2V5VA

W57e flavodoxin from anabaena
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
169
Chain Sequence
b'AKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTENIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
molecule tags Electron transport
source organism Anabaena sp.
publication title Tuning of the Fmn Binding and Oxido-Reduction Properties by Neighboring Side Chains in Anabaena Flavodoxin.
pubmed doi rcsb
total genus 60
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2v5vA00
3NHSA 4ZVNA 2MTBA 4NULA 2FVXA 5LBTA 1SQSA 3OVMA 3OWHA 2MOKA 3EYWA 3F6SA 4YAWA 1D04A 1X77A 1DXQA 2B3DA 3L9XA 4QOHA 4ZVMA 4ICIA 3RPEA 3UXEA 3W78A 3G5MA 2MT9A 5LMCA 3ESYA 1CZNA 1JA0A 3L9WA 3OJXA 4N82A 1J8QA 4H2DA 4FGJA 1XYVA 4S24A 3TZBA 1OBOA 2BF4A 2RG1A 3K20A 5JROA 1ZX1A 1QBGA 1AMOA 1FX1A 3ZHOA 3HA2A 1AG9A 2GSWA 1XI2A 3NHFA 4GI5A 4CF6A 5B3LA 1CZRA 1CZOA 5LVAA 2W5UA 1CZUA 1FVXA 3QFRA 4LTNA 4GR9A 2FX2A 3N3BC 2HPVA 4N9QA 3N3AC 3ESZA 3FJOA 1TLLA 4J8PA 3TE7A 4H6PA 2V9CA 1YCGA 3OX3A 5BUCA 3SVLA 1DX9A 4PU0A 1T0IA 4YAOA 2R96A 3NHYA 2Q9UA 4Y9UA 3B6JA 5NULA 3GFSA 1B1CA 4HEQA 4XDGA 2V5VA 2OHHA 2Z9DA 2BPOA 2MWMA 3NHPA 4PTYA 2QX8A 3F2VA 1E5DA 1DXOA 2FOXA 2KQUA 1AKVA 1BU5A 1YCHA 3NHRA 1J9EA 3TEMA 5F51A 4BMPB 1J9GA 3QE2A 4OXXA 1C7FA 4QOGA 2FZVA 1SG0A 2Z9CA 1ZWLA 3ES9A 2HNBA 2QX4A 1CZHA 1YCFA 4FGLA 3KAPA 3W77A 2OYSA 5LLDA 1VMEA 1YOBA 5F4BA 1FTGA 1QR2A 2FZ5A 3B6IA 5B3KA 1D03A 1I1OA 2KLBA 1KBOA 2BZSA 4FGKA 2QWXA 4GQIA 1FLVA 4PTZA 4LA4A 2QX6A 2XODA 4YALA 1D4AA 1WSWA 2QMZA 2XOEA 2Z98A 3FVWA 4M0CA 3EDOA 1JA1A 4Y9RA 4HS4A 4C14A 3GFQA 4QOIA 2AMJA 1RLJA 1KBQA 1V4BA 1FLDA 1OFVA 1QHEA 1TIKA 1XT6A 1AZLA 5FA6A 3FNIA 1FLNA 4ZVLA 1T5BA 3JSXA 3P0RA 4NLLA 2M6RA 3OX1A 5LJLA 2WC1A 3LCMA 3NHJA 5ULLA 3K1YA 4QOFA 3N39C 5EMNA 3W7AA 4R81A 5FX2A 3KEGA 2BMVA 4U7GA 1WSBA 3O73A 4F8YA 4ESEA 3HR4A 5LJIA 3FX2A 1RTTA 3FW1A 4C76A 2X2PA 4N65A 1BVYF 1AKTA 3D7NA 3GAMA 3NLLA 1NNI1 2OHJA 1C7EA 1FLAA 3NFRA 3NHLA 2F1OA 2X2OA 2ARKA 3B6MA 3F90A 2D5IA 3GFRA 2FLVA 4FX2A 4U7HA 3U7IA 4DIKA 5FUQA 1RLIA 1F4PA 1RCFA 2FDXA 4D02A 3KAQA 4DY4A 1YDGA 1AKUA 1H66A 2QR2A 3HLYA 3NHKA 4XDHA 5NLLA 1ZWKA 1AKRA 3UXHA 1AHNA 2A5LA 3LT5A 2OHIA 4YAUA 2FAXA 2QX9A 3B6KA 4CETA 2BN4A 2FCRA 1FUEA 3O2NA 3F6RA 2Q62A 4LAFA 4YQEA 5TGZA 1CZLA 4C0XA 3NHWA 1J9ZA 1YRHA 2HNAA 1GG5A 3R6WA 4QOJA 1H69A 3ESXA 4QOEA 3OX2A 6NULA 1AKQA 2N1MA 2R97A 2ZKIA 4QODA 2V5UA 4Y7CA 3OJWA 1XYYA 1YKGA 5EAIA 4U7FA 4ZVKA 3U7RA 4C0WA 4YAFA 3QFCA 3KLBA 4LTDA 5F12A 2QMYA 3S2YA 4DILA 1OBVA 5LBUA 3OWXA 4LTMA 3W79A 5A4KA 1AKWA 4BMOB 1QRDA 5EA2A 2M6SA 3NHUA 1CZKA 2Z9BA
chains in the Genus database with same CATH superfamily
4P4UA 3LXMA 1QFZA 2NUTA 4LOKA 2CLHB 3PQ3A 2CC2A 4EI8A 2XZLA 4GGOA 3VISA 1F1BA 1N3LA 1O5IA 4KVAA 4LCJA 1NBOA 5I8PA 4QOHA 5F3RA 4BO2A 5I7UA 2BFCA 3QEMA 3GMDA 4M46A 4AZVA 3MWDA 1ELOA 5HJ5A 2R79A 1TT5A 2ID4A 4MWSA 1DTWB 2PO7A 3TZBA 1U1IA 3DQPA 4I55B 3R8XA 4CTNA 1P33A 5M7EA 2HDNB 3R0VA 4PPQA 4WOBA 4WOKA 4E7PA 5JCOC 1GSHA 4N7MA 1KI9A 1NN0A 3QFRA 3U7FB 3ROQA 1JDSA 1C1DA 1D7OA 3MGBA 4FT4A 1E8NA 2CHQA 2Z1DA 3PUIA 1A7JA 1U6IA 3KJNA 1CX9B 5IRCD 2FG5A 4JNKA 1AGRA 2R8RA 3PHCA 5BQFA 3M7IA 4OQDA 2FPOA 1QGYA 3QEAZ 1LS1A 3CS3A 3OE5A 5CPBA 2DT8A 2B94A 4XGQA 5BNFA 1WKCA 4P3NA 5CCDA 2CKDA 2O05A 3AERB 1XK7A 1Z39A 4KSBA 1GPAA 4QRHA 1IZ9A 3UANA 4KC0A 4S04A 1ACJA 2OO7A 1LLFA 1M2VB 1H5UA 5DNUA 1UP6A 5KQRA 2PUCA 2O8CB 3R6LA 4RLFA 3ZCQA 3ZQKA 4BWFB 5EJ4A 1S8FA 4RO0A 3OBIA 3U3MA 1JFVA 2Q6TA 4JOSA 1TVEA 1A2BA 4HGRA 1KYVA 4AMBA 4BOYA 1YB2A 2IQ5A 3SFTA 1UFVA 5AKJA 5JZSA 2WUWE 1T2CA 2O2EA 1CQJB 3DNFA 3ER6A 3LKDA 4Y1EA 5AJHA 3VR4D 2XYHA 4B83A 4CF3A 2WPDD 3UBTA 1XTRA 5E3IA 2GVNA 3TRKA 2Q1TA 4JFAA 1WSWA 3HP7A 2JGDB 5L3VA 2AW3A 1P7CA 4AU1A 4BE9A 3CLKA 1WNTA 3ZY6A 4X6LA 3RRYA 3VR4H 1A0OA 4DF3A 3R7NA 4MWZA 4YAUA 2YTZA 3TL3A 4MW1A 3TM4A 4ER6A 3DGFC 3HR7A 4WAUA 1Q17A 4JP3A 1QMPA 4QRIA 1QZ3A 2DZDA 3DOUA 5C8DA 5KOHB 2ZJ8A 4ENPA 4M38A 2Z6AA 1VLJA 1RKVA 3DS8A 2X4DA 2J0UB 4A0QA 2I2DA 4GXQA 5L51A 3BPSA 4L6AA 3DZKA 4OU4A 5SZJA 4LZLA 4C0LA 3THXB 4XWWA 4YRQA 1WX1A 5EMHA 4FFRA 3B3FA 2H16A 3ETGA 4DPMA 3AYXB 2B34A 4URYR 4C89A 1JH9A 3FGPA 2J0EA 4TVOA 4DMGA 5CDHA 2CD7A 4DRYA 3GG9A 4DB4A 3I6YA 4OSPA 1T9GR 5KMGB 2BTQB 1TEHA 4UVGA 5LDDC 5FNVF 1G20E 4C7JA 2OBLA 2R5WA 3GAZA 3QOXA 1PR1A 3LX6A 4L74A 2AI3A 1PKEA 2IFTA 2BR4A 3ZYCA 2MSWA 4F4CA 5BW5A 3NHWA 1YRHA 2O0LA 1GG5A 1X14A 4MGHA 3WTCA 2RK4A 1FIUA 4HX9A 1OWOA 1QX4A 3BWBA 5JAZA 5J47A 4ENWA 4RPHA 1B3BA 1M73E 3S2UA 3H2ZA 1H2AS 3VR2A 2HHJA 3P2JA 2Z4RA 1XRRA 2D8MA 4L3OA 4ASUA 3H84A 3HWRA 5EA2A 1PX0A 5HCNA 3F7NA 2VHWA 4NOLA 1E6EA 4RMJA 3PCRB 2W83A 3G2IA 3L5KA 4BPBA 3AQ4A 1XQ1A 3PT9A 2AOWA 5AW1A 1H2WA 2ETVA 2R9VA 1NXVA 4DJDC 1U7HA 3WV4A 5JXIA 5FADA 3O3CA 2BISA 4N82A 4GPZA 1WDTA 1Z12A 2ZJBA 5A62A 3NYIA 1L1RA 3O9VA 1EXMA 3ANMA 1M2OA 1VHDA 3K31A 3P97A 4I9FA 3GDOA 2OHFA 2Z6UA 3REFA 2QZZA 1NW5A 4KZKA 4Y6OA 5AUNB 1CLUA 3GT3A 2XCRB 4YQYA 5SYMA 2NVUB 4M1ZA 2OGUA 2F1JA 4BNIA 4LDAA 2JAOA 4LV5B 1I2CA 4M0FA 3LF2A 4MITA 3MCUA 3R0IA 4GM1A 2ISQA 4KX5A 1JKFA 2P41A 1ZU5A 4F21A 5B4UA 1TZMA 3NT2A 4V0OA 3PXXA 1D9ZA 2J41A 3V3KA 4E15A 3KE8A 1YMUA 4J4TA 4R3NA 2VDKB 2HPAA 3I45A 4PTYA 1S2NA 4WZZA 2BKVA 5TY0A 4D4LA 5K0ZA 3LCUA 3DT8A 1XRQA 1Y6GA 5KJEA 1ZVKA 2I54A 4R2LA 2F48A 2X0JA 3ZXIA 2FX3A 1CUZA 3CA8A 3ZNNA 5KWJA 4E5VA 1TC1A 3HYSA 1D2NA 3IQXA 1MB0A 2P27A 1J8YF 4KZPA 3AEQA 4OQYA 3I6ZA 1F5SA 2OFPA 3KQTA 3EVDA 1K75A 4DA7A 3DUFA 2VDLB 3AKDA 2W6JA 4YCSA 2DBQA 1FEZA 1XA4A 5F9MA 2N46A 1B14A 4IJ5A 4Q21A 4F4FA 5A03A 2IS6A 2XODA 1IONA 4MQLA 4MVJD 4O2AF 3W4JA 2A33A 4MRNA 3MLEA 5FT9A 1H1TA 2ZJ1A 2XNHA 4DVGA 5C8VA 1JDPA 4XTRA 2EGGA 1PJZA 2AFHE 2QUKA 1ISMA 1T5TA 3O1HB 1NLFA 4YP5A 4YRRA 6ABPA 3A3KA 3GROA 4QU8A 4R3WA 2R0QC 3FPKA 2BCEA 3CF4G 4WA7A 2D1QA 2IC5A 2G08A 5G0UA 4O6VA 5LOVB 3JY6A 5DHRA 4Z53A 1ZSYA 2P9EA 5TS2A 1JB1A 2YJ3A 5IC4A 1EM8A 1GL9B 2O50A 3PNPA 4UXHA 4UOEA 2XBMA 4J2OA 4YYEA 2OLJA 1Q1QA 2GARA 4UFPA 4IIJF 2R8XA 2QGZA 1YRYE 2AXNA 2H0QA 5IWCA 1QH8B 1DKNA 3LPDA 3ZUPA 1EK2A 4MPRA 4RETA 3DWIA 4RIFA 1JIUA 2XXBA 2QRKA 4LXHA 3TL6A 5HOEA 3GDWA 3X0DA 4L6CA 6PFKA 3RTGA 5NLLA 5TT1A 2C57A 1AKRA 3BD6A 3G2QA 1ZIPA 2GZAA 1CB7A 3C43A 4NEGA 3AVQA 4QGAA 2F55A 3R3HA 4ACAA 3O2NA 4ITRC 2Q3DA 1DFGA 1L5GB 4AKTA 3UATA 5CIYA 5FIUA 5JAUA 4CPDA 3EQ2A 4MVJP 4HG2A 4CM9D 5LU8A 4A23A 1PYGA 4WY2A 3ZS9A 5JAIA 1OC4A 1TQ2A 1Y89A 1ZOSA 3JTMA 4PZLA 1ZN8A 4AK9A 4CG3A 5JALA 4ZODA 3MEQA 4JU8A 1TLTA 1Y1TA 4C2BA 1KJ9A 4W5RA 4FILA 4YRBA 2PFSA 2XHZA 1O08A 1JPNA 2PH7A 3REQA 4BHTA 4Y67A 3ABOB 3KS9A 1ULHA 1SO8A 2XVAA 3O3OB 2JVJA 4MKIA 1GQFA 2C54A 1K98A 3LXXA 3LY9A 4RY2A 1HG0A 1YR9A 5D1HA 3UXEA 2GPJA 4Q6WA 2B4TO 2PN1A 3N2EA 1HZZA 2MSCB 1RTKA 1YTLA 3CNHA 3Q3GE 4YGXB 2G1PA 4I5FA 4QM7A 2GXUA 3QX3A 3MMPA 4W4TA 1FRVA 1BDJA 3V2UA 1PIWA 3BTUA 4JBWA 4QQFA 5CCBA 1O9HA 3ZK9A 3ZZMA 1MA0A 4IO1A 4YUAA 2OZPA 4X00A 2ZUSA 4HSEA 3DEFA 1X2EA 4O2BB 2IELA 5SYAA 3SHTA 4TV9A 2Q3LA 2ABWA 1V39A 3HM2A 4HXGA 3K9FC 3VVMA 5BN4B 2YHSA 5ECDA 3UMJA 3JPYA 3ZDZB 1V8ZA 3W6ZA 1HC7A 4BV9A 5AJVB 3G8CA 1UEJA 3DMRA 4DLVA 2VJYA 4K1LA 3RVSA 1W0KD 2NSDA 4CMIA 5MN6A 1RXUA 1V45E 3E58A 1X7ZB 3LT1A 4LOHA 4O02B 1VB3A 5DWDA 3AYZB 2BMWA 3K1AB 3UA3A 4QUHA 1WDKA 4D9NA 1S3IA 1LTQA 2D5LA 2W71A 3U4QB 3HEBA 2RK3A 1NNSA 2POCA 3WGYA 2BFNA 2P5SA 5JPCA 1QFYA 3PUWA 3RF6A 1M8GA 4BVFA 2BFDB 1ZUIA 1Y9ZA 2HO4A 1M5RA 1NJ2A 4M87A 1II0A 3I1IA 4FQ7A 4R2JA 3RK0A 3U62A 5H1YA 1PS9A 4FUTA 2VBCA 5ALUA 4FFVA 5BRJA 1WXWA 1DC7A 3DEIA 4EVIA 3H16A 3R5JA 2CLFB 5BVHB 2EFHB 3EZGA 4QPNA 1O0BA 3HJCA 3PKZA 2YZMA 4B6RA 1QPZA 1NYQA 5A9SA 4ZYXA 4RM3A 3OSUA 1XB2A 4NZNA 4OQNA 4LOAA 2DR0A 5CT8A 4E2ZA 1KQNA 2AF4C 5G53C 4JXJA 5FX2A 1XCBA 3NWJA 1Z2EA 5IJWA 1CUJA 5KNCD 3PFHA 2CJPA 3MB8A 4DWOA 4BXOA 2WSSA 3TTWA 2C9YA 2VCYA 5ADVA 3ICPA 4AMZA 1FUUA 2AG0A 3N74A 2QLBA 1Z7YA 2UZIR 5A3RA 4MMZB 5IEJA 3R8FA 1KFBB 4LZOA 3ZC3A 5J1TB 4PQFA 1C7EA 1QTNA 5LQMA 1XNRB 1HDRA 2OHOA 3CTMA 3EY4A 4B6GA 3E0QA 1C9YA 3RUDA 4ARVA 1H23A 1A2OA 2DUNA 2LV8A 3CMMA 1NVUQ 3EFHA 4PSAA 3U7IA 1F3LA 3VNQA 5C51B 4D02A 5JDCA 5JJ5A 3SC3A 2OBYA 1E9VA 1U0TA 4KO8A 8AT1A 1L4YA 1NVGA 2EBHX 1YHNA 1GGMA 2FFQA 1AXGA 2TYSB 3AK4A 4J2HA 2LGJA 4LWQA 4BO9A 1LC3A 1A3CA 2Q50A 4K9NA 3PUHA 1V8PA 1CE8B 3SNKA 1BX3A 1JUDA 2O8EB 3C3XA 1IK6A 4N3CA 5CU7A 1T8PA 5ECYA 3U7RA 5F77A 4CXMA 3M4JA 2VQ6A 3FTEA 4BS9A 4ND1A 4HT3B 2H8GA 3KU4A 3V1MA 4X92A 1ZXBA 4CR7A 5K09A 4GOLD 4F7DA 4P7GA 3E9NA 1E1KA 4XM1A 4Y2TA 2ZIZA 1TTQB 4UNSA 4Z0NA 4O3MA 2PZ8A 4L3WA 1GLVA 1R27A 1IVNA 2ZQYA 4XB1A 5LA6A 4LDRA 4CL8A 4NAHA 1NUTA 1GITA 2FWAA 4P82A 1QYWA 2EIHA 2PL3A 2ZBFA 2Q7OE 1LWNA 4J94A 4WLOA 2Z5LA 4U39A 3UPDA 4ZI2A 1ZRNA 1QH8A 2IODA 2I2CA 3F8WA 3EUEA 5H16A 3UK6A 5CPFA 3JV7A 3W4IA 3EZYA 3KQYA 4R98A 4BLRA 4Z4EA 3L0ZA 4N3AA 1ZX1A 3K70C 1FJ2A 4HDAA 2PV7A 3Q5GA 4PGAA 4IO0A 2V8OA 1ISJA 4QO8A 3G9XA 3HRHA 4CM1A 1SPBS 3LP6A 4ZQEA 6Q21A 3KC2A 3ROEA 4UZSA 2IF2A 2NU7B 2UZ1A 3EVEA 3PD1A 1QZXA 2OZKA 4NEQA 3L8HA 1YFLA 2D5BA 1Q0HA 4EMSA 3DF7A 3RUIA 1Q3KA 3LQQA 2FZWA 3SSAA 3UH1A 3T1VA 3TQOA 3O93A 2DTDA 4Q34A 5CUQA 4AICA 4IM7A 1O03A 3PG5A 3DKPA 3DEKA 4CLOB 2VBFA 2Q1UA 4MEAA 1RPNA 2WHPA 4ZAYA 2WAOA 2YQ5A 1I7LA 3GJ0A 5ARCA 3RRZA 2WABA 3TEMA 4GO1A 4NZ9A 2QIPA 3OZWA 3GGCA 3UENA 2YVLA 2F3TA 1DQYA 3RS7A 3NBUA 1YIOA 4G5GA 1N2BA 2H4HA 3FHLA 4JLMA 5E7JA 5H81A 1WPGA 4KO3S 4UOQA 1Q0ZA 2XMCA 1IN8A 1PQWA 3K2QA 1C9DB 1WXDA 3TNYA 2PBFA 4WADA 4C2AA 3NI2A 1YZKA 3DMGA 3G17A 1QO0D 4JIMA 4PTZA 3OOWA 4A6EA 4A8HA 5JFGA 4HN4B 4JFRA 4OUKX 4YCJA 3DLIA 4RY0A 4Z9BA 5FBZA 4Z51A 4CKZA 3QELB 3U13A 2KJQA 1W88A 1M3SA 3H65A 1JSRA 3TW8B 3ZWYA 2FK8A 3E35A 2L17A 3LHSA 1LI4A 5K3EA 1RBZA 1RFGE 2HA0A 3MPOA 1A8IA 2ZYSA 2HTEA 1PE0A 4UM5A 3RUAA 3NOQA 1HMYA 4Y6LA 2XRMA 4OAPA 5I7RA 2ACWA 1ECPA 1JFFA 2FRDA 2JZOA 4ENQA 2XWBF 1NQ5A 2AMVA 1MOSA 4QAJA 5EI5A 3WDKA 2DQKA 3NUGA 4JSTA 1CU1A 3BSSA 3LW8A 1XDUA 1BVYF 2EP5A 4HP8A 1GTZA 3QBEA 4IY1A 3TRFA 3BXHA 4E14A 3OD1A 5ES4B 3C3BA 3MS7A 1YB7A 5I7EA 2VXBA 3ZBQA 2IEZA 1R00A 4HDSB 3T7EA 3HXKA 3NIFB 4GH5A 1SVLA 3OPVA 1MZVA 2ZSKA 3DFKA 4PLZA 3WQSB 5KYTA 3HLYA 2C3YA 3LPMA 3CWZA 4JVLA 2FDRA 1GGFA 1F4VA 2W2QA 4PIVA 4EKGA 5JADA 1EAYA 2X1HA 4B3TB 4JI0B 1OHHA 1KIFA 2EW1A 1L6RA 3WYEA 1GFZA 4PLWA 2JI7A 3FMGA 4JLUA 3W2FA 4IRUB 2GYVA 3UAXA 1PL0A 4EKEA 1YOVB 1DADA 1JQJC 1R5JA 2VSFA 3DLTA 3H3FA 3PLRA 4UNIA 5J2TF 3T99A 3Q0EA 1IN5A 3ID6C 4Y1RB 4C0JA 1R5BA 3OLQA 1W2WB 2FY8A 4DS3A 5KYUB 2ZJ0A 3I53A 2JCSA 4QX6A 2MSEB 1B15A 2YICA 3IODA 2FGJA 4RULA 1ST3A 3SY8A 3DXFA 1Q21A 4IMIB 1U63A 5ALKA 3EEYA 1OU0A 3GRAA 3D6FA 4D25A 4Y2PA 3VVCA 4G86A 3BJEA 1VI5A 4AKGA 5EHNA 5E0KB 2G72A 3GLTA 1WU7A 4WCFB 3GMSA 3ZZUA 2CNBA 4P86A 2A9KA 4JWTA 1COWA 1G8YA 1YS2X 2HRDA 3QY0A 5A5FA 5IDVA 3C1OA 1J2UA 1UBMS 2ZDQA 3EGDA 1T5IA 1I6MA 2H2DA 4HWSA 5EJ7A 4DMCA 4M1YA 3B2NA 3QE0A 2O8DA 1CUWA 1Y7PA 3QHQA 4B1FA 3QVSA 2BEJA 1DWOA 4IAOA 5D87A 3L1HA 5T6BA 3T7IA 3WHLA 4ACBA 3HY4A 2GSWA 1P2VA 1JH8A 1RZUA 1BNCA 3CEHA 3JD0A 4FYKA 2QRPA 2EL7A 3CSSA 1SQFA 4BFSA 4F4IA 2R7NA 4L08A 2GVDC 4ZOLF 1PSZA 2PX3A 2XMQA 3GGDA 3I39X 5H83A 4B0PA 5KOHA 3SFVA 3U6BA 3DLAA 1O89A 4G0QA 1YMVA 2C58A 4URHA 5EEHA 1C3XA 3HL0A 4MS1A 1WR8A 3FPHA 4FMCF 2P3LA 1T0IA 2ZJAA 4OJKA 4R8KA 5DN6D 3BKXA 1BFKA 1N1GA 5M04A 3SX4A 2FMXA 1G5HA 3OPYA 4G26A 2RH9B 1NQOA 4FLMA 2BKAA 1YBVA 1G3QA 2JCGA 3ILXA 2YINC 3A4TA 4BJ1A 4QBTA 1YL5A 2Q8QA 1BJTA 2H1CA 2K6GA 1L7BA 4P4LA 4WXYB 1Z4OA 1JAIA 2REQA 3GJTA 4ZI7B 1YTUA 1YAJA 3PWTA 1LW7A 2ET6A 2NU6A 5G4LA 2ZDGA 5EVCA 5DV9A 4Q93A 3F97A 1AZWA 1MRZA 4MMYB 1V9CA 4BZWA 2RHGB 4L28A 4MROA 4XR9A 1C0IA 3SXJA 2FN4A 2GYUA 1IQUA 3WBFA 1P9WA 2V74B 4LPSA 3JASB 3V1YA 1D1QA 3U26A 3VC2A 3ULKA 5DYWA 2ZGVA 2V4MA 3ZDYB 5BXYA 2QD3A 3JQ7B 5KKAA 3DBRB 3B6EA 4LNAA 4M0PA 1LWOA 2Z98A 2H1RA 1VI2A 4KBFA 2Z8YA 4N5MA 4V0ME 1VSVA 1KI6A 1DEHA 3OCXA 4IJKA 4X54A 1VDMA 4K2HA 4O59O 3SX0A 3BSWA 2NZVG 1F7VA 2JCXA 3K0CC 3NHBA 4D8UA 4ZMBA 4F8YA 2PH1A 4JAVC 5A3QA 4K3UA 1MT0A 5P8WA 2G40A 1MKYA 3NOOA 3BL8A 2WM3A 3Q3IA 3RODA 4BN5A 2SKCA 1XWIA 3WGLA 4G5SA 2CB0A 3FPAA 4D1YA 2CUZA 1BHO1 1ZHHA 3FMPB 4Q7JB 1JLKA 1SR8A 4EUHA 3JATA 2QAGB 5IAJA 4NONA 3LP8A 5CLFA 5K0NA 4LXGA 3M1LA 4NE7A 1JQAA 4YP0A 3W3AH 1ONOA 3DO6A 3LUPA 1LV8A 5DE3A 5AVRA 2RGNA 3L1KA 1JDUA 4M98A 3RIYA 3O92A 2ZTLA 5FOQA 1YT5A 2Q6IA 1JEQA 1FNCA 2RAFA 1OPRA 3OEWA 4REMA 4ZVRA 1HKUA 4LWZA 1ZJYA 4PANA 1G5IA 3Q6MA 1JEDA 4KFTA 4QDZA 2R97A 5JJKA 5AI6A 4D9BA 3ACDA 4R40A 3RH0A 4IXWA 1P2SA 1PGQA 5T4BA 4OJTA 4ZQBA 4D45A 3R75A 2ZITA 1U1GA 2ZULA 3VBEA 1H5NA 3NPMA 3U4AA 1BD4A 2NZUG 2ZK7A 2QD1A 1BXGB 1VMKA 5LZ2A 4QYXA 1XTPA 4YAJA 1EP9A 3GEGA 2ZSEA 2X0IA 5T64A 3F6SA 3RVJA 3DHEA 1VP9A 3I30X 1M72A 2I62A 1M10A 2X0RA 3ICQB 5TQ0B 4BKOA 3ESYA 5KVCA 3ZK7A 3BRCA 3ITDA 3FOWA 1Q12A 4OIMA 5JROA 3AO0B 3B5IA 5BY2A 2YWJA 1N0IA 2FSSA 4J0GA 3WB9A 3NVDA 5B3LA 4RD2A 3RU2A 2PNJA 2DWOA 2PX4A 4IH4A 4PG6A 5D86A 4B45A 2OV6A 4OOEA 1RHUA 2EP8A 4LDZA 2WHRA 2FQXA 3HY3A 3PX3A 2Y68A 4KNVA 3EZ2A 4EO9A 1PVVA 2RK6A 1JILA 4H6PA 3SF8A 4MK4A 5TR9A 4BFCA 2DFTA 4E08A 1NXOA 1WKVA 2JIDA 3WRVA 3A31A 4RZXA 1QC5A 4RL4A 2ILTA 3PD0A 1JG1A 1ZVQA 4N3NA 3RFXA 2UUPA 2OR3A 4KN5A 3C6BA 3II6X 3B9PA 4WNAB 3FKSA 2B8NA 1XR3A 2VUHB 4ITUA 4I55F 4JWKA 3DP7A 3TR5A 1H3NA 1ZDMA 1P5RA 3G1TA 1U2SA 1TNDA 3R3SA 2EWVA 4R5MA 4Q9LA 4KPUA 9LDTA 1H05A 4HXFB 1AN9A 1U90A 3LVBA 1CP3A 2G9RA 3AFGA 3P2KA 2O1WA 3A6JA 3L6DA 1JYEA 2CHFA 1PDOA 3P5SA 3UV3A 5P21A 4Y3UA 3Q7SA 2YC4C 4O4JA 4KRGA 4H3KB 4N8DA 1ZGHA 3NP9A 3RYFA 2OLKA 1T9ZA 1WSAA 1QDEA 3OFNA 5EQFA 4RH0A 3AU9A 3DCIA 1CRQA 1UAGA 3VTKA 1N32B 1P6XA 3EOZA 3TIVA 1FLNA 5CH5A 5FNVB 3MRVA 5IJZA 3Q12A 4QBFA 5ADWA 4PZCA 1TA0A 1G9TA 1WAMA 1QIHA 2HF2A 4X8HA 3PUKA 4C6RA 4CKEA 2ZRCA 3OCZA 4J0HA 4B5KA 2QMEA 3LCCA 4L5BA 2WHPB 4M37A 3CLTC 1UXGA 2CXNA 4GP6A 3PGKA 1JAXA 4L4XA 3TW0A 3EIEA 2F43A 3N0TA 5G0TA 4AO8A 3SP1A 3ZDBA 1IQ0A 4ROSA 1FVFA 3NHLA 4EHAA 1DV1A 2HDOA 3L0DA 1QQ7A 4BL5A 3LFHA 4RVCA 4ARBA 3BZUA 1DAIA 5TVGA 2UZ1B 4DFDA 1M74A 1E59A 3VPCA 4EB0A 4OB7A 2DP4E 3WQBA 2VWPA 1M6WA 1NUUA 2QP4A 2F17A 4OJQA 5EQDA 5ENVA 4F3KA 3AIIA 4AG3A 1RC1A 3MLBA 3UYKA 1OIWA 4UAUA 1SUBA 7REQB 5TQVA 1W19A 5FWXB 2ZQ5A 4WXRA 2FEPA 2C2BA 4TRMA 3K6SB 2PJRA 3FBGA 4PY2A 3LDFA 5CB4F 1PQPA 2ZDHA 1TF2A 2C61A 4PYQA 1ABBA 3WL7A 5B1EA 2PA0A 2C5BA 2FQWA 3LF1A 3PYLA 3TSCA 4MP3A 4MW7A 4JY7A 5JNLA 1VI6A 1NKVA 2A86A 5LZ9A 2C4KA 1EQUA 1JYFA 4W9NA 1OIVA 1K7FB 2BI4A 2FKAA 3OZXA 5FORA 3R3YA 1J42A 2GAJA 3CLUD 1EUQA 2Z1MA 3GJ5A 2FZ4A 2P78A 1DMRA 1VLMA 3S28A 1B0UA 3TZEA 1JP7A 1Z4NA 4CG2A 2I8LA 1G1AA 4B6PA 4M3NA 5FB3A 2WT4A 1NE2A 1LC0A 3O03A 2PSFA 3GGSA 3HCFA 4TZKA 4CM5A 1Q0PA 2P9ZA 3JASA 1F8UA 1AMOA 3I01M 4YRZA 1SXJD 1Q16A 1XZKA 1QCDA 1MQ9A 5L3RA 3OCCA 1X1BA 3EGIA 3BXEA 2QP3A 3P1JA 1S01A 2Q5CA 3BKWA 1OX6A 3KQOA 1EHCA 3MWEB 5KTPA 3GLGA 1KJJA 1YI1A 3STTA 2P5YA 2BKUA 2GXSA 1XZNA 2A88A 4MLCA 1IUOA 1G21E 5ITZB 4NPAA 4RZIA 2FNAA 2GZHA 1PZHA 4OHYA 1BEEA 3FRIA 4RIHA 1N2ZA 4RU1A 2ZS8A 3TW4A 3B8HA 3VKGA 4DJFC 3FZGA 4UAGA 2WF7A 2R6GA 3UJCA 1EFPA 1PLKA 3DKIA 4P34A 2WVGA 3KQVA 2JLUA 4L5JA 4KX3A 3G6WA 3E8XA 4C1NA 5KYXB 1VE5A 4JL8A 3PQEA 3E9DA 4F8EA 5TNXA 2C5GA 1ORWA 4QA9A 3SK0A 4QOGA 4BJ6A 4IW3B 1COZA 4AMVA 4RORA 2F9LA 2RHWA 1F1JA 5EPOA 4BQPA 1N8KA 1U4OA 2RG7A 4H7JA 2XQGA 1AGPA 4R0NA 3KOMA 1G9XA 4IBOA 4JB0A 2D0PB 3SS8A 4LBYA 4HKTA 3UMCA 4CEHA 2WKQA 1W4CA 1N5RA 4MRSA 5BSWA 2CVHA 5EKXA 3NUQA 4FJ1A 4ZZ3A 1VSTA 4YJHA 1SXQA 1WUYA 4B43A 5KYNA 1ZNYA 2H8KA 4NARA 4LBZA 3D3WA 4UREA 3FR7A 4B7UA 5EHXA 1R4MB 5DH9A 3S8MA 4L51A 1DCFA 4O4LF 3CISA 4L2IA 1E2LA 4O8ZA 1V4BA 3CWQA 2OXRA 5AIBA 3HK2A 3AW9A 1FP1D 3I12A 1R50A 1IM8A 4UJ3A 1PFVA 3VR5A 3AEZA 3SMQA 3EDQA 4RKFA 4JT2A 4ISBA 3N39C 5EMNA 1D2AA 4AX8A 4KQJA 4M0MA 4CUZA 1Z5NA 1XJ0A 2JB9A 1S02A 3RSZA 4FYWA 4A15A 1Z5UA 3A1WA 3BHNA 2X8AA 3RUEA 3N76A 2VNKA 3IDSA 4HEA1 4KPYA 1LSOA 4GC5A 1CEXA 4OGWA 1ZXLA 4OG2A 4RNDB 3B6MA 2ZI6A 4FDUA 3WRYC 4IG9A 1EG2A 1Y6ZA 1KFKB 2H1SA 3MUFA 1TO2E 4QZVA 3RTEA 1W5EA 4FD2A 1CR1A 3RBXA 4ZJYA 2J87A 1AHNA 1SA0A 5CR9A 3WRYA 4D98A 2CUNA 2YN4A 1P0CA 3GC6A 1BX1A 1E5QA 4XUGB 3CX6A 4BYGA 3JAWB 4BX9A 1T8UA 1OH7A 3HN6A 4BO1A 1GTVA 4F12A 1ZG3A 1TUBB 4FNMA 4NU8X 4GP9A 4TMFA 3MHPA 3R3XA 1E5VA 3JARB 2QD2A 3L43A 1IXRC 4GZ3A 2HR1A 3T5GA 3HA7A 2CXHA 3CZAA 2BFMA 2OWEA 1T36A 2Q3EA 4G8JA 4OJNA 3KOZA 4K5QA 3BA6A 2Q99A 5DHPA 3P2YA 2FSFA 2FEMA 1E2QA 5IJ9B 1GD1O 2LDBA 3S8YA 1ZH4A 1WMEA 3AF6A 1DKRA 1WS6A 4BN4A 2BP7A 3TLCA 3V4OA 3W7BA 1U5CA 1TECE 1Q44A 3WYGA 1K4KA 1SC9A 3QELA 3KZCA 2OPHA 4HVLA 2ODTX 2B0JA 2B2NA 1OWLA 2QTFA 3BTVA 3GK3A 5HE9A 5I45A 1LPBB 1Z5PA 5KNBD 1BAPA 1SN7A 4LXXA 1G6HA 3H05A 3K20A 4JX8A 2OORC 4XYEA 5JCJA 3VJMA 1FFXA 4AYWA 2YRWA 4HN9A 1CZRA 4GECA 3P0FA 2UUBB 5JY6A 1NVTA 3DPSA 4E88A 1M1XB 4E13A 4Z2AA 1XRNA 1N78A 1ODKA 2CLIB 1H2ZA 4EDFA 5IM5A 2JIZD 4OLFA 2QLJA 3MWYW 1PWHA 3CMCO 3HN2A 2RJ3A 3HBNA 3EIHA 1R15A 3S2ZA 4A8JB 2YJZA 2XI4A 3I23A 1O87A 2Y1OA 2YS6A 3OM1A 1OZHA 4W5HA 3NUZA 4EYQA 4RHUA 1YVUA 1DOHA 1GU1A 1F2VA 2WG0A 3A9SA 3F3MA 3NR2A 3BN3A 4B76A 1O94D 1IHXA 4TRNA 3N2KB 2YJ6A 5B2ZA 1OX5A 1KNQA 1LLCA 1I1QB 2WR8A 3G79A 4P84A 3B3AA 1EXDA 1Y4SA 3CNEA 1TK3A 3QKSA 1AGYA 2PXCA 5F4BA 4DABA 2F7SA 2ZYGA 2PGNA 2BZSA 4PLFA 2YZGA 1FLVA 5CM8B 3UAWA 4QL3A 1VYHA 3G5UA 1WZCA 4J43A 3EIQA 3T7RA 3QKTA 2DG2A 2AJCA 3PHGA 2OILA 3FVWA 3MJHA 5DNWA 3OKCA 4YP6A 2B35A 1G5PA 2BLNA 2G1AA 1C9EA 4ND6A 2XCQA 3SLKA 1PX2A 2XADA 3HGTA 4A27A 4YMSA 4QASA 4LY3A 3NHJA 3M2PA 3BRWD 4JLAA 4O2BA 5FTKA 4KQMA 5B1HA 2F2TA 2NPIA 5IKOA 4AJOA 1W2GA 1WDMA 5EHQA 2A78A 1UBFA 2J3DA 2HRRA 3OX4A 4X60A 4B6QA 3EX7C 5IASA 1XKTA 2X2PA 4I2VA 4GNKA 3SBEA 1QYVA 3CH7A 1G55A 1H2BA 3AIOA 1P1FA 2H4XA 3WQRA 1SHUX 2RI0A 1Q7GA 4BCCA 2VQFB 1HG1A 2CNNA 2BUAA 1OV4A 5M3BA 1NLUA 4C01A 3PSHA 1I0IA 3LJKA 4N01A 5ALTA 3FNGA 3OJ0A 4XDHA 5IPFA 1PFQA 1J5XA 1KSGA 3ITKA 2HA6A 3TX6A 4UEKA 1E5XA 3MUEA 1A95A 4MUFA 4WGGA 1O8CA 2QPTA 4XX1A 5C7IO 2GCOB 3HCOA 2R25B 4ZRDA 1EQ2A 4UVIA 5F2OA 5KYWA 1WF3A 2G9UA 1SU8A 4QOJA 1T9AA 1QFJA 1RP7A 2V6BA 3Q3CA 2BBSA 2XUJA 3FG9A 2CB9A 4DMMA 1IZZA 5K8LA 1ENYA 3T3IA 4YJHB 3H5OA 4GOJA 2VDQB 3CTPA 3F2IA 1PHRA 4PAQA 1XJCA 1NBME 4IKEA 1R4MA 3TAHA 4D4MA 3EN0A 5DYGA 4EIWA 1PDWA 4W63A 2JIOA 3GVIA 4BB9A 1EX7A 1G41A 2IUEA 2PKQP 3O4IA 4CCSA 4X61A 2D2FA 4PZPA 4DC9A 4POOA 2FMFA 3UMMA 3SZRA 4U7TB 3IBCA 4OY3A 1D04A 3RAFC 3E2PA 4UCQA 1SC4A 2GHTA 1GUFA 1QVZA 1RQXA 1ZHFA 3ANYB 4KN9S 1C5KA 3QEJA 2P68A 3D3QA 1XTZA 5JR3A 1K6XA 1WVIA 3A6DA 4DHEA 1FW8A 2EZ8A 2R8YA 3GHYA 1KYTA 1DHTA 1R3UA 3B12A 3BSYA 1L3IA 4IDQA 4FZRA 3PV0A 4BUZA 1CZUA 3ITNA 3K96A 5J4HA 1JIJA 1TZKA 2PCLA 2BHLA 3CEPB 1MO5A 1V1MA 5HEKA 1XLTC 2OFFA 1KO8A 1K86A 4YAGA 2C0CA 3PRYA 2TSYB 1U94A 1FDWA 3NW9A 3LKBA 5ERYA 1I7PA 4QBGB 4RK5A 2HLDA 1PT5A 1OI2A 2JF0A 2IVFA 3L06A 2QZSA 3ZHBA 1XQWA 1QIGA 3R5TA 4LX0A 4V3CA 4AQ7A 2GJSA 2IK8A 3HU1A 2P1ZA 4C22A 1MTZA 3QKWA 3RLFA 3IV7A 1Q7RA 1FBNA 5T8KA 1QFXA 1X3LA 3ZR4B 1RHKA 5FULA 4DHWA 1OI7A 2JVIA 1UKAA 2FXVA 2WJYA 4POAA 3G0IA 2XA1A 5JWOA 5K4GA 3OEEA 1JAYA 1MNAA 3O7WA 2N42A 3IPRA 1SXJB 2GKGA 2Q5IA 2FWPA 3V1LA 1D03A 2HFKA 3LT4A 4Z0HO 4EX7A 3AETB 1OFUA 1CVLA 1XVAA 3FDJA 4LPKA 1MJFA 4I5GA 1M2EA 1SA0B 3TI9A 3LX4A 4AIRA 1EFKA 4P7BA 1W87A 1FUYB 3M5PA 1TFRA 4LGMA 4LMBA 3V8VA 1ECBA 1Y5MA 2P9JA 1G4HA 1W4ZA 1RZ3A 2W4QA 3AF3A 3HKDB 4PIPA 3AR7A 2R1TA 5EXSA 4CF5A 4R7TA 5E1OA 5KNDD 1D2HA 1YVPA 4Q7LA 3FUWA 3TLBA 5G1OA 1Q7EA 2K87A 1IC6A 3JQFA 3R7BA 4IHQA 4Q3KA 2GEUA 3LL7A 1CUBA 1VZ2A 1N7GA 2QZ4A 3DTNA 3VO2A 1Z6XA 1PEDA 2QMQA 3H8SA 1CJKC 2CVZA 2JIPA 1K06A 3D6MA 1BKDR 2GYYA 1C1YA 2ZB4A 4MRRA 10MHA 5AK5A 4ZVPA 2IBSA 4GFDA 4JBYA 3FXAA 4ZCQA 3C8HA 1UDXA 2QN8A 3BGIA 3KPWA 2O8BA 4H77A 2V5AA 4YXWA 1XU7A 2VJMA 3JS5A 3LFUA 5A0FA 3OZAA 3W2HA 3ZU6A 1PT7A 1QKKA 2AJ8A 4HUQA 4IOLA 4GYWA 1KYIA 3EFBA 4FFSA 3A9UA 3S2FA 2MINA 4B4DA 4D0NA 5JRJA 3D1VA 3HFSA 4EB6A 5ADHA 2IHNA 3DHWC 2J31A 2I3BA 2ZRMA 3FA2A 1U02A 2FCRA 3K8YA 1XZJA 2C2HA 3MQFA 4TS9A 5TGZA 4CGYA 3EW7A 3LT0A 3OF3A 3E18A 4KQGA 4D8VA 2OBBA 4FGWA 4IWXA 4NBTA 4JK3A 4RF3A 1WDLA 5JBQA 3QPCA 4UCWA 1R0SA 4PFSA 3GNLA 1UFOA 3JQQA 3KJFA 3LE8A 4OXYA 4UW9A 4WCVA 1F0KA 2FFRA 2ZRFA 4BMSA 2DUWA 2J0QA 2ADFA 3QK7A 3ICWA 4O3FA 4UTZA 1UC5B 5TV2A 3CUTA 4A1FA 2FETA 1CDZA 1EFPB 4O5AA 5AKLA 3EQ7A 3PQ4A 4Q3LA 1J4AA 1O97C 1PNVA 1ZI8A 2WU8A 1GV1A 2Q1YA 3SJZA 1P2UA 3PTZA 1A72A 1AK1A 3E5MA 4GI1A 2VO1A 3TMKA 1TU0A 2P3QA 1S1CA 3HB4X 4RESA 3UFBA 4ERNA 3IKTA 1DELA 2VQSA 2XZPA 2K7FA 3RSQA 3INRA 2VP0A 4JBNA 4RYDA 3VYUB 3INGA 4IXMA 5DU2A 1N4AA 4G5XA 4BNDA 3LBFA 1UFQA 4LY0A 2CD9A 5GZ3A 3E9ZA 3FBWA 3LK6A 5SICE 2VC2B 4YRGA 3BAZA 3TOSA 3AEKA 4NWIA 4A0FA 5I7HA 4AJ9A 4JB2A 1PJBA 1WHTA 3DWFA 1JTEA 4P2BA 3ZK8A 5JANA 13PKA 1J2TA 4EGSA 3W5DA 3CNQS 4JQYA 5M2QA 1NJFA 4URWR 3OPNA 4KVZA 4EW6A 2D1TA 3HJHA 3UWMA 2FG6C 1YZVA 2AMYA 3M6IA 2Q1SA 2QPOA 1GGNA 2C00A 1BO6A 4MLPA 1M34E 4C7OA 4OFXA 4WLEA 4MRMA 5AXAA 1NU6A 2D1SA 4KIUA 1XNJA 1HETA 5CFQA 2R4TA 1PBNA 2HA4A 4HGPA 4BO6A 2PVCA 3IT1A 1LBTA 2IYYA 3B5EA 1P6QA 4DLXA 3T1HB 1Q0LA 3T4UA 1JV2B 1E0JA 1KEPA 4ZZ2A 4DJTA 7REQA 3KUDA 5CM2Z 3UOGA 2XOKA 3BE4A 4GI3A 5AVJA 5JCOA 3SQLA 2B4RO 2P69A 4Q3EA 5C4MA 1DPFA 4XD2A 4PZYA 4Z1OA 4FLFA 2P4HX 1E2IA 1EP1B 3TKAA 4CHGA 2YH2A 4Z1MD 4JCCA 5CLIA 1QIJA 4MUYA 5DNEA 1I9GA 1ODTC 2BELA 4CT5A 4F45A 1RE1A 1M2OB 5F9HA 1WVGA 5JT1A 3VSAA 1E8DA 3KUCA 4DT1B 1T1IA 1FTWA 1A82A 4BMZA 5C1DA 2M6RA 3A9VA 1XLVA 3Q87B 4OU5A 1HE8B 1R18A 3U60B 2BGIA 5EQJB 5ALVA 1PJ3A 1MNQA 3R3JA 1ODIA 4ND4A 5EIXA 1FA9A 1T0UA 1ITZA 1XD2A 3IULA 4OXNA 2OYCA 4EHHA 1J90A 2DKFA 1SD2A 1VL1A 3AMVA 1D07A 2P2DA 2H51A 5FEMA 1ZD4A 3ZTTA 2CCKA 1N0UA 1Q1AA 3MJRA 1B6SA 1IEXA 3EZLA 2KSQA 2BFCB 5KTSA 1EWQA 1XZEA 1Z6PA 4KN8A 2J5QA 3JQAB 4F92B 1QRTA 2BEWB 3KK0A 3HNRA 2WU0A 4IILA 1X7YB 5DWQA 3WKDA 5FBKA 2X9QA 2QE7D 1I80A 1CEYA 3EEFA 4EW2A 1BQ3A 3BK2A 2CVOA 4QJ4A 2AG8A 2BZ0A 1IN4A 2HB6A 3H97A 4QJIA 1BS1A 2VYNA 4IIHA 2NV2B 2O0KA 1XHLA 3P9KA 3RT1A 5A5VA 3L8DA 1VPLA 3EDRA 2IL1A 1UJ2A 2AYZA 4LXQA 4M1EA 4R51A 2XMSA 2IE8A 1H69A 4JLKA 4BY9E 3FFTA 2GF2A 3AG6A 3GNQA 3MJVA 4B4OA 4IWYA 2F1HA 2IYSA 3T6KA 2XEDA 3GUYA 2CGEA 2WAXA 3RNOA 3PEWA 3KVYA 3K1JA 1V7CA 5IAEA 5B6JA 5H7XA 4X24A 1DKMA 4FN4A 2NV0A 4MUJA 1VBKA 2AN9A 2GJ4A 3CR3C 1QM5A 3EIUA 3TW6A 3UJBA 5LFAA 2ZZKA 4PWZA 3WGMA 1U2EA 4PPNA 3GRYA 1ENOA 4FI3C 1N9GB 2C20A 4H7DA 3TTUA 2OGWA 3CVJA 3CRNA 2XTMA 5EEGA 5EJ9A 1BKYA 5EXTA 1X8JA 2GDJA 1UZNA 2PZEA 4DR1B 4HZUA 3EBOA 2P6NA 2CHUA 2ZREA 3K73O 2FUG1 3AESA 4XPIA 2XYPA 3KVRA 3PGVA 5LVAA 4EI2A 4LFCB 4DEVA 3GRZA 1IATA 1WQ1R 2WJ3A 3NAZA 3MELA 1VXRA 3OM8A 4D97A 1ZGGA 2WJWA 2Z2IA 3BC1A 4QPPA 2QA5A 4J4HA 3OTIA 3L0OA 4QC2A 4EHKA 3TNLA 1SUSA 3CG0A 4JODA 4XFKA 2KYRA 3MWKA 4ID9A 3QI7A 4J90A 3T5BA 2PD6A 1BMTA 4G2NA 3ZV3A 4OHFA 1OFHA 3LAWA 2FPPB 4LISA 5EZYF 2MWMA 4FC6A 4MIEA 3MF4A 1SVWA 4I2NA 4D79A 1XCOA 4CM7A 4OQFA 1QKIA 1GNLA 3EEBA 3QU2A 4RHEA 1WW2A 3L84A 1JDZA 3BWCA 3PJRA 1XDGA 3MSCA 4GNRA 2IV7A 2QUZA 3T52A 1ZA1A 3VPAA 5JSHA 4GPAA 4F9EA 1P3JA 2NNWB 1KBOA 1ZK2A 3UNXA 5DZSA 3PR2B 2PKWA 4ZKEA 1ZAKA 4ETWA 4YRAA 4R68A 5HG0A 4RF2A 3WAJA 1BW9A 3EGEA 2R8OA 4G67A 3PXUA 1PS8A 2E37A 5FWAA 1E9AA 5IKMA 4IQ4A 2ZB8A 1RIFA 4M9UA 1Z0DA 4KWTA 3EPLA 2C7BA 1QG6A 1YIDA 1P1JA 3Q7QA 3JVIA 3JSXA 5LBIA 5BSRA 4CQJA 1KJIA 3OICA 2GBGA 3S81A 3UUEA 4HAUA 3K9GA 4DCNA 1P8JA 3U40A 5DN9A 2VJBA 1RXEA 4FYYA 1U7UA 2XGJA 4U63A 1Q11A 4IJVA 4YRCA 5GOTA 1L5HB 4EG6A 5AOAA 1CV2A 4OD0A 4XWKA 5C5EA 2ZXFA 4QELA 5EIOA 2JLYA 5CYFA 3QPWA 1SOUA 2DFNA 5KYXA 1ZGCA 5HRCA 2R6JA 5LQAA 1NWHA 2YIDA 3G0OA 3KZXA 4FX2A 3AV3A 4WOCA 2VYCA 5H8WA 2EJBA 1R4ZA 2ZIAA 2HXSA 2Q1WA 1VYUA 2FSIA 1EFHA 2QZ9A 5REQA 3P19A 1WTCA 2ZAMA 3K2IA 4P2GA 1FYWA 3TEJA 3KZOA 2DVMA 1R0ZA 3ZHXA 5ALDA 3K9HA 3EXAA 1KETA 2GRAA 4GZMA 2GEKA 3FRHA 2QRLA 3LWBA 4JT9A 1WSDA 4ZT6A 4KXXA 4MQ6A 4P3YA 2GCIA 5ENDA 3N8GA 5JVDA 3KR9A 5LYJF 2DF8A 3T8YA 5AI9A 5FWYA 4BO8A 3L7LA 2CCJA 2V3WA 3NALA 3O38A 3UN1A 3PNYA 3SZLA 2C1XA 2R2AA 4CFZA 4E94A 4JROA 5FD8A 1XBTA 3L49A 4M2LA 1PJSA 2R6R1 3CRRA 5ALJA 2HLDD 4KDRA 2VOJA 2I7TA 2DH6A 3DFMA 3RM3A 3DE1X 4KYUA 4B6EA 1SVUA 3CGWA 4MQBA 1WB6A 3EFOB 4ARUA 1JQ3A 2Q5FA 4IH1A 4MI3A 1GARA 3H9JA 1US8B 1NXSA 5U9CA 2AL7A 2RJOA 1XKLA 3IS3A 5DI3B 3VOBA 3WB2A 2E55A 4XUEA 2RHLA 4OMFG 4BLSA 1TT7A 1DVRA 5K4HA 1JBEA 1N1DA 1L5WA 4GZLA 4E5SA 1QVVA 4B5LA 2AGVA 2WSBA 3PZRA 1OTHA 1MJNA 2IOQA 4RENA 3I62A 1E2HA 1NPYA 1UMDA 1GR1A 1JEAA 4EL5A 5A4FS 2K7ZA 2PJDA 4R16A 3U0BA 4DDKA 4ZEVA 4Y6QA 4EAQA 5LZ5A 2A5DA 1LTKA 4MINA 2YWFA 3WZ2A 4DLPA 2GYWA 4WKOA 5AK3A 4EJ0A 3F7OA 5JC8A 4YUXA 1BMQA 4I50B 4FFPA 4KQFA 5AW5A 3N05A 5B4TA 5CAEA 4FWTA 1DXYA 4ZVOA 4OGGA 2DTXA 1RXIA 2XSZA 1YBHA 3O21A 3IQZA 4IRMA 4J16A 5BW6B 1B1CA 2MSDB 1JTFA 1TZCA 1FNDA 1K6MA 2CNLA 5E4FA 2GNOA 2AN5A 1XDWA 4L5YA 4AG5A 3ZTWA 1X80A 2EF0A 5IAAA 4J49A 3DMDA 3SQWA 2OB2A 1E1DA 2QRUA 4DCJA 3RGWS 3FOEC 1PQ4A 4NFSA 1L9KA 1ZH0A 1VPTA 3B53X 3P2OA 5JFTA 3MLAA 5HBRA 1CTQA 1VG1A 1KH1A 3A4YA 3EXHB 5CT6A 3MMXA 2PX6A 4DIEA 2XUGA 1X42A 1G59A 3AHHA 4ZHQF 1DUIA 4K86A 1PK7A 2ACVA 3ANXA 3IUPA 1ESZA 2I8CA 4JQOA 4ZT2A 4PNHA 2IHJA 4E1VA 1GU0A 3KCNA 3KRTA 1P8AA 1IXKA 1IZ0A 3AZPA 3LRTA 3U1VA 2G8LA 2BR5A 1XYGA 4EQ6B 1JI0A 3O4RA 2HFJA 1YB4A 2GXQA 1PR9A 1QFMA 2XQKA 3RHTA 1EVEA 4JJEA 2Q27A 1DKPA 4ZO4A 3VNVA 3DAGA 4M1MA 4PR3A 5AUOB 1VZ3A 4HRXA 5KJFA 1V6AA 1GKIA 2WFAA 3K6RA 3RLIA 3A1SA 3CPHA 3KUKA 4Z9FA 2JLZA 2X4GA 5BV7A 3IERA 3IHTA 3RFCA 1SU7A 4HH1A 5IKPA 3GPCA 4RLHA 4X97A 4YAEA 3ZKWA 3SHFA 1L5LA 2PKXA 1PL6A 3FF4A 5K0TA 4HNAA 1U2GA 5H9WA 3DKKA 3IUSA 2OXFA 2OXIA 4EHBA 4ZOLB 1HO3A 1C0KA 4R05A 1JDJA 1OFUX 1RBMA 4M9SA 1HFKA 5C18A 1NDHA 3K09A 4MYDA 1MR3F 2QE6A 3HN7A 1FFYA 2NXJA 3NHKA 1S1MA 1S5PA 5D2CA 3SVTA 4ABTA 5KBYA 1K7CA 1OQAA 5CTAA 2I1WA 2XUDA 2DULA 1DNPA 3H0KA 3IXQA 1XTTA 4PNPA 1C8BA 3ZCTA 4GMFA 4KDEA 4YQEA 2B8EA 2BFFA 4H3HB 2A4MA 2BFEB 5DN6A 3R3UA 1OXVA 3FTFA 1IQPA 1JKMA 2QB5A 4W6ZA 3N7TA 4MV7A 4IVPA 4JJGA 1XD8A 4KR9A 2ZI7A 1FSFA 1FJGB 2FI1A 3UWSA 3ZE0B 1E2MA 5JOQA 5AXDA 3TN7A 1GQ2A 3WK8A 2J3JA 2JEYA 1D4OA 2VJOA 4HXEB 3U7QB 1KMMA 1N2EA 1R9JA 3QF7A 1S2DA 1IWOA 3OVMA 2ACEA 2VT7A 4X8LA 3DLHA 4RKRA 1I3NA 4CIWA 3EF3A 3VZDA 1RZRD 1U4NA 2C29D 3WLIA 2P9HA 4BRSA 1BJKA 5C34B 1FFWA 3OQHA 1G8FA 2VZ8A 2H06A 2VNIA 4P93A 2ZJYA 3IT2A 4QICA 4ZO6A 1R5OA 3KO8A 3HJBA 4W7SA 3UB4A 5HIJA 1KVUA 3NATA 4OHCA 3RIGA 4I9UA 1ZCZA 4ZOBA 3ZHRA 4GR9A 4Z0TA 7YASA 4PVCA 2R8EA 1QAOA 1PGOA 2E5WA 2RH5A 3HA3A 2PWYA 3GB9A 3G0DA 1Y6QA 1J8VA 3ZHCA 4ADSG 4H6XA 3BBPA 4RVDA 3KQSA 5EE0A 1M6NA 4F11A 1T0PA 4P7FA 1F2UB 3D6TB 1RI5A 4XWTA 2W2LD 4A0HA 1GZ7A 2EVWX 5ECWA 1ZESA 4KXYA 2AI1A 3DVSX 1T2UA 2X9GA 5LUBA 5JS7A 5KSPA 2DR3A 3EF1A 3TOXA 4BWGA 4L8FA 2NM0A 4WKBA 1V47A 4YUVA 2CBZA 4OXXA 1FXWA 5JSYA 3DM5A 5I9SA 2WNHA 3S1LA 1E2DA 2VYVD 3GELA 4JSRA 3DOIA 4YK7A 5CDSA 5LIPA 4Y1GA 3WL3A 5HILA 2C92A 1X19A 1DC4A 4Y98A 1F6BA 3MOGA 3U7QA 4IXDA 2O5RA 3VPDA 2RCYA 3GXOA 1AV7A 3ZGYA 2I34A 3BXZA 4F6LA 3A2KA 1CJTC 2OXCA 1XTSA 3J81k 3ZU4A 3CT6A 1QH0A 1QHYA 1RMTA 1E94E 4QATA 1JKJB 4X1KB 4C7VA 3ZH2A 1V5FA 4MICA 4E6PA 5LP6F 4EEZA 4ARZB 3GZ4A 1QHEA 2GZ1A 3KXPA 4J0JA 2TECE 4ZREA 2PT5A 1BVRA 2Y0DA 4OMCA 2WTBA 1RJEA 1CIJA 3ZI4A 2QMOA 3W6OA 1FX0A 4BV8A 4TQGA 3MCVA 1G8HA 2WHYA 4X1IB 1SEPA 1F5NA 1RM4A 4LX8A 4W1RA 5CAEB 2G7ZA 1LW6E 2YCBA 1KE1A 1UM9A 1P0FA 1NZJA 2ZSIA 5JMOA 1YE3A 5M5BA 4NPHA 4QU5A 4A8TA 1ONBA 3P9XA 3A06A 3L8FA 3LV8A 2FMUA 3TPFA 4LFAB 5DXFA 4YJ2B 1QCYA 2C5FA 1RCFA 1UMBB 5AVXA 1MAWA 3GPBA 3AY0A 1VJ5A 3GBVA 1GA4A 5KKNB 2IZZA 4URFA 3GLFE 2RGYA 1SBHA 3UOAB 4KYTA 3CLRC 3OOYA 3DKVA 4PTLA 2PLRA 2CFSA 2J32A 3KL4A 4TV8A 5AJTA 3TOVA 1J2RA 1UOEA 1CXZA 3N1UA 4EQ6A 4LN1A 3MJFA 4A92A 4ZYZA 3AP2A 4WSOA 3DBHB 5B6PA 1Y3AA 1FQKA 1YKGA 2YMLA 3UG6A 1SZPA 2AJBA 2ZKLA 2P3SA 3WGTA 3SIRA 4C0WA 3TLJA 4ESHA 3ZWQA 1NBMA 3OWXA 4IFEA 2Y1GA 2F00A 2A1UA 5K8IA 3CIOA 4FM9A 2Y2UA 3QF4A 2JLVA 5LBTA 2QQ5A 1GV0A 1U0EA 3DUFB 3AM4A 4OMDA 2XDAA 3THYA 2Z8XA 3CM0A 1K8QA 1D6NA 3IAXA 4QLOA 1JHYA 1Q7CA 3V3TA 3VU0A 4BGDA 2BGWA 3P4XA 3JRWA 4R1LA 4WJKB 3M49A 1DO0A 4B6FA 5LMCA 1ULZA 1EWYA 3IVRA 3M1YA 3S1AA 4HYEA 3SLRA 3WLAA 1IG3A 1M6EX 2H4ZA 4QJBA 4GI5A 1NFRA 2Q4OA 3K70D 5E3HA 1TVCA 1SM4A 1P4SA 2Q0HA 1PGNA 1Q74A 3LGAA 2B9EA 3PNOA 5AKHA 2ZYDA 3QBVA 1TO1E 5DPMA 1XZDA 5E9JA 2E1PA 3AR6A 5AHRA 5A9SB 1GM5A 3I8SA 4PAGA 3RUCA 2E21A 4M60A 3H2SA 4REOA 1P72A 1P5HA 5ICCA 2JAPA 2GO7A 3MWGA 5BNZA 4TV9F 2ZFUA 4EG8A 2EKQA 3K05A 2XKAA 2NUAA 1ID1A 2R7AA 2WWVD 1Z0IA 4J0FA 2ODAA 2PZMA 3IEUA 2DMRA 1D2EA 2JFFA 4L78A 1TQ8A 2XKJE 4ND5A 5DWVA 5B2EA 1PR3A 4J76A 3TZCA 1Z83A 1I7NA 2JC3A 3HYLA 4YCNA 2O06A 3OT1A 1PDVA 4BEBA 1AS3A 1XZHA 1GNTA 4J7AA 3HEAA 1KK0A 3NNNA 1GNQA 4CQLA 3QOWA 1OF1A 3E4CA 2DB3A 4YV7A 3OUTA 5IVPA 2HEIA 1AHIA 4KRFA 5UKDA 2DPHA 1U3GA 1W5SA 3CLTD 1E1YA 2Q2NA 1BDIA 2YYAA 4B32A 4LF7B 2YHIB 3EG5A 5FWYB 4XB2A 1QK4A 2VF5X 3P26A 1TD9A 4MDYA 4BVBA 4JC4A 1NI5A 1PUIA 2QXUA 1SG9A 3DJYA 3FJ1A 2UVPA 2LIVA 4YRKA 3NTOA 3HP1A 3FMIA 3Q2IA 5ULLA 1FU7A 3DR3A 3L7BA 1OGJA 3ENVA 1ESCA 2A84A 2VPXA 5CW2A 5KDLA 5HR5A 3WIUA 3OMWA 1ECLA 1HFEL 2YJ5A 4BYMA 4V39A 4YT4A 4W7IA 1EJBA 5A71A 1OGYA 1LSUA 5THKA 1ESDA 3K2EA 3W1WA 1YZGA 2DERA 1CUIA 4MRMB 1VLZA 2WD8A 5GVRA 4BEJA 2EW2A 4PNZA 2O0JA 1P1CA 1MO2A 2VTVA 4U0KA 1OLOA 1OHHD 2HWYA 2XJ9A 3KPVA 2UYCA 3BHMA 1CFJA 3KM0A 1HH4A 2A5LA 3FNRA 2OHIA 3GP5A 4XRRA 3UH0A 1PFUA 4S2UA 2H65A 2YHAA 4RCVA 3NWOA 4NCNA 4ZVVA 1W6RA 3ETCA 1PI3A 2C97A 4DWVA 1UMCB 5CDTA 3ZGZA 1HFWA 1K5DA 2AG6A 2JNWA 2X2FA 2NSYA 2RHMA 3QTLA 3P9QA 5J2TB 3KTAA 2YDXA 1ZP6A 2CV0A 2EC5A 4XGKA 2QVLA 2YZKA 5ER6A 5LCXA 3TQCA 4AX4A 2QYTA 4J0DA 1E3LA 4JJ8A 3I6MA 1G3RA 4MB6A 1U11A 3CSUA 3IALA 3LZDA 2OY0A 2PGDA 3IVGA 3Q8XB 4ZVNA 4DSNA 1T9KA 3CB2A 1I4DD 2O8VA 2OAGA 2DWQA 2OAEA 2FW7A 2C2OA 3BE8A 4LV6A 3DV9A 4R9UC 1Z0ZA 1KE2A 1NW6A 1CS0B 2A59A 2ZB2A 3JATB 3EC7A 4BP8A 4TL6A 5KQGA 3ZLJA 3D2BA 3B60A 3C3PA 3U9TA 2XNDD 1VGVA 2E2WA 4Q47A 2QJFA 2WU3A 1IDOA 4MARA 4X7MA 3BXOA 4R3UC 5IN4A 2XVYA 3KXKA 4TMXA 5BN5A 1OFTA 2FDCA 2Y76A 3NG1A 2QTLA 4CEIA 1NP6A 1A8HA 3GF4A 1BE8A 4FDAA 1P2GA 1V1RB 3SFZA 3RVOA 4BRZA 3JD2A 1ZBDA 2I66A 2P0AA 3HB0A 1DIHA 3N07A 5K2OA 3I2KA 1UPTA 1UADA 2I87A 3R7AA 1GZVA 4CUKA 2ZAGA 1NQAO 3DO5A 2FJUA 3HYCA 2OBFA 4I8DA 1N8TA 4BZXA 2BPOA 2K2QB 4PZAA 4M1SA 1GT91 1AVTA 3GFTA 3FCAA 4HS9A 3C1TA 4ZALA 4ZAWA 3OTWA 4GBMA 5FL3A 1LK7A 4AN0A 2CLSA 2JZCA 1B8NA 4LOIA 4BMPB 1FFBA 1SOMA 4LRYA 4AJNA 5BSFA 4CM9A 1ZIOA 1Z73A 1Z36A 4INOA 5KNLA 4DLTA 5BV1A 5EJ8A 1E2PA 2ZZNA 2V98A 1P1RA 2BCJQ 2DUUA 1YOBA 4BN0A 3O8OA 1Z4KA 4ZOAA 1X1EA 4XJSA 2ZEJA 3BHIA 3U3XA 4KLCA 4WV3A 1Z33A 2JHAA 2X5KO 4P53A 4QXPA 1JEQB 2ZBQA 3D31A 4JR2A 4KPFC 3UK0A 1Z82A 3PC3A 3HLTA 4HB2A 5KYUA 3W2EA 4DADA 1U31A 1RLOA 5IXYA 1HMPA 3UWOA 4QKQA 1U9JA 4LJRA 2B0CA 4Q9IA 4B40A 2CWWA 5LUAA 1GKLA 4IXTA 1VTKA 2EAUA 3AB7A 1K8RA 1OFVA 4MS1B 5IC6A 4N54A 3SQXA 3CR7A 1POWA 1KL7A 4P32A 1XQXA 2QQ0A 3BCHA 4YA6A 4XYLA 5DBIA 1IU9A 3CEAA 3JPWA 4QDOA 1D6JA 4L73A 3T7TA 3E5RA 2ZRKA 3K3PA 4HGZA 5B5SA 2YN0A 2G0AA 3SGLA 3H5NA 5GONF 1P1BA 2YNMC 3ASYA 1Y3FE 3ZE6A 4BFTA 1VMIA 3X1KA 2QVXX 1Y42X 2VJDA 1NN1A 3C87A 3HE3A 3JQ6A 3ND8A 4IL5A 1WOYA 2FEWB 3DSRA 4X3CA 3TPZA 3UY4A 4JBHA 1Z6AA 3H11B 4RGVA 5AW9A 1FLAA 4GE0A 4IS3A 1U28C 5KHAA 1ESNA 4RUKA 3O47A 4UZFA 1Q0SA 2XVMA 2VAXA 3UK2A 1J00A 4MZDA 3LZ6A 1KP9A 3UC5A 4CMEC 5D3KA 2IU4A 1ZINA 2OC4A 1E89A 3R5XA 1A96A 4F0JA 4OF4A 3FLMA 3R44A 1YR6A 1RAHA 3HO6A 4G0XA 2VWGA 2A7QA 4B7CA 3PLNA 1Y4AE 1VQ1A 3MERA 1NF9A 1CVIA 2CFCA 3WYDA 4WK6A 4EA7A 3PIDA 2ZUEA 2HU2A 1LSJA 4ALNA 2JG3A 1GCOA 3DZBA 3O2QB 4RJJA 4YFVA 2QPLA 5CRIA 3RQSA 3B38A 1DQNA 1PG0A 2NU6B 4I6GA 4WH0A 3VR3D 3URMA 1XC7A 2QMYA 3AWIA 4DJ5X 1PNRA 1JHDA 5IAGA 3U16A 2FJ0A 2CNDA 3P9RA 4C4AA 3W5UA 4XUDA 1BFUA 3ZDEA 4KFCA 4QSHA 2ZTMA 3EXIA 1WM1A 1FDRA 4CKBA 4JMPA 1TGVA 3KT6A 1UQUA 3PX2A 4NQZA 1QP0A 3ASZA 2CLLB 2OZVA 2L42A 4TYYA 1ZITA 2P75A 4X7PA 3E9CA 3OH8A 5FUBA 1BE6A 3OMLA 1EEXB 2BFOA 2VUUA 3C14C 2ID8A 1V4NA 3HA2A 3I72A 1UBGA 4V0KA 4LQLA 4HJXA 3MG9A 3ROZA 5JCPA 3TM5A 1BGXT 4MRPA 4UDNA 1H6BA 3I61A 2VXYA 4KQ2A 1O94C 1XCPA 4QBIA 4M7PA 2M6LA 3W04A 3IA7A 1FDSA 4D3SA 4EFLA 2XKKA 1KQGA 5EZYB 1CEQA 1KC1A 4EYSA 3BRWA 1DOZA 1E62A 3STUA 1U9IC 3IIEA 3WGVA 5JSZB 2R96A 1JHQA 1R1DA 1VIDA 1NNLA 3H42B 5C7YA 4IGEA 4RJTA 1G7TA 2HMSA 4OH7A 4HNVA 1KXZA 1RYYA 1VCOA 4X64B 4KQ9A 4NOMA 1HORA 2XZOA 5DK6A 3ZI7A 2OVBA 5K20A 2VP4A 1I3MA 3HFGA 1UJ5A 1ETHA 1T8TA 2HJWA 3TDKA 2RCNA 2AK3A 2F64A 3VQTA 2I6GA 3NONA 3HEMA 3QBDA 1A76A 4PN3A 2VNHA 4HDOB 1E7RA 2JJ8A 3G8DA 4BNHA 4HH0A 2QKYA 1Y8CA 1YXMA 2A9PA 1ZUNB 1C7FA 1E1CB 1I5OA 2EW8A 2R1VA 3ZWVA 1NR5A 4B80A 4DXAA 1YNOA 4OGFA 2O7RA 1N92A 3GWZA 4MNTA 4D3YA 4QLBA 3ZDAA 4BNKA 4RMHA 3T12A 1QQBA 4AN4A 4KCGA 2COUA 2KLBA 4DVJA 1Z68A 3GEPA 4LXIA 4EBBA 4ER0A 1XCJA 3SEFA 4OHMA 3D6NB 3T3NA 5EGSA 2ZJOA 3A37A 4WK2B 2G76A 1YZLA 3D9QX 2AYXA 3OOHA 3UV7A 3WP1B 5BWOA 4HQRA 5H3HA 3KELA 4Q01A 5L7WA 1B26A 3A70A 3A3YA 3BVPA 3CGGA 4M0CA 2IU0A 3VPFA 2G4LA 4NSNA 1RLJA 3HCWA 1CUHA 1VCHA 1X6VA 2D3TA 4ND7A 4U2FA 4A82A 1CKEA 1B00A 1WMSA 2JD1A 1SOAA 3Q10A 5AHKA 5L95A 4J1NA 3IAUA 1H9CA 1PG2A 1X7ZA 4JEMA 3AT1A 1U04A 4FXPA 4OYLA 3TOZA 3PENA 2JGAA 2P6PA 3V80A 3DFZA 2WLSA 5BT8A 3B3QA 5JFOA 3ND9A 3RASA 2KM1A 2IZ7A 3C8DA 1AUPA 3CEJA 3UMRA 1PSDA 4US0R 4FDVA 2OQRA 2IX9A 3WNCA 2FW9A 2VJNA 4GX2A 4JU9A 4C0AC 5IBCA 4P8RA 3IQIX 2HPHA 1LI5A 3PHHA 3KKQA 4K46A 3G8BA 3O8OB 4XVCA 2BM8A 4IDBA 2YHBA 4DIMA 5DHUA 3HC7A 1T3SA 4C4OA 1J2EA 1E4EA 1G5QA 3AB3A 4EWLA 3AY3A 3D8BA 1R4NA 2C0QA 2QN9A 3NAGA 2EFYA 3HL4A 3KYIB 1EM6A 2M98A 2QTRA 2XUKA 4JUDX 1YS9A 3IEIA 3VMFA 3KL2A 2G4VA 3RVDA 3BORA 2J5RA 4FYJA 3WHIA 4Y2SA 1EE2A 2V96A 2Y0BA 1IK4A 1R8YA 3GUHA 5GADl 1N5LA 1XYYA 2CJFA 3MB5A 4OHZA 3I5AA 3U4GA 1PT8A 5HS4A 1F8XA 1NT2A 1AQ6A 3QKRB 4MP6A 3WJ1A 4DMRA 3T5PA 1O54A 2O8FB 1G2OA 1IZ8A 1HM5A 1IDN1 1IM5A 4X94A 2B5WA 3ZHUA 3ZDXB 2M6SA 4RBNA 3KKPA 3MPUA 2WMOB 1XDZA 3ORRA 2IYRA 3PFNA 4BNYA 3CRMA 3DOOA 1C7QA 1YL6A 4U1RA 4INPA 1MEOA 3TGLA 5GIOE 2EFCB 5FJIA 4MI1A 2UYQA 4Y6GB 4DDWA 3CLUC 5DFAA 1OJ7A 3FWPA 2C4HA 4U2CA 3H9CA 3SC2A 5BSKA 1G8SA 2BGNA 3FWNA 1WMBA 4MKHA 2ZAOA 3CB4A 3AXTA 3PDHA 1YIAA 3CUWA 1U3VA 4FPXA 3A32A 4IIXA 4PYLA 4NU5A 4WL0A 3V8RA 1FP6A 2PQ6A 4HB3A 5TGTA 2RBEA 2P4QA 1OKKD 1XIVA 3DYVA 5AESA 2GPNA 2OE2A 3FGNA 3KYDB 4RDHA 4TRRA 4WKPA 4M89A 2VJLA 1ZHOA 1DQPA 3OZVA 4JI5B 2HMYB 6YASA 3VDNB 3NVAA 2VTKA 4ZWNA 1U8UA 5ERGB 2G06A 3KHKA 4JI4B 2YVAA 4HN2A 3CUEF 1B73A 1K7SN 3HXTA 2GPWA 2BGLA 1NIPA 1Q22A 2BL4A 3GFSA 1Y33E 4MEBA 4W5NA 1PT6A 4MYSA 3LIPA 4AMGA 2OV4A 3MJDA 3NANA 1MTOA 3CCCA 4IUCS 5ITSA 4F2WA 3CZMA 4RFSA 4IVQA 2D1FA 4RVOA 3I4LA 4N7BA 2HMWA 4YRFA 1R9GA 3M5DA 4Q16A 2G63A 3NHMA 1Y9JA 2WD9A 4UHEA 3WXMA 5F2EA 3UJDA 2QIOA 4EA8A 1XMVA 5L7TA 1RQGA 1QMGA 2XDQB 5B58T 1W94A 2FSVC 3THSA 4JLWA 4UM7A 1H2YA 1NYTA 2MYTA 3GLHB 2RB5A 4FU0A 1YE5A 2OORA 4B35A 2JK0A 2ZSFA 4ZYTA 3D2AA 3BUSA 2V9PA 4TWBA 3VR5H 1RQNA 4DSTA 3MJEA 3QVKA 4P7KA 2W2PA 5LNK1 1X7WA 2CLOB 2GFHA 1E18A 2GPSA 1HDOA 3A9TA 1UH5A 4RKWA 5F23A 1V4VA 3EDOA 1TIBA 4Q3NA 5GOZA 2ZYRA 2PLNA 2GUWA 3RR2A 2YV5A 3BL6A 4XRGA 2ORVA 4ED9A 4F3YA 4Z3KA 1ORTA 1OX4B 3JVUA 4YP1A 4EJMA 4DQKA 4GI7A 1DIBA 1BIFA 1FNMA 3LD9A 4H4CA 3AOEA 2ZAIA 2JHPA 2EZTA 4JR0A 4R8VA 3QW2A 5AI4A 1JDNA 4OXIA 5CBPB 1ULBA 3RJ9A 1GQRA 4QARA 3GEEA 1FNNA 2J9FA 2AOUA 4XASA 4XWAA 4YRJA 4GKJB 4J3JA 5AVSA 3FYUC 3QU7A 3ILHA 5KQSA 1VRWA 5G40A 3B52X 1YDFA 4G1VA 4KPGA 4JT8A 2Q4EA 1A50B 5FOVA 2N3ZA 2ZYIA 4W5TA 3GVXA 1GLGA 3T4EA 3CUVA 2O2GA 2OLEA 3KG2A 2QYSA 1LX6A 4A03A 1CQIB 1ZWKA 3FM9A 4NCBA 4MWTA 3R8CA 2JFHA 4FMDF 2EYQA 2BGRA 3BGOS 3WYFA 4TXNA 2I9KA 3PNKA 2Q62A 4DIUA 2CMFA 2Z43A 3MWEA 4RFLA 3RU9A 3QKSB 3RHSA 1NC1A 3DNMA 2HH9A 4F4HA 3OESA 2X1LA 1V35A 2JFUA 1DWPA 2AMFA 3HU2A 5DBHX 1XEWY 1Z4MA 3ORQA 2ZLBA 4Q66C 2IKSA 4A10A 3ZBUA 3F8TA 1FMFA 2XNKA 2ZSDA 1I0ZA 1OBVA 3DEJA 4PO9A 5IC5A 1FSSA 4F2DA 1MJ5A 1QGUB 3FWHA 3E70C 4EGAA 5EWLA 3E7FA 1Z26A 1UXJA 4A9AA 4V1CI 4ZV7A 3ZNPA 1Z0FA 2R86A 3F4BA 5KHLB 6CHYA 1Y63A 1ZUWA 2A67A 2C2WA 2GMWA 3RC3A 3U7HB 1YA8A 4PC3A 4RWEA 3LOUA 4AB1A 2XOKD 1GPDG 3CX3A 3P27A 1FP4B 1ZIDA 1CUYA 2WE7A 2WOJA 5TGDA 2C31A 3G49A 2C83A 4JEUA 3PFCA 1NRJB 5L3SA 2IVZA 5LD2C 4M1TA 4G89A 4HX5A 4M7OA 3QU4A 2IEIA 1AQLA 3TKYA 1ZZEA 1AG9A 3EQ8A 3GGOA 4G1MB 3ME5A 4E1BA 3VC7A 4W8OA 3UJPA 1CNEA 1ODCA 4L22A 3OE1A 3TI7A 3RK4A 4E5NA 2CK3A 5LYYA 4A5SA 1YZNA 2BFFB 1PR0A 2B4AA 4V0NA 4LXTA 1GPKA 3LUHA 2Q5LA 3Q88A 2J45A 3H2HA 3TFOA 3IQDB 2Y0EA 4KE7A 1Y8AA 2Q29A 2XNSA 5BQOA 1BCRB 1F20A 5AK6A 5CVTA 3TINA 4E4YA 1PEYA 2RI1A 4HEQA 1E2EA 4TMWA 2V0NA 4RA6B 2QU7A 3RBVA 3UT0A 3KR1A 1C7JA 1VIMA 2HHAA 1TUGA 5CP8A 4AUKA 5EFOA 2QD5A 1TF5A 1XNHA 1X7HA 2LBPA 2GAFA 3O91A 4HNAB 4LVCA 2Z5VA 4HNUA 1NY6A 1H8ED 2Y93A 4ZKDA 3FPFA 2F9FA 2O3TA 3DB1A 3CZ5A 3HG7A 1F60A 1NJSA 1VHJA 3TD6A 4XGIA 2NQ2C 1XRJA 4RELA 1T2AA 3JZDA 1PTJC 4OH1A 3IOMA 1U9ZA 3A04A 3C5CA 2FPKA 5EP3A 3RREA 3K9BA 2QWXA 1PWEA 3VU9B 3QLVA 1YI0A 1YBMA 3N2IA 2O07A 5DASA 2A9JA 3WNDA 1X86B 4OK3A 5IZ4A 2AR7A 4FNAA 1U5BB 4CKXA 721PA 4OIFA 1CE8A 1TUBA 2X40A 4TS1A 3L8EA 1XEAA 5JD5A 2EQBA 3QIAA 2V65A 3CH6A 4LZPA 4HWRA 1SUEA 1P4AA 3IV9A 2W6MA 4KWIA 5FTWA 4BAZA 4JUFA 1UF9A 4JYPA 4KWEA 1OLXA 1Y3HA 2RDMA 1SRRA 3RVKA 3SM9A 4H1HA 4D9GA 4L4ZA 2Q4RA 5FI3A 3PHBE 2P2ZA 3QQ5A 1JZTA 2ODNA 2ACKA 3RKRA 1AMUA 2AXQA 2V0GA 1E79D 2ZE5A 4Q4JB 1WB5A 3HXPA 3USZA 4ZV4A 4QG3A 3PX7A 2QJRA 5HRUA 3WLLA 1WLYA 3EXFA 1ISIA 1KFCB 2QAJA 3KLMX 2XDQA 1RJ9B 5KS2A 2RD2A 1DJQA 2CVQA 1FUIA 3G3EA 1FDUA 1M6HA 4KK3A 4DIKA 3WDLA 3SOZA 3LQ4A 5JAPA 1B0PA 2C3OA 4QBKA 1U8ZA 5LP6B 3DAHA 2XGSA 3JQ9A 1U7WA 4IOKA 2WZCA 5BYKA 3D8NA 3QBJA 1LVGA 1AMNA 4KXNA 4K81B 1G0OA 2LKCA 1JLLB 1LKZA 1JLRA 2ENUA 4I50A 4OJYA 2P2YA 3FSGA 1W25A 4YRPA 1QYCA 3U81A 2CJWB 1G64A 2FFBA 1A4IA 2PGXA 1PJ8A 4IV5A 2PUEA 3ENWA 5DOVA 4QOEA 3BILA 2GR9A 5JAMA 2ZJ3A 1YS1X 3FDZB 3G68A 1SC6A 3OLXA 3Q9SA 1QG4A 2FF5A 3MSXA 1XRPA 3S5UA 5CEFA 3U56A 3Q3JB 4GKAA 4JI1B 1UPBA 1M2WA 1EP3B 3Q0TA 4NZOA 3WAKA 4UCXA 1WP9A 4X90A 4Z54A 3RG2A 3N8HA 3LY8A 4M53A 1EK6A 4DMKA 5I48A 4HLDA 1QVAA 2FE1A 2EDAA 2HC9A 3AEYA 1B42A 3BXFA 2HU7A 4YONB 1H93A 4BO5A 4F6CA 5BNWA 5C46F 5BQ5A 2BEUA 2HZ7A 2HYDA 3RC1A 3ZVLA 2R7KA 4PRYA 5E4TA 1E4VA 2VJKA 4OGKA 4LZAA 3L0SA 2WB4A 3VV3A 1E2NA 1V16B 2JATA 2MDTA 4B33A 3LBHA 2VRBA 2I2BA 3C45A 3H19A 2ZI4A 4PPFA 1A97A 5IMSA 5L45A 4RD1A 3R3VA 4EHJA 1FVXA 1ATZA 3JALB 4JB8A 4M55A 3UGJA 2V8BA 1D1PA 1EK0A 2E9SA 1V11B 2D2EA 4E5PA 1C1HA 2HSGA 2FU5C 1P39A 3RIHA 3BK7A 3C4VA 5C8YF 1MH9A 1HE2A 1Z08A 4H0CA 4S3MA 3W7VA 2E5FA 3BHJA 4IG4A 3ZDQA 4ZCIA 1C9NA 1XU4A 2AN1A 2VDNB 3CXUA 3W3AA 1U0GA 3RE1A 3SD7A 4DOMA 3SBDA 4WCFC 1Y37A 5ELXA 3IAS6 3BCRA 2WMNB 4MCAA 5FPPA 3RROA 4ARSA 1VKOA 4YC7A 2PDAA 5SV2A 3HUTA 4IHJA 4IIJA 1DUVG 3F1KA 1RHJA 1QORA 4K3VA 2QAGA 5MFZA 5HJ7A 5GPBA 3ERCA 4NS1A 5HWSA 1ADBA 4L1KA 3VR0A 1LDNA 1EJ2A 2BFEA 2F8TA 1B0ZA 1TM5E 3A4IA 5FWDA 1XZ8A 4EEKA 4NBSA 3WLJA 3U4DA 1VFNA 5BMOA 1EI9A 3EXG2 5BSVA 4J03A 1XMPA 2ZIXA 3G7NA 4PZUA 3GJQA 1ZCAA 2AOTB 2YV4A 4HLQB 2FF7A 3AGQA 3GT0A 3LUKA 4PRKA 4OQ4A 1EKXA 4C88A 4E5YA 3PFGA 1LK0A 2NUPA 4TWZA 1X1TA 4ENSA 3TLMA 1LF5A 4ZAGA 4ZVLA 4S1VA 3RDPA 2AH5A 5ARBA 4IS2A 3KV1A 3GGJA 2O8FA 1EAMA 3CZ9A 2IXFA 1MN6A 1M54A 4Z8XA 1F3OA 2OOSA 4AWAA 5LJIA 2NAPA 2Y9PB 3N5CA 3ZV6A 3ELDA 3QJ5A 3L6RA 3C8MA 4I55A 5WRFA 2WD7B 3TLKA 2D62A 1ISGA 4DQ0A 1G21A 2G6BA 4K9OA 4DDTA 2H6EA 5JD3A 2QNBA 3AY6A 2UU9B 2VZEA 4PZ9A 3V55A 2PMEA 4J7CA 3FZEA 3JWHA 4NG5A 1RLIA 5K8VA 4UPVA 1Z7GA 1YS4A 1JMVA 5GGYA 1GRNA 3RAJA 1JVNA 3KVVA 5DYNA 5L4NA 1VE7A 3OT4A 4KPUB 2LE0A 3LUJA 3UW1A 4X7RA 1MIOA 4OA8A 4OKIA 3M6UA 1KJZA 5FBHA 4U5XA 4WECA 3BGDA 3M4NA 4BVHA 4I1PA 1ZCBA 3CX7A 3D4PA 4WXPA 3A27A 3LYAA 3GQVA 4WWHA 1ST2A 1U98A 3DDUA 4AO6A 5FA5A 2SNIE 3I5MA 1JJBA 1ZD5A 4IFTA 4RAOA 3HDJA 4BV3A 1ATIA 2ZM5A 1WULS 1RAAA 4QTZA 1GKUB 1AKWA 2N47A 5CGQB 2NUPB 5C1OA 4RTSA 3NHSA 4EH1A 5C35A 4W5WA 1DBVO 3GT4A 4BFXA 1XTQA 4FZJA 3C39A 3F8SA 3HCEA 2VAWA 5ICFA 4PLCA 1J09A 3I58A 2ZW9A 2XMRA 3ESBA 2E7ZA 2AS0A 5ESWA 4Z7OB 3UT6A 3O4GA 1EWTA 2JGDA 4E3WA 1T9BA 4FHCA 3RYCA 4LHYA 3H4MA 1NVAA 1YBFA 3M6VA 3QXGA 1HYQA 2ORYA 3KOWA 4Q12A 5IJAA 1OROA 3T0IA 4CKYA 4DWWA 4BFVA 1AB6A 3MAAC 2D1YA 1GG9A 3BREA 3IP8A 3GOHA 1XFDA 5JJBA 4OLJA 1W1IA 2B20A 3BMQA 4DNPA 3G8AA 1D2CA 1X0VA 2PS9A 5AUQA 5K1ZA 2EJTA 4BB0A 4QXRA 3LDGA 3K1ZA 2PRYA 1T29A 3VAYA 2F1IA 1U9YA 4JUAA 5DRYA 4D0RA 4N5DA 1JGTA 2YYZA 4NMWA 1G5RA 3OT5A 1TAQA 4K6OA 4TYMA 1IVYA 5COAA 3L0IB 4OM8A 4HRVA 3V4FA 4E21A 2F4VB 5TC4A 4ZAXA 1B43A 4KVFA 2RBKA 1EFVA 2IUUA 1TEVA 2IU3A 1A8UA 3BB4A 4EKIA 3H5TA 2RHDA 1K0FA 3B36A 3RVLA 2DFLA 1UDCA 2A0UA 5D00A 3Q6IA 3G23A 4AYXA 3PQ6A 1B23P 3T4PA 4R69A 2Z4SA 1XPOA 3T1OA 4MYHA 4JBXA 1G20A 2YQZA 4ZRNA 5FPSA 2WG2A 1W9HA 1UEXC 2J9RA 2Q41A 3OY7A 1ZSNA 1AOXA 2JS7A 1XU9A 1WBDA 4PF1A 2NPOA 1JG4A 2BEUB 3AIKA 2ZIFA 5F1YA 1QTQA 1FFHA 2Z6QA 4H1TA 1WPXA 5E1MA 5EC8A 4D4JA 4D92A 3DHYA 3CT4A 2O52A 1SMKA 1PUXA