3QWIA

Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with nadph and coumestrol
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
260
structure length
260
Chain Sequence
YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the flavonoid inhibition of a fungal 17Beta-Hydroxysteroid dehydrogenase
pubmed doi rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords 17beta-hydroxysteroid dehydrogenase
total genus 105
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwiA00
1F8GA 1S6YA 5KNLA 3GHHA 4R5MA 2I67A 3JD1A 1BGVA 3OEWA 4LMPA 3VTFA 5CEEA 3Q6IA 3C3XA 1X0XA 4KOAA 2DBZA 1QORA 4JP3A 4Q3CA 4DC1A 4E6PA 4WCFC 1UP7A 4F6CA 3AOGA 4YJFB 4I1IA 2BFAA 2EGGA 4E5KA 1I32A 1DLIA 4PGFA 4DYDA 5LCXA 1ONNA 3NTRA 1Q7GA 5JAIA 2AHRA 3MZ0A 3BMOA 3TZ6A 2WWRA 3I23A 2DC1A 4I9HA 3ZW9A 4RV9A 5U9CA 1E1MA 1PR9A 2ZTLA 4BO4A 4WLNA 3S2FA 4DIBA 4WUVA 1U7HA 3JQGA 4TQGA 1N9GA 1JLLA 4KUGA 2C0CA 5GZ1A 4JN6B 4BV8A 3RWBA 3PHIA 1QSGA 3F5QA 2O3JA 2XXJA 3KO8A 4HFNA 4CM4B 1SAYA 4JX8A 1ZMTA 2GRAA 2JL1A 1HRDA 3M1AA 3PWZA 1AXEA 1HE5A 1PJTA 3I6IA 2I76A 4OJNA 4B79A 4F45A 1YXMA 4AJEA 3TRIA 1V3UA 4NIMA 4YDRA 1TT5A 5DCYA 3G1UA 4J49A 4MKXA 3TZKA 2Q1SA 3UKOA 4F6LA 3C7AA 3GR6A 3ZNQA 4UEOA 1GUFA 2NACA 1LDMA 1YBAA 3OIDA 4CPDA 4OSOA 4BNNA 3U49A 4MVJD 5MDHA 5TQVA 4BB5A 4GKBA 2ZB8A 4CQLB 3ZHXA 1PJLA 3WYBA 4A0SA 4CV2A 1YL7A 2JKVA 1DAPA 1WZEA 1ISHA 3I5MA 5IG2A 1GYRA 2GERA 1QYXA 3PYMA 3DO5A 2PFGA 5DF1A 5HA5A 2Q4EA 1JTVA 4IDCA 1PQUA 2NSDA 2P9CA 5BNTA 2D0IA 2HMTA 1LC3A 3NKLA 2C59A 1ISGA 2BMAA 2QX7A 1WW8A 4NBWA 4NBVA 4OHUA 3DDNA 5GY7A 1ZO8A 3GNSA 5HM8A 4BQRA 2HSDA 3Q9NA 4YJGA 3LLVA 3ONDA 3VPFA 4WLEA 2PNFA 1B3RA 1XGKA 2FZEA 4K9DA 3GN2A 1ZNQO 3CUKA 2EEZA 3ON5A 2X4GA 3TN7A 3JQ7A 2GZ1A 3I9KA 4C7JA 4PG4A 1EDOA 4XQCA 2G0TA 4PLGA 1NR1A 4GGOA 3OETA 4QEDA 4LGVA 2JAHA 5B4VA 1Z7BA 3VKUA 3GRPA 5COAA 3P2OA 3ZCXA 1P0CA 5JC1A 3QV1A 1ZMOA 4XYMA 4NK4A 4R51A 1FDWA 3I6QA 2DPGA 1QG6A 3KVOA 4XB2A 3GMSA 1ORRA 3QW2A 2BI7A 3ONEA 1AHIA 1OBFO 3G79A 4XJTA 3PGXA 1U3TA 4DBVO 4XD2A 5G4KB 1NNUA 2JCVA 5JAZA 4YAEA 1X13A 5A9TA 1LRLA 3H9UA 5DP2A 4FBGA 1SEVA 3GF4A 3O8QA 4WASA 5KVVA 4GSKA 2QHXA 4O1MA 3P2YA 1OMOA 1NAIA 1P44A 1NTOA 3VZPA 5JBIA 1P1FA 4CUZA 1IYZA 1YDEA 1GYQA 1E7MA 3WNQA 3BIOA 1QYCA 4FW8A 4U6QA 5F1OA 3WQQA 1LDEA 1F8FA 3FNEA 4Y67A 1U3UA 2VT3A 1UZLA 2NUAA 3AUTA 2AE2A 1R16A 4XRGA 5KJFA 4PIVA 1ULUA 1PWZA 1VL0A 5C37A 4L74A 4E2WA 4CQLA 2D5CA 3WFJA 3V1YA 3PHGA 2C2YA 2GYYA 4BNLA 3DFUA 2P9GA 1I3LA 3Q3CA 4Z0HO 3FHLA 2ZTMA 2X22A 1BXZA 4WNCA 6ADHA 2W2KA 1EVIA 4BMVA 3L4BC 1KVTA 1YH3A 5JDCC 3KRTA 2HMSA 5AQ1A 1YOVA 3G1TA 5TT1A 2WM3A 1H2BA 1N8KA 3IQDB 4CL8A 4YEDA 4DC0A 2QZZA 1E6WA 2VUUA 1E3SA 1P33A 5JAQA 3P5SA 3HJAA 3I9JA 4II2A 1PGQA 4E2XA 3U09A 1HLDA 3ZI0A 3H6KA 2YFHA 4U6SA 3T7EA 2B36A 4GMFA 3ZWMA 3OJLA 1I2ZA 3TOZA 1YO6A 4RF4A 1SEPA 3E5RA 1ADCA 2GZ3A 1PX0A 1R6DA 2A35A 2GN4A 3DWFA 1C0IA 3H9EO 3N58A 4IINA 3LVFO 2LDXA 1MB4A 2X6TA 5L53A 2ZK7A 4QXMA 4BMSA 5B12A 1MG5A 2CNBA 4FOSA 2QIOA 1RM5A 2AXQA 1B7GO 3QQPA 1XCBA 4WECA 4ALJA 2X9GA 4AJNA 1KVUA 5A1TA 4URFA 5I9LA 5T64A 2P5UA 4KQXA 2J3KA 3RFXA 3RI3A 7ADHA 1WDKA 2VUTA 3F1KA 1HKUA 3V1TC 1J49A 4I8XA 4B4VA 4IMRA 1LTHR 2Y99A 1M6HA 3UH1A 1F12A 3WQSB 1KEPA 4FFMA 3V2UA 2FPIA 3JYOA 3QSGA 2C29D 4BNUA 4IDBA 5C3MA 1OAAA 1EFKA 3E1KA 2VNSA 1SCUA 2I99A 2GNAA 4EJMA 4WEOA 4RF2A 4UVHA 3VVCA 2HMWA 4HP8A 4CR6A 1I24A 1XU9A 4FJ0A 3JV7A 3JQ8B 1X0VA 5AXCA 1SMKA 3I9LA 1BG6A 4KQWA 3QE3A 4R01A 3GDOA 4GWGA 4BNKA 3PRJA 4UVIA 4FC6A 4OXNA 1GV1A 1N2SA 3QRWA 2DVMA 1UH5A 3SJ7A 1J4AA 1HT0A 2VZ8A 3FWNA 3K30A 4ZA2A 5IAAA 5CDYA 5BSHA 8ADHA 4L0QA 3GFBA 1YL5A 2A92A 4BHTA 2Y67A 3Q9UA 1T2AA 2O4UX 3KXDA 1R37A 3DMYA 4W6ZA 4J7CA 2G17A 2XAAA 2HMUA 4ZU3A 3O9ZA 3QP9A 1D8AA 2WD7A 2VRCD 2CSUA 2OBNA 2YV3A 2G82A 2EF1A 4N5LA 4CLRB 2C20A 3WSWA 2PKQP 2YHIA 3W6ZA 1VSVA 2C7VA 4AJ2A 1C0KA 1DFIA 1D4FA 2P9EA 3H7AA 4BKUA 4PZCA 3RKRA 4BV9A 5TJHA 2HLPA 2GSDA 3DQPA 4BGUA 3WG9A 5JYDA 3K2EA 3AU8A 4Y9DA 5JY1A 5KVSA 3ETGA 1XIVA 1NR7A 3EW7A 1L7DA 1YB4A 2H63A 5CAEA 2CY0A 1ZJZA 4NMHA 4TRRA 1HDRA 2C54A 4MKZA 4EJ6A 2NTVA 4I9NA 5JXWA 4E5NA 4QX6A 1ISMA 4FFNA 4XGKA 2BF7A 4ZRMA 1CERA 1TVEA 4YT4A 1GZ4A 2W2KB 4BNZA 4XYBA 1YGYA 2WYUA 1KEVA 3HB5X 4LN1A 3GZNB 1XYGA 3MTJA 3K31A 1M67A 4ZICA 2ZB4A 1HE4A 2GD1O 5BNIA 1EVJA 5JNLA 4FSHA 4MVJI 2NTNA 2WEKA 3HWRA 1E92A 1S7CA 4OQYA 1TT5B 4DRYA 1YQXA 3HDYA 2IZZA 4ZQFA 5JSFA 2WDZA 4PRLA 3WGHA 4EI2A 3AUAA 1BRMA 2J6IA 1ZEMA 3DZHA 4Z0PA 4OL9A 1GD1O 1T1RA 3GLQA 4Y8VA 3GGGA 3QHAA 2Y0EA 1FDTA 9LDBA 1M76A 2YFQA 4MVJP 3A1NA 1WXDA 3MOIA 2NWQA 4JXKA 1NBOA 2OUIA 4Y6SA 4CM6A 2NV6A 4XIYA 3IUPA 5EESA 1VSUA 2VHZA 4QFCA 4PFJA 1PL7A 4Q3AA 1EVZA 2VUSA 5A02A 1U9JA 3FD8A 1YB5A 3EK2A 3IP3A 1EUDA 2GUGA 4G2NA 2VWQA 4IBOA 2UV8A 2FSSA 4BOYA 4Y98A 1ZXBA 3ROKA 1NFFA 4CLHA 5JCXA 3H5NA 1HLPA 3AJRA 5IZCA 3JD0A 3AY3A 3PHJA 2DTXA 3WX0A 2WTBA 1HDYA 3KEOA 2ZKLA 3W4JA 4FB5A 3IDSA 3GMDA 4J9UE 3OBBA 4NPCA 2O2SA 1CEQA 4WE3A 2J3HA 4HX5A 1DC6A 1YRLA 3PI7A 5AXAA 3A06A 4CUJA 3VC7A 4FIZA 2DBQA 1H9AA 3C1OA 2JFGA 1CIVA 4LVUA 3BHMA 2IZ0A 5L7WA 3UOGA 4PLZA 4KP7A 4O63O 3DB2A 4XGNA 4OIMA 1B26A 3UGKA 1NQ5A 3GT0A 4DGSA 3COSA 4Z6KA 1UXJA 4YAGA 3EZLA 2GN8A 4OKIA 4IY1A 3GG2A 3ROMA 1LXCA 1W6UA 1PTJA 3WICA 4CQMB 1LEHA 1A72A 3LQFA 1H6AA 1ADFA 4NU5A 1ARZA 1Z74A 4DXHA 1X7HA 3IMFA 3L07A 5GZ6A 1PS8A 1R4MB 4BNGA 1O5IA 1HZZA 3GG9A 3ZN2A 3PTZA 1DRWA 3RUEA 4QT0A 5EIOA 1NWHA 5C7IO 4IIUA 4JJGA 1WDLA 3CKYA 3MWEB 2Q99A 4G65A 1M2WA 2UDPA 5HWSA 2Y68A 3ASVA 3JQEA 4YPOA 4JK3A 1ZK4A 4N54A 3S2IA 3D0OA 2PD6A 4L75A 3O26A 3VTZA 1HDXA 1KYQA 1NPTO 3RC2A 5IJZA 4S1VA 1ZW1A 3LC2O 5KJEA 3NGXA 3F4BA 1I8TA 3AW9A 3SBOA 2GZ2A 1N92A 4IDFA 4XYLA 4XDZA 3QVSA 5JDIC 1NHGA 3NTQA 4MJLA 4DPMA 1Y1PA 3DXFA 2NLOA 5L9AA 4UUOA 4Q39A 3TWOA 5A9RA 1F06A 2YDXA 4B7UA 5A4DA 4YJGB 1E7RA 1OI7A 1LUAA 5A9SA 3M2PA 5U4QA 1G6KA 5LC1A 3UHAA 4FFPA 2EP7A 1KEUA 4B3JA 1PQPA 4RQTA 3WFIA 3O38A 4J91A 1EZ4A 1N5DA 5L4NA 1DFGA 2X0JA 3JQ7B 3FCOA 3DHNA 2PLAA 2VYVD 2YHUA 1E1KA 1D3AA 5CDGA 4ZQEA 3D3EA 4QSMA 1VJ0A 5A03A 3ASUA 1GPJA 4RZHA 1U5CA 5DN9A 2GASA 3DTYA 1RKXA 3CZRA 2JFFA 5JCJA 4XIJA 1LI4A 5DBFA 1IY8A 3JQCA 2V6BA 3UCEA 4RF3A 2BELA 4JBIA 3KZVA 4WEQA 4M49A 5JFOA 3F46A 3ZWNA 1E1LA 2Y1DA 2BI8A 2PD4A 5IDYA 3RJ5A 3FBGA 4RPKA 1AE1A 4YYZA 1HDZA 2HJSA 4R69A 1I3MA 3WGQA 3OIGA 4AG3A 2B4QA 4PZEA 3PHHA 2F1KA 3WR5A 2HKIA 3ONFA 1L1FA 2VN8A 5BNFA 4I5EA 5GMOA 5KKAA 5I9NA 1GR0A 2ZQZA 3G3EA 2OO5A 1W4ZA 4W82A 4J0FA 4DPKA 4GX2A 4WCFB 1ENZA 5TF4A 4YT2A 1Y8RA 1JKJA 4BNYA 1T24A 4G5HA 3WYCA 5FI3A 1DIAA 1WPQA 3FTPA 2QZ9A 3I3OA 1DIGA 2R00C 3HHPA 3QVXA 4E2ZA 2O3SA 4E5YA 4WCFA 1HDOA 2ZJ0A 1B2LA 4GWKA 2V6FA 2JHFA 4II3A 2VYND 3M6IA 3PIDA 3V5NA 4EUFA 3F47A 3PWKA 4KUEA 4DYVA 1PL6A 4BO5A 3ZWWA 4D3SA 5JDIA 1Z82A 4CODB 1DSSG 2B0JA 2AQHA 2B5VA 5L3ZA 2JCYA 3F3SA 4MVJH 3UF0A 3VDRA 2Y0DA 3GK3A 3ROPA 4Q3EA 3I52A 3DC2A 4J1QA 3K5PA 4BO0A 1T2DA 2W98A 3BHJA 4L4SA 5B4TA 1Z6ZA 4D3DA 4GLOA 3GZ4A 3G17A 4NBTA 5F5NA 3CE6A 1GY8A 1VRWA 5CEJA 5LDHA 5LDGA 1E0DA 1QYWA 4PG6A 4RLSA 2NQ8A 4EDFA 4WK6A 1GADO 2JAPA 2V65A 4R3WA 2CVOA 1MX3A 2EGHA 1C1DB 3BMNA 1P31A 1BTOA 1KS9A 1LLQA 3UICA 2PTGA 4JQCA 4I9UA 5TSDA 1H9BA 4CV0A 4UEKA 3ULKA 4OXKA 4GL4A 3EVTA 3QLJA 4H16A 4D46A 1VJTA 3FR7A 4MO2A 1E7WA 1HXHA 2RCYA 3GPIA 4BNIA 3U5TA 1E6UA 5TLSA 4FS3A 2FR1A 3D7LA 1C3VA 4OM8A 4XB1A 4YQYA 4DIFA 4BGIA 5EQFA 3I9NA 1GPDG 4B4UA 5F21A 2WD8A 1QMGA 4MPDA 4L76A 2QQ5A 1DEHA 2QW8A 2VCYA 3I83A 5F1KA 4E0BA 1P0FA 3WNVA 2J5RA 1XWFA 1CDOA 2I9PA 2Y93A 4R4JA 3RBVA 2JD2A 2W4QA 3ZV4A 4K6CA 3GQVA 1LLDA 3HDHA 3H9GA 1WAMA 4OSPA 1NHWA 4RVSA 3ZWPA 4AJIA 5THKA 4Z3KA 5JW6A 4IJKA 1GDHA 2B4RO 2UVDA 3GA0A 1X1TA 3JD2A 3RD5A 4ND1A 4OO3A 1K2WA 3KLPX 3HQ4O 2TMDA 4E2YA 1PJSA 1DIRA 5C5IA 1DLJA 2EIHA 2R00A 4RLHA 1H5QA 4WLVA 3H3FA 4PN3A 1UUFA 5HBRA 4YBZA 1I30A 4YRBA 1JVSA 2PK3A 1W73A 5A04A 2HJRA 1ZUD1 1PJCA 2WYVA 4P8RA 3WXBA 3SLGA 3U9LA 1O9BA 1Q0LA 3D4OA 1UP4A 3BMQA 3H8VA 3Q0EA 3MJ4A 3W4KA 1C0LA 1E3WA 4JLWA 4LRTB 3L6DA 1BW9A 3DMTC 4K28A 3V2GA 3VH2A 2R2GA 3NX4A 1ENYA 2E6UX 4W4TA 3LK7A 1Z7EA 2UAGA 2GF2A 4HADA 5FYDA 1JW9B 2HO5A 2FZWA 4A2CA 4AJKA 4CMEC 3B6ZA 4CM8B 2O7SA 3B20A 1Y7TA 3G0OA 2HAEA 4YAJA 3CXRA 4GX5A 4EGFA 4UUNA 5IN5A 2CFCA 3RIHA 1TB4A 2BFMA 3FNFA 1R0LA 1BVUA 4J2OA 1RWBA 4YR9A 4D0SA 5I7FA 2QRKA 4L9RA 5TS3A 3STHA 3PDUA 3ZWOA 3KEQA 3LDHA 2WE8A 3GAFA 1PGPA 4M89A 3RU7A 4MDHA 3ZV6A 4ZRNA 4TRJA 1ISIA 1CJCA 2EKPA 2YQ5A 3WGTA 1EMDA 2P68A 1KBZA 1PL8A 2NVUB 5G4LA 3C8MA 1DHTA 4PLPA 2BD0A 4EYEA 5ER9A 4I5GA 1BHSA 3GY0A 1TA4A 4OKNA 4CMIA 3WTCA 2Y1EA 1HE2A 1E5QA 4YJDA 4E21A 1E1NA 3SLKA 2X9NA 1C1XA 1K0UA 1ZJYA 3WS7A 1JAYA 5DCUA 1YS4A 2DTDA 3VDQA 1YWGO 5T5QA 1JDJA 1O6ZA 5TIIA 4IUYA 5EINA 5A9SB 2VWPA 2B35A 3QWFA 4ZQHA 1Z73A 1MC4A 3GZNA 3OJ0A 2FOIA 4B3HA 3H9JA 3QVWA 1Y9EA 3A4VA 3PZRA 5CFZA 1U4SA 1V3VA 1EQ2A 3GH3A 5EQDA 1C1DA 3BMNB 3E48A 1ZFNA 4DTIA 4AFNA 3LT4A 5F1PA 4BUCA 1SNYA 1B8VA 1SC6A 3BTSA 3PQDA 2HK8A 3DL2A 2GO1A 2BRUA 1P1IA 1DO8A 2XXBA 3PGJA 4CLOA 2CF5A 3K73O 2O3RA 4YB8A 1P1JA 4ND2A 4DBZA 3ZH2A 1YDWA 2RH4A 3PQEA 3O8QB 3NYWA 5K9ZA 1E77A 4E5PA 3HADA 1ZIDA 4HXYA 4YT5A 4UVDA 3JQFA 1GU7A 4EITA 4YAKA 1LLUA 2GPTA 3LC1O 4AVYA 3PWSA 4IDEA 4XRRA 5BSFA 1A7AA 2ZIZA 1P74A 3ANMA 4E31A 1ZK1A 4WNIA 1R0SA 3GDFA 3I4FA 4XYGA 1XR3A 3HE3A 2AG8A 4R1SA 2YZ7A 1Y5MA 3PDJA 3FPCA 5EN4A 4AJPA 4GPD1 1BW9B 1HE3A 1A5ZA 3E9QA 2NADA 3D4NA 4ITUA 5BQFA 1YJ8A 1F14A 4ZVVA 1JU9A 1V9LA 3IAHA 1VL6A 2ZB3A 3OFSA 3RROA 1GUYA 3EY4A 1QKIA 3IIEA 3HFGA 1PGOA 3JQDA 4XCVA 3AK4A 5I8WA 4RORA 4RZIA 4D3FA 3U62A 4EBFA 4AJ1A 5L7YA 9LDTA 1U8FO 2CD9A 2EHDA 3NJ4A 1IHXA 5ES3A 4FD3A 4HBGA 2BGKA 5BR7A 2GR9A 1ZZEA 1ONPA 1UAGA 1EBFA 3WLEA 1N9GB 3JQ9A 4INAA 4ALKA 3FTNA 1CQJA 4DPLA 2JD1A 3LZ6A 1R4NA 4RVGA 2YV2A 2PV7A 2VHXA 1GQYA 2EP5A 5H81A 3W8DA 2ZATA 2I3GA 3P19A 2I5PO 4WJZA 1BVRA 4HNHA 3ZWAA 4RQUA 1AGNA 2J5KA 3FRJA 1P1RA 3QY9A 3WOHA 3ZDFA 3GVCA 1R4MA 3H4VA 3LF1A 3Q2KA 3UW3A 3OJFA 2GN6A 2VTDA 1DIHA 3ADPA 4CLOB 2PGLA 3GEGA 4NBUA 4MVJM 5DNAA 2D59A 4CUKA 3GHYA 3KSDO 3ORFA 3UUWA 3ZHZA 2X5OA 4IGFA 1X15A 4J4BA 4RJTA 2ZQYA 2J8ZA 2JJYA 4CJXA 1T4BA 2JFHA 3KM0A 3JQ9C 3ZNOA 1XQ1A 1KVSA 3HSKA 3JQFC 3RSHA 3VH4A 5KCZA 3IP1A 1B8PA 4I08A 3KUXA 4U5QA 3QWIA 2I66A 2BHLA 1H6DA 1ZVMA 2PH5A 1IPFA 1K5HA 2JHGA 2B4TO 3GUYA 1GTMA 1XELA 1GUZA 8LDHA 1DOHA 5G2OA 4PLHA 2FN7A 1E3IA 4D42A 2IEDA 1JAXA 1EBUA 1LDGA 4O59O 3MOGA 1ONOA 1V35A 2DFDA 2X0IA 4TZKA 4DIOA 1EUCA 5HRUA 1HL3A 1QYDA 1U3VA 1LX6A 4U0JA 3TSCA 3ITDA 4QTZA 4WOKA 3SJUA 3I4CA 5JO9A 1NWCA 1ID1A 1YVEI 3OSUA 4CM1A 4IJWA 3NV9A 1XU7A 1Y81A 2ZYDA 5A5EA 3EYWA 1MA0A 3OA0A 3JYLA 1LC0A 3IJPA 1CQIA 3LT2A 4R16A 2EJWA 4TKMA 3ZNPA 1MG0A 3TNLA 1QV7A 4M8SA 1EVYA 4M86A 3PQFA 4XJSA 1NXQA 3DTTA 1DXYA 2HU2A 2IRWA 1U2GA 2EW2A 4FGWA 5I7SA 3NT5A 3UVEA 1DJNA 4BQPA 1I3NA 2BFOA 3E18A 4IXTA 2OL4A 3KYDB 3R6DA 3DZBA 4MINA 2RIRA 1NVGA 4MVJG 2D8AA 3PFFA 4Q9NA 3VKVA 3FPLA 5BSEA 4RVDA 4E30A 4A27A 2Y0CA 1R12A 1MUUA 4YJHA 2HQ1A 1ISFA 1I36A 1PZEA 2GGSA 3DZKA 3GEDA 3PIIA 4RVUA 3DZFA 3OQBA 1HEUA 5F5LA 1DAOA 2HDHA 5JMWA 1C14A 3Q1LA 4J1NA 2Y1FA 3IUSA 1MXFA 3ETEA 5IZCC 6LDHA 5L95A 2VRCA 4AICA 2E48A 1K6XA 4GBJA 4E4YA 1GZ3A 1GFSA 2X0RA 1GCUA 3HFSA 2PGDA 4KMSA 3MJCA 1LJ8A 2E49A 4KTTE 5T57A 3RASA 3KHUA 1P77A 1R4NB 1Y9AA 2OHXA 5JDCA 4GSLA 1C1XB 2EV9A 3T7CA 1KC3A 4BKOA 3ZWYA 4CM9A 3ZWVA 2Q1WA 2VNAA 4J7UA 4RPLA 3A28A 3GC6A 3PHLA 1PJQA 2Y1CA 2C5AA 3ZWXA 1ISJA 2G76A 1GZ6A 1NM5A 2X5JO 3NJ8A 1U4OA 2Q2QA 1Y6JA 2DBRA 2B69A 4QECA 1D1TA 3MJSA 3ZU4A 2FMUA 1O8CA 3T4EA 3R3SA 4BO9A 4IM7A 3AUSA 4PLTA 4DQVA 3BTOA 4IQ8A 4KTVE 3WWYA 3RAJA 1K6JA 3IKTA 4PG7A 1PGNA 5IXYA 1E6EA 1T2FA 4U8GA 4R1NA 3RUDA 3RBXA 3K96A 4PLCA 4UAGA 4CL3A 4C4OA 3OMLA 3RUCA 1Q2XA 4BO6A 4WKGA 5ENVA 1ZK0A 1PR3A 3DZIA 3H5AA 2EERA 2X86A 1LSJA 4GVXA 4ND4A 4IXWA 4BB6A 4BO3A 1LSUA 1NX6A 3BZUA 3ZU2A 2NTJA 2YYYA 3CPSA 3R0IA 4RCVA 4ALIA 2YUTA 4LVCA 5I7EA 2H5LA 3NAQA 2RAFA 1Z75A 4DVJA 1N1EA 1D7OA 2QRJA 3NEPX 3AI3A 3DBLA 1DDOA 4J1SA 4FJ1A 3Q11A 3NRCA 5DT9A 1DC5A 3B1KA 3BMCB 4JJFA 2IDZA 5DZSA 4J2HA 3VZQA 1VLLA 2POQX 5JE8A 3E5MA 4N7RA 3PYXA 3CEAA 4YQZA 1DB3A 2ZTUA 1EFLA 5TT0A 5KKCA 2D1YA 1OZAA 3W4IA 2PD3A 4HUJA 3NGLA 3ABIA 3E9NA 4RDHA 1IHYA 4BKQA 1VC2A 5A06A 3PLRA 1Q7BA 3E8XA 3MTGA 4WCDA 3IC5A 1UXHA 3JQBA 2X58A 2CMDA 2WYWA 4FPXA 4RPJA 5G4KA 1E3WB 2VYVA 3RC1A 3WIEA 4W7IA 4XR9A 3D3WB 3WGOA 3U4DA 2O7QA 5FWNA 1AXGA 4BNXA 1IE3A 3BHIA 4DREA 3RC9A 4AJOA 1C0PA 1ZK3A 4RVHA 4HFMA 3PXXA 1X7DA 4KWIA 3GNTA 2EKQA 1RYDA 4MIOA 1YL6A 4WLFA 2IXBA 3GVIA 7MDHA 1X1EA 1ZH8A 4BGEA 3L77A 3INTA 3ZV3A 3F6YA 4XKJA 5L4LA 4P4LA 4LRSB 1CRWG 1PZGA 5EJ2A 2FPPA 4NFSA 2YW9A 4D43A 3OA2A 1EK6A 2OFPA 1IB6A 3NT4A 1A7KA 1W0CA 4TKLA 3TL2A 4BNWA 3L6EA 3VH1A 2VOEA 4GH5A 2CF6A 4ZQGA 3V2HA 3PFWO 2VT2A 2J5QA 2PZKA 5ICMA 4GVLA 2OXIA 1N7GA 3AY6A 3HZZA 4J90A 1HETA 2YDYA 4ZHSA 5TJ9A 4DA9A 4CM3A 3WSVA 1E3JA 2DAPA 4HV4A 3NUGA 2ILTA 5T8KC 3SEFA 4IS2A 3IJRA 4TMFA 4QFDA 2NU7A 2VYNA 3ENKA 4JBGA 2FY8A 2X5KO 1YBMA 3QWAA 3D5TA 3INGA 3PJDA 1FDVA 1HDCA 3JQBC 3TDKA 4BS9A 4UUPA 2X1HA 2CDCA 1E7SA 2Q3EA 2IODA 2W90A 1UP6A 4LW8A 4LISA 1UXKA 4CMIB 2X23A 2PKRA 4J43A 3ST7A 5A5FA 3PJEA 2AQKA 4TVBA 1UAYA 2YHIB 2UUPA 4LMRA 1IPEA 1MLDA 1DBVO 1H94A 2EWMA 1NQAO 2OP1A 3LC7O 4AJLA 2HRBA 1K89A 4AJJA 2OORA 3UXYA 5KVQA 4R5HA 3X2FA 4NQZA 3JYNA 1Q7CA 1HF3A 2IYOA 3TL3A 4BIIA 4D79A 1T1SA 1T26A 3OHSX 1GYPA 3L9XA 1GQ2A 4G81A 2PZLA 3JTMA 1XDWA 2PWZA 1NFRA 1YBVA 3FN4A 3G49A 1WDMA 1PZFA 3HN7A 1E7QA 4A5OA 2FSVA 1M75A 4KDEA 1UR5A 4HNGA 4ND5A 1FF9A 1WWKA 5COQA 3RUFA 5FEUA 3GDGA 1A71A 1YQDA 2AQIA 1GV0A 4J7XA 4OXYA 5TX7A 2ZCVA 1AHHA 4GKVA 1P1HA 1VJ1A 1I5RA 2A9FA 4K6FA 1MGOA 1ZSVA 4I5FA 3ZV5A 5CG1A 3HN2A 1PJ3A 4BNVA 3LT0A 3JYQA 2NQTA 3FSRA 1R66A 3K2BA 3H65A 4YT8A 2O23A 4NBRA 3PP8A 1X7GA 3V8BA 2NVBA 5KOIA 5EPOA 2DFVA 3ANNA 4K26A 1GQQA 5MGBA 3LU1A 4EW6A 4NG5A 3ZHYA 4ONEA 5A3JA 3FBTA 3OF2A 1RPNA 4UVEA 2W2LD 4I5DA 4J4HA 4IPTA 3ZU3A 4OOEA 2PH3A 3F4LA 4B4WA 4R41A 3CMCO 1PWXA 1PS9A 2GN9A 1UXIA 4OGWA 1QYVA 2VHYA 2X7HA 2FWMX 4NI5A 4JNKA 5G0WA 3WWZA 4E5MA 3HDJA 1IZ0A 1ADGA 4XQGA 4D7AA 1NFQA 2IXAA 4PCVA 2O3QA 2BH9A 2PA3A 1XKQA 2LDBA 3WIDA 2RHCA 4IIVA 5GZ3A 3RUHA 1Y8QB 5C7OO 3ANLA 4XZ3A 5BSGA 1KERA 3AUUA 2ZCUA 3F9IA 4R1UA 5CHEA 3VZSA 5KVCA 3DFZA 5L4SA 3SVTA 3KV3O 4DQUA 2Y05A 4IQGA 1RM0A 2NU6A 3O03A 5TC4A 3KYBA 5ICSA 3DBHB 1KOLA 3PLNA 1U8XX 2CDAA 2NU9A 2NVUA 5G0SA 3DAGA 4CQMD 4CV3A 5K6AC 1H0KA 5KJ1A 2DLDA 3BAZA 4XEHA 4WLUA 1FXSA 3GVXA 4ND3A 1Q1NA 1I3KA 3ICCA 4DQXA 3MWDB 1KY4A 4PLVA 4BVAA 3F5SA 1F17A 3DMTA 3F1LA 3RVDA 2W8ZA 5EL0A 4BKRA 3D5QA 5DOVA 2EXXA 2X0NA 3LF2A 3PVZA 3QIVA 5DOZA 3S2GA 3UCFA 2UUOA 2AEFA 3EC7A 3L0DA 1VPDA 4H3VA 5AYVA 5FI5A 1TLTA 5DCWA 2P4HX 5JPIA 2PR2A 1A27A 2DBVO 1JVBA 2AQ8A 3JYPA 4PG5A 1I2BA 3GRKA 4GX1A 3AWDA 3RBZA 3ZZNA 3WDSA 3AM4A 4E3ZA 3JQAB 2Q1TA 2DT5A 1T2EA 1VKOA 3ZU5A 1VI2A 1FDUA 2YV1A 2HMVA 5DBIA 1PJ2A 4N5MA 4YACA 2HK9A 3AFMA 3DAFA 4H15A 3VH3A 1OOEA 3R3JA 4YWJA 4PZDA 2O50A 4ID9A 4Y6PA 1AUPA 1TI7A 4J16A 4TRNA 3P7MA 3CSDA 4DLLA 1U28A 2VZ9A 1RM3A 4DUPA 2RHRA 4XX0A 5ITWA 1BXGA 1E5LA 3OQ1A 2FRDA 4BO2A 2BFPA 3GGPA 3ZWCA 4E33A 4BNHA 1O94A 3GFGA 4D0RA 3HUDA 4YCAA 4Z9XA 1SB8A 1LA2A 4OMUA 4AJ4A 4GLLA 5CG2A 5I9MA 4BO8A 4NJMA 2Q2VA 1GL3A 1EQUA 4EZBA 2ET6A 4JROA 4CMJA 5ADHA 3C7DB 1LDNA 3KYDA 3MJVA 4W9NA 3SXPA 1EK5A 3ZW8A 3L4SO 3MJTA 1O89A 2R6JA 3WTBA 4NNJA 1VE9A 3GVPA 3ICPA 4WPGA 3NTOA 4BNFA 4TZTA 2EJVA 1XA0A 4IZHA 5ILGA 5HS4A 2V6MA 4YVFA 4F3YA 5CPFA 2B5WA 1ULSA 2PKQO 4Z9YA 3DAPA 3RC7A 1LU9A 2XF8A 3W1VA 2C7GA 4OAQA 3B1FA 2H6EA 4D41A 3N7UA 4YJFA 2J3JA 3JQ8A 4N18A 3D64A 4R9SA 4B7XA 4DMLA 3JQGB 3UCXA 4A03A 1ZCJA 5JY6A 4NU6A 1UXGA 4CR8A 4XWYA 2FR8A 3I9OA 1NYTA 3KBOA 1FJHA 1XG5A 2ZYAA 1YB1A 1LQUA 4OYRA 1GEGA 1P45A 4GI2A 4FFLA 4UEJA 4UUMA 4YXFA 3BMQB 4CM9D 1FDSA 4Q3NA 2AA3A 3M2TA 3RKUA 2WD7B 4KZPA 3GNQA 3WBBA 4XR4A 4X54A 5EMHA 1U3WA 1NVMB 2IYPA 1QR6A 5AXDA 1DFHA 3DR3A 3UN1A 1PZHA 1UJMA 4M55A 1IZ9A 2FPGA 1JWBB 3GEMA 1H93A 1SPXA 1MV8A 4YA6A 1L7EA 2XOXA 2FP4A 1LQTA 3KTDA 1J6UA 2AE1A 4JCOA 3ADOA 2F00A 2G5CA 2QRLA 1IL0A 1HTBA 3E9MA 3VVBA 3ZGYA 1BMDA 5AOVA 4MIYA 3SC4A 3DBHA 4XQ9A 4CM5A 2EKLA 3NDJA 3ITKA 3JSAA 5T67A 3JQ6A 1F0YA 1U5AA 2UYYA 4IJVA 4Z3DA 2BGLA 4NZ9A 5KWEA 4MP3A 4NH4A 3DOCA 3EVNA 4P22A 1SOWA 4CMKA 3EAGA 2AMFA 2VWHA 2CDBA 4GGPA 3WMXA 1TXGA 3K92A 2Z5LA 2WJPA 3BTUA 1YJQA 5H82A 1JWAB 2ZTVA 1V3TA 5KJ6A 1WLYA 2VZ0A 1Q0HA 3TZQA 3KLMX 1KETA 3M1LA 4RPHA 3BMCA 1MFPA 3D1LA 1J5PA 1P3DA 2Q49A 3FNGA 4PLFA 4B4OA 4NR0A 3WGIA 3WLFA 2BKAA 3DONA 3U3XA 3TFQA 5IFLA 2H9IA 1XSEA 2EW8A 4H7PA 1PIWA 3U4IA 3TOXA 4AL4A 4YTEA 4DLBA 2V7PA 1E3EA 5ENDA 4MVJE 1YQGA 4FFOA 1DC4A 1ZK2A 4BNTA 3A14A 5JLAA 3WQRA 4WLOA 5ITVA 3RUIA 3GOHA 3K6JA 4XDYA 1KC1A 2Y1GA 1NAHA 1VM6A 1WNTA 3HDQA 3I9MA 4R1TA 4JGBA 3I1JA 1H2HA 2FR0A 4A7PA 3T4XA 1W8DA 1LDYA 1HYGA 4L73A 5ER6A 1CYDA 1WMBA 4MKRA 4CMGA 1CETA 5DP1A 5I7VA 1DRVA 3PK0A 1RM4A 3EGOA 4WOJA 2XPCA 3NDRA 1FMCA 1I33A 5F3RA 5IDXA 3E03A 4JP2A 2OP0A 3KOUA 3B1JA 3HNPA 3PJFA 4NDNE 4OOFA 4FR5A 3AOEC 4PVDA 1LSOA 4AJHA 1A4IA 3WBFA 1DHRA 3Q2IA 4R3NA 4A26A 3KSUA 4EEXA 2OGUA 3LSYA 1UDBA 3FF4A 4J6FA 2E37A 3C7CB 2FHSA 5IZ4A 1HZJA 3GVHA 2YY7A 2ZB7A 1SOVA 4DL9A 4M87A 1JN0A 2X8LA 1D1SA 1Y5RA 2O3TA 2PZJA 2Y66A 4J0EA 1B8UA 5L45A 1B16A 2O3UA 3GPDG 3H9QA 5T8KA 2SCUA 2NM0A 1P9LA 4J4TA 1Q0QA 4UULA 4KDFA 2OZPA 1EE2A 2E4AA 2NU8A 4R54A 5KJCA 1I0ZA 2D5AA 5EERA 1NP3A 1HSZA 1IUKA 3L6OO 1B3BA 3ZWBA 1LLCA 4CQMA 2HK7A 3DBRB 3DZGA 3KYCA 5DDIP 3TZHA 4BL5A 3IS3A 2V6GA 5CDTA 4C7KA 5TRTA 2IEBA 2CZCA 3RCBA 2VQ3A 4R68A 2X9VA 2W2LA 1MC5A 3ZHBA 1SO8A 1B0AA 3C1AA 2DPHA 3HG7A 3TPCA 1OC4A 2PZMA 1WP4A 5AXBA 3E6AA 1QLJA 1U2DA 4YRDA 5KIAA 4P4NA 2WE7A 5HTOA 3C24A 2A4KA 3CINA 5B1YA 1DRUA 1NPDA 4IDAA 3W8EA 2QYSA 3VOSA 4ALNA 1M6WA 1PS0A 2AW5A 1YONA 1BDBA 1N1GA 2C5EA 2PGJA 2QG4A 3TQHA 2B37A 1JKFA 2DUUA 4CM7A 1NASA 4HFJA 1V6AA 3C85A 3CTMA 2CUKA 4RL6A 1O95A 4TVOA 4PLYA 3PZBA 5A3VA 3DOJA 1Z45A 4QQRA 1TEHA 3EZYA 2Q50A 3LLSA 1MXHA 4D45A 1ZSYA 4FFRA 5L40A 2NNLD 2P2SA 1QXSA 4J9VA 4NJMB 4P4GA 4R9RA 5JC8A 2D2IA 3CH6A 1KVQA 3AM3A 4D44A 3OECA 4W7HA 4E12A 1PGJA 5A05A 3QWBA 4LSWA 1I01A 1B15A 3GGOA 4O0LA 2O2YA 2ZJ1A 4CV1A 4TRMA 3GUCA 5AVOA 4M54A 1E3LA 4RDIA 2O4CA 4IMPA 1LRKA 4K1LA 5ILOA 3FR8A 2HRZA 5G0TA 4YJHB 1NVTA 1FK8A 4L8VA 1I2CA 1X14A 4NHEA 3WB9A 4GQAA 1B14A 1EUZA 5FFFA 1HYEA 2C2XA 4DMMA 1BWSA 3TJRA 4JJIA 3WGGA 3DEYX 4XGIA 2P5YA 4W99A 4E32A 3H3JA 2ZYGA 4XA8A 4W9NC 4ZD6A 1V0JA 1YKFA 3VAZA 3U4HA 4DLAA 4YRAA 3PPIA 4XQEA 4A73A 4EEZA 4IS3A 1Y8QA 4TWRA 1CWUA 3VHRA 1OC2A 4FOOA 4QO8A 1VKNA 1JQBA 5CDUA 1ENOA 4TROA 1QLHA 4JBHA 3KETA 2A94A 3OJEA 1T25A 3RQSA 4MIEA 2IZ1A 1GCOA 2H1SA 1ZKMA 5L51A 4N5NA 4U0KA 1UDCA 5IDQA 2C82A 4FGSA 5IF3A 3KSZO 2WSBA 4NJOA 2I3AA 3S1LA 3CIFA 2GCGA 4JIGA 3DHEA 2VHWA 3WYEA 4Q3BA 3K8ZA 3WJ7A 4NFYA 3WGZA 5FF9A 5JYEA 3WJAA 1IOLA 1HSOA 4ZN6A 4EJ0A 5IXSA 1A4UA 1KVRA 4BGVA 1U7TA 1BDMA 1KIFA 3FI9A 1LBEA 5I8ZA 5IN4A 1J0XO 4PLWA 1ENPA 2VHVA 3D4PA 2Z1MA 1HDGO 2OBYA 4EUEA 1PU2A 1YE3A 5G0VA 4J1TA 1ZXLA 1WZIA 4GX0A 1JA9A 1KEWA 3CMMA 4BNMA 5J23A 3FNHA 4FC7A 4LSMA 4IJUA 1ZBQA 2TMGA 3DBRA 1YOVB 3KYCB 4GMGA 4QO7A 3S2EA 4MP6A 1ML3A 1N7HA 3ZNNA 4HWKA 1LNQA 3A9WA 1XHLA 3H2SA 5TGDA 4ZJUA 3QVOA 3EMKA 1NQOA 4GAEA 4ILKA 3MCVA 2G1UA 4KUHA 3TF5A 3PEFA 4ALLA 4CMAA 4B8WA 4RGBA 1LRJA 1U1IA 2VOJA 4IDDA 1P1KA 1XQ6A 1UZNA 2Q4BA 3SC6A 4CMHA 4ZGWA 5KTKA 4B7CA 4WGGA 5K0ZA 5G0UA 1G0NA 4UVGA 3VPXA 1LSSA 1SBYA 1PQWA 2DQ4A 4L4XA 3L4BA 1XEAA 2Z95A 3C1TA 4PG8A 3UAGA 1MP0A 1JKIA 1E7YA 1T4DA 3OQ6A 2VWGA 4B3IA 3CZMA 3RU9A 2P4QA 1BXGB 2JCXA 1TT7A 2DU8A 4TSKA 1M66A 1CF2O 1HYHA 1G1AA 1EE9A 1H6BA 1RYEA 3PYLA 5JCJD 3BTVA 5CPBA 4CMEA 1RJWA 4OH1A 4IDGA 4FQ8A 4M1QA 2DM6A 4YAIA 4O5OA 3OIFA 4U7WA 1SZJG 4CM8A 3OJOA 4L4RA 1HWYA 2Y1OA 4F46A 5JO0A 2OMEA 3ROQA 4O6VA 3BXXA 1ADBA 3INRA 4J3FA 3VPHA 4BKPA 1Y8RB 3GN1A 3ETDA 2I65A 3U4CA 4NFHA 4FCCA 4PRKA 5K6AA 1IULA 2JD0A 3EUWA 3LYLA 4CMBA 5TNXA 4CLDA 3AM5A 2YJZA 3ENNA 3VZRA 4IQ0A 4Z9FA 4HKTA 1GAEO 1DJQA 1WVGA 3RFTA 3K9QO 4B8ZA 4BNJA 5B37A 1OFGA 2AG5A 5JAMA 2IE0A 3AOEA 1UZMA 1EEHA 1NPYA 1O0SA 2VRBA 3OM9A 3QWHA 4HFRA 4RVFA 3TZCA 4CMCA 5C7LO 1DIBA 5COBA 4BMNA 2Q1UA 2OOSA 4PVCA 2RBEA 3W6UA 3MEQA 2J3IA 4Q3DA 5CEFA 4CLRA 3NT2A 4Y6RA 4ALMA 3WMWA 5JS6A 3AU9A 1XLTA 1EDZA 2VTEA 3IL2A 4BO7A 2PY6A 3QVTA 4NK5A 2HUNA 2P91A 2Q2WA 5DBGA 4HY3A 3RUAA 1K3TA 3H2ZA 2B83A 2DKNA 3AY7A 1QP8A 2E82A 4LCEA 3HB4X 5H83A 1VL8A 3BA1A 3IKVA 3S55A 5B4UA 3JCZA 3OH8A 3KB6A 1A9YA 4MOWA 1DPGA 2BLLA 2DTEA 3DHYA 4FJ2A 4RO0A 5IDWA 5CDSA 1I10A 3BMOB 1G0OA 3OP4A 4P38A 1A9ZA 3RFVA 4E13A 5L7TA 3JQAD 3O4RA 3PJGA 3GAZA 4Z0TA 1WMAA 1MFZA 2BGMA 2QYTA 4QUKA 4BO1A 4S3MA 4DWVA 3N74A 1DC3A 3AI1A 1NQTA 3JD4A 4FN4A 1BXKA 4A10A 4OQZA 2AEMA 2C07A 2RH8A 2D3TA 1QV6A 4ESOA 3IOYA 3OICA 5HS6A 4CM4A 5T6BA 3WGYA 4CLXA 3TFOA 2EG9A 3QA9A 4LCJA 1V8BA 1GEEA 2GLXA 3QJ5A 3R1IA 4ZQBA 3U0BA 3EDMA 1KY5A 3NDIA 4MP8A 3VPSA 3H5RA 3S8MA 3V1UA 1PSDA 3FWZA 3JQAA 1PJ4A 3DZJA 3AI2A 3OEYA 3DBLB 2GDZA 1T2CA 5CP8A 4CLEA 2I6TA 1PJBA 3RJ9A 4FDAA 3X2EA 4IGEA 4EUHA 2D4AA 3EHEA 1ZEJA 3AFNA 1PEDA 3D3WA 4RPGA 5BT9A 2O48X 4CR7A 1AN9A 3JD3A 3W8FA 2Q45A 2CVQA 2Q46A 3BYZA 4MVJF 2HCTA 2DUWA 2YQ4A 3E82A 4ROSA 1QRRA 3VPGA 1SB9A 3LT1A 3L9WA 1UDAA 2NVWA 5JMPA 3B70A 3SX2A 4MVJA 4RF5A 5U1PA 2Z1NA 1K6IA 1LDBA 2AEJA 3UFXA 1H6CA 2CVZA 1R15A 3DOOA 4KWHA 4LK3A 5DULA 5THQA 2WMDA 1ZSNA 3DBVO 4UREA 4IZIA 4XYEA 1BSVA 3MJEA 1R0KA
chains in the Genus database with same CATH superfamily
1S6YA 3NALA 1VZ2A 3VJRA 3BQMB 3NWBA 2GYVA 4MB0A 5TPWB 1JLSA 1MO5A 4OQQA 3T12A 2PCLA 1OXXK 2L42A 5CITA 3AHHA 4L6CA 2FH5B 4TVSA 1CB7A 4JP3A 3SVZA 2RDMA 4DC1A 2JIZD 1NVBA 3HGTA 3HB0A 3IEXA 2WM9B 3M4JA 2JJ8A 3OZTA 4PIPA 1UP7A 3M5PA 4GQIA 5FP0A 3S68A 3TRHA 4LY0A 4PFSA 1XXLA 3FSEA 5FBVB 1I32A 3FDJA 2ZIVB 3IVMA 5L3QB 1ONNA 1XVLA 2CW5A 3HXKA 3D8HA 2Q5FA 3MJRA 1OFIA 2JGKA 3MZ0A 4O1HA 1MB2A 3RJMA 5B2FA 1O94C 2PGAA 2DC1A 2DWPA 3ZW9A 3R7AA 5KWVA 1WCIA 1G5RA 1PQ4A 5U9CA 3CBQA 5F2NA 4BO4A 2GYWA 2EX4A 2H4FA 4NZZA 4EENA 4DIBA 3E3MA 1SQGA 4WUVA 3ZDQA 1D0IA 5CB4B 1EFVB 2ZIAA 3FOWA 4TQGA 3A1TA 3P2KA 1N9GA 1CUHA 3HNRA 3HBFA 1T3SA 1WXWA 2E1PA 3EUFA 2YYSA 2SNIE 5JTTA 3CNBA 3RYHB 2F3SA 3R23A 5DMXA 4M0EA 4B73A 4HFNA 2FZVA 2GRAA 3I32A 1Z4QA 1HRDA 4DJEC 1EM8B 3PWZA 5IASA 1AXEA 1HE5A 3FCYA 2R1ZA 3I6IA 4HD8A 4XGQA 2CJWA 2QRNA 4OJNA 1O6GA 3EIWA 4B79A 3TGPA 3NBKA 4AJEA 3JAMA 1AKMA 3OQNA 3HKEB 1X1BA 2WNIA 3ABRB 3HMQA 1TT5A 1UM8A 2G8LA 3E3LA 5K0CA 2NP6A 5DCYA 2WG1A 3L6CA 5DYYA 4A8HA 3R4VA 4M1EA 4UEOA 1B2RA 1GUFA 2C2ZA 4OQXA 2PKWA 2NACA 4C07A 2WHEA 2BKXA 1RLUA 5HIJA 3UK1A 3ZXSA 4DV5B 3BT7A 2PBRA 5F98A 4QG3A 3PI6A 4GMXA 5MDHA 4GKBA 2XTJA 2X8JB 2IEYA 1PJLA 3WYBA 4A0SA 1JJAA 4CV2A 3JW8A 3GP3A 1SQ0A 3IR6A 1ISHA 4AIIA 4KE9A 4DHEA 4ZCRA 3TW8B 3DO5A 3MGAA 4P3PA 1V1MA 2H4ZA 3G9ZA 2JFZA 1OPRA 3IQIX 3PD1A 5DF1A 2I4NA 5HA5A 4BVHA 2Y2UA 1FP2A 1X3LA 2NSDA 2V5AA 2XUFA 2R1UA 2HMTA 4QLOA 1LC3A 1EFCA 2QX7A 1ISGA 2ZULA 1T4CA 1P0IA 4J3JA 4NV0A 4OHUA 3DE7X 3DDNA 3R76A 3ZZUA 3TUZC 1RIIA 4YECA 1G7RA 3QV2A 5A2GA 4YJGA 5HILA 3STVA 2LKDA 1B3RA 3QBDA 5HZGA 1OGIA 4AS3A 2QIPA 4I0WB 4P5DA 3L8YA 1HFJA 3DT6A 4F4FA 2XUPA 4JASB 1QIKA 1ZNQO 3QLVC 3NDBB 1V8FA 3CUKA 4MUAA 2F43B 4OMDA 4LFCB 3ABZA 4U4AA 3M34A 1PP4A 2HJHA 2ZRJA 1EDOA 3OJCA 2G0TA 3O2JA 1NR1A 4C6TA 4GXRA 3DMNA 3NHJA 1N3BA 4MW9A 4LGVA 1RJEA 3OQIA 4JUBA 1EVKA 2ENWA 3DXXA 3RYIA 5B4VA 5JYCA 2B3DA 2FPXA 3VKUA 2PX4A 3GRPA 1FFGA 2HQOA 1H8EA 3O84A 3TTTA 2B8TA 4F4JA 4C7VA 2XWBF 1P8JA 4MYDA 3DVSX 2MWMA 2GVNA 1AGYA 4DEYA 3H11B 1ZMOA 5FTKA 1BKSB 4XB2A 2AFHA 3IERA 3AYZB 1NUUA 3QW2A 2YN2A 3PXGA 1AHIA 1TKAA 3LA8A 2AC4A 1YA8A 4Q1VA 4RZ2A 1IN6A 5FWAA 2Y1WA 1YKSA 4RFVA 4XD2A 2V54A 2Q8NA 1FMJA 3MMNA 2GEDA 5A9TA 1FQKA 1SCNE 2FFHA 2IDKA 2H29A 3BRCA 3L06A 3N2KB 1SEVA 2ISCA 4KVGA 4RM2A 5B36A 4HYEA 3HM9A 4FGJA 5KVVA 2R11A 4CZ2A 4KZKA 3WRYC 5JH7A 1JHVA 5L3SB 1FX0B 3A0RB 1ST2A 4X8LA 3AVTA 4CHTA 3G2QA 4M1YA 1ZOSA 4DIDA 2ONKA 5IDVA 1H4QA 2H5IA 1Y6GA 1O3YA 1NVXQ 3PNSA 4G24A 4HQOA 4F11A 2AV6A 4B2PA 2WMNB 4RGVA 4JCCA 3F0TA 3KK0A 4K1XA 4Y67A 4QKQA 4YJ2A 2G6BA 2GARA 2OV8A 3M9XA 4FEGA 1J0CA 4G1CA 4MITA 3NH6A 3OIUA 2C4HA 3D7KA 2HDOA 5FOSA 2OXCA 2OSBA 3RSGA 2NUAA 1KPIA 3JR7A 3MHPA 3R44A 2NSJA 4O2RA 1EFVA 4ABYA 1R16A 4XRGA 4PIVA 4KPEC 2NZ2A 1ULUA 3SFZA 3FWYA 1PWZA 1DO0A 3IMEA 1N5OX 1HPLA 4MS3A 2DQYA 4QGFA 1GKLA 3SHFA 4CQLA 3PKZA 2D5CA 2C8VA 3PNQA 4P0PB 4LYEA 2C2YA 2GYYA 2HCRA 2P9GA 5DTQA 4Z0HO 4Q93A 1IPHA 3KC2A 1ZITA 4WNCA 2I1WA 5AP9A 3UAOA 3U7EB 1R9JA 1K2VN 3FUUA 4BMVA 5KDDA 1TM2A 3WL3A 1I6MA 4BQEA 2HMSA 4G4SO 1YOVA 5CT8A 1KU6A 4Q4DA 3RC8A 2PBZA 3KYIB 3VX4A 2IUUA 3DCYA 1SQSA 4YEDA 3MWKA 4DC0A 3IT1A 2VUUA 2YJ3A 3M4NA 4ZYLA 2VI5A 1JMKC 3IPAA 4II2A 3I9JA 2CV0A 3T1HB 3QJGA 3K0AA 5DWQA 3QX3A 5ABPA 3DV9A 3PFKA 3ZI0A 3CLTD 1BJKA 2JDIA 2PS0A 4JQOA 3T7EA 1RQRA 3Q7IA 4MR7A 3TOZA 2Q2OA 3DE2X 2D74A 2QMEA 4ZV9A 5IUKC 1SEPA 4C06A 2GZ3A 1S89A 1K3FA 1NI3A 1PX0A 3EDYA 3H9EO 4DRXB 2MYPA 4KV7A 4F5ZA 2LDXA 1P62B 3CV3A 1V1MB 4XSGA 5ALJA 4CG2A 1QS0A 4QXMA 3AVUA 3DT9A 1MG5A 5I9TA 2XQGA 2A2ZA 2ZJZA 4FOSA 1DX9A 3GA5A 3SD7A 4B5KA 4BAZA 1Q3HA 1U1EA 3GJ7A 4ALJA 3LHIA 1XL1A 2X9GA 3B48A 1ZINA 2QQFA 5A1TA 2A0YA 2ZE7A 5LQJA 5T64A 1FP6A 2W8BA 2RC5A 4KQXA 1J20A 2HIMA 1X9IA 5AM0A 10MHA 3IO5A 4E22A 4DSUA 4PGGA 3RFXA 7ADHA 1M1NB 3F1KA 2VUTA 1R0CA 2O8FB 2YZNA 3K35A 5E1OA 4B4VA 3AZPA 2Z8ZA 3R7BA 1LTHR 1WKCA 4PY2A 1HYQA 2Y99A 4CIBA 2J6BA 3FA2A 3W2IA 2FPIA 2WJHA 4A16A 1UJBA 3JYOA 5KTTA 3QU4A 4W5HA 1G3UA 2C29D 2JGDB 4Q18A 4IDBA 4MJ3A 2RGNC 4BNUA 1NBME 3SS8A 4KXNA 2OG1A 7ABPA 1NE7A 4QASA 4FBMA 2CZQA 1EFKA 4PXYA 2VNSA 3TBHA 1PFVA 4AX4A 5CFLA 1Z25A 4G63A 2FX5A 3SQOA 4JEHA 2AEEA 4WEOA 3KTAA 5IUNC 4Y30A 2QI9C 4F72A 3RVBA 5JZBA 1XU9A 4FJ0A 5KWJA 3JV7A 3A9TA 1TL7C 6REQA 2E1RA 3F67A 4TTJA 4Y2HA 3SYMA 1DC8A 1T34A 1I1OA 2VSYA 4ZAYA 1RQPA 3T5DA 1XZLA 1SVUA 1UPFA 2BCGY 1LBIA 4R01A 4BNKA 3PCXA 4NCKA 3WRWA 4K9SA 4FC6A 3QPCA 4OXNA 1GV1A 4JLSA 5LKAA 4XCXA 4PAWA 4LDAA 1E5DA 1V71A 1J4AA 1HT0A 1VXRA 5GAJA 3V97A 3DM9B 3UJ6A 4W63A 5DHUA 5LU8A 1D04A 4DWWA 5K0EA 3KOYA 3MWYW 3CC8A 5E8RA 4DEXA 4ZDIA 3GFBA 3KAQA 4V3BA 3ET5A 4HDAA 4YRIA 3GFVA 1AKNA 4QAQA 3L8HA 3GGSA 1G3QA 4ZI7A 2DPMA 4DCPA 1C8KA 2O4UX 3T9AA 1R7RA 1CJTC 2WJ4A 1R37A 1XLTC 3K9GA 1N77A 1WB4A 3ENWA 5BXYA 2XAAA 4ID3A 1Z4IA 1NRXA 1NVFA 2REQA 5EHZA 4DJDC 2X3UA 1V1RB 2G82A 4LZNA 1Z47A 1KI4A 1WQ4A 1PTJC 2AOWA 4P81A 5HGJA 3F3YA 2E4UA 1CJKC 3EARA 1N9ZA 2JK1A 2MMCA 3QHQA 3QI2A 5HGXA 1P2DA 5E2IA 4KN8A 3T54A 3GZJA 3CSSA 2AI2A 2W6OA 1RKVA 5D6OA 3ICQB 4PNZA 1F0NA 1NVEA 4PNPA 1BCRA 2EFDB 1D4FA 2WNSA 3AF4A 3AQ4A 4MVXA 4LMBA 3W0LB 5LA6B 5IJWA 1UKZA 1YQQA 1O5TA 2P5SA 1EWKA 5TJHA 2HLPA 2WT8A 5LXTB 4H6VA 2ZAGA 4BGUA 2ZOSA 5JYDA 1RQNA 4QL3A 4RHTA 2R1TA 4EYSA 2B1GA 5JY1A 4I1UA 1UPTA 2ZWMA 1L7DA 3B9QA 3EW7A 2QTVA 3L04A 1UBNA 3JRXA 5EMKA 5LP6A 1E5VA 1U0JA 1JDBC 4TRRA 1SVKA 3VUEA 1JPVA 2VF8A 3FCCA 3TO5A 3BXGA 5JXWA 2AC7A 5H9WA 4MYHA 1Z5WA 3X44A 1ISMA 3IAS6 3NHRA 4QFBA 3VM6A 2XNSA 4LJYA 1R9NA 1TVEA 1V41E 4M0KA 2W2KB 3AEZA 4XYBA 3LHKA 1KEVA 2OPBA 4JLBA 4MR7B 1EH5A 2O6LA 5DX0A 2PNJA 3N0VA 3GZNB 5HKKA 4GD3Q 1VHTA 2M32A 2ZSIA 1HH4A 2E3JA 3S28A 2XWPA 4D92A 4MWEA 4ZICA 3K9FC 4DMHA 2DECA 2P7IA 4FXOA 4RJKA 1HLGA 4LHZA 1TUEA 1C29B 3A2MA 2NTNA 4PV7A 2WICA 1ECGA 2X76A 1E92A 1YZUA 3P52A 4KQ9A 4Q3OA 4G84A 1TT5B 4DRYA 2PRJA 1YQXA 1M8JA 5JSFA 4XM0A 4PRLA 1NMSA 4EI2A 1G21B 3EGDB 2J6IA 1VXOA 1JQLB 4HH4A 5HM6A 2B98A 3QHAA 3ZCVA 3VJLA 1UOPA 4BDSA 4QXAA 1P3Y1 2ZTHA 1DWUA 4RACA 1ZQ1A 1G5TA 2C9BA 3MOIA 1IJBA 1NSFA 3F7MA 1NBOA 2OZVA 4DA6A 2OUIA 2O8EA 4Y6LA 1VJGA 3P96A 3RLFA 3IUPA 1C41A 5C18A 4UHDA 2D0OB 1GN8A 2VHZA 4X85A 2UU9B 2PRSA 1FLDA 1L6IA 3N2KA 3IDFA 4PQYA 3FMFA 2Q4OA 3GW8A 4Q3AA 4Q4JB 3GLHE 3QFRA 3PC3A 3D2BA 4A6XA 1JQKA 2HSGA 3FD8A 2FLVA 2I6SA 1LTQA 3TIVA 5CA0F 3EK2A 2IHZA 3HZOA 2CNLA 4IBOA 1DIOB 4OJKA 1A97A 2OFOA 2UV8A 2FSSA 4BOYA 2F3UA 3WLKX 1CE8B 3F73A 3WIBA 2O7RA 1NFFA 1X74A 1MNAA 3DTVD 1SZCA 3TOCA 2FWNA 1Z2AA 2Y1LA 3LL4A 1QG4A 3TVTA 1AKEA 4EFKA 2VF4X 4JJ6A 4OMCA 3ZDBA 3AY3A 4MV9A 1RYNA 1Q7EA 4G0PA 5AJHA 2DCUA 4W9MC 1HDYA 2ANBA 4MUKA 2AYXA 4QOEA 3O9MA 1Y6RA 2YZKA 4LV6A 4XJXA 5K0SA 1FBNA 4JGGA 1CQXA 1KAOA 3GGJA 2GN1A 2ZZMA 1UKVY 3J81k 1E6LA 3TLZA 2YIJA 4Y18A 5CGZA 4NQRA 4QYXA 2O2SA 3LIIA 4WE3A 2J3HA 3GDWA 1P39A 1TD9A 4TYMA 5KVAA 1DC6A 1KYVA 2IHTA 3G13A 1G2OA 2AMJA 2E18A 3IQZA 1EJ6A 3Q41A 4TV8A 3OF3A 5I4IA 1H9AA 4WJKB 2IUYA 3ERCA 2JFGA 3L7LA 5AK3A 3BHMA 4OVKA 4EECA 1J8MF 5IPFA 5JMOA 1Q19A 5L7WA 3GZTB 3HI4A 2IYAA 4UD2A 2J0SA 4WXPA 3W9UA 1PYOA 4V2UA 1QHNA 1R6AA 3WKDA 4LGYA 5KINB 5KKNB 1V2HE 1J07A 4G1FA 3VUFA 5HIKA 1FP4B 1Q20A 4RD6A 2L69A 1H3EA 3COSA 1WP9A 2EQAA 1IN4A 3EZLA 4BV3A 2AK2A 4CIDA 1E2DA 2BWJA 1Q1BA 4OFZA 1V5WA 4K9RA 4ZI2A 3SPXA 1QGUB 2X19A 3GG2A 4HZIA 5DEOA 5KMGA 4MUXA 1LXCA 1W6UA 3G5AA 2F3TA 4JGIA 4PGAA 4Q00A 1UK8A 1LEHA 4Z7NB 4DLWA 4H9GA 5LXTA 3LKZA 1HDIA 2BJHA 3CH7A 3JXEA 3IILA 4NU5A 4PFQA 4MI6A 2R1TB 4RJIA 1SPBS 5ALNA 5ENZA 4ZGBA 1E32A 2BR5A 1ARZA 1Z74A 2JLAA 3HKCA 4DXHA 3RIGA 1F9EA 4DRXA 4I4TA 3OCUA 1WQ1R 4HQRA 3TKAA 2BFEA 2FPGB 4FFDA 4BNGA 2ZR9A 5FULA 1ZCZA 3PTZA 4QT0A 1YB6A 1QUFA 3TLCA 2KBEA 3UUFA 1WDLA 1CJMA 2BM8A 5C4IA 1M2WA 1O03A 5TR9A 5CVJA 1XMQB 4UQLA 1R10A 4MVWA 1ZK4A 3HUEA 3ZLTA 3EBPA 2PD6A 3VTZA 4AMYA 1HDXA 4F4DA 2YN0A 1KYQA 3DR5A 3ROZA 5J5VA 4C4ZA 2Q3CA 5CFPA 2IHNA 1CDZA 2PPVA 4X66B 1FS4A 1MOZA 3H9CA 3NGXA 4MMXB 5DHSA 5KJEA 4K05A 2Z2JA 4QRDA 3SBOA 4DLPA 2EFHB 4KFCA 3PUIA 5EP2A 4IDFA 3TMKA 5FLXA 3W8RA 2IVFA 4K0RA 4XE5A 4GKJB 3PG5A 2QXYA 5J63A 3S40A 1YTUA 3OKPA 2NLOA 5L9AA 1T15A 2JGDA 3IVCA 3LA6A 2P9JA 2F1JA 3FHOA 1OD6A 2QVGA 5A9RA 2YDXA 4BMOB 4X1YA 3A70A 5A4DA 1W96A 4YJGB 4O3FA 1LUAA 3DL4A 5IRCD 2FPLA 2OLKA 3M2PA 1G6KA 5EPEA 1A8IA 5FHQA 1KEUA 2C4KA 4BVFA 4G9EA 4HF7A 3SVLA 5IJ9B 2NGRA 1FB5A 2SKDA 2P0YA 2ZAOA 1ESMA 4WOCA 1PDOA 4RKQA 3U26A 4EH1A 4HLUA 3FCOA 3M4YA 1N32B 2X41A 3A6PC 5ARCA 5HKBA 1F7UA 4F7WA 3ZDEA 4OD0A 5CDGA 3CZCA 1E94E 1JFSA 3GRCA 3D3EA 4FX5A 1RC0A 1QBGA 1ZAKA 3ASUA 3IQFA 5DXAA 1GPJA 4ZYYA 1U5CA 4Q3KA 2D1FA 2FWJA 3C4VA 4AWBA 2JI7A 3K4PA 1NDHA 1YBHA 1N9KA 5DBFA 2ZVPX 2V6BA 4HQKA 3LGSA 2BELA 2D06A 3KZVA 4BX8A 2JIMA 4ZI7F 2HQRA 4PQRA 3HVIA 1O5OA 4J8PA 1CR2A 4F1JA 2BI8A 4N8EA 3ICEA 5BPHA 2ECQA 3FBGA 4HPWA 4PC7A 1AE1A 3RJ5A 3ZJ4A 1JSLA 2QGNA 4MHOA 1O4VA 1XZMA 1KAQA 2M98A 1HDZA 2HJSA 2YFKA 4N3NA 2GI4A 3OIGA 2B4QA 4YK7A 1K9VF 1NXSA 3ONFA 1L1FA 3ZQ4A 1H5UA 3EVCA 5CXSA 3SQDA 5CYPA 4BP8A 4BQQA 1IXSB 4V3CA 3I2YX 2ZIGA 1EWRA 1GR0A 5C8YB 3EFEA 5HRCA 2HGZA 3KL4A 4JR2A 4UDOA 2RHLA 2Q2NA 4IFBA 2IXFA 2WC1A 4WRRA 4EPWA 3K1YA 4G5HA 5FOWA 3JRWA 1KHHA 3NB0A 1P81A 2QZ9A 4FGKA 3KDAA 5CNJA 2SCUB 3MILA 1Z2NX 5EWLB 1TYDE 3GX1A 5DNUA 1ZGGA 2FXVA 1W46A 2WBLC 2Z08A 3FI0A 2JF0A 4II3A 2CHFA 2WHPB 1CXZA 1PHRA 5J47A 1EPUA 2VYND 3M6IA 1FU7A 3MMZA 4NENB 4EUFA 4LF5B 5FTNA 2PN1A 3KKQA 3QF4B 4II7A 1KU0A 5MFPA 2V4UA 1ZY2A 2ADFA 4ZVOA 2EG5A 3T35A 4CIWA 4HDCA 1KO7A 1KIAA 3I01M 3P9XA 2I33A 3E2PA 4OUDA 4QD3A 4URZR 1OIXA 3UF0A 2WWTA 2Y0DA 3EWNA 1G4HA 4Q3EA 2O8VA 3DVAA 4J1QA 3I1FA 4BO0A 4CNBA 2W98A 1SU6A 3BHJA 1L4LA 1NRIA 4FX2A 3DNMA 2W6JA 3IYLW 4CETA 1GRVA 1PVOA 2NMVA 1FSFA 2HRQA 4NBTA 4P83A 5F5NA 4DE5A 3AVXA 1R6BX 1VRWA 2OO5C 2A0KA 4KU4A 3ADBA 3DKPA 1Q17A 2A84A 3K32A 5LDGA 2P6UA 1GNPA 5JBNA 5K01A 4RLSA 2FAXA 3HKDA 4XWOA 2JZCA 2C96A 3V2IA 3ZEIA 4RD1A 5DSZA 2PM8A 5B58T 1GADO 3TDNA 2BLNA 2JAPA 2V65A 4GPTA 4DMUB 1K1EA 2HQSA 3EGXB 2Q6OA 1C1DB 2V7TA 4DY6A 1P31A 1BTOA 1KS9A 1ORDA 3MIZA 3K6RA 2OG2A 2XDAA 4E70A 3HBJA 4I9UA 5TSDA 1GA4A 1K5PA 4GYYA 4UEKA 5IF9A 2G9VA 3UUEA 3LQ4A 1KJ9A 4Q05A 3K5WA 3QLJA 5H70A 3TRKA 1UAAA 5TE9A 1F0PA 3FR7A 4MO2A 2BEWB 1HXHA 4ZEOA 3KFVA 4AF7A 4ARZB 4Z4IA 3WLOA 4A8PA 4DCGA 5IK2A 1JEEA 5TLSA 5JI2E 1ZN9A 3DF9A 4XFJA 4K6GA 1C3VA 3AVYA 3NHWA 5EQFA 2QW1A 3F8TA 3AM1A 2XW6A 3D8SA 4RANA 1AQ6A 3AR5A 1Q0ZA 3O9VA 3TE6A 3HJTA 4TUYA 1CZKA 3L43A 3MRXA 3DLIA 3COJA 1WUIS 2J5RA 1KDOA 3M83A 3OZBA 2Z43A 4ZZ2A 3FGOA 2HLNA 3EGEA 5GOTA 2Y93A 1L6RA 3ZV4A 2JD2A 4X3PA 3C3AA 4ASUA 2JFPA 5E3HA 4Q19A 3W7BA 4C5AA 3GT3A 1H65A 5TF0A 4GICA 5JARA 4PHCA 4H7KA 4PTLA 5THKA 5JW6A 5GADl 4YUWA 1ZM2A 1GDHA 4EKEA 1TJ5A 5FT9A 1YUMA 2Q5HA 4JKOA 1XLVA 1K2WA 4KG7A 3HQ4O 4OO3A 2FPIB 3O2NA 3OC6A 4HR7A 5LMZA 2R0QC 3UT5B 5DTRA 1P4JA 1TO1E 2R00A 4UTVA 2EWVA 3AETA 2GZAA 3H3FA 1JKJB 1BCSA 3SBEA 4WK0B 3WADA 4GRDA 3KLOA 4NC9A 1MQAA 3L93A 1K3UB 1VSTA 3PS9A 4E03A 4CG1A 1Q2UA 3R0VA 2NXWA 3QPWA 2WYHA 3WV5A 1D5WA 4A0HA 4YRBA 1W73A 5A04A 1TAHA 2HJRA 3AUFA 3RM3A 4QUJA 4X65B 1JJBA 4EOGA 1IIRA 1Q0LA 1UKEA 2PYDA 3KJEA 1Z3CA 2O5RA 3RRFA 3E3AA 1OVMA 4BNDA 1E6KA 1AKYA 3NNDA 3EF0A 4P3YA 2NG1A 4TLBA 5CTAA 4K28A 1OLSB 2XB4A 4WUTA 1KRHA 3IOBA 3NH9A 3NX4A 4W4TA 1O57A 4IJMA 1TW2A 2UAGA 5A7HA 1GAXA 3BQNB 2QUZA 1SIWA 1A8SA 3NV7A 2HO5A 2R47A 3UB3A 2QLNA 1I6WA 2O7SA 3EJWA 3GJ4A 3QM1A 2AFRA 5DGHA 3VSBA 2IYVA 3CXRA 3T6KA 1YUNA 3TLGB 4JI7B 1N6LA 1ZC4A 1PJRA 1R8YA 2YWRA 1UPBA 2ZP1A 4RQAA 5IN5A 1TB4A 2VK2A 2Z1DA 4FDTA 1U9IA 3RIHA 1ZUNB 1BVUA 4EY6A 4B6OA 1FNBA 4QJ4A 2V1UA 5TPZA 4KFRA 1THTA 3LC0A 5E1MA 3VMMA 5BOSB 4C14A 5LUBA 4L9RA 5TS3A 1OZGA 2M6KA 1S9HA 3PDUA 1V45E 4LX8A 4QODA 1TQ2A 3LDHA 3BZWA 3OLYA 2GLTA 1PGPA 2OHJA 4AMVA 2VBCA 3EIHA 3ZV6A 5AI4A 1YHNA 3FGZA 1Y33E 2YJTD 2QJFA 1N6OA 1IXZA 1OSNA 2EKPA 3JARB 2Z6AA 1SBCA 1EMDA 4AG5A 4RTLA 4AKIA 1KBZA 1FFXA 3CVVA 5LQUA 3FPGA 2WF7A 1IBMB 4F93B 1XMSA 1SKYB 5ER9A 4EFDA 1U2EA 1MOSA 3AXSA 1BHSA 1FFHA 3GMTA 3GY0A 3IP6A 4P0TA 3VR0A 3K6SB 4TWIA 3I76A 4G8JA 3C5EA 3TW4A 3W3AD 1RHQA 3H86A 1JLLB 4C3OB 1TUBA 2O7NA 3SF8B 4BVGA 4U7JA 3U1BA 3UWKA 2GFQA 3ROFA 2RHDA 1I5OA 2LV8A 2I3DA 3GCZA 3O3OB 3PHBE 4H3KB 1C1XA 3I28A 4ZOBA 5LLTA 2VZEA 1AS2A 1ZJYA 3ENQA 2LWIA 1YS4A 2OBXA 2J48A 1P5FA 1OX4B 1PT9A 1UPCA 3MCWA 4B0PA 4UCFA 2KJQA 4HDMA 2PUTA 2C1XA 3GZNA 2BGIA 3WB1A 3ZHVA 3VYRB 5JV5A 5DTJA 3H9JA 3AF3A 2YZMA 3ZS8A 1LV7A 1SZPA 1W5BA 1V3VA 2ZT7A 3Q3GE 5KYWA 2FW1A 3T1QA 3N2GA 1ESCA 2P9QA 3TQOA 1EQ2A 4HNUA 2AFIB 3NQ41 3E48A 3EEQA 1ZFNA 3LYAA 4XDHA 3GRRA 3MSCA 4PO1A 4AFNA 4DTIA 4QUBA 4F86A 5JU6A 4CCWA 1NMQA 4NFLA 3BTSA 2NSHA 3PQDA 4HNTA 2GO1A 3G8AA 1V2GA 4MAFA 1G1MA 1TQ6A 3H99A 1DO8A 3IP9A 4K8RB 4ER3A 4EVRA 2R6R1 2WJGA 4P32A 1U0GA 3JZMA 1AB6A 3SC3A 3HCRA 3FZEA 4YB8A 1YZNA 3E3NA 3GEBA 4DBZA 4GZ5A 1XPUA 3OPYB 3Q3HA 3ZH2A 5B7PA 5CX1A 4GS5A 3EBOA 3JALA 4ZDKA 1QIDA 3FFBA 3IRUA 1FNSA 2CFSA 1QRTA 3LUFA 4Q12A 3SDZA 1EUQA 1RLJA 1GILA 3NYWA 4BQSA 4P4SB 1E1DA 2OKGA 1UFKA 2CSXA 4D1YA 2F3PA 1WW3A 2CXRA 2TYSB 1ZIDA 3DW1X 4YT5A 4Q4JA 4RX1A 5H0IA 4LWQA 1O95C 2OV1A 4UVDA 5HUJA 1LLUA 3B1VA 5CM9C 5LIPA 2VDLB 4H6PA 1HA3A 4IDEA 4XRRA 2XQJA 3TXAA 4YV1A 1NBEA 2ZIZA 3BJZA 1EYZA 1NYLA 3PPYA 4NABA 1P74A 2DKOA 1N2CA 3AV3A 2J6HA 5BPFA 4M9RA 4E31A 3HYRA 1CDDA 1ZK1A 1R0SA 3GDFA 3KZMA 4MAMA 4WNIA 3U1TA 3V1KA 2QTZA 4IO1A 3R4CA 5LPNA 3VC3A 2XJ9A 3KQMA 1P2GA 4CI9A 5H02A 4QAJA 4XUEA 2NPFA 5EN4A 1NZJA 1DP4A 4JC8A 1JS1X 2VSQA 4DNOA 1GQSA 1YJ8A 2MSKA 2Q7XA 1V9LA 3IAHA 1VL6A 2ZB3A 1QE5A 3DQZA 3RROA 1A76A 2H57A 3FDFA 1BXRA 3K0SA 4RYLA 5BSKA 1OZ0A 1YVUA 3A6JA 4XIIA 1PGOA 1MEOA 5LMUB 5BV8A 1T0IA 5KNBD 2DB3A 4RORA 4GPBA 1UMDB 5HF9A 2IEAA 4HLDA 9LDTA 5KSWB 2EHDA 4DCMA 3NJ4A 4G36A 4HMQA 4X20A 4O1IA 3L0SA 2IHVA 5AKZA 4FILA 4P54A 3P2IA 2BKEA 2Z4TA 3O93A 1F4LA 3IDZA 3WLEA 2KX7A 1CQJA 1MQ9A 2FSVC 2E87A 3FTNA 2O2CA 2JD1A 221PA 3G2IA 4IZ6A 1KNXA 3MGKA 4IL5A 3ZTTA 4LC0A 5KU1A 1GQYA 3W8DA 1OYYA 3B6KA 5D7NA 3L7OA 4Y7DA 5MFZA 5F3DA 2II6A 4CE6A 4ZZ0A 3KOMA 5JI3E 4HNHA 2GB4A 1TFRA 3AZQA 4IDOA 4Y9SA 4RQUA 5CFNA 1K86A 5ESXA 1TEVA 5KTSA 4J0JA 4PC1A 3GVCA 4QBKA 5IP5A 3GLGB 3AHCA 3S29A 4KIGA 3K8QA 5CIQA 5CB4A 4B1FA 3EFOB 2HTFA 2VTDA 4B17A 1IM2A 4KXLA 4R9VA 4NBUA 1JDUA 2ASVA 1XZNA 2D59A 1P1BA 3QEKA 4X71A 3G9UA 3T1OA 4KQJA 3ORFA 3QMMA 3A4TA 5CH8A 4J4BA 2XEXA 4NONA 2ZQYA 5ITZA 1XMJA 2QU7A 1UANA 3GOQA 3JQ9C 3ZNOA 5ANRB 1QFSA 1XQ1A 3AG6A 4JVLA 4F2WA 3V6MA 1Y3IA 3JQFC 1LFAA 1O87A 3KQLA 4C04A 4BYMA 3PC6A 2I78A 4AUKA 3RJTA 4O33A 2I66A 2XUZA 2ZJ8A 2PH5A 3KDSE 4LDZA 4C5BA 1AKVA 3KR9A 4N1AA 8LDHA 2GBGA 3CRVA 3DHWC 4D42A 3PFIA 2WHQA 3BIJA 1L4GA 4YQFA 5IC4A 1T6BY 1ONOA 2WV7A 3MWLA 3QOFA 3UJDA 1C4KA 3OY7A 5HIMA 3RVJA 4ZVQA 1DRKA 1XLUA 4ERXA 3SJUA 3I4CA 4HSGA 1S02A 1YVEI 1KDPA 4Q5IA 4CM1A 1FUKA 2RGCA 2ZYDA 5K4GA 5LD2B 1S3SA 4HEJA 5DGCA 3E7PA 3EYWA 2CWWA 2ODEA 3CLHA 3ZE0B 1CQIA 2BFDB 4LJAA 2EJWA 2PMFA 4R16A 4ZHQF 3LK6A 5KHLB 4M8SA 1GTZA 1NUPA 3I45A 3PQFA 1J1UA 3R8CA 5KYYB 2QVYX 3DTTA 4HQNA 1KAMA 2AJTA 3K5IA 3U7QA 2QZSA 5DLPA 3AZOA 3IUNA 1U2GA 4OA8A 4AYXA 2ORED 1E2NA 2ETXA 4OP1A 3OOHA 1I2DA 1H69A 2BFOA 3SR3A 1WSDA 4FDVA 3CRNA 2H1CA 2HIHA 2QQGA 4J0KA 2ZJBA 4C03A 2NO6A 2SICE 2IH4A 1E1RD 2WSLA 4GG1A 4MVJG 2D8AA 3LWDA 2C5HA 3VKVA 1K4MA 4KMOA 1P2UA 2CVFA 3BILA 5AW1A 2ZXUA 3PFBA 2HXYA 4WY2A 2WP0A 2HQ1A 2GS9A 3RAEC 1ZMRA 5SY4A 2FMHA 2WHYA 2ZW9A 5EIBC 3U17A 3OQBA 4NYMQ 4LHXA 1I5EA 3TW6A 5F23A 2RHHA 4QPNA 1XBTA 4H18A 4UAJA 3N6VA 2IH5A 2JLUA 1EZZA 2XDYA 4AULA 2AG0A 1C14A 1VHJA 1OXMA 2QE6A 3Q1LA 4U7GA 4P0QB 2AI3A 1XPJA 2W00A 1Z0AA 3CF6R 4X7BA 2WYIA 6LDHA 3C5CA 5AJUA 5SY9A 3JYHA 2P3QA 2ESRA 2H0QA 4LBVA 4JB0A 1XKLA 1GZ3A 3EIXA 2JLXA 5KSZA 4PANA 3V00A 3AEUA 4ISCA 3KDPA 1EINA 2E49A 5T57A 3MGGA 5JDCA 1Y9AA 2JKZA 1JAHA 2OHXA 3L0OA 3LPNA 2FFBA 1C1XB 4GSLA 4OJYA 5INTA 3EGCA 1Z13A 3NBMA 1K7YA 5EIHA 5E7JA 4CT0A 3HP7A 3IIKA 4I1RA 4W5OA 2C5AA 2VHEA 1DT5A 3EXFA 1ISJA 3P0FA 2G76A 2VKQA 1NM5A 2SKEA 4LBWA 3RS9A 4NLLA 3K05A 2JZOA 1DKNA 2KMLA 1JG2A 1CY0A 4QECA 2VK8A 5K3SA 4D56A 4MI3A 1GSHA 1JYSA 2OK7A 1E2GA 1RWNA 2HA5A 2VJCA 3GB9A 3L7AA 3VJKA 5HUHA 3T4EA 1I51A 5ALYA 1W1UA 4D9NA 4IHAA 4FGZA 3GLGA 2I2AA 3DEJA 4KTVE 3G1WA 4PPFA 2MYTA 1AF4A 4PG7A 4BEJA 5HMMA 1PGNA 1NKVA 5C5EA 4MV1A 1T2FA 3TBFA 4P80A 3ZUGA 4RHUA 2OYCA 1JR2A 3U60B 2JFNA 2FEPA 4ESHA 5JQGB 3K96A 4F04A 1E9VA 4RTPA 3F90A 1C0EA 3MT8A 4H4EA 1G8JA 3IAAA 1Q2XA 3NWOA 3Q8XB 4LGMA 3JPWA 2V7WA 5ENVA 4JOBA 3GQBA 1GPBA 2EERA 2X86A 4ND4A 3SZ3A 1B8NA 5KC9A 4IXWA 1NX6A 5CYOA 4GYWA 3ZU2A 4OHBA 1KOJA 2E9SA 2YYYA 3NIFB 5F51A 2LGJA 4BIMA 2YUTA 3WIUA 5HX7A 2JIZA 3IV9A 4Z1OA 2WWXA 2H5LA 1V9SA 1IHUA 3KVYA 2H4HA 2BGRA 3FVVA 2H1HA 1M83A 3ACCA 1J56A 1LK5A 1RLOA 2QRJA 5AW5A 3DBLA 5AHKA 3MFYA 2O20A 1S8NA 2X6QA 3E5HA 5LBTA 3ANSA 2PZEA 2WPDA 4MAAA 4PTYA 3B1KA 3BMCB 2WFLB 3ANYB 5H8WA 5DZSA 4BVEA 2PUCA 1ZU4A 2POQX 2QX4A 5EE1A 3E5MA 3E9CA 4HDMB 3CEAA 2JHCA 3NWJA 1DB3A 4Q3LA 1JX6A 1TC2A 3RVMA 1QPGA 1YR8A 4EA6A 5B12A 4HGYA 6REQB 2JGNA 2YHBA 5IYZF 1MO4A 2V3WA 3FYUC 3O4FA 3ABIA 3SMVA 4RDHA 3CEPB 3QLTA 4N6GA 2HYDA 3MTGA 3WGJA 3DDUA 3JQBA 2QMYA 2W6MA 5AKHA 1F2TB 4FPXA 4PZ0A 3T3OA 1E3WB 5D3KA 1CBUA 1YGPA 2R8PA 4W7IA 1XZPA 5G02A 3U4DA 4BX0A 3AW8A 1AXGA 2W8BB 3CWCA 3TEFA 5HE8A 5C1IA 3H11A 5I7RA 1RVV1 4Q7KA 3P97A 1XL0A 1X77A 3ZE8A 4JLUA 2F8MA 4O2BB 3FFAA 4M9CA 4MIKA 2FMTA 2G8NA 3GNTA 3B7GA 5EKDA 1EQAA 5ECGC 3UPDA 2CEAA 2ZIXA 3U3JA 3DE3X 4FR2A 4WLFA 1W7AA 4MUBA 1UBMS 4RV5A 2WWHA 3A8TA 1G20B 5C8DA 3GYGA 1IQ0A 3GRAA 3QVJA 4BGEA 1FRZA 1NV8A 4KNVA 4UNIA 2PS9A 4LZOA 3ZQKA 2W6ID 3QKWA 2RBKA 1JQ3A 2WZDA 3IPLA 1XDZA 2QQEA 2ZS8A 3MMPA 4LZJA 4P4LA 1C9NA 2AC2A 1CRWG 2K2WA 2J0EA 3A11A 4HXFB 4JUIA 2FPPA 4NFSA 1NXTA 2GYUA 2QB5A 4WNAA 4WZBA 5HCUA 3RHZA 1ELOA 2GTHA 2GZHA 2HFJA 1JFFB 1V8OA 3M6LA 1P5JA 3F7NA 2R5WA 4P9NA 5B2ZA 1W4RA 1NLUA 4LY6A 3HCCA 2CF6A 1K88A 3E61A 4JZYA 4PBTA 1PK8A 4S12A 4TV9B 4AY4A 4EG3A 1KJNA 4KK4A 4QEKA 2LIVA 2GCOA 3QA3E 4GVLA 3RS0A 2HA6A 4MW1A 3EXEB 4NEHB 4L6IA 2PSHA 3QPAA 5TJ9A 4CM3A 3HBMA 2HV8A 4P7JA 1DARA 3B7PA 2PVSA 3IJRA 3BIWA 2ID7A 1P0MA 2F59A 1BDHA 1P60A 4DFDA 1U98A 1N0VC 5IBQA 3ZY3A 3EBLA 3ENKA 4ZEXA 3ZDAA 3D5TA 1FDVA 1HDCA 3ZYZA 1JR6A 3JVDA 3OMWA 2WB2A 1Q1QA 3GT7A 5HIAA 5AOCA 1X1DA 2Q3EA 1YULA 2XA2A 4M7OA 2JFYA 5DNWA 4ENRA 2YXPX 3GD7A 1J7KA 2A14A 1FFCA 1AKRA 2PKRA 2XZPA 4N6OA 4NAUA 5ALMA 2AQKA 3T0GA 1N1DA 4TVBA 1UKBA 2FMFA 3U4MA 1B93A 4QU8A 2UUPA 1QRAA 4OBBA 1JU4A 3IRVA 1QUEA 4UARA 4BLOA 3ZDXB 1NBIA 1JWLA 1H94A 2WVHA 4ZK6A 1NBMD 3EAFA 1FL9A 1MRNA 4V0QA 3E22A 1U5BA 2GJ9A 4AJJA 1KQOA 9GPBA 5D3QA 1NXOA 1XALA 4H60A 2LCQA 2YHAA 4OK6A 4RKFA 1T1SA 2QI9F 2GHIA 2B8WA 5KX5B 3IMKA 5AVTA 3L9XA 4Q1FA 4BQIA 1GQ2A 4MRNA 1CUJA 4ZYWA 2AFIA 2C4UA 5LP6F 4DR3B 2DLCX 1YBFA 1YBVA 3CHYA 3PUJA 3VAAA 2NAFA 1SUAA 1ACMA 1PZFA 4QEZA 4EG6A 3MJHA 1SKBA 1T9KA 3GFQA 3QE4A 4A5OA 2RARA 3B38A 2C9YA 4UE3S 4HDRA 1TPYA 4LYHA 1A71A 1FW8A 2FUG6 2TECE 2Z30A 4QXRA 1Z17A 1J8DA 1GGJA 2H92A 2WAYA 4J7XA 4OJMX 4QQNA 3UWMA 2WW8A 3FJOA 5BUSA 3U61B 1AHHA 2VXBA 4IMIB 1P1HA 3D6AA 2UZ1A 1I5RA 1Y3HA 4IQFA 4N49A 2PJRA 4BFVA 2CL7X 1SBNE 3FCUB 4F2HA 4HEA6 3ZC3A 3OCCA 5CG1A 2WZBA 1J2EA 1USVA 3CXUA 4CCAA 2VNIA 3G85A 2N0SA 1PJAA 5FPHA 4I6EA 4CF4A 3K2BA 4DR4B 3PXCX 1HORA 3H65A 4JFAA 2XCLA 4BATA 2O23A 4YT8A 2HN9A 4X6YA 1G6HA 3NC1C 3QVMA 1J00A