1QZ3A

Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
309
structure length
309
Chain Sequence
PLDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVKKEPVAEVREFDMDLPGRTLKVRMYRPEGVEPPYPALVYYHGGGWVVGDLETHDPVCRVLAKDGRAVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAAVTSILAKERGGPALAFQLLIYPSTGYDPAHPPASIEENAEGYLLTGGMSLWFLDQYLNSLEELTHPWFSPVLYPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQFYSLSPGATKALVRIAEKLRDALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CARBOXYLESTERASE EST2
publication title A substrate-induced switch in the reaction mechanism of a thermophilic esterase: kinetic evidences and structural basis.
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
total genus 110
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qz3A00
4FFWA 2D0DA 5AK3A 4EBBA 2XUOA 3O4JA 4OSEA 3QMVA 4IQ4A 1IUNA 1H2XA 2XLCA 3WK5A 3BIXA 3BE8A 4HXGA 1KEZA 4K2AA 3C8DA 4BZWA 4GBGA 2VQ6A 1BROA 3FVTA 3HI4A 1SFRA 5DLPA 3LCRA 4Y2SA 4F0JA 4KAAA 2GBFA 4QNNA 5AI8A 2VT7A 4IHAA 5AI4A 3G9ZA 3C6BA 3AJAA 3WQHA 4BTLA 2DQZA 2CJPA 1YA4A 4WFKA 2IITA 2XUGA 3IUNA 1LLFA 4N5IX 2J3DA 1O6FA 4QDUA 1QE3A 2VATA 5ALEA 1CUXA 4CIAA 2QTBA 1R3DA 5LKAA 1GPLA 4UHDA 4KJXA 1THTA 4RNCA 4BRZA 4KAFA 2OXEA 2IIVA 4OCZA 2RHWA 5ALYA 4BE4A 4B0PA 5HCUA 5ALZA 2PVSA 1QO7A 1ZI6A 1CUBA 5ALKA 5JZ9A 4EY6A 5ALJA 4QEKA 1G5FA 1N8SA 3C6ZA 4AZ0A 3H2HA 3WZLA 2XMCA 2HU5A 5KBYA 2C58A 1CIJA 1QFSA 2EDCA 3I28A 2ACKA 3STUA 2JIDA 4DMCA 1Z68A 2J4FA 4DSZA 1YR2A 1R1DA 4FOLA 5AICA 3D2AA 4DMFA 1EVEA 2V96A 4BTVA 4DTCA 1ZD2P 2XUFA 5AM2A 1EK2A 4C6HA 3KWJA 2DCMA 4BC0A 3GELA 3OURA 2AJCA 4GHWA 3IA2A 5AK6A 3AIMA 3UUEA 4Q82A 2G63A 1ACLA 2I3ZA 1LPSA 1X70A 4RPCA 4UBIA 2WM2A 1QIJA 3RK4A 1H2ZA 1QFMA 4Y2PA 2WUEA 2C0QA 4NMWA 4Y2XA 3A6ZA 5DYTA 3R3VA 1QIEA 1YAHA 4QLOA 3SK0A 1MAAA 3WL5A 2WHRA 1U65A 4CFSA 4I4CA 3STVA 4CG1A 1LBSA 5LZ2A 2YXPX 3DQZA 4Q3OA 5A2GA 1XZMA 3O0DA 4FLEA 3WYNA 5EHNA 1EXWA 2Z8ZA 3I2JA 1RYYA 1AUOA 3D2BA 3H0CA 1FFEA 1UK6A 4B0OA 4H7DA 1A8QA 5D6OA 1CUWA 5BWBA 1XRMA 3PUIA 3JYHA 4J0IA 2G4LA 1CUSA 1ZD5A 5DYYA 3ZLTA 3D59A 2FUKA 2WQZA 1MAHA 3PI6A 4KE8A 2HA6A 1VZ3A 2XUHA 4W63A 5EIHA 5I9IA 5KWJA 2WJ6A 1VXRA 2VT6A 5T4FA 1W4LA 5FXMA 3X3HA 4E15A 1MX1A 2PSHA 3BL8A 1J1IA 3OM8A 4AO6A 4PO3X 1PV1A 4E14A 3CXUA 2B9VA 1I6WA 3G9TA 4I19A 3I6YA 3QBJA 1O6GA 4HS9A 4AZ3A 3F9CA 4OU5A 2ZSIA 4UFOA 5A6VA 1R4ZA 3A2LA 4L72A 1W1IA 5CT8A 2JGKA 4F21A 2WTMA 1A8UA 1VZ2A 2O7VA 5ALMA 2J4CA 2QM0A 3GZJA 2B61A 2XUKA 3AIKA 3WK7A 3WJ2A 4BBZA 5BV7A 2XUQA 4H35A 3G9XA 1E66A 4UBMA 1ODTC 1K6EA 1FFCA 4DNPA 3ANSA 2VJDA 4X7BA 4QE3A 2XQGA 3FWHA 1BCSA 4JYPA 3WJ1A 5EHQA 2VJCA 5AKHA 5T4HA 2GYUA 4DSAA 4KEAA 3C87A 3O9VA 3VDXA 3PDCA 4DIUA 2I3DA 1F8UA 1WOMA 4DYHA 5ALSA 4HXEB 1U8EA 1CPYA 1TIBA 5CH8A 3KWFA 1CVLA 4C89A 2QJWA 1XZAA 4J0JA 3IBTA 1NU8A 1CEXA 1CUZA 1BEZA 4MYDA 1ODSA 2HA2A 5ALHA 3VISA 4GECA 4Q3LA 4CI9A 3VVLA 2B4KA 1UT6A 1WB4A 3ESAA 3HRHA 4ARAA 2BCEA 1CQZA 2OLEA 2C5GA 3WA6A 5JAPA 3AIOA 5K3EA 3OC0A 3IDAA 2QXUA 2XMDA 4BZZA 2WFLA 2XUIA 4U2FA 2HA0A 4UBNA 3FOBA 1EH5A 1JI3A 5AP9A 4BVKA 1EHYA 2OCKA 3HZOA 3I2FA 3FNBA 3WWEA 1W75A 1GT6A 3EF3A 4ZV7A 4OYLA 4FKBA 1CLEA 1CUCA 1FFDA 2PSJA 3I2IA 1F0PA 4BDTA 4J0HA 5AJHA 2HA5A 5BOVA 1XQWA 1FFAA 5T4EA 5AOBA 2QRUA 1Y7IA 1SC9A 2ECFA 4W1RA 2WIKA 5E4YA 4BB0A 4QWWA 2AJLI 1EDBA 3ICVA 5JAUA 4D9JA 2Y2UA 5AIBA 3OTQA 2C5FA 4MEAA 4A23A 3WK4A 3ICWA 4X93A 5FUMA 2AJ8A 4AQDA 1MT3A 3G0DA 3IB3A 4BE9A 3K2IA 1EK1A 1GQSA 1MX5A 3VVMA 4H7IA 5C7YA 4BP8A 5CXUA 2O7RA 3QITA 5AH0A 1D07A 1MN6A 2C4HA 1WM1A 1XZFA 1Y37A 1HL7A 2BKLA 3YASA 5AKGA 3KSRA 5IVIA 5DNUA 2PSEA 4Q05A 5HK8A 2W22A 1F0NA 1HKHA 4INZA 4BAGA 1AGYA 1WPRA 3DKKA 3IULA 1DTEA 1AZWA 3GBSA 3O4IA 1MTZA 1JMKC 3HC7A 1BEEA 1LBTA 2PU7A 3FVRA 5KREA 1EB8A 5AI5A 4U2BA 5K3DA 1N1MA 4BRSA 2WG0A 4C4YA 4X6UA 3A70A 5AIAA 1GPKA 3GUUA 4X85A 1GXSA 5FLKA 3S8YA 5DYWA 1VE6A 1CRLA 3FYUB 4H77A 1J07A 4AO7A 4M0EA 2RHTA 2XUAA 1H2YA 4FHZA 4HTAA 1SCKA 2CB9A 2WJ4A 4IH1A 3E0XA 3DD5A 3LLCA 2AXEA 3M82A 1TK3A 3PFBA 5ALPA 4UFNA 3STYA 3H04A 1A8SA 3U1TA 1XQXA 2XQJA 3AZQA 2ZYHA 2XMSA 1ZD3A 5HZGA 4TVKA 5CH3A 2JGIA 1BS9A 4B84A 2PUHA 4Q3KA 1BE0A 3SC2A 1DWOA 4C87A 5DNVA 2OPHA 1CUAA 5CTAA 5C8VA 2H9YA 4ZXFA 4UFPA 3IVMA 3L1HA 5ALUA 5KWIA 5ALFA 2I78A 2CUTA 4X95A 2Y2VA 3MGAA 1T2NA 5ALIA 1LPNA 2ZJ7A 5IVDA 3O95A 5AK5A 2V98A 2Y1KA 3W2TA 2HU7A 4FNGA 5DNWA 3BDVA 4FFVA 4QDZA 3EBLA 4G5XA 3R40A 3OPMA 4MYSA 1LPAB 3D0KA 3W05A 3C45A 4K6HA 4PW0A 2RONA 1BN6A 1G66A 2O2GA 2JGJA 4B80A 4KRXA 2OCLA 1UFOA 3EQ8A 3WWPA 5A7HA 4FLMA 2VJBA 4BDSA 1S8OA 1XRQA 2RI6A 3P2MA 5CH5A 5HF5A 3PFCA 2WFMA 4WJLA 4J0DA 4UHHA 3B3QA 1B6GA 1ZIYA 1ZGCA 4ITVA 4MWSA 4X00A 4G1FA 2GBIA 4B82A 4EY7A 2ZSHA 3A2MA 1UK8A 1QTIA 2BUBA 1XZHA 4DNQA 1DWPA 3IUQA 3ESDA 5JASA 3PE6A 3WK6A 2OCIA 4UBLA 1Y7HA 4B81A 4NS4A 3G0GA 2WHPB 5ESRA 2JGMA 4PF1A 4U2EA 4JH0A 1UWCA 3E3AA 3G8YA 2WHQA 5AKXA 5JARA 4W1QA 2QXTA 2V97A 4LYEA 3QMMA 3TEJA 5HFAA 3GFFA 5JADA 1UKAA 3R3YA 1K8QA 3T52A 1E8MA 1OXMA 3EIOA 3DS8A 3MUNA 1MU0A 4UPDA 4P93A 5EIAA 2P8SA 3ZV7A 4X91A 4Y2UA 1TKRA 3OG9A 1EINA 3V1MA 3ZLVA 5HKAA 3H17A 1EA5A 1QONA 3UMJA 4M0MA 3QYJA 5LLSA 3D3NA 4LIPD 2X5XA 1DWQA 1M33A 3O4HA 3WIBA 3D7RA 4GI1A 4E46A 2Z3ZA 1ORVA 5T4BA 3IUMA 2GZRA 4E11A 1C4XA 4KRYA 3DL4A 1E5TA 3HACA 2YH2A 1ZGBA 2JEZA 3R41A 4MJ3A 4LHEA 3STXA 2ORYA 2QJRA 4G4GA 4ZWNA 2VTVA 3PUHA 4HAIA 5ALXA 3NWOA 4ARBA 2BGNA 1ZICA 1ZOIA 2K2QB 1FJ2A 5LZ5A 4F60A 2XMGA 1P0QA 3CN7A 5CXXA 2Z3WA 3BWXA 2GBGA 3H2GA 1UOOA 5HFNA 1YA8A 1YB7A 3M3DA 5A62A 3DDUA 2QKYA 3R3WA 1EDEA 2XUJA 1E8NA 5AKLA 3WLAA 4LYDA 4V2IA 3VKFA 5AKYA 4Y2JA 3ZI7A 4PSUA 5EIEA 4HXFB 2WUGA 4MWTA 4OD0A 5K3BA 4C01A 5IH7A 4ZREA 2XI4A 5AM3A 3GROA 3QM1A 5FDFA 3FLAA 1UOPA 4Y2QA 2I03A 3WI7A 3WL8A 4ETWA 1L7QA 1Q0ZA 4QDTA 5E4JA 1LPPA 4MQMA 2YASA 4UBJA 3FYTA 1LPOA 4FLFA 4S0XA 3WA7A 1DQZA 4HVTA 2HIHA 2V9ZA 1JMYA 5J3JA 3DNMA 3W06A 5JAHA 1XZBA 1PJAA 5HKBA 3WZMA 5LP1A 4OB6A 1OCEA 3RM3A 1TCCA 2ZJFA 2CKMA 3W9BA 3DLTA 2XE4A 1IUOA 4A5SA 2ACEA 1J2EA 5AM4A 2ZVDA 1JU4A 1IUPA 3H2KA 2EEPA 2WILA 2VJAA 4FTWA 3RARA 3ZWQA 4K6GA 5F4ZA 1UK9A 1B41A 4AMZA 4P9NA 4FDMA 1OILA 1YB6A 5CMLA 3R3XA 3QPCA 3FSGA 1G42A 4ZGBA 1RP1A 3R3UA 2WU3A 5AKZA 4NVRA 3NUZA 1W52X 1ZJ4A 1H22A 2O2HA 1NX9A 3WKCA 4H7FA 3WYDA 4GEGA 3NGMA 4JNCA 1AC5A 4DMKA 4X92A 4CCYB 3AILA 1EX9A 4RE6A 3DKRA 5CRIA 5ISMA 1HBJA 1U2EA 3CN9A 3HXKA 4F5ZA 2D5LA 1H23A 4X90A 2PUJA 3DOIA 4BAUA 4H18A 4P92A 3WIOA 3PF8A 2VA9A 4MXDA 1HQDA 3O4GA 4C4XA 4N8DA 3VXKA 5I7UA 4HRYA 2W6CX 4QDOA 5AK4A 1QIFA 4FWBA 4XJVA 1FFBA 3WKEA 1Q83A 1CR6A 3QPAA 4KYVA 4G4JA 3RKSA 3B5EA 1CUGA 4HZGA 4J3JA 2NW6A 2FJPA 2R8BA 5JYCA 3ZLUA 2BAGA 5JD5A 1LZLA 5AM5A 3F67A 4QA9A 2QVBA 2XMRA 4MQLA 3SX4A 4BVJA 4I3FA 2PSFA 3C8HA 3DYVA 6YASA 3WWOA 3N2ZB 2XUDA 4J0KA 1W76A 4XVCA 3HLKA 2QOEA 4AMYA 3STTA 2BGRA 4Y2YA 1DT5A 4GW3A 2B20A 2G5PA 1LGYA 1UKCA 1QIMA 4L3WA 2E3JA 2JGLA 4OB7A 1QIHA 3CCBA 5LZ7A 5EGNA 2WU4A 5C81A 1GPNA 3BJMA 3H19A 1DX6A 1VXOA 4G8BA 2OGSA 1VA4A 1SCIA 2WKWA 5EFZA 1Q84A 1ZI9A 1HDEA 2QUBA 2GYWA 5HF8A 3RLIA 4DMHA 5FOQA 2J3QA 4C4ZA 1DQYA 2QS9A 1NU6A 3W9UA 1ZI8A 1ODCA 3D5EA 3AZPA 4YK7A 3K9BA 3AINA 4X94A 2BJHA 5HQ3B 1XKTA 1MX9A 3LIIA 2HRRA 3WKBA 1BCRA 4RE5A 1THGA 1SCQA 5FPPA 1AMNA 4QLAA 4B6GA 3GA7A 2VAXA 3DOHA 1QTRA 1N5MA 2PKYX 1VE7A 2QMQA 1QIDA 1W6RA 1YSCA 3IIIA 2JGFA 4L9AA 5LIPA 3F97A 5K3CA 2WIJA 4N8SA 4KE9A 4W1SA 4ZV9A 3PICA 3WWCA 4RGYA 5FP0A 1JJBA 4KE7A 2QR5A 3HYSA 3FLEA 4U2CA 5H3HA 3WK9A 4OB8A 1XRLA 4CG3A 1GQRA 3JWEA 5I8PA 3IUJA 1BRTA 4H7JA 2FJ0A 3VJLA 2G5TA 5E4TA 4Q34A 2BUCA 1EVQA 1MJ5A 4EA6A 1XZJA 3TGLA 2WFZA 4B9AA 3VJKA 1XZCA 3C70A 5AKEA 2HM7A 4J0CA 1VJ5A 3D4LA 2H7CA 1WB6A 1XZIA 2PU5A 5K5EA 1G4HA 3G9UA 2CBGA 2JGEA 1CV2A 5JIBA 5DTJA 5A71A 1K63A 5ALQA 4U2DA 3BJRA 2CMFA 1UK7A 3I2HA 5EHZA 2WSLA 1WHSA 3KDAA 3N0TA 4JUIA 4H7HA 1XZDA 4Y2VA 5ALNA 2OAGA 5CW2A 2Y6VA 2Z8XA 1XRPA 2DHEA 2JF0A 2XQFA 4Y9SA 5SYNA 5DWDA 1F6WA 5HK9A 1YS1X 4H0CA 1A7UA 1LPBB 3DCNA 1WHTA 1K5PA 3M83A 5AI6A 1YS2X 3V1NA 2PSDA 2C7BA 2IX9A 1AKNA 4G4IA 1DT3A 4AB1A 3QMWA 1A88A 1MNAA 1QIKA 2GYVA 5ALRA 3F98A 3MUOA 2WFLB 3M81A 4EY5A 4H7KA 1L7AA 1R9MA 2WUFA 3R0VA 3HABA 4ZRDA 5JD4A 3B12A 3FAKA 3KXPA 1E8DA 5CBKA 5CURA 1R50A 3I6MA 4YASA 4HRXA 5ALOA 4CCWA 3U0VA 5CT4A 3H2JA 3LP5A 4K5QA 4UHBA 3AFIA 3HSSA 2HFJA 3KOOA 2XLBA 1CUHA 4G8DA 1QJ4A 3LIPA 5CT6A 2WJ3A 3AZOA 1AURA 3O9MA 1XQYA 2HL6A 3H1AA 3IURA 3ED1A 5SYMA 1LPMA 1P0IA 2XQKA 3C6YA 2WG1A 2OGZA 1IMJA 2PL5A 3ZPXA 1Q0RA 2WIGA 5AM0A 5AHXA 3NOXA 4IH9A 2CZQA 5LZ4A 1MO2A 1WCYA 2XMZA 4P08A 1PFQA 5AM1A 2BFNA 4DM7A 1WB5A 4JEIA 4IH4A 5FV4A 2H7XA 4CG2A 5EI5A 1CUFA 2ZYRA 4CCYA 1TCAA 2AJDA 2DR0A 3FBWA 3E1GA 2RIPA 2QUAA 4Q1VA 2WIDA 2JEYA 2R11A 5AKIA 4L0CA 1XRNA 5K3FB 1HPLA 1EDDA 4O08A 3WL7A 1ETHA 5D3KA 1UZAA 4DGQA 2GBCA 1E89A 4G9EA 1EB9A 3I1YA 1N5RA 1P0PA 2ZYIA 1MNQA 3G7NA 4J0GA 5BWCA 2XDWA 3V1KA 1XZEA 4Y2RA 4ZI5A 2UZ0A 1EI9A 5D3ZA 3OOSA 4WY5A 1XZLA 1MPXA 3C5VA 1TCBA 2HHAA 1QIGA 4BP9A 1AX9A 1T4MA 2PPLA 2EDAA 2CEKA 2ZYSA 4K6KA 5ALWA 4UHEA 1QLWA 3EQ7A 4Y2TA 1LZKA 2Y6UA 1JJFA 4YPVA 3FCXA 1XQVA 1CUJA 2VEOA 4KR0A 5AOAA 2WLSA 1R9NA 1UXOA 3DL7A 3QH4A 1GZ7A 1HLGA 3T4UA 3I1IA 1H2WA 3SWWA 3JW8A 4GWLA 1ISPA 1QGED 2XT0A 4J03A 4X71A 3BXPA 3MVEA 4OYYA 2JBWA 3FYUC 5AI9A 2PX6A 2DQYA 5FKJA 1CUDA 1DU4A 2HA3A 3R3ZA 3G0IA 3C5WP 3L1JA 2VF2A 1X2EA 2XB6A 4UUQA 1CFJA 3C6XA 1QO9A 4N8EA 4PSCA 4X6XA 1CUEA 3BF7A 3H18A 3D2CA 4UBOA 1CQWA 5IKXA 5HQ3A 3DJYA 4B7ZA 4B9EA 4H7EA 1XFDA 4X97A 1KU6A 1UOQA 5FRDA 2OQVA 3DEAA 4FNMA 2H7YA 3AUKA 2ONCA 3V9AA 1XLUA 1JJIA 1GKKA 4W9RA 2YYSA 3FYUA 1TAHA 3FSGD 1QIIA 1JU3A 1XROA 4IO0A 3C43A 3TRDA 5JZSA 4KAJA 2WUDA 4LKOA 5ALTA 4QWMA 5HF6A 2QZPA 3E4DA 2HA7A 4EY8A 3V1LA 4OU4A 2HFKA 4XX1A 1C7IA 4PNZA 1YCDA 1BN7A 1K4YA 3QPDA 4WY8A 4NZZA 4WDRA 1XZGA 1VOTA 2OQIA 1FSSA 1JT2A 3F8SA 3WKAA 4YX9A 5ALGA 1JFRA 3W04A 4FBLA 2LIPA 1R88A 3HJUA 3ILSA 2OGTA 2GZSA 5LZ8A 3Q8WA 1VA5A 7YASA 4UHFA 4A16A 3A2NA 5AI0A 2WG2A 4EY4A 4G9GA 4WCVA 3FCYA 2DHCA 2RAUA 5JZBA 4BC1A 1ZJ5A 1TQHA 3S2ZA 2HADA 5JD6A 1GGVA 1YAJA 2OAEA 3PF9A 4C88A 5YASA 3FLBA 4AO8A 5FPQA 3H1BA 1CUVA 1CUYA 3CCCA 1UKBA 4GXNA 4KE6A 1E3QA 2AJBA 2RGUA 4EZIA 2XUPA 3H2IA 3BDIA 2H1IA 2VSQA 3DYIA 4M0FA 2ROQA 4XWGA 4G8CA 5CT9A 4AXBA 4BVLA 2HRQA 4OUKX 5DTIA 2X8BA 4KACA 1SOMA 5JALA 2WTNA 4EHBA 3V48A 2C0PA 3G0BA 3G0CA 1XKLA 2VAVA 1KU0A 3I2KA 5CT5A 5AO9A 5C8ZA 2DFPA 3WKDA 3QZUA 4Z49A 3KD2A 4TPKA 5ALVA 5C8XA 4GDMA 4PSDA 3VJMA 5JAOA 1P0MA 3Q0TA 2DSNA 1YASA 3BF8A 4J7AA 5EHXA 3F96A 2WIFA 4PV7A 4BCDA 3EQ9A 3ESBA 4DLNA 3ESCA 1WPXA 4EB0A 5D7BA 2PM8A 4BCBA 2WHPA 4OPMA 4WFJA 5LKRA 4QDXA 1AQLA 5LYYA 2XQIA 1GKLA 1XRRA 1JKMA 4X3CA 3WK8A 5HF9A 3L1IA 1XZKA 1J06A 1DX4A 5E2IA 4BCCA 1XLWA 2O2IA 2ZJ6A 4DNOA 4DNFA 2XMQA 4UBKA 4WFIA 5JANA 2QT9A 1RWQA 2FX5A 4N5HX 4AN1A 5AKJA 1QZ3A 5AKKA 4LXHA 1USWA 2XMBA 1ZIXA 4AN0A 5K3FA 3I6ZA 3I2GA 4X6YA 4ROTA 5A7GA 5ALLA 1LNSA 1BU8A 1VLQA 4GLBA 3WMRA 4EUSA 2ES4A 1U4NA 3ANTA 4TGLA 4LXIA 4CIBA 2DHDA 1ACJA 2HA4A 5AOCA 4BYMA 2X76A 4FBMA 1C7JA 2HDWA 5LZ9A 4UHCA 2Z5GA 4BAZA 1ORWA 1ZD4A 3STWA 4LXGA 3LS2A 4JYMA 5JATA 4MEBA 3BIWA 3UUFA 5K3AA 3QVMA 4FMPA 2OCGA 4WDQA 5DJ5A 3WWDA 1CUIA 4XIIA 1X2BA 3G02A 2HU8A 1VKHA 4U2GA 4Y7DA 5A7FA 4B85A 3TJMA 1XLVA 4BATA 1L7RA 1IZ8A 2Q0XA 4QZVA 3K6KA 3HEAA 1IVYA 4B83A 5ALDA 2PBLA 4W1PA 2OG1A 1CUUA 4AX4A 1DINA 1TRHA 3WL6A 1IZ7A 4PQEA 2BUAA 5IVKA 1QOZA 5IVHA
chains in the Genus database with same CATH superfamily
1PWEA 1ORDA 1XCLA 2QF7A 3CJRA 3K9FC 3EUAA 1RWXA 3UJCA 3F6RA 4MP3A 3UMFA 5KKNB 2G1PA 2AQ8A 5HMMA 1V48A 3IP6A 1V37A 3BORA 3GJXC 4F1JA 4M9CA 1U99A 2OP0A 1OH8A 3JR7A 1U28C 4PG6A 3VNSA 1KWKA 1JVBA 3VU8A 3H13A 3KTFA 3B89A 1RWPA 2JFPA 3BIXA 1J0XO 3N2GA 3V97A 4MUFA 1BMDA 1T4CA 1SULA 3LJKA 4K2AA 3C8DA 4X3OA 3SF8B 1WDTA 4MQFB 4UTVA 4EFKA 2IHZA 4LJ4A 1PVOA 1BROA 2RH9B 1Y8AA 3HI4A 1NN3A 2HWKA 1FMLA 1RPTA 3RHFA 4JQYA 3B3JA 1T6NA 1M1YA 3C3JA 1VHWA 5DFAA 4M76B 4E07A 5DLPA 3BQNB 3LCRA 2OBNA 2PA0A 3WGHA 4WLOA 1NJ6A 4LYFA 3LWZA 2WD9A 3QK7A 1DQRA 1CYDA 3NAMA 4KAAA 6GPBA 3ENWA 3AL0C 1CJBA 4Z0HO 4IQFA 3HJHA 4WHMA 3TO5A 5CXQA 2H1FA 1JE1A 2E1PA 1TXGA 5AI8A 2VT7A 1ODKA 1RS0A 3HKBB 1O5IA 1TTQB 2WKQA 5JQWA 5KSOA 1QCYA 2XSZA 8ABPA 4NXNB 3FYCA 3E0QA 3Q3HA 3HGQA 2B1GA 3RUFA 5BN1A 2A0FA 1SOUA 1TMOA 3AJAA 3AHGA 4HGPA 1HRKA 4PS0A 4WXYB 1P60A 3LECA 4DLWA 2FRXA 3W6OA 1QPZA 1XCBA 2BEVA 2FVYA 1VJRA 1UAGA 4Z4IA 4FC7A 5H3LA 4P84A 4F72A 2DQZA 3H75A 1BYIA 1ZAYA 1YA4A 4WFKA 3G2QA 1T0JB 4TV8F 2Q9UA 2IYZA 1JXMA 4IVRA 1XKXA 2FRDA 2JI8A 4OHVA 5HE8A 1QKJA 5T3YA 3SBEA 1M5UA 2O5EA 1PEAA 2J1LA 3TLBA 4BLWA 2J3DA 2C29D 4DPKA 1HFKA 1ENYA 1UBEA 4HNQA 1O6FA 1X87A 3AUJB 4DVJA 5JYBA 3PT9A 2W6JD 4Y30A 1QE3A 3TGWA 1LVUA 3H9UA 4ZCTA 3DPIA 4WCFA 1G3QA 4P82A 5I9TA 5SYAA 5CVCA 1A2QA 2W6IA 4C30A 4GWGA 1T3GA 2QTAA 3ESZA 3DEYX 3JZAA 3QG1A 3IQEA 3AF4A 1GPLA 1U0NA 2Z58A 3IR7A 3PX3A 2DULA 2AD5A 4EUNA 2VHEA 4ARCA 1US8B 1ESZA 1HV8A 2CHGA 5J40A 5L3SB 1HR0B 4R8MA 3KR1A 4HWGA 4MR8B 2JAQA 3PT5A 2HF7A 4Y9UA 4FZ3A 1XF1A 3WNCA 1WEHA 5A0FA 1CR0A 1ONBA 3L5KA 1PK9A 4QUHA 4DLLA 1YDWA 5KVCA 3KQKA 4BMVA 2WT8A 3U4DA 2Q5IA 2O8EB 1Q1NA 5KNDH 2IIVA 3AR4A 5JJBA 1SPBS 4HO1X 4OCZA 5A4IS 1UJ5A 5BMVF 4J7UA 5PGMA 3CO5A 5EQJB 5ALYA 6Q21A 1OZFA 2IZ7A 3PPVA 5K05A 1VKJA 1XBTA 1OAAA 4IDOA 1AVTA 3CR3C 4JLUA 2D0PB 4LRTB 3VVCA 3W2FA 4B0PA 3L8DA 1ZI6A 2PR7A 2R66A 4OTZA 4QBIA 5ALKA 3UMRA 5INTA 3NT4A 4YO7A 2Z2KA 2BBSA 1Q7GA 3L84A 4ZKEA 4GSLA 2C98A 1N8SA 2NQ2C 2EIXA 3O82A 2PFSA 4AKHA 4IV8A 3ZLBA 3HEBA 3PWSA 3C6ZA 4A8TA 5K8JB 1VQ1A 2NXWA 3R9XB 1ZUD1 3VGJA 3ZXYA 1O03A 2G6BA 4GGMX 3OBBA 3SBDA 1EUDB 3WQQA 4ND5A 2RAFA 1B8NA 4ZRMA 3JQFC 3E84A 4L78A 2H5LA 3OFKA 4O5OA 1ZW6A 2C58A 1G5TA 4YQYA 1EFRA 4Z4CA 2EDCA 3WSWA 1V43A 5WRFA 1PS9A 1G5QA 1NASA 1F6BA 1RM5A 3QYAA 2BZSA 3STUA 3FWZA 3LSTA 4HX5A 4UEKA 3OO0A 1CY6A 1Z5ZA 2XKAA 3IQFA 4K9RA 1KE1A 3THXB 3VC7A 2H2FA 3BH6A 4HGNA 4ZVOA 4BO1A 3RJTA 4BWYA 3CBQA 1Y3BE 3O74A 4IF6A 1FS5A 2LPMA 3GT7A 1KAEA 3LLMA 4R1UA 5EZYB 3SBXA 3W34A 2EHJA 1J9GA 2VQ3A 4MA4A 1VLHA 2GN0A 2OT3B 2Z1NA 1Z45A 4IKOA 1M34E 5F78A 4E30A 1VPLA 2CYBA 2LCIA 3D2AA 4DMFA 1EVEA 3AHCA 1HYBA 4BTVA 1PL0A 2JLBA 4E5MA 1RKXA 4ZN6A 4DR1B 2HMWA 4AD8A 3MOSA 1R7RA 2XUFA 5AM2A 1I4OA 5A0TA 3M4ZA 4PCUA 3DXXA 2J3LA 1Z83A 3CUSA 1UBCA 4Q18A 4CIVA 5L3VA 5DE3A 4CTMA 2DCMA 2PUDA 5IM4F 4BC0A 3BIJA 3IR5A 3T12A 3ZQJA 3AF0A 2X8JB 3Q40A 1DUVG 2D2XA 5IBRA 1P1FA 4IQ0A 3VVBA 2MTBA 3R6GA 4DLAA 4B2PA 3A37A 1G1MA 4FDAA 5AFSA 1Z15A 2BFCA 5AK6A 1KMCA 4BNLA 3H99A 1S2LA 1LDEA 1G20A 3EZLA 3MQFA 3PUYA 3TTWA 3UUEA 5CM2Z 2O3SA 4DMMA 1ACLA 3GBPA 4QXOA 1PYDA 1LPSA 1TDJA 4HNAB 2NYUA 3N3BC 3OQIB 4P33A 4W9NA 1C3XA 5FNVA 4MWGA 3N7UA 3UXYA 4Y7CA 5KYYA 5IYZB 1TTPB 3AUXA 3P2IA 4GNKA 4G5OA 3SICE 3ZWYA 1V47A 3L4EA 4CF7A 2P2GA 3F6EX 3RK4A 3CZMA 3ROZA 3FGZA 6PFKA 4FIDA 4IY1A 1H2ZA 4INJA 2CSXA 5LQNA 1O57A 1QFMA 1XL0A 3AR3A 1WW3A 2C0QA 1OH5A 2O8BA 5TSDA 1A5ZA 3QW4B 2IE8A 2FPGA 3GGCA 4PLVA 3R3VA 3T7AA 2X4IA 1ZD8A 4M9XA 4GFDA 4BVEA 1IHDA 5C1BA 3JAKB 3LM8A 4EF4A 2BM9A 2CVHA 2VRCA 3A28A 2GAIA 3OPNA 1TM2A 4HHEA 4O29A 4OXIA 3RUEA 1AOXA 1M0EA 1BVHA 4DEYA 1ZHFA 4QLOA 4MI9A 3OX1A 3P20A 3WNZA 1MAAA 4O2BB 2VXYA 1FQJA 3ER9A 3BJZA 4RM2A 2D2VA 1TM4E 4I4CA 3U7JA 1E1CA 1U0EA 4K88A 5THKA 3EMBA 3DLBA 4RANA 4BKOA 3GY0A 1PNOA 3NAGA 4NE7A 4XVUA 5KYTA 1AF4A 4EG5A 3DQZA 4G2TA 1MRSA 4MRNA 4Q3OA 5BWLA 1GPDG 2V7BA 3ZXXA 4LV6A 4POOA 1W0JD 1CE8A 2P2YA 1BD3A 4KCGA 2VTDA 1Z4QA 3QUSA 3VO2A 1H9AA 3L7AA 2YVLA 3A6EA 5CVEA 4R51A 3ENZA 5G4LA 1CD5A 2HX1A 4WXPA 4CL0A 1ZGAA 2LV8A 4MVWA 1RYYA 4TLBA 1JH9A 5KNDA 5J5AA 2CMHA 2AOWA 3O4FA 5B2FA 1NVKA 1RAHA 3EXIA 3CPEA 1CSEE 2CDBA 3H0CA 2BE9A 2Q49A 2RH8A 1FFEA 5KNBD 2IL1A 3KS9A 4OHWA 5BUZA 3QOYA 5J4LA 1F4PA 3UGKA 2R65A 1A8QA 1CUWA 1GGHA 4MITA 3R7WA 1SKMA 4NEGA 4M9ZA 4O2AB 4EHIA 5BWBA 4TVSA 1LRKA 1MGPA 1SHUX 2CCJA 2IUYA 3PUIA 4DQDA 2SNIE 3AYZB 2AWNA 2ZRLA 5KOHB 2G4LA 1KBQA 3JSAA 3IQXA 3MWKA 2A9RA 1N0HA 4Q03A 3DZ8A 2KHZA 4UU7A 3NG1A 3TLYA 4NONA 5JPCA 2FWNA 3T0GA 2BFAA 2HRDA 2ZI7A 1EK0A 4FD3A 4NMHA 2Z4RA 4M38A 1K4KA 2WQZA 3QXSA 2TMKA 1IB0A 2JFFA 4HZUB 4TQ9A 4ZXPA 1L5MA 3SC2B 4CM7A 5LJIA 2BSAA 1CY7A 2ZI5A 3R7LA 2XUHA 3TFWA 1ORTA 4EDHA 3K70D 3DVAA 1WMSA 3P0RA 5H4GA 1RJDA 1W8DA 4NP6A 4CE6A 1SCNE 2RHLA 1PK8A 3LLVA 3LL7A 4OA8A 1K6IA 2VT6A 3EZNA 5T4FA 3G17A 3K6SB 5AUOB 3GCDA 3EXHB 2AK2A 4DMGA 1PQYA 3JYOA 3A9CA 4MGEA 5FXMA 3R7FA 2PO5A 2PSHA 5LDHA 3COWA 2MSWA 1U6IA 1BHQ1 3BL8A 1V35A 4EO7A 1EJ0A 4KAXA 2JFNA 2RCNA 3K35A 3OM8A 4IBOA 2JFOA 3ZIAD 3WYGA 2CMGA 3HKEB 3NXKA 2ISQA 1QDLB 2B9VA 1II9A 2WD7B 1LJ8A 2RGNA 4V2UA 1XRSB 4I19A 2IY8A 3O3MB 4NKRA 3U2QA 1EWQA 4ARVA 4DCVA 2WC1A 2J9GA 1NVUQ 3FPEA 4PO1A 4Q9AA 1BGVA 1PZFA 3EIFA 1BAPA 5EESA 3DAGA 5C3UA 2ZUBA 3RQSA 4AJIA 2WINI 4ZAWA 5HRAA 4HY3A 5A1JA 4OU5A 2ZSIA 3JASB 1IPFA 3N75A 5JVDA 3GMTA 1CR2A 4CMHA 3GLGB 3ROMA 3NBQA 3BTOA 1VJGA 3LLSA 1O97C 4UJ5A 4ESVA 5CT8A 1HLPA 2H65A 2JGKA 2VJMA 4JBIA 1TYEB 3G59A 2QMHA 3WOVA 2AYYA 5FBLB 1E7SA 1BE6A 3QVTA 4LC1A 1DBIA 5HDQA 4ZAXA 2HO5A 4JA2A 3O2NA 3JQRA 2HT6A 3AIIA 2XT9A 3REQB 3SZ3A 3BPSA 2O7VA 3FPFA 3NEPX 2J4CA 5ALMA 5BW6B 4C0KA 1IBKB 5BVGA 3GZJA 1KORA 3IPYA 4HTFB 4DQ0A 4HYEA 2V0CA 4CEJB 1ZH2A 3KKLA 2YBEA 4FSXA 3GNSA 3WK7A 1WR8A 1WQ3A 3UG6A 1ZN2A 4ABTA 4EG1A 3CUVA 4BPBA 1Z5UA 1T5IA 5DHFA 5G1OA 3JALA 1KNXA 1B42A 2PV0A 1QP8A 3DWIA 4REOA 4BO8A 2CNWA 1XZ8A 3DKVA 4COOA 4HNUA 3CVXA 4QODA 3NHWA 4DKJA 3T5CA 4A36A 3GWZA 1ODTC 5DISB 2H06A 1GSHA 2BRUA 3D6AA 3ZQUA 4DNPA 3VPXA 4CZ2A 5C5IA 3V1YA 3ZKWB 4KITB 2Q4DA 1UPTA 4AX8A 4X7BA 1MJHA 1KARA 2XQGA 2OYRA 3T8YA 2QTNA 3FWHA 2W0MA 3W8RA 2QW1A 4LQCA 4Y6LA 4M21A 2VZ0A 4MUKA 4HVLA 4JLMA 4B8YA 4P22A 4Q12A 2O2YA 3RUHA 4KGVA 5TQ2A 3RRZA 4NPHA 1H0RA 4NENB 5B3KA 1KI6B 2MJLA 4IHKA 1F0YA 3FG9A 2VC2B 2FE4A 1HDXA 4FYKA 4N0PA 3SZUA 4BFWA 1N33B 1T0UA 3ESYA 3M4JA 3TXXA 4J8PA 2FOIA 3O9VA 4RQUA 3PDCA 4EAQA 1K08A 1ZSYA 3F1KA 5BURA 7GPBA 5KYWB 2BSQA 1HQKA 1WOMA 2IH2A 4FB5A 1GSOA 3AM5A 3H4TA 2BGLA 1Z0FA 5A6SA 4UJ3A 3D6VA 1Z82A 1URPA 4DJEC 2Z3VA 3UKJA 3INTA 3VR0A 1CFZA 5ECDA 3BTVA 3RVRA 2EAUA 1CPYA 2FF5A 1GILA 2D62A 2IJGX 1TIBA 3JZIA 5FNVF 4DCOA 4EJ2A 1Y5IA 5HDBB 1U2DA 4PYLA 1EJ2A 5AW0A 2EQAA 4BO2A 5CB6A 1LLDA 2GH1A 5I7AA 3WL3A 2EBWA 1TMGE 2YXEA 3PQ5A 4HRAA 3NVMB 4JQOA 2E87A 3X1ZA 2HI0A 4FS8A 5F7ZA 3R7AA 5FORA 4YYEA 3IBTA 4ENQA 4I1OA 4YWJA 2Z8YM 2G88A 1BEZA 3U6BA 2IEZA 4EA8A 4Q4DA 1NATA 3PGXA 1X7YB 1VIMA 3L7CA 4YMWA 4YAJA 3QU4A 4K6MA 1ZH4A 2Z98A 4DMUB 2P8JA 4GXQA 1DEHA 2ID9A 4RHTA 2PH1A 2QE6A 1CF2O 4Z9BA 3VVLA 2B4KA 1CK4A 1UT6A 2RGGA 3OIYA 3U7QA 4QREA 4ND4A 4G0PA 1HK7A 2FUCA 2X13A 2PQ0A 5E7IA 5H70A 5EKTA 4QYXA 2BCEA 3EEBA 3SPXA 2VDPB 3EBOA 4IF4A 2DFVA 2YIJA 4XTRA 2C5GA 1IBCA 1K7YA 2RHMA 4OH1A 4H3SA 3AIOA 1U0SY 4D8WA 5JAPA 3AY3A 3SHVA 2UZAA 1N4AA 1ZOOA 3CKKA 3L7NA 4N6GA 3JAMA 2LW7A 3I92A 2P6OA 1OX4A 3IDAA 4JJAA 4DBZA 4G1MB 1M2WA 2Q1TA 3C39A 5DTQA 3EASA 2XUIA 2B99A 3TR6A 1ADJA 1YOVB 2HSZA 1LWOA 3UFXB 1NNUA 4G25A 4BO5A 4NI5A 2C54A 1SQ0A 1BDBA 4LVNA 1W88A 3P19A 1JI3A 3GWGA 5AP9A 4BVKA 3M1YA 4FMCF 1RBMA 1KSGA 1J23A 4MO9A 1ZGHA 4XVRA 3I72A 2H4WA 5KHAA 1YT5A 1OF1A 3WWEA 5AVSA 3DE0X 4URXR 3OLQA 1QRDA 1YFJA 1UMDB 1W75A 3IP8A 1GT6A 2C07A 2FFHA 1MMFB 3PYLA 3QLUC 3W1WA 5I7OA 1E2PA 4P53A 5D86A 3PWKA 3PEYA 1B93A 4JOSA 1EP9A 2YWXA 3LPMA 3Q98A 5EYPB 2XCOA 3DL0A 4CMEC 1CLEA 2PUEA 3GFTA 3FMPB 1FFDA 1LEHA 3FFWA 3I2IA 4V0ME 5DK6A 1F0PA 3KBBA 1DO2A 4YO8A 3BCUA 3WLRA 1UFVA 4OVKA 2HA5A 3H8SA 5AJHA 4BDTA 1YBVA 1PZEA 3R6TA 1G64A 2IYOA 4MUMA 4RYDA 5BR7A 4RC9A 2V6BA 4Y6RA 2VS1A 5LUAA 4JL6A 3RRBA 1OFIA 2ECFA 4ZAVA 3RUDA 3NBXX 2Y93A 4ZI7A 1NMYA 3ITEA 4X24A 4KU4A 5T57A 3ZDRA 4QWWA 5I5EA 3ICVA 3SZLA 2MHCA 3DSRA 2QRGA 3GRPA 3CHYA 3ULKA 2Q5JA 3LZ6A 5BNZA 2Y2UA 4UDXX 3NRCA 2Z9DA 1H9CA 1SXJE 2QTZA 4TRJA 1RTTA 3CX8A 1JTFA 2QIOA 4A23A 3MMPA 5AJWA 2BTQB 3ICWA 4LNAA 4Z4HA 4JUAA 2DOKA 2YIDA 1P8AA 1I6LA 4AQDA 1MT3A 3AB3A 1EUZA 3E9NA 4N49A 2HGZA 3IB3A 5DXJA 3B3AA 1S01A 3IQWA 2RGWA 3OBIA 5DMXA 2B4TO 4CCAA 4LYAA 2HMAA 1L8AA 2YJ3A 2G5CA 1UIMA 4ZYYA 1LC0A 1RLMA 4Q16A 3H97A 3WGKA 5JT1A 5KYNA 1DXQA 2RH4A 4WGFA 5JVDF 2P9ZA 3WLOA 4BTEA 5DW0A 4LWQA 5DNCA 2B5OA 3NAZA 4QELA 2N1BA 4EGQA 2I4LA 1MB0A 1XAJA 5FWXA 4ZZ3A 5CXUA 2CMDA 4GMXA 4DNFA 1GUBA 2QGZA 3O8QA 3R9WA 3E7WA 4N9QA 2PANA 4YN3A 1LS6A 1NM5A 3H8VA 2QN7A 4RENA 2C4HA 4LF8B 3RS4A 4AXXA 1KC1A 1U8FO 3LG2A 4OSOA 2EJVA 2GBLA 3PL1A 3WS7A 5IULC 1MVNA 3AM4A 2H16A 2HMVA 2BMVA 4IGEA 1T3LA 1PT7A 1NRJB 3E9YA 4TKUA 1JWBB 5F7OA 3D4BA 5JSZA 2F4VB 1ULTA 2HEGA 1GZ4A 4EHHA 1VG1A 1U0TA 3E22A 3IVCA 3JQGA 1MQSA 4QL3A 1U8CB 3ZE2B 5MN6A 4YMGA 2AT1A 3ND9A 2QRLA 5BSHA 4LWZA 3B6JA 4NTZA 2Z0MA 4P3KA 4Q05A 3IX7A 4MARA 1LXCA 5E0OA 1S89A 2NV2B 4U7HA 4IMIB 3I30X 2ZJ5A 1TZKA 2IZ0A 3AOGA 1JYSA 1BYUA 2EX1A 3ETNA 3GJQA 4MDHA 3ONWA 4P4UA 4ZT7A 3F3SA 3LX5A 1AGYA 4C0WA 2GDZA 5C53B 1KK1A 3PNOA 3LCVB 4HB2A 3IULA 2A4KA 3LE8A 3OTGA 5EMKA 2OGWA 3GBSA 2GJ8A 5EJ2A 3ETGA 1QU3A 2A5FA 1J8DA 1S6YA 1JMKC 3HC7A 3RC3A 5T6MA 2YX1A 3OP1A 1KF0A 3M6XA 5AI5A 4RDXA 1P0FA 5E9QA 3L6OO 5I9MA 1Z3CA 3Q3JB 4P3YA 3U37A 4ND3A 4CV3A 5CYGA 3A70A 3VR5A 4BGUA 1XDSA 5AIAA 4X85A 3GUUA 1NAHA 1SKUA 3TZKA 3NV9A 4PC1A 5FLKA 5KTKA 5E38A 1YE5A 3ND8A 4Y9RA 1W5AA 3F5QA 5IJXA 5IU6A 1AA9A 3DPUA 1CRLA 3HJNA 1NI4B 2WE8A 3FJ1A 4KX3A 4ZOLF 1VDZA 2O57A 2H85A 4K26A 2B4QA 4YAGA 1ZO8A 4IX9A 4M0EA 4WBNA 1RZRA 1GGJA 1LRLA 1E0JA 2J3JA 2FMKA 1Y3DE 4NECA 2CB9A 4S05A 4WKPA 2J6HA 4NZYA 5JNVA 2POCA 1COWA 2X1MA 5IZCC 2DBVO 3MB5A 1K88A 3DD5A 1K7SN 2P11A 3M0EA 3ROGA 4LRUA 4I1SA 2J0EA 4QQFA 4RV9A 2DRIA 4ND7A 2XHZA 1ZA1A 3L7IA 3P97A 3PD0A 2PKQO 1PL6A 2YWHA 4F38A 3PEEA 2PGXA 1Z2DA 1MC5A 1YBFA 2H2GA 4KP7A 2O0JA 3SSOA 3TOZA 1L4LA 2JHCA 1DNPA 2ZYHA 3MTEA 3FNQA 1WS6A 1K68A 4YY3B 4YEDA 2P5SA 3BRSA 2IU0A 5EC8A 5BWMA 1BDHA 2CXQA 2VHWA 4BKQA 4X41A 4CQJA 2AOTA 3E82A 5J5VA 2IOQA 4NJOA 5K0TA 5CH3A 1RJGA 2ATVA 1LLQA 1YKFA 1YIDA 2V9PA 2W0SA 1T8UA 2IXDA 3C5EA 3MCWA 4W5WA 5CLQA 4ARZA 5JS1A 4RJIA 1H6CA 2W6ID 4Q0MA 2BGTA 2YRFA 2PLWA 1PVVA 4WCFC 3WNVA 3G6WA 4EYQA 1Z25A 1DWOA 1XLTA 2GGSA 3VU9B 3BSYA 1WOYA 4EABA 4DTIA 4WA8A 1TZMA 3IDOA 2HUNA 1RP7A 2LDXA 3DE1X 1BHJA 1CUAA 1ORIA 3NALA 4ZYXA 4ACBA 3PPIA 1K9SA 2ZGVA 5CLLA 4BFCA 5B12A 4K6FA 4DQVA 5C8VA 1QLHA 2C42A 3EOBI 5AUNB 4M55A 3IVMA 2IYVA 4FIZA 1Q3KA 1ML3A 2PXXA 4L9RA 4FNAA 1Q74A 1HLFA 3L1HA 3WSTA 5ALFA 3E1KA 3QE3A 3L0YA 4Q48A 5J2TA 2JLVA 3UJ6A 5BSVA 1T2NA 4FHCA 1CIPA 1LPNA 2X1HA 4V1CI 4UQPA 3M3PA 4NR0A 3TMAA 1UJCA 1E7YA 1HNXB 2ATXA 4W82A 2A67A 3TX6A 3ET4A 2D0OB 1JVNA 4CKEA 4IUBS 4LDZA 3ZQKA 3CX7A 2NWQA 2HLNA 5A03A 2D5AA 3M2PA 4MWDA 3QE0A 4HG2A 2HU7A 1KMNA 4YI5A 2ZI3A 2YVAA 3HU2A 1R6DA 4ZI7F 3BDVA 5JRDS 1AS2A 4FFVA 4UU8A 3L4KA 1V16A 4G5XA 3CE6A 4KLNA 5IWCA 4D25A 3RAPR 4TSKA 3FPGA 2NM0A 3L04A 3OAAA 2JCXA 2XB9A 5CIYA 1O08A 3TDNA 1EFRD 4NNPA 3SFVA 1LPAB 3D0KA 5T8KC 4QUGA 4Q4AB 3BG5A 5K0ZA 2CXRA 13PKA 2B98A 4PW0A 3TLGB 1XMXA 1YQTA 2OHXA 3JWGA 4JP8A 1BN6A 3MQ4A 2J07A 2G8LA 3V4OA 3JD1A 4I0WB 1XNRB 4JJEA 3CC8A 2QL6A 4OMDA 1D8TA 1KJ9A 4FHDA 1O0BA 2CHVA 4B80A 5DKFA 4C6TB 2XKJE 1UFOA 2XRYA 5FR2A 4E2FA 4Z0PA 1DUIA 1U1CA 3I8XA 1JR2A 5IN5A 4KH0A 4BY9E 3VYVA 1NKVA 1SAYA 2QMEA 2R8ZA 3F7OA 3RAEC 2V65A 4BDSA 2ZAOA 3U3JA 3U7RA 4Z7QB 2FX3A 1P4JA 3C1UA 4FCWA 1XRQA 3K9GA 4MIOA 4Q1DA 3T3DA 4F3CA 1MW8X 3HYTA 2CSUA 4MJ7A 1UCFA 2E4VA 2GD1O 2PAAA 1GQOA 3Q10A 1U8ZA 3NFRA 5HF5A 4CN8A 2YJTD 4NZPA 3WTBA 5K6AA 4C5CA 1F2DA 4YUVA 4LHVA 4MLDA 3V4RA 4J0DA 1C14A 2PK3A 3TQFA 4RK5A 1P33A 3VR4A 3FNRA 3CW2A 4DRXB 1HT3A 1QFJA 1MABB 4ESEA 1B6GA 1ZCFA 1GPBA 2YZKA 3RAGA 3CLSD 3R0QA 1I32A 2X5JO 4ITVA 4LYYA 3VU0A 2QLJA 4YRZA 5D8DA 4G1FA 4B82A 3OPXA 3UT5B 4F8EA 2B30A 2OD9A 4BECA 2HCTA 3U81A 2ZSHA 4J1NA 1FFWA 4EY7A 5EQDA 2PVCA 3CLSC 4H9GA 1IXZA 3B52X 4KI0A 2I2BA 3IQDB 1Y4AE 4D0LB 1XZHA 2HPAA 4DNQA 5EE3A 3IUQA 1ST2A 2V6FA 3T5GA 3OJLA 2EQBA 1YJQA 1FMTA 5UKDA 2JAXA 3LT0A 3TSZA 3PE6A 2PBZA 4IJUA 5CDTA 5EJEA 5C9ZA 2OCIA 3RADC 1T5TA 5FBHA 3ZGNA 3P4UA 2QD2A 2NVUB 4NS4A 3G0GA 3GFPA 5FUBA 4YVFA 4DJDC 2JGMA 3EYWA 1SKYB 3OC6A 5K1ZA 1UWCA 4P3XA 1B8OA 4W8OA 1E18A 3PA8A 2C8VA 3ADKA 4XH9B 4A15A 3I12A 1AO0A 1JPUA 5I45A 3MJFA 4Y6OA 3FFTA 1VCOA 2PSSA 3EYAA 2QXTA 4FFPA 5DN6A 2OBFA 2V7PA 2HNKA 3QVKA 4LYEA 4YJ3B 2QL9A 1EFVA 3RAJA 1RQRA 3AP3A 1NUTA 3QNWA 4O4HB 4L8FA 4R01A 4ISBA 1HKUA 4NJEB 4HI0E 4FCTA 1IQUA 1K8QA 1J21A 2X3YA 1E8MA 1Z6QA 4NEHB 1VL0A 2E21A 2X14A 2VBFA 4WBNF 3JTMA 1MO3A 3MUNA 2JJYA 1MU0A 3FTFA 2X15A 5EHIA 3VX4A 3C6KA 1EFTA 1G41A 1YE8A 3AYXB 3T94A 3WB2A 2UZ4A 4LYGA 3LXXA 5DZSA 1NVWQ 1JEOA 3RF7A 3UWMA 5BY2A 5KNDD 2YY6A 3ANXA 1P81A 3DQQA 3MC1A 3KNZA 4I36A 1Y9ZA 1AUPA 3RYIA 1T36A 1H6AA 1MF7A 4ZJYA 1EINA 1FE8A 4LUCA 1DO0A 3V1MA 3ZLVA 1X1AA 2FG7C 1D1SA 2P77A 2P9EA 4DS3A 2HK8A 4MW0A 4NE2A 3GP5A 4KDRA 2FEOA 2GFHA 4IXNA 5DXFA 3RW9A 1DKQA 2EX0A 1IK6A 2NPOA 1RI3A 4RY9A 1MR3F 1YMQA 1NJ5A 3PD7A 3RNOA 1U5CA 2R2GA 2YC2C 4JDUA 3M5CA 5IC5A 1A9XA 4JROA 1NLMA 2O2JA 2X5XA 3TZBA 4HQLA 4CEHA 1NF9A 3FW1A 4R1SA 2WF6A 1J33A 4X7MA 2FRVA 1DRWA 3O4HA 3WIBA 3K3PA 2PS1A 3A9VA 1P45A 1CHNA 1ZJ6A 1JLLA 1T3TA 4ZCLA 1TD9A 2Z3ZA 3AEQB 1P6UA 5T4BA 1FB5A 3U3MA 2ZUTA 3T4EA 1RWOA 1RJWA 1OROA 3TM5A 2GZRA 3NU1A 1U9YA 3T9CA 1IN7A 3UG7A 4M88A 4YT2A 2JI6A 4YMTA 3I5MA 1U2PA 3DJFA 3NB0A 1RZ3A 2ZRDA 3ZDAA 1E5TA 1Z26A 3HACA 5T6BA 1ZGBA 3HYNA 3B9BA 1AHPA 1L8OA 1OWLA 1P5JA 3FI0A 3IAEA 1GRVA 2CL0X 2QTCA 2O6LA 3GLGE 4LHEA 5JMPA 3EXG2 4ISCA 821PA 2ORYA 1EYZA 3C41J 2I7CA 1U11A 2QJRA 3FMVA 3H6HA 2OLKA 3HDHA 4I8DA 5M3BA 4BUZA 3C8MA 1NZJA 1GZVA 5DWVA 3H11A 3NBAA 3MJCA 1W4AA 3DTNA 4ARBA 3ZGVA 5ICEA 3I34X 3PENA 1PGOA 1NHWA 5J2TF 5KDOA 4MUJA 1ZOIA 2N1MA 1PR1A 3O2JA 4RZUA 1E61A 2BHSA 4XX0A 1EWRA 1PJBA 2FK7A 5DHSA 1Z17A 1Z4LA 4W7IA 3E27A 5A2QA 4RJKA 2Q2VA 1QKIA 3F9RA 5TJHA 4MVXA 4AS2A 3K15A 4UUNA 2UXBB 2O8DA 1PFVA 3NFYA 1EDZA 5HQTA 4AY6A 3P32A 4LF4B 2JHGA 3QHAA 5TQJA 4KFTA 4KIFA 4TS3A 4HV4A 1AGPA 1GZ6A 2B35A 2M6KA 3AVOA 3BWXA 2UXCB 4KVFA 1T2CA 1R6UA 2LVBA 1KAHA 4HFNA 3CA8A 3VAZA 5HQJA 5HFNA 1V7CA 4UUMA 3FIJA 4UEOA 1EX6A 1YA8A 5C51B 1HXHA 3NHMA 2XH8A 4B6OA 3NNSA 3DDUA 3ADCA 1ECGA 1UM9A 3PHGA 4GRAA 4M8SA 4MGIR 4MR7B 4CKCA 2PZEA 3X1WA 5AKLA 4O8CA 1FS4A 3WLAA 4LYDA 4JBWA 5LA6A 1R0WA 2ZAYA 4W6QA 3WVNA 3R09A 4YRAA 2G9RA 3H5NA 2ZIXB 1PLKA 2LD4A 4V2IA 1EFKA 3QPBA 4H4EA 3VKFA 4ENVA 2CNWD 2YIMA 1AQYA 3ZI7A 4CDMA 2QN9A 3IDZA 2FP3A 2ZSAA 1G1AA 4X1YB 3V4FA 2FN4A 3KAQA 4HXFB 2J5KA 2WUGA 4CUZA 2QAGC 4G3XA 4A5OA 2FUEA 3BULA 3TIGA 4CETA 3K9HA 4QGGA 2YY7A 5IH7A 3SZRA 2BRUC 2H11A 3OZEA 4DB2A 3CFYA 1NNI1 1XB2A 2BHNA 2XXAB 1I1NA 3I45A 2QX7A 5IBPA 3VYRB 1TX4B 2ECQA 1PJCA 3V8MA 1G5IA 3MXTA 2P75A 4YYZA 2Q5OA 3T1TA 1P3JA 2ZT5A 2A1UA 2YN2A 4X64B 5FDFA 5IAOA 3KLNA 2AUTA 3OX3A 4QECA 3EFHA 4LHYA 1GRRA 1BMQA 4Y2QA 1AH2A 1P4SA 3ABIA 4RFLA 1DTWB 2V45A 2J5RA 1L1FA 1L7QA 3ZVRA 2DR2A 3T7SA 4GQIA 2YDXA 4QDTA 3HRKA 1XTIA 4ND8B 4BGIA 5E4JA 3IPLA 1KGDA 2PHZA 2Q2QA 5BQXA 3ZDBA 1FX1A 4URFA 4FLFA 1KOLA 3BXXA 4OAOA 3B13B 1SXJA 4NYJR 3DHNA 3FNFA 5CVVA 3WLKX 1JG3A 2EX4A 3KE8A 2IYPA 1H4TA 1C8BA 4EKEA 1UBHS 4M83A 3EG9B 4CTNA 2X0NA 3P9QA 5A4KA 2RGYA 4JS0A 3V4SA 3U40A 1JMYA 1P4HA 1U2DC 3RREA 4AMVA 1LU9A 4FOOA 2AHOA 4YRSA 4FR5A 4XFJA 3PFWO 5J3JA 2QLBA 3V00A 1ULHA 4TMZA 3VTZA 3B1VA 3D0RA 4CGZA 3BERA 2MCFA 3LXRA 1XZBA 4NJMA 3ZDDA 1LX6A 4J0FA 4UAUA 4K9OA 1VPEA 1QXSA 1G7RA 1T9HA 4H6WA 1THZA 4OBWA 2YHAA 3THSA 1WVMA 3GXBA 2OKGA 4KXQA 4OB6A 3T0IA 1TCCA 1R3UA 4Z7JA 2CKMA 1AKYA 1R5NA 2O3JA 2WT9A 3MCZA 4JLAA 4PG5A 5K4AA 4A5SA 3TOCA 4UM9B 1Z4JA 1X6VA 2W6NA 2RHDA 2ZVDA 4I08A 4PWYA 3LWBA 1U3CA 1OAOA 3D7KA 1NV9A 1AO3A 2Q9CA 1DKOA 4JNKA 4Y98A 4CT0A 1SUPA 6CHYA 2ADFA 3IXMA 3LT1A 3IOEA 3Q7SA 2PZAA 3BRQA 4H1HA 5KPJA 1PD1A 3ZOKA 4PBTA 1X7HA 2PMCA 3G1UA 2HLPA 3AUSA 3EFOA 3KKMA 4H3KB 2WB2A 1YR8A 4KB5A 1V3QE 1VFNA 4BQIA 1LJLA 2FU5C 4DQLA 4I55F 5E2AA 2QP3A 3OZXA 4U7GA 4J9VA 2HUPA 4P9NA 3PGJA 4KXLA 1M5RA 1QM5A 3KZKA 3RYTC 1GCOA 4OX9B 1RM0A 4YRKA 2EW1A 4QDKA 3TBFA 1FIUA 2ZS9A 4YIKA 5ITZB 4MQFA 4XM1A 4EYSA 5LQAA 1J5PA 3H2SA 4BQFA 3GJ7A 1GT91 2GN4A 1YB6A 4WZBE 4D4IA 5LQMA 3R3XA 2PE5A 1QV7A 1ULAA 4RETA 1P62B 3ODGA 1VMAA 2NZVG 3IFSA 3L7KA 3I9V6 2RJNA 1N7GA 3NHUA 4GU5A 4CKZA 5JDCA 1E6UA 1U0HC 1OXTA 1GARA 1RHQA 1BOOA 4R3WA 3GLHA 3VKWA 2Q7DA 3WGZA 2F55A 1EDOA 1QV9A 2NV6A 3VO9A 1KJIA 1ZJ4A 3LDUA 4R7TA 3CVWA 4MB6A 1SVOA 3B2NA 4IUCS 1M8JA 3IO5A 3HKBA 3KLMX 4IICA 4RWEA 4R16A 1T4GA 5DGCA 1T3SA 4MV0A 3KT8A 3FX2A 5FJIA 5GJBA 4D2IA 4TMXA 4Q6BA 1U1FA 3JYNA 3ZNQA 4PRKA 2JCBA 3E9EA 3AXTA 1S0UA 2YRWA 1AZLA 3FSRA 4AL4A 4J4HA 1F2TA 4IYJA 1G60A 2XRFA 2YV4A 2AEFA 1B16A 2QQ0A 4AWXA 5JCXA 3BB4A 2BMFA 3AFNA 4IOJA 2H0RA 1U2EA 4MNTA 1IAQA 2OXRA 3CN9A 1HSOA 1ZUWA 2FSFA 5KU7A 4W5RA 1T2EA 2PUJA 3DOIA 4O8ZA 5B57C 3SGLA 2IPNA 2Z5VA 3K7EA 3PI7A 1IB6A 4FEGA 2GSDA 3W9YA 4BAUA 1P9WA 2IQIA 4H18A 4F56A 2GKSA 1LBEA 1MENA 4LAFA 3OFJA 1PF7E 2WJIA 5CHYA 2C2WA 2D2FA 3IUSA 4WY2A 2Z83A 5H68A 3VXKA 1P7YA 4HRYA 5IX8A 1Z37A 4ENRA 1E9EA 2IYWA 4GZ5A 5A4JA 5ANRB 1KJNA 3W5DA 2ZYUX 1VBNA 3O4VA 4XR4A 4QSMA 3AG6A 1US8A 5I4KA 1QX4A 3M34A 5JBNA 5L3SA 2BBTA 1CJCA 4EVRA 1C1XA 2PGAA 1JIXA 1J8MF 1VYVA 521PA 1JZSA 4TLEA 3RS2A 1ZLXA 1CR6A 2HSJA 4G26A 4MR8A 1RMTA 3FDIA 4GC9A 1PTKA 3JCZA 5ARCA 1Y3AA 3V2UA 3NIGB 2FPRA 2O8EA 1CUGA 2FPIB 3UJAA 1KYVA 1Y8RA 4JVOA 4REQA 2ZRBA 2QYTA 5JYCA 2GBLC 5LA6F 4E51A 4X66B 1KO7A 4HFRA 3DZJA 4EPVA 2IXBA 5JD5A 1W1WA 1UZMA 4PC2A 1G8JA 2C9DA 3HDGA 2CJWB 1G8GA 3HB4X 5BQ5A 2ZUCA 1VE1A 5C4MA 6ADHA 5GINE 2PWBA 5HSGA 1C7ZA 3A6FA 3EH1A 4KMRA 5G53C 1FP7A 3JPWA 5CNJA 3SX4A 3L1KA 5GZ1A 3R9XA 3KZ1E 5DYGA 2V4UA 2MMCA 1OBCA 2X4LA 1UBGA 4A2PA 3C8HA 2WJAA 1UFRA 2XJ4A 2ZTMA 4C6RA 4W5TA 1A9PA 2EU8A 4RVFA 1TAUA 1E4VA 3IKMB 1FNNA 4IUYA 4QGAA 6YASA 4DV7B 3V2HA 2RG1A 1P29A 3IQZA 2XUDA 1P61B 3Q2OA 2AOXA 2PZBA 4JXXA 1YGYA 1EZ1A 2VPZA 2JD2A 1RAFA 4XVCA 1SEVA 3CR8A 3N2KB 1DCTA 4RTOA 2J3KA 2X9NA 4M7RA 4YCAA 3THXA 5EG5A 3IILA 2CY0A 5P8WA 2NVOA 3VR5D 2HOQA 2BEWA 1RXUA 1UOEA 5IS2A 1IM5A 5HIKA 5DVZA 1P39A 3GLVA 1OHHA 3KZCA 4AUNA 1IG3A 4C21A 1W2GA 3QPWA 1QIHA 1SY7A 2QA5A 4JUFA 2ISSD 4D9HA 1J90A 1KC3A 1FVFA 3LHSA 4BPRA 5L3QB 1KQPA 3B7PA 3GLIE 4K7JA 4NEQA 4FI3F 2WU4A 4PQFA 2ISCA 4B44A 2WU8A 5C81A 5J4KA 5KS2A 3EEOA 1RZRD 4LRQA 5JNSA 3BJIC 4KLCA 2G4VA 1RAEA 1H5UA 1VXOA 3H19A 4L28A 1KE2A 4QYIB 3U4MA 3O8OB 4HWTA 3B6KA 4LXQA 1F17A 4G8BA 3BHNA 1K7FB 4OM7A 2R7NA 2ETVA 3RVSA 1NC1A 3QEMB 4ZVTA 2QTRA 1Y1QA 3M9XA 1F0KA 1YZQA 2FP4B 3GUZA 1Q84A 3L8YA 3INRA 1PL7A 1SD1A 2GRAA 3EFBA 1C4OA 4MIYA 5AJYA 3WFZA 4ZOAA 5DPMA 1J0EA 2Q4TA 4JUBA 4NPAA 3RLIA 3GAMA 3G5UA 5BSWA 5C7IO 1JB1A 5C31A 4HAWA 3Q9UA 3CV3A 3NH6A 1NSTA 4MI3A 5CPBA 2VSXA 5EZQA 2QYOA 3KKZA 1YL5A 3X2FA 3IUPA 5HNKA 4BJ3A 2Z2JA 4OXNA 3VM6A 1Q50A 4GVLA 5IYZA 5AK0A 3T52A 1HC7A 1P9NA 3O47A 1KFCB 2IYSA 3CRW1 1ZIPA 1RFLA 2W8BB 4HQKA 4YMIA 1V1JA 5GVRA 2BJHA 1Q1GA 3INGA 1FFHA 4XJXA 1P2TA 3BE5A 3GEBA 1KIMA 3V1TC 1D2NA 2OCBA 1KAOA 1ZC4A 2EL7A 2ZBDA 4OMFG 1D4ZA 3REFA 1IBMB 3HQ4O 3JQDA 3RIHA 4PHGA 3AR8A 4EJMA 5LCXA 4C7KA 4W7SA 2VA8A 2ONKA 1Z5NA 4FT2A 3JAKA 4RE5A 2FW0A 4X0EA 4KXYA 3CISA 5BV8A 1EESA 2PUGA 4D02A 1CY2A 2FKAA 1NT4A 1Y8QB 4E88A 1E3LA 4WD3A 1NJ2A 1Y4UA 3T4PA 4O2BA 1SCQA 4QPJC 3PV0A 4WV3A 3HRIA 3ZWVA 1AMNA 4HQ0A 4D9EA 5CDUA 3CVUA 1Z4IA 2KM1A 4HQNA 3QI7A 2O2XA 1Z07A 1GA1A 2Q4BA 3JVEA 1W4RA 3G5TA 1XLTC 4B6GA 3MWJA 4MMXB 1XKQA 4I5DA 3O8RA 3MD0A 3TCNA 2PX3A 3L0BA 1TW3A 2XXJA 3K8OE 5CPFA 4XGQA 2CFRA 3EVFA 1X1EA 3TRHA 3V1UA 4DLRA 3WYEA 1YV9A 3UMMA 4IIJB 2ZCVA 3QA3E 3PC3A 2QMQA 4ZVSA 1QIDA 4M99A 1W6RA 3AEKB 4UARA 1QVWA 2W2LA 4FYIA 1QH8B 1Z36A 2C5BA 4KPUB 1UJ4A 3IIIA 4UE2A 1UZUA 5A9RA 1QZTA 2PUTA 3DEKA 3LHIA 3Q8KA 2PL9A 1LC3A 4RL4A 2CXNA 2WIJA 4MAMA 4F86A 4N8SA 4BQOA 2NU6A 2IDZA 2VPQA 2W71A 1TK2A 1YIAA 2Q6IA 3IAM6 1FRZA 2XIQA 4RXUA 3HA2A 3WWCA 4DLKA 4LJYA 5D5QA 5BRNA 4EI2A 1Q2XA 4O2AA 3QX3A 3Q0EA 1T1IA 2XVMA 3FLEA 3SQLA 2ZR9A 3G2IA 2RI1A 3OAAD 4QUDA 5F1KA 3ZCUA 2EG5A 2WLTA 3HWWA 1NYTA 1TCVA 4P86A 3AQIA 4U2CA 5KOHA 1GP2A 3X1JA 2WKPA 5JI3E 4O4LB 5AXDA 4CF6A 4LQ4A 3D3WA 3BRCA 4QEDA 3PKIA 2ZSUA 5B1EA 3T7TA 3QXGA 1BGWA 3IUJA 2N46A 5DI3B 3FGOA 3HCEA 2Z9BA 4L4SA 4EB6B 1JQJC 2CVOA 2QYHA 3LC2O 3DGEC 4HZUA 4O2LA 2YMLA 4TTIA 3VJLA 4BQEA 5L3RA 1ELOA 5CFMA 1WNFA 2NQ8A 1P2VA 2BUCA 4HF7A 2N47A 2W2NA 2A84A 4O25A 2FR0A 2FMFA 3ZCVA 2WFZA 4HH1A 4IQ8A 3A0UA 3ZWDA 3SYNA 1R6TA 4QGFA 1QYRA 1SUDA 2AOVA 1XWFA 1ML4A 2HM7A 3PZBA 3KKKA 4LTNA 2H7CA 3K2BA 1WB6A 4NNOA 5K5EA 3KQOA 2PX5A 1G4HA 2UUPA 2NUPA 4ON9A 1C0KA 4LBVA 2JGEA 4NYMQ 5JIBA 1B0UA 3NGXA 2RBEA 3RPEA 2LCFA 5DTJA 5CFZA 2WVJA 2IY7A 2C5EA 5HZHA 5A71A 3ZGZA 3GJZA 3U1VA 2A0UA 3HVKA 2C7PA 1BVYF 4JBXA 1K63A 2RC6A 3HZHA 4HDNB 1HDIA 2FN7A 3T7CA 2WPDA 3VR4D 3UKDA 2UZ1A 3C74A 3HH8A 4YPOA 5K6AC 5M5BA 2OA0A 1U1DA 2PRIA 3I2HA 5EHZA 1E5QA 1NAIA 3CNHA 1DBSA 1JG6A 4ERXA 1SKYE 5K51A 1ZD1A 3I1JA 3JASA 3QPUA 4UVIA 4HUQA 2NU8B 4A6EA 2PYZA 4JEHA 3N0TA 2FEAA 2FWPA 2IBSA 1SIBE 1NIJA 4Y9SA 2OO5A 1E1LA 1LFAA 1F6WA 3ZU6A 3HDVA 4C2TA 2BTOA 1E7RA 2AQIA 4OQYA 1R6AA 1A7UA 3MWGA 1FNCA 4EJ6A 2XNHA 4KPYA 3LZDA 1K5PA 3DZKA 3H6GA 3I5UA 3GW8A 4I1IA 5DM1A 5AI6A 1T5OA 1MA0A 4Q4JA 4PYMA 4HTFA 2XOKD 4IINA 4KXUA 3VZDA 4TTSA 3EA5A 3RR2A 5IFKA 3HI6A 3C1TA 8OHMA 1RYFA 3OE4A 4RHUA 2G36A 4ZI3A 1S4QA 4FCVA 6NULA 1QVVA 4G4IA 1G3RA 1VYHA 1LRJA 2YHBA 1DT3A 2X0IA 5FYQA 1DELA 4KI7A 1ZSNA 2D7CA 4JI6B 1G7SA 3C48A 4QKQA 2I3BA 3EAQA 3EPKA 3LZCA 1PW5A 1OJLA 3P0HA 2WFLB 2I9KA 1WUYA 5DN6D 1RPZA 4EY5A 3E18A 4LTMA 4QGBA 3DO5A 2JJMA 1L7PA 3QWBA 5EZYF 4Q39A 1L7AA 2E89A 1WSAA 2WUFA 3R0VA 3BT7A 3ZKWA 5JD4A 3NEAA 3B12A 2VUHB 4PX9A 1A9TA 5CBKA 5DM4A 3OZIA 5H1YA 2YXLA 1IOWA 3C6QA 1R50A 1I3KA 2AHRA 1KI6A 2BMWA 3I6MA 2K87A 2VZLA 2JRCA 1PJ8A 1CY8A 3W8DA 5ALOA 3F4LA 2C2YA 4B6RA 1OREA 2WOJA 1YD7A 4H6XA 5KYWA 1UWVA 2CHQA 1A8PA 1E3JA 1FQOA 4JFRA 2XITA 4BKRA 5JG7A 4PLZA 3W7VA 3QOWA 1K92A 5ESDA 4NAUA 5F7JA 4RY8A 2ADMA 2W2QA 2ATIA 3EOAI 1QFXA 1ZH8A 3K5HA 4TKVB 4UOEA 3MRVA 3EF0A 1ICIA 2EKLA 1E1NA 1W47A 3IURA 2I2DA 5IYZF 1PWHA 1P0IA 2F3UA 1QB8A 2XB2A 2P27A 3OP4A 4DANA 3CH5A 2B78A 4TUYB 4QLBA 5EP3A 1PG0A 1DAMA 1N2EA 5EWLB 3ZDZB 4ALIA 4PGGA 1D4AA 4EVSA 5ERYA 4QAJA 3LDGA 2M32A 1G5RA 5AHXA 4KWTA 4B3TB 2CZQA 1IONA 4M0KA 3O93A 3CZ4A 3FWYA 4J2HA 4AP6A 4MPPA 4QUEA 1MO2A 5CDFE 1B8UA 4B31A 5GTDA 1AK2A 1RE0A 2VDOB 1ZVJA 2XMZA 5G4KB 3ZDFA 2IZ6A 3UCFA 4DYVA 1PFQA 2X7JA 4O2BF 1YULA 2AWOA 2H2HA 5AM1A 2NLOA 3PQCA 5DSTA 4DM7A 1V7QA 4EMTA 3JY6A 3F7MA 4N3CA 2FMUA 4RF4A 5ES3A 4URUR 5DXAA 2OWEA 3ZY2A 2P90A 4EH1A 5A4FS 2R6FA 2ZYRA 4MVJI 2CV1A 4HDQB 4AG3A 1AHHA 3E81A 5HW0A 3P2EA 1OFTA 5JJIA 1EM8B 2QZ4A 2RIPA 3SKXA 1JV2B 1I0IA 3I73A 2IIBA 5EJFA 3V8QA 3DDHA 3PDWA 4HL6A 1GD1O 2MINB 2X4GA 4JENA 1XN1A 3CCFA 1N0UA 2W6ZA 3HA5A 1E99A 3QBDA 4ZVUA 4S04A 3U3ZA 2IBTA 5T64A 3RBZA 3S5JA 4TMFA 4MV9A 3HBMA 5K3OA 3GG2A 4KQXA 4ZYTA 5D3KA 4R2HA 4MS1A 1UZAA 4V0SA 3D4OA 3JYPA 2UYYA 1EHCA 5AW5A 1TPZA 1LI5A 3G8AA 4G9EA 4MP6A 4XWYA 1A4UA 1QF9A 2Z2XA 3TMYA 3H87A 1GYQA 1XXLA 4CW7A 1N5KA 2BTEA 1B1AA 1RRCA 1N6NA 1RMYA 3ZE6A 3CGWA 1N1GA 4NV3A 4O2AF 3OJ0A 4L9SA 4JLSA 4PGFA 3X2SA 1L1EA 1QAMA 4H1VA 5AHWA 2DERA 1W36D 4I1VA 4KV7A 5K20A 4DJAA 4FGWA 1HURA 4CL8A 1SZDA 2DP4E 3B9PA 5EYPA 2P2DA 1IBSA 3UWOA 3K4PA 4JCOA 2C8JA 1QYIA 4DR2B 2JATA 3AWDA 3OCUA 5CCXA 4NX2A 3OZCA 2XOXA 1R6XA 4CM6A 2CJYA 1W5FA 1T13A 3ETEA 1TECE 1DP4A 4QBKA 2I4RA 3TSYA 4BB5A 1SCUB 4Q7QA 3BRWA 4HGRA 2YXNA 2GZ1A 1ND5A 1F2UB 2R00A 5L7WA 2QN6A 4NBLA 2ZUFA 1QIGA 1BA2A 5FUVA 1PDOA 2QMUA 3EE6A 1JUDA 3V6LA 2QRNA 2VJPA 4NAHA 5FWYB 1WQ1R 2PPLA 1IOVA 3VPBA 1XMSA 2ECPA 5JAIA 4F9GA 1GXSB 1L3IA 2CEKA 2D7JA 2VHYA 4S1NA 1DAGA 2E82A 4JKYA 1K89A 4PFJA 2ZYSA 2GUWA 2OHOA 1GR0A 3GGOA 2EKBA 5ALWA 4UHEA 3WGJA 1TC1A 1ZWKA 1KY3A 1M2OB 5DX8A 3SYMA 3SOPA 4DZTA 4N48A 2FSPA 3TW4A 4YNBA 3ANLA 3LBIA 2YV1A 1Z06A 4OKNA 3DEIA 2Y6UA 5HUHA 3UJNA 2WTUA 2JG3A 3RDPA 3UH0A 4AF7A 3FCXA 1G5PA 1A98A 1CUJA 2I8LA 4Z2AA 3U4QB 2IVFA 1IN1A 3QSYA 3GIDA 4KFUA 4YCMA 3RCBA 1R64A 1UEXC 1A27A 3IEUA 2W70A 2H31A 4DR3B 1CJUC 3E1SA 1SXJD 1GZ7A 3W1VA 2XE6A 3GDHA 4P7GA 4B4DA 2R6AA 1VGVA 2ZT7A 4JHXA 3I1IA 4Z8YA 3HM9A 3HCNA 1ISPA 2ODNA 3M6VA 3OT5A 4GWLA 4ZI2A 2DF8A 2HAEA 2ZE6A 3QXHA 3UV6A 5FEMA 3L8FA 3RVMA 1R66A 2ODEA 3BXPA 2UYGA 4IZOA 3FYUC 1U63A 5AI9A 5IEJA 2O1WA 4XOUA 1KVQA 4EKNB 1QNLA 2ZIVB 4QD3A 4Y2GA 2P6RA 1DU4A 2AUNA 1JNXX 2HA3A 3HO8A 4RDHA 5A4AA 4R5MA 3CU5A 3V55A 4X1KB 1KSJA 1K3TA 3R3ZA 2WM8A 1YJBA 4UEQA 4HK4A 3EHEA 3PD1A 5ILGA 3FI9A 2ZBUA 3DMDA 2GEVA 3GT3A 3F6CA 2O4UX 3VMFA 4QM6A 4NC9A 3EA0A 4M1OA 4KIGA 4UUQA 3VZRA 5JMOA 2WVHA 4II3A 1CFJA 1ABFA 2FE1A 3GFSA 2QB5A 2OMEA 3PHBE 1DKPA 4D5EA 2B0JA 2AVDA 4UBOA 2HJHA 2AXNA 3UGTA 5K0BA 5IKXA 2EFCB 3FDZA 4Q4LA 4PLFA 3ZWWA 3WLTA 4YI3A 4B7ZA 4H7EA 5K4HA 3OHMA 2Y67A 2JLXA 2E48A 4FW8A 1XFDA 3PC4A 4X97A 2HIMA 2ZRHA 3FUXA 4P2BA 2B6NA 2KWIA 4R54A 3W6UA 1M72A 1HOTA 2VTKA 1Q5PA 2QRHA 4HLNA 3W3AH 4AUEA 1RKVA 2OCPA 3LQ4A 4LOIA 3A0RB 5FRDA 2NU9B 4R8KA 2H7YA 3AUKA 3EXFB 5FD8A 1X15A 3QHQA 1V4BA 1XLUA 3ILHA 1QDUA 1JJIA 1OIVA 1PG2A 4ZOCA 4AN4A 4B3SB 1NI4A 2JFGA 3PQ2A 1VE3A 3DM9B 2B5WA 1JXOA 1NNLA 3L6DA 4G0UA 5K0GA 1NMXA 3A1UA 1C3OA 2YOFA 4B79A 2ZDHA 4IO0A 4MI6A 2ZB4A 3OUZA 3TRDA 3K30A 4KAJA 3HDYA 3RFXA 4ZC1A 1QGUB 5C4GB 5JDCC 4QTZA 5ALTA 1KI9A 3ZWCA 3AR6A 4M1TA 2EW2A 3I53A 3V7WA 3GPLA 1VGQA 2CHFA 1UJ6A 2F48A 3H4MA 3QKWA 2HA7A 4XWTA 1ZM9A 1C0EA 4KYIB 4EY8A 4PTZA 3JD0A 2HFKA 3AOEA 4GI2A 3WIVA 3ZNNA 4F96A 3G2MA 1BO6A 1UEIA 3QFRA 4NPCA 2ZYTX 3H1GA 3O91A 5CJPA 3WLNA 1CKEA 2JNWA 2A5DA 1BN7A 4G1EB 5EHGA 1IUKA 1SB8A 3NHPA 4J76A 5EE5B 4ER3A 2VHVA 1IY1A 4QG7A 4AY2A 2OZKA 3S7ZA 4WFQA 5HIJA 1DBPA 2VDJA 3SIRA 1R0RE 3SDSA 4MROA 3HJBA 3R5SA 1XZGA 4PHCA 5K0LA 4V0LA 4LJRA 2B7BA 2OQIA 1V9CA 3DC7A 1FSSA 4YAIA 5IKPA 5BSRA 2HKIA 1TGYA 2FSGA 3MIIA 2CLHB 2YUTA 2GZDA 3R5HA 1XI2A 4TM8A 3GHHA 3W04A 1SBNE 2X58A 3QTBA 4F6CA 4ZMSA 1P4GA 1U7UA 2LIPA 1R88A 1IBRA 3PQ4A 4A73A 3MHPA 2BZ1A 2FQQA 1X1DA 2K6GA 2VNKA 5AVUA 2X4DA 4CMCA 1KY5A 4EHLA 3N2EA 1U7OA 5AVTA 2Z43A 5LZ8A 1JJAA 4RK6A 2OZVA 1USUA 3UHFA 4DV5B 4AZ0B 4NESA 1LA2A 2IOHA 9ABPA 5C2JB 1X1BA 4GBMA 5B6IA 1O96A 2YWEA 3HBLA 2ZVPX 4LF7B 1JHMA 3VOBA 1TADA 1RABA 3KWLA 5F12A 3IJPA 5LQJA 3FCYA 2VWQA 1B23P 1YRYE 2LR0A 5LXTB 2DHCA 4F2GA 4Q7MB 3ZY4A 1D2HA 2RAUA 1GDHA 1SUBA 3Q7PA 1ZJ5A 3JQAB 5JZBA 1RSZA 3UJ7A 4NFHA 3HJAA 1FSZA 3PSAA 1UDXA 2JLCA 4GLJA 3CRRA 3S2ZA 4D4KA 4EGSA 2CJFA 3F47A 2HBZA 4FFNA 2VP6A 1FJHA 1XK6A 4N5MA 3WTCA 1M8FA 2M6LA 4E31A 5HS6A 1LDYA 2QLFA 1DEAA 2I4TA 3D6HA 1EWKA 3LK7A 1AK1A 3H1BA 4NY1A 4AO8A 1WUTA 4WXEA 4BNFA 5JJ5A 3ZJUA 5AJTA 2VCEA 3WC4A 3DZHA 1E64A 1UKBA 5DU2A 5EQTA 1RCTE 3LBNA 4QUJA 4D8YA 1OYYA 4LC9A 1M2FA 2C2GA 3MT8A 1ZYUA 2AD1A 5EFOA 3W5IA 4EZIA 1M2VA 3VKHA 4PU0A 3A9WA 4MWZA 1NXTA 1GEEA 1ULUA 3O1JC 4TXMA 2RDMA 1OLXB 4Q4AA 4KX5A 3I0NA 1KMMA 3IELA 3KT6A 2ROQA 3LT4A 3TLGA 5K8LA 4XWGA 1C29B 1TNDA 1H1LB 4BVLA 2HRQA 4FEEA 4YQFA 4JA0A 4BMNA 4KACA 1GPYA 1L4MA 4HN9A 5L4LA 2EGUA 3MT9A 3UWSA 1OHHD 2H4JA 2IYYA 4JHLA 3PDIA 4ROSA 4Z99A 2QX6A 3I37X 4PZYA 4KUGA 1L5HB 4BNTA 2JH9A 3W3AA 3RV4A 4FE4A 3VTAA 1VJCA 1SOWA 3Q2KA 4KQFA 1A3CA 4RORA 4KNYA 1OUMA 1P7VA 4OP3A 1ZOLA 3I2KA 4R4JA 4KFRA 5EXEA 4DKXA 4B3RB 1YZGA 2NIPA 5AO9A 5DTIA 4DQXA 4QVIA 3OUTA 3TZHA 3MGBA 3RABA 4LYHA 2ZG6A 4CM3A 4YUYA 1N36B 2E4YA 1QYDA 2W6PA 2JD1A 1MOQA 1WKCA 5HMLA 3USES 3KD2A 1RI1A 3QOFA 1TYCA 1NNEA 5CLIA 4DUPA 2H5JA 2OP1A 3RK0A 3E9ZA 4AAYA 3CSDA 3ZGXA 3KIPA 1FVXA 1MABA 4EGCB 5HIAA 2O8FB 3ME5A 4L75A 1O5OA 1B3RA 1WBJB 1U2SA 2ZQ5A 3UT5A 1MBZA 1CVRA 3L46A 5EJIA 4NU6A 2GQ0A 4J7AA 5ICMA 1XXHE 2CLFB 2I5PO 2WDPA 5EE1A 1ES9A 5AHOA 4BCDA 5JJLA 3Q7QA 2Z2IA 4OJKA 1CTQA 5ER6A 2ZP1A 5DCLA 2W4MA 2AN9A 3ZGYA 5BMOA 1XJCA 4DLNA 3Q6IA 2ZWPA 3DFKA 4LQDA 1H2RS 3LBHA 3BB3A 4Z3DA 3TQOA 4BU1A 1WPXA 1VRVA 5B3JA 4EB3A 2GZ2A 3IKLA 2VP5A 3E5MA 3EBPA 4ZAYA 1T5SA 4EL5A 1VECA 3T5DA 1K5DA 2DBZA 4FFSA 4U1RA 4OQLA 1I6KA 4EFMA 1DKLA 4A9AA 3N8NA 4P0PB 5JXWA 3EAGA 3L18A 1HTWA 4GPIB 1ZBDA 4GX1A 1RYNA 2J45A 1XJQA 3T7EA 2IHBA 5KNLA 1XRRA 3CIFA 5AVJA 4ZZ1A 2H6EA 4CQMB 3GQBB 1UBTS 1ULBA 3LPNA 4EIWA 5LN1A 4MZDA 5D1HA 3TTVA 1M74A 1KSHA 4IDHA 5KQSA 3EIQA 2W2TA 4RIIA 4YJ3A 4HS4A 4LPSA 1RQ7A 3L1VA 2AR9A 4O4HA 5ENVA 1J06A 1L1QA 3FUCA 4BCCA 2PIAA 4FGUA 4OL0A 4QSHA 2F43A 1XLWA 1V8BA 3I9MA 4ZZ0A 2EIHA 2G4CA 2W2LD 3PS9A 5CIQA 1TO2E 2BGGA 1FYEA 5EXDA 4C7VA 3NOVA 1GGEA 3ABZA 4N0QA 2HIGA 2QT9A 4LI0A 4UBKA 4WFIA 4XRRA 3RTAA 5JANA 1H0SA 3ROTA 3L82B 3KSZO 1OU4A 1F9EA 3S2FA 4KNVA 5JWOA 4H7PA 5CB8A 5AKJA 4GM0A 4PLGA 3ASVA 1YJXA 3AJDA 3IYLW 4BFZA 4E21A 2NVBA 3HNOA 3PX2A 4FGKA 4I7EA 4LXHA 4ZEOA 2XMBA 3G2OA 5LBIA 3T7RA 4G4SP 1TT7A 1WCXA 3CURA 2EJTA 1PS0A 5CK4A 2BLNA 3GDOA 3KOYA 4JB3A 3Q15C 3X2EA 2JFUA 2FZLA 3KJEA 3CZPA 4L4UA 1I0LA 1RBYA 2P6NA 3I9LA 1BU8A 4GLBA 5MN4A 4KZPA 1NLZA 2WJJA 4EUSA 1MEEA 4ZIRB 1YQUA 1U4NA 1YO6A 2X9LA 2IXTA 3E2IA 2IP4A 1FTSA 2V3VA 3GNTA 4L8GA 5KJFA 2DB3A 4MSUA 2BGMA 2ONJA 3DC2A 4IRUB 4HPWA 2H08A 5CVTA 4AJ4A 4IDFA 5AOCA 3DE3X 1IFXA 3Q2IA 4FBMA 1WMAA 4YCDA 4GMKA 2HDWA 5FULA 5BW5A 1DEOA 4KQ2A 1I3OA 1P1JA 4UHCA 2CXSA 3FUVA 3NPMA 4EQZA 4KBYA 3PWZA 2DT8A 3O73A 2HQOA 3I09A 2XCSB 4Q3CA 1ORWA 1AGNA 5A9TA 4HVCA 1NMZA 2NO5A 3WGMA 2OGUA 1YQDA 2GX6A 4OXKA