3QWIA

Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with nadph and coumestrol
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
260
structure length
260
Chain Sequence
YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17beta-hydroxysteroid dehydrogenase
publication title Structural studies on the flavonoid inhibition of a fungal 17Beta-Hydroxysteroid dehydrogenase
pubmed doi rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwiA00
1Z82A 1Y8QA 5BSGA 5MGBA 4K6FA 1HDOA 1OC4A 3A14A 4XWYA 4IPTA 1PIWA 1MGOA 3OF2A 4E0BA 1DO8A 2OP1A 4Y6SA 5IZCA 2OL4A 1KY5A 3QV1A 3W8FA 1HSOA 1B15A 3PLNA 2P9EA 1MG5A 1ZEMA 4D3FA 3TRIA 3QRWA 3PXXA 2ZCVA 3UCFA 1T1RA 2AEFA 2I99A 5KWEA 2DBQA 3INTA 3HDQA 4PFJA 3U4CA 4E5KA 1MG0A 4LN1A 2D5CA 1AXGA 3MCVA 3VH1A 2G17A 4MO2A 1ORRA 1YDEA 2B69A 2PD6A 1ENOA 1FDSA 3L77A 2WTBA 3NTRA 1I01A 1NQAO 4GVLA 4IXTA 3M2PA 2JD2A 2GF2A 4CLDA 4ND3A 3KEOA 1KY4A 1FF9A 1PJTA 4II3A 1DBVO 4MVJA 4ND2A 1A4IA 3X2EA 1LLDA 3ZWPA 1U5AA 3JYOA 3WYCA 3C3XA 4TQGA 4B4WA 3GGOA 1DIHA 2HJSA 5DBIA 2FN7A 3ORFA 3KETA 2HMTA 4FS3A 1S7CA 1ZK2A 4NFHA 4YXFA 2J3JA 4PGFA 4GLOA 4DRYA 2GPTA 2NSDA 4WLFA 4CLXA 2QYTA 1Y5RA 4M55A 1DRUA 2J3KA 4J43A 4FOSA 5T6BA 3MJEA 1P31A 1Y1PA 3DAGA 3I9LA 4XQCA 2ZIZA 3NYWA 3P19A 3PJGA 5GZ1A 1DIGA 5HS6A 3RD5A 1ZNQO 4PLVA 1PGOA 4KTTE 4DIFA 3DONA 3MOGA 1PR3A 4W82A 2VZ9A 3S1LA 4JBIA 1HSZA 2A94A 5KNLA 4TKLA 4E6PA 2BHLA 4W9NC 1J0XO 3I9OA 4GPD1 1ZSYA 4LRTB 3U4IA 3JYPA 2JHGA 2PK3A 5B4TA 4XR9A 3UXYA 5JCJD 2YV2A 5FF9A 2UDPA 3LC7O 4QSMA 4BO7A 1V3TA 2WYUA 3HNPA 4EUHA 1P45A 3DTTA 5KVQA 1NFQA 3QVXA 1EUZA 5IN4A 4UAGA 2EF1A 2RCYA 3KYDA 1YS4A 3VPXA 2D2IA 2GD1O 1ISIA 3H9GA 1ISGA 5TJ9A 4UUPA 2FWMX 4CL8A 1HETA 4RQTA 4IGEA 1PL7A 4NJMA 1TI7A 3SXPA 5IZCC 2FRDA 4GWGA 3SJUA 3UFXA 2UAGA 2F1KA 3RUFA 1LUAA 4HKTA 3UF0A 4RVSA 5C7LO 1F12A 2AG8A 3ROMA 4DPLA 1BXGA 3KYBA 1X1TA 4GX0A 1UXKA 1DB3A 3EHEA 5F5LA 4RF5A 4IDCA 1CRWG 2C29D 1BG6A 3RIHA 4BMVA 3V1YA 4JBGA 3QIVA 1HDCA 3ADPA 2A92A 3MOIA 4DQUA 3CEAA 2X0RA 3ENKA 3V1TC 4QUKA 5H81A 2PY6A 4BGEA 4U8GA 5CDSA 2P2SA 1ZBQA 5DOZA 4F46A 2EP5A 3PGXA 3ZH2A 3ZNQA 2HUNA 3WQSB 4BUCA 3AI1A 4RQUA 1WW8A 4CM9A 1ULSA 1WZEA 5EJ2A 2H5LA 1E1KA 2Q3EA 4DLAA 3ROKA 2OO5A 2PZJA 1I32A 4KDFA 3ITKA 5C7IO 2QX7A 3VC7A 4D7AA 5JY1A 1C3VA 2VHWA 3HG7A 4UVDA 3FPCA 2YDXA 2C2YA 3BMOA 4XDZA 4GGOA 1H2BA 4UUMA 4E2YA 1GZ4A 3UUWA 3PHJA 1CEQA 2O3QA 3JSAA 1WVGA 2E82A 3WBFA 3S8MA 3TDKA 1Y9EA 1DHTA 4KDEA 5JCXA 4WOKA 3P5SA 2X5JO 4DYDA 5CEEA 5G0UA 1QLJA 3ZWCA 1RYEA 1XQ6A 3R6DA 2PWZA 4TZTA 4Q3EA 3UKOA 1XSEA 5TJHA 1U8FO 4ALIA 2A35A 2O3TA 3RUIA 1PX0A 2X9VA 2PKQP 4OQYA 2ZB3A 2UYYA 3D7LA 3ANLA 1QV6A 3W6UA 2AQHA 1J4AA 3QP9A 3IQDB 2HMUA 1Z75A 4RPGA 1P74A 3U4DA 3V2GA 3WMWA 2P5YA 2OGUA 1X0XA 1EVJA 2ZYAA 3RBZA 3JQEA 4OJNA 5L7WA 4I9HA 1C1DA 1U3VA 5I7FA 1Q1NA 4TRRA 4MP3A 1PGJA 3DB2A 3K30A 4PG8A 1KEUA 4ID9A 2PTGA 3RROA 4R3NA 1V0JA 3E5MA 2G0TA 2OP0A 3KUXA 4M86A 3JQDA 3OJOA 2B37A 3DWFA 2GZ1A 2VOEA 3KYDB 4PG7A 3ZU4A 1ZEJA 2AEMA 3PQFA 3GAFA 5CPBA 1XELA 2VRCD 1CJCA 1PU2A 2IXBA 2X0NA 4U6SA 2J6IA 3IS3A 4N5MA 3W4IA 3BA1A 1LRKA 2O2SA 1GTMA 1A7KA 3EY4A 4HFRA 4YT5A 4ZN6A 2Q1UA 1C0LA 2W2KA 4AJIA 3AI2A 3EW7A 1BXGB 4WNIA 4NU5A 1IPFA 3L9XA 2X58A 4RORA 4MKXA 3D4PA 1UXGA 5IN5A 4E32A 4CMBA 1ZO8A 4TRNA 2EKLA 4YQYA 1T25A 2Y05A 3BMCA 1H5QA 2ZB7A 1XYGA 3NX4A 4PLZA 4ZGWA 3ITDA 3KXDA 2O3JA 5JC8A 4E4YA 3D3EA 4LK3A 3H2SA 5ENDA 5TNXA 1YOVA 3EDMA 4WCFA 1DOHA 1MXFA 5T67A 1E6EA 2FSVA 4IMPA 5TF4A 1E3IA 4WE3A 1NXQA 5A9RA 4YBZA 3RFVA 4AJHA 3EC7A 3MTGA 3OQ6A 3OEWA 1K0UA 1MXHA 1YXMA 3U3XA 2OXIA 1VI2A 3LLVA 3BHJA 2HO5A 1IOLA 3KSZO 1NR7A 4AJKA 3WIDA 1D7OA 1I3LA 2CDCA 4J7UA 4CLEA 3QY9A 3VDRA 4B79A 3L6OO 4QO7A 2Y1GA 4GLLA 4P38A 4ILKA 1R4MA 3OECA 3SEFA 4YVFA 5A3VA 4FPXA 5JAIA 1DFGA 3ZWVA 1E5QA 1QRRA 4XIJA 4KQXA 3GHHA 3I9JA 5I9NA 4HX5A 1JVSA 4A5OA 4MDHA 1GPJA 4D3SA 1MV8A 3OIDA 1BWSA 2XOXA 3VPHA 4AJPA 4WJZA 2VN8A 3BTVA 3ZHXA 4FD3A 5A02A 1PZHA 3IMFA 4PLPA 3H9EO 3RKRA 3CXRA 4IY1A 2DLDA 1YB5A 3TNLA 1A27A 3LT4A 5I8ZA 4OMUA 2VRCA 1E3JA 4HV4A 1XWFA 4HADA 4YPOA 1UDCA 5JDIC 5KJ6A 5CHEA 3NAQA 1C0KA 1H6AA 1UZMA 5K9ZA 4FGWA 1NFFA 3GN1A 3PFWO 1R0SA 2WM3A 4ESOA 4R54A 1T4DA 5C7OO 4L74A 3WB9A 1ENZA 3H3FA 1U7HA 4U0KA 5COQA 1U28A 1ENYA 1C1DB 1O95A 4D43A 4IUYA 3ON5A 1SNYA 3DHNA 3TSCA 4ZRMA 3LYLA 4ZD6A 4XQ9A 5A1TA 1UXJA 4UEOA 2I3GA 1FDUA 4WECA 4DLBA 3L6EA 2EG9A 1WZIA 4Q3CA 3IKTA 1QLHA 5F5NA 1LXCA 2CF6A 5I7EA 2A4KA 2OHXA 1L7EA 4YJGB 1BXZA 2UUOA 2ZTMA 1E7QA 3AUTA 1EFLA 1X15A 3GY0A 1BW9A 4WCFC 1N9GA 4QEDA 3UICA 4YACA 1CERA 3GUCA 1DPGA 3WGIA 3ANNA 1F8FA 3RFTA 2P68A 4GAEA 4MIOA 4EJ6A 2Z95A 2PR2A 2W2KB 3WGTA 1O94A 7ADHA 4MVJF 4E5MA 2HRBA 2Q2QA 2X4GA 3FBGA 4B7XA 1V3UA 2WJPA 2ZQZA 3JD0A 1LSSA 2ILTA 2J5RA 1LEHA 1D4FA 4RO0A 4F6CA 1AXEA 1DLIA 2HJRA 1RM5A 3F5SA 1YH3A 4ZHSA 1NQ5A 3DMYA 4HFNA 3VVBA 1YQXA 5CEFA 2P5UA 4WCFB 4IJWA 3T4XA 2QYSA 3S2FA 3VOSA 3GEMA 3RI3A 4QT0A 3GGGA 1KOLA 4CR6A 2VYVA 4AJEA 1GY8A 4AJJA 4NFSA 5JC1A 1XG5A 3JQCA 1ZJYA 4P8RA 4L8VA 3ASUA 2C5EA 1Z73A 3UCXA 3WLEA 4AFNA 3EGOA 2Q49A 3OP4A 1VKNA 2Q4BA 4GKVA 3BTOA 1EUCA 1JN0A 3C1TA 4E5YA 4S1VA 5FI5A 3GNTA 2R6JA 3FNGA 1JQBA 2WDZA 2Q1TA 1R4MB 2IZ0A 1KVSA 1C1XA 4GX2A 4AJ2A 4R41A 3DEYX 3GAZA 4YEDA 5G2OA 4RVFA 3GDGA 4J1QA 4OKNA 4R5MA 4H3VA 1E3SA 2WE8A 1O9BA 1U3UA 4L4XA 5KVSA 4CV2A 2C82A 1AHHA 4J2HA 3ETEA 4XYBA 2VCYA 4G65A 2X8LA 1HDYA 2GRAA 4BNGA 4XCVA 2YV1A 1XGKA 3LU1A 4F3YA 4FC6A 3WTBA 4QQRA 4BO0A 2DC1A 1ZK1A 1HRDA 5DOVA 5FWNA 4NDNE 4IZIA 1LC3A 1P1KA 2CVOA 2IEDA 4RLHA 1ZK4A 3GG2A 1DHRA 3VZRA 4GSLA 2NU9A 3K5PA 4XEHA 1XU7A 5THKA 3O8QA 4XYLA 4BIIA 2D1YA 2NVUA 1JKIA 2NQTA 4RPKA 3GFBA 4WLVA 1SOWA 2NU7A 3AUAA 4OKIA 3A28A 3AY7A 3ZW8A 2JAPA 1E5LA 5T64A 2NV6A 2Y0CA 4B3IA 5AQ1A 3FBTA 2J3IA 2C5AA 1DC4A 3W6ZA 4XD2A 3NDRA 4FFPA 3LSYA 3ZNOA 4FGSA 3FWZA 2RH4A 2VHZA 1EQUA 1KEVA 4BKQA 4PLHA 4E2XA 4NHEA 1VJ0A 2WE7A 5B37A 4BNZA 2AQIA 1IB6A 1N8KA 3I9MA 3E6AA 3Q2IA 3SX2A 1EDZA 4M54A 1KVQA 1HZJA 3K92A 3KTDA 3VPSA 1ZSVA 1BW9B 1N9GB 1T2DA 3DDNA 4ZQFA 7MDHA 3H3JA 3ANMA 1HL3A 3NTQA 3LQFA 4JK3A 3VKUA 1HEUA 1HF3A 3H8VA 4ND4A 3Q9NA 4WK6A 1RM4A 5CDYA 5HWSA 1E1NA 4B3JA 3BMQA 5DZSA 5B4UA 1XA0A 4XQEA 3QVTA 4HNGA 1YRLA 2FPPA 1NWHA 1YQDA 3ZN2A 4CUZA 4CM1A 4WUVA 5DF1A 3IL2A 5A05A 1AE1A 1EQ2A 1NAHA 3CZMA 1OI7A 1PEDA 4JNKA 3A06A 1OOEA 1P1IA 1XIVA 1BGVA 1P33A 1UR5A 1B3RA 3VH2A 3WGQA 4W4TA 3U5TA 4BGUA 2OUIA 3WDSA 4KWIA 3FNHA 1IYZA 4XYEA 1LSOA 3C8MA 1T24A 3G1UA 2HMWA 2IDZA 3CH6A 3ZU5A 1BDBA 3DBRA 2FMUA 2OFPA 1I2CA 3NEPX 2X5KO 3IUPA 2QZ9A 4NBTA 4CLHA 1VKOA 3C24A 4KOAA 4IM7A 3NV9A 3DZBA 4OSPA 4XDYA 4RGBA 3VAZA 1ZMOA 2QHXA 3F1LA 4Y9DA 6ADHA 1DIBA 3DFUA 1LLQA 3GEDA 1JKFA 3H7AA 1IULA 5JMPA 1C1XB 2JAHA 4K1LA 1H94A 1PJLA 4CMEA 1LSUA 1P0FA 2NWQA 4ALKA 3U62A 4W7IA 4R51A 1E3LA 1PL8A 3I9KA 4RPJA 3GEGA 4IS2A 5ES3A 3AU9A 3IJRA 1SMKA 1U1IA 3IC5A 1PJBA 4CL3A 4MVJE 2EJVA 1HE3A 1GCUA 2POQX 4YR9A 3D4OA 3GDFA 4XYMA 3L07A 4NK4A 1DSSG 1P1JA 1PZGA 1PS0A 4CM5A 5L9AA 5F3RA 2BELA 3JYLA 3DR3A 1M67A 4CMIA 1RWBA 5EL0A 5TC4A 3VKVA 2BF7A 1FDTA 4BL5A 2GYYA 1XU9A 3O8QB 2NVUB 1LRJA 1LDBA 2Y0DA 2FPGA 3DAFA 3D1LA 4RDIA 3DBVO 1P3DA 2BI7A 1K3TA 3N74A 1C0IA 3RCBA 3RC9A 4D0RA 1GCOA 5B4VA 1CF2O 4G81A 5A5EA 4GX1A 1WXDA 2D3TA 2F00A 5BNIA 2OZPA 1Q7BA 3GMDA 3INGA 5DP1A 3GVHA 4M8SA 5ADHA 3M2TA 3GZNA 3PIIA 3H65A 2C07A 3GHYA 1DFHA 5DN9A 2I9PA 2CDBA 1B8UA 1CIVA 3G0OA 5IDYA 2Y68A 5L51A 1OFGA 1ZMTA 2VYND 1NVGA 4RZIA 3MJ4A 5BSHA 3HB5X 1KBZA 1Q0QA 3H4VA 4E2ZA 1W4ZA 1GFSA 1PZEA 3WIEA 4ZJUA 1PTJA 2YHUA 3AU8A 3I9NA 2IE0A 3EVNA 1D3AA 3JQ8B 5KJEA 1GPDG 5FEUA 3NJ8A 1ZK0A 4EJ0A 4CMAA 1E1LA 1V3VA 1QORA 3BMQB 4G5HA 2HKIA 2XPCA 1ZUD1 3IAHA 3ETGA 4FFRA 5CP8A 3TZQA 2Y0EA 4IJKA 3TPCA 3EZYA 1YWGO 4E33A 4YQZA 4BV9A 2SCUA 2OOSA 1GYPA 1C14A 4JCOA 2V6GA 4RDHA 3OIFA 1VC2A 5JPIA 1F17A 1PJCA 1CYDA 1X7GA 1I3MA 4CMEC 4WGGA 4M1QA 3O26A 1NPDA 4YAJA 1IPEA 2PGDA 4B7UA 3LT2A 3ETDA 1JAYA 2I76A 3GQVA 5TQVA 4Q3DA 3RBXA 5JY6A 5DNAA 4BO6A 4JLWA 1G1AA 3DBRB 3UOGA 3NT4A 3BHIA 3QJ5A 3SLGA 3WJ7A 4DXHA 1QP8A 2BFOA 1J49A 3QWHA 2E48A 4PIVA 2HAEA 4L4SA 1VSVA 1OZAA 4QTZA 1P9LA 3MJTA 2YJZA 4OGWA 1UXHA 1HLPA 3GVPA 3G79A 4JBHA 1UH5A 2YDYA 3DAPA 4QO8A 3UN1A 4CM9D 1M75A 1T2EA 4DL9A 2GN4A 3TZ6A 4YT2A 1PJ3A 1UP4A 3H9QA 5I9MA 5JAMA 3LK7A 5TS3A 1OMOA 1Q0HA 2O2YA 4MIEA 4A03A 1DIRA 4GKBA 3MJVA 4J4HA 3RC1A 1HWYA 2BFPA 2Q2VA 1EVIA 2CVZA 3HE3A 1ADBA 4FCCA 3NUGA 5JO0A 4BVAA 4I08A 3B1KA 4PRKA 5BT9A 2VYNA 2DPGA 1VE9A 3P2YA 3AFMA 3WWZA 4NMHA 3VH3A 5L3ZA 1PGQA 5T5QA 3OQBA 4MPDA 4IDFA 5CDGA 3TQHA 4CMIB 2I6TA 1A5ZA 1BTOA 5JLAA 2W8ZA 4GX5A 1YBAA 1EE9A 2Q45A 4WEQA 2WEKA 2VT3A 1E7RA 2IXAA 1ISMA 1KEPA 5BNFA 5HS4A 4ZICA 4XA8A 2DKNA 3ZHZA 2V6BA 4JJGA 4FFMA 3ONEA 5JFOA 3PGJA 1I0ZA 2FOIA 1KETA 3GF4A 4LRSB 1Z45A 5C5IA 3I6IA 1ZKMA 4BNIA 1E7SA 5ILOA 3HN2A 2BD0A 3GZNB 4BQPA 3G1TA 3PDJA 3EVTA 2JD0A 3R0IA 3RJ9A 3FR7A 1V35A 1KS9A 4JJFA 4PLTA 1PJQA 3IP1A 4I8XA 4Q3BA 2BFMA 4BNFA 1BXKA 1MUUA 2J5QA 3VPFA 3RUAA 1Y8QB 4UUOA 5A9SA 2I66A 3GMSA 2HK7A 4DWVA 3ICCA 1LLUA 1YKFA 3GPIA 4P4GA 2PFGA 1CDOA 4FC7A 1ADCA 4RVHA 5EN4A 1DAOA 2G5CA 3BHMA 3ZZNA 3OJFA 1DC3A 3OJ0A 3S2GA 4Z9FA 4E5NA 5IXYA 2HMSA 2RH8A 2O7QA 4XJTA 1ADGA 3VZQA 4RL6A 1YONA 4ZQGA 2AEJA 3DZJA 3DL2A 2DTEA 2EHDA 3WYEA 3VVCA 5HTOA 1P1FA 3KO8A 2Q46A 1N5DA 3FRJA 3GG9A 1Y81A 2CF5A 1YB1A 4PLWA 4RVUA 2XAAA 2LDBA 3STHA 4Y67A 1GAEO 1NBOA 2W2LD 3KYCA 4D42A 5IDWA 5KJFA 4BB6A 3EZLA 1EBFA 3K8ZA 3BMNA 3DOJA 1PS9A 3ICPA 2B35A 3EAGA 4WASA 2O4UX 1MA0A 3LVFO 1GYQA 3FN4A 3FTNA 5HA5A 3ZV6A 2BGKA 4EZBA 5TT1A 3AOEA 2YYYA 2BI8A 3OM9A 1BHSA 3TZCA 1X7DA 3DFZA 1H6DA 4O0LA 4XR4A 1C0PA 1SAYA 3U0BA 5F21A 4QFDA 4PLGA 1ZXLA 2GERA 1YL7A 3I6QA 4D79A 2I67A 1TT5A 3HB4X 4FFOA 3PP8A 1XDWA 1DFIA 1DJNA 3LZ6A 2X23A 5L40A 4L0QA 2G1UA 2JFGA 3JYNA 3DZHA 1I2BA 1JVBA 3JQAD 2OMEA 3FF4A 1CWUA 5LCXA 1RPNA 4IJVA 3RUEA 5IDXA 3MZ0A 4A7PA 4LMPA 4J0FA 3PFFA 3ZWMA 1ZIDA 4IXWA 1R15A 4XGIA 2C7VA 2BH9A 3K96A 3BTSA 5ER6A 1UAYA 1PJ4A 3I4FA 3S2EA 5T57A 1X1EA 5IG2A 1ZZEA 2VWPA 2QW8A 3G49A 4BNNA 1VRWA 4DMMA 3A1NA 3L6DA 3ZWWA 5TSDA 1DIAA 2R2GA 1OAAA 4BO2A 4NJMB 3VHRA 5CDUA 2Z1MA 5TRTA 2GN9A 4AJ4A 8ADHA 3S55A 1XR3A 1YB4A 1VPDA 3E48A 4CJXA 1UZLA 4DIBA 2BGMA 4PZEA 4IZHA 5EERA 2DM6A 1ISJA 3V5NA 4CLRA 3NGXA 4D44A 3WXBA 3DC2A 1SOVA 3AUUA 4YJHA 2W2LA 4WLNA 1RYDA 2DT5A 3AUSA 3DBHA 4CMKA 4PG5A 1V9LA 4J91A 3D5TA 4RCVA 2EIHA 3M1LA 3ZWXA 4EUEA 3HSKA 5CAEA 4BO1A 2EGGA 4E13A 1QXSA 3Q2KA 1O89A 2CUKA 1M66A 3TL2A 1QR6A 4RV9A 3K6JA 1I33A 2CZCA 2VUUA 5TIIA 3AOEC 3E5RA 4DMLA 2YFQA 1FDWA 3F46A 1AN9A 2H9IA 1PWZA 2Y93A 1EVZA 3GFGA 3OBBA 4FW8A 1T2FA 2DTXA 5EPOA 4P22A 1E6UA 4WNCA 4TVOA 3NJ4A 3JQAA 1TXGA 1PWXA 3BMOB 4GH5A 5L4LA 1NWCA 4KWHA 4D0SA 3F4BA 3RASA 2NVWA 3QWIA 4D45A 2EERA 3KYCB 4NBWA 2UV8A 2E6UX 4YWJA 4IBOA 2YW9A 1Z6ZA 3BMNB 3ENNA 1TA4A 4BGIA 4KUGA 3D3WA 3ZI0A 5AXAA 4O1MA 2VYVD 1T4BA 3ZCXA 5AXDA 2GZ3A 4Z3DA 3RVDA 3WTCA 5L53A 1DAPA 2D5AA 3FR8A 4YJFA 5JAQA 4CV0A 5IJZA 4TROA 1TT5B 2JHFA 2XXJA 3A4VA 3C1OA 4B8ZA 2Q2WA 3E8XA 4PZCA 1PJ2A 1EVYA 2FR1A 5HM8A 4UVHA 1K2WA 2UVDA 3PVZA 4AG3A 1NVMB 4DC0A 4ND5A 2HU2A 1WDLA 4YCAA 3CINA 5EIOA 3PQDA 4E21A 1B3BA 1S6YA 3MJCA 4WPGA 1GZ6A 1FDVA 1NAIA 4YB8A 1SO8A 4IDAA 4J1SA 1SPXA 3JD2A 2EJWA 1L7DA 1UAGA 3GA0A 4N54A 2PGLA 3ABIA 4FOOA 4ALJA 4ZQHA 1SCUA 4W7HA 3QVOA 2ET6A 1LSJA 3WQQA 2HK9A 3VDQA 4ZA2A 2FR0A 3WX0A 2B5VA 4DPMA 4W6ZA 3DOCA 4RF4A 1Z74A 2E4AA 1YL6A 3RBVA 3AM4A 1JAXA 3HADA 2IZZA 4BMNA 5G4KA 4BNHA 1ZK3A 3JQGA 4M89A 4K28A 1I5RA 3CPSA 2JFFA 4NBUA 1RKXA 1NR1A 3PHLA 4CLRB 5GZ6A 2C54A 3PHGA 3IDSA 2EWMA 4BHTA 3ZWNA 1PGNA 1Q2XA 1YBMA 3ULKA 1R0LA 3KSUA 2GSDA 3MWDB 5I9LA 3GDOA 3CTMA 3KZVA 4YDRA 1JTVA 4BNYA 3BMCB 4MIYA 3W8DA 3DBHB 1GYRA 2B36A 2Y1EA 5F1PA 3IKVA 3UHAA 4EYEA 1WP4A 5G0VA 1YOVB 2QRJA 2V7PA 2DAPA 1PQUA 3EK2A 1X7HA 5J23A 3JD1A 2GCGA 4NQZA 3KOUA 4IDDA 4TRJA 4TKMA 4QX6A 1LDMA 2CFCA 5LC1A 3RU9A 2NTNA 5COAA 5JMWA 2YFHA 3QSGA 3E9QA 4I5DA 1LJ8A 2Z5LA 5KVCA 1R12A 2D4AA 3OMLA 4YAKA 2Y1FA 3C7AA 3D64A 5JYDA 2O3UA 1PR9A 4RJTA 5DP2A 1FK8A 1P0CA 2O48X 3CIFA 1R0KA 2PKRA 2AG5A 3DZKA 2ZTVA 3F4LA 4NFYA 4OHUA 4AJ1A 5JBIA 3JQAB 3QHAA 4J3FA 4LMRA 2EW2A 3OEYA 4PLYA 4NPCA 5LDGA 1ENPA 2X1HA 3E9NA 3PEFA 5KKAA 3DXFA 3ROQA 4BO3A 2YY7A 4BNWA 4B4VA 2OBYA 1KC1A 1GL3A 4GMFA 4NBRA 3H9UA 3EUWA 4A0SA 3QA9A 5IXSA 4BNUA 2R00A 2VOJA 3ZV4A 3PTZA 2VT2A 1QKIA 3ONDA 3KB6A 5L45A 3QWBA 4WLEA 3RUDA 3WGYA 3PJFA 5KKCA 4I9UA 2DUWA 4DIOA 3KVOA 1E3WA 1P1RA 4YJFB 3EYWA 4DQVA 4YRBA 3DQPA 1QYCA 4CMCA 1H6CA 4PG6A 4IQ8A 3JCZA 2ZCUA 4E5PA 1B26A 4LSMA 4TWRA 4UULA 1DDOA 3LDHA 3A9WA 1I8TA 3HDJA 2JKVA 4MVJG 1PGPA 2FPIA 5ILGA 2QRLA 1V8BA 2CSUA 3F3SA 4A27A 4MKRA 2X5OA 3KLMX 5JXWA 1M2WA 4CR7A 5B12A 4OAQA 3RFXA 3ASVA 1UXIA 4YTEA 1VL6A 3ZHYA 4I5EA 4JQCA 4KMSA 4FFLA 1U5CA 2TMGA 3W4JA 4R16A 3KV3O 2O50A 2VUSA 2VTEA 2ZYGA 1MP0A 4OXNA 1YJQA 3HDYA 1F8GA 1YDWA 3RC7A 5I7VA 1M6HA 4R1SA 3PHIA 3WFJA 3OFSA 3DHYA 4CLOA 5G4KB 2JJYA 4PG4A 3I4CA 5U1PA 1JKJA 2O4CA 3JV7A 4PLFA 4BKUA 3TFQA 4BO9A 5A5FA 2EKPA 1Q7CA 3FTPA 3GT0A 3V1UA 3GLQA 2IYPA 1DC5A 3GZ4A 1KVUA 1UZNA 2BLLA 4Z6KA 4J9UE 3HDHA 4E2WA 5GY7A 5K0ZA 1U2DA 2DQ4A 3B70A 1Y6JA 3NTOA 4FDAA 4XB2A 4A26A 1NPYA 3R3SA 3BYZA 1NYTA 4L76A 3ADOA 4C7KA 5CG1A 3H5NA 4GI2A 3JQ9A 4I1IA 1EDOA 3HN7A 3E9MA 5A3JA 3E82A 5EESA 4RVGA 4KUEA 4DREA 1QMGA 2UUPA 2J8ZA 1GV1A 1OBFO 2R00C 3S2IA 1XEAA 6LDHA 2VHXA 4GQAA 3WYBA 5ICSA 1J5PA 4OXYA 4DQXA 1P77A 3GRPA 2VRBA 1HZZA 4JGBA 5L4NA 3SJ7A 4DBVO 5FI3A 4CQLA 4QXMA 5JE8A 1HE5A 1D1SA 5G0SA 4CM8A 3IOYA 2WSBA 4BO4A 4JP2A 4MVJI 3RUCA 1KEWA 4RVDA 4N7RA 4R68A 3RWBA 3BAZA 2GO1A 3VPGA 1TT7A 4E3ZA 3U4HA 2YZ7A 4CV1A 3L0DA 5K6AA 4UEJA 3WGHA 1I3NA 2HCTA 1HT0A 3Q0EA 2C0CA 1JLLA 1Y7TA 4IMRA 3ZWAA 3H9JA 3PHHA 3RQSA 4KZPA 1UDBA 4B4OA 4K6CA 3ZV3A 3ZNNA 1EFKA 1MX3A 5DDIP 5DT9A 1MFPA 1GQQA 1E3WB 1Y8RA 3TJRA 1AGNA 2G82A 3HQ4O 2OORA 1ISFA 1K5HA 4U6QA 4GVXA 3GNSA 4CM7A 3FD8A 1SZJG 1ID1A 3BXXA 3WWYA 5HRUA 3DZGA 1GR0A 3H6KA 2IODA 3DMTA 3G17A 4IINA 3NRCA 3GC6A 1IE3A 1NASA 2P9CA 2X22A 5BR7A 2Y67A 2RHCA 3QVSA 2NTVA 4ROSA 1WLYA 2BGLA 2EEZA 4JJIA 1IZ0A 1DRWA 5H82A 4BO5A 2WD7A 4BKRA 3FHLA 2NACA 4EGFA 2NADA 4NI5A 5EMHA 4Y98A 3OHSX 1HE4A 3QVWA 3GVXA 1YQGA 4IS3A 4K9DA 4CMHA 2HDHA 1HDRA 3PRJA 1VLLA 2JCXA 3SLKA 2DBRA 2D0IA 3JQ9C 3DZFA 3Q3CA 4CV3A 1H93A 1HLDA 1NX6A 2JCVA 2VHVA 2X0JA 3GH3A 3OIGA 3P7MA 3PYMA 4AVYA 3U9LA 2NVBA 4XGKA 2HMVA 4CLOB 1FJHA 5BSEA 4R3WA 2GLXA 1SBYA 4R4JA 2B5WA 2RHRA 1EK6A 4J6FA 4OXKA 4FR5A 2C20A 2O3SA 3PI7A 4UVGA 2QQ5A 3AM5A 2G76A 2PNFA 1SB9A 3M1AA 1PSDA 4GSKA 4OOEA 4Y6PA 1N1EA 3TZKA 2B4RO 3I3OA 1NNUA 3Q6IA 4H7PA 2P9GA 5CEJA 4XQGA 4EEZA 3QQPA 5CDTA 5F1OA 1Z7EA 4TVBA 3ONFA 4DA9A 4HFMA 4J0EA 4M87A 4EW6A 4IDBA 5K6AC 3OA0A 1ZXBA 2GZ2A 3Q11A 2QIOA 3AOGA 3ZGYA 3F1KA 4YAIA 3NDJA 4HP8A 4PVDA 4KTVE 4L9RA 1BRMA 2ZB8A 3CE6A 2OBNA 4RF2A 3TF5A 3R1IA 3E1KA 2DBZA 4J1NA 4ZQEA 3DTYA 2JFHA 4L73A 4DYVA 1LNQA 3KBOA 3R3JA 1ADFA 4LCEA 2X0IA 3WFIA 2ZJ1A 4PCVA 4CQLB 1UP6A 2HLPA 3HHPA 3SBOA 4CM8B 2P4QA 1YJ8A 3TL3A 2X9GA 5CPFA 2AQ8A 2C2XA 3DMTC 3RAJA 2PA3A 3ZW9A 4OOFA 1X0VA 4HY3A 3K2EA 5CFZA 1DXYA 4A73A 1PS8A 3ZV5A 2VUTA 1D1TA 1E1MA 4EEXA 5A9TA 5ICMA 1HYHA 2NTJA 3K2BA 4IGFA 5KVVA 3WGGA 5L7TA 1GD1O 3OH8A 5JO9A 1WPQA 4EITA 5JDCA 2Y1CA 2DFVA 2LDXA 3CUKA 4C4OA 3KM0A 3PWKA 1DJQA 4O59O 2IRWA 3DOOA 4LVUA 1LX6A 4R1TA 4BNJA 1Y8RB 2QZZA 1J6UA 1KYQA 1A71A 3MTJA 2GGSA 3TWOA 2PV7A 5TGDA 2WYWA 4WCDA 3W8EA 4Y6RA 3IP3A 4I5FA 3UAGA 3H2ZA 4ALNA 5A4DA 4ND1A 1E92A 4TMFA 4R1NA 2C59A 4YYZA 4BV8A 5IAAA 5JAZA 5AXBA 2CD9A 4ZRNA 2BFAA 4GBJA 1QG6A 5KTKA 1RM0A 1K6XA 2B0JA 2WD7B 3CMMA 2RIRA 3I23A 2Q4EA 3V2HA 5G0TA 1WMBA 1RJWA 3PYXA 1CETA 5IDQA 5ER9A 4KQWA 3WLFA 3VZPA 3K31A 3IUSA 1W73A 1U8XX 4XKJA 2X7HA 4AL4A 1H9AA 4UREA 1YVEI 5EQFA 1NPTO 3WR5A 4XRRA 5C37A 5JSFA 2PZMA 3TZHA 1PJSA 4OIMA 1VL0A 4CM6A 2YHIA 5TX7A 3D5QA 1RM3A 2PH3A 5JNLA 3C7CB 1JDJA 5AOVA 3GN2A 3LF2A 3O9ZA 1B8VA 2AE1A 2V65A 3NGLA 4CQMD 3PLRA 5IF3A 2Y66A 5GMOA 5IFLA 1LU9A 3GVCA 3RKUA 4IDGA 4NJOA 4FBGA 3LT0A 1YL5A 1JWBB 1X14A 4EUFA 5A03A 4J1TA 4L75A 3ZDFA 2AE2A 3C1AA 1YO6A 4CM4A 4RZHA 4CUKA 2W4QA 4IQGA 2RBEA 2CVQA 4UUNA 2GDZA 2JD1A 1LQTA 4C7JA 3E03A 5KJCA 2FY8A 1ZJZA 1WWKA 3M6IA 4J90A 3RC2A 5AVOA 5JDCC 1YBVA 3TN7A 3WSWA 3ZU2A 1GU7A 1EK5A 1LA2A 3I5MA 4U0JA 4YT8A 1VJ1A 3AFNA 1A9YA 2V6MA 1QYDA 3FNEA 5DCWA 1TLTA 4YT4A 3HFGA 3Q9UA 3SC4A 1I2ZA 1E7YA 4BOYA 4HUJA 5JCJA 5A06A 5EINA 2E37A 2J3HA 1O5IA 2EGHA 4UVEA 1I36A 3AW9A 3IJPA 4K26A 2ZB4A 4R9RA 2HRZA 3F9IA 3WQRA 3VTFA 1A4UA 4N5NA 4FSHA 4HXYA 5BNTA 4RPLA 2JL1A 5DULA 1FMCA 3OQ1A 5I7SA 4FQ8A 1LRLA 3B1FA 1LDGA 2BRUA 4NH4A 1PZFA 4WKGA 3ZU3A 1KVTA 1YE3A 4XRGA 3UH1A 5KIAA 4LISA 5TLSA 1EEHA 3I52A 4MINA 1E0DA 3BIOA 3GOHA 4NNJA 4S3MA 3L4SO 4I9NA 1K6IA 3GUYA 4TRMA 4D41A 5MDHA 4DTIA 4OL9A 3PPIA 1B7GO 3HZZA 1F0YA 3AY6A 1LTHR 1GUYA 1CQJA 4J4BA 4Q3AA 1Q7GA 1WDKA 3PWZA 2A9FA 3LT1A 4J9VA 2AW5A 4HFJA 1UP7A 4A10A 3MEQA 3D0OA 4BO8A 3DHEA 4BNLA 1HTBA 4PZDA 3KRTA 4YAGA 1K6JA 5ITWA 3F5QA 3AK4A 4MP8A 4GL4A 4BNKA 4NU6A 1H2HA 1TEHA 1PL6A 4O5OA 1IL0A 3JTMA 3NKLA 3PK0A 1T2AA 2DFDA 4BKOA 1GDHA 3WSVA 3JYQA 3UCEA 1SB8A 5I8WA 4CQMA 1VM6A 1HYGA 1JW9B 2PGJA 3GR6A 1U3TA 3B20A 4INAA 4OYRA 1N7HA 4BS9A 1ONNA 3O38A 3WNVA 1ZCJA 4JROA 1LDYA 3C7DB 1MC4A 3JD3A 5JDIA 1Z7BA 3HFSA 4J4TA 4JX8A 4NG5A 3FWNA 4YJGA 4EDFA 5FFFA 2GR9A 3U09A 4WLOA 2ZTUA 2IEBA 4J7CA 5A9SB 2VWHA 1JA9A 1U2GA 4OSOA 4R01A 5DBFA 3PJEA 4DUPA 3JQBA 3O03A 5JW6A 5G0WA 5L4SA 4D46A 1O8CA 2YV3A 2XXBA 4E30A 2YHIB 5G4LA 1GADO 4Z3KA 4MP6A 4DLLA 1XLTA 2DPHA 2H63A 3ZWYA 3DO5A 1LBEA 4H16A 8LDHA 4E12A 4IIUA 4W99A 4RF3A 4ONEA 2EP7A 4FN4A 5EQDA 2YUTA 3RJ5A 2P91A 2Q99A 5TT0A 3JQ6A 1U9JA 3JQFA 1UDAA 4OO3A 3WMXA 1EBUA 2ZQYA 4CUJA 3SC6A 3F6YA 2PLAA 1E77A 4PVCA 2CY0A 1AUPA 3FI9A 3KHUA 1MFZA 4R5HA 1ZH8A 2VWQA 3HUDA 4HWKA 2B4TO 4X54A 2Y1DA 4U5QA 4DVJA 4CM4B 1U4SA 1LLCA 1MB4A 1SEVA 2DUUA 4ALLA 4J49A 3B1JA 2DU8A 2HSDA 3PQEA 4II2A 2VZ0A 3W1VA 5L7YA 3KEQA 1LC0A 1K89A 5JS6A 1D8AA 2NNLD 2FZWA 3D4NA 4KP7A 3T7CA 1L1FA 3JQ7A 1Y5MA 4BQRA 4IDEA 1W0CA 3FCOA 1WMAA 1EE2A 1QYWA 4R1UA 1WAMA 2RAFA 3DBLA 2B83A 1UJMA 1H9BA 1ISHA 2CMDA 1N92A 1E6WA 4CPDA 4CM3A 3T7EA 4Y8VA 2CDAA 2QG4A 2W90A 3GNQA 2QRKA 3QW2A 4NK5A 4MVJM 1ARZA 1XHLA 2ZATA 4Z0PA 2AMFA 4G2NA 2H1SA 3GVIA 3RU7A 1E3EA 1DLJA 1NP3A 2Y99A 4EI2A 5B1YA 1LI4A 2Q1WA 4GGPA 3KLPX 4YRDA 5AYVA 4IIVA 4TZKA 1E7WA 1W6UA 4OM8A 2VNAA 4PRLA 4ZU3A 2J5KA 4JP3A 1XQ1A 4FJ1A 3I1JA 5C3MA 1QV7A 4Z9YA 1ZVMA 1IUKA 1HDZA 1GUFA 1IZ9A 2B4QA 4JIGA 3TOZA 4D3DA 4MOWA 2PKQO 1QSGA 3JQBC 1BMDA 1TB4A 4Q3NA 5U9CA 1A9ZA 2NM0A 2NU6A 4B3HA 2AQKA 4RPHA 4CQMB 3OETA 1XKQA 1IHXA 1EMDA 1W8DA 2NLOA 4NZ9A 5KOIA 1SC6A 2O7SA 3L4BA 4QFCA 1V6AA 2I3AA 1EZ4A 4UVIA 3BZUA 3PJDA 4YJHB 1M76A 4B8WA 1ULUA 3JQFC 1R4NA 4B7CA 4LSWA 3COSA 2FSSA 4ZVVA 1DRVA 4XJSA 3AM3A 1OC2A 1B16A 3B6ZA 3Q1LA 4FJ0A 1I30A 2H6EA 3G3EA 4LVCA 4MVJP 2NU8A 5LDHA 4FJ2A 2IZ1A 2AA3A 2C7GA 5DBGA 4ZQBA 1N7GA 2BKAA 4MJLA 2IYOA 2I5PO 1ONPA 4L4RA 1H6BA 3H5RA 2WD8A 1GEGA 5DCYA 3WGZA 3TOXA 4A2CA 5A04A 2GN6A 3O4RA 1NHGA 3PIDA 4YA6A 3AY3A 1G0NA 4OQZA 2HK8A 3I83A 3GPDG 4N18A 3ZNPA 4CMGA 1P44A 4KUHA 3CMCO 4WOJA 3MJSA 4BKPA 1B0AA 3LC1O 4P4NA 1LDNA 1DEHA 1EUDA 1U7TA 3V2UA 1N1GA 4N5LA 1R16A 1LQUA 4HBGA 4Q39A 3U49A 1MLDA 1BVUA 1HDXA 2GN8A 2NUAA 3DZIA 4CR8A 3VH4A 1GEEA 2NQ8A 1TVEA 1U4OA 3TFOA 1BVRA 3D3WB 3WGOA 4PLCA 3LLSA 2CNBA 5BSFA 3JD4A 4Z9XA 3VTZA 5IZ4A 1JU9A 1NHWA 3JQ7B 3NDIA 1A7AA 2BMAA 2X9NA 2YQ4A 4R69A 5T8KA 3NT5A 3ZWBA 2AHRA 1GZ3A 2EW8A 2O23A 4PN3A 5KJ1A 4JN6B 3DBLB 3OJEA 1KERA 1Q0LA 1O6ZA 3C85A 2X6TA 1T2CA 2E49A 5HBRA 3W4KA 4AJLA 4URFA 2W98A 4BNVA 5ITVA 4YRAA 2V6FA 4XZ3A 5FYDA 3CSDA 1R66A 1KIFA 3QE3A 4DC1A 4H15A 3L4BC 1JWAB 4IQ0A 3PZRA 1ZFNA 1IHYA 3H5AA 3E18A 3FPLA 1T1SA 2VZ8A 3HJAA 4ITUA 1NM5A 3L9WA 3AJRA 3WBBA 3ZHBA 5GZ3A 1GQYA 4GMGA 5L95A 2VHYA 1PQWA 1GV0A 1E7MA 3ROPA 4XIYA 4MVJH 2FZEA 1B8PA 4QECA 1QYXA 3WJAA 3UVEA 2PD4A 9LDBA 3PZBA 1AHIA 2ZJ0A 2X86A 1NTOA 3JQGB 2EKQA 2Q50A 9LDTA 5ENVA 4FFNA 1ONOA 2DTDA 3VZSA 3QWAA 2DBVO 2P4HX 4BNTA 3PYLA 3CKYA 4XGNA 3MWEB 2ZKLA 3PDUA 4TSKA 4AICA 4MKZA 2GNAA 2VTDA 4BMSA 1NVTA 1NQOA 5KCZA 2DVMA 1O0SA 1I10A 1G0OA 4LGVA 4P4LA 4FB5A 1PQPA 1R4NB 3WOHA 3JQ8A 2YQ5A 1M6WA 2PH5A 3OJLA 3KSDO 4DBZA 1CQIA 3LF1A 2Z1NA 4NIMA 4EBFA 2VWGA 4J2OA 1P1HA 5U4QA 3AI3A 4OH1A 1HXHA 4B4UA 1I3KA 4Q9NA 3OICA 4BNMA 5JYEA 3OSUA 2O3RA 3V8BA 4DGSA 2PD3A 3P2OA 3EMKA 1U3WA 3IIEA 3QLJA 4M49A 5H83A 4NR0A 4UEKA 2FHSA 3NT2A 4Z0TA 3QWFA 4XYGA 5T8KC 4AJOA 3T4EA 5F1KA 1N2SA 2I65A 1HE2A 5COBA 1ZSNA 5BQFA 3X2FA 2D8AA 1A72A 1I24A 1VSUA 4F6LA 4CODB 2GUGA 1DC6A 4Z0HO 3HWRA 4NBVA 2ZTLA 2ZK7A 3GGPA 2XF8A 1BDMA 2WYVA 1HYEA 4BNXA 4BGVA 1G6KA 4LCJA 3UGKA 1VL8A 1NFRA 3WS7A 4JXKA 1FXSA 5CG2A 1ML3A 4YAEA 1NQTA 2JCYA 1UUFA 1WNTA 1SEPA 3OA2A 2GASA 2TMDA 3CZRA 5THQA 4DPKA 3GK3A 4FIZA 4MVJD 1R6DA 4HNHA 3WG9A 1ZW1A 3GRKA 2WMDA 1VJTA 4U7WA 4F45A 1F14A 3RSHA 3SVTA 3K9QO 4ALMA 3AWDA 5AXCA 4O63O 3INRA 3RUHA 1YGYA 4J16A 1B2LA 4I5GA 1KC3A 1X13A 2Y1OA 1B14A 4J7XA 2FR8A 1R37A 3PWSA 4CMJA 4AJNA 1QYVA 1T26A 5DCUA 3UW3A 1HKUA 3BTUA 2AXQA 4GWKA 2VQ3A 4YJDA 3WNQA 1HDGO 1BSVA 3WICA 4W9NA 1LDEA 4IJUA 3F47A 2WWRA 4LW8A 4RLSA 3FSRA 3K73O 2PZKA 1WDMA 4E31A 1Y9AA 2D59A 3LC2O 2VNSA 4O6VA 1H0KA 4WEOA 4EJMA 1GQ2A 2EV9A 2ZYDA 4WLUA 4R9SA 2EXXA 2Q1SA 1GUZA 3N7UA 3N58A 1F06A 4XX0A 3ST7A 1XCBA 1MC5A 2HQ1A 3FNFA 4XB1A 2PZLA 4BB5A 3ZWOA 2FP4A 1KVRA 1IY8A
chains in the Genus database with same CATH superfamily
3JR3A 5EHGA 5BSGA 3PC4A 3GJ7A 3UMBA 4XWYA 2JFWA 2P1ZA 3DT9A 1MHTA 4OU5A 1M54A 4RYLA 3C5HA 5EYPB 2IH4A 1CRPA 1DO8A 2I7CA 1HLGA 2A7QA 5E3HA 1W36B 2FZCA 4E15A 4JI7B 2F67A 3QV1A 4MW5A 3RS4A 3W8FA 5KYYB 3OX3A 2ZI6A 4EF6A 1ZEMA 4POAA 5FB3A 1PNOA 2AYXA 5BN5B 1CQIB 1G291 3KOYA 3QRWA 1Q91A 4REQB 1KAEA 3VYTB 2DBQA 5BW4A 3HDQA 1MG0A 3G02A 2D5CA 1AXGA 4L0DA 1DIOB 2G17A 4Q18A 3WO0A 5KQLA 3D8SA 2B69A 2QL9A 1ENOA 1FDSA 1RWWA 4M1ZA 1NQAO 3CURA 1VCIA 2QTTA 4IXTA 2SECE 3RODA 2X6RA 5ETJA 4C87A 4EY4A 1O58A 2CB0A 1TFRA 3GA7A 4ND3A 3OCWA 4NAHA 2QOEA 4II3A 5BMOA 2EZTA 1A4IA 1JHOA 2P2NA 4IDQA 4TWAA 1RVV1 1C30A 1QC5A 3C3XA 4W8HA 3JZDA 2YNMA 5D2CA 5EVCA 1RWNA 1MF7A 5EZ5A 4ZAZA 3GJQA 1WW3A 1DQYA 3BXHA 2FN7A 3KETA 1T5HX 2OENG 1EPUA 2FLKA 4WNYA 3G2HA 5BSVA 3E05A 3NVMB 3OIUA 4DRYA 2GPTA 1ESEA 3C7TA 3MUOA 4CLXA 2QYTA 3ADCA 2F43B 1Y5RA 3K5IA 4FHEA 4M55A 3PNKA 3KLBA 5A0TA 2J3KA 5AW5A 3VSEA 4GMKA 4C0BA 1ZWLA 1P31A 4TQUS 4MCJA 3I9LA 1P80A 1JLLB 4RK5A 4W6QA 5EC8A 2BM1A 3SWWA 1DIGA 1OV4A 2DF8A 2H2DA 2JHAA 2OECA 4PLVA 5CHYA 4KTTE 1KQOA 3SYRA 9ABPA 2WP0A 1N5MA 2X4IA 4TS3A 3V33A 4YUWA 1JIKA 1KZ9A 4TS9A 2JLUA 3KCNA 1PHPA 4TMZA 5HR5A 1H4SA 5H5JA 2PMFA 3SMVA 3R9WA 4G4SP 4PNEA 1PZNA 1G8JA 1J1ZA 2CFRA 3I9OA 4W9NC 3M8KA 3UZUA 4X65B 1TZJA 3JAWA 1BE6A 3U4IA 1KKMA 3EC2A 3RS5A 3QNWA 2C0PA 3F67A 2EG5A 2G5GX 1W2HA 3E35A 5JCJD 2O2GA 2YV2A 1QH0A 4PAGA 5J4KA 2ECFA 3LBNA 3UWOA 3HEMA 4QSMA 2UVPA 3HNPA 3IH5A 5I9TA 1P45A 2IGTA 2VHTA 2VRNA 3ROFA 4F21A 3AEKA 3DTTA 3FYUC 4YIHA 2X42A 4F5YA 1QKJA 5EKSA 1N1DA 1BCRB 1JSCA 2QW1A 3KYDA 3AF5A 1RKUA 2F48A 3GFTA 2D2IA 4PM4A 3VYUB 1ISIA 1Y5NA 3GUVA 3H9GA 5TJ9A 4ASUD 2F8SA 1UANA 4QUEA 3QLTA 4DWJA 4IGEA 5EUQB 1TI7A 5IZCC 3SJUA 3FGZA 3MRSA 2UAGA 2F1KA 4FP9A 3Q2OA 4IHJA 4O2LA 4OJYA 4XM1A 4BP1A 4IW3B 2C77A 3KJHA 2XBUA 4FWIB 4LQDA 1SBQA 5CB4A 1I6LA 3NHMA 4JUCA 4RVSA 1KYVA 5D00A 2QLTA 3E1SA 1C7EA 3JS5A 5F3WB 5LMZA 3MELA 2NXJA 1X1TA 1OH6A 2ZRCA 2QI9F 2QRVB 3EHEA 3H9BA 1U2SA 1XZPA 2FWBA 3V1YA 3EEFA 1EWKA 4HVAA 1PO7A 2VLBA 4C4TA 4Q0MA 4JI8B 3TM4A 1QGED 3ICEA 3I0MA 3ADPA 3U60B 2P3LA 2A92A 1RFGE 4KFTA 3FAKA 2VJLA 3ZGZA 3Q5DA 2OM6A 4E1VA 2H1HA 4P7JA 4KYTA 1A97A 1D1QA 3B36A 1TF5A 5DX8A 1ZBQA 5DOZA 3WL5A 3EZ9A 2Q28A 1NMZA 1OIWA 3R3XA 1VL5A 3N28A 4XASA 2OGTA 1XOIA 3SR3A 2HUNA 3AEQA 1FSSA 5LFAA 4GOKA 1ZRMA 3D3QA 4AN4A 3QLVC 2O0MA 4CTJA 2J9YB 3X1YA 3UGTA 2ERCA 3Q7RA 3WQSB 3MS4A 4HVLA 3FYTA 3PNOA 4CM9A 4AY6A 1SCBA 4Z7OB 3K6SA 1EX9A 4BBZA 4IAOA 5FLYA 1CFJA 4YP7A 2H5LA 2XIJA 2PSFA 4HOYA 1TF7A 2Q3EA 3GEHA 5HQJA 1N57A 4CNBA 3AEYA 4Q34A 2OO5A 3ICQB 2G9ZA 3P0HA 4D7AA 3LD9A 4RY2A 1UKVY 3EUEA 4MWEA 5F3RA 3FPCA 5AKEA 1GA4A 4UUMA 2JVIA 3AL3A 5E4TA 1JFRA 3PHJA 1JFVA 3NORA 2ZRJA 3CX8A 2PH1A 4RHEA 4YFVA 1C30B 1QC5B 2BIFA 4MHSA 3S8MA 4Z1MD 5I3ZA 1L4BA 2YCLA 2CYAA 3TDKA 5KYNA 4KDEA 1ZD4A 5JCXA 1FJXA 2YMPA 3P5SA 1JBEA 3VISA 4DYDA 3MQ2A 5CEEA 2OE2A 5IT9A 2GBIA 2IELA 3RHSA 2QUJA 3C15C 3KJIA 3MTDA 2ZUTA 4TZTA 3IILA 3ENWA 2JARA 2A5YB 3FUUA 3AP3A 2BMJA 3EVEA 4V02A 2AF3C 3KXLA 2A33A 5BSTA 1E20A 1TMGE 2NZYA 2BM8A 1XSEA 1NJSA 1PZXA 1XQ9A 1G17A 3PNBA 5EXTA 4ASUA 3N6XA 4C03A 4F2WA 5JAHA 1RXVA 1RAFA 4LHWA 4JUAA 4M0CA 3K05A 2V7WA 3ILYA 1ZD3A 4FINA 4MGKR 2CHFA 2ZSKA 1YKSA 5ALEA 2RBKA 4FXPA 3D7LA 3Q7EA 5HIJA 1LF5A 2CLLB 3ANLA 1C9DB 3CBQA 4M0EA 5IVIA 2AQHA 1E8DA 1UZUA 2GAJA 1TUGA 4R7TA 4RAOA 1UQRA 3WMWA 4A82A 4A2QA 1GLGA 2RDMA 3C6ZA 1EVJA 2ZYAA 4JCCA 1E0KA 1NKTA 1U80A 3JAWB 4I9HA 4URYR 5I7FA 1OWOA 2OTCA 1O57A 3AVUA 4MP3A 4R84A 4DCUA 4I9FA 2J9XB 3UK7A 1JLKA 4M6WB 2IOYA 1RXYA 4PG8A 3GPBA 4FSXA 2PTGA 4KN8A 2GD0A 2Z9BA 3JQDA 4R8SA 1BX0A 3OQIA 4BEBA 2B37A 3DWFA 3KALA 4RJLA 2GZ1A 3SKVA 4CI0B 3KYDB 4ADSG 4NSNA 1VRCA 2IUEA 2RONA 2XVZA 2QLBA 3C4JA 4DGQA 3E58A 1PU2A 1YRHA 2M2IA 2X0NA 1XFAA 2BFCA 2WNIA 3UT6A 3FHTA 1RMTA 3W4IA 1SR8A 4IHJB 5JNWA 4MDYA 4Y2PA 1EWYA 1GTMA 4GM4A 1S01A 4NRDA 4ZJZA 4HFRA 1B93A 1KY3A 3MJRA 4G1FA 2OM2A 4NBLA 5CB4B 4NXMB 4P1ZA 4KITB 2QRHA 1KOFA 1UK8A 4MA0A 1OWMA 1PK9A 3S44A 4C20A 1WQ3A 2O59A 1E2GA 1WXIA 3HMKA 3M9LA 2BHSA 5AM3A 3OX2A 3MMZA 1ZO8A 4TRNA 1V39A 3MWDA 2BZ0A 1R9NA 2A9KA 1V1MA 1MIHA 1KZYC 2HRQA 2JC3A 3B1WA 2QPTA 2RI6A 4ZAWA 3KXDA 4YCLA 3MOSA 5JC8A 4FEAA 1YOVA 1IJFA 2ZYWX 3DF9A 3NVAA 3PD0A 4WCFA 5CX4A 3FOEC 2ROQA 1IWPB 3E9RA 1IBRA 1E6EA 1OFIA 2DPLA 2FSVA 2O14A 4GW3A 4IMPA 5KWIA 2QMZA 4HEJA 4BLRA 4YBZA 4Z5XA 4AJHA 1L5OA 3AEQB 3OQ6A 2OHIA 1K0UA 1MXHA 3U3XA 2QVLA 2OFOA 1RKBA 3DYVA 5ALNA 3RS2A 3KQYA 3QPAA 1R8QA 3NIFB 3KSZO 1B6RA 3GRYA 3AUYA 3K6SB 2FQQA 1KPIA 3T3GA 1QHHA 1RNLA 2LPMA 2WF9A 2Y6VA 3QY9A 4DV4B 1X38A 3ZBTA 5AHRA 1K92A 2PGIA 2BKVA 1O94D 4LXYA 1TQHA 3BRSA 3QE4A 1DKLA 1NUUA 2CUNA 5A3VA 4FPXA 3ZZ1A 4E7OA 5JAIA 1QRRA 4XIJA 2YICA 3GHHA 3UKDA 5I9NA 3IBFA 2VL7A 7MHTA 4PS1A 4X8HA 3MAJA 2HW8A 3DULA 2JIZA 1EFDN 4KAJA 3GFOA 3IXMA 4KQHA 4LHYA 2OD9A 4LOIA 1MV8A 3OFNA 3C3JA 4S24A 3SIPA 1LCIA 3OIDA 2XOXA 4K3UA 1TAHA 2VJOA 1V2HE 4AJPA 4XWOA 3BTVA 4FI3F 5A02A 4EJSC 3NC1C 1C0EA 2QWXA 1KMHB 3H9EO 4PLPA 4M8NE 1R18A 4LWZA 2VDUE 3PEUA 3CXRA 2P40A 5DHRA 1W76A 4GKKB 1QIGA 5GP1A 2JATA 2ZREA 3HFJA 4HTAA 3LT4A 1RYNA 1UKCA 2GS9A 3CZAA 3TR6A 4DS3A 2FDXA 5HKAA 1L4UA 3AKEA 4E22A 4O4HF 2WKRA 2ZI7A 5TMPA 4HADA 3DW3X 3S7ZA 2Q5CA 1UDCA 5JDIC 3FZYA 2DRIA 5IK2D 2ZS7A 1ODJA 3RF7A 4LF5B 3I2HA 1C0KA 1CJKC 1UZMA 4DA0A 2F6RA 3BEDA 2RHBA 5BXQC 1R0SA 4ESEA 2WM3A 4N6GA 1O54A 1SCKA 4EA9A 2J6BA 4RMJA 5C7OO 3FOZA 1N2HA 4IR7A 2NZ8A 4C0AC 4C3UA 3DWEX 4UNRA 1U28A 1G7SA 1XN4A 3QF7A 4LJ8A 4AUNA 2PZFA 3G2KA 3SEAA 4RS4A 4FYPA 3T35A 3QOYA 3LYLA 4NABA 3K9HA 1TVKA 4RPIA 5CLFA 2I3GA 1FDUA 1NVFA 2ON6A 3L6EA 3N8NA 3NP9A 2NUTB 4LXQA 4UMVA 1JHVA 3A3OA 4HNRA 4Q9JA 3STXA 3VBCA 2PRJA 1QLHA 4KNWA 1PDOA 1LXCA 3RK1A 3STUA 4JL6A 2CF6A 5ALUA 1I2MA 5I7EA 4R40A 4MHOA 1L7EA 3O4FA 3Q9SA 1BXZA 4YJGB 3DKVA 1EFLA 1X15A 4X95A 5KNCH 2GM5A 3BUSA 3FVQA 1G1MA 2M6SA 2BFCB 3IPCA 1HQDA 4JJ7A 3UB4A 3ZK7A 4CU2A 4DARA 1MX9A 1Y7LA 2P9BA 3PHBE 2QUAA 4YH1A 3ZS8A 4XFJA 2FUCA 1GNLA 3BGIA 1K06A 3HVUA 5H7XA 4K86A 1IJKA 3LQRA 1YHNA 4XXHA 1WRBA 2D00A 1O94A 3DZ8A 4C3ZA 5C5DA 5F78A 3KT3A 1JR6A 1DG9A 5B58T 3FVRA 2PH7A 1K4YA 1HQYE 5FLEX 2I87A 5HRAA 4Z0NA 2ZQZA 2AJDA 4KH1A 1LSSA 1Q22A 5LXTA 3E9ZA 4RO0A 3RC3A 3R76A 5M7EA 3BD8A 3CUTA 2HJRA 2MDTA 1RM5A 1V1MB 4NYMR 1K97A 4PZAA 4ZHSA 5JZVA 1NDUA 4RIGA 1NQ5A 5DI9A 1MKYA 1IQ0A 1KZHA 1YQXA 4QGBA 4C7VA 4WCFB 2AC7A 3N2EA 3VOSA 2CBGA 1Y1SA 3GEMA 4GPIB 5SV2A 4CR6A 2VYVA 4AJEA 4KPYA 3ESXA 1H2XA 1J8FA 3F8WA 2B1RA 3P2KA 5LIPA 2H57A 3JQCA 3UUGA 4K9KA 1G20A 4ZOBA 2C5EA 1Z73A 1RXIA 4L4ZA 3NWEA 5BYJA 1JECA 3EGOA 3O1LA 1VKNA 2Q4BA 4IF6A 4DG9A 1JN0A 4CIXA 3RSGA 4Q4LA 1H2ZA 5IK2A 4UTVA 5ARCA 2DPXA 1SIWA 1ZH4A 3B3FA 3H5VA 5FI5A 3UJAA 4JBXA 2P6NA 1JQBA 3C3DA 3FNGA 4OQXA 1JG3A 3EASA 4LHVA 1KVSA 3ZDYB 3KDAA 1QIFA 4AJ2A 3SYLA 1BDHA 3GAZA 2WJAA 4C0LA 4YEDA 4RVFA 4OI2A 2I7XA 3GDGA 4MPPA 5JMOA 1KMNA 2WZQA 4YHHB 4NMMA 2AX4A 1RSZA 4QJ3A 1U3UA 4YCMA 3FGOA 2QSJA 2D5BA 1VP3A 1AXRA 5A6VA 5LZ9A 5FTMA 4NESA 2IYXA 1P2FA 1O95C 3PD7A 5LLTA 2X8LA 1HDYA 1YASA 2QUBA 4OHFA 3UOWA 1SPBS 4Y7CA 1E3DA 4BLTA 5AI8A 4F3YA 4D02A 3WTBA 3LPAA 3HM9A 2HJGA 1ZK1A 1NUSA 2QTBA 4DN6A 4IHJF 3KUCA 1LC3A 2IEDA 3DTNA 4OHOA 5DTRA 2VK4A 4EYGA 5CM8B 3CNNA 4KQ2A 1WB5A 1WCV1 4EPRA 1R0WA 4GSLA 4PEVA 2NU9A 1QBKC 1MVLA 3IMKA 1NOJA 3F0TA 1XU7A 2X1LA 4XYLA 4QXRA 1Z2AA 2WICA 4RPKA 1VSTA 4C0QC 5DLEA 1I94B 3D7MA 4WLVA 2NU7A 2DPMA 4EBBA 5AVWA 3L1UA 3E70C 4RL4A 1LVUA 2CJWA 4LV5B 4JENA 1GPH1 3FBTA 1DC4A 4N65A 4TWIA 1NMQA 3QLEA 3B7WA 3V3TA 2IVZA 1T8WA 1E4EA 3BWBA 3RHFA 3ZNOA 2R5NA 3T1TA 3HXLA 1MB9A 2ODNA 3ETCA 4WADA 1G3QA 5KHLB 1TVKB 3BWXA 4MV1A 4NHEA 1QTRA 1VJ0A 1A5SB 3MWLA 4YDSA 2AQIA 2H17A 2IDJA 2P0EA 3C3WA 3JQRA 3KKKA 1ECCA 1SUAA 1UOOA 2FZ5A 2FETA 3I9MA 4JGGA 4KXLA 5AHXA 3Q2IA 2PVCA 2ALJA 4Q4HB 3SX2A 1EDZA 1WXHA 1LLFA 3PL5A 4D9IA 1OT3A 2O6HA 3UQYS 4IOLA 3JW8A 3K92A 1M2VA 3KTDA 4G8JA 4B40A 1T2DA 3DDNA 2ZANA 5FWDA 1EGMB 2FG5A 3CVUA 5IMSA 1N2EA 3H3JA 3HDGA 3NHLA 1K86A 1TD9A 2CC2A 3FZEA 4JK3A 3VKUA 2P1RA 3N7AA 4FMCB 2WKWA 5JRJA 4QBIA 1SKYE 3D3KA 3N1UA 5EZQA 5B4UA 1TX4B 1U9CA 1XA0A 1HNNA 2C61A 5TY0A 2OOKA 3SEQA 1YQDA 1IBMB 1CFZA 2OKGA 3V55A 2I34A 1E2EA 2PRIA 3UWMA 5LXTB 4JNKA 1INLA 1VE5A 4AT1A 4X9XA 5TEWA 4QUJA 3VH2A 5ALPA 2E1RA 4MKHA 5C31A 1CUVA 5HTKA 3CNEA 2XB2A 1M6VA 3OZBA 3R09A 2OT3B 3WDSA 2Q3HA 1YBFA 2F3UA 1KNXA 4IG4A 4KO2S 1LK5A 4EHHA 2FN3A 1IPHA 5ALQA 2HMWA 2IDZA 2IPXA 1XEWY 5FPPA 2C1ZA 1IEQA 3KKZA 3ZU5A 5E6RA 4MTCA 2HJ9A 1JFFA 1I2CA 2OFPA 2BBSA 2PBLA 1G20B 4R8RA 1UCFA 2GQ0A 1VKOA 1FEZA 3CFYA 2XAUA 1XZAA 4KOAA 3GA5A 1U2TA 4IM7A 4XDYA 1ZJWA 2ZRNA 4AULA 4N9WA 4PFQA 1T36A 4L57A 4RGBA 3RTGA 1ICIA 3EXHC 4NMWA 1ZMOA 2QHXA 1J25A 1GJRA 2W6ZA 3F1LA 4K9OA 4UBMA 1ZPDA 3MWYW 1TO1E 3GEDA 5G1NA 4EJFA 2XB9A 3M4NA 1XMVA 5ALDA 4XQ0A 4RTNA 1QP4A 2JG3A 5AK0A 1GL6A 4K1LA 3RV3A 4M7OA 1YIDA 3HGMA 5A7FA 4CMEA 4PX2A 2PGNA 5KYXA 2O52A 3IT0A 3OX4A 3PF8A 4AB1A 2H7CA 1X87A 1LJLA 1LSUA 4KLAA 2R2AA 4R1OA 3A4YA 1AF7A 3I9KA 2NPOA 4RPJA 4IS2A 1FTQA 5ITSA 3AU9A 3G9XA 4JDPA 1PJBA 2P5SA 2REQA 1NNSA 2H0RA 4WFKA 3B9BA 4Q7EA 4BGDA 1A7UA 1S8AA 1HE3A 2EJVA 4HNAA 2CW5A 4GO1A 1Z62A 3D4OA 4RLQA 2R7LA 4RHXA 4NK4A 3TTTA 4HDOB 1YZ3A 4MRVA 3VZBA 4FEYA 3RRXA 1PS0A 1XZFA 1J39A 1JBQA 2BELA 3DR3A 4IRMA 3PEEA 1EM6A 1RWBA 4XWWA 4OSEA 2WVGA 5EL0A 3P0IA 5TC4A 2NU9B 3VKVA 2BF7A 1FYWA 2GYYA 4WV3A 1EX7A 1L8LA 1LRJA 1PX2A 1RPZA 4DV7B 1JDPA 3DAFA 5T4EA 2NU7B 4OHZA 2A88A 4FHFA 1GCOA 1UKEA 3JTEA 1UQUA 1XZIA 4S1PA 4GX1A 3E81A 2CJWB 2D3TA 4C2TA 1E98A 4RZ3A 2J9ZB 2WU3A 3P0JA 2I4IA 4ZCRA 3BICA 1KXZA 3INGA 4P5PA 1KR2A 5DP1A 4M8SA 1L9KA 4KO3S 4YMSA 5ADHA 1E4EB 2X6QA 2VF4X 4AO7A 4ZDIA 1OGJA 3KJQA 2D5IA 3EA5A 3X1ZA 4KSYA 2YY5A 5EJFA 1ZIOA 3KXKA 1OU4A 3O2JA 2W42A 2DFLA 3WMFA 3TNJA 3Q72A 4OTZA 4DCPA 1Z5UA 3MJ4A 3NG1A 3SIXA 5CX1A 2AB0A 3EZFA 3BC1A 2ODWA 3QFFA 1JHUA 3LZDA 3O91A 4H6VA 4CG3A 2HYDA 4E2ZA 2CNDA 3M5WA 3Q87B 4L3OA 1XAIA 2ILVA 3HPRA 4FS8A 4ZJUA 1W4BA 1M2VB 1PTJA 5C9ZA 3EVNA 1W47A 3T7JA 2K5UA 5KINB 2D4HA 4XTCS 3EDCA 2R1VA 5KJEA 1AMUA 3TB6A 4C78A 3NJ8A 1U3FA 2BOVA 3LBFA 4MWZA 4EJ0A 1V3VA 2O19A 3RVJA 3QXXA 5CP8A 1YA8A 2XPCA 1ZUD1 3PC3A 3R3VA 3P0FA 2BLNA 4LDQA 1KYTA 3BXOA 5HUQA 3TPCA 3G68A 2EWVA 2W83A 4E33A 2P2GA 4DLNA 3BM5A 2ZJFA 3FOBA 4I66A 2SCUA 3CIOA 3I92A 2Y71A 3AERA 5F3DA 5IUKC 1I6KA 1ODKA 1OF1A 3RNLA 2ERYA 5IT0A 4G0WA 2FZKA 1FZTA 1Z4QA 1GN8A 2V6GA 1ANKA 2YVLA 4G85A 4UXJA 1E6MA 1RRCA 3Q7PA 2FTKE 1ZISA 2OG1A 2JK0A 1GKLA 2ZITA 3EGCA 3EG9A 2GRUA 3DEZA 3HKBA 4MUGA 3PRHA 1V41E 2I4MA 4M1QA 4YAJA 5ALRA 4B7UA 3LY7A 4S35A 1PBTA 1SHZA 1M6VB 4ZMBA 4N01A 2SKCA 2EBHX 3ZXUB 3M7IA 4I6EA 3M3HA 5AW1A 3W9UA 3OJWA 4BVKA 3F96A 4FK8A 4RAQA 3LX8A 4BO6A 4JLWA 5KREA 4S2EA 5E6RB 5IKXA 1RTTA 3QJ5A 1JFFB 2PWPA 5IBRA 1TJYA 4DXHA 2BFOA 3QWHA 2W4MA 2E48A 2P4EA 4S1OA 4NPAA 2P65A 1OZAA 1P9LA 2B30A 3EQ8A 4PX5A 1N2JA 2YMLA 4X6YA 2F59A 2C5SA 1T36B 4OGWA 4P7FA 4YK7A 1HLPA 5H16A 3KSBC 4PF1A 2PJDA 1SCAA 2H2HA 1Y9JA 3EHDA 2H4HA 4PPYA 1T2EA 3BGDA 2QD2A 2A57A 3GW8A 3TZ6A 1UIRA 4ZEVA 5LP1A 4YT2A 5H4GA 1F4LA 1QMPA 1VMDA 1DT5A 2IF2A 1JHXA 2YIDA 4Q5IA 4Z9BA 1Q0HA 1JLSA 3QUQA 4DNXA 4LVNA 1QIMA 4Y2TA 1YMQA 4GKBA 3ASYA 1HFWA 1KYWA 2IW3A 1BE1A 2BFPA 2CVZA 2I8CA 3HE3A 1Y3HA 2BE7A 2HNKA 4NAVA 2GJ8A 3CB2A 3C3BA 4BVAA 2QX6A 5HYVA 3CVWA 3QE2A 2REQB 2RJNA 3BFVA 1ES9A 3P2YA 1MAVA 4PYMA 4MRNA 4HNAB 5FBWB 3REGA 4MRRA 2V1UA 4FUQA 5L3ZA 2L17A 3E7FA 2I6SA 1U0GA 4G84A 4IDFA 5GV8A 2HWUA 1Z39A 4PGGA 1TJPB 4WKCA 4WH0A 1HI9A 3ZE9A 4Z4GA 1QG4A 1OLOA 1B41A 2JJ2D 2LZ0A 2I6TA 2O2JA 4PICA 5CT9A 1A5ZA 1ZP6A 4ZRDA 5JLAA 1U0LA 3HI6A 4Q9DA 2V0NA 4WEQA 2WEKA 3NHFA 4GECA 4NQRA 2D8MA 4XPIA 2VSQA 1UJNA 3F98A 1GNPA 2EFDB 1NR5A 3MRXA 4FFSA 4ZOCA 3SZ3A 4ISCA 3UJ7A 2V6BA 4FFMA 2AOUA 1T15A 1DWQA 1X9GA 4JEHA 1R6UA 4DVGA 1I0ZA 2C4WA 2PSHA 4HDMA 4FWTA 4L3WA 3SK0A 5K6RA 2ZBFA 3L1JA 3EQZA 5C5IA 1Z45A 1N3BA 1JJ7A 3IGFA 1N8SA 4EKGA 3G88A 4TTTS 1BWRA 1FPMA 5EKDA 5J63A 4D26A 1YQQA 3EVTA 1GCGA 3QFSA 3RJ9A 3AF6A 1KS9A 2BEUA 5EQTA 5FP0A 2WWXA 4KPFC 1PJQA 2BY4A 2JRCA 4Q3BA 4YRIA 3RYHA 3FMIA 2PYIA 1SCQA 2BFMA 2M6LA 4ZAVA 3X1JA 2J5QA 2B7CA 2ES4A 4DEVA 2P6MA 4BC1A 3TZLA 3GMSA 2HK7A 1TCVA 2OA0A 2HWWA 2QTGA 3E7XA 3OPNA 3T3DA 4A23A 3ICCA 4JYAB 3S1SA 4R3UC 1LLUA 2J48A 2ESRA 1JQEA 1K6EA 1M9NA 3HJRA 1TDJA 3GPIA 3I34X 4P4GA 5AOAA 1ADCA 2K7FA 3K6RA 2G5CA 1VKZA 3AF0A 4P80A 3OJFA 3TLMA 3OJ0A 3L82B 2ATVA 1W44A 4PFSA 4ZEWA 4E5NA 4MYTA 4P58A 3FTQA 3SJAA 3UA3A 4LJ5A 3ESBA 4XJTA 2IJGX 3FUCA 1ZICA 4RL6A 3TFWA 4UAUA 3D6TB 1VA4A 2MSWA 3GMIA 3KT0A 2Y6UA 2SCUB 3RTEA 3DZJA 5JROA 1G38A 3IA2A 3VFDA 2LCIA 5FQNA 2J7KA 1TIPA 4HX9A 5F7ZA 2AKYA 1R5OA 4KQJA 1P1FA 3WKAA 3VR4D 2Q46A 4YY3B 4PLWA 4AKGA 1Y81A 2YYSA 3EG9B 3HKBB 4FGUA 2QZ4A 2XNJA 1HMYA 1X74A 2LDBA 5F73A 3EFBA 4D8YA 1GAEO 2W2LD 4L08A 4BYGA 2H8GA 3IVRA 4QU8A 3K8ZA 3TCKA 3QVVA 1HBJA 2J1LA 1PS9A 2QL7A 3RYIB 4MHTA 4WASA 2C95A 1E60A 2E6KA 2NSHA 3DAYA 5REQB 1C80A 5MFZA 2YYYA 2BI8A 3QU5A 4FNOA 1ZM3A 4XR4A 1R0RE 1QHSA 5JADA 2P77A 4AKTA 1QZTA 1C0PA 2JJ2A 1GNRA 2YX1A 1W7AA 1NZJA 1GIAA 3IPRA 1ZXLA 4IO1A 2GK3A 5GONA 3W7BA 4KQEA 2I67A 3A9VA 3CX7A 4IV8A 3L8FA 4FFOA 4R2HA 5EPEA 3UJNA 1DFIA 4EFKA 2PIAA 4WY5A 1NVEA 3R74A 1XRSB 1YS2X 2X23A 4HEA6 4UZEA 1DKQA 1AF4A 2R8PA 1UADA 1XDUA 5E1MA 5EJMA 3VI3B 4H4CA 4N1AA 3ILHA 4EHIA 2CL6X 1GGEA 2VZLA 4PE5B 4ER6A 5KTTA 1ZWKA 4D98A 5IT5A 2J0SA 3AVQA 1W1UA 1P19A 5HMMA 3NIGB 1J0AA 2VPPA 4FT2A 4LMPA 3PFFA 3ZD8A 3ZWMA 2KE5A 4PTLA 4EA8A 4JC8A 2WWVD 4RKFA 3K96A 4DMHA 4JAVC 2C42A 4QGGA 3BE8A 2R6ZA 4J0DA 1EHYA 3LGSA 5T57A 1Z07A 4KXYA 2IIPA 3UIEA 3PDIB 4YI3A 1G18A 4JT8A 2V7TA 3C45A 5G1OA 4CQNA 4JJ4A 2KI5A 3B3AA 4E3WA 5AI5A 3WLMA 3LQ2A 4LNAA 3UAYA 1DIAA 2DKOA 2G7MC 3T7DA 4BTLA 1VXRA 1L4FA 1XVUA 3AR7A 4HEA1 2H1WA 2ZAOA 2QV7A 2HLNA 4XPIB 2ZWOA 3S29A 4D97A 4NJMB 5KAMA 3VHRA 1GA1A 3ZWDA 5CDUA 2TMYA 4MTLA 3EIQA 2P90A 3VR6H 4HH3C 4Q4CA 4FYVA 3AR9A 3QV2A 3U7QA 4DR4B 2AOUB 1YB4A 3MCUA 4P0TA 1U8TA 2BGMA 4PZEA 4HDMB 1Q0ZA 3CLUD 2PT6A 1X7XB 3PUHA 3NM6B 4JLUA 4LJ7A 1CDZA 4JJ6A 2QQEA 4TMXA 3VR4A 3U3JA 4X3CA 4BP9A 4EY6A 3WXBA 5CLIA 3SQLA 1SOVA 1WXWA 2HK6A 4CU5A 4LC9A 2BEUB 2W2LA 5CGQB 3RW9A 3MGCA 4EVIA 3ZD7A 3T3IA 1S7GA 4WLNA 1HR0B 2EQAA 3CPHA 2DFPA 2RGAA 3RYHB 3SGLA 4PBTA 1K8YB 4PG5A 1NKSA 1V9LA 3BL6A 4NV1A 1IEVA 2XGSA 1V95A 3B2QA 1P0MA 2NV0A 4KQFA 1QXSA 4QBKA 3NHBA 3TL2A 1GSOA 4CHTA 4CIWA 1IB0A 4JU9A 4RV9A 2YZMA 3K6JA 3LCRA 2IHYA 2VUUA 4UEWA 5ALSA 3WC4A 4EGAA 2L42A 4L22A 1EFVB 4DMLA 1FP4A 5HJEA 1I7PA 4CXMA 2Q8PA 3WGLA 5C8ZA 1YVDA 1DQZA 3UK0A 3DVQX 1SZPA 2PYDA 1M2NA 2Y93A 3EPJA 2IFTA 3H5LA 5CGZA 5A4AA 1Y7PA 3A0RB 2RHWA 2E4ZA 2H2IA 1FX0A 1BHQ1 5EPOA 4ZTBA 4BUJA 3FW1A 4YPVA 5FUVA 2NUBA 4JC4A 1QRAA 2NO6A 4TVOA 3RPEA 3WYDA 4EW2A 4P86A 4KWHA 1C3OA 4LECA 1UWLA 3FYHA 1CJUC 4Z7QB 4CG2A 1QWSA 2J0EA 3OOJA 4NBWA 4QHTA 3UMGA 4AMUA 4D45A 1R6XA 5CD1A 1W8IA 2MINB 2I4NA 1US8A 2NO4A 2RI0A 3EZXA 3FMVA 4OB8A 1P7CA 1BFDA 3O84A 2D0DA 4QRDA 1KJYA 1AGYA 2TS1A 3B60A 4KUGA 3ZI0A 4N76A 1K7YA 4QRIA 1RI1A 2Q5JA 4WBNA 4ZZIA 4GPZA 5CNJA 5JWHA 3UW1A 4B75A 2BTQA 1XZMA 2GTPA 4AY5A 3T1HB 4IEEA 3DBIA 3RVDA 3OC6A 4G41A 3O21A 4XVUA 3D7RA 2XTNA 4F12A 3GLIA 1E2FA 2AOVA 3QEKA 5JAQA 5GONB 3VR2D 4CV0A 2P3SA 2V9PA 4BJ3A 1XPOA 1WZUA 4N3BA 3A4VA 1TFUA 3ZCQA 3FA2A 4PZCA 1KMCA 5KUTA 4BWFB 1EVYA 2HHAA 1U02A 4UVHA 4E5UA 1QRSA 2P9ZA 2Q6IA 2RHMA 2UVDA 2QVYX 2GBGA 3SC2A 1TJNA 1Y7HA 5JNTA 3CRQA 1AV6A 3TI7A 4ND5A 2HU2A 2WT9A 2IK8A 1U6IA 2KHZA 3CINA 4XM2A 1R7RA 3GAMA 5EIOA 1B1AA 4N8DA 4QDOA 3OQHA 1S6YA 3WI7A 4DC9A 4WPGA 1GZ6A 1ZUIA 1PKXA 1KQ3A 4ZODA 4UHFA 2YWJA 1N77A 1SPXA 3JD2A 1RWKA 5FBHA 1UAGA 1NF8A 2JJQA 1FU7A 4ALJA 5EGSA 4JYBA 3KKQA 1FFYA 2ET6A 2ACWA 2PGOA 4RNCA 1P61B 4HS4A 1E1QD 2HK9A 3MBIA 2B2NA 1IY1A 5KCMA 4FYKA 4DPMA 1ZBDA 4DEXA 3DOCA 3HRHA 1Z74A 1ZMXA 4DDHA 5LKAA 1Y4SA 4MR7A 3ER9A 1DVRA 4FUTA 1B23P 2J3LA 1BQEA 1OLUA 3AKDA 1R3UA 4GC5A 5G4KA 4TM8A 4BMNA 1ZK3A 4BNHA 5I9BA 1Z4NA 5HGXA 1YRYE 2PU7A 2VJKA 3EFOA 3KKEA 2BC9A 1BDJA 2OD2A 2ZR7A 4KMRA 3U7QB 2WT4A 2WWGA 1G9XA 2P9HA 3HR4A 4K28A 1I5RA 2FEXA 3A1SA 3W7VA 4UPVA 1RKXA 3D81A 3NAGA 3E7PA 1IHPA 3AF3A 4BQIA 5I47A 1T5BA 3MMNA 3IOEA 5TQ2A 4LFAB 3MWEA 4HLDA 2C54A 2X8JA 2EWMA 2VSYA 3AHHA 3T7RA 2WFMA 2DWUA 3ULKA 2LCFA 2GSDA 4KLRA 3MHPA 1IN8A 2RGWA 4BPRA 3BMCB 3NHRA 3NVKI 1GYRA 1MNAA 2B36A 4RDCA 3IKVA 4RQBA 4EYEA 2GRJA 1HEIA 2QRJA 4FCWA 2QLNA 4B32A 2N1MA 3Q9LA 4JB8A 3ZE6A 3BGSA 3JD1A 1Q7EA 4NQZA 3KOUA 3INYA 4IDDA 4YP1A 1CLUA 1LDMA 1GSIA 2CFCA 2JLRA 2NTNA 5FOSA 2VJQA 5LC1A 1QTIA 3VR2A 1FP4B 4RPCA 2YFHA 3B6EA 3OY7A 1XQYA 3PEVA 4NDAA 1LY1A 1XD8A 2F1JA 1R12A 1JIVA 1E2DA 2J9FA 4J7AA 4YAKA 2AUNA 1EFHA 4QPZA 3OKAA 1VP9A 3ITEA 2I1VB 3VDNB 2R84A 3A6ZA 4IXNA 1FX0B 5DP2A 2C2OA 3DFKA 1AQ6A 3OFVA 4IH1A 1SQSA 2MT9A 4H1VA 5BSUA 5AW8A 3JATA 5JBIA 1GN9A 5BUZA 3CZ9A 1W36D 1A8SA 3FOWA 3OEYA 1NVUQ 1F8XA 2DOKA 1C3OB 4F8YA 5B1IA 1GZHB 4PLYA 5IM4F 2FEWB 2PIDA 2JCGA 1ZX1A 3EVDA 1ENPA 1P2TA 1M83A 1REQA 4NPCA 2W6ID 2EZ8A 3DXFA 4N39A 1US8B 2YY7A 4MI6A 5KKAA 2OBYA 3ROQA 4XWTA 3VNRA 3TTSA 1PQYA 2IV3A 1U7ZA 1ISPA 1NN1A 4GMFA 1BWQA 2WZDA 2OKCA 2F1RA 5IXSA 4BNUA 2R00A 3PNPA 4WBNB 2XTAA 2PX5A 3PTZA 1QKIA 1WBJB 1E1QA 2BTQB 3ONDA 3TUZC 2WM9B 4U2CA 4Y6LA 1EUYA 5L45A 5EMLA 4AP6A 1XFDA 1H3EA 3RUDA 3HJCA 4WLEA 4H59A 3PJFA 5KKCA 3GLIB 4BLUA 1GG9A 4RD2A 3KVOA 4L4UA 1P1RA 4IXMA 4DIOA 2YVKA 3OF3A 2BI4A 4YRBA 1E3MA 1LW7A 1TK9A 1KRWA 4GR9A 1QYCA 1H6CA 1C7JA 4PG6A 3OI7A 4DCTA 3AVOA 4CKCA 2HSZA 4TWRA 4UULA 1DDOA 4KXFB 5HBGA 3KE9A 2IZ5A 1Z7GA 2PPVA 4TWBA 4HZIA 3OOSA 3SC2B 3A9WA 2Y76A 4QL3A 3QJYA 1SG6A 1W4CA 1UXOA 1OXVA 1NSTA 2QPOA 2DHCA 2FPIA 3X1KA 5ILGA 2OAP1 5I7RA 2L19A 4A27A 2XTMA 4MKRA 2X5OA 1ZI6A 5DSXA 1YCFA 5BYAA 5LD2C 4V3BA 4BY9E 2KLBA 3KU4A 1L7VC 3OM0A 4Y30A 3BSYA 4OAQA 5CVEA 5B12A 3WXMA 3RVMA 4EABA 5I3CA 1UXIA 4KI0A 3OOHA 1P9NA 2C57A 3MT8A 4I5EA 4KMSA 4M1SA 4B33A 4JV5B 5NLLA 1I1HA 2INGX 2ZR0A 3EG5A 1KYIA 3ER6A 3B9QA 3D59A 3QMPA 4F3KA 3NCTA 4R16A 2ZFUA 1HM5A 2GN0A 1MP0A 1FCJA 1OI4A 3MMXA 5KS2A 2Q3FA 1PL0A 3DEIA 1F8GA 3L6BA 1NBHA 1PQ4A 3GROA 2IEZA 1W5SA 1MO3A 2CYCA 1YDWA 3H6GA 1YB6A 1USUA 2DKFA 3N59A 3QYAA 2NUPB 2X15A 3BK7A 4MR7B 2BGTA 4ZU1X 2VF7A 1ZHOA 2D7DA 4CLOA 4WKPA 1IY2A 3G8DA 2D1QA 2HSJA 2PUWA 3OD1A 4OMCA 3H1PA 5G4KB 3VC2A 4CTNA 1TVMA 2O4CA 2OXTA 3O4HA 3SQXA 2HMYB 2IXEA 3BWMA 1ULZA 4BO9A 4MQBA 2OLKA 4D8VA 2IHNA 4JLAA 2CL5A 4EI7A 4RDXA 2V55B 2IYPA 1DC5A 2G5PA 2I8AA 2XSZD 2ZS8A 1E2KA 3GZ4A 1UMDA 3LUAA 5TQ2B 1KVUA 2BLLA 2HO4A 3TJMA 2X8JB 4J9UE 7YASA 1P1BA 2V8OA 1JB9A 3RABA 5AK3A 4MAMA 1VIVA 5EWMA 5K0ZA 1G21E 4WN3A 4YRJA 2OV8A 1CDEA 4FT4A 3P4YA 5ELMA 5EIBD 2RC6A 2W6IA 4IFTA 4FR0A 4L76A 3ADOA 3THWA 3EGVA 3N2GA 1TEXA 4I1IA 1E96A 1JQ3A 1E58A 3SM9A 1L5RA 3CKMA 5CJPA 3E9MA 1J8VA 4LGYA 2H08A 1HT1E 2N0SA 2RGEA 3OZXA 4HPJB 4X7PA 1DOAA 4RVGA 4DREA 1FNCA 4LBZA 5GGXA 4WXRA 3A11A 1GV1A 1OBFO 3ZVLA 1AZWA 2I2WA 2XUKA 3S2IA 5DHQA 6LDHA 4NNOA 5ICEA 4B6FA 2VA9A 1ZR4A 1P77A 2J9FB 4CDRA 4OI0A 1SXQA 1AGRA 4YV1A 2QK4A 3T41A 1PUXA 1G5PA 1EM8A 1RFLA 3H2KA 4MVXA 3FX2A 1YKGA 3OZAA 3LG2A 5FI3A 4NX2A 1XXHA 1A8UA 1HE5A 3KD3A 4FQ5A 4CM8A 2JDIA 3JATB 3T34A 4MVJI 1TKBA 4BO4A 1PKEA 4BRWA 4YDQA 1KEWA 2SKEA 4QQFA 3R9KA 1NGSA 5I01A 1ATIA 3BAZA 1O6BA 2ADFA 2IBTA 2FEOA 1QGOA 2GT1A 2Q5HA 1VLHA 3H5IA 3RB8A 2Q1YA 5LM3A 4JMPA 5AKGA 5E9QA 1PBNA 4UEJA 5K6AA