2V5VA

W57e flavodoxin from anabaena
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
169
Chain Sequence
AKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTENIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Tuning of the Fmn Binding and Oxido-Reduction Properties by Neighboring Side Chains in Anabaena Flavodoxin.
pubmed doi rcsb
source organism Anabaena sp.
total genus 60
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2v5vA00
3ES9A 3W77A 1AMOA 4QOGA 4H6PA 4GQIA 2Z9BA 1ZX1A 1KBQA 3NHKA 3EYWA 4U7FA 3KAPA 1JA1A 3N3AC 1C7FA 1J9EA 3U7RA 2V5UA 1T5BA 4QOIA 2BZSA 2N1MA 3TE7A 2FX2A 4ICIA 2XODA 4ZVKA 3F6RA 1CZOA 1H69A 5EAIA 5B3LA 4BMOB 3GFSA 1FLVA 2OHHA 4BMPB 1AKQA 1C7EA 2QX4A 2FOXA 1FUEA 5NULA 1OFVA 1QBGA 4C14A 2MOKA 5A4KA 1F4PA 1E5DA 1D03A 1KBOA 1GG5A 1BVYF 3F90A 3HLYA 1AKVA 1DXQA 1AKUA 2QMZA 5JROA 1ZWKA 5BUCA 1AZLA 3G5MA 1XT6A 1YCFA 3L9WA 2HNAA 2FVXA 3D7NA 2FDXA 4CETA 4N65A 2M6RA 3NHJA 1CZKA 2FLVA 3JSXA 3OX2A 1CZLA 4YQEA 3N39C 1TIKA 1YKGA 5NLLA 4QOEA 1B1CA 2FCRA 2QX9A 4XDGA 3NHRA 4FGLA 3B6MA 2BPOA 2W5UA 3NLLA 3KEGA 4C0WA 3OX1A 4LTDA 2R97A 3FVWA 2FZ5A 2BMVA 3OWHA 2HNBA 1FLAA 1VMEA 5FX2A 3FX2A 1YCHA 2RG1A 4DY4A 4N82A 3GAMA 3NHLA 1T0IA 2KQUA 2R96A 3NHYA 3P0RA 2Q9UA 4YAFA 3FW1A 1CZRA 2GSWA 5LLDA 2QX6A 2QMYA 2BF4A 1CZUA 3ESXA 4PU0A 3K20A 1AKWA 2FAXA 3KLBA 1XYYA 2WC1A 4F8YA 3QFRA 3F2VA 3TEMA 1D4AA 1AKRA 4Y9RA 1DX9A 3O73A 4OXXA 4Y9UA 3NHPA 2V5VA 1XYVA 4M0CA 4FGJA 1AHNA 4LTMA 4YALA 3OJXA 3OJWA 5LMCA 4U7HA 3GFRA 5F12A 4GI5A 4QOFA 1ZWLA 3NHUA 5LJLA 3W79A 4LA4A 4YAUA 3TZBA 5ULLA 1FLDA 4NLLA 1J9GA 2Q62A 3LT5A 3S2YA 5F4BA 4Y7CA 1AG9A 1AKTA 4QOHA 4DIKA 1RTTA 3FJOA 2ZKIA 2MT9A 4ZVNA 4D02A 3HR4A 3NHSA 4QOJA 2MWMA 3F6SA 4ZVLA 3NHWA 5EMNA 2Z98A 4N9QA 3R6WA 3NHFA 2A5LA 2B3DA 1WSBA 4ZVMA 4PTYA 3QFCA 3OVMA 5F51A 4YAOA 4PTZA 1TLLA 5FA6A 2Z9CA 1JA0A 4FGKA 4GR9A 1H66A 3OWXA 2HPVA 1I1OA 2BN4A 2D5IA 1FTGA 1XI2A 5FUQA 1RCFA 1NNI1 4J8PA 2QR2A 1V4BA 3L9XA 2X2OA 1QR2A 3EDOA 2V9CA 2F1OA 3N3BC 1WSWA 1SQSA 3B6IA 1DXOA 2OHJA 2OHIA 3GFQA 4U7GA 3UXEA 1OBVA 3OX3A 4CF6A 5EA2A 3UXHA 4HEQA 3W7AA 2OYSA 3FNIA 4NULA 4LTNA 5LJIA 5LBUA 2Z9DA 5B3KA 3QE2A 1FX1A 1SG0A 1FVXA 3U7IA 3RPEA 3B6KA 1CZNA 4ESEA 6NULA 4R81A 1YDGA 1FLNA 2QX8A 4XDHA 2KLBA 1QRDA 1YCGA 5TGZA 5LBTA 1CZHA 1QHEA 3LCMA 5LVAA 1BU5A 4C76A 4FX2A 3HA2A 2XOEA 3SVLA 3B6JA 2AMJA 2ARKA 4YAWA 3ZHOA 3KAQA 2M6SA 3K1YA 4S24A 1YOBA 2MTBA 1RLIA 2QWXA 4HS4A 3NFRA 2FZVA 1D04A 3W78A 3O2NA 3ESYA 1RLJA 1J9ZA 4QODA 1OBOA 4DILA 2X2PA 1X77A 4C0XA 4LAFA 1J8QA 3ESZA 4H2DA 1YRHA
chains in the Genus database with same CATH superfamily
1MT0A 3ISTA 4PRYA 4MP3A 3M1IA 1KKLA 1AE1A 1N2HA 1Z7WA 1QZTA 2X5NA 4GOOD 1F60A 5D00A 3S27A 5KTSA 3IEPA 1R1DA 4IHQA 2E5LB 1XKXA 3NH9A 4WESA 1R10A 5DEOA 2O8FB 3QEMA 3DXYA 4ARCA 4C7OA 5FTNA 3MJDA 4R0MA 1T9BA 4W7IA 4XPIB 5DGIA 1M66A 1CJSA 2GDZA 1Q15A 3KZ1E 1JZSA 1E4EA 1N6HA 3ET4A 1CUFA 5I5GA 2ICAA 4NEGA 4UC0A 2ODTX 3GO4A 2E7ZA 1XTZA 3WSTA 4CMEA 4IZOA 3UNXA 5G4KB 1Z6YA 2FLKA 2RHLA 1BXKA 2QHXA 4AVYA 5K2OA 1WPQA 1CUDA 2PKXA 2VNIA 2QQGA 1GUDA 2J48A 3TUJC 1A4UA 1B0PA 4KEAA 3E53A 4C4RA 2EBUA 5FA5A 4FFOA 4UTPA 4XWKA 1RWKA 2Q5HA 4RABA 4ICIA 2XODA 3AHCA 3ABQB 3HB0A 4GBMA 3TQCA 4ALLA 5K3SA 5H9WA 4ZVKA 5K09A 3L7NA 3JYLA 4IIUA 5IT4A 2ATEA 1DAGA 4G4IA 2GKOA 2PV7A 4U1RA 5HCIA 1HUQA 2PRSA 2X1MA 2Y6UA 4CLDA 3LHDA 1DJOA 4IF4A 4YGYA 1IVSA 2PMKA 3CURA 1KAMA 3MLBA 4JL8A 1V35A 1CR4A 5BNTA 4AU1A 1ZSYA 1EUCB 3NOVA 2HN9A 3OZRA 4L5JA 1NT2A 4NZMA 2V74B 1NXWA 4DDTA 2YBEA 1ODCA 3KUKA 4CNQA 3FMIA 5JYDA 3HL4A 4AJLA 1CUGA 5ICSA 3F7TA 4S1NA 1NMQA 4JQOA 1MD9A 4N7MA 2BM8A 3TQTA 2H1VA 3WO0A 2Z6QA 1RKXA 1Y8QA 3DFMA 2VJMB 5IM5A 2EGGA 4QTTB 3A9RA 5IT5A 3FPSA 1ZSVA 1T8UA 4ZVSA 1CR2A 2I8AA 4I4TF 3RWOA 1JVSA 4PZAA 3FTDA 4A2CA 1OA0A 3LDUA 1D7AA 5F2EA 1S01A 1OXMA 1KORA 4KZPA 1RCUA 3HNOA 4L8YA 4M88A 4LGMA 1ISGA 4ZAYA 5IEBA 4D9KA 2J9GA 5CFRA 3A6JA 3V7YA 2BEWB 2R86A 4G0VA 4N5LA 3TRKA 1ISRA 4UUAA 5MDHA 1UJ4A 3JQBC 3W5BA 1CEEA 3VPSA 1I3NA 5KVVA 2PX8A 3I9JA 4QXAA 3C3KA 3CNHA 1AKUA 3BWEA 4NU6A 1LDNA 3NORA 4I9FA 2EJCA 5CXQA 3IQIX 4WLUA 4M0PA 2F43B 1QVAA 3M6VA 4BO5A 2R44A 3FXAA 3TPFA 1AHHA 2Q1WA 2XWBF 3EH1A 4WW0A 4B2IA 3DTYA 1SUPA 4LWOA 3E2PA 1MOZA 2QL9A 3LP5A 5AKZA 1IWOA 1ML3A 4J4HA 1QE3A 4EARA 3KXPA 1PJCA 1OFHA 1AH2A 4ECEA 4GMGA 2WYUA 1ESMA 5AXDA 4MO9A 3EG5A 4MUYA 1EFUA 3P4XA 1NKSA 4RM3A 4UUOA 2WYWA 3W8NA 3KOWA 4O4IA 1UKEA 1MH9A 1SG6A 1ZM2A 1NYTA 1LSJA 3GCWA 3IGFA 4H77A 3O21A 1EDOA 1NXSA 1P0PA 1JKMA 3BILA 3SBDA 4QTUB 2O2YA 5JT1A 3DLCA 2FRXA 2OFOA 1XD2B 1QK4A 1VLQA 2RC5A 4O4LA 4PX3A 4URWR 5KYWA 1C3VA 1QLJA 4H15A 3PEEA 1QGDA 3QPAA 1KHTA 4X3CA 2ORYA 3ZGNA 2G77B 2QW8A 2OMKA 4TSFD 4QQNA 2C9DA 3PE4A 4G8JA 1P74A 4EB8A 1TQHA 5M3BA 5HF9A 5CBPA 2YNMA 5AW7A 1P5JA 3KK0A 4O4JA 3SF8B 1P1JA 4LN1A 4KPFC 3CLSD 4IDOA 1LW6E 4RF5A 5K0GA 3CQ9A 3GGCA 2PXHA 3F49S 4CKBA 1XU9A 4D8WA 3THSA 4EG4A 1EFPA 4MUIA 1A0OA 3KR0A 3WY9A 2ZBPA 4AP6A 4EI9A 3FPGA 3IAXA 4JH0A 5IHPA 1XLVA 3PPYA 1FS5A 4F5EA 3B36A 1ADGA 1BE1A 5I7RA 2Z2KA 1FQJA 3A1UA 3I9NA 1S2NA 1CUAA 3CXRA 4RGVA 2OV3A 1E3SA 1DSSG 3A2MA 3QG5A 2NUAA 1CR1A 1KEVA 4FIZA 1NR7A 1L5HA 4EMSA 1K68A 1Z62A 3JRWA 4W63A 2BKAA 4Y6LA 5EIHA 5L4SA 4TLAA 1LDEA 2X0JA 3ROXA 3BGIA 1Z0UA 3OLWA 4EW6A 3RE1A 4DUGD 1ZGAA 4XW2A 1B0UA 4ENPA 2IDMA 2P65A 1L3IA 2PZGA 1KDYA 1TK3A 4NEHB 4TN5A 3EZNA 5EFOA 2J0EA 4Y0VA 4RKRA 3D4PA 3JQQA 4CKYA 2I7CA 1XTSA 4U6QA 2A78A 5IXYA 2FEXA 1C7ZA 1K89A 4UU8A 1SULA 4D4JA 3B7PA 3WTBA 3WWDA 3RF6A 5GTDA 4JX8A 1II8B 4XWYA 1P1RA 1RQNA 1Z4QA 3AUSA 1E3WA 2J5BA 2H2GA 3GT0A 4RXTA 2CD7A 1DEKA 2ZQ5A 3PCTA 3DFZA 3G6KA 4YRLA 4XEHA 5DU2A 5EP4A 2FYTA 2GPBA 4ZCLA 5LD2C 2JJ8A 1DADA 1CWUA 4WY8A 4TPKA 4ZJUA 4R9VA 1TJ4A 4XA8A 2AXEA 3UJHA 3CF2A 5BPFA 4N6GA 1WL8A 2QGFA 3ABOB 5AKKA 1NRIA 5F9HA 4RUKA 1LBEA 3H5RA 2A14A 5EXTA 1NJSA 1D4ZA 3TLXA 2I3BA 3P2EA 4OMFG 4KBFA 4N12A 2BONA 1QAOA 1ZNZA 1G7CA 5AI4A 5H1YA 2YHUA 2GQ0A 4OFXA 1H42A 4OHBA 1DEOA 3HXTA 1XROA 1HEUA 4M98A 4CGYA 1J99A 3AP3A 2M2IA 3JQ9A 4UNNA 4F56A 4TYNA 3C0KA 1ZH6A 2F3PA 2VN8A 2XUZA 3NJRA 1YKSA 3O31A 1NPDA 1NV8A 3NANA 1QFJA 3ILSA 4N6NA 1I4WA 3WKBA 3R76A 3VUFA 4DV6B 3V4VB 2XYQA 3E81A 1ZCAA 2G5CA 3ESRA 4MWDA 3UBMA 2FPWA 1ESNA 3WIUA 2BFAA 2OV8A 4RVDA 3D64A 3I0MA 5FI0B 1E2PA 2EU8A 3Q8XB 3TLZA 3LVFO 4CLEA 1GZ7A 1R5JA 2IUEA 2VJBA 4G86A 4IBOA 3N0RA 1IBMB 3TNDA 4F4IA 5EHQA 4YT5A 3NOXA 1MQSA 1NQAO 3QKRA 5HW0A 2VDRB 3C6MA 4ZJPA 3ZD6A 3F5SA 2OFXA 3KLOA 3ESQA 4KP7A 2XZOA 1H2WA 2O7QA 3CCFA 4TUYF 4QYMA 5FUVA 2C92A 2BELA 5BQFA 1DOAA 2PLAA 2BZGA 4N0MA 2VJKA 1ZHHA 4D9MA 5JIBA 1UPAA 4V0ME 2CXRA 4LC9A 3RO7A 3CEHA 1EDEA 1WXHA 2EF0A 3KZNA 1E2NA 3FUVA 3FZGA 4PQRA 3ZK9A 4B4VA 3OP4A 4UNQA 4KJXA 3IT3A 3K9CA 3UMSA 4DQXA 1UKBA 3KZVA 4X90A 3E03A 1UDCA 2FFHA 2IBMA 1V96A 1C8VB 2OSVA 3OBIA 4AJJA 2H31A 2H2WA 4XR9A 1WO8A 2Q0HA 3VJMA 4ZVNA 4D02A 4FDTA 1BJKA 4OBWA 1P4AA 5B3JA 2JEYA 4LSWA 1ODJA 3NHAA 5IEJA 3BMQB 4NBTA 4CJXA 1FZQA 5BQ3A 5CDGA 5C7LO 1W49A 2FPPB 3LV8A 3NHSA 1C4WA 3P71T 4KXQA 4IR7A 3NAZA 3KLPX 2WJYA 2RHCA 3FDXA 1BE6A 1VHLA 3HCRA 1T5IA 4RLFA 1Z5NA 5AVRA 1JFSA 1CE8A 4DA8A 4DRYA 4YDRA 5JNWA 2HRCA 2RH9B 4JLBA 1MC4A 2FWPA 2VP2A 2OMEA 4L1KA 4L4SA 1J20A 1OYOA 1ZFNA 1VE1A 3NBZC 3R6WA 3NBAA 1BXGA 1JEAA 4U8HA 2CE7A 3F6EX 1K7SN 4PHFA 4AN1A 2A5LA 1Z12A 2B3DA 3ZNPA 1Z2AA 2CLFB 3ADKA 4PTYA 4RMHA 3QEAZ 1KJIA 4Z1MA 3H4VA 3OE7A 1E1RD 3AF3A 4DLAA 1H0KA 4HAUA 2IZOA 2Q2VA 1RP1A 1PR9A 2EARA 2DRIA 3KJQA 2V55B 2ZIEA 2FPOA 4Q24A 2BHSA 2CDBA 4Y2JA 5FA6A 3N59A 4QO8A 1Y8AA 3UK1A 1N2CA 4F6RB 3KFLA 3ANXA 4C2TA 3EGVA 3F97A 3NAQA 3V97A 4EVIA 5DM60 1PK8A 4V02A 2QZ4A 4K05A 5BW6B 3U7EB 4XYGA 3SP1A 1HRKA 5TEVA 4AZ0A 3IQXA 4FVTA 1GGJA 3ZKAA 2XNCA 4Z0NA 5BV8A 1KRXA 1OFUA 3U3DA 4UBJA 3T15A 2WMYA 3JALA 2PYZA 2J4CA 4OK5A 3RYIB 1OXSC 1CU1A 2PQ0A 3AFOA 3F1LA 5KNCH 5C1OA 4LRWA 4TT3D 3HZOA 4QRDA 1ULUA 1EX6A 1P44A 3LIIA 4MQEA 4A0QA 4IG9A 4M0DA 1URPA 4R01A 4R2WA 4C78A 4O2AB 1JDPA 1YFJA 3DS8A 2CHGA 4CCAA 1QVZA 3K05A 1ZL2A 3RHSA 2J3JA 2GLXA 5L3ZA 2ZUTA 1W1UA 1AXEA 2C2KA 2F64A 2G0TA 3TLKA 2MMCA 3KHUA 4JENA 3TPCA 3V8EA 1PZNA 4XCQA 1VSVA 3EPLA 1OPRA 1DRJA 4OATA 4EUEA 4YV0A 3V7NA 3X2SA 2QJWA 3L1KA 1TUBA 5LR6A 4E15A 5AVKA 2JFPA 3GEEA 4Z53A 2IE0A 3HR7A 1O95D 4HZUB 4JLUA 2FFJA 4MCJA 2QP9X 1QZUA 3OKPA 4M37A 5EIAA 2ZIFA 4L78A 5GJVC 5LQSA 1V11B 5DI3A 3VJRA 2HU8A 3RW9A 4IJKA 5BMVB 3AMVA 1TCVA 5U4QA 3SQMA 3EVNA 4FZVA 5FBWB 5FUWA 4F6CA 3VPXA 5IJWA 3ICVA 1V4NA 3RF7A 2BGLA 5BN5B 4FXPA 3OKFA 1XJ5A 2VHEA 3SR4A 5CDFE 3SR0A 2QTGA 2AR0A 1YJBA 3FOAA 3KZKA 4KFRA 1H2EA 2DPMA 3GMIA 3BTVA 3H6HA 3IEUA 2OBYA 3AL2A 4LSZA 3BXPA 1Y5MA 4PINA 1B16A 1FS4A 4HPJB 5DM70 3MRVA 2REQA 5IVIA 3G7NA 4EEKA 3RARA 4WKBA 3PIIA 1G17A 4D9FA 2Z2IA 4JOQA 1DWUA 3MWJA 5EJEA 3JQFC 1CETA 1UH5A 1RPJA 1TZ2A 2QB5A 3HBJA 4O1IA 3MSCA 5EMHA 1UC5B 1NPTO 3T5DA 1RR6A 3GPBA 2DWQA 1UK9A 3LVBA 4IWYA 4JSYA 4NS1A 2NO4A 1FYDA 1LCIA 3Q9UA 3LUFA 4XGQA 5E8RA 5JWHA 1VA5A 4AKIA 1OC2A 4LVOA 4YRTA 2D8AA 3DEHA 1J1UA 2QRLA 5BSFA 1H9BA 1JDJA 2WKQA 3QLUA 5IJ9A 4DG9A 3TRHA 3E9QA 3ER8A 1Q84A 1SO8A 3LP8A 1FVXA 3SQDA 2XYHA 4PSUA 5D6OA 3MTEA 5JZVA 3NC1C 1GPKA 4XGKA 3ANYB 1YE5A 2HM7A 3JQRA 4ZOEA 5K05A 3X1XA 2IP4A 2QR5A 3AF5A 2WSIA 1M2OA 3BKXA 1OX4A 1CPYA 5CIWA 4BFTA 4ME6A 4TV9F 2IYAA 2ZSBA 4F9FA 1KI3A 3BE6A 3GLHB 2DPGA 4R2MA 4YLEA 2P9GA 3ROQA 4GPBA 1QIEA 3UUEA 4JAVC 2CSXA 3IOYA 2CB0A 3QXJA 3LQFA 2PH5A 1JIVA 3KQSA 4OUDB 5EWLA 4BVFA 3MS4A 2ECFA 2WFLB 5CJPA 1OH5A 3JZAA 4IG4A 3HJFA 3PXEA 3ER9A 3PGJA 1X7ZB 2YIVX 3R5TA 3I61A 5CB8A 1DFHA 5FOUA 4E4RA 1VL8A 2ZSIA 5T7BA 4JJGA 3ZV3A 2HJ9A 1LWNA 1PGNA 5JH7B 5A9TA 3QJYA 4EI2A 3DZCA 2DE0X 1T3GA 5ENVA 3GK3A 1C4XA 3IDSA 4EEXA 3KT3A 5IF3A 3ZHOA 2EKLA 4FJ1A 1JJVA 4K6OA 2NUTA 3TBKA 4PO1A 4HDQB 3IOEA 4A92A 4FR2A 2PR7A 3KAKA 3T3NA 4EPXA 4BNWA 1LDMA 2B30A 3GUZA 3OQOA 4E08A 2GF2A 1PNOA 3F1KA 3B53X 1A97A 4KQMA 1H94A 5IUKC 3W2HA 1LLFA 1NTOA 3MWLA 2BTQA 4K7JA 4XDYA 1JWAB 1Y6QA 2ADMA 4Q7MB 1KC1A 4Q4HB 1NVVR 2GR9A 1OBOA 4KMMA 1QH1B 4NV1A 3OJLA 1AV6A 1UMBA 4M6WB 4HFNA 3PNMA 3LWDA 2WF8A 3STUA 3BTUA 3R7FA 4XYLA 3LM8A 4PN3A 3IXQA 5K3OA 4MQLA 1T5OA 3I2KA 3S2IA 2BFWA 1E2IA 3L0DA 2DBRA 2WU4A 3PC8A 1WXFA 3GELA 4MQFB 2D6FA 3GDFA 4C29A 3IA2A 3KJHA 3MXTA 1H2ZA 4JZKA 4M87A 2IXTA 1XZQA 5FNZA 5AD1A 1HLDA 2AQKA 1Z6QA 5CRIA 4HRXA 5A4AA 2HA2A 1KQFA 1W94A 2V7QD 1WXGA 1EVIA 4OLAA 4FWTA 1ZCBA 1Y5IA 1YTLA 3KJGA 2JFOA 2HNKA 1S5PA 1TL7C 2GHIA 2PRYA 4TSFA 1R0BA 1RZ3A 3FKSD 4PZPA 2BI8A 4BAZA 3JQ7A 2X0RA 1SCUB 2I2BA 4OCZA 5AJVB 3D02A 1R6TA 1BX0A 2JI6A 4J75A 4PGAA 3AWIA 4L76A 4N54A 3VKVA 3PLAE 1Y4AE 4TN1A 2FJPA 1GNPA 1N5KA 4QDXA 4BMZA 2WPNA 1CS0A 4Y98A 1FSZA 4MUMA 3DQZA 1MX5A 3FAKA 2UYHA 3MERA 3PDCA 4W4TA 4JUDX 4HNUA 3CV3A 1PGQA 2O4CA 1M6HA 2NYAA 3AF0A 1S8FA 3MJTA 3S7TA 3PKJA 2N1MA 3H16A 1WXQA 4HYTA 1O6ZA 3NUGA 4PNPA 1QP7A 4D6XA 2ESRA 4TL9A 1GUYA 4N3CA 4QTZA 4G8BA 4RKEA 4YHBA 3RVNA 3WJAA 5LMZA 8OHMA 2FEWB 4C4ZA 4NZZA 3A6HA 4JB0A 5C8XA 3KLMX 1G7RA 2AKAB 2AUMA 2FW0A 3OZBA 1I2BA 3EFBA 3I28A 1ID8A 5B3LA 4DUGA 4CCWA 5ALKA 1XX6A 4DJAA 1GV1A 2NIPA 1I33A 2B83A 4BMPB 4BE9A 3ZDCA 3T3DA 2E4WA 1JHQA 4QEZA 2XRMA 1NQOA 2CXQA 3FYUC 1Z45A 4ITVA 5H3LA 2BFEB 3L6UA 2R0QC 1E6WA 4TWJA 2QRNA 1SUAA 3G2MA 4WBNF 3BIWA 2C83A 4RU1A 2OBMA 3RD5A 2HLDD 1ENPA 2W4IA 5FTWA 3AL0C 4I6JA 3SLRA 1KVTA 1YMUA 3FOZA 4YR9A 3PUYA 2BVNA 4E5SA 4H6WA 1G4UR 9GPBA 1M1XB 3F5MA 2B25A 3D31A 1SMKA 3ORSA 4B4UA 3HLYA 1WABA 3CGWA 3L8MA 4KQFA 4QU0A 4BJ6A 1Y7IA 3PFBA 3LZCA 3SDZA 3AF1A 4FC7A 3T9EA 4WZAE 4BZXA 4JKYA 1G7TA 3LLSA 4EJSA 1P80A 1YB6A 2IYSA 1E9CA 1NN0A 3G1WA 4WL0A 2XVXA 3FTQA 5B6JA 5FV4A 1RJFA 5KYXA 3LBAA 3EHDA 4P2BA 3VI4B 4HH3C 3C15C 3HJRA 3MGKA 2Q49A 1QYWA 5DV9A 4CL0A 1JFTA 2J67A 3LWNA 2IY7A 2HC9A 2WSYB 5A5EA 1K8ZB 4L0MA 3GBPA 1APBA 4HQFA 3FN4A 3QUSA 2YFQA 1UFKA 1UZLA 1WG8A 4PLCA 4EF5A 3R9WA 1PYGA 1USVA 2BW0A 2E37A 2NSDA 3VJKA 4FFRA 1LDYA 4K03A 2JVIA 4YONB 5D51S 3T4EA 3RI3A 1YD7A 2FDXA 2JAOA 2V7PA 1A2QA 3RVQA 3W4KA 4B1FA 2JC3A 2B78A 3I1IA 2VQEB 2J09A 2O7VA 4DR6B 2AEFA 4YJ2A 1RMYA 1FIUA 4EZIA 1I94B 3LYAA 4KV7A 2ZIXB 3DKKA 5J5AA 3BWMA 1ABBA 1ONBA 4KC0A 4S1VA 2GD6A 3D6TB 4QHYA 4DQKA 1C1DB 1VE3A 1H1DA 4DBZA 4GOKA 1Z63A 4CHTA 4TMYA 2IUFA 2ACWA 3NTUA 4HG2A 3RNOA 3SZMA 4DWWA 2ACKA 2GEKA 2H08A 2RHBA 2Q6LA 2W4QA 4KSBA 1P3Y1 4QYSA 2MU1A 3GUYA 4W1QA 1T6YA 1JJAA 3CE9A 3LKZA 4ML3A 2PNJA 4KRFA 1CNFA 5F51A 1XVTA 3VHQA 4EZEA 2FI1A 3G82C 5DM4A 3FPCA 3CSDA 5HS6A 4A1OA 4LK2A 1QTRA 5L3RA 5JY6A 2B1QA 2F8TA 4D5GA 1CY1A 1DIAA 4LUCA 4FGLA 3KCNA 3NLLA 4QU9A 3VR4A 5JR3A 5T6MA 3A6KA 4J3NA 5E7JA 1VXRA 3IEMA 1XZEA 3IL2A 4A8JB 4Z9AA 3KU1A 1PR0A 3LYUA 3O3NB 3TQIA 3TVTA 3LKBA 3IHKA 4CKWB 3EEYA 1GLVA 4CI9A 4P5PA 1U7ZA 5JD3A 3IXLA 5FX2A 4KFTA 3E7DA 2BR4A 1PV4A 1RHRA 4WKNA 3RS2A 1ONOA 3L77A 1DXHA 2HJHA 3BXEA 4C3VA 1JFLA 2C3PA 2XQIA 4CWAA 5DYTA 1ISFA 4G67A 4BVEA 3B6EA 3ZN2A 3T94A 1CUHA 2GFQA 2WJ4A 3K0FB 1UKZA 1FP7A 1EVLA 1HTWA 1HSOA 3PHGA 3PRJA 4M9CA 4EY7A 5BOSB 4IKPA 1MDFA 1OYWA 2Z4SA 2GEDA 3OCXA 4I4IA 1IB0A 1PZMA 4RKWA 1E1RA 3ZVLA 4B35A 4EATA 4TVOA 3ZU4A 1DZIA 5EP2A 3HU5A 1Q2UA 3W5DA 1TTQB 2WHQA 3QOWA 1JA9A 4E94A 2XA2A 3U6BA 4XJTA 2OUKA 4PGGA 2PRKA 3KQLA 2Z57A 2AZTA 1J8YF 2GKSA 3U2QA 2ZIWB 4GSYA 1WUHS 4LHXA 1U3TA 2QTAA 2XEXA 3GXOA 3SHTA 3VQTA 1QX4A 4B31A 2PUCA 1EG2A 3LT0A 4FMCB 1UP4A 1LS1A 3KTAA 4LXXA 3L4BC 2QZJA 3DE0X 3K72B 3TTTA 4KB5A 3EN0A 4WNAA 2V6IA 2HW8A 1QQ6A 1MOPA 4UHJA 3AJRA 1UC9A 3CT4A 4GFDA 5EMLA 4JASB 4I8DA 1CEXA 3ZU5A 3M8KA 4PZLA 3BDIA 5K4AA 3LGAA 3Q9LA 1U0BB 3UBTA 2J3QA 4FGJA 4GYYA 3A0RB 2J5XA 4S12A 2GYUA 5LL6P 1A9XB 2ONKA 3X1WA 10MHA 2EW2A 3LLUA 2FWRA 1GNTA 4I55A 4IGKA 2VK1A 1EKXA 1M6EX 1C0IA 3QOFA 3HVRA 3W4IA 5A6VA 4B8YA 3DE1X 2ZYAA 4YI5A 5A5GA 1DOZA 3ME5A 5DBEX 3B2EA 1P9OA 1J0XO 1O95A 3BGSA 2IY9A 3WLQA 4DCUA 4Q39A 4S3MA 5FJIA 3BWYA 1QUFA 3DAOA 1EHYA 3ZI0A 2IS4A 2ZTUA 1E1MA 1R50A 3HEMA 3PJDA 2BBWA 3DBOB 3PU6A 3WMXA 4EMBA 4DR2B 3TOCA 1FTQA 3HFRA 1PJ3A 3DOJA 2JFVA 4ZWNA 3NHUA 4JI5B 2FVYA 1GTVA 5HKLA 2VAVA 2B2XA 3U3ZA 3QE4A 2H1CA 3RBAA 3GUHA 5ERXA 1NXXA 1IATA 1Z5WA 4NPAA 1GGEA 4XQEA 1DBSA 4B71A 2FUEA 3URMA 5CHYA 3AIKA 3QMPA 3L02A 1MDBA 1DBWA 3I9V1 4TLEA 1PQ4A 1BCRB 3LT5A 2J0QA 1YDFA 2FEPA 1VMDA 4MV4A 4XFJA 2RD2A 3WB1A 4IICA 1PFVA 5IKXA 4WVLA 2WEKA 4OJTA 5BW5A 1TAUA 1P4RA 4L08A 1L7NA 1N3LA 1Q16A 5DT2A 3QP9A 5JMPA 1W5EA 2V0CA 2XQVA 1BMTA 4PRZA 2HSGA 5I9TA 2DZDA 1QHSA 5GOZA 4F93B 1JIQA 1K7CA 3QVKA 5A0FA 2IP1A 5KSOA 1RYFA 4RK7A 1QWSA 1ZBDA 1NJ5A 3DWIA 5DGTA 4F04A 4GZLA 5F23A 2HF7A 5SY4A 5TQ2B 4YFVA 4JU8A 2H3EA 4GQBA 4XM0A 4WKOA 1OLOA 2GA8A 2QKYA 1JLKA 4F3KA 3IP8A 3LXXA 1E0KA 1IBSA 1X0XA 4I6GA 3ITEA 4ZVLA 4KWIA 5I9MA 3U44A 5LA6A 2XBMA 4XLLA 3AVUA 3P9SA 2A67A 3BOSA 4GLFA 1ZK2A 2WJZB 1E96A 2FY8A 4EB6A 3PDHA 2QQFA 3E48A 2WAAA 3EWIA 5ESXA 2QD4A 5HQ3A 1UADA 5DBFA 4HWTA 1HM5A 2GEFA 1M8JA 3M1AA 1SR8A 4NFYA 3SIRA 4CFZA 5SZKB 2COKA 2ZBQA 4IIYA 1W47A 2PSEA 3K0CC 3N0XA 1XTJA 1WW8A 2FZEA 2XMQA 4LV5B 5EUCA 3W6PA 1WHSB 3O8QA 4MW5A 1Y81A 5G0WA 2C2YA 2A59A 3LXRA 3MJFA 4U63A 3ZOKA 1KYYA 2W2KB 4ND2A 3B20A 5KHAA 1LQTA 2OO5A 3O4GA 2JG3A 2AHRA 3LHKA 3QX8A 4GSKA 1LA2A 3B89A 1QIHA 3AHGA 3SEQA 3TRJA 3HLKA 1SY7A 1OXXK 1QHGA 3RRNA 5ICFA 4O1MA 3TJMA 4A6DA 5JNUA 3HTXA 2ILTA 4CG2A 2IYRA 3QX9A 4CIAA 4CIDA 1UT5A 3K9GA 3PJFA 1N25A 1WETA 1UMKA 3TQQA 2O54A 1CG6A 3LUPA 1KBZA 3MCUA 2YHAA 5KEIA 3DBLA 4IILA 3SS8A 4PZ9A 1FU4A 5FBZA 1N9GB 1O87A 4MP8A 5IK2A 3TOSA 2C4MA 4CG0A 1MUUA 3ASUA 3I0NA 1W88A 2WTEA 1Z7GA 3HKCA 4DEXA 1MV5A 4AZVA 2DUJA 3DE7X 3NVDA 3A25A 5K0FA 3STHA 3L9XA 1HDIA 1HYQA 4G1MB 1MABA 1KFEB 1WSAA 5TE9A 5BR4A 5EHGA 1CUSA 2FZLA 4DOMA 4RCVA 3BMNA 1LU9A 2XT6A 3D8NA 2ERYA 2ATVA 1W581 5A6SA 2G3YA 2B8WA 3HKDA 3ID6C 2D62A 2ZRFA 3D43A 2R8YA 4DVJA 5DYYA 5CTJA 4C0JA 2JFNA 1UQUA 2EZ8A 4BUZA 3PPXA 4JR2A 4UDXX 1JDSA 1PWZA 3KDPA 1Z7YA 1U8YA 2VF5X 2FRDC 2O8CB 3C3PA 3ASYA 3N2EA 5JAZA 3PXDA 4NAVA 1RC0A 5DE3A 1KEUA 2FH5B 1EGAA 2PH3A 3WL6A 4YAEA 4BNJA 1YB1A 3NWPA 3FKSA 4J9VA 1TIPA 5JVDB 1U94A 4OJMX 3ZX4A 3U4GA 2GJ4A 2G9UA 2WBLC 3LS2A 3DKPA 3QLVA 4RPHA 5BSGA 2HSWA 2Q0SA 1NI4B 3KXIA 1V3QE 4MUJA 5KOHA 1KOJA 4UM7A 3IV7A 2QDKA 2QTNA 2FKAA 2O2DA 3FSRA 3AETA 4V38A 4MVJF 2YJNA 4TWBA 1CY0A 1PFKA 1TZCA 3CTPA 2O2HA 5JSUA 5K3EA 2PBRA 3GL9A 5DMHA 3WV4A 5AVSA 4KODA 4M0LA 2UZ0A 4UM9D 1A27A 4XE5A 4RLHA 2JATA 1TA9A 4CW7A 3JVEA 4BO0A 4WN9B 5G3YA 2OB1A 5FOXA 1JQ5A 3STVA 5TMPA 3DOCA 2PAAA 1HFWA 2V97A 4YFYA 4LZNA 1UBKS 2X22A 3QSYA 4W6QA 3D8BA 2EG9A 4CCYB 221PA 1T1SA 1E0DA 1IL0A 3T3GA 1WB4A 4FK8A 4NCKA 3UMBA 1KKUA 4RVNA 2BCJQ 3LC7O 1Q1BA 1NIPA 2LCFA 5JCPA 3DMNA 4B2PA 3EXIB 4LOAA 2YTZA 5SY9A 3TR6A 1ECPA 1RAFA 3ECSA 1D4OA 3H2YA 2O5CA 3NIGB 2FSSA 4IRXA 3BX1A 2C8LA 4J16A 3QXGA 1FFXB 2JD0A 4K46A 3EJ6A 5D3MA 5FWYB 3ZDBA 1WNFA 4QE3A 3I12A 3UICA 5LMUB 1IUOA 2HLDA 1Z28A 2O3UA 3CMMA 5HM8A 1UUFA 1L7VC 4AZ3A 4EG6A 1V9SA 2ZAMA 1XJ0A 3FROA 4FGUA 2Q6VA 1DIHA 1DWPA 3BB4A 5D2CA 4F72A 3DKVA 2O8EA 2E4YA 3C1TA 3OICA 3TEFA 2Q0XA 2NMVA 3R0XA 2KMLA 2GAIA 5EPUA 1XL1A 2M32A 3GC6A 4FOTA 4DIOA 5C0OE 1ZJ5A 1KO5A 4TWZA 4I99A 5A1TA 3OI7A 3EW9A 1G8KA 3N8DA 4RNCA 5JHHB 2PL1A 4DV3B 1I3CA 3N5KA 5FO1A 3KX2A 1S2DA 2QVGA 4NXNB 1ZGJA 5U4XA 1TAHA 4IF6A 3ZZ1A 5BVHA 3OZDA 2WWXA 1YOBA 1M0EA 3PQEA 4IO0A 4IIVA 3EXEB 2EKPA 2OWEA 2REXB 3ETHA 4R3NA 5F73A 2ZE5A 2BP7A 3E5RA 4LXTA 4ZQFA 3T7DA 4AMZA 1ZI8A 3NASA 3FHCB 1T4MA 1NYLA 2C4TA 1JKFA 3IUJA 4OA8A 2Z83A 4YRQA 3SNHA 5GONF 3VV2A 3COWA 4AJNA 1QKIA 1GA4A 2CFIA 4HDAA 5G3ZA 4YUXA 4TRJA 4M9RA 4PHGA 5GJBA 1T4GA 2GK4A 1Y8RB 2OL4A 1O3YA 4IV8A 5ELMA 1LJ8A 2VUTA 2PSJA 4EKYA 4IIJA 4IYJA 4UU7A 1M2GA 2V3CC 4GI1A 4JI2B 2AX4A 3HJHA 3JQ6A 3SCZA 4GO1A 3Q8LA 4PHTA 4Z7QB 2P3LA 2O0LA 1SBYA 2EZ4A 4PHHA 1Z29A 2O8BA 1YRHA 4QJBA 5DWVA 1CY2A 2HXSA 2QQ5A 3NG1A 1JG2A 1O7JA 2VDNB 2GS9A 3O84A 1US8B 1YR1A 1UMCA 2GF0A 3WK9A 3H9BA 1R16A 4B7ZA 2CNNA 4PIMA 2QPOA 3B1KA 2HUNA 1RDFA 4QJIA 2QN3A 4M8SA 1J5PA 2EVWX 4C30A 4ZHQB 3KM0A 1NBHA 3CUVA 2ZJ8A 2Q3HA 1NMYA 4RIEA 2AFHA 1EJ6A 1GQRA 1MG5A 3EZYA 4FPXA 3M5PA 4Q1VA 4UHDA 1XMPA 4ATNA 4YCSA 4BE4A 3I64A 3O6VA 3B78A 2GXUA 1WLSA 4KO4S 1WZCA 2PMCA 1G6Q1 1AN0A 1VLHA 2YCBA 3E0QA 4FFDA 1VFPA 2BZSA 3WL8A 1ZVVA 3H9UA 4MLPA 1QIJA 5KTOA 5BWBA 1U0EA 4DCNA 1UBCA 2VPIA 4MUGA 5J1TB 4DAOA 3Q3CA 5IARA 3FCEA 4RPLA 3GARA 2IEBA 4ZU6X 5I7EA 5E6RA 2PBZA 4IUDS 1SD5A 4UTZA 3S1LA 2ZYTX 4LDQA 7AT1A 2WD7A 3QFTA 4LSMA 3UOGA 5A05A 4C0KA 3H1PA 1QHIA 4HO1X 4ENWA 1V8OA 4Z4FA 1VCHA 4GX5A 2ZATA 4Q4DA 1YFLA 3MWFA 1GEEA 1LRKA 4ZVRA 5BSKA 3OBBA 3DGEC 1C9MA 4LRUA 4OYRA 5L45A 5MHTA 1X8JA 3Q41A 5I9LA 4OHPA 1BMFD 2Z43A 5BQ5A 1XRSB 4D98A 1KARA 2HA6A 3C6KA 3K0HA 1PN3A 1JP7A 1UK7A 5EJMA 2VTEA 3EODA 1H5UA 1AGYA 1EFVB 3CPSA 4R8SA 1V95A 1KWKA 1GKKA 1HZJA 1E3EA 2IXAA 5CVCA 2ZWAA 3A1FA 3IURA 1QRRA 2PMBA 5KVAA 4E14A 3VVLA 3DAHA 2RGBA 4UJ5A 4DRXB 1T3TA 4PCAA 2NZ8A 1RQ7A 4E7OA 1SA0B 2YV4A 2O6LA 2NU9A 2QK4A 3AHEA 3ZV7A 3EIOA 4FINA 2HB6A 3ND8A 2QM7A 5ETJA 2ZYGA 4P58A 1YDWA 1YRBA 1AKVA 1XLTA 1GL7A 1YJQA 2C94A 2HSJA 2JJ1D 4ZQGA 4JYAB 3TECE 1K2VN 4J0HA 3HO1A 1RHJA 5GV7A 2YXDA 1F3OA 4C2BA 3OU2A 5IAGA 2ZJYA 4ZXPA 1LW7A 1NL3A 3DZIA 3GCDA 1JMYA 3KQPA 4QASA 3ZYCA 4GVPA 1DNPA 1SWVA 4NU8X 2E48A 1HYEA 1GJRA 2CUKA 5AVWA 1V37A 1TFRA 4KO2S 1CQJB 5J5CA 5BMOA 1E9AA 1YI8A 1FP4B 4I36A 4E5UA 5G4KA 5FI3A 3RS9A 3WSVA 4EYQA 3EQZA 1IHOA 4A26A 3DTVD 4D45A 1Y37A 1A9ZA 2GTPA 4KHPB 4N4AA 4NBNA 1K5GA 3PFNA 3IOBA 3D3WB 4BFYA 1G8YA 1K4KA 2FVXA 2A0UA 3D7NA 2TS1A 1EZ1A 1VLJA 1PT8A 2AJLI 1RFLA 1M1NA 4GLJA 4OU4A 1TO1E 3KUUA 2GHRA 4K1LA 2O07A 3HV2A 1MRSA 4NH0A 1EIZA 4F38A 3T95A 3C45A 4IIBA 3W3AA 1EVJA 5B2ZA 2P2ZA 1CZLA 5EVCA 1DS6A 1G7SA 2Y2VA 3FNHA 4RGQA 1OOEA 1YQXA 2P8SA 5K2MA 3RYFB 2EHJA 4XWAA 4MKXA 4MXDA 5DLQC 4LBVA 5AHXA 3H9QA 2YN4A 4J0KA 4BCDA 1ZUD1 2X0IA 4TV8B 2UZ4A 3KPYA 2G80A 2ZWMA 4IKOA 4B6FA 4ZICA 4XDZA 2PD4A 1PV2A 1QC5B 1FC0A 1QG6A 2I78A 2W6OA 4WXYB 5AI8A 1P2TA 1XEWX 4BE7B 1NWHA 1NY5A 1PVVA 4MP6A 4DADA 4WASA 2VXCA 1IHUA 3FKQA 4D81A 1JQJC 1QGUA 4BQEA 3LC2O 4OMUA 2DFTA 4X9XA 1XYGA 3BMCB 2PS1A 1FMCA 3RWBA 4TQGA 4J0CA 2I4OA 2HNBA 4C06A 5ELXA 1X7WA 3CO0S 3G79A 3BN3A 5C7OO 3E27A 5EZYB 2IVFA 2W11A 3GEMA 1UAGA 1PTKA 3E82A 3LY8A 3V1TC 1YCHA 2TSYB 5BSHA 4KE7A 1N4DA 2CC2A 4UU0A 1HT1E 4PPQA 3UH1A 4DTCA 2H1SA 1GADO 3KOXA 4L3VA 1T4BA 3T7JA 1BMQA 4H1UA 4YVFA 5IJ0A 1SB9A 1TQDA 1OLUB 2XCIA 3RVLA 1HURA 2JGEA 2VDLB 2FUG1 2FW8A 3MVEA 4U5QA 1GVHA 2WJ3A 2PX3A 3P2JA 1BYIA 4CM9D 2CYCA 2CZQA 2UZ3A 1OVMA 3SMQA 1KNXA 5IZCC 2C0PA 2P3QA 2EL9A 2HMVA 2HJWA 3D6VA 1ATZA 1W6RA 4X1OA 4OHWA 3ESXA 1R0SA 2QZ9A 5BY2A 5D7NA 5MGNA 4PSAA 2OGSA 3H0EA 3Q7TA 3CZCA 4KVGA 4AI6A 3DE3X 2H59A 2NU6B 3CUEF 2DOKA 3P9NA 3KPWA 3O83A 2ALJA 1UR5A 4LWQA 1Q1GA 1YBVA 3RS7A 3SIWA 1PJTA 4RTQA 2XLCA 5J4KA 3ZJUA 3S68A 4LOIA 4M7RA 1U8CB 3KKOA 3OT1B 1MA0A 2FHSA 4IFIA 3TEMA 4IQ0A 3DHWC 3DL2A 4H7HA 1DTWB 2DU8A 1YACA 2WNIA 4Y9RA 1Z0IA 2FSFA 3I09A 2RKOA 4LHVA 4PQGA 3MCZA 3A4IA 3CJQA 1J0EA 5IN5A 1JDVA 2ZTMA 2QRVB 4JR0A 4IIXA 4ZV4A 2JLYA 3EAGA 4X00A 4R51A 3Q6MA 4RTLA 1JXAA 1OJLA 4GI3A 5IHXA 4MRRA 3QPDA 4PVDA 2XADA 1XYVA 2ZRDA 3S0JA 3N87A 4D56A 2AFIA 4K9MA 3F9RA 1WRBA 2AYXA 3TW8B 4HFRA 4P3YA 1NVAA 3HGQA 3RRXA 5FWNA 5JQGA 3IVRA 4TQ9A 3SF8A 2C2ZA 4YV1A 5LMCA 2IGTA 3UWMA 1AQJA 1QQ5A 3C3MA 5IFKA 1ORRA 3DHYA 2CNOA 2G88A 1IY9A 3V1LA 4F4DA 4GAEA 3O8RA 3E70C 2JKYA 2OOKA 3BJEA 1Q0ZA 1VE7A 4UUPA 5HUQA 1AZTA 2PPLA 4RH1A 4CFYA 1BA3A 2IUUA 2CUZA 3EXFB 3B1JA 2I2CA 2YC2C 3OD1A 4JB2A 4XM1A 5AVOA 4EKIA 1DELA 4YAUA 2RGGA 3Q11A 4KXMA 5EMKA 1HDRA 4QDKA 3K9HA 4MW4A 4QYTA 2DUNA 2ZJBA 4D96A 1K92A 3R7LA 1SZDA 2HSDA 3W5UA 5LXTF 5FYDA 2C7VA 5DCWA 1NOKA 1V5IA 2JI4A 5T64A 4DXDA 3LTNC 4JI4B 2AJBA 1UBEA 4RD4A 3RJMA 3IEXA 1ZZEA 1JLMA 2XRZA 4JQYA 4UVGA 1L4YA 5IPFA 1FFCA 1P1BA 2GFIA 1L1QA 2W0SA 2YICA 4IVPA 5FAXA 1JNYA 5C3MA 3V4LA 5M34A 3Q5GA 1UXGA 1LBSA 3A7EA 3BE4A 3ZGXA 1SKYE 2A5FA 3KAJA 4KIGA 2PUBA 1S8NA 1UQRA 1JEEA 1QJCA 4E22A 2QBYA 5AKEA 4H08A 4B6RA 5BUQA 3RAFC 1KA9H 2PQ2A 2CHUA 4HJXA 4V2UA 3WHLA 5CDHA 2Z4RA 3ERCA 1HZZC 3RSHA 3OPVA 1ACJA 3CX4A 4JFRA 3K6SB 1EXWA 3R75A 4NBVA 4ASUD 4UPDA 3UMCA 4CM8B 4TMZA 3IOCA 5BSTA 3CVVA 5JCOC 3E4DA 4LVNA 1Z4PX 1WUYA 4AYTA 1YHNA 2DHDA 2B4YA 2X6TA 3OOJA 4N48A 4EY3A 3OEWA 5ADHA 2CJWA 3QOYA 1CIJA 1P2DA 4OQEA 2B0CA 3JY6A 4PFQA 1LB1B 3D3QA 2LV8A 4JYCA 1B42A 1EM8A 5LYJB 1X70A 2VF8A 1GZHB 3Q2OA 4KQJA 2D4AA 2XTNA 1EJ0A 2FFQA 1L5MA 3KQVA 3OU7A 4AFNA 3WKEA 1MT3A 4PIVA 1R5BA 3TH5A 1OZAA 4LZZA 4N3AA 2OXFA 1L5NA 1IZZA 2RHDA 3PFGA 3PCRB 3N75A 1N5IA 3R3VA 2VPXA 2XBLA 2XUQA 3EOBI 4TWAA 3HACA 4NZ9A 2FZKA 1X7YA 2NPOA 3PGLA 4HQLA 4MUXA 3DSRA 2K6GA 2XT9A 1GDDA 4MQ6A 5HOQA 3C98A 3SHQA 1ILEA 4LZPA 1FBTA 4NBKA 1P9WA 4PC7A 5IKEA 3HEBA 1L5RA 4ZV9A 3OWXA 6PFKA 4IWNA 2PLNA 2BMFA 3UCXA 2YJ3A 4KO3S 5B64A 4KXYA 4NTZA 2C7GA 3KR9A 3PLRA 1JIKA 3HVIA 2BBOA 4MKZA 1WJGA 3JPWA 1NVGA 2O0JA 1F4VA 4X6UA 5I9BA 3LUDA 3MAGA 4CTMA 1CY7A 2Z2ZA 3O2JA 4MS1B 3OT4A 4L4UA 5LOVF 1VKZA 2GM4A 3RBZA 2HRBA 4ZRMA 2WWHA 3OPNA 3OTWA 3IUNA 3VC2A 4Z0TA 4V1CB 1PYDA 5DNDA 3WMGA 1LTHR 1MU0A 1ZIXA 2BJWA 4HGOA 3WG9A 2VBFA 4TX1A 3UAVA 4RO0A 4J90A 1KSFX 4E5VA 5I3ZA 1Z2CA 4JLSA 2GZAA 1VHTA 3FHTA 3OLCX 2VHVA 4B44A 3D4OA 4HVAA 1N5MA 1IVNA 2JFUA 4M0UA 2C5EA 3WOHA 3P9XA 2P90A 2Q45A 2HADA 2UKDA 1OTXA 2W7TA 4E09A 1BEZA 5IXSA 2JLZA 2IH4A 2JA2A 1WDMA 3KOOA 3OY2A 4YBRA 2WUFA 4FCVA 3T9CA 1C2YA 4ARUA 5BNIA 5KJ6A 3TO5A 2FPPA 1Q0UA 3QPWA 3RT7A 5B58C 1JHMA 2OO7A 5CA1F 3O1LA 5AJHA 5ED4A 2JAWA 3W1WA 4DGSA 2IFTA 5AP9A 4OHMA 2BMWA 4MVYA 3NNNA 1K9VF 4U7GA 2ZRHA 4U9IS 5HKOA 2SKEA 2A8YA 4RFVA 1JLLB 5AOVA 1I7DA 1N1EA 3E2MA 4WPGA 2ZJ4A 5CB4F 2XF2A 4H9GA 3ND5A 2Z6UA 4CKEB 2I0FA 4UAJA 3PQ5A 1P2SA 2F48A 1WF3A 5CB0A 3W9YA 1OAKA 1MPXA 1FDUA 1CTQA 3ENQA 2CLLB 4FFNA 4W82A 1OSNA 4HDSB 1QUEA 3DAGA 3LMKA 1AKMA 4EY6A 1LLCA 2PR2A 1OF1A 3RS3A 4A15A 5DHTA 4B7XA 1L1FA 1KU0A 1DQYA 4QGGA 5ALDA 2NQ2C 2IEIA 3HP1A 4LEIA 2AYZA 5DSXA 4DS3A 2NZWA 2PWBA 4PFSA 1M0WA 4B4OA 4EVRA 4QLOA 3WL4A 1G4AE 1RWVA 2GJSA 4RD2A 1QCDA 2AC7A 4ND8A 1IEWA 3I05A 2SHKA 3ZWBA 4N41A 4DV1B 2AZXA 2GRJA 2ILVA 2VNKA 2Z5GA 4MV0A 5FNVB 4ZI7B 4U7TB 5G1PA 1SH7A 1U0TA 2VG8A 2X3UA 2ZB2A 4GSLA 2WAOA 1IEVA 1U1GA 2OFFA 5KHOC 4ETIA 4CMCA 4LV8B 5CU7A 4BKQA 3ODPA 3K0SA 4R81A 1BMFA 2H4WA 1Q2XA 2GN0A 1QH8A 1QIIA 2YUTA 2AN5A 3GG2A 4II2A 3MM4A 4YRDA 5EKXA 3ZJ4A 1V71A 5JXHA 3TF5A 2CVZA 2VTDA 4JBHA 4JA0A 1ACLA 3BHMA 3TM4A 2ORVA 4KLCA 5A04A 4FZ5A 1LV8A 2PL5A 3AEQA 4OJYA 4B84A 4M99A 2HR1A 1JV2B 2AEJA 3NT4A 1SU6A 4C0AC 1JH9A 2OD7A 4BKPA 1BQ4A 1C7JA 2IWRA 2WAMA 3RFVA 4TS3A 3IAS6 2VTKA 4AECA 3PI7A 1X8XA 4EY8A 4BQNA 3KFXA 3QYPA 2VBCA 2B21A 2BGKA 4I2VA 2VNHA 2XKJE 1EUDA 4FX2A 2GEUA 2P1ZA 2JJ1A 1K8RA 5BT8A 1OLSB 4Z0HO 1CUUA 4R71A 1EVZA 1SBZA 3ZYZA 1ZSNA 4HATA 4G24A 3RC7A 3UB4A 4EG1A 1X92A 4RA9B 2ZZKA 2JVJA 5IDXA 5LYYA 2GBLC 3IBFA 2VAPA 1E20A 3DV0B 3P8ZA 4AZSA 1Z8HA 4E2ZA 3O8OA 5IKPA 3D2BA 1WKBA 4HY3A 4R1TA 3RYCB 2WWGA 4AD8A 1K7EB 5FOWA 4YCMA 2RGUA 3DTVA 5D7BA 5EXPA 2B2CA 4X41A 1NUUA 2FZVA 2ZITA 1LI7A 3HCOA 3RIYA 4AF6A 4H60A 1YF3A 5JWOA 5FADA 4ARIA 2VDJA 2HK6A 4K40A 2GCGA 2PWZA 1Z6TA 1Q17A 5CR9A 2JEOA 3OQBA 3ONFA 2R6DA 3MOSA 4R84A 3OQMA 2Q4OA 2O5EA 3U80A 2C57A 1YUMA 1GA1A 2JLBA 4KQCA 3BL8A 1W4RA 4KQ2A 1E2GA 4WADA 4DPLA 3IBSA 3W1EA 1M83A 4YRJA 5JEEA 5JZSA 3K32A 1WMDA 2O0HA 2ZS9A 1YSCA 3DLTA 1FRZA 1NMXA 2C61A 3ICCA 4G4SO 4QYWA 5CA0B 1NQ5A 2XHEA 3FUCA 3AONB 1WHTB 1QAMA 2NAFA 1RADA 4D9HA 3BHJA 4BKUA 3I76A 3MUEA 3RK0A 3W77A 4QOGA 4GVLA 1JQLB 2EXXA 3H2HA 3VR5D 4D43A 4ZDJA 3O3CA 2YMLA 1F8XA 3QTTA 1X1EA 4X66B 5JXGA 1Z34A 1NUPA 3PC7A 4W8GA 4XFDA 4B9AA 3AI1A 1PTJA 3KAPA 4ZPXA 3NJ4A 2K87A 5ESDA 5HJ7A 2G5PA 2VA9A 1I36A 4N01A 1QYRA 3E3OA 1HT0A 4QTYA 3STWA 1OLXB 2I6TA 2WFLA 4NY1A 3K7EA 3DYBA 2OPHA 2UZIR 2FMKA 5K8JB 4FMDF 2B34A 1EINA 2CUTA 1FQOA 2J4DA 3O9MA 2LKCA 2VRWA 2HHJA 3NEJA 3W8EA 4G85A 4Q9KA 4MROA 2I80A 4WD3A 5ESRA 1L4EA 2C3MA 1X3SA 1CDEA 1G21A 2YMQA 1TYDE 3C7DB 3GJ5A 3VHRA 2FNAA 4UHFA 1J2UA 2QG9A 3PXGA 4AWAA 2YXEA 4NQZA 3NTXA 4BPRA 1D1TA 5AO9A 2P6NA 4ARAA 3F7MA 1C9KA 3QPBA 1H69A 4WLEA 1XZMA 2EZ9A 4ZJZA 1GPNA 1TT5A 3TAXA 3NKLA 2HK9A 1HFEL 3QOXA 2A9OA 1XU4A 3RTGA 3GFSA 3NCHA 2B7CA 4NCAA 3JATB 4CM9A 3QFFA 2DT8A 1O77A 4NFSA 4PLHA 4BYGA 4MRMB 3T5TA 4NFHA 2JPDA 3RHFA 2BKVA 3TQOA 4RTPA 1ZC3A 3VISA 5HX7A 1UEIA 2HWWA 1S8OA 5ANRB 2PFSA 4RTOA 1RHMA 1ZD4A 1DLJA 4EYKA 4FD2A 5EGNA 1U0JA 1O08A 4LJ9A 5JS7A 4KPYA 3IHWA 3AKEA 3AXSA 2ZSUA 3DFUA 3QRWA 1QSGA 5EXEA 3UAZA 4NL4H 3DXXA 4RZHA 4UHCA 3MMSA 4DG8A 1MW9X 2JLUA 4U6SA 1N57A 4HDKB 1TQ2A 4JI6B 2LWIA 3H8JA 4IS3A 4C14A 3FOFC 2O2XA 4YLGA 4E5KA 4WA7A 4R1NA 2QXUA 2O3QA 1SUDA 4QPDA 3HCDA 5E6UB 3NVAA 3U3XA 4XM2A 3L7OA 4BO6A 3JZFA 2GN4A 3IDQA 2PUEA 1YRYE 1X7HA 2BI7A 1JALA 3DEAA 3KTFA 4JLPA 5CW1A 5EEHA 3ZW9A 4D3ZA 4E5PA 2YYAA 1SCBA 4G01B 1OJ7A 4IDAA 2X13A 5IF9A 5HIMA 3IEIA 3SKYA 2JARA 1SCNE 2NP6A 1U2DC 4B73A 4CHGA 2PUAA 3I8SA 1UJ5A 2OHGA 3CLHA 2XMSA 2X19A 3QVMA 3B1XA 1T2EA 5FIUA 3BAZA 3OJEA 3SFTA 1N9ZA 3VR5H 3HVHA 3VYRB 1D8TA 2R8RA 3IXMA 3LA6A 1Q1NA 2ZVJA 3K5PA 2ETXA 4MPDA 2Z1NA 4S1WA 5DNWA 3DR3A 3GMSA 4O6VA 3CUYA 2C9OA 1Z8NA 2W2LD 3ESAA 3NOOA 3ZK8A 4Q3KA 5B6IA 3KVRA 1I01A 9ATCA 3S6JA 1HE3A 3GIWA 5B58T 4ZMBA 3ZVKA 3DDNA 5L3QB 3JVIA 3DLPX 2FPKA 1YVDA 4D0GA 1RFGE 2O57A 4D9CA 1LQUA 3EGEA 4GS5A 1GCAA 4Q4AA 1V47A 4AC9A 1JTFA 2PGIA 4O2AF 1E7YA 1N77A 5K3FB 4G37A 5KWSA 4IXNA 2DKOA 4FSXA 5TS3A 1B41A 1Q95A 1NQUA 4V0NA 5JNTA 1U1FA 5IAOA 4O4IF 3T99A 1YKGA 5EPEA 2P67A 5F2KA 5JUWA 3QWHA 3WOVA 1SG9A 2RDMA 1W36C 4J76A 2OD2A 3KELA 5CGQB 3C6QA 2CDCA 2FQXA 5EYPB 2BFEA 3ZVMA 2LIVA 3JD2A 2BPOA 2RGCA 3KVOA 3MD9A 4YJHA 1PG5A 3EZ6A 4LTDA 6ADHA 3FNBA 4EQZA 2CCJA 3FUTA 5H68A 2UUOA 3LCVB 1FFSA 1EDDA 3OWHA 2VSFA 3U3MA 1GUZA 1FLAA 1ZN8A 2OVBA 3A9CA 3OF5A 2PKQP 1MQAA 2HDHA 2EV9A 4ASUA 4EQ6B 4PZCA 5B12A 5FR1A 5AHOA 5JSZA 1OZ0A 2DCUA 3NBMA 2KYRA 3BSYA 4O4JF 5JJCA 4I14A 4D3SA 4DDMA 2P6UA 1YR3A 1T2FA 3KT8A 3IPXA 3TCXB 3SWWA 1WQ4A 4DKXA 1Y4DE 4YWJA 1ODIA 1D1QA 4KLNA 5JW6A 3OSZA 3PQ8A 2Q07A 3H5IA 4K3UA 5I4IA 5J2TB 3UWPA 5LD2B 1ULBA 3HDVA 1ZHOA 3FW1A 3EVEA 1BN6A 1D1PA 1XPRA 5H83A 3SF0A 3CH7A 1BS1A 3RV3A 1RE0A 1O4WA 2YVLA 3TW0A 1R0XA 1M74A 3I04A 3FYSA 3TB4A 1FJ2A 5BNWA 1RT9A 5CNJA 3A1VA 5BURA 3UA3A 1MX9A 4FIDA 3WAJA 3VTFA 3R9IA 2PFGA 4JYBA 3UPTA 4JXXA 2CNDA 3QELA 1N7IA 1QLWA 2AUNA 2B4RO 2GCOA 2ZVDA 3JVDA 2DSTA 3NKVA 3HN6A 3PUJA 5J9FA 3VKUA 1XYYA 3L01A 5KQGA 3HDTA 5DHRA 1D4AA 3AL3A 1PZHA 1SCDA 1GKLA 3P9KA 2IW3A 4FQ7A 4Q1EA 2J5KA 5CAEA 1AKRA 1KWGA 1A1VA 2R7LA 4XEUA 2DULA 4YREA 1E9VA 3PC2A 4C7XA 1C1DA 4B3BA 1OXVA 1XTRA 2NSJA 1EK2A 3IQHX 2CL7X 3NO4A 2ZW9A 1QG0A 4HSGA 4YAJA 2ZRBA 5DLEA 4UE3S 3RUEA 4YRSA 1OR8A 2C96A 2WJWA 2HAEA 4ANFA 1KMHA 3EXHA 4LPSA 1E5VA 3V7FA 4LYFA 2GBFA 3CJTA 4CU2A 3WQHA 2XXAB 3DMGA 3M5DA 3MBOA 3UZUA 1D6JA 4R8RA 4LNHA 2ZP1A 3LPAA 1RKQA 4L51A 3RRFA 2GMWA 3WZLA 2YZ2A 5CM2Z 3CUWA 3VNBA 4AICA 4AG6A 2XMDA 2AYYA 2MIIA 3ELDA 1HDOA 1PEAA 2C2GA 4A7PA 1LBQA 3EPRA 1A2BA 3H87A 1JHOA 3HRKA 5CX1B 4EFKA 3DO8A 3Q7IA 3JXEA 2JAHA 3ROMA 3TOVA 4CKWA 4INJA 2JVKA 4W8HA 1SUSA 5JZBA 4C05A 1VL0A 1RZUA 5TVGA 4BNDB 1YFKA 5CFQA 5LJLA 2XGGA 1ORIA 2VSOA 3ONDA 1GGMA 4H35A 3JQEA 1XZNA 3DV9A 2NO7A 2JI8A 4O08A 4KZKA 4PR0A 1R12A 4X1IA 4XVCA 3CJRA 2MCFA 2WA2A 3PNYA 3GWZA 3HJGA 2PVCA 2M6KA 2OE2A 3MJVA 1W44A 2P2LA 4LX0A 3K0FA 3WSWA 2Z08A 5TQ0A 1HDZA 2F3QA 1ZCFA 1QFYA 1U0OC 3V4FA 5LQKA 4UU1A 4QM6A 1PR5A 1G6KA 3A6FA 2NYUA 3O5AA 5CLFA 3THRA 4JCOA 3C3EA 4IINA 4AJ4A 2FG6C 5HP4A 3VNVA 4DT1A 3LZDA 1OWMA 1XCJA 4C1BA 5FTLA 4ZARA 1Q1EA 1GL9B 3WADA 2O1WA 2I99A 3DLAA 3NU1A 2XWJI 1SEVA 2LTAA 4JOSA 2H1HA 1MO4A 2DQKA 4MR9B 5BN3A 2EWMA 3HXKA 1Y1RA 3FB4A 1DT3A 1MNQA 1QB8A 1VPLA 3NWBA 4FGSA 1ZEMA 4RGYA 1DCMA 4TTVA 1RC1A 3UJ3X 3ILVA 5B4VA 1Y8ZA 2C31A 1RBQA 2V7XA 3IUPA 2HDNB 4HSEA 4O8CA 3FE2A 1A7JA 1FFAA 1PR4A 3I6QA 5DOZA 4QTXA 4J94A 2FPXA 5K4HA 4QBIA 2QLBA 3I8XA 1TZJA 1ILWA 2ANCA 2WOOA 4Y2GA 4Q3EA 3ZS8A 1SQFA 4IDNA 5B3AA 4COOA 3E9YA 3PHIA 4RD3A 1XA3A 3LCCA 1FE8A 3K1TA 3Q0TA 1TU4A 1JEQA 3IBCA 3K8YA 4V3CA 2C2WA 4X45A 3E3MA 4H7KA 4ZCTA 3QUQA 3ZBQA 1JQKA 2LUOA 3C74A 3HZHA 3SNKA 1J06A 4D3DA 4BJ5A 4DYHA 1CX9B 2CMHA 3JQPA 4G0PA 2QORA 2BUBA 3V5NA 1XDSA 1K1EA 3Q88A 4ENVA 2IYTA 3O8NA 3DBIA 3WFIA 1YIOA 3O92A 4DCSA 4FUTA 5KI6A 2W42A 2BFCB 4QPZA 1E0SA 2BFFB 4YAOA 1K4MA 3F8TA 4IDDA 1JBKA 3HHEA 1MB9A 3BIOA 1SK9A 2PRIA 4BQQA 3RS4A 1ZAYA 4REQA 4FOOA 4YJ3F 1ZD5A 1M8GA 3N8IA 4QSHA 2QW1A 4KPUA 3X1DA 1SN7A 5H4GA 1I1OA 2NPFA 4JITA 1L1EA 1WKVA 4R1PA 2D5IA 4E3ZA 3DVAA 4HEHA 3I9OA 4FDLA 4ZTUB 3IFSA 2WK1A 2Y1KA 2QSJA 1PLKA 1UJ6A 3EIWA 3H4MA 4C3OB 2Q1YA 3QF4B 3E9EA 2C5FA 3EZGA 5LQMA 1EVQA 4Q6WA 3UQZA 3PJRA 2D5AA 4P0TA 4BQRA 3HBMA 4FZRA 4WGFA 3ZQ4A 3DCJA 2ADOA 1C14A 1XBTA 3CRNA 3JQ8B 2ZYWX 3ZCTA 5BR7A 4FMPA 4MYTA 4X97A 3EZLA 4B6EA 1GQFA 4MV8A 3PFFA 2PGAA 4GRIA 1BNCA 1QR2A 1DIGA 1RD4A 5ALLA 5ALPA 2NXEA 1A9TA 3E5HA 1FDRA 1L4MA 3IQWA 3IMCA 4H3HB 3ZQ6A 3K0AB 2RAUA 2J9FB 5EMJA 1UKCA 3N3BC 3U26A 2OHVA 1NW4A 2FETA 1NKVA 2AXQA 4I50A 3FCXA 4MYRA 1JEYB 3SBXA 4I2NA 3ZGYA 3IVGA 3BRCA 1OTYA 4QGBA 1I6WA 1GTL1 1JLHA 3C41J 2OHJA 2Z6VA 3Q9SA 3VR5A 5C34B 3TZCA 2MSNA 3KO8A 2UZAA 3T5AA 1K6IA 3INYA 4BEVA 2GCEA 1YQEA 1MIHA 2Q0QA 4XIIA 3KWLA 5KVCA 1Y4UA 2QE7D 1BD4A 2G9NA 3OZWA 5REQA 1TO2E 1VDMA 2DH5A 1E79D 4TM8A 4D8YA 4YQFA 1ZRNA 3MAJA 3Q3IA 4MW2A 4OK6A 1L5GB 1G20E 5C1BA 1E69A 1ZL0A 2DP4E 2P3OA 3P94A 4RWZA 3SX2A 3EXAA 3VVBA 3WFJA 4PBTA 4U7DA 2C9CA 3UMFA 1PVOA 4HNAA 3DZDA 4DCMA 1R2QA 4QVGA 3VZBA 1T1EA 4GZ6A 3DEFA 3K9QO 1GRVA 1SU8A 1WHSA 5TEWA 2FSIA 3W5JA 2VYVD 1ISMA 3KKMA 1CFZA 1JHVA 2NVUA 2PA3A 1RWOA 2W2KA 1U0GA 2DF8A 3U60B 4M4SA 2O8DB 1ZOPA 1GITA 1L4NA 3EDRA 5EJ9A 2GETA 4ZOLB 4EFMA 5JPIA 3KKNA 5FR2A 5ALRA 1NBME 2NTNA 5DBGA 2WIBA 4EZBA 4Y2TA 3MB5A 2OVFA 2R8PA 3EYAA 3S2ZA 4BHTA 4BWGA 3KEFA 2VHYA 4K9PA 5H9VA 4Y2UA 4G1UC 2YWDA 3IJEB 1DAOA 1N9GA 2E1RA 1PFYA 1HNZB 1CZNA 4AP5A 3KU4A 4LJSA 3K30A 2YJGA 2VT6A 3VR1A 5LKRA 3TGPA 2VAXA 2WVJA 4I5DA 4I1RA 3LHFA 5ALSA 4BC1A 5CITA 4NBUA 5KKNB 5HF8A 3S2EA 4F5YA 2WKPA 1P1FA 4EVQA 2PIDA 1OWNA 3PD0A 1N0VC 3M6UA 4JLKA 5DX0A 4D74A 4EB0A 5L3VA 4MVCA 1HT2E 4C5CA 3LG2A 5FBQB 2I65A 1LV7A 3A1CA 1TZKA 3KTDA 4MAFA 3L05A 1DO8A 3W2FA 4K1XA 4BWYA 1G8FA 2X41A 3GJYA 5C4MA 2H2FA 2PZ8A 2Y71A 1JSCA 3EF0A 4BLOA 2P2GA 1GKUB 1XQ9A 1DARA 1XRLA 4KKXB 3WB9A 4BNMA 1Z0SA 1WD5A 2W98A 3HFSA 4JUAA 4LYGA 4N8SA 4RH0A 4RETA 4MTLA 1HLPA 1BX3A 4KXXA 3KUCA 3M6LA 4AQDA 1WW2A 2VA8A 3CLTD 2FSHA 2GBGA 4HLQB 3HMKA 4JQSA 4MV1A 2OFWA 4Z9YA 4CLXA 1D9XA 2JH9A 3HA2A 1B8OA 3I5AA 4HWKA 5CH5A 2DFNA 2FQQA 4PX9A 3UEOA 1JE1A 2MYPA 2WZDA 4K88A 4Y0NA 3KD3A 4JBGA 2P62A 1AS0A 2C9YA 3AP2A 1ULTA 3AHIA 3KKZA 4RL4A 1G8GA 4DCTA 4RVUA 3NONA 4TYYA 1UF9A 3BFXA 2OBXA 3ILXA 4BP3A 3MB8A 1YOVB 1XC7A 5G0SA 1PFWA 4KQGA 3WDLA 3CVUA 1BDHA 1SWWA 1ZCJA 2FWJA 3FB1A 3PA8A 4RSRA 4YECA 5DM2A 3HB1A 4IM7A 4ZN6A 2QVBA 1XQXA 4HYQA 5CH3A 1NDQA 3PPIA 1ZMXA 2H51A 2WT8A 3MWYW 1IVYA 3FVVA 4LC0A 3VPGA 5BYAA 1K3TA 4HYEA 4Z7NB 2DEUA 3OQ6A 4D9GA 1EWKA 2J9XB 2W2LA 3HFJA 4BKRA 3OEHD 4HQ0A 4Q03A 4U5XA 5KSPA 1KI6B 2Q3BA 4BNLA 4C4PA 2QRMA 3TIXB 3EPKA 2B0JA 1LC0A 1WCIB 3I2JA 1YZFA 2PT5A 5JY1A 4K9RA 1IBLB 1H6CA 2QAGC 4FGWA 3BA6A 4JLAA 1S2OA 3OESA 4REMA 4KLZA 2E0IA 5KOIA 4G5FA 1MJGA 2HTEA 4AUMA 1MMFB 1ZNQO 5KVSA 2NZUG 1YK0A 1VRWA 5A9RA 4FYJA 1THMA 2R8BA 1CF4A 1TM1E 1V39A 2C1EA 2P0AA 1VZ3A 1UDRA 3AGPA 4UM5A 4LVCA 4Z2YA 3WGZA 4BN5A 1YQGA 3PXXA 1GL6A 3B7WA 3ZXSA 3NHKA 4U2GA 4K9QA 2A5YB 2ZDHA 5FWYA 1FFXA 1JA1A 5F64A 1G2PA 3LNCA 3LYHA 3OZUA 1C8BA 3LPNA 3OY7A 1ZVKA 1F6BA 4GZ5A 4MPPA 2FR8C 4J1TA 3EPHA 4KYUA 2GN9A 2YV5A 3MJ4A 2Z8YA 3G9ZA 1U63A 4QXMA 5BSMA 2IKSA 1CR0A 4RADA 4PRKA 3HYCA 4L5IA 3QXHA 5EIBC 2A88A 3BQMB 3FYUB 1SQ5A 2CLMB 5KYVA 3JAKA 3WP1B 1AUXA 3R9XB 1GTG1 1CEQA 1X74A 2ZRKA 3TRFA 1QF9A 3K09C 4K26A 2IYQA 4P38A 5DTMA 5EPOA 1C0EA 1CZOA 1NF3A 1G5TA 2J41A 2X2FA 1A9RA 3D3EA 3ZH9B 1TF7A 4F2WA 3ZZ0A 4QHSA 3GP3A 3LO8A 3P5SA 5CT5A 1UJCA 1NVTA 4BCBA 4P7JA 5H0IA 1MZVA 1NRWA 2IYNA 2QP4A 3CLUD 3ENKA 1FLVA 3FNEA 3MUOA 4X3OA 5BN4A 2HT1A 5TF4A 1HORA 3ZDXB 2BRUA 3WGJA 4LW8A 5F7ZA 3BIXA 3CVXA 1XJWA 1WY7A 5HK9A 1D2MA 1VCOA 3I58A 5DHFA 2I54A 1G41A 1ESEA 2PQ6A 2YS7A 2Q3MA 3AVQA 4AKEA 3WQBA 4XRGA 1AC5A 3TSOA 1TTHA 3N2LA 3B3JA 3I9FA 3EG9A 2FA9A 3P52A 2H5JA 4H3KB 3VR6D 1FTNA 2QVZX 4XH9B 4Y30A 1QU2A 2MYUA 3PYXA 1OAOC 5HDQA 2GZSA 2I91A 2BEUB 2YYSA 4QDJA 5HZKA 4MVWA 1I2ZA 4GX2A 4RF2A 4D9EA 1XD9A 2R7KA 3MILA 1Z6ZA 4K5QA 3M6FA 1B8VA 1RI2A 1XSEA 2B1GA 2JRCA 1BZYA 2WKSA 3BXOA 4MGHA 1SUBA 3SXUB 5CT8A 3DGFC 4AKTA 1PJQA 3GJ6A 4H7DA 4NJEB 2J3MA 1B8PA 4GXNA 3VKGA 2FN4A 5DDIP 1AKNA 4TZ6A 4FFLA 3E61A 4DABA 5AK4A 2FF5A 3VR0A 1E7RA 1CVIA 4Q1FA 1CJVC 1NU6A 4XQCA 3UYLA 2IUTA 3OOHA 1E8MA 1IIBA 1N5LA 4ND1A 1DKLA 1EI9A 2C2HA 5PNTA 4JB3A 1RAHA 1XCPA 5A3VA 4EHJA 1T2CA 1PZFA 1QHHA 1VPVA 2CJYA 3GNLA 4AS2A 1C3LA 3N5CA 3MYYA 2J0SA 5ALJA 3FWPA 2VK2A 2AL7A 2ISSD 2XYVA 3A3YA 3EQ8A 2NO6A 4R9SA 1DL5A 4TTSA 3ICQB 4YJKA 1N5RA 5EJ2A 4JXZA 5T5QA 1XTUA 4INOA 4A8TA 3CNNA 4WGGA 4CETA 2QTMA 2OENG 4QGFA 4ZQBA 4EG0A 3FPJA 4FYHA 3L3BA 2CFTA 4TWIA 3WMFA 3NJ8A 4D97A 1XQ1A 4GEGA 4F60A 5JJ5A 4WVFA 1P7CA 2AG5A 4XFKA 1HNWB 2ZBRA 1CZKA 2FLVA 4C4AA 5AW5A 4IVNA 4CMEC 1NSTA 3ADPA 3RLFA 3CZ9A 4EA6A 4YQEA 1F6DA 4BRWA 3T0GA 1QO7A 1YGPA 3N39C 4FYVA 2Y92A 1QTQA 3C6XA 2GESA 4ERNA 1M5UA 2A7XA 3Q7SA 1Y7LA 4I4TB 2AI1A 3DZ8A 4H7IA 5JMTA 4R1LA 1YT5A 1D0IA 1D5WA 3WGKA 5FDFA 1JEDA 3PV0A 2JIDA 2HSZA 1EFVA 3VGPA 2VKTA 3KBOA 3RYHB 4RV5A 4RHCA 3H3XA 2G5GX 3PI6A 1Q74A 2PS0A 3IO3A 1F7VA 5L53A 3KYIB 1UWKA 4IO1A 1RS0A 2I4MA 4E4TA 2YN0A 4JJFA 3O93A 3PIRA 3MEQA 2BMVA 2WZQA 5B37A 3WLTA 4RPKA 1M6WA 5EHXA 3A8TA 3SHFA 2Y6VA 3FWHA 2RGEA 3VAAA 3QY9A 3U7GA 2IW1A 1KDRA 1SA0A 5CG2A 3UHJA 1AK9A 1IK6A 1JEJA 3BBPA 3INGA 4C7VA 4ZMSA 2ZCVA 3LYLA 3THWB 3CN9A 1E9FA 2C29D 2RG1A 4GKVA 3ZWQA 1T29A 1T2DA 1WDTA 4ALJA 2IV2X 4BO4A 3WYNA 3ABIA 3QKSB 4PZUA 4WZAA 2X0NA 5ECDA 3IDOA 1Z0KA 2EKBA 4PCUA 3L46A 3QF7A 3COSA 4KLAA 4RAQA 3OT5A 5CJJA 4YY3B 4MIOA 1XNQB 5AH0A 2Q9UA 3PQ3A 1LVUA 5ALFA 1GNQA 1LUAA 2J33A 5EWJA 5FFNA 1JT9A 2OXIA 4MR7A 5B4TA 2ZYVX 1XB2A 3ITNA 4XSHA 3BFVA 4R2XA 1RQXA 4UVEA 1T25A 3T6KA 1IIRA 2RFLA 2CL5A 4ESHA 4BMNA 4FC6A 3V8MA 1VIAA 3GR6A 4TMWA 4WLNA 4CIXA 4QUKA 4UHKA 2P4QA 2OGUA 4QX6A 2EFJA 2G9RA 2F59A 2OY0A 1JU3A 4NYMR 2ZJFA 4BFLA 2UXDB 3K31A 4BAUA 3T8YA 1P1KA 3VM6A 2ONYA 3FGOA 2DWUA 4YRCA 4K6MA 2ID9A 2K7FA 3BWXA 1J5EB 4MVJP 3THXB 1NFFA 1RXSA 2V54A 1B6RA 2I7VA 4HTFB 4QOSA 5GOTA 5T4HA 3ZU3A 2CXSA 4AIRA 5JFGA 4ARZB 4DBLC 1XMXA 3J81k 2XB2A 3RTCA 3ORRA 4G5SA 1JG6A 4JY7A 4B3IA 1EH5A 4GQAA 2YRFA 1V6CA 1S3FA 1YULA 3NHPA 3OHSX 3LWBA 4YPFA 8LDHA 3H2JA 4BEWA 3TLGB 3UK7A 5F3DA 2MMGA 1K3UB 1A95A 1G63A 5ILQA 1N5OX 3GRCA 5DTIA 2ZCJA 1KIAA 4P32A 3SJBA 3M6IA 3EIHA 1WR8A 4EHLA 2YYYA 2BKUA 3Q85A 1T4CB 1M2VB 2OXEA 3BK1A 4C04A 1E4VA 4I1IA 4HXFB 1MO5A 1J2JA 1UXJA 2VTVA 4A16A 1S9DA 2Q27A 1L4LA 3O8DA 4LGCA 5D1NA 4I3HA 3BMCA 4BUCA 3SJUA 1JAYA 4GPD1 4HN9A 3OM1A 3LOQA 3LLMA 4ZCPA 1DQNA 2OKCA 3ZHQA 5HM6A 1B4DA 3N74A 2HX1A 1IQ0A 1HMYA 1WXWA 4I55F 4RHUA 1DTSA 2FK8A 5EZYA 2N47A 4FNOA 2GEBA 3LK6A 4BMSA 4DV7B 1SXQA 1ZWLA 2C82A 1GYRA 1IZ0A 1DUIA 3ZTYA 2FPGA 1Y7TA 2RHWA 3L84A 1VLVA 3HKBB 4Y1GA 2CV2A 4URYR 3GHHA 5ULLA 2YNMC 2CNLA 1X1AA 2QE7A 3LUGA 4ND7A 5D3ZA 3S4YA 4E7PA 1M34E 1X3LA 2CJPA 1TVCA 4WH0A 1SIOA 1OLUA 2R00A 3BUSA 5DB4A 1NP6A 3GMTA 3TNYA 3VRHA 3WJ7A 1JWLA 1XVIA 4IKEA 4B3FX 1ZA2A 1USWA 2RH5A 3DOHA 4NBWA 2FJ0A 1U80A 3K8QA 4ZALA 3OC0A 4QECA 2G40A 4D6YA 4HGRA 2UYQA 4LXIA 2AN3A 4FZJA 4QUEA 2XMCA 2XDWA 6Q21A 5KWVA 1BFUA 1KJ9A 3PA6A 1OU0A 3O7MA 1WA5A 4U00A 2UVPA 2VYVA 3ZHVA 1Z6PA 2PLRA 4U9HS 5LQAA 5CVDA 1AG9A 2H18A 4HQ6A 3L2OB 5TPWB 4BBAA 4DIKA 4AQYB 5I47A 2WM2A 4ZDWA 5DNYB 1HK7A 1TYAE 3PE3A 1MVOA 2R8EA 5THKA 1LSSA 4AROA 3F67A 2AOUB 4QUDA 1VJ1A 2YRXA 3OT1A 1AK2A 1TEVA 2I2AA 1FNMA 2AC4A 4P98A 2CXNA 2V59A 3FRIA 3PRHA 1PT5A 2VNSA 4LQLA 4X85A 4B5KA 1SCKA 3H4TA 3H2SA 4GF5A 3IAFA 1EK6A 1M8KA 1PCXA 2ZJ3A 3BIJA 3OU6A 2OYRA 3ZDQA 1RWQA 5MN6A 1J0DA 5LWQA 3WK6A 5KYKA 2CXPA 3DOFA 5DJ5A 3FMPB 4CMJA 2X8WA 3TZLA 3JZIA 2AKYA 3U17A 1QZ3A 4MWOA 4DA0A 1Z2EA 3AUJB 3DZKA 4P53A 4PLZA 2IXFA 1DUSA 3S1AA 4KI0A 1FDIA 3TW8A 1KXJA 4C5BA 3F3KA 5KNDD 4M53A 1QRSA 2AKEA 3GRKA 5CEFA 4ENTA 5JO0A 4URZR 2OORA 5K7SA 2JI7A 5LA6F 2WTMA 1KNQA 1DX6A 3DFIA 1FRNA 3I4LA 3RSZA 3JW8A 4KYVA 3HK2A 3EPPA 4PC1A 5ADVA 1NVDA 4Z7JA 3H18A 4CIYA 2QVYX 4GUDA 4HN2A 4MDFA 3OVMA 4TUYB 4OQMA 2C77A 1ZN9A 3DD1A 1OT3A 1TLLA 2R1TB 3KR2A 1ODLA 1G0OA 4HWRA 5DTRA 1JQAA 3HA5A 2EP7A 1O8BA 3IKLA 3QWBA 4PLFA 3JWJA 2I87A 2Z1DA 2VEOA 4I08A 4B82A 4YDHB 3PS9A 4MRSA 1CHNA 4KWHA 1I10A 3JQ9C 3GRVA 4M7OA 2J59A 3CPHA 4HD8A 4WLOA 5E6SB 2IXDA 4D1YA 3IUBA 4II7A 4AY3A 5AK0A 2JAXA 1Z2OX 3F46A 4L2IA 1Z0JA 2IYUA 3DMFA 4LYAA 1PJAA 1DPFA 4BRSA 3F3SA 2PMFA 1HC7A 4CV2A 5BSVA 2PEZA 1T0JB 5D86A 2ZJ7A 1J24A 2EFYA 1LZKA 1CF2O 1JKIA 3HSKA 4JBIA 3EGIA 3HFGA 3ZHBA 5EZ6B 2YY7A 1NVFA 3OEHA 1ZIOA 3DP9A 1TXGA 3U5ZB 5B6PA 2C98A 3HH8A 2B61A 3QBJA 4L5AA 1L4UA 3Q15C 4JI0B 1RABA 1NX6A 3EDOA 4MKGA 4GM4A 3GVCA 1CIPA 3SY8A 1Q21A 2IZZA 2AWOA 1KVQA 1P4GA 1G5QA 2Q3LA 3W5AA 1WSWA 3SQOA 5I9NA 2IEZA 3UJCA 1V16A 3OPYA 2ZYHA 1SXJD 5KNBD 3W0LB 2YW2A 3T12A 2XXJA 4J03A 2ZIGA 3WI7A 3PKZA 2IXGA 3QZUA 5D1HA 5TC4A 1M5RA 3T1HB 1CF9A 3BDAA 4JUCA 2OLKA 1JHYA 2FN7A 2QRQA 4H4DA 3TBHA 4RLSA 3GMDA 2BFPA 3T4XA 2CK3D 4C07A 2XNSA 1P33A 1R4NB 2BC9A 4YNBA 2QMEA 4XX0A 3U62A 3USES 1R74A 3OHMA 2GYVA 1I6MA 1E77A 5B3JC 5K3CA 1H3FA 1DG9A 1V5WA 1G19A 5DLDA 3NDPA 3TWOA 2XHZA 4LMBA 3IP9A 4FEGA 4DMCA 1FMJA 3I52A 4OYYA 4NNJA 4I0WB 1YVPA 1IEQA 2QUAA 2HMUA 4QFDA 4EL0A 4LRXA 1QNLA 1W5SA 5KNDH 3FBTA 3KR1A 4HAOA 5JCXA 2WFZA 4D4HA 2WAXA 5FWAA 3BCSA 1L5WA 1TECE 2C5AA 4NJOA 4RQAA 1M6NA 2R8OA 3KYDA 4N0QA 1J23A 2CFCA 1RWXA 1G8JA 4FDAA 5AKYA 3RK4A 3QG1A 2XDAA 5GGXA 5TARA 2CDNA 4GI2A 4CEIB 4WCFA 3T5GA 1H23A 2R66A 1TC2A 4AMVA 4CEHB 4BAGA 2X58A 1R37A 5F1PA 5F3WB 2G08A 4PQFA 4RPGA 1UIMA 3UQYS 2Y1FA 2H7YA 3GVPA 2Q5LA 1SUEA 3B6ZA 5JS8A 5E95A 5DMXA 4IY1A 2HO4A 1ST2A 3IOMA 3S5UA 1SCAA 2XJ9A 3P9PA 1RXEA 2J87A 3SXJA 2V7EA 4GU5A 3SE7A 2LXNA 1FUKA 4YAIA 5C8ZA 4QGHA 2DFKB 4ER0A 1SKBA 4HNTA 5BWLA 4QA9A 1ONSA 3L1JA 4C6SA 3VR6A 1DAKA 2I6UA 4MI1A 3K9LA 1XWIA 2HPHA 2ZPTX 3OPYI 1ZLYA 2QNRA 4EBFA 2I2FA 1T1JA 5LM3A 1UBUS 1N7HA 2PX6A 4FHCA 1ZM9A 3SM3A 3CVWA 3UYKA 3JARB 4Y6OA 4MGEA 2JGDA 3G2PA 1LLDA 2H0RA 5F1YA 3V34A 2Q1TA 3PC4A 3B70A 3QX3A 1ZM7A 4KI7A 4JFAA 2WILA 3VBCA 1QV9A 4H16A 1E2KA 5CNMA 4Q18A 4MVJE 1WDLA 4XSGA 2JGNA 3NFYA 2D54A 1ZI9A 2PL3A 2W37A 1G6OA 3G8AA 1BFKA 2QAIA 4PAQA 3W6NA 1ZH4A 5HXAA 2I7TA 6REQB 1W8IA 1XE3A 1UT8A 2CNBA 2X8AA 3JAWB 1E2FA 4HGQA 4ZYTA 1N78A 2P5SA 5CT9A 5B7GA 3CLVA 4OKNA 3VPCA 4AJIA 2JKVA 1NR1A 2QWXA 3P9RA 4EX6A 4P83A 2DLCX 1QG4A 1GOTA 5MFZA 1B2RA 1H0SA 2NNWB 1E2UA 3JRXA 2CBGA 3KJNA 5HBGA 1SQGA 5GZ3A 2GSDA 4NQRA 5DK4A 3D59A