2V5VA

W57e flavodoxin from anabaena
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
169
Chain Sequence
AKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTENIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Tuning of the Fmn Binding and Oxido-Reduction Properties by Neighboring Side Chains in Anabaena Flavodoxin.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Electron transport
total genus 60
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2v5vA00
4C76A 1BVYF 1YRHA 3SVLA 1VMEA 2OHIA 1FLAA 4BMPB 3HA2A 2ARKA 5B3LA 3OX1A 3NHUA 3LT5A 2Q62A 3UXEA 1FUEA 3KLBA 1J8QA 1OFVA 4ICIA 3NHFA 1YCFA 2F1OA 4R81A 4QOFA 3W7AA 1DXQA 3QFCA 3GAMA 1QR2A 4Y9RA 2QMYA 1CZUA 3O2NA 2M6SA 4LTDA 1E5DA 1YCHA 4YALA 1T5BA 4CETA 3W78A 1C7EA 2B3DA 2Z9CA 5EMNA 1CZLA 2Q9UA 2KLBA 3KAPA 4OXXA 4YQEA 1D03A 1ZWKA 4XDHA 1D4AA 3S2YA 4DY4A 1JA0A 1QRDA 3NHLA 2A5LA 4S24A 3ZHOA 4LAFA 1H66A 4F8YA 3TZBA 2QMZA 1WSWA 5LJIA 2V5VA 2FOXA 3ESYA 3B6IA 4FX2A 4J8PA 4ZVKA 4FGKA 4NLLA 3NHPA 3FJOA 5LBUA 1F4PA 4C0WA 2D5IA 5NULA 2FCRA 1J9EA 5LVAA 2QX8A 2FZVA 2WC1A 3R6WA 1CZOA 3TE7A 4FGLA 5LJLA 4C0XA 2KQUA 2BMVA 5ULLA 1CZNA 1XI2A 3OVMA 2QR2A 3GFQA 6NULA 1ZX1A 1JA1A 5TGZA 5F12A 4QOGA 4QODA 2QX6A 1KBOA 3F2VA 1XYYA 5JROA 2HNBA 1QBGA 2M6RA 1KBQA 3HLYA 4N65A 1AZLA 1WSBA 3K1YA 1YCGA 4GQIA 1J9GA 2QWXA 3OWHA 1SG0A 4PTYA 2BPOA 2GSWA 3F6RA 5LLDA 5F51A 4NULA 1FLNA 3NHJA 2HPVA 4U7HA 4PTZA 4C14A 5EA2A 2HNAA 1C7FA 1RLJA 3L9XA 1XYVA 3NHKA 2BF4A 4ZVMA 1FLVA 1XT6A 2OHHA 2BN4A 3N3BC 3N39C 3B6KA 1NNI1 1AKUA 1AHNA 3OJWA 1AKVA 5LBTA 3QFRA 3NHYA 1TLLA 2Z9BA 2N1MA 4BMOB 4Y9UA 3QE2A 4ZVLA 3RPEA 3FVWA 4DIKA 3EDOA 1FLDA 4U7FA 3EYWA 3B6MA 1AKTA 3L9WA 2Z9DA 1FVXA 4HEQA 2FAXA 2OHJA 2R96A 2XOEA 1YKGA 1D04A 3GFSA 2OYSA 2BZSA 1AKRA 2MOKA 1T0IA 3G5MA 4YAWA 1V4BA 1SQSA 3FX2A 2MT9A 4LTMA 2FDXA 1AG9A 1ZWLA 1CZRA 3JSXA 1GG5A 1OBVA 4YAFA 3U7IA 5NLLA 2RG1A 2FVXA 3N3AC 4QOEA 3TEMA 3OWXA 1X77A 2W5UA 3W79A 2ZKIA 2V5UA 1BU5A 3ES9A 4H2DA 1CZKA 4GI5A 4YAUA 4Y7CA 1FX1A 3LCMA 2QX9A 1DX9A 3NHRA 3F90A 2MTBA 1QHEA 3ESZA 1YOBA 3FW1A 1AKWA 3NHWA 5F4BA 1OBOA 4HS4A 3ESXA 2V9CA 1RCFA 2QX4A 2FZ5A 4H6PA 3NHSA 4CF6A 4N9QA 5A4KA 1H69A 3HR4A 4LA4A 3FNIA 1I1OA 3OX3A 1DXOA 5EAIA 4ESEA 4FGJA 3NLLA 2R97A 2X2OA 4QOIA 3P0RA 3D7NA 2X2PA 4XDGA 4PU0A 1J9ZA 4D02A 4QOHA 3U7RA 3O73A 1TIKA 1CZHA 1RTTA 2Z98A 4ZVNA 3F6SA 2FX2A 3NFRA 4LTNA 5FUQA 3KAQA 5FX2A 5BUCA 1YDGA 1B1CA 5LMCA 2AMJA 1AMOA 4QOJA 2FLVA 1AKQA 3K20A 4YAOA 3OJXA 3OX2A 5FA6A 5B3KA 3B6JA 1FTGA 3UXHA 4U7GA 3GFRA 4M0CA 2XODA 4DILA 4N82A 3KEGA 4GR9A 1RLIA 2MWMA 3W77A
chains in the Genus database with same CATH superfamily
4RA6A 4D98A 1QCCA 3WXMA 1UOOA 4LE1A 3D3KA 2CV1A 1IM2A 3CUTA 5DHFA 2XVZA 1VIDA 3UKJA 4YRDA 4CKBB 1VMEA 1XJWA 3QX7A 4NFLA 2Q2NA 5D01A 1E58A 3OEWA 2QAJA 4PXSA 4JBNA 4YONB 3MJEA 1NQUA 1LI7A 2AX3A 2GXUA 2RGGA 1JMVA 3LZCA 3GJZA 4H0NA 1K89A 2YYZA 5IFKA 3NGLA 1LPOA 3FTQA 3O94A 4DCTA 1KEEA 2YVUA 2HEGA 4AIRA 4BEWA 2VSXA 4Q6BA 5K0GA 4JLOA 3IUQA 2IZ5A 5CNKA 1OLUA 5JBQA 3G2OA 3SXUA 3T4UA 1I7QB 5J2UB 1KJJA 5TDHA 2QUKA 3QLVA 3TLAA 4OQQA 5CAEA 4J0HA 1AQLA 1II0A 2JLAA 5EYPA 2CBXA 2NT3A 2W93A 3D0QA 3PQ5A 3OOJA 4RVOA 1U7WA 1DGQA 3E3AA 1X0VA 4ICIA 1CEQA 1GNRA 1P61B 1SOWA 3IEUA 4HR7A 3RVRA 3H5OA 3X1JA 2GN2A 1S9DA 2QRMA 4H17A 2A0UA 2PM8A 2XHEA 1V48A 4U63A 1J0EA 1J2UA 4HH3C 4C4SA 1OC4A 1WXDA 2Y2UA 3AVYA 2F1OA 1U90A 2HT1A 4K9DA 1FDUA 2ALJA 5GV7A 1XXHE 3PGMA 4PRZA 2NZUG 3QFCA 4Z4EA 5MGBA 4GMDA 4C6TB 4D57A 4F92B 1BYIA 1PLJA 2HA6A 1M67A 4TKVB 3UWKA 2B36A 2KWIA 5ALXA 1EIZA 1NPDA 4RV9A 4G5GA 2VNIA 5F76A 3SQNA 5ICEA 3E4CA 3KJQA 3GT0A 2O8BB 3BD6A 2JGNA 5FAKA 3Q9LA 2AN5A 4YALA 3VU1A 4CI9A 3I9V6 2DPMA 5A7GA 2EWWA 3RFXA 3HJFA 2ZRQA 1G9SA 4ADSG 1DDOA 3DZ8A 1R0XA 1SIBE 2V7QD 3MT8A 3H2JA 4I1IA 3UOWA 3UWDA 3B5IA 4EI2A 3L1UA 1G8SA 1NKVA 2VF5X 4GKAA 4MGYR 3ZDCA 2VUSA 1YZHA 4UTZA 2JHPA 3FIJA 4G01B 1AK9A 4YO8A 3U39A 4PLWA 3U4HA 3C6XA 1LTQA 2EEPA 4Q7JB 5HZKA 2QW1A 5LOVA 1PNVA 4OQ4A 3U3XA 5H16A 3SZOA 4RTPA 4IEIA 3IX7A 1BJKA 1BE6A 2CCGA 1NZJA 4G63A 4KDCA 4WIAA 2CDAA 3HCPA 1T3SA 1RXCA 2VG8A 2WZDA 3LW8A 2A0WA 2C8VA 2I3ZA 3L04A 3PDUA 4FOTA 4R31A 4ATNA 4C7MA 1H4QA 1E2DA 1ESNA 2CXXA 1JG4A 2A5LA 3C1UA 1PR6A 1N2CB 3EODA 2O5EA 4OI0A 4LVUA 4MS3B 1WEKA 1DJMA 3LK7A 1SVOA 3PGXA 4MA4A 1A71A 3DMRA 2OBNA 5J5CA 3U19A 3HU5A 4AY4A 4DNOA 4BC1A 1FQKA 4F8YA 4LI0A 4YCSA 1RFGE 1VJRA 2GJ9A 4WZBA 4E5NA 1G8PA 5IAGA 3U0BA 4ARUA 5KVSA 4BMYA 1NXXA 3FD8A 3NYIA 1NQAO 2WFLB 3LO8A 1ZRHA 3S3TA 2N75A 2ZK7A 3R0JA 4A8JC 4ALIA 5LC1A 3TSWA 4BQPA 2QJOA 1K88A 1DNPA 4IDOA 3TLYA 5JC1A 1II8B 4QHYA 1CR0A 4IXNA 1NW8A 1PF7E 3WZ2A 4LZPA 4BEVA 1WHTB 3KLPX 2Q3EA 4CMJA 4TKLA 1NSFA 4J29A 1EJ6A 3CLKA 5EMHA 1FP7A 5GIOE 2DERA 1GOTA 4CDGA 1H4SA 4ZEOA 2RC5A 4B35A 2JFHA 1BH2A 2ZU0C 3VVLA 1RI1A 1HDZA 1VB3A 2WIFA 4JBWA 4DIBA 4Z3OA 3UY4A 3EQZA 4GXRA 3UKDA 3QPAA 3LO5A 4FXPA 3WLNA 4YCNA 4V24A 3C4VA 1HYHA 3ET5A 3LIIA 4FQ7A 2BH9A 2R8PA 3PHBE 1W36B 3ZKWA 3ZHUA 2D5IA 3JWHA 3ROPA 3GJXC 4MTLA 4GGMX 4A2WA 2J6BA 1A69A 4HAYA 2G4CA 4MIYA 4DQVA 3GDHA 4JYMA 1ZW1A 2ZB8A 2FCRA 1DKNA 3O9VA 4OGFA 3DKVA 3BMXA 2Z56A 4FCWA 2ZAMA 4INJA 3DZKA 2FSHA 3VC3A 3BUSA 1Z7BA 1V37A 2YHIA 5LQJA 4FM9A 4DJ5X 3THRA 1P1BA 2RJOA 5L3QB 2XT6A 2XE7A 3PNLA 5E3HA 4U1RA 2DC1A 2IT1A 3F3KA 4MAMA 4DEVA 3JQQA 2ZJ6A 5AJUA 1I24A 5BO5A 2RJ3A 4AURA 2SICE 2G1AA 3K30A 2PRYA 1CZNA 2MR5A 3MMSA 2WJHA 1FDIA 3JTMA 5KYUA 1L7EA 1TTHA 1POXA 2QRPA 3OCVA 4ZEWA 1UKCA 4NOJA 5CEJA 4KNYA 2CMDA 1PJZA 4PRLA 3PPYA 1CP2A 1WKBA 4C6HA 2YZGA 4C9BA 2QN7A 1T2UA 1ZX1A 5DTEA 2YJZA 5HRAA 3AW8A 4LGCA 3HY4A 4MKHA 1ZJYA 4LOHA 5F12A 5IWCA 1Q19A 1NU6A 4YRIA 1CV2A 3M81A 4H3SA 1AS3A 3RHTA 1W4RA 4B3RB 2VWGA 1J70A 2QX6A 2ZWVA 5A4MS 3PEVA 2YW2A 2Q9BA 5TARA 4JFAA 2R5FA 3NONA 3AZPA 3X44A 3LUAA 1T0JB 4CV3A 2IW1A 4NG4A 4RK1A 1TFUA 4FWIB 3MWFA 4R54A 4ESOA 5F23A 5ES4B 3KC2A 2WAAA 5BQOA 4DMRA 3SZLA 1SXJD 2W2LA 1H2RS 1MAAA 2YICA 3KTOA 3R23A 5BVGA 3NXSA 3LDUA 4FNGA 3CJRA 5JR3A 1X7GA 3U48A 3OPYB 2R7AA 3T12A 5FPHA 3PQ4A 4FDLA 2PGXA 3BMQA 4N5NA 1FDRA 1XZ8A 4QXAA 4D46A 1N8TA 3TOXA 4NULA 4PZ9A 5J58A 3P26A 2HA2A 4NK4A 1XTUA 4PYMA 4YI3A 3URKA 1IVNA 1ZD2P 3JQ6A 3SM9A 4AJ4A 2AVNA 1IC6A 4KDEA 4L9AA 2XOXA 4EBBA 4C7VA 1AF4A 2GO1A 3D3NA 5L3SA 3CLSD 3H5NA 3GMIA 1KZ7B 1MNAA 1NQ5A 3LXUX 3QIVA 4Y2VA 4YIKA 2OFXA 5IC5A 2HLHA 3VPHA 3FDXA 4IVQA 3WL6A 3PFWO 2OFWA 4BFCA 2GN8A 3WMGA 3UH0A 4DLWA 2G40A 3B1ZA 4ZOLF 1R27A 1V25A 2W48A 2IUUA 2GILA 2VDWA 4WHMA 2ZJFA 3STYA 1ETHA 4PC3A 2WUVA 1C1XB 2BFFA 3WK4A 1WPRA 4UTRA 3T3PB 4EZEA 1VBFA 5TXGA 5GJBA 1FYVA 1WOYA 2JZCA 3QITA 5HIAA 1F8GA 5IT4A 3A6EA 2P35A 3DCIA 4LX0A 4NU5A 4TMXA 5HX7A 5F98A 2KS6A 3MJVA 3GUHA 1QIIA 2ZVQX 5D2CA 2Q1UA 2CUNA 4X3PA 4O4JA 1P7YA 1GSIA 1NHWA 1DCTA 1AHNA 1LTHR 4D80A 1XAIA 1VIVA 3L0ZA 5LP6B 3FCAA 2ZCJA 3K32A 3HBNA 3OPQA 4G41A 2O9JA 4L1KA 1E2FA 1P2DA 3A6JA 4RF2A 3NVMB 3SSNA 1BCRB 1QIGA 3M0EA 4Q1EA 4WZAB 2Y1CA 4RHUA 1E0KA 3MF4A 1ZJJA 2O0MA 3UW1A 2VZ9A 2HYIC 2FPGB 5L3ZA 2WNIA 3EIOA 3KSBC 2DFNA 4OXQA 3D31A 1Z5VA 4J1QA 1HM5A 1U1GA 2PZJA 3VH3A 1ZJWA 3OHPA 4DIOA 3T54A 3E05A 4HYQA 4AZTA 4GLFA 4NV1A 3ASYA 1QC5A 4WKBA 3EDOA 4XOUA 1NQWA 1TMGE 1MP0A 1GPYA 3G68A 3THYA 1Z22A 2VHVA 3RJ9A 1TCVA 1TL7C 1U3WA 5DJ5A 1TJ3A 1UJNA 1ZH8A 3IEKA 4IOLA 5CIWA 3TTXA 2GOYA 4AW9A 2I7CA 1EGQA 5LZ9A 3OH8A 5GJCA 2VCHA 2VHQA 1CDZA 1YVEI 4Q15A 4YRMA 3ZD6A 2EP8A 3QUCA 4AS1A 1P2BA 4G1UC 1M5RA 5CCEA 4TRMA 3WYEA 1EFPA 2JGDB 3N2KB 4HNHA 1UBUS 4OHVA 4RFSB 2AJBA 5E9AA 2I4MA 1W29A 2VFAA 3IMCA 4G2NA 4PYKA 1FVOA 3CUVA 3C5EA 1LVUA 2QIOA 3BMCB 3EXG1 3H3FA 4O4HB 4X97A 4YTEA 4P7BA 2IHNA 1NBHA 2AQKA 1PI3A 4OBBA 3TZLA 1RVV1 2NXEA 5F3DA 3ZN2A 4AYTA 4YCLA 1NYQA 4N3BA 1X19A 1OPRA 1ZITA 1H05A 4GNRA 4JNKA 4XQ9A 5GAJA 3C8MA 1YL7A 5TF4A 4F8EA 4MS1A 1G6HA 2VHYA 3ORSA 4OP1A 2KM1A 1SA0A 2MR6A 3I64A 5FR1A 4BVHA 4CIDA 1QIJA 5DWDA 4M0UA 5THQA 5A4FS 1YTLA 4RELA 3R0VA 2Y1OA 5COAA 4DLVA 3D4BA 3GJTA 2EJBA 2V7VA 4GH5A 2O23A 5EXPA 5BYJA 1BMQA 3KO8A 3BFVA 5PGMA 2PR7A 1CU1A 3AG6A 4CMAA 5IKXA 4LMRA 4DS3A 4F46A 1E7WA 4N6OA 3I5UA 3OP4A 4WNAB 2AX4A 4R8LA 2G08A 1U2QA 3DJYA 1TZMA 3GA0A 4GEGA 4I8XA 2Q8PA 3GWGA 1E2GA 4PO3X 1MMFB 1O3YA 4A4DA 2FSVC 2IHVA 4KQCA 3KJZA 1D4OA 4DEXA 2GLXA 4RAQA 3D4LA 2E4UA 1KQGA 4FYIA 5KWVA 2WTAA 4EA9A 3OT5A 4PZZA 1ZW6A 4BN0A 3N0RA 2CNOA 5JAIA 3G89A 2CD9A 4AY2A 1JL3A 3DAGA 2HZBA 2IYFA 3OY2A 1TUBA 3KXDA 3DOEA 3AL0C 4GI7A 3WTCA 5EE5B 2WUFA 1WQ4A 2NYRA 4B4UA 3QEBZ 3CLTC 2CE7A 3JWGA 1BJRE 5AI5A 2JKZA 2Y3IA 5AICA 4DV5B 1H6CA 2PK3A 4UHDA 5B37A 1IG0A 3WISA 3ROGA 4EY3A 2VKTA 3AUFA 1WNFA 3OMXA 2ZKIA 4B4DA 1AQUA 3GA5A 1JV2B 4QU9A 3DHVA 1Z6ZA 1D8AA 4S2UA 3RS3A 1P80A 4E2XA 3P9KA 3ROKA 2GWHA 3LCMA 2RGCA 1YDFA 2A35A 3JQ8B 3KPYA 3KR1A 3K1AA 1V6AA 4Y3UA 1HNXB 1KWGA 2UZAA 2QSYA 1WO8A 1HY3A 1KA9H 3FPEA 4HGNA 4Z0TA 3ITEA 5A0TA 3NDBB 2QORA 3BKWA 2HF2A 4LBWA 1HRDA 1ESDA 2WHXA 3RCBA 2NVOA 4DRXA 1RP1A 3EGIA 5HIIA 1KZYC 2FNAA 4IJ5A 3JQAB 4GL4A 2Q1WA 4FKMA 2ZUTA 4DW8A 2P4EA 1XTVA 3AOGA 1NVAA 3ACBA 1NY6A 1XRJA 4ZQGA 5I9MA 5JADA 2A9QA 2O52A 2HAEA 5DX0A 1ONNA 3V8EA 3VZDA 3IAFA 1T2VA 3C85A 1O5IA 3LTEA 4XM0A 2IPMA 4JBHA 4M7RA 1ZQ9A 3EB9A 1H23A 1QHYA 1JVBA 1IHOA 3LRXA 1GRQA 3FCSB 3KTAA 1G17A 5DI3A 3O2QB 4YQYA 1DPFA 5EJ6A 2JLRA 3USCS 3AFMA 4LGMA 3L8GA 1F3OA 2A8YA 3AGPA 3OZBA 2B2NA 4RIFA 1SHTX 3NM6B 3TIVA 3W06A 4PLTA 1WXEA 1QRSA 1V95A 3WA7A 2V65A 4RMGA 5IMBA 2QM7A 2PQ0A 4RZUA 5I8ZA 5KPJA 5JFTA 4M22A 1E6UA 3H0KA 3JVIA 2JJ2D 1Y8CA 3QYFA 3HS3A 3U81A 4A0HA 4EP1A 4QA9A 3TB4A 1SQGA 1G38A 1X1DA 2PN1A 4M60A 5CJPA 1MO2A 2VF2A 1QYVA 4V03A 4EBFA 1C2TA 2VDNB 3DE2X 5IJAA 3PPVA 3DE1X 4ID9A 2H57A 3PGJA 5LZ7A 3T8YA 4D26A 3MGGA 2P67A 2RDMA 3L1IA 3IESA 2QG6A 1XLTA 1FIUA 3MYRA 4W5TA 1S1MA 1SVMA 1V35A 2GSDA 3SLKA 1PWZA 3DS8A 3HUTA 1H8ED 1NBME 4WESA 3F6SA 1G1MA 4OA8A 4ZHSA 1SKBA 1XZJA 1Q2XA 1G41A 2F59A 1JE0A 4QDOA 5H9WA 1XQVA 2KYRA 3E1SA 1QIDA 3PWTA 3ZWYA 4UNPA 1PAUA 3KQLA 2OESA 4QG7A 1OUMA 4BWFB 1EE2A 1NWHA 1XEWY 1ZA1A 3H1TA 2W9XA 4JEHA 4P0TA 3GF4A 1H3FA 1PSZA 3LUPA 3UB2A 2OHGA 1Q17A 1E3WA 4NI5A 1CQJB 4X41A 2J1LA 2RBGA 4NFHA 4B7AA 5KU7A 2QA5A 3CLRC 1M83A 3A4LA 4NMXB 3UWPA 5HM8A 3BIOA 1DAPA 4MB6A 1OAKA 2QW8A 3N7UA 5KO2A 4EVQA 3EBPA 2Q41A 5DNVA 3R7AA 1OB5A 3N8IA 3WYGA 1VG1A 1BZYA 4LV8B 1CLEA 2YVAA 2FU5C 2CK3D 2ZIEA 1XTZA 4MJ7A 2ID8A 4KZKA 1RRKA 5AQ1A 2J5KA 3LHDA 1SUSA 1DEAA 4H27A 4HGQA 2VP6A 4RIGA 2Q29A 3EFBA 2ZYSA 4UD2A 2YVLA 4IDEA 1COWA 1PT6A 4N82A 4S1VA 3GFTA 3KK0A 3ZZMA 5H3LA 2V7GA 4LSMA 5D1NA 3EEQA 3QSGA 3WR5A 5BPFA 1WE2A 2PO7A 4XIFA 2XWJI 1QE3A 1LDBA 3O84A 3OQHA 1F4VA 1E3JA 3BE4A 3JYOA 4AWBA 5JAQA 4IS3A 1QCDA 1A9TA 2HV8A 5LQMA 1NC3A 2C4KA 3DE5X 2FUNB 3I6YA 3W6UA 1R16A 2ZBRA 4KQWA 5ERGB 2GEKA 3L8CA 1QVZA 3F8SA 1AK1A 3L7IA 1Z4IA 4M9XA 4KC0A 4B09A 4BPBA 5JARA 4XQEA 1M76A 1TLTA 1KDTA 1ISIA 1U0GA 4DQXA 3WDKA 1XP5A 2VP3A 4CM4A 1TKBA 1Z4LA 1D2NA 1T8WA 2VN8A 3JD0A 1HT2E 1IRXA 2CGEA 1KO5A 2BTQA 2ZUUA 3CYFA 4KQXA 3X1XA 2RI6A 5BSWA 2XECA 4YUVA 4B79A 3AM1A 3GGPA 1JIVA 4BFLA 5EKTA 3GG2A 3W5DA 1FUEA 4CMEC 2BCEA 1DVRA 4CRWB 4E5VA 4H7PA 1JX6A 3CURA 1ZLXA 6Q21A 3L8FA 3H9QA 5DM60 5EHZA 2IZ7A 1EXVA 4HWTA 4BATA 1KH2A 2XHZA 3PQ2A 1LLUA 2DZDA 2FXVA 2V59A 3DP7A 3DUFB 3IUPA 4FC7A 5HMLA 3ZGLA 4CKBA 4UXIA 1U3VA 3KVRA 5IKPA 1VPWA 4WY2A 1V5GA 4F71A 4YRGA 2X3FA 2O8DB 1JR3A 1ETUA 1JT2A 1V71A 2ZETA 2IX3A 3RR2A 3BSFA 2Y9MB 3MFYA 2PKQO 3DZFA 3K3PA 1FMCA 4OQDA 1RBMA 5BV1A 3FVTA 3QE4A 1KJQA 4WGFA 4HQ6A 2OMKA 4AICA 4YT5A 2WIKA 3HJNA 5J2UA 4FQ8A 2I1VB 3DOCA 1Y5MA 2V55B 2WOOA 1HKUA 5KNBH 3TRIA 1JILA 3F3MA 3UBTA 3TL2A 3EY9A 3JARB 1XWWA 3ZDZB 4R71A 1UANA 1EP1B 5SY4A 2OZEA 5H4GA 1GVNB 2C5LA 4LZLA 1O0CA 2I4LA 1OILA 4RH3A 1SEPA 4OJMX 5HZHA 4PSCA 1G1AA 1UBRS 1IUNA 2OBMA 1RPTA 3GRPA 1JEOA 3D7RA 4YQEA 5EE0A 3L4JA 1BDJA 3EZGA 1DKQA 1CP3A 1YZNA 2OP0A 3A1TA 2WWWA 1I7SB 5HK8A 3B38A 5A7FA 4BUZA 4ZV4A 3X1MA 1NXWA 1NUHA 3DMNA 1NQXA 4MV7A 1UL1X 1WU8A 2UVQA 3G5AA 2WFZA 3ORQA 4A8TA 3NHLA 5IAJA 3M3HA 4Y2PA 2FFJA 5ED4A 1ZS9A 1WV1A 1Y8QB 2O8BA 2BGLA 5DVZA 1E2BA 3VO9A 1LDMA 1R9NA 2C2ZA 3Q0IA 2XVXA 2F6RA 3KKZA 1YRAA 4I5IA 4I6JA 1W35A 4TWRA 5AKZA 2BFDB 3UJ8A 2HOQA 2J4DA 3C7DB 3HI6A 3HJHA 1BVRA 1YQ9A 2YASA 4UU0A 1S5PA 4W5NA 4Y2JA 3ZIDA 3G1TA 4WLNA 3LTNC 1L7RA 2ZSBA 5JALA 1YRWA 1Y37A 3EVNA 3FVQA 3HBFA 2BFWA 3WO0A 3FZNA 1GZDA 3SY8A 1L4FA 4N0QA 3T3NA 1F3LA 4Q1CA 3L0CA 1UBJS 4CNQA 4LKOA 1QK4A 2JCVA 3R7NA 1AN0A 3TVDA 3ZTTA 4L0DA 2JJQA 2JI9A 4FX2A 4JODA 1TZKA 2XMGA 1RYFA 2QXTA 3KFVA 4FGUA 4B8WA 3M1LA 1T3TA 3QVGB 4WY8A 5JWRA 1JHDA 2I5PO 2GTPA 1CKEA 4G65A 2B37A 5AOVA 4NLLA 4BY9E 2WJ4A 5FUWA 1N2CA 3A3NA 4RMHA 1CY7A 3DEKA 1H5NA 1VG9B 3A4VA 2FR1A 2GDJA 3T9FA 2GFQA 4RY2A 4EITA 1G9XA 2W2NA 3KKPA 1D6SA 5CMLA 3TNFA 2REQB 2G9UA 4W1PA 1NOIA 3TLEA 4BFUA 1VE5A 3FROA 3A4YA 2IJGX 3LW7A 3SVTA 4CKZA 1VPEA 2PXAA 5K0LA 4HDOB 1KVQA 1Z5GA 2WFLA 1PWYE 3EA0A 3OQPA 4XUCA 2HF8A 5IM4A 5ANRB 5LQRA 1F17A 4NHOA 5GZ3A 2R6HA 4P22A 5KOJB 1II8A 2CY0A 1W4ZA 1SC4A 3IHLA 2GESA 4JBIA 5ALEA 4D9BA 3M5DA 4Q3DA 3RYHB 4FCTA 1R6DA 1T8RA 4R2HA 2RAUA 3HR8A 1V1JA 2IZOA 2X0RA 4OQYA 1I2BA 4ZRMA 5IBRA 3DKPA 4GMKA 3MCVA 5BY2A 3AI3A 3BCSA 3T3EA 1MZPA 5KJEA 1UMCA 2F3RA 3B13B 3W1WA 3RF6A 2IWRA 1FJHA 2GD6A 2O3RA 4NJMB 1PP4A 3DZGA 3TM5A 4ETIA 4LNHA 2Q2OA 5KHAA 1UXIA 3ZEAA 4GOMD 2QI9C 3DBRB 3QFHA 4LXIA 4NV0A 3EA5A 2G4VA 3L84A 3VDQA 4C2UA 2ZTVA 1KVSA 2L18A 2BHRA 2LDBA 3EZ7A 5FWYB 1J99A 3PNYA 3OQBA 1E9DA 1Y6FA 4RJIA 3V1NA 3W5JA 3LP5A 4FDMA 3IP9A 4ISBA 2ENWA 1YZFA 3PVSA 1RADA 1UEJA 4XX0B 2BGGA 1DJQA 4AJ2A 3U3OA 1LSJA 1K68A 3G9XA 1EJBA 3IMKA 3V4OA 1IHUA 2NZJA 1MAVA 2V7WA 1FEZA 1NKSA 3BJEA 4LJ6A 4PBSA 4BKMA 4Y2YA 2HU8A 2R8RA 5L3QA 4AFNA 2V4MA 3BORA 2HU7A 1J9GA 3AMVA 2WU8A 4GQIA 3L05A 2UV8A 1N5RA 2CUZA 1OVMA 3LC2O 4J3FA 4RETA 4UCFA 4BO9A 4ZVOA 3ML1A 2IUTA 2QP3A 1DBPA 2ECQA 2QZPA 1TK2A 4JGGA 1VFPA 2R62A 3HN7A 4RSGA 2PXCA 1O2DA 3FMIA 1O97C 4MKZA 2IHTA 2IBMA 1BTOA 1QIMA 2GHIA 3H2ZA 3HR7A 1L5MA 4WAUA 4DIFA 5DXAA 2QPTA 1K06A 2GM5A 2W83A 2Y1DA 2YOFA 3FFTA 2FE4A 3LC0A 3LNTA 4HSGA 5H3CA 5IKMA 4MV5A 2QRHA 4N48A 5J4HA 1N0HA 1P60A 4W5QA 2YUTA 4KKVA 3OEHA 1Q1NA 4M8KA 3IVAA 5JXHA 2AK2A 4KI0A 3DZDA 4GUAA 4Q4HB 3ZQUA 3VJRA 3P32A 5G0VA 3GEIA 4KPFC 2NZWA 1SIWA 1WDMA 2PMKA 3ZGYA 1VHTA 1XYVA 2FJPA 3E7WA 4G0MA 4EABA 1KRHA 4CTJA 4EHDA 4UTPA 4WV3A 3UGKA 5EKXA 1HDCA 1I5EA 4U7JA 3GJ5A 2RGAA 3BMOB 2J9RA 4IHJF 3KIPA 4E46A 2ANBA 4BNIA 4G4JA 1TTPB 5D7NA 2O2YA 3FUTA 1IU9A 4BKQA 3E9QA 2FEWB 3GBSA 5B2FA 1HK7A 1GCGA 5JRDS 4RY9A 4EI7A 3FYTA 1JHMA 1GARA 3D7SA 1TB4A 4MVJM 4XWTA 4NMLA 1A5AB 1RXSA 5FBLB 4BGVA 1C3LA 4K05A 2COEA 3LPDA 4GR5A 2J3HA 4HXEB 1MEJA 3GLRA 1MABB 4KAJA 4ZT2A 5FHQA 2BR4A 5KINB 3IULA 4PFSA 4JMPA 4QVKA 2PY6A 1KMCA 3EJWA 3CKKA 4ENVA 4I8IA 3TOSA 4MIOA 4Q4LA 5K3SA 5T6BA 1C1XA 2A1TR 5IZ4A 4R9NA 1O94D 4HC4A 5IDXA 3FAZA 3E48A 3F78A 4YFYA 3W3AD 4JC0A 3WLOA 1HEUA 3K6JA 1Z2OX 2A7XA 1NX9A 4IWNA 3OZTA 4RTOA 3H5TA 3N6RA 4M9UA 3RANA 4G85A 3RASA 2JGJA 3RVOA 1SKUA 3VZPA 1EFTA 3V1LA 4ZAWA 3LKZA 2PVCA 4F1JA 3TKYA 1FUKA 4HATA 3NM4A 2P5SA 4MGHA 4XLZA 4V0RA 5JAZA 3L0BA 5LP6A 1RM4A 3RG2A 1QZUA 4ZYLA 1AHHA 4K8RB 7MHTA 2FOLA 1DT5A 2XQJA 2XUAA 3BIXA 4L5AA 3WFJA 1JLRA 1FXWA 2QN2A 4KFUA 1G5QA 2FEPA 2C0QA 1IJEA 3I3OA 2FPGA 3D1JA 3R7DA 3IDSA 2XBMA 1K27A 2XUDA 4JYPA 3EASA 3ILHA 3MIZA 3THXA 1FE8A 1CPYA 3U44B 1UUFA 3ICCA 4X71A 2DR3A 2YOGA 4U4AA 1PJ2A 1A98A 2XCSB 4K28A 3IQDB 1Y9AA 2I4TA 4ZREA 1CR4A 1RWOA 3C70A 3F8WA 3F3YA 3NBFA 4OV6B 5A3VA 1RMYA 5E6SB 2AXPA 4B83A 4O63O 3JAKB 2YIMA 1NQTA 3OF5A 3UUEA 5TLSA 5JCOA 3C5CA 3KYBA 3VOBA 3OUTA 4ARIA 3G5MA 5ALPA 3OQIB 2IPXA 4R1TA 2GF9A 4L6AA 5D6OA 3LOUA 5EWMB 4F11A 5A2GA 5IZCA 1AGYA 3BBPA 4BMZA 5HUQA 2GN6A 3OZEA 5EIXA 1MO5A 2JGDA 4Q4AA 2Q6IA 1WZCA 1HQDA 4RFSA 3WLRA 1JHRA 4TV8B 4BGIA 1DKRA 1F2DA 1ORRA 4O4HA 3VU9B 5KTSA 3BMCA 4Q37A 3FA2A 2D7CA 3R3SA 4G2TA 3ZPXA 1E7QA 1MO6A 4UNNA 3GFPA 1V3TA 1EWRA 4DAEA 4NFYA 3RVDA 4EKDA 4OLAA 2FPLA 1MO3A 3TIFA 3DB2A 4XGKA 2HZ7A 1ESEA 1QH9A 1QSGA 3VOSA 1KYYA 4QOEA 4Z51A 3DBIA 5BN3B 5JS7A 1NRXA 3R7FA 2NN3C 1P0PA 2JJ8A 3MBIA 3SJUA 5EVCA 1UJ5A 2VK8A 3EVEA 1ORWA 1ZOLA 5E4FA 2W5UA 5DFAA 2FMUA 4RTRA 2DR0A 2A9OA 1SUCA 4ARAA 3ZY3A 1KORA 1ZIOA 1X1BA 3A6FA 3ZNNA 3WYCA 2V5UA 3P0EA 4O3MA 2QPLA 1TEVA 3OPNA 1U9IA 4GX5A 2APJA 4XQGA 5KWJA 2I33A 5TT0A 1VPVA 2OCAA 2P0YA 2K4MA 3IERA 3KRTA 4IO1A 3HCWA 3S40A 4C3OB 2Y05A 2OV4A 4E22A 4QXOA 2CVQA 2VXCA 3RQSA 1OTHA 1NUPA 3UUFA 3OQJA 1M8KA 4WVLA 3WL7A 5TPZA 5COQA 1FQWA 1ZD4A 4UHCA 3RTEA 4X65B 3T3DA 4ND5A 2ZP1A 1N2SA 2HSDA 3O90A 5DM4A 2XVMA 2ADFA 1TUGA 3SGLA 3L8ZA 3RVKA 3V9AA 2HMUA 3HZOA 1K75A 2GPJA 2P9EA 2CCJA 3D1LA 4AROA 3T1TA 3AF2A 4AJLA 3ROFA 1RCFA 1YXMA 4KB5A 1GTSA 1CUXA 2FZ5A 4B87A 4E7OA 3ZDBA 1Q7EA 1QGZA 1W85B 1Z7YA 4YLEA 3I73A 4PR3A 4BDSA 5A4KA 1IVSA 2FEOA 3H7IA 4QTTB 4UOEA 1R9JA 3K9CA 2DKOA 3FFBA 2CXSA 5G41A 1CVIA 3V33A 4PC1A 4A6EA 5BVHB 5D7BA 5BWBA 1PLKA 2P75A 1STOA 2ZYWX 3DOOA 1CUFA 5JCPA 4PLPA 5IN4A 1QLHA 1XNQB 2C7VA 2P4HX 4CG2A 4LMAA 3O5AA 2R25B 4JD5A 2OENG 1OBCA 4X94A 3OEED 4Q9KA 3C6BA 4I5EA 4G5OA 2ODEA 1H2WA 4D0NA 3CW9A 1M2HA 2R7KA 1NDHA 3DGEC 4G8JA 4HVAA 1ULAA 5G2OA 4UEJA 2I2DA 2P27A 2YWJA 3BGIA 3BC1A 2XSZD 4XDGA 2LCFA 2NVUA 3G2MA 4PU0A 2VAVA 4AJJA 1EX6A 1L7OA 5BSGA 4MQLA 1YA4A 4A0FA 3IO5A 1SUDA 3FKSD 3PLRA 5DXFA 5EPOA 2QTCA 2GKSA 4K6GA 3L1KA 1CERA 1M8PA 3NVKI 3RRBA 4ZI2A 1YZGA 4Y6OA 2O48X 3PHIA 2XQKA 2EX4A 4NEGA 1MFZA 2QZZA 3A3YA 1T5SA 4O5OA 1W5AA 4UEOA 3TW8B 4C4RA 5JC8A 2GAJA 2E18A 2AT1A 1XU4A 1X8KA 4JH0A 4UVIA 4UM9B 2RH4A 4BBJA 5FX2A 4KR2A 4UUQA 4TUYA 1DKMA 5FI3A 5E1BA 3QPVA 1ATIA 2BGMA 2QDXA 3AY6A 3LWNA 3RS4A 5EJ5A 1IJFA 4L78A 5KBYA 1VRCA 3ZXUB 4ROSA 1OGJA 5IAEA 3IURA 4MH0R 5BN4B 3PFBA 4GAEA 2YBEA 2X8JA 3ZQKA 2KMLA 1PR4A 1I5RA 1ZZGA 2DECA 2GYYA 3TTUA 1OMOA 5FL3A 2YWDA 1VYVA 4LISA 4LXXA 2DGDA 1W76A 3FUVA 4GF5A 2C3PA 3NC0C 4RHEA 5CYGA 4GQAA 4XKJA 1EGAA 2HSGA 5FOXA 5C4MA 4WZBE 1D3AA 5JWOA 1A4XA 1G8JA 1ZM9A 3GGGA 3GLHE 4WKNA 5AKKA 5HCUA 3HG7A 1ILWA 5TQVA 4F7DA 1YA6A 4AQYB 2F43A 2QMHA 1WDTA 1HO3A 4NZPA 3GARA 1B42A 4WL0A 4L6IA 3PXAA 4CQMB 3WGNA 1NBMD 3MGCA 3DE7X 4O1IA 4G89A 1K7EB 1YRHA 4CUZA 5C1DA 2JI7A 1NMZA 1OI7A 2BI7A 2WJPA 2D54A 5L95A 4PN3A 4H6WA 2B61A 3MXOA 1Z73A 4MWOA 1X86B 1B1AA 3AU9A 4A9AA 2JIBA 1CBUA 1LK5A 4P0PB 3Q40A 3HSSA 1FDVA 4P53A 5BNWA 1AZTA 2FKAA 1UQRA 4W1SA 2ARKA 1T36A 2VZ0A 2YY5A 1SCJA 3LHKA 3SIRA 5K1ZA 4K7JA 4ZZIA 1S2GA 3OOEA 4KE6A 3R41A 3QPBA 4W6ZA 1FBNA 3C3WA 1KU0A 2II6A 3JY6A 4PAWA 1HE4A 1HYBA 2FG5A 3KSMA 4XUEA 1BQ4A 4P08A 4AK9A 5KOYA 1SU8A 2XD9A 1Z5WA 3RC3A 5DHTA 1EZ4A 1UM8A 3ZV5A 1E62A 3QFTA 4DA6A 5KTTA 3W7BA 2Q5CA 3CSSA 4MVJA 4NZYA 5ALSA 1WXWA 1MBZA 4ZALA 3CPHA 2H5EA 2QJTA 1TMOA 5EIAA 5TMDA 4K6OA 3KXIA 2JLQA 2CHFA 5CPBA 3C3YA 1W7AA 3KV3O 3KT3A 5ABPA 4ZZ1A 1EP9A 1VKHA 2Q1YA 4OVKA 3ER6A 1OTXA 1U1CA 3AUKA 5GP1A 2FH5B 2H2HA 3WADA 4BP3A 4LFBB 1VLZA 2ORIA 4IQGA 2R6GA 1A1SA 3HJBA 1DX6A 3H11B 3QU9A 4ND4A 4QOFA 4RLSA 1B7GO 1KF0A 2P9JA 3FTFA 2BFBB 1QZZA 1CZUA 3WYNA 1T9DA 3NAQA 4OHKA 2EX0A 4RFLA 4PLVA 1NN0A 3VYTB 1ISSA 1U1IA 1BRMA 1ZJ5A 1QPGA 1GPLA 1XCBA 3FMFA 3H13A 3IE2A 3QWIA 4WMLA 5FOUA 2JFWA 2FUG1 2NXCA 4P1ZA 2GN0A 3UPDA 3L79A 2EJVA 2R8XA 3TL3A 1YRBA 3A1FA 3F5FA 1C81A 4XPZA 1PGPA 3F2IA 3HBLA 2HRRA 2AUMA 3N2LA 4DMUB 4HL6A 1DZIA 3B3JA 3IUJA 2HK6A 3QHQA 4P54A 4TXJA 1ZOIA 3KAPA 2VJYA 3LDFA 1Y1RA 2OWDA 3R24A 1R8SA 5CVTA 5KOIA 5JCJA 3CX4A 2PX0A 1IPHA 3HEAA 4WINA 1Y6GA 5IJ9B 4K6CA 3SZGA 3G82C 2A6PA 3ZG6A 1UWLA 2HB6A 1RXWA 2PBLA 1UJBA 1YB1A 1NQOA 3QU7A 3NWBA 4ER0A 4TXNA 1N2JA 3VR6D 3TPCA 3BBLA 3PQ6A 4KFTA 4RVHA 5EUQB 4BFVA 1CQPA 2IY7A 2SKDA 4TQAA 2JD2A 1T2AA 3QXCA 2JBWA 4L73A 2G83A 4K03A 4Y8VA 1I33A 3FOWA 1W46A 1C1DA 1QH1B 3UC9A 4C2TA 2W0SA 3JARA 1LD3A 1PQYA 2C92A 4IGEA 3OE5A 3R7LA 2FEMA 2ZDGA 2V96A 4NYJR 4BRZA 4MNTA 1MOSA 2CJWB 3P7MA 2O20A 2CT8A 1L8AA 4B3FX 3JASB 1NHGA 2YR0A 3EIEA 2O2XA 4A91A 2CYBA 9ATCA 4L15A 1WZNA 3A6ZA 1B6RA 1SN7A 3BGVA 1T34A 4IGIA 2EG9A 4N12A 3PRYA 2YNMC 3ESYA 2P91A 3U6KA 2I4IA 1UBNA 2AUTA 1R6BX 2AQIA 4OAQA 2VK4A 3AZOA 1SKQA 3LUFA 4P3OA 3A31A 3R40A 3IP6A 5DYGA 2JAPA 1S02A 1V7CA 5JY6A 1INLA 1F60A 5KNLA 4O33A 5JS6A 3X2FA 1WVGA 3NKFA 3KSRA 4KYUA 3LUGA 2Z1MA 5C46F 4LNAA 5AUPB 2IITA 2E1RA 2BFDA 4XB2A 1SCDA 4GC5A 5CT9A 4C4ZA 4OY3A 2ZTSA 4U2FA 3O8CA 3G17A 1G5HA 4EDFA 3K8QA 2CVZA 3I1IA 4RK4A 1UOEA 3EGWA 4I7EA 1WQ1R 1FUUA 1G3IA 2ODNA 3QRWA 1UDXA 4Q03A 4WTOA 1E1YA 3O0DA 3F97A 1Y9JA 4LZAA 1H6BA 3W0LB 1JXQA 4I2NA 4CEIB 1PSWA 4MKFA 4L9SA 3EXIA 2OCPA 3PUXA 1XLVA 2OGTA 1TX4B 2ZI4A 1KOJA 4PCAA 4DSNA 2QX8A 4UATA 4C4AA 1KO4A 2IEDA 2PU5A 5EGNA 1L1FA 3T9AA 5AW6A 1AKYA 4C22A 1NBEA 2PS3A 3CGWA 4IRUB 3EVFA 4ZPXA 4K9SA 3PJEA 5CA1B 3AEKB 4Q7KA 3OTGA 3GZTB 4R1QA 1FTWA 1TA4A 3L7DA 4ZT6A 3OX4A 5M3BA 3CLTD 5KX5A 1N0WA 1YMQA 1JPUA 1QGYA 2DWUA 3AHCA 3FVRA 3RUPA 1ZD1A 2ZCVA 4D9HA 4EUKA 2BFEB 3PR3A 1JMYA 4RD1A 3RADC 3DVQX 2REQA 2W2MA 5CM2Z 1J1UA 3MUFA 1K4MA 1QM5A 1YR1A 2YMLA 2IUSA 3BWMA 4B44A 4XZ3A 4Y9SA 1ZHOA 1ZSVA 3BEDA 4KGXA 1VBKA 5IKOA 4LQCA 3TRHA 3C97A 4JCOA 5EXEA 4CIVA 1ZM7A 5JROA 5F5NA 3EUAA 2Z3ZA 4G8DA 3W2IA 1J2YA 3ZNQA 2QTTA 3AHGA 4RJKA 1IY9A 1CUVA 5KOJA 4DHEA 3PEUA 2AFHB 1JEAA 2ZWMA 2KBEA 3OLCX 3UV3A 2D59A 3H0EA 1KFBB 4YR7A 1QGDA 3PFHA 3RYHA 1QG4A 5TS2A 1V5IA 1JVSA 4X61A 3K7EA 4OYHA 4ASUD 4E0BA 1VL8A 2CLFB 1W5TA 1ISPA 1KYWA 2XRZA 4FYYA 1KR5A 3I4CA 4R51A 1VP3A 2GCOB 4MPJA 1THGA 2GZ3A 4NJMA 3K2BA 2ZJBA 1RHKA 3C5WP 3LVBA 1EIWA 4TLAA 2DUJA 2GLTA 2YUIA 3DBRA 5B7NA 1EQAA 4L8WB 1XFAA 4Y1RB 4F2WA 2A86A 3QLJA 3IMEA 4YJ3F 5FWYA 2ZIUB 1KI9A 1NXQA 3JD3A 4XYGA 1F2VA 1UIRA 2O2CA 1O6BA 3QVJA 1LKZA 2GK7A 5DO9A 2PRJA 3GJ0A 3VPFA 3KM0A 3BHJA 4D5GA 1GU7A 2IXEA 4GZ3A 5DGCA 3T0GA 4XX0A 721PA 3RT9A 2JFQA 5IBQA 1XVUA 1RLJA 1P19A 5B36A 5FNZA 5ALQA 4D5EA 3MWGA 2FMIA 4C0JA 2DT5A 2FR8A 2DY1A 3IMFA 5EFOA 3T61A 3D8RA 3V1YA 4G0QA 5JDCA 2ZWAA 5KTRA 3QF7A 4ZVMA 3UMYA 5AHOA 3L6BA 3C7TA 3BIWA 5DN9A 2G06A 2XDAA 3AHHA 5IK2D 1WP9A 5J63A 2WY2D 4YP9A 4QO7A 3U4DA 4MV6A 3VUFA 3VR3D 3I9FA 3EQ2A 4JI7B 2Y93A 1FDOA 4M0DA 5AXDA 4RLQA 4DUGA 2B7LA 3NB0A 2BFMA 1KARA 1SOUA 3Q4GA 4G0XA 3C24A 4A6PA 4BCDA 1M2OB 1U8XX 1GP2A 5JE8A 4DQ0A 3LY7A 1N6PA 3SVZA 4F7WA 4TT8A 3U09A 3IEVA 3GBVA 3BK2A 4EJFA 1E18A 1IQRA 2FFAA 4PFJA 5KQSA 2Y67A 3NOQA 3HP1A 3TKLA 1X2BA 2ZRCA 3STXA 4X3CA 4YP5A 2VP0A 3V8NA 1J09A 2I65A 3FNRA 4UUPA 1W52X 1I2CA 2RI1A 1OT3A 2SKCA 4DMLA 1DO8A 4YY3B 1B43A 1CRPA 2FCAA 4NARA 1J00A 1H6DA 4Q4HA 5JVDB 3MHTA 1RJ9B 3GOHA 3BH6A 3LQ1A 4YN3A 1O1YA 3WWYA 2I9PA 3G0GA 5JASA 1XVLA 1N5DA 3CR7A 3FZQA 1KNQA 1FLDA 3Q5EA 4AKGA 3SBDA 3K35A 5J5VA 3BPSA 4OGWA 1KK2A 5KJ6A 121PA 4JBGA 2ZKLA 4YRPA 1EESA 1DTEA 3BMOA 3LWZA 3QGMA 4JSYA 5IS2A 4RJTA 2A78A 1A9YA 1QVAA 2GASA 1XZMA 2QNRA 2ZRNA 1W36C 1SQ5A 5KSOA 3C8HA 3D8UA 4LVOA 4IXDA 1T1GA 2V6MA 3PUKA 5FL7A 3UAZA 1AUQA 2X2EA 3HVIA 1KI8A 1F6DA 3K2IA 3VAYA 5JNUA 1DBIA 1M1NB 4O4LB 4NQZA 4EG1A 4KMRA 4XUGB 3I12A 3MELA 2WE7A 4AMBA 4JVLA 4AD8A 1MABA 3GFSA 2VLIA 4MHSA 2NQ2C 1XNHA 2HDNB 2OORA 3IQGX 4PQEA 4YMUA 3N07A 3WDMA 3AWDA 5TQ0A 2W6ID 1UDWA 2FFRA 3AM4A 4XUDA 3TH5A 2A57A 3LBNA 5AK0A 4BQRA 4EW6A 1ADBA 1CD5A 5ALGA 1TYCA 3HCAA 3HMQA 3L7KA 2IV3A 3ULKA 3ZDQA 4M1EA 4CF5A 4L4SA 5BSUA 3E5RA 4IDQA 1MCZA 2B82A 1XKTA 2X4LA 4P82A 2WYVA 5ICMA 2OV2A 4BTVA 3GP5A 2C9ZA 4V0MA 4FJ0A 3V7FA 4NZMA 4GDFA 4KDFA 3WOVA 3JYHA 2C4HA 2OYCA 2V3CC 1J0CA 1JI0A 1SQSA 4RD2A 4D9FA 2BE7A 3BAZA 3FB1A 4XB1A 2PQ2A 3NEPX 2WM8A 1J20A 2FSSA 4C7JA 4BO4A 3A9RA 5JAUA 3MT9A 4F1KA 2PSSA 1FNDA 2IYOA 1GU0A 2GRJA 2XBUA 4YBZA 2ODBA 4ZYUA 3AEZA 3PJRA 4BLUA 1GRNA 3KQWA 2Z2JA 5AM2A 2P9BA 3ND7A 2C58A 3A4IA 5FO0A 4BLQA 5JJKA 4YAFA 4HMQA 2I62A 3W8DA 3U44A 4TKZA 3E7XA 1YJCA 1T3ZA 1PGJA 1RYZA 2C5BA 1UBSB 2ODTX 4M54A 3F4KA 3OUUA 3PENA 4G26A 4GPZA 4BASA 3FMOB 1QIHA 3CF2A 5D86A 4R69A 1X7YB 4QRHA 2ZSKA 2AA3A 1GPBA 3T99A 3FBWA 3CZQA 3EBOA 4MQEA 3BWDD 1HEYA 3L4EA 5EWMA 2IHUA 3OQIA 3AIMA 3ES9A 3DE3X 4Y1GA 1IN1A 5IDVA 2HWYA 2VYND 2EQAA 4WY5A 4Y7CA 3MG9A 4MEAA 3ZIUA 4A10A 2JKYA 4A5OA 4TV8A 1G8FA 1DO2A 1TYEB 4URUR 4HJXA 3VU9A 1WWKA 2XMPA 1YB5A 4ML3A 2WPNA 3QY9A 4LXHA 1AQYA 3PQCA 1RZUA 4U2BA 2V74B 2NM0A 1FRZA 3NT2A 1C9EA 4LBZA 4EGAA 1TECE 1CF4A 4WERA 3BHNA 3TLBA 4KODA 1OAOA 1XZCA 3BREA 4JZKA 2ZGVA 4KDRA 4DLKA 3BXPA 4Q4CA 2YV2A 2GZ1A 3IEPA 4JI0B 4HRYA 4MWCA 4YA6A 4U5XA 3TQHA 2P9GA 5EL0A 3LYAA 3VA7A 4YRRA 5KHLB 3LP6A 5LP6C 3CCFA 1J1ZA 2IS6A 4QTZA 1AU9A 1MN6A 3COYA 4OXNA 3F6CA 3UAGA 3TDNA 2J9YB 5CM9C 2YHUA 1L3CA 5K4AA 3Q2KA 3W9BA 1KETA 4AY3A 5K0CA 4ZJPA 1G2OA 4DWJA 3OKCA 2QUAA 1EFUA 1XZBA 1AZWA 4Y67A 2ZT6A 5FWAA 2D0PB 2QB5A 4LJLA 1PDWA 4M3NA 3UICA 5C7YA 3T1OA 1SVKA 3E9YA 4KLCA 1Q14A 4C05A 1C4KA 1AJEA 1QHFA 4B6RA 4FC6A 4GOOD 1JR3E 3T9BA 3VYUB 2AV6A 2G5PA 2UZIR 3P0RA 5KJFA 1Z33A 2ZJ3A 3L7OA 1ILEA 3M1AA 4YMSA 2XCOA 5DM1A 4PFQA 4YMLA 1ZMOA 3ZXXA 3GOQA 4JQYA 4U9IS 4D1YA 4EJ2A 2D2IA 1PJAA 1RU3A 2P11A 4TL6A 1G4AE 1KR2A 3CJQA 5IZCC 1KMHB 2DEUA 1LF5A 3TZ6A 1YC2A 2GEFA 5CBPB 1YASA 4L16A 1TPZA 5EPEA 1ECGA 1M6YA 1W85A 3K96A 4PQGA 1XZDA 1ZMXA 3QWBA 3JYPA 4MMXB 4U6QA 5IHPA 2P77A 2X4DA 1Y9ZA 4QT4A 4U0KA 1CFZA 1DRVA 5BVHA 3EOBI 1DHRA 5I3CA 4OJNA 5KREA 1ZGBA 4H4CA 1AGRA 4WKPA 1CYEA 4RESA 1N5KA 3B9PA 4P35A 3H2SA 4BX8A 4EKGA 1WZ2A 5DBEX 2IKQA 2N1BA 1JAYA 3ZEIA 2OD2A 3AIKA 1EDDA 4RKEA 4QUHA 2VNAA 4LJSA 1CIVA 1VCNA 5I9SA 2AH5A 1P9NA 2DHEA 3NWJA 4Z4CA 1EK6A 4NXMB 2P6PA 5LMZA 2OGWA 2F1RA 2WWHA 1W9MA 2ZBDA 2X76A 2PGIA 3K0EA 3NTVA 1K8XB 4BO1A 1QGAA 2YHBA 1J90A 4DRYA 2V0CA 4MAAA 2PGDA 4TROA 3RHFA 2DUMA 1U2RA 3GRZA 2GD0A 3MILA 2VWQA 4PVDA 2C7GA 4WOJA 3AUYA 3IOBA 4YAOA 3KUUA 2FPIB 1EGVB 4B17A 5ICGA 3C3KA 2AI1A 3QWHA 1TW3A 2PWBA 4KXWA 1Y80A 5U1PA 4GPIB 2RG7A 2I1QA 3GFRA 3OIUA 1NDQA 1DJNA 1BC5A 3KEGA 3TW8A 2O8EB 3KVVA 1N0UA 2X1LA 2L2QA 1PIWA 1MIOB 1U28A 4DY6A 1ZGJA 1TKRA 1CNFA 5HSGA 4QULA 2PJDA 4RACA 4R84A 1NMQA 3R3YA 3SE7A 2BLNA 2NIPA 4M1MA 1JF8A 2V4ZA 1VJ5A 1TM7E 4C76A 1A7UA 3EMBA 5AIAA 3VV3A 4R16A 3FDZB 4R2WA 2OCLA 1MC1A 2PDAA 3FNFA 3D0OA 2ATXA 1E9VA 3HZZA 4IJQA 3OQMA 3LUCA 5FWNA 1ZK3A 1JBQA 1RI3A 3OT1B 1FLAA 2ECFA 3F5DA 4HVTA 3ADBA 4FHDA 4L57A 4JP5A 1N2CE 2CYAA 5CDYA 3HA2A 4OL0A 3QVMA 2DWPA 2BDTA 1E3MA 1JG2A 5BV7A 1CY4A 4AX4A 3CZCA 4KR3A 1NXOA 2G36A 4EO4A 5BORA 4ZV9A 1FYEA 1O7JA 2LD4A 3C87A 4RVFA 1X0XA 3T15A 3I58A 5L7WA 3MSXA 2ZIAA 1Z4JA 2CLCX 3ZHCA 5HQ3B 1GKIA 2WD7B 2HCFA 1JR6A 3ETJA 1IZ7A 1X7HA 1HTBA 3DMTC 4MUFA 1P4RA 3U7EB 4Z8XA 4ZJUA 3O4JA 4C5CA 3AFNA 3R6TA 4PGAA 3RUEA 4WDRA 2IU0A 4H7IA 4Q7MB 3I62A 1VSUA 5AYVA 1M75A 4RNDB 3TRKA 4DLTA 5ARCA 4FQ5A 1TCAA 2H1LA 4EHKA 4B3XA 1B26A 3DV9A 1JE1A 2ON6A 1WW3A 2I76A 1P0FA 4M0EA 3SEZA 4BB9A 3WZMA 7REQA 4EB0A 1QV9A 5E9QA 5EJFA 4XQCA 2HFJA 3TTYA 4M1WA 3VR4H 2D74A 1S6YA 3WRYC 8ADHA 4R9SA 3A9WA 1E2QA 3GEGA 1T4GA 3H2HA 3GRCA 2IHYA 3I6BA 2YL2A 4FSXA 1ZVJA 4BLVA 2ERXA 1ZK1A 4CGYA 3EPRA 5AVTA 4JT9A 1I6KA 4IDFA 1K3FA 3LKBA 1UWKA 2JRCA 1EWVA 4NU6A 2D1QA 1JLKA 3QFFA 3FUWA 1Y63A 3VKUA 4P8RA 1GRCA 1WW2A 1ZWKA 1DDGA 1BWRA 2ZTUA 3OTQA 5B5SA 1EHIA 3O31A 3HZRA 4B74A 1E6MA 1UBFA 4WADA 2IS4A 4LZWA 2DUUA 3LPAA 5JXWA 3H11A 4S0ZA 4KQIA 5IKEA 1CUYA 2JCGA 1OI2A 1FX0B 1LBTA 1DTSA 2PA3A 3UCFA 4ALNA 5HUHA 1M8FA 2YQZA 1FYWA 3B1VA 3DPIA 4QLOA 4LFCB 2G6BA 2WFMA 2BUBA 3OLZA 2YYYA 3PDJA 4KH0A 1V9SA 1GCOA 4ZYVA 2VXBA 5JHHB 2C9YA 2YHSA 5FQNA 1K4KA 2HJGA 1ZCJA 3NGMA 4D3SA 4OLHA 3A6PC 4G0PA 2W7TA 4HEJA 4KPUB 4GT1A 1OJ7A 2FEXA 3OCWA 3QI2A 2IVFA 5AM4A 1HMYA 2H3HA 1JHZA 3ORRA 4J03A 1CDEA 3GP8A 1G42A 4WOBA 5KVQA 3QG5A 1RWQA 2P4QA 3I2HA 2OZLA 5DV9A 1WSWA 2X5NA 3CO0S 2RGRA 5EZQA 2ZBGA 3QKIA 2G4LA 2R79A 1PJSA 1BHJA 5HJ7A 2P3OA 4I55F 4X95A 4P4SB 2H00A 3M6AA 4MRRA 1X1TA 1Z4OA 4HZUB 5IJ9A 5SYAA 4CT0A 1ISJA 1QX3A 2HGZA 4TMKA 2YTZA 4XD7A 3K9FC 5JJ5A 3FPHA 2W2LD 4X85A 1RXVA 1HQCA 4AT1A 4HN2A 3CB2A 4QNRA 3WP0A 2JLUA 4JB3A 1GLVA 2R1ZA 3I3SR 5HZGA 2DHRA 3VKHA 1P3Y1 4HZGA 1FS5A 4LX8A 3Q5DA 4R1PA 2EGUA 3GXOA 3GJ6A 1DLIA 1OROA 2IYAA 1BIFA 1UMBB 1XU9A 2QD1A 2VYFA 1SC1A 1KAQA 1QH1A 4FN5A 3RSCA 5IXJA 1ACJA 3ODGA 1QR6A 2KHZA 4UCXA 2VDPB 4FMDB 3SBEA 1T6NA 3L7BA 2ZSEA 4FT2A 4WOPA 5IABA 3ZCXA 1Z6TA 2WF8A 3H4TA 2CJWA 1ZHFA 4W5WA 1YUMA 1WW8A 5HFNA 3HB7A 3JASA 3QVUA 4B0OA 1YAHA 2VUHB 2R6R1 3ABOB 4E31A 4EIWA 3AINA 4X64B 1D0VA 1DBWA 2V98A 4C89A 5DN6A 1QU3A 4Z2YA 4BWVA 3ONFA 1UOPA 3CE9A 3FH0A 3WGOA 1VHLA 4II2A 4OQXA 3CX3A 3AR3A 1JVNA 2B25A 4TLBA 1CE8A 1FSPA 3LY9A 1QFZA 2WYIA 4FCVA 5BXQC 4FR0A 2PJUA 3JAMA 2YQ4A 1XHFA 2PFGA 3EEIA 3RUIA 2MMGA 4NE2A 1QHGA 2Z1DA 4TTAA 2H0RA 3VR1A 4TWJA 3RARA 1EH5A 2NPOA 1NW5A 2FMHA 1ZUHA 4LRWA 1Q16A 2XGOA 3JQEA 3BH0A 2LKDA 3Q3GE 3SNKA 2ZPAA 2ONJA 2X1MA 4KZPA 4PGGA 1ADFA 4MGEA 1X3SA 5AKYA 4LG1A 5DP2A 2O6HA 1RWBA 5ERYA 1XYYA 4JKOA 1E3TA 4CEIA 4R8VA 5G40A 1JIIA 2BKLA 2DPGA 5JH7B 4ARCA 1WSBA 2A3NA 4RD6A 2IDKA 2C88A 2NZXA 4DTCA 2PGOA 2F17A 3KQKA 4PYIA 5D85A 4KNWA 3JZAA 3RI3A 3TCKA 2EU8A 3KP1A 3OJCA 4PTYA 3HFJA 1I94B 1YWGO 1P29A 2PX4A 1QH0A 2VJCA 3DMFA 3H1PA 3HDTA 3ITNA 4JOCA 3KR9A 3UB4A 4JX8A 2EBWA 3C39A 4A27A 3BILA 1DKLA 3AEKA 1CX9B 2E49A 3BRSA 3EH1A 2BGJA 3HJAA 4M4SA 2QK4A 4NDAA 3P9SA 4CM9A 1HR0B 5ENVA 4L7QA 2WMYA 1OWMA 2BFEA 2CWWA 1VXOA 2VA9A 4PQRA 1M1YB 4FMCF 5AM1A 1CB0A 1UQUA 1ZVMA 3RBVA 4EHJA 4F2GA 2XX3A 3JS5A 4LQ4A 5LZ5A 5A6SA 1PJ4A 2QM8A 2P6RA 1C7FA 5BURA 2HJSA 4MQBA 2AZMA 3JQ7B 3O4HA 5DSTA 2ZAOA 3EW7A 2I55A 2YH2A 1I2MA 3FCXA 4G0UA 1E7YA 3JQCA 1K4YA 5EWJB 3V8PA 2AFHA 1S8AA 1S01A 4P3KA 2ZPUA 5AW2A 3ESDA 1TO2E 5K0TA 3EC1A 4LDQA 3ZY5A 2OHHA 3M5CA 5GGXA 1ICEA 2ES4A 4NABA 4FHCA 3QFSA 4BKRA 2UZ1B 4R98A 1RPAA 2CE2X 5CVEA 3PF8A 1I51A 1IN4A 4EW1A 1S96A 1M8JA 2GCOA 1DIAA 1N3BA 3I9NA 4QPNA 4X6YA 2FF5A 3DTVB 3KOZA 3K6KA 5BQ5A 4PAOA 5EZYF 2EJTA 4I4TF 1SH7A 3SJAA 4D43A 1ENOA 4YP6A 5BSFA 1X1CA 1F48A 1EK5A 3QKSB 1EPUA 1X14A 2HX1A 4D3FA 3HDYA 3UV6A 3RYTC 1VLMA 4G4IA 3PRHA 1DZ3A 3PS9A 1GEGA 1SEVA 2JAQA 1O4VA 3NEJA 3Q3CA 4CMKA 3MCWA 3K70C 3RPEA 5HHTA 3TFOA 2VOEA 4HGYA 3RSSA 3EH2A 2ZM5A 1G59A 2HIGA 4IFTA 2M9MA 4FWTA 1FRNA 2PLAA 4HRAA 3O8QB 4LZZA 1X38A 2H92A 2X3YA 2OQVA 4CN8A 4A0RA 3AY7A 5IT0A 5ELMA 4TYPA 5B7PA 1RYEA 1UZNA 2Z43A 1A82A 5HTOA 1G2QA 2HIHA 3SJZA 3PQ8A 4TMVA 5HS6A 1M2OA 3AVWA 3SS9X 4G0ZA 2IZ1A 2FYTA 4KO3S 4QLAA 3RC9A 4CHGA 4JVMA 2BLLA 4M38A 1JDPA 3K4PA 5EHIA 3GROA 1HG0A 2QLLA 4MCJA 4TYNA 1L1QA 1WCWA 1ZD3A 2GYVA 2QUBA 1AOXA 2UXCB 5SY9A 3QY0A 1N1EA 4ECAA 3CUKA 2OLJA 4XGQA 4DDMA 2OM6A 1THMA 2H07A 2AG6A 2GYWA 3KU1A 3KLNA 3M4ZA 2GCIA 3EF3A 4NR0A 5JVDA 5L4SA 1TMYA 3GRUA 1UBHS 4D41A 4IQ4A 1N6OA 4C2BA 2PSDA 2DQYA 3UT0A 3L6RA 4Z4FA 4RLHA 5JY1A 2COKA 3LD9A 4K9QA 4AUEA 5BYKA 3FE2A 2OXEA 4M1ZA 4CDMA 1JLSA 4Q4JA 4B7ZA 4JCCA 2JJYA 3ABIA 4JLWA 1BXRB 2G71A 4OXIA 4R40A 1OF1A 2C0PA 1GUBA 3RC8A 1WMDA 1B6SA 5AHKA 1PS0A 2BHNA 4J0FA 5DASA 5HCIA 4F84A 1EVKA 3FX2A 1TJ5A 4O4LA 4K9LA 5B1DA 1R4AA 4TWIA 1L5QA 2AOXA 3ZHBA 4R2IA 5JDCC 3I04M 1NNSA 4HUJA 4B6FA 1SBQA 1RZVA 3WJ7A 1CZRA 1VE6A 1ZG3A 2AWOA 4BMDA 4ZO6A 4WFQA 5B1HA 3CISA 2GQ0A 1U0BB 5GOTA 5AVKA 4D74A 2RHLA 3IIEA 3L4BC 3UK6A 4NDZA 3K94A 4IX9A 4GZ6A 3PQ7A 1NFFA 4LE2A 5GONB 3OCCA 3E3LA 4YP7A 1S4QA 4DGQA 2WQ6A 3THWA 1YIOA 2HBRA 4OYRA 1VBNA 1AUVA 2Y71A 3B70A 1T6YA 2WKWA 1GPJA 4H2DA 3MAAC 1T9GS 1HGXA 2VPPA 3A3PA 5KTMA 4KX3A 4M7WA 2GH1A 1YVRA 1OY1A 1E7SA 4UVHA 1NR1A 5DRTA 2AZ4A 5A03A 1NASA 2X8AA 4AZ0B 5HIKA 1A76A 1IBLB 4C7OB 3GJ3A 1RQ2A 2NU9A 4C0SA 2ZU6A 3PJFA 1OFUA 3N58A 1CRZA 1E1LA 2E5WA 4YUWA 2V7BA 4P7KA 3AZQA 1J7JA 2BV3A 2NO5A 1E1QA 3B53X 4B76A 2Y1GA 3HO8A 4XFDA 5JWHA 3RIGA 3SKVA 2R1UA 3QI7A 4F9GA 2D13A 1OB2A 1EI9A 2MYPA 2F62A 4GP9A 4GO1A 3PGA1 4GOJA 4OKSA 4BCBA 1XZFA 4DRZA 4R5HA 3ESXA 5EIHA 2YN4A 1NVEA 3DBOB 3II6X 4YPFA 4X8OA 4QDTA 5EEHA 2TYSB 4LKRA 3T9EA 4CLOB 1X7YA 3JVUA 4JX9A 4UU8A 3SN6A 5JZ9A 1YKFA 3UMVA 4Z4IA 1QX4A 2BTOA 3KAJA 1UINA 2OB2A 1MT0A 3D3JA 3JR3A 3L7MA 2N47A 2OVBA 3LT2A 3AF3A 4LA4A 4MVJE 2WP0A 1C7JA 2BMJA 4N4AA 4J0JA 5DSZA 1P75A 1COWD 3DZCA 3L4SO 3K73O 2XGSA 1NYTA 2C2XA 3LL4A 5DTMA 4UMVA 3S1AA 4FFDA 1U6IA 1A8HA 1H2HA 1I80A 2XRFA 1NJGA 5JRJA 3WAJA 2PD4A 5F1PA 4OXRA 4HEHA 5BUZA 1HSOA 4J07A 5A5FA 1GNLA 3HUDA 2V0NA 3SF0A 1L5RA 1ZM2A 2PZEA 1SG9A 1YJ5A 3GFOA 1JEYB 1BYUA 1H5UA 2QTWB 3CQ9A 1RAFA 3HJGA 3LHFA 3M6FA 1R2QA 3LUHA 4CG3A 1O08A 3N8GA 2JFNA 3UJNA 2DWQA 2PT7A 4ND1A 1UM9B 1LDYA 1AKMA 1KK1A 1E2PA 1KBZA 1AZSC 5C8XA 1SCKA 1LFDB 3M82A 4LC9A 1FA9A 2WTBA 4D9GA 3FTEA 3HCEA 5B58C 2XTAA 2D5CA 5LQUA 3FKJA 4WACA 5BOSB 3RYCB 4FILA 1PV4A 1OH5A 3INNA 4HDSA 3RSZA 3V4SA 2XKJE 5EZ6B 3OU2A 4LSWA 2ZRIA 5EQJB 1PEDA 2JCYA 1SFRA 1RXYA 5EJGA 3CMCO 1VI2A 1JDUA 1T91A 4UAUA 2Q8NA 2PANA 3D8TA 2ZRHA 2ZVDA 3NT5A 4EMBA 1CJCA 1GITA 3KWLA 3BD7A 4Q16A 2WUWE 4MCIA 4E6EA 4H7KA 5FNVF 1QH8A 1SHLA 3S2FA 2FQ1A 2WHPB 4HTFB 2X9LA 4DDVA 1KP2A 1PZHA 3T5CA 3DKKA 3DBVO 1JR3D 3Q87B 5LYJB 4ZMSA 1PK8A 2BFNA 5EERA 1KMHA 4LHEA 1T2EA 3IQHX 2ODPA 3UKOA 3V4LA 3DL2A 5FA6A 3QELB 3QOWA 3V4PB 1UDBA 5E0OA 2B98A 3A2LA 2R5NA 1EJ2A 2EP7A 3P4XA 1VCOA 3LBYA 4M0CA 4D4HA 1A4UA 2IX9A 2JGKA 1LK0A 2GEDA 4M2LA 4M49A 3KE9A 1KEKA 4YAJA 4FEEA 1OAOC 5IJ0B 4YV0A 2DE0X 2QXUA 2FG6C 1LSSA 4FFWA 4IOMA 4RF3A 4EI9A 1U7DA 3I0ZA 4YYEA 5TF0A 2VPTA 3K8ZA 4X54A 3EGDB 5ALMA 4ZI3A 2C77A 3TQOA 1JEQB 1ZU4A 4YPOA 4URVR 4ZQIA 3A3KA 5K09A 2PLWA 3WJ2A 4U7TB 4BGEA 3FSRA 4UVEA 3P9CA 1K7FB 1E3EA 4QT0A 2BD0A 3CF6R 3TEJA 1FFDA 3R3JA 5ALHA 1WVMA 2FPIA 3IJEB 3G8AA 3L77A 2QV7A 4LQDA 3WKDA 1PS8A 3C16C 1C3JA 1YQQA 1FFWA 3TFWA 3O4RA 4EY6A 2Q62A 3N6XA 5EWLB 2C7BA 2XADA 3ABRB 1ECFA 4JDPA 1DO0A 3VSCA 4AN4A 2GT1A 1RKBA 1P2VA 3AF0A 3L07A 3Q7QA 1NIPA 4CR8A 5KYWB 1NI3A 1W5SA 3A1CA 4HDMA 5DHUA 1RM5A 4G1CA 3SOZA 1MIOA 5AJXA 1I32A 1P4SA 3O8RA 2EHDA 1QZTA 2JLZA 1DG3A 2ORYA 3KZCA 1XXLA 4NHEA 3PYXA 6REQB 3FNBA 4HTAA 2QZSA 3AR8A 2B83A 1M2VB 2AKAB 4W1RA 3FDZA 1RAHA 3NHAA 2H1IA 4KN6A 3N8HA 1YCFA 5LA6A 2C1XA 3MJHA 3OF3A 4H59A 5DT2A 3TLGB 2Y6UA 3WGJA 5CDFA 3OT1A 1B8OA 4BNMA 4R81A 4DR7B 3ZQ4A 1EE1A 1PG2A 2BMFA 2UDPA 2Y1KA 4M1QA 1G55A 4AN0A 1Z74A 3DDHA 4BNDA 4D3YA 1E5LA 3IDZA 1XF9A 2ADOA 2G9NA 1N6RA 2D7JA 3M5PA 4IIFA 5ALWA 2BM9A 3R3HA 4TMYA 4UZFA 1SPBS 5JV5A 1OLOA 4Z7QB 1K2WA 5LZ4A 1LA2A 2EKQA 2DOKA 1W87A 4PZLA 1ISHA 1YJBA 2F9LA 1YIAA 1C7EA 2CLIB 2HIMA 4ODIA 5EMNA 1QZXA 3REOA 5HQ3A 4O59O 2Q99A 2VTBB 2B1GA 2AMVA 2OP1A 4HN9A 1QQBA 3MMNA 1KYTA 1GCUA 3OECA 4NE9A 3IPLA 2WMDA 4OXXA 3V8VA 4LXTA 3K0SA 2JGFA 3LNCA 3G2HA 4DLLA 3B9RA 4M9SA 2DPLA 4V1CB 1TW2A 5LWHA 4HGOA 3W5UA 4A6DA 3L0IB 3M8KA 2YZ7A 5LN1A 3RV4A 4E09A 1CHDA 3Q72A 2HLDA 2I8AA 2W2QA 3PRJA 3FUCA 4G4SO 4GG1A 4JVNA 5DEIA 5EKUA 3IBSA 2FWPA 4EWLA 3LCCA 3CZ4A 4K5QA 4CMEA 2GBLC 3P2IA 1NMEA 5TMBA 2GEVA 1U28C 3CRRA 4D9EA 4D8UA 3R3UA 1I7DA 4ZC1A 1KY5A 4Q93A 2DLCX 4PZPA 3ZHOA 3GUYA 3DXZA 2FWMX 4QWMA 4JJAA 1O87A 3PT5A 2X9NA 3ONDA 3I4LA 3RRZA 2WD9A 4FFVA 2YJ4A 4HQNA 3QMVA 4XXHA 3WK5A 1R12A 1VMDA 5E7IA 1C41A 1W36D 4JVSB 5K0NA 4C0AC 2L0XA 3PPIA 3UW3A 4OI1A 1NI4B 1YUNA 3VXKA 3EGVA 3QVWA 4NPCA 3I04A 9LDBA 4KR7A 1ULTA 5LD2B 1EK0A 1NJFA 4GXQA 2H2WA 4O4IF 4WD3A 2OG2A 4OJTA 4YRAA 2ODQA 1UZMA 2OLKA 3OHSX 4K9OA 4QDJA 2BHLA 4BWGA 2OQ2A 1UXOA 3DWIA 4OUDB 1R8XA 5CFNA 3WRXC 1FX0A 2IEYA 3EEOA 2AF4C 1F06A 2JEZA 3G0BA 5JSHA 3RTAA 1E1KA 2OMEA 1TM1E 2K87A 5FFNA 3ILVA 3FJOA 1EUCB 1N9GA 3KKNA 1SB8A 1CIPA 3U62A 2Z6QA 2HHJA 1TA0A 1T8UA 3WI7A 3ZVNA 3JVDA 4EG7A 3OIVA 3TKAA 2P3LA 2ZJ0A 4HNAB 5GOZA 4GU5A 5M29A 4P81A 4DR2B 1E3IA 4B6OA 4HQFA 2FMFA 3OEHD 2F9MA 2R9VA 3SQDA 5J4LA 1Y8RB 4J3NA 5CNIA 4Q4DA 4CV0A 1UAYA 1CS0B 1Y3FE 3ADKA 2Q1TA 3GN1A 4FD2A 4QGBA 1DAHA 3PKZA 5LQDA 4F9FA 1CY0A 1RYHA 1SUBA 1SU7A 1XQYA 1N5JA 2AZDA 3D8HA 3NH9A 1SBCA 2LKCA 4HZUA 4JI2B 1EX9A 2KQUA 3WGIA 1PFVA 4G4GA 4TX1A 4RDXA 3ZBTA 4U9HS 1JHYA 1GZHB 2IYSA 3NC4A 4FOLA 1OIXA 4N7RA 4UHJA 1OX4B 4AKIA 3CF0A 5LBIA 3VR0A 3WLTA 2PAFA 1G3MA 1GV1A 2R7MA 5CVDA 1PV2A 221PA 1E1RA 1FNSA 4L22A 4CR7A 5TGZA 1UMBA 2ACVA 5BR7A 1ADYA 3ID6C 1MEEA 5F2NA 1LBHA 3ETDA 1KRXA 1O4WA 1D4ZA 4MV0A 4YRSA 2YWEA 1FU8A 4MKIA 5DK6A 1PD1A 3IVMA 4E14A 5EJ4A 2BJVA 2QUZA 4CR6A 4YUAA 5DYNA 5ISMA 1APBA 3JCZA 1QBGA 3QTBA 3EY4A 4UQPA 3HLYA 1CJBA 1OH6A 3BXFA 3SEFA 2EAUA 1ECBA 3KNZA 4YV1A 3QLEA 3HKEB 4NJEA 1N2GA 4V0ME 3T7TA 1YRYE 3VPXA 3PDIB 4RJLA 5L7TA 4CEHB 1LK7A 2P78A 1FK8A 3KT0A 5JNLA 5AUOB 4JXZA 2ZWOA 1XGKA 3DAYA 5JLJA 1ZIPA 4Y30A 4MQ5A 1QQAA 1ZLYA 4RX1A 4FBLA 3DHNA 1DAKA 2ZJ7A 3YASA 2CB9A 1IXYA 4OBWA 4EL0A 3DTYA 2NAPA 3E27A 3M4JA 2AN4A 2PYZA 3TEFA 3Q15C 2PT9A 4A03A 5EIBD 3GLUA 3M34A 3I2GA 1MTZA 1RNLA 2IU6A 2NAFA 3PFIA 5EA2A 4UMFA 2A4MA 4M0MA 1CTQA 2VDQB 2ZYHA 1KEVA 2ZYRA 4TUYF 4Y9TA 5C0OE 3WKEA 4AX8A 5FR2A 4EO7A 3UA3A 5FOWA 5JH7A 4CGZA 3OFVA 5CX1B 4BO2A 3INGA 4WEOA 3TFQA 3NMUF 2OK7A 1GQOA 1USGA 2CCKA 2OXFA 3JZFA 4ZEXA 5JIBA 2V7PA 4HFJA 3ZYZA 2CNWA 2CNNA 5AKJA 1ORDA 1KNXA 1BCSB 4L8VA 3HM9A 1KJYA 1MH9A 4MXDA 4Q1FA 1Y3IA 1FSGA 2Q4DA 3DO6A 3OJWA 1AKVA 2IZ0A 3GUCA 4NONA 1TD9A 4IOKA 4Q34A 1PG0A 4Y18A 3SNHA 3UPUA 2PQ6A 3NHYA 1L4HA 2Q6VA 2P6UA 3DVRX 3OLXA 5KVVA 3CUYA 2GBPA 5FBRB 4JJKA 2N1MA 3E8MA 3UVEA 1BD3A 1MVOA 1A5BB 1M1YA 4GYWA 1Z4MA 5CH3A 3V7WA 3EHEA 4OATA 5HDQA 3ZJUA 4HNRA 1SCIA 3NG1A 1YVUA 5EKDA 2A9VA 1XC7A 2J59A 2FLKA 1QK5A 2ZTMA 1CUSA 4TSKA 3R8XA 4JJ6A 1FFEA 4C06A 1U2SA 1YIDA 5CB4F 4EFDA 4MRPA 1DRJA 1Q0HA 4Y2HA 2WQ7A 3V4ZA 1Z08A 1C3VA 1AA6A 4KXVA 5FPPA 2X0EA 1GTRA 2TSYB 2HGSA 5D1HA 5AO9A 4TS4A 1I1QB 1AKTA 1UKYA 2UZ1A 4N6GA 3HXQA 4E5UA 5LB4A 4N47A 4G5YA 4E4YA 4IH9A 1BE1A 5A3SA 1G63A 2WF5A 4ANFA 3K9WA 4I4NA 4P80A 2FAXA 5H5JA 1OPXA 4A2PA 1RHJA 4HX2A 1DRKA 1V1RB 2RH5A 3OLQA 3UT6A 3ZWCA 2EL9A 3QKSA 3V7YA 1KYVA 1QUFA 3IR5A 2YDXA 2QG4A 4X63A 3FCUB 2I3GA 1ZL2A 2QLNA 1G7RA 1PL0A 3WQSB 1EFVB 1V26A 5TPZD 1OSNA 3BYZA 4Q21A 3ONVA 2VJNA 5AVOA 1BDHA 4EG5A 3VZSA 3GD7A 4IKPA 5HJ2A 4ZZ3A 1HLPA 2EGGA 1A1VA 4HFMA 2PRSA 3ITKA 3QW2A 1DMRA 5CK5A 2QP9X 4BZQA 4FKZA 4QQRA 3F5QA 2ZSJA 4P36A 4PEVA 1M5TA 3ZK7A 5KS2A 4XIIA 2JA1A 1PT5A 4YDRA 3X1YA 1RE1A 3EWSA 3GGSA 2MOKA 2PH7A 4F3TA 5E1DA 4RVCA 3KV1A 2ZI9A 1WZIA 2R751 2VBIA 4KQ1A 4LOLA 1HZZA 1U1FA 3A26A 4XDYA 1DT3A 3E5MA 4D56A 1L2TA 4RYLA 4BO3A 4TYQA 3S44A 1XRSB 3DZJA 4CL3A 4DE5A 2W42A 4MVWA 4WK2B 2ZIWB 1WNTA 3W1VA 3K6SA 3PPXA 1C3OA 1JFLA 2HCRA 1IQ0A 1SPXA 2GK3A 2ZRBA 4JVOA 4ETNA 5D3MB 2OAQ1 3EF1A 4P3XA 4CTNA 3KOOA 1QHIA 2XB6A 4UZSA 3U9TA 2DLNA 3UHJA 4YAKA 5A5DA 2DJ5A 3OOWA 4DC0A 2XV1A 5FI5A 3AKEA 3WYBA 2AHRA 2IGBA 5AUNB 3IKMB 5KTOA 1KE2A 1ZONA 3CG0A 2ZUEA 3L3BA 3BH7A 4WGGA 1HEIA 1XE3A 1D5CA 3MK31 5BNIA 5FTNA 3FLMA 3I09A 1VZ2A 1IUOA 1F8FA 2OY0A 4PF1A 5EP1A 1DLJA 3A9UA 4XCQA 1LRLA 2UYGA 3KFLA 4FHGA 4R7GA 4O6VA 5AJTA 4BJ5A 3BRCA 4UW9A 1F6WA 2VUIB 3BS4A 2V58A 2OXRA 2Z83A 3L5KA 1NXTA 3ORFA 4DTIA 1MJGM 1JHUA 1PQWA 2PU7A 4V0NA 1KSJA 3NCTA 2PFKA 3K8YA 4HPXB 1DAMA 1PSDA 4J4HA 1TJNA 3HVJA 2HY7A 2CVPA 3LLUA 3LSYA 3RNLA 1B00A 3UK0A 2M1XA 4PS1A 3BTOA 2CBZA 2GJKA 4J0KA 3OY7A 1MB3A 2H1RA 2GZSA 2P9TA 3ACDA 3AUJB 5H3HA 5IC6A 2ZSIA 3F9CA 1ORHA 2VH2A 3L46A 4QAJA 3ESZA 3RSGA 1NF2A 2EKDA 3V48A 1XEXB 4X93A 4GKVA 4EGQA 1CIJA 3VPGA 3QW4B 4JHXA 3W6ZA 2CVHA 1OBOA 2WFAA 3LCVB 4P4GA 4RNCA 1XTPA 4B48A 1ZJZA 2I8LA 1TVMA 3ZOKA 4DV1B 5EC8A 2JAWA 1L5GB 2X2FA 4Q7QA 1LRJA 1QHHA 5GONA 1AH2A 2K2QB 1F0PA 3ZLTA 4HX5A 3I83A 1IONA 4WECA 5IPFA 1NMSA 4R6WA 1I0ZA 1EA5A 2R65A 3EOAI 1XMPA 1G5IA 4D4GA 1P3DA 4NYIR 1P9OA 1ZGCA 3LFTA 4RK6A 2VPYA 3BGWA 2FHSA 4GYKA 4LW8A 4YUZA 3KCQA 2HH9A 4CIAA 1PUXA 4MRAA 1GGKA 5KNBA 1AQNA 1DQNA 1YS9A 3UHPA 1SOVA 2WILA 3C5HA 3FNIA 4FCCA 4LZOA 5SY6A 5T4BA 1MR3F 2P6OA 1CCWA 4B9AA 2C20A 3KYCB 3WJAA 2NADA 4AZ0A 4K3UA 3NLLA 4C7OA 1VKNA 1TYDE 4R8SA 5ILQA 1GY8A 3SMQA 2I34A 2HMAA 2QIPA 3C2QA 4RANA 1SQ6A 2HMYB 4TLMB 2LVBA 3BN3A 3DO8A 3RODA 4H60A 3UAVA 4BQIA 2HA4A 4F45A 3BSWA 4X00A 2WDPA 1YZQA 4QGHA 4XM1A 4MWTA 1WM1A 1FQOA 2ID9A 4CF4A 2VF8A 3B9BA 3UT5B 2O8FA 3IALA 2GTIA 3GVPA 1GU1A 3LOQA 2JIMA 3IUMA 2I6TA 3WNDA 3MQ2A 3L5OA 4HF7A 2ZUDA 3PV0A 2ZATA 5M7EA 1U80A 2XEDA 3UMSA 3TK1A 4WBXC 1RJWA 1UXHA 2GAIA 4EKIA 1YS7A 5AVZA 2G04A 3H19A 3KKMA 4X6XA 2O5CA 1BS1A 1SWVA 3JQRA 5DOZA 4YBRA 4PVCA 1VXRA 1YB7A 5K3BA 4JI4B 1BGVA 4MVJD 1XTBA 3NWPA 4R8KA 3QBJA 4W6QA 3QU2A 4X1IA 2I7XA 4RE5A 1H42A 4C04A 1CEEA 4FIZA 4OBXA 1B1CA 2P8SA 5BUSA 3MJTA 3K1TA 4C03A 1V3UA 5LMCA 3GRFA 1UIMA 1JEYA 2NNLD 2NTVA 5EMLA 4JP3A 5ALYA 1V0JA 4Z86A 4NCAA 4X1KA 3SFTA 2BEVA 2L17A 2JFVA 3MT0A 4HDNB 4DGSA 1EHYA 2W0MA 2PSEA 4KQEA 1AKQA 4N7MA 4HY3A 2Y1EA 5DM2A 2O0JA 1Z0AA 2B99A 2PT5A 2Y4NA 3FPCA 5DYTA 3VR6H 2IYNA 4B75A 5B1IA 3AYXB 1TO6A 5T57A 1FTGA 2WWTA 5AHXA 2ZPTX 3QV1A 1TKCA 3WGLA 5BOSA 3RYCA 2AW3A 5CLLA 1GRVA 4E3WA 2Z1NA 4ENWA 1ULZA 2HO4A 4QGSA 2IOYA 3K0FB 1EP3B 3W77A 1WB4A 2R47A 3DFMA 1TCCA 3K4HA 1ZL0A 1BVYF 5AW5A 3RFUA 3IB3A 1PYOA 3MERA 1VMKA 1RRGA 1X7DA 4FZ5A 3VGPA 1PEKE 2OHIA 3CZPA 1H2AS 5JCJD 4XA8A 1OC2A 1NP7A 4L07A 2WHPA 3EPPA 1TQ8A 4J6FA 1CQIA 2KBFA 2H7CA 2P69A 5FCDA 3UMRA 4C7BA 1GXSB 2PPVA 4XOIA 2YZMA 3CLHA 4OFZA 2E5FA 1FPQA 4OIFA 5LYJA 3H6KA 4BX2A 5BMVF 2J67A 3PTZA 4QHTA 5C3MA 4Q3CA 1ZN2A 1Y4UA 3GZNB 3QELA