2V5VA

W57e flavodoxin from anabaena
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
169
Chain Sequence
AKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTENIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Tuning of the Fmn Binding and Oxido-Reduction Properties by Neighboring Side Chains in Anabaena Flavodoxin.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Electron transport
total genus 60
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2v5vA00
4ZVLA 4LTMA 1AKQA 3W78A 4LA4A 3U7IA 6NULA 4XDHA 1FLNA 4QOIA 1T0IA 1RLIA 2X2OA 3GFSA 5LBTA 1SG0A 1ZWLA 5TGZA 1FUEA 3OJXA 2Z9CA 4FGJA 4D02A 3ESZA 2OHIA 3D7NA 3EDOA 3B6JA 2QX8A 4CETA 3LCMA 3OWXA 2N1MA 5B3LA 2MT9A 3NHPA 1XYVA 5FUQA 1V4BA 4LTNA 1OBOA 3F90A 5LJLA 3GFRA 1QR2A 5LLDA 3KAPA 2KQUA 3N3BC 3B6MA 4C14A 3FW1A 1FX1A 1AHNA 1BVYF 4ZVKA 4QOFA 2QX6A 1CZHA 1WSBA 3KEGA 1QHEA 4XDGA 3F6RA 3EYWA 5LJIA 3SVLA 3ESYA 3B6IA 4YAOA 1AMOA 3ES9A 4PTYA 1AKVA 1YOBA 2Z98A 3F6SA 4U7HA 5F12A 3NHFA 1CZRA 5F4BA 1RTTA 1J9GA 3NHJA 2M6SA 3KLBA 2FX2A 4BMOB 1QRDA 3S2YA 4QOEA 4U7GA 2A5LA 3W77A 1GG5A 2W5UA 2BF4A 4ZVNA 2OHJA 4H2DA 5LVAA 3HA2A 3HLYA 3ESXA 3NHRA 4C0WA 1DXOA 3QFRA 1ZWKA 3OVMA 1YCFA 4GR9A 3UXEA 3O2NA 2R97A 3W7AA 3NHLA 2BN4A 1BU5A 3NLLA 1D4AA 5NULA 1FLVA 3U7RA 3L9XA 4F8YA 1CZLA 4N9QA 3JSXA 2KLBA 4H6PA 3L9WA 4PTZA 4YAUA 2OHHA 1NNI1 5B3KA 2MOKA 2BPOA 1T5BA 3KAQA 4HS4A 3O73A 1H66A 2FZVA 3TEMA 1AZLA 4LAFA 3OX3A 2QMZA 4QODA 3N39C 2X2PA 3B6KA 1JA0A 3G5MA 3W79A 3K20A 3FVWA 5LBUA 5JROA 4NLLA 2FCRA 2R96A 2M6RA 4M0CA 2D5IA 2F1OA 2FZ5A 1FLAA 2Q9UA 1OFVA 4HEQA 5BUCA 1XYYA 1FLDA 3OX1A 3NHUA 1SQSA 1KBOA 4Y7CA 1YCGA 3NHWA 4GI5A 1E5DA 2WC1A 3TE7A 4BMPB 3F2VA 2BZSA 3P0RA 4QOHA 5EAIA 4ICIA 4YALA 1C7EA 4S24A 4J8PA 1X77A 1FVXA 3N3AC 2QWXA 5FA6A 3UXHA 3NFRA 4YQEA 1XI2A 1YCHA 1YKGA 3FJOA 1FTGA 2Q62A 3ZHOA 2AMJA 2V9CA 1ZX1A 2FOXA 1OBVA 1J8QA 1KBQA 4C76A 2XOEA 1AG9A 5LMCA 1AKRA 2ARKA 2ZKIA 4YAWA 1CZUA 4QOJA 2FAXA 3FX2A 2V5UA 1B1CA 3LT5A 2QX4A 4DILA 1F4PA 2MWMA 3NHSA 1J9ZA 1XT6A 1JA1A 1I1OA 2B3DA 2XODA 2QX9A 3R6WA 2FVXA 1D03A 3GFQA 4C0XA 3HR4A 2OYSA 5FX2A 5EMNA 3QE2A 1DX9A 2HNBA 4LTDA 4NULA 1CZKA 2FLVA 1RCFA 1C7FA 4R81A 4DIKA 1AKUA 4PU0A 4ZVMA 2MTBA 1D04A 1VMEA 4N82A 1CZOA 4GQIA 4YAFA 4Y9RA 4FX2A 5EA2A 1H69A 2HNAA 4FGLA 3TZBA 3K1YA 2QR2A 1TLLA 5F51A 4QOGA 2BMVA 4CF6A 3GAMA 4FGKA 3NHYA 3RPEA 3OWHA 3QFCA 1AKTA 2FDXA 4U7FA 2QMYA 1DXQA 3OJWA 2RG1A 4ESEA 2V5VA 2GSWA 1YDGA 2HPVA 1CZNA 1QBGA 1YRHA 3FNIA 1WSWA 5NLLA 2Z9DA 3NHKA 2Z9BA 1AKWA 5A4KA 1TIKA 3OX2A 1J9EA 1RLJA 4N65A 5ULLA 4DY4A 4OXXA 4Y9UA
chains in the Genus database with same CATH superfamily
1KZ7B 4IF4A 4LTMA 3LQKA 4CR7A 3LNTA 1ODFA 3QQ5A 3R6GA 1QUEA 1BJTA 3TNFA 3FOEC 4EEZA 4YJKA 3NUZA 2RHDA 4R98A 5KYNA 1EZ1A 4P36A 3PE6A 3AP1A 4Q9NA 1ZL0A 2ZI6A 2W90A 4J6EA 4RQAA 1A9QA 5FADA 4KMOA 4C04A 2BJWA 4CCAA 4ZYVA 2BFMA 4TYPA 4RA9A 2OSVA 5C8XA 1ADCA 5FBLB 2DETA 1WY7A 2C2YA 3I2FA 4OGLA 3QNMA 1HDXA 1UZAA 4W8OA 5FA5A 2IF2A 4BNHA 1JFTA 2WHPB 1P31A 2X3UA 3CJQA 5LQKA 1IMJA 1IOVA 1Z6XA 4LIPD 3UV7A 4YRFA 4DA0A 1GGVA 1UZLA 1BDMA 4WOJA 1EFVB 4M46A 3DZDA 4Z0HO 2YY6A 4FUTA 1Q7BA 3D8NA 5JSYA 3VHLB 1V7CA 1LU9A 4L9SA 3Q40A 1T9AA 4Q02A 4TXJA 2OVFA 3RABA 5HM6A 3SFVA 1DKNA 2PGIA 1KJ8A 1KARA 2ORYA 4N7RA 1U8TA 2AE1A 2HLNA 4EG7A 2QLMA 2R6JA 5DLDA 2MT9A 2NU6B 3RC9A 4FD3A 4EF6A 1MB0A 3ZGVA 5D84A 1YBFA 4F3KA 1NJ1A 2WIDA 3CUVA 3QI7A 3NDPA 1IWOA 3MMXA 1KAEA 4ZAGA 4DV7B 4K88A 1LPNA 1M2OA 1CY8A 5AM5A 2QA5A 5LJLA 5KJFA 2NX2A 5CG1A 2QT1A 5COBA 5ECWA 1PWXA 2E1RA 2ZWIA 3I04M 4Q7LA 3UOGA 4K6CA 5BP7A 1K4YA 1SY7A 1GU1A 1ZY2A 4BO4A 5DXJA 1MPXA 1JVSA 1KPGA 4L8VA 3QKUA 2NUAB 4C14A 5K20A 1VCHA 1FJGB 2VHZA 2OZKA 4HX2A 3RR2A 4CR6A 3LYUA 1XQ1A 2OG2A 5LXTF 1NN5A 1SAYA 2NIPA 3FPGA 4MRSA 1YVPA 4ZI2A 4QJ3A 3O4GA 4RGBA 4U00A 4YECA 4HOYA 1U28C 1KO5A 1DBQA 1G5FA 1HZJA 1VL8A 3PRJA 4JJ8A 1KMMA 1GAEO 4J1SA 2JDIA 1EH5A 1WTCA 1YTUA 2WRZA 3NOOA 1ZN2A 4TTTS 3WLSA 5KTPA 1QR6A 3PVCA 1Q7GA 2IIVA 4MA4A 1YRYE 3O4RA 3C8MA 4TV8A 5JNRA 1LB1B 3JQAA 4N39A 2ACWA 4D57A 3FB1A 3PC2A 2O8NA 2F00A 3OMWA 2FZLA 3QVWA 1GKIA 1THGA 1U02A 3P45A 1BA2A 2A33A 2EU8A 3SYMA 3U3MA 2FSGA 1MQSA 2IHZA 3GLVA 1RI4A 1DP4A 4C3UA 3ADBA 2PX5A 4LGYA 3VR4H 1EK2A 3DPSA 3SQNA 3EFBA 4FN5A 1ZRNA 4C1BA 1C7JA 5BN3A 4RD1A 1AK2A 1C9KA 3HJRA 4PC3A 4HXYA 4H60A 1ISJA 1AQUA 5ADHA 3ZWCA 3HJAA 3LUCA 2JJ2D 3R41A 4ZVTA 2DPMA 2ID4A 3HJHA 3HLKA 1TD9A 5U4XA 1XZDA 3LL7A 5BQ3A 1PNVA 3LAWA 2UYCA 2Y92A 5FB3A 4R1PA 1RTTA 2OK7A 3I4LA 2VDLB 1YJ5A 1LK7A 3RW9A 1IHXA 5HRUA 1U1CA 5A4IS 4NXNB 1KO8A 5CXQA 1WLYA 5C5DA 1CE8A 3LPMA 3PGMA 4ETNA 3OQOA 5HS6A 2HBYA 2Q4BA 1Q95A 3EXFB 1SN7A 3NIGB 4QHSA 5HFNA 4D96A 2EAUA 2JCBA 3EG9A 2PX0A 1W5FA 3KSBC 4TS1A 4C0JA 3GD5A 4H2DA 3S70A 4LHWA 4EJ0A 1L5RA 2H1SA 1NP7A 3BM5A 4RTLA 3DLPX 4XD2A 4PZAA 5A1TA 1XRJA 1DAFA 1EUZA 2ZAGA 1ITZA 1Y9ZA 4RORA 4MS4A 2O3JA 3M82A 1EG7A 3AV3A 2IC5A 1IN4A 1GVNB 2PIDA 1NUQA 1VIYA 4G4JA 4YRDA 2VQ3A 5FHRA 2PS9A 1PV4A 3MMNA 1CBUA 2QAGA 3HXLA 2XE6A 3L0OA 1YSCA 3F98A 4QYTA 1L8OA 1QYIA 1VZ3A 5GWXA 1J5EB 1V9LA 1A9ZA 1C0KA 1X1QA 1XJQA 2RI6A 2V97A 2X2FA 5GONF 3SPXA 4E5PA 1N33B 1CQXA 2OCAA 2IUTA 2G0TA 3NLLA 4INZA 1UDBA 3KDPA 3RYHA 1MQ9A 3ENWA 3UY4A 1VYUA 1OU0A 1W1WA 5CNJA 4MQ5A 2Q46A 5NULA 3CBGA 3UWKA 2QORA 3TECE 2R11A 1VPWA 1BXGA 3MMPA 2J3QA 1BOOA 1CIPA 3FDXA 3O8OB 1QXSA 4CHTA 2CBZA 1NVVR 2WFLB 3JSXA 4URHA 4F2GA 1C81A 3IAS6 1Z12A 2FZGA 5BYAA 2ZEJA 2HT1A 3HVUA 1JVBA 3IAS1 3S2GA 5I6DA 2FXIA 3VHXB 3H04A 3E35A 1KEVA 3BL6A 3SKYA 3W5JA 3PUYA 3SDSA 2BUCA 2FEKA 2XQGA 4FTWA 2XXAA 2GF2A 2WKRA 3QF4A 2ZYDA 4DDUA 3ABRB 1ACLA 3E7DA 3CA8A 3H8WA 4OD0A 4RTJA 1L7QA 1IVSA 2EHJA 2ORWA 2B61A 1A7AA 1CRZA 2G9UA 3R1IA 1ZW6A 3EEYA 1G3MA 2I3BA 1HORA 4J03A 3OO1A 2VLBA 4OK6A 4PHGA 2ZE7A 3L49A 3WTCA 3KELA 3A1EA 4ON9A 1S0UA 5DMHA 3K8QA 1AMOA 3IERA 4YCLA 3X0DA 2I03A 4DMMA 3QLVC 2PLAA 3U3DA 5JASA 4IP0A 2OCGA 4AMUA 2DU8A 2L2QA 3WQRA 4H0CA 4LJ5A 1IYZA 2EYUA 3D31A 2HJGA 2C7QA 2BFEA 1E0AA 4MKIA 1IU9A 1S9DA 1OT3A 2PRIA 1NKTA 1SOWA 2H2DA 4ADSG 3JAKB 3PDIB 5FTNA 2B7CA 5L3ZA 3THOA 4IDFA 2V45A 3AIMA 4DUGA 1XN4A 3GYGA 3LFUA 4WUVA 3L6RA 3ZDZB 1M1YE 4H35A 5FPPA 2ZIUB 1O1YA 4URXR 4KQMA 4MITA 3QSGA 16PKA 1DE0A 4MPDA 3P2OA 1EFHA 3P0IA 3NM4A 5IKOA 3AX6A 3NV7A 3LK6A 3S40A 1RXYA 4D1YA 1W35A 5LXTA 2IYAA 1COZA 3GJSA 4H7HA 5E7JA 3EWSA 2II6A 3EQ8A 1SD1A 1TUEA 5A3RA 5C7YA 3MBIA 4ZZ3A 3SHWA 2D59A 4GOKA 2ZTSA 1P4AA 3D3NA 3E3LA 2G1AA 4PZLA 3W7AA 4Z0NA 3P96A 4K9PA 3N0XA 4J75A 2IJGX 2VAMA 1WHTB 5DSTA 1XTRA 3IX7A 4U63A 3STYA 1QRSA 2GCOB 2GHRA 1QQ6A 2QDXA 2JRCA 1VB3A 1OFVA 5EIAA 3OURA 4MVYA 4JD5A 2DWOA 1WP4A 1G6HA 5FBKA 4IRXA 3RSZA 1TCCA 4B45A 2QE7D 3AMVA 4JENA 4TWRA 3IUEA 2ZULA 2AV6A 1H0KA 3EPKA 1Q91A 3NWPA 1W48A 3SBXA 2WD7B 1FBTA 1OWOA 1TO2E 2I4OA 2W83A 2VCYA 5AI6A 2H54A 1NTOA 4HN9A 4OXRA 2ZIZA 1SVSA 3OX1A 1XALA 3GVHA 5FPTA 3RIGA 1CFJA 4UULA 1EINA 2CZQA 1BFUA 4IFBA 3GLIA 4KPUA 3S1SA 2CNNA 4GMHA 2MYUA 2OBBA 3OC6A 1GL6A 4KQJA 4LYYA 1N6IA 4MJLA 3UV3A 4CG0A 5D3KA 4P84A 5LQUA 1NNEA 3RLIA 3F2VA 5CAEA 1P62B 3KEQA 1IZ7A 4WK2B 5EAIA 1NQAO 1RZRD 3KL2A 4L5CA 2J7PA 1N36B 1DWPA 2ZYTX 3A6PC 5KJ6A 4TS9A 1T9DA 1VHQA 3AUXA 3D6JA 3WYNA 4EVIA 5K8CA 2QX7A 4LF8B 4YAJA 5KVSA 1W4CA 3OCCA 3E9DA 4QEKA 3U61B 3RUIA 3HDJA 1ZC3A 3OE7D 3ZJYA 3ZEAA 1Y81A 1X8JA 2ODNA 2J3KA 2D1FA 4W1QA 2Y99A 2A9JA 3BXXA 3OZXA 1I5OA 1K63A 3R4CA 4JR2A 1NR7A 2QNBA 5AM1A 1KYZA 3V8QA 3RG2A 3WK7A 3WLLA 3HB9A 2DG2A 2I6SA 4FZRA 4ALLA 3DYBA 3M9WA 4UDYX 1T1GA 3T94A 1Z28A 4UDNA 1FNNA 1MX1A 4HN4B 4EHIA 4F9TA 5U1PA 1XEWX 4ZOEA 2HK6A 2YWFA 3WY9A 3ZI7A 10MHA 1UBTS 1A5TA 2VTKA 2ZUDA 3DUFA 3NYWA 4JGIA 4TROA 5GONA 1UODA 3AHFA 1OH7A 3G8BA 5HKLA 2RGGA 2FOXA 2WIBA 3C8HA 4BO5A 2NYVA 4HNGA 3ESQA 4F46A 1AH2A 2GCGA 1YU9A 1BX3A 3NKLA 3PYMA 4J1QA 3TW0A 4RXTA 3VZCA 2Q3FA 2J5XA 4IQFA 2HLHA 4QUGA 4YJHA 1UJ4A 3P19A 2PRJA 3BC1A 1HQKA 4Q18A 3HVJA 4EATA 1ZZGA 1E98A 2FRXA 3HFGA 2WINI 3KKQA 4IJUA 5HWSA 1YOVB 5JSFA 3MRTA 2BKAA 5HE8A 3CLUC 4IWYA 3QVVA 3E9NA 1G5QA 4F06A 2FMKA 1V3VA 3R74A 5JCOA 5E1OA 4DA6A 1W2WB 4S1OA 1PL8A 2EKPA 4NEGA 3BXGA 5I7RA 4A36A 1CRPA 1FQKA 1JMYA 1KU6A 2MSDB 2EBFX 4JODA 2ZAYA 4JQYA 2IXGA 3B2QA 2XMCA 4YRCA 3VO9A 4ZCIA 4LOLA 4L3WA 1OFTA 4ZCLA 1MAVA 2IKQA 4IIFA 4N7JA 2FZCA 4KKXB 2ETXA 2XCQA 4LVNA 3VX4A 1ML4A 5ITWA 2C3MA 1F4VA 1KRHA 2JJQA 2I7VA 2IZZA 2W2VA 1Z0SA 4RX1A 3E22A 4U5QA 4CVNA 4E5MA 1U9IC 3B1YA 1EDEA 1SXPA 2D0PB 2QX9A 1Y98A 3CE6A 3OP4A 3E05A 4PWYA 1G64A 1L1EA 4Y2GA 3IIIA 3RVQA 1V4VA 3MWDB 2WFAA 1HT0A 4JUAA 4YO8A 5EFZA 4BCBA 1YFJA 2C1EA 2I33A 2CY0A 1Z5VA 4RA6B 4ZV7A 1VMIA 5DNDA 4BN5A 1RZUA 2PXCA 3B2NA 5KJ1A 4EVQA 1DX9A 3L6BA 3M89A 2VQDA 4G5HA 3NVAA 5D2CA 3T5CA 3USES 5CA0B 3M1IA 2I3GA 3F5MA 1R6AA 2NVBA 4AIRA 4F9EA 4YP5A 2ANCA 2A58A 4GS5A 5E7IA 1I1NA 3B38A 1TQ6A 2WD9A 2YZGA 4ZT4A 2ZUWA 4O8CA 2COKA 3RS4A 1KJJA 2XQFA 3TR0A 3QBDA 3DVLA 4E2FA 4BV8A 2H9AA 5ALJA 2DWCA 3KLMX 3VU0A 2JD1A 2V3WA 3BTSA 3JWEA 5FHQA 1MOPA 3LYAA 1MRZA 3IDQA 1YR8A 4KL8S 4C0HA 4EY7A 2GWHA 3D3KA 3H2GA 1LSSA 3E03A 1F38A 1PR0A 3BHMA 2PKRA 3H13A 5CGQB 4N6OA 2VWGA 4Y9RA 1XTUA 1B1AA 3KTAB 5ALMA 1CK4A 2QJFA 4KP7A 2YUIA 5CW1A 1BNCA 1OMOA 4WMLA 4IIDA 4Q9IA 3S2UA 2BDEA 4OKNA 1QBKC 1PR1A 1Y1PA 1F51E 1OWMA 1ND6A 3CVUA 2LNDA 1WNTA 3NYQA 1YACA 2VPQA 1WW3A 3H97A 3I1FA 1QZTA 1WOYA 4R8RA 1CIJA 4UCFA 5ILGA 1PAUA 5ALTA 2VBFA 6LDHA 3EMKA 1DRWA 2BM8A 2A0XA 1BD3A 1XLUA 2NXCA 1GM5A 1KDZA 5REQB 1N5LA 4M0FA 2XUPA 5HE9A 2KBFA 3WGJA 3VPBA 1J07A 3WL3A 3EMDA 3WWYA 4YASA 3TJRA 4GBGA 2WJIA 1TADA 1TQDA 2Q3EA 2YJ4A 4URZR 3VVBA 3RU2A 3HBMA 4KN6A 3NTVA 2BZGA 1NVDA 4BYGA 2Z1DA 3DFZA 5A5FA 2HHAA 3BBPA 4NCKA 3TZQA 2ASVA 3IODA 1SXJC 2EEPA 1T5IA 1G6OA 2B0JA 2LV8A 1YRBA 3ELBA 3HYSA 3QVSA 4FJ1A 4OA8A 2QAJA 4UUMA 3B70A 2HEIA 1SUFA 2V5VA 2WUVA 1P2TA 3P26A 2F3UA 4I8DA 3WVNA 2HSDA 2DSTA 3AKEA 3ICVA 1T8YA 2IEBA 1WA5A 5JCXA 3QOWA 2WTAA 1TE2A 4WJZA 2PU5A 5K0ZA 4P0TA 5L6MB 8LDHA 3MG9A 2IZ5A 2QMOA 4PANA 1YZGA 3OEWA 1P7CA 2V98A 3PT5A 1B8VA 1RYFA 3AGQA 3ET4A 1D09A 4DADA 2YFHA 3A1TA 1VLZA 1T24A 1SHJA 1GFSA 1YC5A 4NMMA 3RM3A 2JHCA 3SC2A 5JD5A 2WK1A 3L40A 1E9FA 1WSWA 3IV7A 5I9SA 1MKYA 5F9FA 2W2MA 4AT1A 1AO0A 4AICA 1R4NB 4ZGBA 2HHJA 2HQ1A 4ODIA 1ND5A 1Y82A 1B3BA 2H2IA 3GMTA 4W5HA 1CY4A 3FMIA 1EP3B 1OA1A 5LQNA 2QLLA 1J9EA 3G0OA 5AK3A 3H1EA 5JBIA 1G9TA 3V4PB 1XLWA 1DJLA 4O5OA 2F59A 2P7HA 5CDSA 4KK3A 3NMUF 3B36A 1UMCB 5G0TA 1GZUA 5IC6A 2ANBA 1H3NA 2FOLA 1GNTA 4NJEA 1BX0A 4TUYB 3DMTC 2JA2A 3OEED 2R68A 1OPXA 4OLHA 1E1RA 1Y8RB 2PH3A 1KJZA 3I0MA 3ME5A 3F6PA 4I5FA 4QDJA 3AHDA 2XXBA 5SYMA 3WYGA 4DIOA 4EITA 3HLTA 2OBYA 5EJ8A 5KYUB 3RC8A 3AY6A 3DHEA 2CLMB 5AHRA 4YXFA 3ROZA 3GUHA 3D2CA 2O23A 3UFBA 2PM8A 3TGLA 1YI1A 4PLTA 4AWXA 4G1BA 5FWDA 1M1XB 1IK6A 3IP8A 1VKZA 4GPZA 5CLQA 4GLFA 4CLRA 3WGVA 2NP7A 4KBGA 2ILVA 4OXIA 4AJ4A 2WJ6A 3W2EA 1KJQA 2QUAA 3JQGA 1NURA 2ZJ0A 4LJ7A 4WZ6A 5JIBA 2HMVA 5G0VA 3KXPA 2VDQB 4ZRNA 3STTA 1NBHA 1V95A 5KYUA 1SGWA 4RUKA 4V3CA 5FAXA 1BW9A 3ELYA 3RG8A 5IM4F 4D02A 1I6WA 2Z95A 4E11A 4FHCA 3X1KA 2ZYGA 1GRCA 2HTEA 4ZIRB 3IAFA 3CWCA 4Z9FA 2GN2A 2XYQA 1T9KA 1NJ8A 3W9BA 3D7NA 3EDOA 621PA 1CEYA 1JR3D 1SVLA 1Z4KA 3EULA 3SMVA 2DHEA 1RXVA 1IY1A 5ALUA 1RXSA 3S3TA 4F2WA 1HTWA 2FPWA 4NX2A 2C0CA 1W36D 4BNXA 1M0SA 4U02A 3HJGA 2ONCA 4LWOA 4TL9A 3RADC 1J56A 4RGYA 4GM0A 4DHEA 5B3LA 3OMXA 2GILA 4AO6A 5ES3A 3TRJA 2RIRA 1OWPA 3BJRA 1K5DA 3ZIUA 3K0BA 4F1KA 4FW9A 3E8XA 4YS6A 3K6SB 4RLHA 3R8FA 1XZAA 2B69A 4QUAA 3I58A 1F48A 1RKBA 3EXEA 1ZO8A 2NMVA 4B7XA 1R0WA 1CJMA 1EX9A 3L0SA 1KI4A 1WB6A 4HJXA 4HLUC 1MT3A 2RH8A 4NCNA 2XTAA 4OI2A 5AH0A 2IS2A 3TLZA 1NNLA 3ZWMA 4CV0A 1EBFA 4DDVA 2ZJOA 4MKZA 2REBA 3O21A 3GJ7A 3FPBA 4W8GA 3V4RA 1QNFA 3WIBA 3R44A 4Z99A 1USWA 1A8IA 4WZAE 1X8XA 3IJEB 4AY3A 1ZH6A 2XQKA 1N3BA 2ISQA 1ZGZA 3JD2A 4ZYYA 4ZVKA 3IIMA 1MO2A 4EJSB 5KQGA 1UDCA 3X3HA 4M8LA 4R2WA 1VA4A 4OFBA 3C2QA 4OF4A 3DKKA 3ZHSA 2WAMA 4PNEA 4E2XA 2PFSA 1SR8A 5KPDA 3TIGA 3UTDA 4DLNA 2HWWA 1IN7A 1CJBA 1E20A 3GBVA 4B0OA 2Q21A 5HCNA 2QN9A 5TPWA 4B4UA 3WFIA 2PUGA 4M1YA 1U2EA 2OHXA 2IS6A 2DYKA 4UHEA 1U7XA 2J9FB 3WDMA 1ADJA 2RHJA 2UUCB 5M34A 4KEAA 4LYFA 3QUAA 4TM7A 3CVJA 1AQIA 3VXKA 2C88A 2IP2A 5EZQA 1V35A 1GDDA 1N6OA 2AMFA 3HCEA 4TN5A 1G8SA 1MR3F 1O94C 3DJFA 2V3VA 1WDWB 3MGAA 5LU9A 4G0VA 2BGGA 1N3LA 1FW6A 1IDOA 2HWYA 1TX4B 1W5BA 2W4IA 3K09C 4HPWA 3IDSA 4YVFA 4ARZB 4CR8A 5LOVA 2FQYA 3FPHA 4F4JA 3HMQA 4IJ5A 3KXDA 1ZJ4A 2IE8A 3G13A 2XZTA 2ZGVA 5CEJA 5LQCA 3KU1A 3BF7A 4Z0PA 1CB0A 5K2MA 1IM5A 3BL5A 5C52B 2ZTLA 2XNJA 1HRKA 3HNOA 4JITA 1RJGA 4Q4AB 4XX0B 5CVCA 3LGSA 3K70D 4I08A 1OAOA 5CMLA 3VTKA 1UQRA 4TTVA 2Q3DA 4A0FA 5CDTA 2C03A 4DWJA 4PBRA 3RTGA 4A15A 1MJGA 1Q1AA 1UM9A 1Z6QA 4EA6A 4IV8A 5BWNA 3BFVA 5EIWA 5K0EA 1Z2AA 1F2UB 3CO5A 1V16B 1LQTA 3PA8A 5B7PA 3H1BA 4KI0A 2OHJA 2OPBA 4Z7QB 1R12A 2XWQA 3CLTC 4U2KA 1XSEA 3H5IA 2X1HA 3REGA 3NCTA 1EVJA 1DXOA 3MN1A 4RCZA 3C7AA 4DV2B 4OQFA 4Z3DA 3LECA 2BWJA 1JX6A 1N75A 1GT6A 3UXYA 1FMFA 2J87A 3H2SA 5IVIA 1O94D 1ZXXA 3F7NA 3G0IA 4NCHA 3WMXA 2IEAA 1UPFA 4RD2A 1QS0B 3MFYA 4RH1A 2JBWA 3FYUC 3Q7TA 3WLEA 2GOYA 4DSZA 3U4QA 1N4AA 1HE3A 4WN9A 1WMBA 4X1YB 1XCOA 1F2UA 1PR2A 2CB9A 1IK4A 3AW8A 3PJFA 4G5XA 4RKRA 3VISA 4B47A 1J23A 3M6MD 3QE0A 3EHEA 3BTOA 1LDMA 1TTQB 2OZPA 3N28A 5FQNA 3JYPA 4XH9B 2O2JA 1XZMA 4F8YA 2V7XA 3AKDA 1VJTA 4JI5B 3UVEA 4DNPA 1D6JA 4HG2A 4OHKA 1KEWA 3SAJA 1S7CA 4ENUA 3TMYA 1DEXA 2GNOA 2BEVA 3GN1A 3L46A 2D74A 4FKMA 3OZUA 2FPGA 5IM4A 1N77A 4YWHA 5E6UB 2V03A 4AYTA 2Q6OA 2BHSA 4JUCA 1XUOA 4H3VA 2QD4A 4PSCA 4X1YA 3OOEA 5C51B 2ZXUA 1XFDA 4K2HA 4RTRA 2Y0EA 3E6AA 1NW5A 1WXIA 4ZJUA 1IEQA 2ZUUA 4N1AA 3IJ5A 3UC5A 3AUTA 3EF1A 2EWMA 2FN9A 1N0IA 3LSTA 3V6MA 1W75A 2NXWA 4NMHA 4UTXA 2QVYX 3PUKA 1Z47A 3TB4A 5JJIA 5CNMA 4GNRA 4BNKA 5JR3A 3FWNA 3OX4A 5B64A 5I47A 3GT4A 4LHVA 5K7SA 2Q07A 2MMGA 1Z0IA 2JCSA 5B4TA 3PWKA 1YBMA 3O73A 4K2AA 3JYQA 1A82A 3WXBA 3ZCUA 1DRJA 3T5PA 3FR7A 4NAHA 2QQGA 4PLYA 3Q8LA 4YUAA 4XD7D 4YCSA 3EQ9A 4MHSA 4E5NA 3SLKA 4ZMBA 4CKWB 2UZ1B 3GT7A 4JCOA 5I9MA 1I1QB 3GV0A 4KR2A 3PEYA 4CNQA 1E3DA 5IBPA 1CY2A 1OU4A 4X20A 1RWOA 1LDGA 5AJZA 3BMOB 3WNVA 2O07A 3RO7A 1P0FA 3PHLA 1VIMA 5A03A 1WEKA 2AMLA 4FZ5A 3ZV5A 4S1TA 3LWZA 1TYDE 4O3FA 1U2GC 1SKYE 2RGXA 4ZCTA 2FZ5A 3IRVA 1QF6A 3BIOA 3TAUA 1EK1A 1NLYA 1UWLA 3FFBA 3N2GB 3OJFA 2CHEA 4UAUA 1I0IA 4QNRA 1VE6A 2JGJA 1VE7A 2Z4TA 1M1YA 4HDAA 1G4UR 4NRDA 3QGMA 1M6HA 1SC9A 3BXFA 3GEHA 1BO6A 1WMAA 1JLMA 4OI4A 3WGLA 1HSOA 4FQ5A 3P20A 4M3NA 1FE8A 1NMSA 1SQ0A 3TCNA 5P8WA 3VTZA 5JAQA 4O6VA 2HMSA 3O7MA 1KEEB 1P80A 2A94A 3N2GA 3OPVA 2C94A 2OO7A 3UGQA 3N2EA 3ZLBA 4RTSA 1GQOA 1IPHA 2GARA 3MUNA 3EGDB 1T10A 1QCCA 4KR3A 1F06A 4DQKA 4MHTA 1CUJA 5JCZA 2QVXX 5JRDS 2BFDB 4KUGA 4QU5A 5E95A 1KDPA 1LF5A 3KOWA 3RIMA 4M99A 2CLSA 3T7KA 3QFHA 5LQAA 2PUBA 1P4GA 2OZLB 3AVOA 1I80A 3R7BA 3UG6A 3ZGYA 3K0AB 1M72A 1CNMA 2JLSA 2ZPTX 2FHSA 4EI2A 3CLVA 3MIZA 1NFFA 1WXQA 4IZHA 5BORA 3GJYA 2P8SA 2OQ2A 2C9ZA 3JVVA 4ZAZA 1DUIA 4A5OA 4JB8A 4BO9A 1CDDA 4B6QA 5CCXA 1C0IA 2M2IA 1J97A 3U3OA 4OHRA 3KOZA 1QE0A 1YKGA 2WAYA 3FJOA 2AZ4A 3H2YA 3IFSA 3IULA 3RS7A 1C0LA 3W4KA 5AVUA 3OIDA 4CIAA 5ICMA 3AKCA 2D4AA 4TXNA 4OX9B 4INAA 1V96A 1E0JA 1X3LA 2WF5A 2G7MC 4QPDA 4F7WA 3RWMB 5C8VA 3QI2A 2ECOA 3W1WA 2J0QA 1QTNA 1L9XA 5TY0A 3VYSB 1EB8A 1U0GA 1UOPA 1CY1A 1JILA 3PD1A 1L6RA 1LPSA 3NG1A 3PPVA 4HQ6A 2GBPA 1TAGA 4QWWA 1XCGB 1SUPA 4C08A 4F4UA 5K8TA 4KE8A 1L5VA 4UARA 3VVMA 3ZDEA 4UEOA 2XMRA 4YMHA 1RPZA 4IZIA 4BQRA 3QJYA 2C83A 3CCBA 2HWXA 2X77A 2GQ0A 1U6JA 3E9EA 3OLXA 4L4XA 4CCSA 3T3IA 3FHLA 4B17A 4YV1A 5JVDA 2WJGA 4BL5A 3AEUB 4D4LA 1X1EA 3UJHA 4C89A 1MHTA 2GM4A 2C2GA 2CHFA 1FTWA 4GOJA 5C4GB 2L0XA 2NT4A 3K4PA 4KQ1A 2WWFA 3RYCA 1CZUA 2BAGA 4Q66C 3OIVA 4Q9JA 4DIFA 2YWHA 4Y6GB 3VSAA 3V4FA 1HGXA 2F43B 3OT1B 4LHZA 2ZUTA 3D7LA 3DM9B 1BDIA 1QPZA 2FAXA 3A4TA 4AQ7A 4Q12A 2OHFA 2OFWA 4M36A 3TW8B 3K72B 3CRNA 4CKCA 4F1WA 1Z0JA 3E5MA 4M1ZA 1RE0A 2QN7A 2YXPX 3VPHA 2ZUFA 2IU3A 3LC7O 3CRVA 2PD3A 2HA3A 3F74A 3R3VA 4ER0A 5BWMA 5I7OA 5IVHA 2X8LA 3EDQA 3KHKA 1GZ3A 4J0CA 2BR4A 1ISIA 1JA1A 2COEA 2BISA 2WFMA 3MJ4A 2QENA 3ZOKA 2P30A 1NMZA 1USIA 4R41A 2Z5LA 1KI9A 3LU1A 1WXFA 1Q92A 4MYUA 4RZXA 5FI5A 5SZHB 1RRMA 2F8TA 1UH5A 4RVCA 3Q3JB 3PXAA 5IWCA 2C9DA 4IMJB 4NYJQ 5H4GA 4AJLA 4UHKA 2CL5A 5LFAA 1ZC4A 3VU1A 3LHFA 4TT8A 5DCLA 1WXHA 4LTDA 2QMEA 2PYIA 1M2EA 4JT8A 5I01A 1F9EA 5FFFA 3NORA 2WT9A 3QIAA 3T8YA 4FE7A 1FB5A 5J40A 4IEEA 2JH8A 1XJWA 1LI5A 3CEJA 1S2IA 1UCFA 3E7PA 3Q3EA 3R5SA 1Z4PX 3A2LA 3AVWA 4HGZA 2ZVDA 1O95D 1LD3A 1D04A 2KMLA 3B7WA 2EKDA 2J3HA 5I7VA 1GKKA 1Y1KE 4FNAA 1CZOA 2E6UX 1ES9A 3HB7A 3U60B 3PQDA 3CVVA 5HIAA 1OILA 4RY2A 3DVRX 3H9JA 2VI5A 4R9SA 3L02A 4XM2A 4QXMA 2I6XA 4GDMA 5EP1A 3GG2A 4BGIA 1U8ZA 4RFSA 4J0HA 1RQGA 4P9NA 4KH1A 3WNQA 3C85A 5HIMA 4FNGA 3AB3A 4BMZA 1HL3A 4RY9A 3EBOA 1LLDA 4RVGA 3C6MA 4FGLA 2PH1A 2RH5A 4IGFA 1IUOA 4QXQA 4V3BA 2AXPA 4RESA 4CG2A 1RYHA 4E2WA 1QRUA 4LZJA 4U9IS 4EZEA 2KLHA 5IHPA 2IHJA 4AKEA 1MP0A 1W6UA 3R5XA 1QP7A 2DFPA 3GRKA 3E1GA 4CDNA 3OFND 4PHFA 5FTMA 1ZKMA 3OQJA 2HA6A 2AFRA 4M1EA 5G1OA 2ZB8A 2EF1A 3A8TA 3KD3A 4IIJF 4JL8A 5E9QA 3ELWA 5IDQA 3HPQA 4CF7A 2ZRJA 3U31A 3WKDA 4AKIA 3L8GA 4L02A 1WQ4A 4A23A 2ZWVA 2ATXA 1L7VC 5CG2A 4AY2A 3CLKA 4WW0A 4D99A 4ARIA 2FI1A 3EIHA 2QXYA 1NXWA 4E6EA 4OXKA 1N2SA 3VOBA 1WZCA 3E15A 4CM4B 3ZNNA 2QJWA 4EF5A 4LDAA 1RYMA 3LPLA 2C57A 3MB8A 2WJPA 3LQ2A 4U7TB 4IHAA 2D7DA 1D8AA 2RG1A 3ENZA 1UPXA 1ZL2A 1F2TB 1FRNA 2EF0A 4X61A 3ZDQA 1W7AA 3ZD7A 2W2PA 4LK3A 1E7MA 3R7LA 1WF6A 4FHZA 3VI3B 1TEXA 2VDNB 3A4VA 2CMHA 3VR6D 4H31A 1VIDA 1Z07A 3ZJTA 3WSVA 1F12A 5I45A 1AQNA 3T1TA 3IELA 3WWCA 4DBLE 4OFWA 4J9UE 4CM4A 2C5FA 2XUJA 1MIOB 3FCCA 4I8IA 1H94A 1E2KA 2UVPA 1U2DA 1JHAA 3FLAA 2O52A 2PJUA 2AR0A 1E3EA 3PFKA 4XQ0A 3KZOA 5MFPA 4BE7B 4CUKA 2PYDA 5LZ4A 1EE2A 1XIVA 4RAQA 2H51A 2MSKA 3JWIA 2PKYX 4V0KA 4URVR 4RHEA 5A4KA 1B0PA 2HUNA 4RHFA 4FDLA 2JIMA 4L2IB 1TO1E 4NMXB 3IKJA 3SQXA 1WF3A 2P9CA 1Q17A 2Z6VA 3NVMB 1UOQA 2XDWA 2OO5C 1NR5A 2Q4OA 3AONB 4KVZA 4KNWA 4D9BA 5JAPA 5TMPA 1HFEL 3KQVA 1P5JA 2IYFA 2E3JA 2H2AA 4G3XA 1CUHA 1RAEA 2CNDA 4HH1A 4NNJA 4WHMA 3AF5A 5DHUA 1ZXBA 2QPLA 4KRFA 2GD6A 3I92A 2IY7A 2OK8A 3R0XA 2J9ZB 3UUGA 2GNAA 3I6MA 4KGXA 1QOPB 1U9CA 2RHLA 3KV3O 3CNLA 2Q2OA 3R5KA 1S2MA 1JLLA 2OAP1 3EXHC 2QW0X 4G1CA 5J2UF 1B42A 2GXAA 1J2TA 2HXSA 1F5SA 4N8EA 4AP6A 1SBQA 2BKXA 3IHTA 4HXEB 4LXHA 2V7EA 3AQIA 4NBWA 3CTPA 2QUBA 3HV0A 4LMPA 4WNAA 1W29A 4E2YA 2AFIE 1A50B 4F4CA 1N8KA 2BGJA 3PGKA 4PLVA 1AXEA 2ZJYA 4QNNA 4PCAA 4ENPA 3ZDFA 3A2NA 3JASA 1ONOA 3HXTA 4CUJA 1A9PA 1DELA 1VYVA 1K9VF 2RHTA 2A1UA 3AZOA 4AWBA 4B71A 2CJWB 3A1VA 4ZU1X 3UMMA 2D6FA 3U3RA 4PXAA 1GTJ1 3G2PA 4NATA 3S1AB 3PX3A 4KCGA 2DQ4A 3GA7A 3O75A 4OQ4A 5AXCA 1GZSA 2OXRA 5KYWB 3REFA 1XLTC 4LHSA 3RIXA 1M2NA 3C3YA 1ZGHA 3GEDA 3KKNA 4M83A 1KJWA 2OBXA 3MT8A 1GNVA 3AVQA 4O25A 4C3VA 4RSRA 4P22A 4NF2A 3LDGA 4CETA 4I1VA 3AVTA 1A71A 4IVNA 1MF7A 1UBEA 1ZUNA 4WK0B 4HKTA 3EMBA 3ZHBA 3ZWYA 5E3IA 2IXFA 2XDQA 1V4BA 2X9VA 3HA3A 4LRUA 1V37A 2VJBA 2ZUVA 4IIJB 4WY8A 5CD1A 2XHEA 5M29A 4CFSA 2WTXA 2XT9A 1CQZA 1SHKA 4AK9A 2BEKA 2P0EA 5EMKA 4ZK2A 1P7WA 3TLAA 1GV0A 2GAIA 2YOGA 3OZ7A 4K9RA 5B3AA 4BTLA 2IF0A 1AO3A 2A5JA 3QK7A 2O8FB 1K89A 3CEAA 3RYTC 3UHJA 1FX1A 2IY9A 2I8AA 5C1IA 3LBYA 5WRFA 3RKSA 3F47A 4CHGA 1Z5WA 4A0GA 4CMHA 5JI2E 2PFKA 1DTWA 4CTJA 4IIJA 2QX6A 3V80A 2O2CA 2Q1UA 4Q7EA 3PKIA 4W9NA 5CDGA 4XGQA 4K40A 2NADA 3F4LA 4W6QA 2BFAA 1MO5A 2Y2VA 3KAJA 3RTAA 3ZE0B 5A04A 2VAWA 4E7PA 1NF2A 4FONA 3WRVA 3F6BX 4DDMA 2JGLA 5KSYA 4JUIA 5AKZA 3V7UA 2JLXA 4J0JA 4KB5A 4YV0A 1MBZA 3TGPA 2O8FA 4K46A 2ZUBA 3T1OA 3B6IA 3DF9A 1I3LA 4ZO6A 3L1JA 2WILA 4HK4A 3VPXA 5HUHA 3D6VA 1F0YA 5CPFA 3F97A 1BQ4A 5B53A 1Z5UA 2QLTA 4MW5A 4R0NA 3S2FA 2P9TA 1W2HA 2DULA 2VJMB 3VH1A 3KCQA 4DR6B 1ZOOA 4KAFA 3T61A 3TR5A 3GAZA 3B9QA 5JC8A 3KETA 4ETIA 3FUVA 4RD4A 1CYDA 2IYTA 3W1EA 3ID6C 5I8PA 2FMHA 4XOUA 4DA7A 3EWIA 2FPMA 5EE9A 4LRQA 3E82A 3Q0EA 5LKAA 1NW3A 1HLFA 5FUMA 2VH5R 3RJMA 2XB2A 3P0EA 3VAZA 2JAWA 3LRXA 2I6UA 4O4IF 1NHGA 1OLSA 1UEXC 4N6GA 4R83A 4TLMB 5FBHA 4AP5A 2I4NA 1XTKA 4YI3A 3THSA 3W5UA 3X2SA 1ZGCA 1A9OA 1KH1A 2A0WA 5I5GA 2OQRA 2VPYA 2J0SA 4Q3AA 3GP5A 5CFLA 2WJWA 4LJ4A 1JDNA 5CVJA 1DU4A 4HATA 4ZOLF 1V8ZA 1C9MA 1WD7A 2CN1A 2I54A 4RJKA 4UVDA 5K0NA 4A3SA 1D2AA 4Z5XA 1I4LD 3GZTB 2XRZA 1SIOA 4OJMX 4JI7B 1SVOA 1VLVA 4GZ3A 3NEJA 2ZBPA 3OE5A 4UMDA 3SYTA 2P5UA 1EX6A 2MHCA 3PUXA 1GVHA 3TZEA 3ESBA 4CLDA 4LY3A 1T4GA 1ZWKA 1Q3TA 4ZVRA 4KSYA 1U2TA 4IKEA 1YF3A 2YY5A 2PUEA 1O03A 4P0QB 4AZ0A 1GCGA 3NHLA 4GAEA 4DWVA 4EPWA 3CH7A 3N74A 4G1FA 4Q24A 4C05A 1FS4A 2DUNA 1BU5A 1E9CA 5AI8A 4QYIA 3HCDA 5J2UA 3V7WA 2Q5JA 2QGNA 2CMGA 2VSOA 4IDAA 1CHNA 3DAGA 3TLXA 1NBMD 3U4CA 1FLVA 1YKSA 2JHPA 3JAWA 4MV7A 1CUWA 2OILA 5H82A 3H16A 2HSZA 2A1IA 1FXWF 3CR3C 2G9VA 3PIRA 3AR4A 2CXRA 2I2DA 2WSYB 2PN1A 1E7QA 3SBOA 4OPMA 1OIXA 4KQKA 1HF3A 1QGUA 4YJDA 1R6DA 2BP7B 5EUMA 5TNXA 3ZQJA 3PLRA 1N5DA 3G5TA 1JQEA 3FKJA 5K09A 3QW4B 4G1MB 2I65A 3MQFA 3NKFA 3EY4A 2OHHA 5LCXA 4M0LA 2QOEA 1NNI1 3FDZA 1RD4A 2NWQA 4UHDA 4PAWA 5E9AA 5C8DA 4XLZA 5BUSA 3RAPR 1JAYA 1X9IA 3D6HA 5EXTA 2BZ1A 3D0KA 4BZWA 5EESA 1ZSVA 4YP1A 1BH6A 2HO4A 3KVOA 2W00A 4ZHQB 4ENWA 5IWAB 4ALKA 1I01A 1T1SA 5FV7A 4OMUA 4AM8A 1T6ZA 4JYMA 4U1RA 4TSKA 1KS2A 1SZDA 4YRRA 3RB8A 1M7GA 4V0LA 2ZQ5A 2W98A 1E4OA 2J3IA 5EKUA 3WZ2A 3RAEC 3ESDA 1ZMBA 4DQXA 3CEPB 1AM4D 5EWLA 2FZVA 1JAZA 5DK4A 3FTCA 2HMYB 2V7TA 1EUDA 1U6IA 3MXOA 2J07A 4HDMA 4TVBA 4AZVA 3WL5A 3SR4A 3GMIA 2QRZA 2EJTA 1E2PA 1L8QA 2I62A 1DXYA 1J0XO 3AETB 4BFWA 3Q41A 3R76A 3P0FA 2Q1TA 4KN5A 4TLLB 3ZHCA 1JA0A 1AS3A 4PC7A 3SBEA 1Q0LA 1WZEA 4A10A 3LGXA 2JBAA 3HSYA 4WKNA 1NXSA 1NDUA 1PZFA 1YS2X 4RKFA 5AJTA 4EKNB 3Q8KA 2RH4A 3T3EA 1TRKA 3E0XA 2WHEA 3I6YA 4LXYA 4B2PA 1LY1A 2OWEA 1C50A 4C29A 3KSAC 9ABPA 3ZLVA 4C6HA 1QZ3A 2CSUA 2OFPA 4Q82A 1Y6JA 3P9CA 3Q4GA 2FKAA 3HUEA 3O8LA 1PJTA 4HPJB 1YB6A 3WE7A 3ZCQA 2MIIA 1EESA 2R87A 4MR9A 1Q1BA 2X8JB 3EVCA 1Z5PA 4PFKA 4XZ3A 5P21A 3TD6A 4HPXB 4UE6A 4G01B 2HIHA 3UK0A 1N2XA 5JAMA 4FS3A 1FLDA 2P9JA 4O4IB 3QOFA 4OM8A 1CF4A 1HRDA 1WMFA 4EW2A 3ZNOA 5TIIA 2K2QB 4IDQA 4MV9A 1GPJA 3GDHA 3ZY6A 1RFGE 1SVKA 5EHNA 4BBZA 3WA7A 4J2OA 1F5NA 2XGSA 2AI3A 3IKMB 3N86A 5CYPA 1XVUA 2GUWA 1ESEA 1ZVQA 1ZVMA 5AT1A 4EYKA 2GF0A 1G0NA 1LCIA 3JU3A 5DNEA 1XZFA 3VNAA 4BRSA 1P3DA 3P52A 4DG5A 1QHYA 1FFXB 2I80A 1P73A 3TRIA 2NU8A 4BO1A 1S89A 2IEZA 2H1HA 4BVAA 3F0TA 2NNWB 3K0HA 1VKJA 1CF9A 2BOVA 1CUUA 4GBED 4HH4A 4DMHA 4L72A 4P80A 4AZ3B 2QSYA 4O4IA 4YA6A 2VZ0A 5EIEA 4MLDA 2Y77A 1IY8A 4P7JA 3HXKA 4B79A 2X7XA 1G1MA 1TFRA 4AU1A 1J2RA 4XI9A 1GXSA 1F8GA 3BIFA 1XR3A 2CHUA 3HUDA 1SBIA 5EIBC 1SD5A 1KRXA 5ITSA 3DFUA 2QHXA 2I2CA 4ZOLA 3BRSA 4H0FA 4KBFA 4YAEA 3MHTA 1AXGA 2NG1A 1N5RA 3OPYA 5TEVA 1BCRA 2ACVA 2IU0A 2NO7A 3RVOA 3W5VA 4P4SA 1H8ED 4HX5A 4UQOA 5T6BA 3QXGA 1KQOA 4GW3A 1Y6FA 4OUDB 1J8VA 3ZVNA 2XMPA 4L74A 1UR5A 3CN9A 2VZ9A 3DOFA 3CMCO 2GBFA 3DT8A 3PFBA 4MQFA 3T38A 2PKWA 2F8SA 4D0NA 5JYDA 3KK0A 1BH2A 1US8B 2V7VA 4HFRA 3M4ZA 3RAJA 2X23A 4BMXA 3LX4A 4HFJA 4QVKA 1RYZA 5GINE 1QX4A 1ETUA 2B25A 2HA7A 1T1IA 3OQIB 3T3OA 3C3DA 5DEOA 3RCBA 5GV7A 4ZD6A 2CLFB 4C76A 3HFSA 3JWPA 1AUPA 1WXEA 3OAAA 4DC1A 3J81k 3GH1A 3UAXA 1QV7A 4M87A 1FXWA 4AC9A 1TI7A 1FQJA 4O4JF 2VNIA 1IZ0A 2ZBDA 4I1OA 1BHQ1 3OE4A 4RK5A 4B9AA 1L7DA 2BW0A 4BEWA 1MPTA 2J0VA 3UZUA 3EIEA 3PRHA 4HDRB 4O8ZA 1ZRHA 4D9EA 1TU4A 1TKBA 2WAOA 1SRQA 3OQIA 4IOKA 3DHNA 3VR2D 1E0KA 2NO4A 4CEHB 3OQ1A 2M98A 3GOQA 3KSRA 4RELA 2X5KO 5H02A 3TR6A 2K7FA 3PQCA 3RFTA 5FV4A 4PYKA 4LDPA 1QP0A 4DILA 1OY1A 2Q5FA 3DKPA 3F5SA 1MD9A 2ZB2A 3W3AH 2ID8A 4L8FA 2YS7A 2CEAA 3DEIA 5FJIA 4UUNA 1AOXA 3LT1A 1OXBB 4DCJA 4OI0A 1Z2DA 1HO3A 1PO7A 5G0WA 3BVPA 1AN9A 2ZRLA 3NVDA 1UXGA 1KZHA 2UV8A 3FUUA 1F0NA 4JBYA 4H7DA 1U7HA 3IB6A 3NANA 1L3CA 5C81A 4K6HA 3OH8A 4MIKA 4YJ2B 4IMPA 4B6EA 1C2YA 5FL7A 4KVGA 4GR4A 1ODKA 2A4MA 3K0CA 3QE2A 3ENKA 1GPMA 1V3QE 4K05A 1K9SA 3FSEA 4P4GA 2J3DA 4H7PA 4YDSA 5EZSA 4CF5A 3WGIA 1IB6A 3PQ3A 5FLYA 4UBKA 1KFEB 2D13A 3UANA 1Y7IA 5F9HA 1C9DB 2RARA 4U3JA 1AIPA 1AKUA 1ISFA 1I2DA 2P9HA 3K94A 5AKHA 3AJAA 4ZVMA 1F6WA 4V02A 1ECPA 4HMPA 3TLGA 4OY3A 4TOIA 3JARA 1L7RA 3ZLJA 3CUKA 4GQIA 1N78A 1ULBA 2BJHA 2HHLA 2IYVA 3FZGA 4KGZA 3N8NA 3MQ4A 2P9FA 4QXAA 5EJIA 4D4KA 2MU1A 5HJ5A 5TSDA 1DZ3A 3B3FA 1DRVA 3G2LA 4II3A 4M21A 4HGOA 1R27A 3DZHA 4ZC8A 3NUQA 4R8VA 5TS2A 4AN1A 5FWNA 2PJRA 1UC8A 3E7WA 4WOCA 3NTQA 4B85A 4KQHA 1H1LA 1T3SA 1JALA 4MVJG 4MYRA 5KWSA 2WIGA 2BEWA 4JELA 3KUKA 3SP1A 4D5EA 1N9KA 1R66A 2NSLA 2LDBA 3WWDA 2AHOA 2FEPA 5F76A 1U1FA 2IZOA 3QKTA 3NO4A 4URWR 1W36B 1TUBB 1RRCA 2JJ1D 5AOAA 1MG5A 1R8YA 2ATCA 3CO0S 3M3DA 3CH6A 3DP7A 3RT7A 3UMFA 5CFZA 2DE0X 1KC3A 1U0RA 3S55A 3JYOA 1YS4A 3W04A 1J99A 1Y9DA 3PEVA 4R2JA 2C31A 2J30A 3QWFA 3WMFA 4JC4A 4EQ6A 2IGBA 1PGJA 3ML1A 4ZYLA 2JANA 4E09A 3ZJ5A 3ICEA 4CG1A 1MEJA 5D00A 4X7RA 4TKUA 2XA2A 1MJNA 2X0JA 2FCAA 2XYVA 3BDVA 1GL3A 1EP1B 4I1PA 4JHXA 4HZUA 3KE9A 1NXQA 1RU3A 2QP9X 4O2RA 1TUBA 5JHGB 4MJ7A 2Y1KA 3CSDA 3P4XA 5JZOA 2QP3A 1R9JA 3GGPA 4ZDIA 4DIDA 5FIUA 1FL9A 3KFLA 3E5RA 3VR6H 4CMAA 1T43A 2VDRB 1JBKA 4U0JA 2X4LA 2YNMA 3B3JA 1PHRA 4MW6A 2RC5A 5CBKA 3CNOA 1TDJA 3D5QA 521PA 3UWDA 4ZFNA 4JJ7A 1MAHA 1FUYB 3UAYA 2G9ZA 1KAMA 3OCJA 4R1LA 1PSDA 5LZ5A 4F11A 3HZOA 2YHSA 2FF5A 1H2WA 3TFWA 2C04A 4DMKA 4EKGA 1PJZA 1MW9X 4IIXA 3GZNA 5EZ5A 5K4HA 3DQZA 3IXQA 2CMKA 4ZAVA 4Q6BA 3F6CA 3MGBA 2LBPA 2Y1GA 1PFWA 4DTCA 3Q3GE 3MT7A 4Q9KA 3T99A 3B1VA 4QBGB 4CT5A 1XGKA 2C4VA 4O4JA 3O93A 1KXZA 4E6PA 2P5SA 4NYIQ 4XSVA 5CJJA 5ULLA 4KHZA 4DBZA 4C2BA 2PKCA 4TYWA 3IKVA 4NPCA 4FU0A 4RPKA 2ERCA 1QGYA 2W6CX 4X3OA 2HHHB 3VNVA 1UKBA 3DPUA 4BV2A 2V54A 4IO1A 3WK8A 1H1DA 1G8AA 4OYRA 2W8ZA 4NESA 2A0KA 1ZCFA 4OEHA 4ZVLA 4LVOA 5LQSA 5IC5A 2DWUA 5IDYA 3AR5A 3K6KA 7YASA 1NV9A 4ZZ0A 2YHIB 3K2BA 1N1DA 3IVAA 6NULA 3E23A 1X13A 3PVZA 3E7XA 5IKEA 2VO1A 2CXQA 2VDPB 3C39A 4QOIA 2CW5A 5CTAA 3G0DA 4IWXA 4F6RB 2XUZA 2MYTA 4UNIA 3O0TA 4TSFD 2QG6A 4U39A 5ALIA 4BNYA 3K70B 3BXPA 4FIZA 1W44A 2C9OA 4P08A 4HAWA 2H5IA 1ZDMA 4PQRA 3IEXA 3RSLA 5C80A 2SKDA 3FBGA 4YCCA 2W2QA 1BQ3A 2C4KA 2C3OA 2PY6A 4OH1A 4DDTA 3LW8A 2NQTA 1LEHA 2GHIA 2RAFA 3S99A 4XFDA 3HE3A 1FUEA 1HEYA 4AY5A 5K6RA 3C7TA 3EQ2A 5BVHB 1XE3A 1VPVA 3W5AA 3TX2A 4FGJA 4WASA 1RQRA 4DCGA 2H9YA 1SULA 2P3OA 3A0UA 3GWGA 3PSHA 4N0DA 4KFSA 5GTDA 1JAXA 4YAKA 4EGQA 1E6KA 2VJNA 3LY9A 3QVJA 5IW8A 5JPCA 2CSXA 4JXZA 1Q7TA 1NQ5A 3OA0A 2O8EB 1OFGA 1J8DA 3AEKB 1L5HB 1RJDA 2AFIA 2ZJ1A 4CM3A 4E5DA 4OB7A 2WMYA 1N57A 3L1UA 2O7RA 4ZEOA 1VB5A 2PKXA 2VPXA 4JDPA 3AVXA 2ZRNA 1E9AA 4HZGA 4UOQA 2ERYA 1TTPB 1RMQA 2YZ2A 1DWQA 1GY8A 3IOEA 3MS7A 5KDLA 2VRCA 5B58T 3RC3A 3UK7A 1OBOA 3HL0A 2J4CA 2REQA 3E0QA 3V3TA 3C8UA 1JVNA 1GPNA 3D8UA 5IP5A 1P4JA 2WF9A 4ZZ2A 1E8NA 3LUJA 3MCTA 4WBNB 1YAJA 3OBIA 2JGNA 3PNPA 1ZXLA 3VQTA 5JQGB 4QG7A 3FOZA 3PNKA 1A8QA 1JKXA 2FK7A 2H1IA 1CR1A 1U9JA 2J6CA 1XTBA 1WDKA 3KAPA 1XF9A 1JR2A 3KHSA 4WKPA 3SZGA 3EARA 4JP5A 4PSUA 1U9YA 2CGEA 2ZROA 1Y4UA 4ZANA 3L43A 4MLPA 5AVOA 2FB9A 1JFRA 3K2EA 5AUQA 3CGGA 3E3NA 1Q3KA 5AOCA 1F7UA 1VL6A 4X6LA 3KO8A 5FNVF 2R8ZA 3A6ZA 4X5OA 3SNHA 3WB1A 2FSFA 3CZQA 1VMKA 2P65A 4N3NA 2J6IA 4RLQA 3FYUB 2V9ZA 3ED5A 5JXHA 4RF2A 4F3TA 3N05A 1P9LA 4NBRA 3NV9A 1Y4SA 3RJ9A 2A0YA 8ABPA 3AM1A 3IBFA 3VKHA 3PJRA 4PQFA 3DDUA 5LJIA 1RAGA 1EUCA 5BN5A 2X3YA 2Q5HA 4FNMA 4RF5A 1I7NA 4Y2HA 3G17A 3RHFA 4NENB 1ABBA 3UJBA 2WLSA 1JXAA 4GBMA 3K9QO 1D2EA 2R84A 3W8NA 4EIWA 4QGSA 1PT8A 1QE3A 1SBZA 4JK3A 3TG2A 4RVUA 2X42A 4PQGA 4TRMA 4GE3A 5FPQA 4BIIA 5ALVA 5EQTA 3RD5A 3NBYC 4B76A 1VL5A 3CXUA 4M9SA 4V0NA 5EP3A 3GRUA 3H5WA 3PX7A 5JJLA 5LR6A 3VGPA 5IHXA 4G0QA 3A06A 1UBHS 4P38A 4QXRA 4ZEMA 5KHAA 3F6SA 1SKQA 4JA2A 4MCJA 2R79A 3O8QA 3JWGA 3WQSB 5M5BA 1C8KA 1JIQA 2VDKB 4GZ5A 3II6X 3BWMA 1JEOA 3H4MA 3P0JA 4KTTE 4DYHA 4MYHA 4CM8B 3PQ8A 3UPUA 3C87A 2BCGY 4M22A 1ORTA 3MILA 2NU9A 3TBKA 2CV1A 1Q22A 1JDZA 3GGDA 1DV2A 5HMMA 3RU7A 4EYGA 2ZYWX 3BZBA 2XCIA 5ER9A 3THYA 1KL7A 3R75A 4QUKA 4XTRA 4DR4B 4A1OA 3TSWA 3AHEA 3X1ZA 1IONA 3DOHA 1N6RA 3M4YA 4HGRA 4PINA 4DCCA 2ZS8A 5AW3A 5LVAA 5AW8A 2X0FA 4PSVA 4EUNA 3GJTA 3A9CA 4R51A 4US2R 4NHEA 1R0SA 4BQOA 1PJ4A 4E21A 2X0KA 2EIHA 2ZTVA 2P3QA 3BSSA 5F2EA 3TCXB 5KNBD 1LSUA 4NAVA 1F8YA 4YB8A 1FCJA 3IT1A 2FOIA 2GF9A 3U13A 2YOFA 1N5KA 2ZP1A 4IGKA 2F9FA 4GKAA 1IN8A 1YHZA 2GRAA 2W6JA 4RETA 2HJWA 3ETDA 1RWKA 3LIIA 2QZPA 2PBRA 2Y0DA 2ZDGA 5LP6C 5FP0A 2YJZA 3PB3A 4LF7B 2X13A 3QU4A 4AKTA 2FPPA 3RUDA 4D6YA 2GXUA 3E5NA 5JAZA 2UDPA 3F9IA 3U80A 4YAIA 4JV5B 3G02A 5ECGC 2MSCB 1V5EA 3OESA 1EFAA 1YK1A 1RYNA 2P3SA 3SLGA 1FBNA 1C2TA 2UYQA 3OM1A 1ECLA 4CIXA 8ADHA 2FR0A 2VBIA 5AOVA 4JROA 2E48A 3CZ4A 1E4YA 1FW8A 5AJXA 4LNUB 2ZRCA 4YMSA 5EKSA 3W34A 1TTTA 1K3UB 2L42A 1UFRA 3DT6A 1N1MA 3PZBA 3GEPA 2AN1A 4YLYA 3ZHRA 3L6CA 1E59A 3ZIAA 5KQSA 2PVSA 2AWOA 3R7WA 1VPTA 2IT1A 2WAAA 1G20A 2PEZA 1LPMA 2WQ7A 2NXJA 4NDAA 2UZ0A 4K9MA 5BQPA 1AKYA 4ZGWA 1L4BA 4P53A 3FR8A 4KZKA 3KJEA 1G16A 1DCKA 3M6IA 4PPNA 4HH3C 1LPBB 2VSYA 1FSPA 1BX1A 1IUKA 1TOAA 2A9RA 3IP3A 4JJEA 4OBXA 5FNVB 2WTEA 3V8NA 5CFPA 2CBGA 1LW7A 2JD0A 1JV2B 4FYKA 1A4XA 1EVKA 3HCFA 4AJNA 5EIFA 4OQLA 4A8JB 1UC9A 3D0RA 4GIBA 5G4KB 3H0CA 3TL3A 3N39C 2HU2A 3H6GA 4FFBA 1GAXA 3C7KA 2CKMA 5ICSA 2P35A 4X97A 1T3HA 3GEMA 4OIFA 3RRMA 4DREA 2FEOA 4QA9A 3HO1A 2WWXA 3CPSA 4BB9A 1AXRA 1IQRA 2AT1A 4H16A 4RACA 4JXXA 4W9RA 3K1AB 2G6BA 5FNVA 1KZ4A 3C3MA 1IQ0A 4IHKA 1YUBA 3PQ2A 5GGYA 4LPSA 3V7YA 5K8UA 2NOAA 1UEIA 4M0CA 4GR5A 3BF8A 2NQ8A 4Y3UA 2P1DA 5ED0A 1UBCA 3T7TA 4D46A 2E4VA 2DTDA 3AUUA 4WDRA 1KVQA 3MBOA 2VZEA 3QY9A 3QV2A 4FUQA 1RP7A 4K9LA 5E6RA 2QBYB 7MHTA 4YFYA 3QJ5A 3DMNA 3K16A 4DA8A 1LK5A 4B73A 5L3SA 5DCWA 2JH9A 1YQTA 4TLEA 4GEKA 1ICEA 1X9HA 5ALQA 1UKEA 3VO2A 1XTJA 3W2IA 1YE5A 3VOAA 4R2HA 3OPXA 1MGPA 1ZZEA 2IS1A 4OJKA 1C3OB 3T5GA 1U5BA 2TMGA 4S35A 3H5TA 2AZMA 1ISHA 4FB4A 2FPLA 2YYSA 4OVKA 4IDNA 3SC6A 2ZWMA 4ARAA 1E1YA 2QBYA 1NUHA 1FP1D 1ZCJA 1MOSA 5EUCA 4NYIR 3K9BA 4Y0NA 1PD0A 2GBGA 4TTRA 5L6LB 3TE7A 5L3QB 4OREX 3CVOA 3HXMA 4BJ5A 4X45A 1FA9A 3H3FA 5HTOA 1C8VB 4BQIA 4QYSA 2ZLBA 3VDXA 3GD7A 4DR3B 1C7EA 4XWGA 4UBMA 4EPYA 1RXEA 3ND8A 2J46A 1UPAA 2H59A 2YJ5A 3L8EA 1MVOA 1QCZA 3QVMA 4U9UA 4C4XA 4KYUA 1M76A 1WVIA 1GPAA 3BDAA 4ZI5A 3TD9A 5AJWA 3T0IA 1NLZA 3OHSX 1DOZA 2MJLA 5DSXA 2ZRFA 3PR3A 4RE5A 2NTJA 4A26A 4H3KB 4QL3A 2QTFA 2HRDA 2VNAA 3JAMA 4FWTA 3V1NA 2ECFA 2Y1DA 4BEBA 1R0LA 3SICE 3T0GA 3GLGE 1EDDA 4MQMA 4MSUA 1HFWA 3ZKAA 1HLGA 1VIVA 3AVYA 3P2IA 5J2TF 3A6DA 3HY3A 4IUDS 1QLHA 4KRGA 5CTJA 2PNFA 1Z6PA 3ECAA 2ASEA 2AOWA 1DO8A 1LS1A 5J4VA 3H2JA 5ERXA 2Q8NA 4BP9A 4EQZA 3HYRA 1KH3A 3NT2A 4JKIA 1WABA 4PV7A 2IHUA 2K7ZA 2ZRPA 3IUJA 1SBHA 1ZX1A 4QFDA 4UUPA 4M89A 1DS6A 2W6ID 4DCUA 4ECEA 3NTOA 4LV8B 721PA 4FYYA 2ZSEA 1CP3A 1KP9A 1JHUA 3CF4A 1HUQA 4GC9A 4JAVC 4O4LF 3LFTA 2ZFUA 3RRNA 4QPJC 3VR4A 2B8JA 2AC7A 2J59A 2Q0QA 5KNDH 5DGCA 1QO7A 1JJBA 3QHQA 3JWHA 2ARKA 5KTKA 3NIFB 4JP1A 3COPA 1W0JD 5ERGB 4QIHA 3U09A 5CBPB 3GA0A 2GFIA 2QTZA 4S04A 1ZEMA 3C3PA 2IKSA 4CM9A 1H3EA 5I8WA 2P2ZA 2X76A 4DJTA 2LR0A 3H5RA 3RJ5A 2OV1A 1YZUA 4FMCF 5KKNB 2V6GA 2E21A 4MRMA 1N6LA 3CVXA 4JLSA 2BIFA 1B1CA 4IFIA 1BMFA 4RIGA 5EERA 1B7GO 4FFDA 1VMAA 4LQ4A 3GLFA 4NIMA 5LKRA 4BTEA 1G21E 3MRVA 1G60A 2UKDA 1OH6A 1E96A 4EAAA 1I6KA 3C6XA 3LUAA 3DNFA 4BQEA 3KQYA 1U4NA 3PDHA 4WUTA 3ZXXA 3BMQB 5JW6A 1M34B 1QGAA 3L7NA 4MP3A 1TM2A 1VJ1A 3TL6A 4XVUA 1RM4A 1UJBA 1WJGA 1CS0A 4ZQIA 2VDWB 4U7WA 5BRAA 1NNUA 3VAYA 2YQZA 3RYFB 4HB4A 4BFTA 4HQNA 1IZ8A 2H00A 2XDYA 3L4EA 3QG5A 1ATZA 1QAOA 2NO9A 1U81A 3JD1A 4EHBA 4WA8A 3CZPA 3GFGA 3A4IA 4D0LB 1FNSA 5ARCA 3IP1A 3IQDB 4C4PA 3ZHTA 2R6AA 1YA8A 5JD3A 5J5AA 4RMGA 1KOJA 1HYGA 1KZYC 4FLEA 1VRWA 1BWPA 1RCFA 2IOFK 3K32A 4Q6WA 2QJOA 3RF7A 9LDTA 1M34A 2QDKA 5K0JA 3TTSA 3IP7A 4KIFA 4JI3B 4JLOA 1TT5A 4TL8A 1UQUA 2QY9A 2XE8A 3QUBA 3B9RA 3QRWA 3WDLA 2J32A 2XTMA 3GCWA 4L9AA 3ZS8A 4RK1A 3C3AA 4UPDA 4Z51A 1KSGA 3ASVA 4J16C 4TKZA 1LH0A 3N2LA 4DCOA 5FAKA 3VNSA 3TQHA 2O0KA 3WLPA 2XOKD 4UUAA 3K6RA 3PFGA 4OMCA 3WK6A 3FVTA 4RH3A 4UEKA 3PQ4A 1Z62A 1JEYB 4PIMA 1XL0A 1E2UA 4UU0A 3D54D 3O4VA 4RF3A 4CEIB 2A5YB 4RW0A 2WF6A 1E2BA 3TPCA 3QM1A 4GOLD 4YV7A 1X7GA 2AL7A 3KQNA 3C3CA 3HWWA 3MS4A 3BERA 1J42A 1Q0SA 2ZIXB 3R3WA 4IIEA 2Q7OE 2E18A 1JDTA 4G5OA 4LN1A 4FIDA 4RY0A 4UQPA 4CF6A 1VHLA 4QUIA 4MVCA 4WZBA 1Z74A 2P2SA 1VTKA 2PA3A 4DUYB 1T3GA 2KYRA 4PX5A 2OXCA 3EAFA 5JNVA 4MOWA 2O8BB 1FXUA 1RJ9A 3PXGA 2D4HA 5CCBA 1J06A 1E5XA 3DFMA 2JFVA 3F9CA 4W7IA 4ETMA 4AUEA 4GHWA 4CEIA 5DM1A 3UFXB 1M8JA 1G55A 4O1HA 1EFRD 1ST3A 2B5OA 2WPDD 2C7VA 3P9IA 1E2FA 2WR8A 3DZKA 5F21A 5KQLA 4LOAA 2I34A 4REQB 3T4UA 1N2GA 2CNWD 1OC2A 2F3QA 3H9BA 2C00A 1UK6A 1W85A 2B8TA 3FLMA 3VDNB 4Z1OA 1WV0A 3UNXA 4KPYA 1DLJA 4ARSA 5L7TA 2GPSA 5J2TA 1USUA 3V6LA 4RZQA 3KKZA 3R9XB 3S8EA 2WIKA 2QTGA 4Z1MA 1WMDA 1VI2A 2CWDA 3L18A 1ZIPA 4TRRA 2G40A 1OE0A 4LV6A 2RGUA 1ZKDA 3MPOA 2QRJA 4IH1A 2JIZD 2Q5OA 3LZDA 1GRRA 4HXFB 1MORA 1K6JA 3D4LA 1E1MA 5CT4A 3UFXA 4BNNA 3IAHA 1XDSA 1KKUA 3C5VA 4NICA 1DDOA 3NHKA 4P3PA 5CK4A 2RFLA 5SY6A 4REQA 1SUAA 3H7IA 3F67A 4O4LA 4DM7A 5H9WA 4A8TA 4IVPA 5B2FA 4KXQA 2AWNA 3T5DA 2RJ3A 1YQXA 2AI2A 3IQFA 1TMOA 2Q9AA 2ZI5A 4C0AC 1Q44A 3H11B 1D2HA 5K45A 4DMFA 3GRRA 3C6ZA 4H4DA 5JXIA 3AQ4A 1QH0A 1TKRA 3IBSA 4R2XA 2WYWA 4C7KA 4ES6A 2DPHA 3OZWA 2P2YA 5KIAA 3EZFA 3WMRA 1IMOA 4QQFA 4C01A 2QV0A 1C4XA 3GDOA 4RCYA 2YVAA 1L4EA 2B35A 3C7DB 5C1PA 4HAIA 5ED4A 2IHTA 3NJRA 4B3JA 4JQOA 4M6WA 2YWBA 1ESCA 2JK0A 3QP9A 3HN7A 5GAJA 5LBIA 3U39A 3PDWA 4BKMA 4MTCA 2CFRA 4TPKA 4QJ5A 3SQWA 3FFWA 4ZTUB 2YDYA 1Z08A 1I3OA 4FSDA 4PGHA 1PDOA 3KNZA 4TXHA 2MCFA 4KUEA 2ZWOA 3P2MA 2EFGA 4PX9A 2IPNA 1CUVA 2GEFA 3EN0A 3AEXA 3TMAA 3ENVA 4QECA 4YONB 3OZIA 3EH2A 1QO0A 3R9XA 1YZLA 2VPZA 4IZOA 4ZQFA 1PTKA 3OOJA 1KXJA 1P2UA 2NT3A 2Z9CA 3D0OA 3LBFA 3QU7A 1LRLA 4KQ9A 1YR2A 1JMVA 4EPXA 2PMKA 1PTJA 3GEBA 1XU9A 4NBSA 2SBTA 3AI7A 3LSYA 1TC2A 4CM6A 1Q74A 3UB4A 4J7UA 5K0GA 1DEHA 1COWD 1PBNA 5IK2D 4JFAA 4IDDA 4J2TA 3RC2A 2WSLA 3LLMA 1EXMA 1T0PA 4IIHA 3H9QA 2HY7A 5TQ2B 1T8TA 4MW2A 1LSJA 1T91A 2H92A 1NONA 6REQA 3N2KB 3LPCA 1RQXA 4FQ7A 3V1KA 5KNCA 1TB4A 2P2GA 2N1MA 4Q7MB 1LPOA 3CG4A 1N9ZA 1LNQA 2VNKA 3KT6A 1KMIY 1H2FA 4PZDA 3UICA 3KB2A 4U9HS 3ZH9B 4KIWA 3ABQB 3KWMA 3BYZA 3JQBA 4UOZA 4JB0A 2X1VA 1G2QA 3KZNA 4P4LA 2PT9A 4EB8A 2C4MA 3DVQX 1CHDA 3VA7A 5JAIA 4OA5A 4XYGA 1MQ8B 4IH4A 1CLUA 2O48X 3R0JA 2IY8A 5IFLA 2ENUA 1GEGA 4FP9A 2BUBA 2H29A 2Q1WA 1CQIA 2B82A 4AW9A 1FY2A 3VNUA 4JLNA 1T2VA 3B6MA 2AXNA 4B3XA 1R15A 3MRSA 4MDFA 1FTSA 2C2OA 1H8HD 2YXEA 3DC7A 4Z9XA 2AN5A 3SR3A 5FQOA 5K01A 4CL0A 2V4MA 2V5AA 4R3UC 3VUEA 4HUQB 4WEOA 5FI0B 1CZHA 1U9ZA 2VH2A 5FWXB 4PZ0A 5DTMA 2LCIA 3FD8A 4KYIB 4IDHA 4MVJP 1LJ8A 1S02A 3HI6A 4UTRA 4AI6A 3KLOA 4XDGA 3P71T 3V4ZA 3UHOA 4I46A 5EZYF 2B2NA 3BL8A 1M33A 1B8NA 2A5GA 3I52A 3L8DA 4MV3A 1ECGA 3SBDA 3SCZA 1E3WA 2BKUA 2BD0A 3WP1B 3FDJA 4JA0A 5FUWA 4DJFC 5L4LA 3Q8MA 2PGJA 3N0RA 2GK3A 3A4YA 1GUBA 5EJGA 3LVQE 5JFGA 1TU3A 4YCBA 3JQFA 4EAQA 1PS9A 5KSPA 2VXCA 2ATIA 3RS0A 2GPTA 1NUPA 2GJ8A 1S8FA 1PSWA 4F5ZA 5C8YF 2NGRA 4D9JA 2W9XA 2O2YA 5IKXA 2A30A 3VC1A 4ROTA 4BKPA 5DO9A 3C16C 3RLFA 1CZRA 1EMDA 2FSUA 1C1YA 2GFQA 2PZEA 2VWHA 3WIUA 5HXAA 1NSFA 1RPAA 3ZK8A 3UMCA 3C41J 2FGJA 2PGXA 3GEIA 2QRGA 3I09A 1T36A 2A6PA 3GBPA 5H1YA 2Q5EA 5KQMA 1ZMTA 1VG0B 1X74A 3DOJA 3HCAA 3UK2A 4HVCA 2UUOA 1PRYA 4CEJB 1LBHA 2QL6A 3JX9A 4U7GA 1WUKS 3DBRB 4Q1CA 1LZLA 2PUJA 2FPXA 3QU2A 1POWA 4W9MC 4PNZA 3OM0A 1L8LA 5DNWA 2Y6UA 2VXBA 3QELB 2YIVX 4J0DA 4D0SA 3CW2A 5IMSA 1W52X 1Y1QA 2G4VA 1UBLS 3KU4A 1A8SA 2DBQA 1JHQA 2HXGA 4WCFB 4D80A 3I62A 1E3MA 4JFRA 4G5QA 4ND8B 1URPA 2PU7A 2A7QA 1G8JA 3GC6A 4BLTA 2P62A 2BI7A 3QMMA 2VEDA 4QTXA 2H2FA 1ULSA 5KNBH 1INLA 1J0EA 1H6AA 4GSKA 1DFIA 5DHTA 1NLMA 5EQJB 3DLIA 1YIDA 1RHUA 1OXMA 1SZCA 3HQ4O 1B6SA 3K92A 4GQBA 2RGNA 5GM1A 3R3SA 3ZVRA 4CZ2A 2ZT6A 2HA4A 5ELXA 5TV2A 4WGFA 3IHKA 1UK8A 4PAGA 4X3CA 2GASA 2QM0A 1Z22A 2WJ4A 4KXXA 4PF1A 5DM2A 4Z54A 3EPHA 4WCFA 3UB3A 3NGXA 4B32A 1DG9A 1TYAE 2FUCA 3D0QA 5DN6A 1TNDA 4Z4IA 3PHBE 3RRBA 4XGRA 3K9FC 2BMJA 5DM60 1WSDA 3T9FA 3ROFA 4PE5B 3AH8A 3AF4A 4D41A 4DR7B 1GQ2A 4D8TA 1Y5IA 3QQPA 4MVJM 4W1SA 1GGJA 4G07A 4RQBA 3LC0A 4KU4A 1MIHA 1ILWA 1ULTA 2QXTA 1SXJE 1C29B 2F90A 1NY5A 3M5WA 2J85A 3L84A 4KWEA 2WWVD 3RUCA 3ZJVA 4DSNA 5D5HA 2PO7A 1CRQA 2VP3A 4IMRA 4CE6A 2R1TA 2VUHB 2P6MA 3CRQA 1FTNA 4MR7A 3FHCB 5DDIP 1PJSA 3UA3A 4HDSA 2BHRA 1T6XA 1GSOA 3I3SR 2A86A 3IAM6 4QXOA 5C0OE 3UIEA 3RKRA 5HYVA 5JMOA 2V0NA 1S6YA 3EZGA 3WAJA 1R4AA 3MGCA 1WZNA 3HBLA 3M5DA 3AUJB 1L7AA 4XSHA 3SOPA 1Q1QA 5B37A 4HQKA 4M8KA 1A9TA 3OM8A 3WIVA 3BZUA 4B87A 1QKIA 3T4PA 4L5JA 4QQNA 3ODGA 1JIXA 4YRKA 3JY6A 1XU4A 3QPDA 4Y1RB 2P9EA 1RRKA 3HVHA 4BX8A 1AZLA 2PZFA 5DKFA 4JC5A 3R7AA 4PHTA 4XVRA 1LRJA 1ZHHA 3ICQB 1KAHA 1C0PA 4YC7A 2PL9A 1ZH8A 1W34A 1KNXA 4MYDA 4YEDA 4ID9A 5EZYB 1DMSA 3FVWA 4GPTA 3RK1A 1JG6A 4N5NA 4NNOA 2AOUB 2IZ1A 2PUTA 2B5VA 5G02A 4GPEA 4EFKA 4M9CA 5F2NA 1IXYA 4AS3A 1SRRA 2M9MA 1SB8A 3F1KA 1JR3E 4CN9A 2XZPA 3KT3A 2X0IA 3OOYA 5B1IA 4MS1A 3IC5A 2BTQA 3SQLA 4X6YA 4KQ6A 4NZYA 3SEQA 5BNTA 3QX7A 5HQ3B 3DMFA 1T8UA 1TVMA 1DV1A 1J2JA 2IYUA 3F3SA 3PFCA 4R2MA 4QPPA 3KE8A 2H1WA 3TXYA 5CDUA 2GT1A 2ZQZA 4DA4A 3OE1A 5KKCA 2XMDA 4BV9A 1QTIA 5EZYA 1XAIA 4R6WA 2GNPA 3CT4A 4DJDC 2P90A 1KYIA 1DVRA 4L0DA 4RYDA 2JC3A 2Z3WA 3KYDB 3KQLA 2WZQA 2Z0MA 3KQKA 4JBHA 1NC3A 6ADHA 1FYFA 2X6TA 2Q0HA 4PX2A 3WL4A 1PJCA 3NDIA 2CFOA 1FFGA 3FCAA 4GMKA 2B1QA 2WT4A 4PPFA 4MGHA 5COAA 5FH9A 2C5BA 3IA7A 3AC0A 3OM9A 5C8YA 4A0QA 5AKXA 4G8BA 1RC8A 2MYNA 3QPUA 3RQIA 4A8HA 2OCPA 4OQEA 5BPFA 5I7SA 5I7FA 3LGAA 4DLRA 3IV6A 1K7XB 2WWGA 3Q2OA 2D8AA 4KWHA 5JD4A 3FOCA 4G1UC 3ZWQA 1FSGA 2QPTA 1YD7A 4QOHA 3ZV3A 2VQFB 1LI4A 1CV2A 2B9EA 3IDFA 2I2FA 3OCVA 1L4GA 4M54A 5FOSA 2BM0A 3HG7A 3COWA 5TVGA 5U9CA 3JQ6A 2KX7A 3F5FA 2PLFA 4MVJF 2VSFA 4RSMA 1PFYA 2QWXA 3MTQA 5KINB 4PYMA 3LWNA 4F9GA 5KYXA 1KYXA 2UVQA 3EZ2A 1E9RA 2OUIA 3MELA 1Z5ZA 3B1JA 1QE5A 5JALA 1OAAA 1OBFO 2AG5A 3NFRA 5I7EA 1ORWA 2F9MA 3ZVMA 4RQUA 1A69A 2QTNA 1HQCA 1HT1E 3TQOA 1W2GA 3QKSA 2W7TA 2CLHB 1VIAA 1JAIA 2JASA 2JGMA 2FMTA 2WU0A 2CVOA 4UTZA 1E79A 1TCVA 1VDZA 2Q62A 4LZPA 4F2DA 3T95A 2AOTB 2C5SA 4L57A 1R5OA 2BGIA 2J48A 4UCWA 5BYKA 4UU7A 2VYNA 1BDJA 1KAQA 4YROA 1ZMXA 3HFJA 2WD8A 4EL0A 3CPHA 2XUHA 4ZA2A 1GEEA 3P9KA 2H4HA 2HA5A 2WPNA 4G1EB 4MULA 4N5DA 3U1TA 2JGFA 3PL5A 1U0OC 3ZG6A 1L5ZA 1JQDA 3CGWA 3LJKA 3UMBA 2VNSA 1FU4A 3I8OA 7AT1A 1MCZA 4RSHA 2DKFA 1IBRA 4IJVA 4BXOA 3F7TA 1Y7HA 5KWEA 4RF4A 2CVPA 3QX3A 3TLMA 3ZDBA 2ZSDA 4JU8A 4PS0A 5H8WA 5LB4A 1EFLA 2AYYA 4WESB 1E2NA 4NU6A 3DQQA 3C0KA 4A0RA 3IH5A 3U3JA 1NIJA 2IDKA 4ISBA 5EJMA 3ZJ4A 1T1RA 2A8YA 4OB8A 1P18A 1U28A 1NPTO 3GF4A 3U3KA 1TVKA 3U44B 5JSQA 1WXGA 4U7JA 5BMVF 1VSBA 1KK3A 3ZWPA 2ZCUA 2R65A 1XT6A 2PH5A 1EAMA 4DNOA 3D3WB 1I1OA 1T34A 1TZMA 4GI1A 3UAZA 5H70A 1NP6A 2C92A 1YMVA 2R85A 2ZWPA 4NH4A 4E88A 1YJBA 3D59A 2F7SA 3O3OB 3DBLB 3QHPA 4WESA 4MKHA 1MABA 4O2BF 3A6EA 3EVBA 1I1HA 1T0UA 4X24A 3TPZA 1E6MA 1NT4A 1QDEA 4GRDA 1HTBA 4B4KA 1FNMA 1TZ2A 3QU5A 3H3JA 1G21A 3JQ8B 1GR0A 4PG5A 3C6KA 4O4HF 4O2LA 2NPOA 5CT6A 4LJ6A 1H2YA 3NS7A 1ZK1A 4A4DA 2G1PA 4PIVA 4E07A 1L7MA 1Q19A 5KU1A 3ISTA 2YJ3A 4AX4A 2C8KA 5AIBA 1YJ8A 2EX1A 3MFQA 1E2EA 4UVEA 3LQ1A 1I6MA 4P7KA 5K6TA 1S2LA 3FPAA 3WHPA 4O2AF 5DN9A 4KITB 5EWJB 2AEJA 2JFYA 1VMEA 1CS4C 2QRKA 5BY2A 3EAQA 4IIBA 2BI8A 3L0DA 5ANRB 3RHTA 2JVKA 2JFFA 2CE2X 1JQ3A 4V1CB 5E2AA 1LX7A 3ILVA 1A5ZA 3JQ8A 2R2AA 1Z63A 2QNIA 2D62A 5BRJA 3IBCA 5CW2A 3MMSA 1UAYA 4MQEB 4I5EA 4DRXA 3VYRB 1YGYA 1T6YA 1SIUA 1AQYA 2ENWA 2HT6A 2XYPA 1AHHA 4JBXA 4KDRA 4NJOA 1EA5A 5DJ5A 3BICA 4BUZA 4JP8A 5HJ7A 3QE9Y 2B78A 1VE9A 5ALSA 5HJEA 1UKAA 1NUUA 1XV5A 2Q1XA 1JHDA 5IAAA 2CYAA 2ZSJA 3Q6NA 2I99A 3ASYA 4HQRA 1HNNA 2RJOA 2BBWA 3IEKA 3M6FA 4MVWA 2WVHA 4FGWA 1R50A 4PTLA 4Q3LA 3CZMA 4YCAA 2BFPA 2EG9A 5CP8A 5FOXA 1H4TA 3G7SA 2R86A 1IM2A 2W8BB 5DHPA 2C78A 2Y1EA 2ZIWB 4E32A 1Z6YA 3HMKA 2AKEA 1BXRA 5JH7B 1J2UA 3MJDA 3KALA 1DCTA 3KVRA 3O5AA 2FRDC 2Y76A 3QFCA 4JOBA 5DX8A 4ESOA 4RZ3A 4UUOA 4RGQA 4XX1A 4BO2A 1AZWA 1M7HA 2DY1A 4I6EA 4TVKA 4OSPA 1YDWA 3VSBA 3TIVA 3ZZNA 4G84A 5JFTA 2Z8XA 2R6HA 2YV3A 2ZZKA 3DWGA 3GXOA 4MR8B 2O7QA 2IP4A 3VDRA 4Z4QA 1YE8A 4Q4HB 4WCVA 3BD8A 3AI1A 4II7A 1H2EA 4ZJZA 1G42A 4HNTA 1E7RA 1P39A 1W4LA 4FYJA 4RZSA 4IBOA 4KQ2A 2UZ3A 4ZALA 1CZNA 3WGMA 4JWKA 4LPKA 3HXOA 1V5WA 3G2IA 3X1JA 4HEJA 1Z7WA 2DPGA 2PBZA 1ADYA 1C3XA 4B3GA 2GK6A 4EDHA 3HDGA 3OCXA 1JKMA 4ZOAA 5K2OA 4CYMA 4ERXA 4GDFA 4MCIA 3GDGA 2VA8A 1TAHA 6ABPA 5F3RA 1UBSB 4BVLA 2J9RA 4ZJPA 3T1YB 4B4OA 4K9NA 1GU7A 2XY4A 5EQDA 4ZI3A 1P4RA 3QLVA 3OCYA 1P61B 4E30A 1C1XA 1I7PA 3EIUA 2IXTA 4N7MA 1DO2A 3ESCA 1WCIA 2PVCA 2XBUA 3E70C 3CVWA 3GCGA 1V26A 2MINB 4J0GA 3MJSA 4YJFA 2NNLD 1A88A 2DQSA 3UT5B 2QD1A 3UYKA 4E14A 2PLWA 2SKCA 5CFRA 1FP4A 3EZ6A 3GLUA 4BWGA 1IL0A 3B9BA 4Z8XA 4L15A 4ISCA