1SKBA

Crystallographic snapshots of aspergillus fumigatus phytase revealing its enzymatic dynamics
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
435
structure length
435
Chain Sequence
CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRHGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKALARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVARTSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKELDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-phytase A
publication title Crystallographic Snapshots of Aspergillus fumigatus Phytase, Revealing Its Enzymatic Dynamics
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Hydrolase
total genus 156
structure length 435
sequence length 435
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1skbA01
1C81A 1FBTA 1SK8A 4FDTA 4ARVA 3K4PA 2F90A 1QWOA 1UJCA 1UJBA 2P77A 3DCYA 3F2IA 4JOCA 4GPIB 1C7ZA 1E58A 2RFLA 2I1VB 2WNHA 2IKQA 4AROA 2WNIA 4QIHA 2HPAA 1YFKA 4TSRA 1DKPA 3R7AA 5AK0A 1DKLA 1DKQA 1YJXA 4IJ6A 2P2ZA 2EKZA 5HTKA 5PGMA 5AJXA 3NFYA 2HHJA 3DB1A 5CDHA 3QPWA 1T8PA 2EKBA 2H4XA 2P9YA 4PZAA 4D4JA 3LL4A 2EOAA 3E9CA 3KKKA 4PZ9A 3HJGA 3MBKA 3NTLA 1NT4A 2YN0A 3IT2A 1RPTA 3EOZA 1H2FA 1V7QA 4PGMA 1QHFA 3D8HA 3QPUA 2P30A 3MXOA 5CU7A 5HR5A 2OWEA 4JOBA 1BQ4A 4E3WA 4MA4A 3F3KA 3FJYA 3EZNA 2QNIA 1FZTA 3IT3A 3IT0A 1H2EA 1QFXA 1SKBA 1RIIA 3D6AA 3OI7A 5AJZA 3D4IA 1RPAA 3LNTA 3E9DA 1XQ9A 1C80A 1SKAA 2ENWA 3GP5A 1EBBA 4JODA 3O0TA 3FDZB 4D4LA 2A6PA 2BIFA 1DKOA 1V37A 4IJ5A 2DWPA 2HIAA 1BQ3A 1K6MA 3GP3A 5AJYA 5AJVB 2P9FA 2H0QA 2WU0A 2ENUA 1IHPA 2OWDA 2H52A 3K4QA 4ARUA 3ZHCA 2P2YA 5AJWA 2P75A 1SK9A 2AXNA 2P79A 4ODIA 3FDZA 4EMBA 2P78A 2P9ZA 3BIFA 3GW8A 3PGMA 2PA0A 2GFIA 2H4ZA 1E59A 1CVIA 4ARSA 3E9EA 3IT1A 1ND5A 2A9JA 3LG2A 4FDUA 1ND6A 1DKMA 4D4MA 4D4KA 4EO9A 2YN2A 2DWOA 4GPZA 5CX4A 4HBZA 1DKNA 2P6OA 3C7TA 1BIFA 2P6MA 1TIPA 3QPVA
chains in the Genus database with same CATH superfamily
1ZUD1 3DE3X 2WSYB 4DEVA 2C0PA 2Q9UA 4CG3A 4OMDA 3K9QO 3CS3A 4YRKA 3DZBA 4URUR 1U8AA 2J30A 3G2OA 1VIDA 4CGZA 3L6OO 1CY0A 3V2IA 4EH1A 3K09C 3ZV6A 2NPFA 1WDLA 2NLOA 1ZX1A 1GNVA 4TQUS 2GBPA 2UYYA 5KVCA 4IIJA 4FGUA 1N2XA 1ZM4A 1WBDA 1RPZA 3IPRA 4DPLA 2WF6A 4HB4A 4WBNF 1R00A 1CTQA 3BXOA 1G9TA 3GWGA 4JBYA 3WYEA 4ABTA 4GE0A 1U7WA 4R2LA 3OETA 5CA0F 3SVLA 1W4LA 3TO5A 1AKYA 1UH5A 1A1SA 5K03A 1OGJA 1D3AA 3RVSA 1G98A 1X19A 2Q1UA 2FWRA 3SX0A 1VPVA 2ZJ8A 3WIEA 1RM3A 1E79D 2QYTA 2OKCA 3D4OA 2QEQA 3QQ5A 4V0ME 4OB6A 4RF5A 2QPTA 1IBMB 3DMRA 1PJ2A 2YFHA 1JU3A 2YZ7A 2Y4NA 4ZYWA 5BNWA 5JEDA 5LZ9A 1NQUA 1XXLA 3DR3A 4YI5A 1UP6A 2F3RA 3K8QA 4U7WA 1RACA 1Q3KA 1T9ZA 5BUZA 5ISMA 1EEHA 1DINA 3TINA 5LMZA 2Y2UA 3J7AC 3HY4A 4M9RA 1E4EA 2HCBA 1PT7A 1QKIA 3NVAA 2VT7A 1JEEA 3LDAA 4Q39A 1NVTA 5BNFA 1DWUA 5EWMB 1MRNA 1QRAA 4KN5A 5GONB 2VDWB 3V4VB 4CL8A 4DCCA 3VNUA 3K8OE 4ZAFA 1GO2A 4PYMA 2FQ1A 2NO7A 3FZGA 4EGSA 1MC5A 3EW9A 4GM1A 3BDVA 3LI2A 3FROA 3AVTA 2NSJA 2Z5LA 3N0XA 5LB4A 2JGAA 3PJDA 1T5HX 1KBQA 1IQRA 1HL7A 1XU7A 3TDKA 5FUMA 3FGPA 5KNCH 5EUBA 3RC7A 3QI2A 2F1KA 4HQFA 3K1ZA 1GTMA 2FWNA 4DA7A 4EIWA 4IGIA 4GG1A 1RPNA 1KAQA 3L1JA 3LHKA 3CZQA 5P8WA 2AQKA 1Z39A 1ZOLA 3BFJA 4NFYA 1RRMA 4BDTA 4C1BA 2V7WA 4YJ2A 5JARA 1M2KA 4R1SA 1KHTA 3VPGA 2GNAA 2SCUA 1U1EA 1VKZA 1Y80A 4EHAA 3AZPA 3T5AA 1T6YA 2FSSA 1BX1A 2P6NA 4Z1OA 2I9KA 3DEJA 5CVUA 1EWVA 3D31A 5AT1A 3PPXA 4LXYA 4EPWA 4PXSA 1GD1O 3C3MA 2C2BA 3HMQA 2W2VA 2YHIB 3G5TA 4MLDA 1CCWA 4Q05A 4RM3A 4XYGA 3R8XA 3NIWA 4JCCA 3D6JA 2D5AA 2WOOA 2I6UA 5JQGB 4GUAA 2ZBGA 3K20A 1BGXT 4KQXA 4TWRA 3C70A 3REQA 1YNSA 2I80A 2OSBA 1IBRA 5CFOA 2C29D 3COPA 1NDUA 1KO1A 1ONSA 1R0WA 2GBLC 4YCJA 4BNVA 3ZWVA 3ZLJA 1IXYA 2RSLA 1MA3A 5DSTA 1HRKA 4F2GA 4NQZA 2Y0PA 3GZTB 1TAGA 5DMXA 4C3UA 1G41A 2ZRLA 1T9CA 3LFUA 3DXZA 2E4VA 1OYOA 1M6VA 4JB2A 1SCDA 2OHIA 3QMMA 4G5GA 3RT1A 3U6KA 1K6JA 2O2XA 2R1UA 3JWPA 4LE1A 4JYAB 2JBWA 4H1UA 1H4TA 3NTUA 2PKQP 1AGXA 4LBYA 4QODA 2A9KA 3OT1A 1QRRA 2F9MA 2VHEA 3ZWBA 3VM6A 3PNQA 1FFGA 3SCZA 3T7EA 3VVCA 1Q57A 3B1FA 3C98A 3MUNA 4WY5A 4Y9SA 4AIRA 1E64A 4MPRA 3DF7A 1Z5WA 1TTTA 3EF1A 2OP1A 3DC7A 4D99A 1Y1LA 2OUIA 3IHKA 1F6BA 3ESZA 5I7AA 5DCYA 2FXIA 1HDZA 4RCZA 2XGJA 5DHRA 1YQUA 2Z9BA 3WB2A 4FFRA 1FY2A 1SBCA 1N5MA 2VDKB 3H42B 1GQFA 5CD9A 5FUBA 5D86A 1SBTA 3PC8A 3JQGB 3H87A 4QRHA 2GA9A 2VTDA 4OOFA 4Q1EA 4TV9A 1SHTX 3G5LA 4Q9HA 4AJJA 4F93B 5HKKD 4NZNA 4Q1FA 3EHDA 1A1VA 1QF7A 1JB9A 3GI1A 4LZJA 4UZEA 3GFPA 1PK8A 1SUEA 3P7MA 3ZZUA 3UKOA 5BWNA 3NH9A 4NONA 4E3WA 4F5EA 2YWHA 3QVWA 1PD0A 3FJYA 2ODPA 3W1VA 3EDCA 1ORDA 2WUDA 1DV1A 4J7AA 2Q6VA 3AVQA 1X13A 2FP4A 2CN1A 4NV1A 4O3FA 3JD1A 2GCOA 1E7QA 2CLEB 3KSUA 2PRKA 4FGZA 4NENA 4MYCA 3RBAA 3HA5A 1LUAA 3RR2A 5HKAA 1DRJA 3FHTA 4M7PA 1TW3A 2DUWA 3E3MA 4LC0A 4QHSA 5DX0A 3U48A 4LJ4A 5EJ6A 4LKOA 4NYMQ 2JRCA 2OVFA 3ILSA 4O2BF 3SJCA 1DKOA 1DADA 2PH7A 2FR8C 3CHYA 2YCBA 4B2YA 5LQDA 3HP7A 1EXMA 4HRAA 4PYJA 2FLVA 3AHDA 4FHCA 4KQHA 5FPPA 5JSKA 2B4AA 3UT0A 1U2RA 5AJVB 2DCMA 1VE7A 5FJJA 5IN5A 4XVHA 2JFBA 3ZE6A 1YOVA 3U44B 5CEFA 3OX1A 3L84A 1HLDA 3AU9A 5DX1A 5AVQA 4Q5IA 2P2GA 2GT1A 1ZIPA 2YWJA 2FPGB 3OIWA 4JKYA 2VIIA 2A30A 2O4CA 3O5AA 4HX9A 5LP1A 1F2VA 1S9HA 2RIRA 1XCJA 3ZWKA 4P3XA 1ZMRA 1P5FA 1GAEO 1P62B 3PHIA 1NHGA 3H5VA 3L4SO 4AXXA 3B6EA 3ZCQA 3LL7A 3H6KA 5IVHA 1UFOA 2FEAA 3B1WA 3KQTA 2Q3DA 2ZOSA 1H3NA 1OWNA 5C1BA 4QXOA 4YJHB 4E14A 4H3HB 5EJ7A 1WE2A 3GQBA 5F9HA 5LR6A 1WABA 2IDKA 2GPSA 4PO8A 3ZIAD 5M04A 3Q9LA 2ZVJA 5CX4A 1OB5A 2XR1A 4OIFA 2BMEA 1QGAA 3WWEA 2R2GA 2OR3A 3FPAA 5IM4F 4J2TA 4UTPA 1OWPA 3E4DA 3QLUA 1ZGJA 1STOA 4UBMA 5B3JC 1GARA 1XL0A 2PH1A 3BSWA 3GBPA 1JB1A 5HJ5A 1PLKA 1QZ3A 2IZ5A 5DISB 1M2GA 4FQ8A 1WTAA 3H86A 2Q3BA 1UJCA 1EVLA 3AP1A 4MIKA 5G3YA 2JH8A 5B1YA 1PP4A 2R8BA 3MJFA 2PL3A 4JOCA 2G80A 3JZFA 4LXQA 3OOJA 3RTBA 4PFSA 4A0SA 4AJ9A 1M2EA 1C9DB 1E2EA 1LDGA 3R7SA 5GGXA 1YC2A 2WOJA 3QXHA 4QTYA 4Z0TA 4LV5B 2QAGC 2AC7A 4QDKA 1YJXA 1B8UA 1ZIDA 4Y1RB 4XXHA 1AV7A 1E7SA 1A5TA 3E7DA 5AOBA 3PC6A 2YNMD 2ZBFA 2PGLA 5C34B 3G13A 4HADA 2AUTA 5BYBA 3W4JA 4ZYVA 3LBIA 2UYGA 2A1TS 4PZAA 1P1RA 3SYNA 2FA9A 1P7CA 3OX4A 3WKCA 3JXEA 1GTJ1 1U3FA 2YV4A 4P36A 3TYXA 3B1VA 1RWNA 4FXOA 4PBSA 4UBOA 3AILA 1A98A 1VJDA 3LQYA 5TF4A 4ADSG 1PL7A 2IYFA 5JWOA 3DBOB 4ITUA 2AN3A 2JB9A 5KX5F 1T4MA 3EIQA 3OX3A 8ATCA 4TKUA 5BRJA 4YHHB 2RK4A 1OLUB 1QRTA 4FR0A 5IULC 4N1AA 1ZIYA 4FHDA 2H06A 3GRYA 4ZVUA 5FHQA 1S4MA 4N12A 1NBIA 1TUEA 1EVJA 5B1SA 3SSAA 4QQRA 3RREA 2CWDA 2JIDA 4AUNA 4DLLA 221PA 1UT6A 2QA5A 5CAEB 2AZTA 1LNSA 4S12A 4BVJA 4Q03A 4PIVA 1C0LA 3RKRA 3KCNA 3KYDA 4Q4LA 2IIPA 4TTSA 1WVMA 3S44A 2B4RO 5AVZA 4FOTA 2GJKA 3DJYA 3U1TA 2VYND 4HYEA 2P0YA 4X6LA 3V8NA 2JFYA 2IYTA 2F3QA 4JJEA 4HC4A 4QD3A 2O8EB 2N75A 2ZRHA 2BI7A 2VHWA 4ZCRA 4HWPA 2WHRA 2Z0MA 4RPKA 1MFZA 4XIFA 5EEGA 1Q0UA 2YFYA 3MM4A 1A8HA 4G1EB 2VUHB 2AXQA 2VYQA 4PZCA 4TL8A 2F43A 3RNLA 5LXTB 3DXYA 2VRCD 4UOZA 4CEJB 3LKVA 5LOVF 2C2YA 2VAVA 3Q7PA 4XOIA 3EGIA 5THXA 3IBYA 3ERCA 3T4UA 2FW9A 1G6KA 1OBCA 2GBIA 2QMYA 4JVMA 3GMTA 4GGMX 4UU0A 4A2QA 1OXVA 4QZVA 2ZUSA 4ZAWA 1J0BA 4LXUA 3UMBA 1Z0DA 1J8VA 3H5NA 3VR5D 2WHXA 4LN1A 5BMVB 5CG1A 4LMRA 3WY9A 1NJSA 1YOBA 2OXIA 4OHCA 1T4BA 4TSFD 1ZD9A 2IU0A 3WFZA 1P2SA 1G7SA 3UFBA 4V1CB 5EY5B 2GRAA 1DCTA 1AO3A 1ORIA 3HKDB 3HKCB 1VE6A 4LXTA 2AV6A 4OQNA 1G38A 2WT8A 3O8CA 2FSHA 4QFDA 4OFBA 1Y3CE 3IAM6 5ECDA 1T5TA 4OU4A 3IP1A 1QLWA 2R2AA 4ZYTA 3ET4A 2C8JA 3TCKA 4WK0B 3GVCA 4M9UA 2VJOA 1PR3A 3H3XA 4QBGB 4DCPA 1W8DA 1NN0A 2I4LA 2YIJA 3MERA 4LCJA 5IDQA 1HLFA 3CX4A 3FJOA 5A4AA 1KQOA 2ZAIA 4YI3A 4X24A 4C03A 1GHTA 4UAUA 4EKNB 4C0HA 3QNWA 4WN9B 2P41A 3SICE 2OGWA 4JL5A 2BGJA 3W5JA 2WIAA 1UFKA 4II3A 4PLFA 5F5XA 3MAGA 4AX8A 4QXPA 1AUPA 3HQ4O 2HMTA 3CR7A 3DLIA 3NCHA 1RYMA 2BHNA 3NRBA 4M1OA 2QRQA 1WD7A 3C1UA 2OOKA 3IX7A 3JZAA 3AHIA 2V74B 3Q3GE 3WLIA 3RTAA 4J0QA 3SJBA 2RHTA 4INPA 1SZDA 1YMUA 3OLYA 3PKIA 1WRBA 3O8QA 4M6WB 4QOFA 1M1YB 4XJXA 3LW7A 1R8JA 3IUEA 4IOMA 2NSHA 1BDIA 1YI1A 5HTKA 3MYYA 1PKXA 5B2FA 4KQ1A 4MGIR 5EKTA 5K0ZA 2V7QA 1TRKA 1NUTA 2C2HA 2W2NA 3U1BA 5I3CA 1AG9A 1EPUA 4WCDA 3FSGD 1U4NA 1V39A 4MVCA 1P17A 2WQ7A 2XNKA 1N2IA 4KE6A 4OA5A 4TL7A 3V9PA 2Q99A 3ORHA 4R0MA 2I4OA 3EXHB 1Z26A 3FR7A 4D9HA 4P86A 1KYVA 2AX3A 3UQZA 2PL5A 4YFYA 2J3QA 2DVMA 1RQGA 1YZGA 3NETA 4FYIA 2BSAA 1ITZA 2NYVA 5F3DA 3ZY5A 4PQGA 4FSXA 4F9TA 5L9AA 2EWMA 3DYBA 1T2AA 1HQKA 4JUCA 4MA5A 1LVGA 1I2AA 2ASEA 3NJ8A 4NU5A 1PT5A 5THKA 2QTAA 4LWPA 1HUQA 4ZYLA 4AJ1A 3WOHA 2ZYDA 1P6QA 2PZBA 4GC5A 1DVRA 4NMXB 2A4KA 4MVJP 2D00A 3QEJA 3QVGA 3WQSB 1GPJA 4DXAA 2PL1A 4YXWD 4RL4A 3OZFA 2JGDA 1JQDA 4GKVA 2RCNA 2RGEA 2ZTUA 3TR5A 2C9BA 4YRNA 3MXTA 5I4IA 1OILA 4QPJC 3UUEA 3PUXA 2C1ZA 2IYUA 2CVPA 1JXOA 1L5HB 2J5QA 3WYDA 1FXWA 1U0LA 4FOOA 1LQUA 1SC4A 3DHWC 1RKXA 3GT4A 3TB4A 1ZG3A 2WDPA 3MWLA 4EUSA 4PNPA 5MGNA 3TLEA 3TX6A 3ASUA 4OK6A 1JQ3A 3HXKA 5KKCA 1X1AA 4UHEA 4BNKA 4UVIA 4RE6A 4Y3UA 3EWNA 4CG2A 3DE7X 1XKQA 3O8OA 2OZLB 3PRYA 4C4YA 5GADl 3LKDA 4ZHQB 3U49A 4X97A 3W2TA 4KQMA 1K9SA 4P9NA 5BOVA 5CB6A 1VCMA 5KNDD 5DB4A 1X15A 4BE9A 2I4RA 2IIQA 5HBRA 3HXMA 4B82A 4FDUA 1JE0A 4WGFA 1CUUA 5JO0A 5AUNB 4IGKA 3DWFA 1A4UA 1L4LA 1DJNA 5LJIA 1Z2AA 2ODBA 3T9DA 2O3TA 2HMWA 2XTZA 5M3BA 3QEMB 2HHHB 2XCLA 2PLAA 3W6ZA 4YBRA 4PONA 3SEQA 4ED9A 6REQA 2Q5LA 2J67A 1I1HA 2R751 1I4WA 3C6QA 3CLSD 3MCWA 1NPTO 1UWLA 2YC4C 1TVMA 4HL6A 4L02A 2HT6A 4XM0A 1CEYA 4GOKA 1JMKC 5E6UB 3KOOA 3O4HA 2YWDA 4U3JA 2I1LA 4Y2YA 1KPHA 4MUXA 2WU1A 3ZDBA 3WL7A 4UULA 4CU5A 4TS9A 4CQMD 5C3MA 3MLEA 5BN5A 4DDMA 1IZ7A 2OOSA 2VF5X 4IHQA 4JWTA 2VAWA 2OFPA 5EIXA 3LBYA 2GHRA 5AHXA 2EBFX 4D4HA 4KR0A 5E9AA 4LCBA 2R1VA 2EEPA 3JYQA 4EY5A 5DK4A 3A3YA 3AI7A 4BEWA 5J2TB 4HZUA 2WV7A 5J4YA 1SKQA 2O48X 3VU3A 4YA6A 2HREA 3FZNA 3S0JA 1VPWA 1CJMA 1V25A 2B8WA 5G1OA 1MEJA 3H7AA 4YCSA 2PGJA 1JHRA 2VBGA 3G0OA 3GRAA 2XXJA 5ICMA 2IW1A 4R5MA 2G4CA 1KZ4A 1YZVA 3B1ZA 1SBZA 1UPCA 3PNSA 4IEIA 1NMQA 5EXDA 3S68A 5HJ7A 5JC1A 3AL0C 3BBLA 3HJBA 5H7XA 3L4EA 1X8JA 2D7CA 1FMFA 4HDKA 2ZI9A 4O4IF 4KFCA 1V7QA 4FQ7A 2CUNA 2WYUA 2H1HA 5C2JB 3DKVA 2BE9A 3UBTA 1YGYA 2R7AA 3G2NA 3KV3O 1Q83A 1DUIA 3OIFA 4ND5A 4XM2A 5EXSA 3ZQJA 4AS1A 3HG7A 3OZBA 2R8EA 3PPVA 4XGRA 2OFFA 3LFTA 4XQ0A 2YWXA 4ECEA 1GGEA 1T0UA 2JAWA 1Z9BA 1O6BA 2AI2A 3DCNA 3L2OB 3O2QB 5A9SB 5JZOA 5TLSA 3ELYA 3GG9A 4YK7A 4BJ3A 3RUEA 3MFYA 3MTEA 3C85A 4LYYA 1GCIA 3BILA 3E0XA 1ZJJA 2P2DA 1TFRA 2Q6KA 4LTDA 4KUGA 2JFZA 1C30B 4AD8A 2NPIA 3KR0A 4KI0A 2ODTX 2GZ1A 5BWMA 2HMSA 3R20A 1ULBA 1H4QA 1H65A 1Z12A 1FF9A 1C5KA 1IYZA 2C5GA 2JARA 1K6MA 1AZSC 1T9AA 2YASA 2HQRA 3RC3A 4EOGA 3JD3A 5E9WA 1I9GA 4JC5A 3DTVB 1F2UB 3TW4A 2Q1YA 1NAHA 3IDFA 1P4SA 3HADA 1KDYA 4ILKA 1G1MA 2N0SA 4QYSA 3RASA 3DH0A 3RU9A 3UJ8A 1YZFA 1NI4B 1M1NB 2EAUA 1MLDA 4B83A 4UNRA 3N87A 2J9FA 3CSDA 1VLZA 4LRQA 2YYAA 1P3Y1 1ESNA 3RUAA 3T99A 3ABOB 3PB3A 1PIWA 3UJ7A 2I7TA 1LBIA 3UNXA 1E2KA 1PJCA 4XQGA 1USVA 1S2NA 1IEQA 4IDOA 3QP9A 3ETGA 4BNFA 5ERXA 2M32A 4GOMD 4RS3A 5CRIA 3OIUA 5GJWC 4CETA 5K6AC 1FYDA 4UZSA 4D4IA 4MV0A 4MV3A 1MIOB 1EJ0A 5IAAA 4DR3B 4MTLA 4WFIA 1E3WB 4JJKA 4BL5A 1UXIA 1VXOA 5EGSA 5I7SA 3E2PA 3IT1A 5B12A 3JS5A 5JXJA 1P3DA 1HFJA 5LQCA 3ZDZB 1PX2A 4UXJA 4ZYYA 2FZKA 1LPPA 1ZEJA 1LTHR 2QJWA 3LVFO 1HBJA 1PGPA 1PJLA 1WW8A 2GF0A 2I4IA 3IO3A 3SQWA 4JB8A 2IS1A 4AL4A 1BHQ1 4R9RA 5JCOA 4LSGA 1FVXA 2JCYA 2K87A 2R9VA 2CMFA 1Z22A 2EZUA 2KHZA 2PWBA 2D7JA 4HR7A 3W78A 1EB8A 3GLGA 1PWZA 2HK7A 4H1HA 2QRVB 5IH3A 3PXEA 4DPMA 3VPDA 4AZ0A 3RV4A 1XVAA 1DXHA 2HF8A 3PXAA 1BD4A 3HN6A 2DECA 1RYFA 3B36A 3D6MA 1VGVA 1YFKA 5AI6A 3X1MA 4A27A 4D97A 3TSWA 2RHWA 1D1PA 1VKNA 1P6UA 3I23A 2PMKA 2OENG 3C3DA 4KFTA 5K3EA 1GRNA 4R2XA 4UVEA 5AW3A 2ZRIA 3AUFA 4YRBA 1GITA 1M2VA 1W1UA 2ZRQA 2IEAA 2NSDA 4CUKA 3R7FA 1T9BA 1V2HE 5HMLA 2LIPA 4BC0A 3K1TA 2ZJ7A 2VATA 4U7GA 2IZ6A 3ZW9A 1Z7GA 5LBTA 1BE0A 1SVUA 2AOXA 1XVTA 2HBZA 2JATA 2DLCX 3UMVA 3ZGVA 4QPNA 3RC2A 1X39A 3WBBA 2OO5A 1MF7A 4I8XA 2OBBA 3OEHD 1GGNA 2H5LA 4FS8A 2UVPB 3TLKA 1ADCA 1U28A 1XRNA 2YJ5A 3Q3HA 5E1BA 1EUDA 2WIBA 1V43A 3RS4A 4DM4A 3AVYA 4XKJA 1SQFA 3TW8B 4WV3A 3ZBPA 1CB0A 4BBPA 2ZR9A 1KTVA 3U4DA 5CCEA 1FDUA 3S99A 5ADHA 3VKGA 3CB2A 3E22B 4AUEA 4CCYA 2W6JD 3HH8A 3L04A 1SVMA 2C9MA 1OI3A 3DZIA 4WOPA 4N65A 3L92A 3EQ7A 1FPQA 3OQJA 1A9PA 4BECA 4EENA 2R6CA 2TMGA 4ZAYA 3AG6A 4WNIA 5EPOA 4RSRA 2QLBA 4TTVA 2JLUA 3WC4A 3AQ4A 3BRCA 1N0UA 5SV2A 4IQFA 3PFHA 1OH8A 1UP4A 1GEEA 2NW6A 3UKJA 2GFQA 2PS3A 3L8MA 1GGMA 1KE1A 4ACBA 4B73A 1MEOA 4BZQA 9ABPA 1TPYA 5LVAA 5ALVA 1AKVA 1WZIA 4UEQA 1P80A 4P53A 4X64B 4EL0A 3QF7A 1SFRA 4O29A 1L7PA 4HAWA 5KMGA 5LNK6 2XV1A 3R9KA 3E2IA 5BUCA 2AX4A 3BHJA 1UMCA 4RSHA 1BWQA 2OO7A 3NGLA 1J5XA 2PKXA 2R79A 1E3MA 2ONCA 3ZNPA 1UR5A 3MLBA 1LBEA 3R4VA 3GFOA 2WJWA 4AZWA 4G2TA 4L8FA 3K0AB 4J7CA 2KBFA 1PI3A 4J0EA 1F20A 1T6NA 2HPHA 3OJCA 2TMKA 3DTVD 4BXOB 1Q16A 3WZMA 3HZZA 1KWGA 3R9XB 4JXXA 1COWD 1KK0A 2SKDA 5BSEA 2DFPA 2PO7A 2FPKA 3EVGA 4MV9A 5BSTA 1VE5A 1XEFA 3BTOA 3WTBA 3V2GA 2V96A 4DQ0A 4IYJA 3KKMA 4TMYA 2DERA 1ATIA 1EQ2A 4GAEA 4I9GA 3FNQA 4N47A 1C1DA 2MT9A 1G66A 5DSZA 2OL4A 1YB4A 4GI1A 2PZEA 3SK0A 2B69A 3OFSA 3PUZA 5L51A 2D13A 2QYSA 5FR2A 3A10A 2HKIA 1Y9ZA 1JLMA 4DQDA 1EX7A 4OI1A 1ML4A 1XWWA 4OI4A 2W4MA 2EHDA 3I76A 2NO0A 3AG5A 2WK1A 2HYDA 5IKOA 3PC8C 1HH4A 3VNVA 3N75A 5A7FA 2X23A 1YMVA 2CVOA 1QH1B 4MRMA 5E8JA 5KNLA 3DZGA 1AGNA 1QXSA 2FVXA 4X0EA 2B21A 4YX9A 3MQFA 2GYWA 5BO5A 1UFQA 4RGYA 3UMMA 3TOXA 1CQZA 3FOWA 2I2FA 1I2DA 1OWMA 4FP9A 3V2HA 1D2NA 2C3UA 4TRJA 3TX2A 4YT8A 3C41J 3TNFA 5EJMA 2P11A 3GD5A 3L6EA 2GYUA 1Q17A 4WPGA 2D3TA 3MQ2A 1QMGA 5FULA 4E5PA 2GAOA 2XPCA 1JR3D 2OY0A 4D25A 4H35A 1HDIA 2A1IA 5KTYA 4MUFA 5JNUA 2VYVA 3QX3A 4LZOA 3LL4A 4MWCA 4RF3A 4MCHA 5FNVA 3T7AA 4X92A 3U0BA 4L16A 4DADA 3KR2A 6PFKA 5HXAA 1BKYA 2ZXFA 1DHRA 5JSUA 3AZQA 1MOZA 2VP3A 3VSCA 2IX9A 5J5CA 3D0OA 1HTWA 1G64A 1EFAA 2X3UA 5HIJA 3FNIA 5IW8A 1IUOA 2ALJA 3IHTA 2ZUUA 1PQYA 3RYTC 4RZ2A 2G08A 5CVDA 3TLBA 3CWCA 2Z1DA 5IC6A 3X43A 3FDIA 3PQFA 5ALUA 3V4RA 2BZ1A 2AEJA 2C59A 1RD4A 3NEPX 5MN5A 4K86A 2H8KA 4NZOA 3Q8LA 1SUIA 4RPIA 5CR9A 4D9MA 1OU0A 2V7TA 5DZSA 3GUYA 3LNTA 2B4YA 3QELB 1KEEB 5AP9A 1WSAA 5JADA 4QM6A 3R5TA 4U2DA 4RJLA 4GVLA 4ZQBA 5J1TB 3ECSA 4PV7A 3S2FA 1P7VA 1K4YA 1QIGA 5E7QA 5BQOA 5LYYA 3LA6A 4DMUB 1JEQB 3H9BA 5HSGA 1AQNA 1UQTA 1ZUNB 4XX0B 1VL1A 4BJHB 4GM4A 3ZX5A 3CRZA 2F3UA 1KAHA 4CKBA 4KPEC 1JA0A 4EFKA 3VBCA 3GV0A 3RGGA 3O1LA 1YCDA 1U80A 2C2MA 1QVZA 3CNLA 4DLYA 1XC7A 1JSXA 1XRSB 2JFUA 2ACEA 2QPOA 2XKJE 2PA3A 1KJWA 1UBEA 1NG9A 1CS0B 2Z3VA 3CH5A 5L7YA 1T9GS 3QOFA 4ZREA 4DCOA 3G85A 2HN9A 3EC1A 4L51A 1HOXA 4MRPA 4U6QA 1PEAA 1B15A 2C1EA 1N34B 2G5TA 4RQTA 3UMYA 4HGOA 4K46A 2VP5A 4CIYA 2NUAA 4I14A 5DBIA 1WVGA 3ABZA 5C8YA 3TBHA 1A8IA 2PUGA 4D4KA 2QPLA 4RVFA 3FIUA 3S55A 2OAQ1 4KAXA 1CY7A 4XVQA 3A4NA 5K6RA 4UHKA 2VEDA 1JSCA 1KU0A 4C04A 5BQFA 1QVVA 5ITWA 1MDFA 3WK5A 4CQJA 2GTIA 4M60A 1H9BA 3FDFA 3R3UA 5CLIA 2VT2A 2GD6A 3PK0A 4EW3A 3L1UA 1B8PA 3L4BC 4LW8A 3TLMA 5KYVA 4DIFA 2Y05A 3M2PA 4O1MA 1EA7A 4PZLA 3ND9A 1P72A 1ZK2A 3ZWQA 1AB5A 3AVUA 2I65A 4ON9A 1CUAA 1E5DA 3NI2A 2ZIVB 2VT6A 3LE8A 2GPTA 5BUSA 4LFBB 2I4MA 3GJTA 3KYIB 1VPEA 4AAYA 1AQLA 2H3HA 2GILA 1OXBB 2XUFA 4IXDA 1NASA 3R6WA 2I1VB 3EN0A 3GLFB 4ZVOA 1Y5MA 4D3DA 4ZO7A 4M0MA 4AG3A 1RBYA 2FU5C 4JEIA 3KB2A 1P45A 3FWHA 4CLOA 1QG6A 1AQ6A 3RIMA 1PJ4A 3EB9A 1XXHA 5IFKA 1GM5A 2Z5VA 1PNOA 1WZCA 2B3TA 3IEPA 3M9LA 1FJXA 1CY6A 3SDSA 5DI3B 1A88A 4KMOA 2F64A 2H4XA 4LDAA 5AVXA 1XTRA 3O3NB 3KXKA 2EZTA 2DETA 1JF8A 2AG6A 3K1YA 1HYHA 1V1JA 1ZUHA 1CR1A 1S4QA 3GK3A 1EFHA 2Q3FA 1E79A 4K9MA 4KVZA 4ZPXA 1BXZA 3ZVRA 5HOEA 5JRZA 1XQXA 5KOIA 3HYNA 5PNTA 3UTCA 3ICVA 1QV9A 4DG8A 2BMDA 3P9SA 4O1HA 2Z2XA 2J4FA 1DTSA 4BZXA 1SD5A 2IFTA 3BAZA 3D4PA 2XLBA 3VZRA 4ZOQI 2BKVA 3PNYA 1ZH6A 2JFHA 2NUTB 1GTL1 1AQUA 2ZRBA 1ZINA 1UEIA 2PWZA 1A7KA 3MOGA 3NHRA 1R5BA 3H4TA 3PSHA 1PS8A 1DC8A 3FNBA 3QPDA 4UMVA 1I7SB 4K6GA 1RXIA 4J29A 4FGWA 5G02A 4HD8A 1JECA 4B2LA 2ZUVA 3OH8A 3CF4A 1D0SA 5F51A 3P2JA 1HT3A 5LPNA 3VAYA 1OWOA 1RPAA 2HEGA 5DW0A 3OICA 2IYOA 4FE7A 4A8JB 1DRKA 1CVLA 4BNTA 1EP9A 3R7LA 4JROA 3A1UA 4U5QA 1Z73A 1J99A 2REBA 5G4KB 1M2HA 1E2FA 1ZK3A 3FUUA 3COZA 5F77A 2CDRA 2IHTA 4J4HA 3USZA 3W9SA 4UE3S 1XCBA 4PG4A 1FJGB 1Q20A 1UT8A 2B82A 4D81A 2VNHA 1FSZA 3S7ZA 3WKBA 2GX6A 1P0FA 4H4EA 5KTSA 4G5HA 4FJ1A 2IEDA 2IK8A 4BFSA 4V0RA 3RRZA 4LVOA 3UOGA 3TDNA 5JBIA 4QUIA 1E3DA 4GXTA 4JB0A 1RU3A 4E2XA 4FM9A 1H23A 2MHCA 2ICAA 4RESA 5EQTA 5CA1B 4DR5B 1KI8A 3Q0EA 4R1NA 1R0YA 3VC3A 2QV0A 1NJ8A 5EIBC 4DC1A 1E0KA 4K26A 3FVTA 1G42A 1RLIA 3IMCA 1ZXXA 3WGOA 5A1TA 3BRQA 3T1OA 1SQGA 4BVBA 1NP3A 4ZI5A 1DG9A 3LUBA 3SG0A 4PU0A 3LYAA 4R0NA 4Y6OA 3IE2A 1YQXA 1V1MA 4KPUB 3NBMA 2PXXA 2PSJA 3EIXA 2IITA 1S8OA 1ZWLA 2EG9A 3GPIA 3SKVA 4RY8A 3VKFA 2A1TR 4BTEA 7YASA 4RHYA 1ML3A 1DJQA 1FYWA 1IVSA 3AF1A 1VIYA 3JYPA 1EVEA 1RHQA 2GXSA 4QU5A 2GPNA 1P4RA 3D02A 2J0EA 3W7AA 5CBPA 4QG3A 1LGYA 4DTIA 4AZ3A 1Y6QA 5EXXA 4M8NE 3EIEA 4Y2UA 2A84A 2I54A 3I6ZA 3HK2A 1NW5A 3C6ZA 1LS1A 3K30A 3HCFA 4Z8XA 4LJYA 5CT5A 5DTMA 2MR6A 4KGVA 4DEXA 1XRRA 4Y7DA 3OM8A 3TBFA 1Z18A 1OFIA 2JFQA 3HJHA 4AN4A 3I1IA 4MIOA 1L7AA 1ZMOA 4KV7A 4LQLA 1L4GA 4BFTA 4MDHA 4B85A 3NAQA 2D8AA 1N6NA 3Q7RA 3KB8A 4N39A 4WUTA 1CF9A 4LPKA 5JH7F 3K92A 1GR0A 3U7JA 1N9GB 3H11B 5KB3A 2NTVA 4Z7QB 2I4TA 3K0EA 3GAZA 2L82A 3L0OA 4OH7A 1G7CA 1T5BA 3VHQA 1L5MA 1Q14A 2A5LA 4MW0A 5U1PA 4MRNA 3EY9A 4AMBA 3RG8A 1H6BA 1A7AA 1Y63A 2FPMA 1XWIA 1Y89A 2EC5A 2E4YA 2ZYIA 3K35A 1XUOA 2FPPB 3PGXA 5JJ5A 5CLQA 5EZYB 1X1SA 3UMFA 4WXEA 3K2IA 3OCJA 5G2OA 3COVA 3OLCX 4KSCA 3UMRA 1ESZA 3TGLA 1L5QA 1R50A 1TM5E 2GMWA 5HKKA 3ZWYA 4H4CA 4LZZA 3A9UA 1XVLA 5L8VA 1TC2A 3K0FB 3VDQA 5MN4A 2VDUE 3M6LA 3MRVA 2PWPA 1MV8A 1V9LA 1Z4IA 1WY5A 3AEUB 3ICPA 4JBLA 5CT6A 4NCNA 4UE6A 3WLSA 3W90A 1N8TA 3MELA 4LJ6A 2FETA 2JVIA 1TAUA 1AJEA 3H2SA 5ALXA 4DDVA 2H00A 1PSDA 3OU7A 1RW4A 2VXCA 3BPSA 3C5CA 4YQEA 3HN7A 4EB0A 2PX2A 1LZLA 4PZUA 4UNNA 4EGQA 1JAZA 5JY1A 3B9RA 4LSWA 4YLEA 1Y6ZA 5EWLB 4BTLA 2EEZA 5EJIA 4GO1A 1T24A 1VRCA 1RJWA 1SKYB 5DWVA 5ITVA 2QY6A 5FLEX 3EC7A 2DQ4A 1G5FA 1Z63A 4IEEA 4MWTA 1XQYA 4KN6A 4CKXA 3DEAA 3W77A 5GONA 2VDWA 3NASA 4BQIA 2RONA 4YQFA 3QVKA 1XA4A 4DNPA 4MO2A 3RRFA 1X1BA 3MIZA 3NEYA 3R41A 4LX8A 1MZPA 2XVYA 4WK4B 4C87A 3OMXA 1VHQA 2BR4A 5HE8A 4LV8B 2H2HA 1M7HA 1KJYA 4JLAA 5LUBA 4ATNA 4LOHA 4BJ1A 1QE0A 4B4UA 4I3FA 3SP1A 1VSBA 5GGYA 3UTDA 2BEWA 2VJDA 1N6KA 3E9MA 3LF2A 4NU8X 4HAOA 4AM8A 2V5VA 4ZJZA 3TNJA 4Z4IA 2VSYA 1QBKC 5F5NA 4FINA 2C7OA 4O08A 3Q6NA 4CDRA 4HBZA 1X0VA 4DUGD 1YF3A 3U62A 3BH0A 1A97A 3ZIAA 4YR7A 4LXGA 3ROFA 3AF4A 3AXTA 1VMEA 4IQ8A 4GPEA 2BRUA 2E3JA 1OV6A 1FE8A 4KKVA 4L5CA 4M7RA 4QJ3A 1K7YA 5EHIA 3U61B 2II6A 2GNPA 1HTBA 1SIOA 3HYCA 4I8IA 3DMTC 3E9NA 2O7NA 2YHIA 3O2JA 3V4FA 1N1DA 4IGFA 5AKKA 5KJFA 3RAFC 3DFZA 2NVOA 1HEIA 1AHHA 1QJ4A 3EQ8A 4CV0A 2CLCX 4XYMA 1RBQA 2CEAA 2WVHA 3CZCA 1UBRS 2HFJA 3NEAA 2NQ8A 4PAGA 1TUGA 3WGYA 2QZ4A 2ZI7A 3MJDA 1S2IA 2WJGA 3GJ4A 4IXNA 4BMXA 3GC6A 1JEAA 1WCYA 3QTTA 4ZGBA 1QO7A 1G5TA 4I08A 3KPWA 4INJA 3C5WP 4B17A 1CUZA 4RTSA 2XGOA 2EBWA 2EBHX 4HLDA 1JDZA 4CQMB 5LP6A 2RH5A 2VLBA 3ABSB 4UXHA 2FEOA 3CE6A 2GK6A 3UB4A 4BN4A 1ZJYA 3J7TA 2YNMA 4A6EA 4L22A 4Y0NA 4Q3LA 4W8OA 4BQRA 1IBLB 2CL5A 2IPLA 1B23P 2I03A 5KHLB 3EPJA 2XUQA 1TGVA 3VZPA 4RTNA 2RBEA 4OREX 1W34A 4IXTA 2R85A 1XTTA 1BEZA 4H7IA 4KK3A 5JZVA 5CT9A 2XNCA 4QDUA 2Q3HA 3H2IA 5FWXA 4OM7A 4IDEA 1JHAA 4R54A 2XXAB 1X2BA 5F2KA 4HAZA 5HP4A 1Z5PA 2CXUA 1INLA 1GVHA 2XAUA 3B53X 5LBIA 3RIGA 4CQNA 3CWQA 5DLEA 1KVUA 2EF1A 1VG0B 3JQGA 3PEEA 1BCSA 1XQVA 5IYZB 1CQPA 3P20A 3CNHA 3I0ZA 2CD7A 1ZNZA 1Z2DA 2X9GA 1ESEA 5KNBD 4GQBA 2NMVA 4LI3X 2CB0A 2VYNA 3KLNA 3Q0TA 1ENPA 3DVAB 4TMZA 2JZCA 3NWBA 5B7QA 2IXEA 3KQVA 4AS3A 2C9CA 3NKFA 3SJAA 3CBGA 4BX8A 1OW3B 2DULA 5I4BA 4OVKA 1J06A 3TB6A 5KU7A 2UYOA 2NVUB 3WRXC 4BP1A 5CVTA 1SBQA 4C2TA 1FFAA 1KZ7B 2VRCA 4NNOA 4RE5A 4D57A 1R6UA 1VHLA 1RI2A 1X1DA 3PXXA 4ZT2A 3GEHA 3RK1A 1KTIA 2H29A 3KWLA 4M9SA 5AH0A 1XA0A 4X8HA 5JCOC 3SLRA 3SSMA 3L6RA 3DT6A 5I8ZA 3RS8A 1PFKA 3F6YA 3ER6A 2IX3A 4KVAA 2LR0A 2C4KA 3VR5A 4J4BA 1YCFA 4TSFA 5GM2A 3TJMA 3CN7A 1B41A 4AECA 3RFUA 3TOCA 5FCDA 4MQUA 3GYBA 3TI7A 4UNPA 5EJAA 3QSYA 1P1CA 1GPWB 2A9JA 3U44A 1N3LA 2OP0A 3QE2A 2HX1A 3V3TA 1E3EA 3C1AA 5JDIA 3IULA 3M3DA 1MB0A 1D6NA 2W22A 1PSZA 4QT0A 4OKNA 2O05A 1Y81A 3BCSA 3I5UA 5HYVA 3ICOA 1KIAA 2B7BA 4L4UA 1NJ6A 3CUSA 3EDMA 2X19A 4CMJA 2H1OA 2IYVA 1ZKMA 4X1IB 3BIOA 4L3WA 2DFLA 3BJIC 3CIOA 3G9QA 2EU8A 3Q7SA 1N92A 1FFBA 3AJ9A 4E07A 1S3GA 1XMOB 1GL6A 3FMGA 1GG2A 4YJHA 1BHJA 5FLYA 4EMUA 3G2QA 1RZRD 1R8YA 3TSZA 4PCUA 2OO5C 4BVGA 4LE0A 3TCNA 1ECGA 4WKBA 3EJWA 4MQ4A 1QTNA 2VJKA 3LC2O 4XWAA 1HNNA 5LFAA 2PKYX 2H48A 4UEJA 1GDTA 2H1WA 1V8PA 2FNAA 4L5JA 4E4TA 3GPLA 4RWEA 4AQDA 1GGVA 5DKFA 3UWPA 4KRFA 1Z2PX 1Z8NA 4U7DA 2K7ZA 5CTJA 1DRUA 2DMRA 3GELA 1JG4A 3WP1B 3DKKA 3HCNA 2OCPA 2GHQA 2JIMA 5C35A 4NECA 1DI0A 3RARA 3KP1A 2GR9A 3D7NA 5C8VA 4NH0A 1NYRA 3FSGA 3OPVA 4OMFG 4O4JB 2CNOA 3A04A 4R69A 4D9EA 2G0AA 3A1DA 3CFYA 3AI3A 3KJZA 3BAFA 3PT5A 1PNRA 3N5KA 4WT7A 3DL0A 3M1LA 5CFNA 4BAZA 4TUYA 4BV9A 5DEIA 4NMMA 4Y1RA 3RH0A 5JBNA 1AH2A 3U09A 1O6GA 4FK8A 4GYYA 4RF2A 1AQJA 4MVYA 3W7VA 5HIMA 1Y9AA 4B8ZA 1N5IA 4P32A 1W4RA 1OXUA 1GWNA 5KOYA 4IDCA 2RGUA 1AE1A 1G21E 2HWYA 2BZ0A 2OHVA 4L5YA 2GM9A 3DE0X 4Q19A 1B8OA 3UCEA 3LCRA 2A88A 5BNTA 4CF7A 1L5VA 2G9UA 2HUPA 3FPLA 4Q82A 2YVAA 1KSHA 5KSWB 2QG6A 4R84A 5DK6A 4KBGA 2R7LA 3CZPA 3GUUA 4JLKA 4WZBE 4LVNA 5H5JA 1H5QA 1KZ1A 2ZU0C 5E7JA 1OLUA 5BSMA 3FRIA 4GOJA 4IQGA 4YXWA 5EP2A 2ZIZA 3FVWA 2P69A 3VR5H 4RYDA 3R6GA 1AD2A 1XZKA 2CNNA 4I1SA 5CAEA 3EJ6A 4MKHA 2FCRA 1ZA1A 3F8TA 3G5UA 4C6HA 4NSNA 2WG1A 5BQ5A 1IUNA 2JC3A 3H3FA 1H69A 1QVAA 1T4CB 4DAOA 4WUVA 4Q4AB 1QWSA 4HDNB 1RXCA 5DTJA 3SR3A 1AKMA 3B5JA 3I9MA 5I6DA 2RI6A 4CM8B 2BFPA 4IZ6A 5CGZA 5KREA 2JLSA 2YCLA 1E32A 3PHJA 4ZJUA 4RIIA 1NNEA 2O8EA 2YX1A 3ORYA 4JKOA 2BZSA 3A6ZA 5J43A 4HNSA 2G1KA 3C6XA 2AR9A 2HHCA 4DYHA 3KWMA 4HWRA 3BDIA 2J4DA 1LPBB 2YW2A 3OBIA 4TLBA 4DMCA 3A14A 4DV7B 4CEJA 1KFEB 5ILGA 4CNBA 2OZPA 4X1KB 5KNDA 3IIEA 5B2ZA 5E3JA 2HOQA 1OH7A 3V9AA 3OEYA 4JQZA 5IDWA 1PTJA 5BSVA 1D1TA 2R0QC 3NEJA 2CHEA 2OMEA 1BEEA 2C2OA 1WCV1 3SU8A 3GARA 3SBDA 4BWGA 5BMVA 7ABPA 3JWEA 3DLHA 1JHMA 5EFZA 4V1CA 4GSLA 3UW1A 5BW4A 2QMUA 3HA2A 4IUBS 4DIOA 5L53A 2IE8A 2OV4A 3HKDA 1XX6A 4RY2A 3MPUA 1DDOA 3DB2A 4H7DA 5HF5A 1PEDA 1U8CB 4EK9A 2VBIA 3EH1A 4UTVA 1KXJA 5ALMA 2BL4A 1YIAA 1YR3A 1LSOA 3ISTA 4KQEA 1EP1B 1I2CA 3WLNA 4D9CA 4F97A 3IP6A 1QYXA 1YE8A 2P8JA 3A0RB 3IMKA 4NQRA 3FR8A 2ZXUA 1VI2A 1ZGHA 1RXUA 3GH1A 2AFHB 3OZVA 2VA8A 5DN6D 4CQMA 2C2WA 4TPKA 3I8OA 5AKXA 5EKUA 4YV1A 1ZLXA 3C39A 1K3TA 3QU4A 2H4JA 2I22A 1F5NA 1WCIB 2JAPA 2ID9A 4CMIB 5I47A 3ZIDA 4RKFA 4CIAA 3HI6A 2Y0CA 1IAQA 2ZBPA 2ZCVA 3KQSA 4WN9A 5SYAA 1J07A 4I5GA 1JBQA 3OZGA 4RLQA 5IKEA 1C7QA 3ZWNA 4L7VA 1CQJB 2Q6TA 3QA9A 5SZKB 2HDHA 2YXPX 1KQ3A 2P91A 1S1CA 4B47A 4C7OB 2G4LA 2OCAA 1PJTA 4HNTA 3BE6A 5DYGA 3HO6A 1T1SA 4L3VA 3ZGYA 3HJGA 4M6WA 1GGJA 1M1YA 2BFBB 3C8DA 3X1XA 3ZDAA 1ULHA 1GLVA 3EC2A 3EWAA 1J21A 4OBEA 4RTQA 1YJAA 4FGSA 2BJWA 1URPA 4FILA 4L5IA 4U0JA 5KTNA 1Z33A 4G4IA 2ZRJA 4YLYA 5AO9A 4GP9A 1DLIA 3JD0A 5HZKA 1TO6A 3HR7A 5LQJA 1JV2B 1E7YA 1JFLA 1OA0A 3AUXA 3KD3A 1A9TA 2DHDA 4PHFA 3T5BA 1YDGA 2GZHA 3V42A 4UTNA 1VMKA 3AY3A 4XD7D 2GBCA 5H70A 1X92A 4LISA 3L3BA 3K0SA 1PG0A 4JITA 4L5BA 1Z08A 1JR4A 3FETA 3EDQA 3EXHA 1E5TA 4ESHA 2LP4Y 4Q34A 4C76A 1T9HA 3SQLA 1Y34E 3LIPA 3F3SA 3U3JA 4ENPA 3VNBA 4J7UA 2C54A 3WJ7A 2DWPA 1NXQA 2Y9PB 1JAXA 1XBTA 4MGHA 2JF0A 3D6VA 5D3KA 5A4MS 2V3CC 2CSXA 3A6PC 3BWBA 4XR4A 3UJBA 5MF6A 5EIAA 2FTKE 2A3NA 3ELBA 2ENUA 4Y18A 1QV7A 5IAGA 1U98A 1QGYA 3W05A 2ZSFA 4B87A 2IBTA 2C84A 5AJWA 1D4AA 2I7XA 4UOQA 2VS1A 5KNDH 2HLNA 1M8FA 1D9ZA 2QD4A 4CMAA 4L8VA 2A0FA 3PTLA 1I24A 1VBFA 2ZZKA 2PLRA 4MVJI 4PHGA 2JIPA 4KO4S 1V7CA 1PG5A 1M34E 3GW8A 1I3MA 4OL9A 1T5OA 2XTMA 3AINA 4D26A 1W5AA 2X4IA 3P9CA 4GI2A 4L6AA 5DCLA 4RSGA 5KJ6A 1UBNA 1GAJA 2J6BA 3HP1A 4E7PA 4RZ3A 3HO1A 3KEGA 2EX1A 3QFSA 4RHFA 5A9TA 3TFWA 3K05A 3UENA 1QKKA 1Z34A 2ONKA 3P2YA 4BJ5A 4FMPA 4K3VA 2YY7A 4KCGA 1HDRA 2IWRA 4HGZA 3HPRA 1WL8A 2YVLA 2OZLA 4NXMB 1SVIA 1CW2B 4X8OA 4QPCA 2WVJA 4ZHQA 2ZR7A 4GZ5A 3QBEA 3RYIB 1WKVA 2CW5A 4XI9A 5EUQB 5JO9A 4PLYA 3I05A 4RVNA 2BLLA 2ZRAA 3AHGA 4L75A 3D5TA 4BQOA 2J8ZA 1SOVA 2R5FA 3TG2A 5JAMA 3IRUA 2IP1A 4E12A 4YAGA 4RCYA 1RYZA 4TLLB 4QXAA 4RK1A 5SY4A 2WPDD 2VTEA 1JWBB 4XM1A 4FU0A 4LWZA 3UEOA 3L8YA 3BZWA 3QEMA 2MSNA 2O3UA 5CFZA 4Q3OA 1MUUA 2DM6A 2GEFA 1UBLS 1JQJC 2AKAB 3S27A 4KB5A 1KI2A 1WKCA 4B3TB 3AM1A 1KGSA 2QTGA 4PYOA 2B5OA 1MQ8B 2EDCA 1QCZA 2AEFA 3N76A 5L4SA 4RV5A 3FPBA 5E6UA 1N2CA 5F1YA 3WK8A 1Z0FA 2JNWA 2O6HA 2W6QA 1Z83A 4JA2A 1JJFA 4PS1A 1C3OB 4KFRA 4CLDA 2C9OA 1OFUA 1VL8A 4MWDA 2O8BB 3IERA 4NPHA 4UM7A 1V8OA 1QGED 4I4LA 5AFSA 3OEHA 2AB0A 3DZHA 3CYFA 1BA3A 4MVJD 4E2YA 3VR6D 5J2TA 2WSMA 1P2GA 4DCUA 1G17A 4R3UC 1JHVA 4FMCF 2G71A 3FGOA 1WIWA 5IBRA 1DUVG 1XMVA 1FMJA 2VTVA 1T9GR 5EJGA 3WK9A 3I8XA 4BWVA 3S8MA 4RHXA 4WKCA 5I9MA 3LFHA 1GLGA 4IGEA 5DLYA 4IDNA 1U3TA 5HFNA 2W6JA 5M7EA 1R8SA 3U7QB 3AUAA 3K0HA 4GR5A 5JWRA 1N0IA 3TF5A 3WLMA 1RXVA 2NSLA 4MDYA 1M8JA 5BW5A 4EFNA 3GLIB 3NHJA 5G53C 5BVHB 4MW5A 2YJZA 3ESBA 1ECCA 4NFSA 2P4HX 2VXBA 4IJ5A 1N33B 1MX5A 2Z43A 3BB4A 4J3NA 1G6HA 1U1DA 4GNKA 1R4NA 3K3PA 2P5YA 3SXUB 4B40A 1HXHA 3UK2A 2G9VA 5A9SA 1ZOIA 2VXOA 3B3FA 3ZQKA 1Z7BA 4A26A 1RHMA 1QIMA 4RHCA 4ND4A 3H7IA 6NULA 4G2NA 2G0NA 5CDUA 1HDYA 1Z0UA 3KSRA 2E6KA 4DXHA 4JQYA 3F7NA 2PTGA 1C30A 2FR1A 2LKDA 2NACA 3EW7A 1QH9A 5JJLA 1H2WA 4MA0A 4WERA 4I4TF 3O9VA 2C00A 4KMRA 1W36B 1CHDA 2D6FA 3B3QA 3DTVA 3KQQA 5JCZA 1RAAA 4NK4A 1UK9A 5JROA 4A7PA 3CF2A 3A11A 3ODGA 4M36A 1COWA 2JLVA 4M2LA 1Z6ZA 1F0NA 3KO8A 3ZV3A 3I0NA 2IDMA 2E0IA 1NI4A 1M1NA 1DE0A 5DCUA 4ZQCB 3VGPA 4ES6A 1Z36A 2EP7A 1BE1A 1JLKA 2A1UB 2H17A 3AWDA 3OVMA 3U40A 4CXMA 2LDBA 4MKGA 4CV2A 2PV0A 1G7RA 3I5AA 4QA9A 1Z6XA 3NIGB 3AL3A 4GX2A 4DQUA 5EG5A 1KO4A 1MIOA 3E6AA 4MQBA 4OK5A 4FS3A 5CTAA 1Y1TA 4F4CA 3N8HA 1E3WA 2A0XA 2E1RA 3MGBA 1Z6TA 1US8B 1WXQA 4TXNA 3OMWA 3G1WA 5BSGA 2AFIB 2NZ8A 3O83A 3A2NA 4J03A 4PPGA 2HSDA 2VDNB 4B4OA 4G01B 4GWLA 5B55A 1QB7A 2ZJOA 2ZATA 3PGVA 1TJ5A 3SZGA 3SNKA 2PSHA 1QK3A 4JJFA 4RACA 5DASA 3FOEC 2GKSA 2M2IA 3FOZA 3F7TA 4FCVA 1WB6A 5BOSB 1K86A 3EZ2A 1PUIA 4LI0A 5I7FA 4ZJPA 2LNDA 2P5UA 4MKIA 4DDUA 3HFRA 2QRVA 2WC1A 1JAIA 3OCXA 4L0QA 4MZDA 3WTCA 3ZZTA 2B7LA 2GWRA 3NIBA 3HEAA 2FZ4A 1DV2A 4LOKA 1JR3A 5C81A 2EOAA 2PRIA 3I6BA 4J9VA 5EE9A 5CLJA 3DFFA 1GFZA 3E8SA 2VRWA 2AK3A 2OHJA 1XD9A 1VLQA 1ZRHA 4V2IA 4FIDA 3RAJA 2EJCA 4LQCA 1SC3A 3GJ8A 3KSZO 3CVOA 2BBTA 4LNUB 2WA1A 4JI2B 4DILA 1YKSA 1S3FA 3VTKA 1WMDA 2ZJBA 1AF4A 2PRSA 4L9AA 3R23A 3RIYA 4R4JA 5ALLA 3C4QA 1RJFA 4AY5A 2Z4TA 2WTUA 4ARZB 1OZFA 1MQAA 1QDUA 5I7EA 3E81A 3FVQA 3NM5A 5AOAA 2C4WA 4C20A 3WR5A 4WTOA 2ES4A 5KQPA 1DDIA 1CJCA 3IUJA 1P9OA 1HE2A 4ENRA 4KAJA 3FOAA 2PUVA 4QYWA 721PA 4YMLA 3DW3X 2FSIA 3DHNA 2NN3C 2NP6A 5CXSA 1IDN1 1I4LD 1NI3A 3A05A 3ZH9B 1F6DA 2C8VA 4Z4HA 2ORED 3WGNA 4Y1EA 2PUCA 3ZWPA 1Y0BA 4ZI2A 2XVMA 3TW8A 2B3DA 1U94A 3BXGA 3W5AA 2I3DA 1FP1D 2VHZA 4RIGA 5B36A 3E22A 2OD2A 3DUWA 4RH0A 1ZGAA 4G1UC 3WLLA 4CLXA 5FNZA 3EPHA 1KFKB 4TYMA 2FJUA 3TTXA 1ICEA 2XSZD 1YD7A 4AU1A 3HEMA 2X1HA 3F0TA 3WAJA 4TM7A 1JALA 1GLNA 3ELUA 3F2VA 1JA9A 5BRAA 2GVNA 5JAQA 3VU1A 3S8EA 4F5DA 1E2UA 3SSOA 1WBBA 1OR8A 1ZGZA 2VR1A 3FM9A 3H3JA 3T6KA 5KPJA 1JU9A 1PFQA 2EKQA 3S2IA 1M7GA 3UPUA 2X5OA 3R44A 4RFVA 4L27A 2QOEA 5KHOC 4L07A 4G8JA 1BOOA 1UK6A 2VJYA 2IOFK 3LUJA 1PCXA 1WPRA 1UKAA 4FOSA 1V5IA 2PMBA 1G6OA 3FPKA 4ZA2A 2C7QA 3L7YA 3NAGA 4K9RA 2HGZA 4MNTA 5GP1A 1EJBA 2F4NA 1UMBB 2HK9A 1KMIY 2R6HA 4EB6A 1O77A 4QAQA 2Q5QA 3DO8A 4PR3A 4RVOA 3VR4D 1J2EA 1ZVQA 3F71A 3VU8A 4CW7A 2AE2A 1U2QA 3K0AA 1NATA 1XHEA 2B61A 3AK4A 3EVNA 3T1NA 1A04A 3IAS1 2QWXA 4F38A 1W36D 2A9RA 5LQRA 2GCNA 4G63A 5EIEA 1UMKA 4BXOA 5KDDA 5K3FB 1R6VA 3F6EX 3ZYZA 2J7PD 2I2BA 4MI1A 3R9XA 1P5ZB 3C8HA 3K31A 4CEIB 4KO1S 1SIBE 2DCUA 4CR7A 4MLPA 5A4IS 2BFOA 5LWHA 2X77A 3PWTA 2YZKA 1BN6A 1C4KA 3BORA 3G6WA 3GDFA 1W19A 3QE4A 5I9TA 2XBUA 5AVTA 2Z6QA 1Q7TA 1IOVA 4QIHA 1VLJA 4N3CA 2R87A 4ER6A 2B34A 4ZZIA 4LVCA 4BNJA 1EXWA 2GZMA 5LIRA 3CRMA 1FFHA 3OQNA 1SCUB 3LO8A 2COUA 5DHUA 4AF8A 4J16A 4C78A 4IG4A 3WV5A 1N5DA 3KAQA 4N7RA 3D9QX 3VNSA 4C4XA 1NULA 2N3ZA 1PO7A 3IMGA 4TKLA 4W9NC 2IHKA 2AYXA 1YZTA 4EUFA 4YRZA 1QH1A 2GPBA 1UXGA 3DBLB 2VZEA 1XZLA 3N86A 4I6JA 1JLLB 4NATA 4OGFA 4YJFB 2QLJA 2AMVA 3KZ1E 1CUHA 3OE5A 2X9QA 1GFIA 4YMTA 4O33A 4LRSB 1QFYA 1U5CA 2YBDA 4I1YA 1CUVA 4NS4A 1J8QA 2GEJA 3DGEC 4TUYF 4H60A 5F3RA 2G09A 2GLUA 2WKWA 3LT4A 4ZEVA 1Z07A 4MGZR 5JSFA 1GUYA 3TQHA 1LW6E 2D1QA 3I9NA 3JATA 4WAUA 2L42A 2IS6A 1VFNA 4MAAA 4EZEA 4D82A 4YT4A 5AW4A 1GGKA 2NYUA 4KR9A 2GJ9A 4EYGA 1HKUA 1TQ2A 3E15A 3GCDA 1Y3FE 4FW9A 4E0BA 3OURA 3OLXA 3NT5A 3VOBA 1I0IA 4RAQA 1YDFA 1T5SA 1T34A 3HU1A 4ETNA 3A8TA 4QUDA 4DS3A 3ZHVA 1CJTC 4OX9B 1FQOA 1IMOA 4E6PA 3KJHA 1OXMA 2PCLA 2OZKA 3U37A 3VSAA 3KOYA 1POXA 3DZFA 1W4CA 3HPQA 5LXTF 1IBCA 2X22A 2QUIA 3N2GB 1KYQA 2C2ZA 1LWNA 3KHSA 1RXEA 1XKXA 3WDKA 3AP3A 3EVDA 1I51A 2VL7A 3D3JA 3FNGA 4CG1A 5JDIC 3TZQA 5JRDS 3QPCA 4WBNB 4XIYA 2I62A 4EL5A 2VPTA 3EG9B 1I1OA 1YJBA 4R9VA 4HKTA 2R8OA 3QELA 1LK0A 2YHAA 1UAYA 1VQ1A 3DGFC 5T3YA 4YFVA 1KEEA 1AF7A 5CA0B 4MV7A 1HT1E 4OHUA 1O87A 1U2GA 4E5YA 3C14C 3FWNA 4UBJA 3AQIA 3GPDG 1EK1A 2PA0A 4G4SP 4RJIA 3QVVA 1JEQA 3HDYA 3UCFA 4EBBA 1PUJA 3B20A 1ZUNA 4XX0A 3RVLA 1P5RA 3VH3A 4F60A 1USGA 1LTQA 2EWWA 4EP1A 1HDOA 4X3PA 3O8RA 1NBME 3IB6A 5H80A 4CLRB 2ZSHA 1NTRA 1DC6A 2Q0SA 5FJIA 2R8RA 1ZNXA 4MP6A 1W0KD 1F0KA 2ZLBA 2WY2D 3G89A 3M83A 2VJMB 4YJGB 3WKEA 1CS0A 1R5OA 4ZANA 2IU6A 5DU2A 1ODIA 1XEWY 1MX3A 3GLQA 1IU9A 3K96A 3Q87B 4GRIA 4KRXA 1Z6GA 1O95D 2VJQA 3U4AA 4EAQA 1FTQA 5FH9A 4KMMA 1MJGA 3RSQA 2ZKIA 3VVLA 2ACKA 3RUDA 4B5LA 3JWJA 1FMCA 4P4SA 3OOSA 4JP1A 5FO1A 1J2TA 3KK0A 3RFTA 4K03A 4RQUA 1ORWA 5LN1A 2ZDQA 1K68A 1EWRA 3DOEA 1YR6A 2ON6A 3AB3A 3M2TA 2HJSA 2P40A 1HDCA 1IB0A 1MTOA 1Y9EA 3SX2A 3MJHA 1T2NA 4NCHA 3WRWA 3JRXA 2DPXA 3C16C 3DDSA 4TKVB 5J63A 4YC7A 4MV6A 3GLHE 2XAAA 3EEOA 5B3AA 2JAUA 1GXSB 5LZ2A 3IVMA 3UKDA 3A2LA 4A15A 2IY8A 4ZALA 5SYNA 3U0VA 4AMVA 4NY1A 5HF9A 2BM1A 2JI9A 5E7IA 4YRQA 3MPOA 4OLBA 4ZOEA 4P92A 1SVOA 5FBLB 5A2QA 3TK1A 1B26A 1A27A 2QORA 4KDRA 1YS6A 1YBFA 3GLFA 4OQLA 1FFYA 1AHIA 1Y7LA 1ZZEA 4LKRA 3THRA 1V26A 3CEMA 1H2FA 4FOLA 4MQ6A 3FCOA 2P90A 4ESOA 1QQAA 4XJVA 2FK8A 1KPGA 3B85A 3ORQA 1D4ZA 2OE2A 3DVQX 2FW6A 3KU1A 4II7A 3OEED 4MWSA 3UXHA 1BQ4A 3N7UA 4HYTA 1CX9B 1D2HA 1P1BA 5DI3A 1B2LA 1H05A 3O4JA 4PWZA 1N8NA 1B0ZA 2C98A 2ZTVA 2ZVQX 3V1MA 1LW7A 3CTMA 3NUGA 4DRXB 4EAAA 4MQLA 3KJFA 3DHEA 2QRKA 3B51X 4WNCA 5K2MA 3UQYS 2D2FA 3FVVA 3OFND 4RM2A 4PLWA 4FKZA 4TLMB 1FK8A 4HWSA 4AFNA 1VG1A 3EGXB 4IS2A 1QYIA 4QRIA 1DOHA 3C4JA 2ZU6A 3FNHA 4CEHA 2HA5A 2ZBVA 3U3DA 2CLSA 5IF3A 3G0HA 1T6XA 2YV1A 2ORYA 1TK3A 2NUTA 3AUKA 5M5BA 1DKRA 1AKWA 2H1SA 2ZTLA 1JIQA 4LFAB 2HLDD 4ITVA 4RTOA 2QKYA 4MYTA 5HNKA 1VC2A 2EXXA 1U6KA 1E4OA 1PTJC 3B1YA 5GZ1A 2GDJA 1T3ZA 5IXYA 3ISJA 1YR7A 1YS1X 2EQ5A 2ZFUA 4QUJA 5AMXA 5IT4A 3R7WB 4ARUA 1MOPA 1CF2O 3ZHCA 4A0HA 4A8JA 1Z4QA 4KYTA 2AXNA 2ZI5A 3ROTA 5BRNA 1KYYA 1L5ZA 2OCBA 4X3OA 3WWYA 5DLPA 5IS2A 5K5EA 3P94A 2QM7A 4DB2A 1S8NA 2ZJ0A 3BQMB 2P78A 3V7YA 5G4KA 1YQDA 3KX2A 4NX2A 4UBNA 5ELMA 4EB8A 1ZNYA 1J8YF 4ZEOA 3SDZA 3DP9A 4I4CA 1THMA 4FDAA 4COKA 3EBLA 1NSFA 3VMMA 1RADA 4GOLD 4HZGA 2CBXA 1V45E 4OJMX 1H1DA 2EW2A 1C8KA 3LHDA 5H1YA 3V4LA 1NU8A 4LC9A 2A7QA 4MSUA 4LYHA 2VPQA 4NBUA 4AJEA 4U8HA 1E7RA 2RG1A 3F6BX 3FGNA 1FNMA 2P6OA 1H2XA 1R4ZA 4QPPA 4BFWA 4DUGA 3FZYA 2AJTA 3TNYA 4FBMA 2BISA 2OBLA 5CA1A 4QECA 2GO1A 3KUXA 3LPCA 1YASA 2GM3A 1IQ0A 1SCJA 3IUQA 4MKZA 4QGHA 3ZI0A 3Q85A 5K0JA 1NW3A 1U0RA 5EMKA 2BY4A 3SZLA 2PXHA 4A36A 1E0SA 4H6WA 5TSDA 3JQ7A 2PG3A 1T5IA 3N2KB 2C9DA 2OYCA 4BZZA 1M6NA 3Q11A 4KPUA 1XJ0A 3MSXA 3OHPA 4MWEA 4O2BB 1UJNA 1WD5A 2TRSB 2XUKA 1EFLA 3UV7A 3ER9A 3F74A 4DWWA 2YMPA 3TSYA 2B8TA 3N0WA 5JEEA 2LKCA 2QN2A 4EPRA 3CURA 4HWGA 2P5SA 3I4FA 1D03A 1XDDA 4F4FA 1CY2A 2JKVA 4RFSB 3IDSA 1Z75A 1F38A 3PWZA 3QPWA 4E15A 3AR7A 2OBFA 4E2FA 5C18A 5I9NA 3T3NA 1E0AA 5IKMA 3H4IA 3UCXA 2R11A 2FMTA 1K08A 4W1RA 3N58A 3Q5DA 4ZO6A 1MO4A 1C8VB 3FCCA 1SC6A 4ZT7A 2XDYA 4KZKA 5F21A 3NGXA 1NVFA 3VZBA 5AXBA 2GB4A 1ADGA 2GLTA 1BXKA 1FDVA 3L43A 3D64A 4GLLA 1XZBA 3O93A 4C0XA 3ORFA 4RD1A 1KDOA 1U81A 2I1QA 1E9SA 4IR7A 4O59O 3KZOA 1N9GA 3H11A 1MO5A 3ZBTA 1C14A 2PKQO 1WR8A 1L2TA 2PR2A 1IG3A 3CLRD 3IAM1 3N2EA 3ND5A 5M29A 1FZTA 1XR3A 2QN3A 2VUTA 3O8DA 1OTHA 1MCZA 2OHFA 4F4JA 3OTOB 3DYVA 1CDEA 1W1IA 3OFVA 4JT8A 3FYUC 3KTFA 2HSZA 4NE9A 3F5DA 1FYXA 2FPPA 3B5IA 3TE6A 3UXYA 4BO9A 2JFWA 2C5LA 5EZYA 1NBEA 2BMVA 4W1SA 3PENA 4DJJA 1OGYA 3FNRA 2R60A 4F04A 1CHNA 3E8XA 3BD6A 4G09A 3G7UA 4FYVA 3MUFA 3ZS9A 2CNLA 1C4XA 2QLLA 1EZZA 6CHYA 4LZWA 1LI5A 4F71A 4JGBA 5KNBA 4W5NA 1DAPA 2BR3A 3AEUA 3HFGA 1DQRA 3P9KA 1VMDA 3PF8A 5JSZB 4R01A 5G1NA 3GJYA 4XASA 3ENZA 1CD5A 2YRFA 3LBAA 1GQOA 1LX7A 1MAAA 2Y0EA 4IHKA 4JSTA 1WW2A 4BU0A 3C7AA 4F2PA 1VYVA 4YCDA 5K51A 5C51B 4CKCB 4EPVA 4G0VA 1VP3A 1N9ZA 1WJGA 4XIGS 3X1YA 1TF7A 2OBYA 4BO6A 4Z6KA 1KEKA 3CNEA 4N5HX 2I6XA 2VPXA 3E5RA 4B75A 5JPDA 1PR5A 1KF0A 2WVAA 5GIOE 3IILA 3L0CA 3IXMA 1Q7BA 4IZIA 1YULA 1AM4D 2FRVA 3VAZA 4AWXA 5AW0A 2QIPA 5E8RA 3ME5A 1IY9A 3ZQ6A 4E5KA 5IJZA 4BLRA 2Z6UA 4KWEA 1C1YA 2IXBA 1N2HA 3BS4A 4INOA 1WQ4A 2XJ4A 4ND8B 5KX5B 1GZUA 1H8HD 2V0CA 3C24A 3VZCA 1C0KA 4HAXA 2M1ZA 2R6FA 4Y2PA 2P4SA 4W9MC 1Z82A 3AO0B 1Z47A 1D4FA 1KZYC 2P4QA 2Y1CA 3KLPX 3PL5A 1XCMA 3KB1A 4IM7A 3PE4A 1M73E 5GOTA 4LJ8A 1K6XA 1XZNA 3IUMA 3L1KA 4E03A 4WK6A 3PWSA 3BWYA 4GPD1 2I78A 2NYRA 5MDHA 1LC0A 1RI4A 2IHZA 3JWIA 2X0DA 3NYQA 4O4HF 4Y2RA 1ZMXA 3ED1A 1SMKA 4GX5A 1R4MB 4CL0A 4ZFNA 1TNDA 1RZRA 4QOJA 1KKLA 2PAFA 4PX3A 4TL9A 4ZZ3A 3UW3A 3DFIA 3SVZA 1D07A 4BZPA 1WY7A 2ZBUA 1X6VA 5E38A 1BSVA 4N5LA 5LOVB 4OAPA 1ILWA 2VNKA 3HABA 5BYJA 1WSBA 3Q12A 3UO8B 2IHNA 4HVTA 5LQUA 5M34A 4F12A 2PZLA 2YZ2A 4GW3A 2XMPA 1MGOA 2C57A 1Z2EA 4BP3A 3D5QA 4JWKA 4QGGA 2BGNA 2OORA 5DXJA 2BJHA 4Z9FA 3DDCA 4LZPA 3KUKA 1T3SA 5H3CA 5A62A 2CE2X 3WMXA 3HCEA 3DLBA 4YAWA 1S8FA 4JSYA 3RJZA 2ZE6A 4KQKA 4L4SA 2XZPA 4TLAA 3KDPA 2CXRA 4F85A 2JAXA 1EFPB 2EWVA 1RHJA 2Q07A 2XQGA 4PSVA 3LBNA 4X85A 3BB1A 2OWEA 4U7TB 1MW9X 4Z54A 1P2BA 2JPDA 1XZAA 1ZM2A 1MPXA 1L5YA 3RS3A 1UM9B 4MIEA 3NTQA 1OBOA 5KNBH 4O0LA 5CM8B 3SF8B 5JVDF 1ZY2A 3TVDA 4YY3B 1Z28A 2IV2X 2WKSA 3EIUA 5CW1A 1U0SY 2RAPA 3O8LA 2A5JA 3QXGA 2C4UA 2EZ8A 4DQKA 1GZSA 4ERNA 2ZUTA 2ZWMA 1W9MA 2FFJA 3CPHA 3STWA 3UAVA 1V96A 3C3AA 3GY0A 4JZYA 2CJPA 2QMEA 4CM1A 5IASA 2O2IA 4YCMA 4WZAB 5DNVA 1POWA 3I2IA 3NBKA 1L7MA 1PDOA 1KP9A 1MTZA 3WNBA 1JJBA 3JALB 5F2NA 1ZCFA 2XXAA 2IUTA 3DO5A 1QGDA 1RTKA 1U7ZA 1SCAA 5JYBA 3M5PA 3EZGA 4MUYA 1LK7A 3HBLA 2CGEA 3QVMA 3U4CA 5JIBA 1JXQA 2XUHA 4N6OA 1NXWA 1X38A 2BFMA 3CZMA 4YN3A 2HXGA 3SHOA 5IYZA 2WV9A 4EG3A 10MHA 5EHGA 4OK3A 2XIQA 1PX0A 3QPAA 3A37A 3AI2A 5DYWA 5IEBA 2F4VB 4PYQA 2Y3IA 3H5TA 2ISSD 4BJ6A 3FKSD 3PICA 5JHGB 1PZGA 2O6LA 2QLNA 3DVAA 5KTMA 2O20A 1NQ5A 1MNAA 3UMGA 4C1NA 3S28A 3PGMA 4N18A 1GTG1 3A36A 3AF5A 4PANA 4PFQA 5BVGB 4PZZA 1VHJA 1XJCA 3V8EA 2HH9A 2I2XB 1PK9A 2NVUA 3H8WA 3KOMA 1DO8A 3PC4A 5HRCA 3WLTA 4DW8A 4QPDA 1C0PA 4LXIA 2ZW9A 4EKGA 2G83A 1RLUA 2HRDA 1RLJA 4G0OA 1GPMA 1UK8A 2X1LA 3ZWAA 3WBFA 2O2HA 2BHRA 1E4VA 2G06A 4NOMA 3SZ3A 4TTRA 1WOMA 3BXXA 3FYDA 2ZBDA 1E92A 1E6KA 5HKBA 1HNWB 3CPSA 3JQBA 1Q0SA 1UFVA 2P6MA 3QEKA 4DZTA 5AICA 2REOA 3C5VA 4PSDA 3I2JA 2DR3A 2JLYA 1H9AA 4GU5A 1WPGA 2WSBA 5COQA 4CT4B 4FNAA 2JLZA 1U90A 3IKJA 4ZTZB 3EG5A 2C8KA 1RHKA 3I04A 2VTKA 3AF0A 4B5KA 2AXPA 3QHQA 3IOYA 4UBKA 5FBZA 3QHAA 3RHFA 2BDTA 4C01A 1J56A 5TGZA 4E7OA 1LSJA 5DN6A 1L3IA 4GUDA 4TV8F 1TZBA 1YCHA 3OQHA 4UCFA 3ZGOA 1HR0B 2O9JA 4IZOA 4Q1VA 1V41E 2P9JA 2V1XA 3AR9A 1SU8A 4X1IA 3Q6MA 4IQ4A 2BCEA 3TLGB 1ZR2A 1G3QA 4R8RA 1UOQA 2I67A 4GMHA 5HG0A 2I34A 4MR8B 4PCLA 1AMUA 3TMAA 1J4AA 3RYHB 3WXBA 1E2HA 3LNCA 3C5HA 5EKSA 1KSFX 2CXXA 3QVLA 4FYJA 4XUCA 1G59A 4MW4A 1UANA 3UPDA 4D41A 1YJ5A 4DKXA 3PF9A 2ZYUX 3ITNA 5JTUA 5BT8A 1ZI8A 1NT4A 2GAJA 2ZPAA 2XWQA 1A77A 2Q8NA 3IT2A 1F2TB 1UWVA 2W93A 1RKBA 1ENYA 3S5JA 1L5FA 1E1LA 1O6ZA 2HRBA 2OXFA 3L5KA 5IAOA 5JAZA 3K70C 5JNWA 1J9GA 1C2YA 1JLHA 4OAQA 4GI5A 4MYUA 3DFUA 2FEPA 3GUVA 3E35A 3UB2A 5CIYA 4EO4A 3COWA 5FP0A 1SKBA 1GGFA 5LQKA 2AYYA 2BFWA 3RU7A 1THTA 1TF2A 1GNRA 1W46A 3AW8A 1P39A 1TD1A 2PT6A 1CZRA 4NZMA 2PJDA 4I99A 2HWXA 2AA3A 3AH8A 2R25B 3EGEA 4O4JA 4OGGA 4U2FA 4XD7A 1SCQA 4AJNA 1FRVA 2AFVA 1M3SA 5DHAA 4F1WA 2EP5A 3LUFA 3ESXA 5L3ZA 3H1TA 4K9QA 2BTQB 4WLVA 4BIIA 2GEVA 2LVBA 5ENZA 3LUPA 1NUSA 2O2SA 2XY4A 1EG2A 4W9RA 1CUIA 1OC2A 1Y1RA 2H0QA 3HR4A 3KSMA 1X86B 4RDIA 4ZCQA 4DA4A 4QC2A 1RRCA 3GJ6A 3N7AA 1ST2A 2Z04A 1NGSA 1P1HA 1T35A 1XZQA 4OB7A 5EMNA 4BFXA 3VTFA 5U9CA 2J9ZB 4HEA6 2BP7B 1DAIA 3HVIA 1NI5A 1TFUA 4JR2A 4D9GA 4Z4CA 1H5NA 4V24A 1OV4A 2X6TA 1ZHOA 1VMIA 3H0CA 1G5RA 1L8AA 1Y5LA 5DGIA 1Y33E 4KO2S 3SQOA 1UBCA 2UZ1B 1CVIA 2XMSA 1B14A 4O4IB 2QLFA 1U5BA 2GJAA 4RK0A 5G0UA 3C15C 2QTHA 3ZGLA 4JIGA 2ZBEA 4CZ2A 2P6PA 1QVWA 1DKNA 1W6UA 2IYEA 1T4CA 2V5AA 3BSYA 4CTKA 4Q4AA 3CMCO 4HDNA 1JVBA 2BD0A 5I7RA 2IYSA 3ITDA 2D4HA 3K6KA 4PGFA 4CM8A 4B32A 2A94A 1TQ8A 2ZVDA 1C7FA 1JFVA 2PPLA 2ZXEA 3LTEA 4XCXA 1XK7A 5HGXA 4W5TA 3NJ4A 4TYPA 3AVWA 2PUHA 4P80A 5IT5A 3FHOA 5UKDA 3QY0A 2P4UA 1DQPA 1DRWA 2O7SA 4QXQA 1Y8QB 3CSSA 1IOLA 4PLZA 3R6TA 4QXRA 4X1KA 1E2GA 1G0OA 2IXTA 4MW6A 5EC8A 2Z2ZA 2VPWA 5AM5A 1CLUA 4QQNA 2OHGA 1T0BA 2XDWA 2L18A 3N2LA 4RADA 4BNZA 4ECAA 1P74A 2O8CB 3BCRA 3PU6A 2WPDA 2Z8YA 4Q3BA 4GICA 2CXPA 2DPMA 2NQ2C 2COEA 5LKRA 2QP3A 2AOTB 3RWBA 3OZRA 4F46A 4S24A 4YJKA 5D84A 3RDPA 4Y67A 5C37A 1N6RA 4ARAA 1U7TA 1I5RA 3QOXA 4Y7CA 2IS4A 3P9RA 1A82A 1J00A 2O3RA 3UG7A 2UVDA 4B6QA 5L3QB 1DX6A 2BGMA 1I30A 1NVVR 1DIRA 1L7DA 2NTEA 2FWJA 1T4GA 2BI4A 2I7DA 1YUBA 3LAWA 5IJAA 4D4JA 1QU3A 1GUBA 1UEJA 2BGLA 4KE9A 4FOPA 3KXPA 3MEQA 4NK5A 2AFHA 1F60A 3K5WA 3KKKA 4PRKA 1BN7A 1EHCA 1KZHA 4GZLA 5F33A 1PFYA 4LF6B 2WVGA 4HDQB 2V6FA 4KQGA 4YVFA 5DHFA 3WGZA 3OZWA 5ED0A 1WCIA 3BGIA 2W6CX 3H9CA 4Q9AA 3CUUA 5C8ZA 4CMIA 5LMUB 4DGQA 5ALEA 5FBQB 4TXLA 1C4WA 4IF6A 5LMCA 4Q18A 4RMJA 4MVJA 4EMSA 5CCDA 4MQFB 3VR6A 3IBTA 5K0GA 4H77A 3KZXA 1CQJA 2I2DA 2YWBA 2BMFA 4IUYA 4ZU6X 4Q3NA 3WZ2A 1GZ6A 1Z4MA 4C7OA 1UXKA 5KBYA 3F4BA 2FPLA 4DCGA 3STTA 5ENVA 2PGDA 2ZSIA 3BYZA 1U2GC 3TH5A 2BFBA 1MXFA 1MB9A 3IOBA 1KO8A 3F6SA 1J0AA 4QE3A 3TOSA 2CYAA 1ZS9A 4L9SA 4MCAA 1D2EA 2ZT6A 3NPMA 1JQKA 1Q2XA 2P9BA 4MLZA 3LLMA 5EZ5A 1CRWG 2BC9A 4BEJA 3HNPA 4WJLA 1BQ3A 2B8NA 1WWKA 1XTIA 1XNHA 2ORWA 5K3CA 4BOYA 5TIIA 2NU7B 2CHFA 1DBSA 3PPIA 3RFVA 1UBHS 1ZA2A 1WA5A 2G5CA 2GF2A 3BVPA 2ONJA 3WWOA 3U6BA 1A4IA 2GEBA 5JXHA 4B9AA 1LB1B 3AIIA 5ILOA 4IWXA 2J6CA 3SDBA 1WHTB 4X94A 3DC2A 1DUSA 2V6IA 4JJIA 4QTXA 2F67A 3CH7A 3EEYA 5EAIA 3WWZA 3KEOA 3QVUA 4BLPA 5BP7A 4NBWA 2ONZA 4LRXA 3OG9A 4JUAA 3V97A 4DMRA 2JJ1D 4UDXX 1TE2A 1OT5A 3SFVA 3ZXIA 2W6OA 3ZZMA 3B9PA 3PDUA 4IIBA 4C4RA 3ZD6A 3OMLA 5AW1A 3NV7A 4ID9A 2B6HA 3IVRA 1HT0A 3KJNA 2ZP1A 4KIGA 1JTFA 4DABA 2YN2A 4URZR 4X84A 5ESDA 4NVRA 1CWUA 1LPOA 1U7UA 1ZRSA 1ZOPA 4U2EA 1WB5A 4QUKA 4N49A 3TUIC 4N3BA 1QG0A 3A4TA 1WW3A 4FNMA 3TLXA 3ZE9A 2PEYA 4ARVA 4C0AC 4YQYA 3G9TA 4ZT6A 1VPDA 2BBSA 4ME6A 4QGAA 5ALTA 4HVAA 3G5AA 4PTYA 4X6YA 5IFLA 3IV7A 1VECA 2R1TB 4BRWA 2P6RA 1YZUA 2G70A 3C5EA 5DPMA 2GD2A 4HSEA 5JMWA 1N6OA 3OZEA 2V7GA 3KJEA 5CHYA 1L7VC 2UDPA 1YHYA 4JI3B 3RYIA 2FPWA 5CLHA 2HMAA 2P3SA 4POAA 5EEHA 3T5PA 1JGTA 3IPXA 1E0DA 2XE6A 4WDQA 1M0SA 2PT5A 1QC5B 2XTAA 3QBTA 4MVJH 4N7MA 2LIVA 1ODLA 3ACBA 3CEPB 5TARA 1I33A 1O0SA 3U7IA 3VR6H 1P81A 4DNFA 3ZLTA 1N7GA 1NSTA 2BTOA 5CEEA 2ROQA 3GJSA 4OF4A 3ZVKA 1BWRA 4E5VA 4H6VA 5LQMA 3IKTA 3R4CA 5J3JA 1YE3A 3IAEA 4AY6A 3E61A 1K8ZB 5IDVA 3G2MA 2ZAYA 3C6KA 3I8SA 3U3XA 3A70A 4M0LA 4YMWA 2XB9A 1FX0A 4JT2A 4DFDA 1YS4A 5FPQA 2UUBB 4JLSA 1JTVA 3T7DA 3ZDXB 5CIQA 2OD9A 5D2CA 3QU7A 5AJZA 5ALGA 5ALRA 1J22A 5BY2A 4UARA 4A8JC 3IOEA 2PMCA 2E5WA 1PE0A 3C6MA 4E88A 3NVDA 3ORSA 4NJMB 2ZSBA 3HKEB 4RNCA 3F46A 1ZMTA 4S1NA 2GAAA 4BB6A 3RHSA 2O8BA 1YO6A 1KBOA 2Z95A 3HBNA 4U5XA 1QP8A 2ZTSA 5G4LA 2C3MA 3UA3A 2ODEA 2B5WA 1UIRA 4CIDA 3V8RA 3MTBA 4ZI7F 3D7LA 1ZCBA 4JLJA 1XDBA 2A0WA 3ZHXA 3A3KA 1NJFA 1UINA 1MJGM 3MINB 4UVGA 5LBUA 1SUSA 4C3OB 5A6SA 3ZN2A 2ZWPA 3CGWA 2G28A 3MMNA 3DNPA 3U7QA 1GSOA 4BV8A 3WBKA 3RVOA 3UHPA 2D1RA 3I9OA 3HWWA 3DULA 4LIPD 3ZVLA 3GLIA 3WGHA 1JSRA 4J0KA 5BVHA 5JR3A 4QUEA 1J8DA 1VKJA 1AURA 1XDUA 2HTFA 3K94A 4DMFA 2AFRA 3B5EA 3V8QA 2BKEA 4RJJA 1B8NA 2ATCA 2WM9B 2Z2JA 1L5WA 4G0PA 5BW6B 3SXUA 4CIBA 4IZHA 1KAEA 1JHPA 1FJ2A 2G07A 4M1TA 4X7MA 4JLMA 2D2VA 1H2HA 1A2KC 4AWAA 2R66A 4C3ZA 3DV0B 3PS9A 4MWBA 2RHGB 1KPIA 1GNPA 2EKDA 3C0KA 4WRRA 4F0JA 1HF3A 3VR4A 2PGIA 1S01A 5IJXA 3IP3A 3I1YA 3CR3C 5FI1B 4DJ5X 1JHZA 4TLDA 4HLUA 4EVIA 5JS7A 4OQFA 1DEOA 1FTWA 2Z09A 2PDAA 3PJFA 4Z2YA 5KYKA 3FLAA 2NV6A 1GA1A 4X1OA 3K2BA 1OYVA 2P77A 2PGXA 2XMBA 3IAUA 5IDYA 3KKLA 4TTTS 1KO5A 1X1RA 2J7PA 4GPIB 1GVNB 2BOVA 4DYVA 3BGDA 5KKAA 4CCWA 3KLBA 2PLWA 4DREA 3HXOA 1I7PA 2DUNA 3PTAA 3AOEC 1RE0A 3JYLA 4EY6A 1J5EB 1IEXA 2W4IA 3H5AA 5C1PA 5JBQA 4ZCLA 3L18A