA 5ALSA 5KTNA 3GJ4A 3O1IC 3FG9A 3WK9A 2PWBA 2JCXA 2L42A 4US0R 1Z06A 3P4XA 4D8XA 1FDIA 1C2TA 1KI6A 1EE9A 1IN6A 2UZ1A 2JAWA 2ZYRA 3P2JA 1H22A 3R5TA 3NVMB 3GU3A 1NF3A 5AW9A 3UMSA 4YV0A 3J81k 2QRQA 3U44A 4TMKA 1QO9A 1ZWKA 3MXOA 2IEIA 2Z8YA 2PV0A 4K03A 4BFSA 5JSYA 3C7DB 4AO8A 4MICA 5B1IA 1EDZA 3G9QA 3NBYC 5LD2B 3K05A 4MGZR 1JBKA 3F71A 5KNCH 4B48A 1OB5A 3NPMA 2ZRIA 1XRPA 1LDNA 3DYVA 3U6KA 3VHQA 2J07A 4ZAXA 1HWYA 2NYAA 3E7FA 2J67A 5DYWA 4B6JA 3TVTA 5CDSA 4Z3OA 3OWXA 5KWEA 1I0IA 3W6OA 5CCEA 4BNUA 2I1QA 5IDWA 3JSAA 5KQRA 1EVQA 2EEPA 5C53B 4Z8YA 5CH5A 2P2CA 3GVIA 4PAGA 4Y2SA 3QGMA 4FGKA 5E9AA 5EYPB 2YJ6A 4D9HA 1FSZA 1B74A 1NURA 5HHTA 4YJHA 2BI4A 4DIBA 4RZSA 1F9EA 4OOFA 3PXUA 3PZRA 2K5UA 2X13A 1N6HA 3PC7A 3TX6A 4D4KA 3OZFA 1IJBA 3GQBA 3UJNA 4WECA 5FUVA 1JSLA 2X9GA 3TNDA 1WSAA 3IPAA 1XZIA 1EZ4A 2M2IA 1NXWA 5JD4A 3KWJA 4NJEA 4IIUA 1YS4A 4UMEA 2GD1O 5AXDA 1CDOA 2C2GA 3H2HA 1IMOA 3M8KA 1R4AA 5K0TA 1NY6A 3VSDA 2PSEA 4EW3A 1UPXA 3D3WB 3B6MA 1KE2A 1IBKB 3N6VA 1G20E 3EUFA 2GK3A 5CIQA 1KZ1A 3SJ7A 4N7MA 2J7KA 1FDUA 3DVAA 1T4CA 3K0BA 4YXFA 1F8YA 3A14A 3ISVA 1AKWA 3R5KA 3F5MA 4X1KB 2OCGA 2XUQA 1G41A 1JDVA 1SKQA 4UAUA 2QGFA 4GVLA 4AJEA 5DM70 3EUWA 4QTYA 3W04A 1F3OA 3WWDA 4OH1A 1FYEA 5B6JA 1U9YA 1JWLA 5C51B 4QQ8A 2IK8A 4A6DA 2QY9A 3FF4A 5IRCD 3M4NA 3GUCA 2XT6A 1JJBA 4Z4IA 1R5NA 1Q77A 1NW6A 2R4UA 5ERXA 3HB7A 2O8CB 4RU1A 1I2AA 1NNI1 2XAUA 4CT5A 1RAEA 1U3TA 2EP8A 1XXLA 5JADA 1QVWA 2AJDA 2I71A 3BGIA 3AEQB 4D82A 4DTCA 5EXXA 4JDUA 5M5BA 4JP5A 3ZX5A 3COSA 4FNGA 1ZG3A 4UD6A 2FMIA 2NU6A 2I2WA 1IUPA 1Y82A 3RAGA 3L5OA 5J2UF 1IU9A 1ZOIA 3OF2A 2XUAA 4R40A 2PWAA 4RKYA 1QH1A 1NJ1A 1VE9A 1LSJA 2RB5A 2E0IA 4TL7A 4KO1S 3QJYA 1LA2A 2PMDA 3BB3A 1B16A 1J00A 3TBHA 2AI3A 4XGQA 3IEMA 4QEKA 1ZJ4A 3W8FA 1RRKA 2MSNA 3CE6A 5FRDA 4HWOA 4TL6A 5THQA 1EA5A 2H9YA 2L18A 3E4CA 3VQTA 1J5EB 1A8QA 3IUMA 3KAQA 3Q6NA 3V34A 4AO7A 5I8PA 2ZE6A 4ZQCB 3W4IA 1U0TA 1YUBA 5HYVA 4R8KA 1I36A 4UHCA 3UTCA 4Q39A 1W5EA 5JHGB 2WAAA 5KYXB 4WVFA 1QZXA 3WAKA 5AR1A 1CF4A 1HF3A 1ABEA 5C1PA 4FCVA 3UJ8A 3ESZA 3ZTWA 3FB4A 4LDPA 2ONCA 4UC0A 4YJ2F 3RYIB 4K2HA 4DZTA 3GRRA 2A14A 3LHKA 5LQCA 2VJKA 1W9HA 2PQMA 4L16A 3MT8A 4H1HA 2OV2A 1SC4A 1OX5A 5KX5B 2FPPA 3L49A 3L6EA 3M6FA 3L4BA 4ARSA 3TIVA 4ENRA 4QFDA 3VAAA 1BX3A 3T9FA 2EGHA 4E31A 3RSZA 1FZTA 1P4JA 2AG6A 2G88A 1Z75A 2VPQA 4FJ2A 4QBKA 4UZEA 1JQ5A 2QVYX 3NKLA 4ITRC 4LFAB 3Q40A 4DLAA 3QWIA 5JO0A 2Y9PB 2ZUCA 4EKNB 1TLTA 1DC4A 3IUPA 2UXDB 2NVOA 4DDWA 5GONA 4C87A 4NBUA 4LG1A 1PEDA 4WW0A 2NU9B 2OCIA 3C1AA 5CVUA 2RKBA 3L79A 4AN4A 1XP8A 3W1VA 1J20A 2Y0BA 4WOKA 1DHTA 2AUTA 2IWRA 2REBA 4TWJA 3JV7A 1QFYA 1VFNA 2C4TA 5FCDA 1JVBA 4LC1A 4UEOA 4QWWA 5HTKA 2GJ8A 3JQBC 3UJ3X 1BXRA 1U2TA 4X54A 3QNMA 3I53A 3SSOA 2JCVA 3WL6A 1CS0B 1J8YF 2Q7OE 3K9FC 4Q1DA 3ZV6A 4DHWA 5I7UA 1EWVA 3ORRA 2CLHB 1THMA 2NSLA 2JZCA 4UBMA 2VRWA 4M22A 1YZLA 1Z2AA 2NXJA 4LTMA 4TMWA 4PRZA 2CDRA 1ZITA 4BLSA 5F33A 1VJ0A 2D54A 4IJWA 1FP6A 3PRKE 1F1BA 1MAUA 3N70A 1QAOA 3W1EA 3CA8A 1ZRSA 3NLLA 4CMGA 4U4AA 4JX9A 2PD3A 2WHYA 2XJ4A 4FFVA 4AUMA 2CEAA 2R84A 1Q20A 5FOTA 1MB4A 1N5JA 5KNBD 2OV1A 3ODPA 1J06A 1O5OA 5EGSA 1BE6A 4ICIA 1W1UA 1KI4A 1VPLA 2R11A 1FUEA 3OJ0A 4KQXA 4TWIA 3RV4A 1DC3A 1NV9A 3C6QA 4Q1CA 4HT3B 5A1TA 1L8XA 5JR3A 2J33A 1KKMA 1TKAA 3LBIA 1LI7A 2X6RA 4ZCPA 1S2LA 3TZHA 5ADVA 2H1WA 2YUIA 2PGNA 4UTOA 1ZD3A 5KYWB 5LZ2A 2WHXA 2AYXA 5KVQA 1Q7CA 4MWTA 5I9IA 1US8B 3I3OA 4Q34A 3MINB 1N36B 4F84A 2QQ5A 1DZ3A 2O2ZA 3ZE9A 3E9QA 4EYSA 2GETA 5DKFA 2B4TO 1H1LA 4TUYF 4CL2A 2R96A 4AJ1A 4EG3A 2WMYA 4MRAA 5EMJA 3W9UA 3AV0B 3U37A 3A9SA 3T7CA 3NYIA 3N53A 3I73A 1SCBA 2B7BA 4I4CA 4N65A