1QZ3A

Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
309
structure length
309
Chain Sequence
PLDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVKKEPVAEVREFDMDLPGRTLKVRMYRPEGVEPPYPALVYYHGGGWVVGDLETHDPVCRVLAKDGRAVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAAVTSILAKERGGPALAFQLLIYPSTGYDPAHPPASIEENAEGYLLTGGMSLWFLDQYLNSLEELTHPWFSPVLYPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQFYSLSPGATKALVRIAEKLRDALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A substrate-induced switch in the reaction mechanism of a thermophilic esterase: kinetic evidences and structural basis.
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
molecule tags Hydrolase
molecule keywords CARBOXYLESTERASE EST2
total genus 110
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qz3A00
3G02A 1CUZA 2PVSA 3AJAA 3HRHA 2PSEA 3QM1A 2J4FA 5HF5A 2OCGA 3I1IA 1XZFA 3FSGA 1H22A 4X7BA 2RHWA 3BWXA 5JZSA 3KDAA 1DQZA 5AKHA 4KAJA 3VKFA 4GECA 4C6HA 1C7JA 1H2XA 3HI4A 4OB6A 3PF8A 4FDMA 3AINA 3C5WP 5KWIA 5AOAA 1XKTA 3VISA 5CW2A 3L1JA 2AJDA 5BV7A 1GXSA 3A70A 5EHZA 3MUOA 2ES4A 4UHEA 4U2CA 3ZLVA 3G9XA 4KE6A 2H7YA 3ESAA 3UMJA 1CUWA 2XUQA 3WIBA 2ACKA 3M81A 3CN7A 1AZWA 3IUNA 1Y7IA 2OPHA 1IZ7A 3I1YA 5K3CA 3IVMA 5J3JA 2XUJA 5AI9A 4CCWA 3W06A 2CUTA 4X85A 4TGLA 3W9UA 2K2QB 3H2KA 1VXOA 3G0IA 5LZ9A 4QDXA 1VXRA 2BUBA 3BIXA 3H2IA 3I6YA 3AZQA 4OYYA 4BAGA 1TQHA 1LPAB 4EUSA 1YA4A 1JI3A 4Y2UA 3R0VA 4DMCA 5AM1A 3H1BA 5A2GA 2C7BA 4EY8A 1ZJ5A 1EINA 2VEOA 4HXEB 3CN9A 1UOOA 3T4UA 4ZWNA 3WWPA 2WKWA 1JJBA 2WHQA 2HFJA 4Y2TA 1CUSA 1R88A 1VE6A 3EQ9A 4UHDA 2X8BA 1SCKA 4N8DA 1IUNA 3NGMA 2DQZA 4DM7A 4BC0A 2PBLA 2EDCA 4ZGBA 5HF8A 4INZA 1EDDA 1CUVA 1CUAA 5CT9A 1JJIA 2QS9A 1JKMA 3WYDA 4UBOA 2ZVDA 2GZRA 4BP9A 4BP8A 3D5EA 5ALKA 1BEEA 1CQZA 3DCNA 5C8VA 2XMDA 5ALEA 3RK4A 3E0XA 3VXKA 1XZBA 3ESCA 5JALA 1W4LA 4AXBA 3BF8A 5FPQA 2LIPA 1XRLA 4LYEA 2ZYIA 4KE8A 2QM0A 4UPDA 3BXPA 3R3UA 1QFMA 2OGTA 4OUKX 2YYSA 4B9EA 3FVRA 2XUDA 3OOSA 2VQ6A 2XUKA 1LPSA 3HEAA 3K6KA 3H04A 3AZOA 1GQRA 1XZAA 3NOXA 4Y2VA 5SYMA 1DT3A 1GKLA 2AJ8A 2R8BA 3AZPA 4XIIA 4KJXA 4HTAA 1BN6A 1C7IA 3SK0A 4E14A 5AOCA 5AKJA 3OURA 4Y2XA 2EDAA 1UOQA 4X91A 4FMPA 2GZSA 1ODSA 5K3EA 2VT6A 4UBMA 3F67A 3CCCA 2HM7A 2HA7A 1CVLA 2DFPA 5FPPA 3AIKA 4E46A 1ZOIA 3C87A 2QMQA 3EF3A 1JU3A 4J3JA 5D7BA 2Y2UA 5ALHA 4X90A 4CIAA 4BE4A 3DOIA 5E4YA 1G42A 1T2NA 3WL8A 1ACLA 1XZLA 4OD0A 2RAUA 4BVKA 4I4CA 5KREA 4BE9A 4HVTA 2B9VA 1LPOA 5HQ3A 4FBMA 1UWCA 1ZGCA 1G66A 1U2EA 1QGED 1QIKA 1RWQA 2XMRA 4Y2QA 1XFDA 3DQZA 4YPVA 4N8EA 4GLBA 4UBKA 3DYIA 4AN1A 4X6XA 3W9BA 1MU0A 2XDWA 1QOZA 4A16A 1X70A 4QWWA 5AJHA 1O6FA 4AZ3A 2BUAA 2GYVA 1DX4A 3AFIA 5T4EA 5EIAA 1PV1A 1YSCA 1ISPA 4ZV9A 1W75A 4DSAA 5BWBA 1TAHA 4GW3A 4L72A 1OILA 3KD2A 3ESDA 1P0QA 4AQDA 4QDUA 5CT6A 4IHAA 3H19A 3RM3A 1AKNA 4QDTA 4BDTA 5K3AA 5YASA 3O4GA 4BVJA 4X3CA 4UFOA 3CCBA 1XZGA 2FUKA 3DKKA 4Y2PA 2VT7A 5EHNA 1K63A 1BE0A 4JYMA 5IVDA 1XLWA 1OXMA 4QA9A 5AK6A 5ALFA 4C88A 1DX6A 3P2MA 1E8MA 4DNOA 5EIEA 1R9MA 1CUBA 4H7KA 4KEAA 1U4NA 4RE6A 1CUXA 2Z5GA 3T52A 3HC7A 1FFBA 5JD6A 4MXDA 2C4HA 1MAHA 3CXUA 4G4IA 1XZIA 2OQVA 1WB6A 4B6GA 4NVRA 1DT5A 2FJ0A 4Y2SA 1ZJ4A 1CUDA 2B20A 2WG2A 1IZ8A 4H7HA 3H18A 1R3DA 4JNCA 3C6BA 4U2BA 5LLSA 5FUMA 5D3KA 1JJFA 3ED1A 2FJPA 2HA2A 1BU8A 4FTWA 1VA4A 4HRYA 5A71A 1ZICA 4FBLA 3WA6A 5AK3A 5FOQA 3WL6A 4EY7A 3F9CA 4DMFA 1UKBA 3EIOA 2VAVA 5HKAA 3HZOA 3RLIA 4LIPD 5FKJA 3YASA 1YR2A 1XROA 3DL4A 5K3FB 2X76A 1X2EA 1QO7A 2VJAA 5I7UA 2QUBA 3Q8WA 1Z68A 1CRLA 1VKHA 2HA5A 2ZYHA 1KU0A 4ITVA 3E4DA 3HYSA 4FLEA 3EBLA 4KRYA 3WKDA 3I2FA 1BCSA 4H18A 2BFNA 3C70A 4J0HA 2RI6A 2PL5A 4UBNA 3S8YA 1QIGA 3PICA 2HU7A 2B4KA 4YX9A 5ALWA 1H2YA 3LIPA 4QEKA 1YB6A 2XQJA 1I6WA 3BJRA 3PE6A 3FVTA 4Z49A 2XUFA 1JU4A 4IO0A 2XMBA 3FYUA 4RPCA 4J03A 3FOBA 1DINA 1UK6A 1UK8A 2YASA 4XX1A 3A2MA 5LP1A 4B83A 4PSCA 1WM1A 3I2IA 1EA5A 1GPNA 1G4HA 1P0IA 2C0QA 3D2CA 5EHXA 1ODCA 4AO8A 2JF0A 4DLNA 1VE7A 5E4JA 1W6RA 3U1TA 4L3WA 4Q3OA 1XQXA 2VA9A 1YS1X 5ALGA 1CUIA 4KAFA 2PPLA 4Q3LA 4J0KA 2V98A 4E11A 1ZI8A 4BCCA 5CXUA 2W22A 2QXUA 3BL8A 2J4CA 4BZZA 3O4HA 1IUOA 5CT8A 1OCEA 5CTAA 5AICA 2DSNA 5DYWA 2PKYX 1TCCA 3L1HA 1EX9A 4FNMA 5C8ZA 4W63A 2Y1KA 2B61A 1XLVA 5AI4A 2WHPA 1W52X 3FYUB 2BGNA 2Y6UA 4DIUA 3DYVA 4WY8A 3C6XA 5FLKA 4U2FA 1NU8A 2WLSA 2QR5A 4G9GA 3WK7A 2OAEA 4X95A 3MGAA 3WA7A 4LXHA 4M0FA 4L0CA 2VJCA 4CCYB 4D9JA 3QPCA 3K2IA 5EHQA 4C87A 3A6ZA 1HDEA 1XQVA 2YXPX 2H7CA 3ILSA 4X94A 5T4BA 3I6ZA 5HZGA 5K3DA 3GROA 5BOVA 1MX5A 3GA7A 3H2JA 3OC0A 1SOMA 4UHFA 4WDRA 5JAOA 1E5TA 1SFRA 2C0PA 5AKLA 3EQ7A 3SX4A 1L7QA 1QJ4A 1QTRA 4Y2YA 1ZIYA 4UHBA 1X2BA 3LCRA 5IVKA 5ALUA 1XZMA 4PSDA 1CUFA 1EHYA 1XZJA 4KR0A 4C4ZA 4G8CA 3DS8A 3IB3A 2AJBA 2QZPA 4U2EA 2ZSHA 1YA8A 3V1NA 4PF1A 4UBJA 1S8OA 3TJMA 5LIPA 1QIEA 2HA6A 4W1PA 2JGMA 5AKKA 1QONA 1UKAA 2HA3A 4MJ3A 4PW0A 2YH2A 2WG0A 3M83A 5AI5A 3S2ZA 5CT4A 1AMNA 1Q0ZA 2ECFA 1QO9A 5F4ZA 1Y37A 4KRXA 1GGVA 3FCXA 1MN6A 5CBKA 1P0PA 3GBSA 3ZWQA 1CEXA 4G9EA 1K5PA 1CIJA 2XB6A 4WJLA 1Q83A 4Y9SA 1BCRA 4S0XA 3N0TA 1N5MA 4G8DA 1XRPA 1CUYA 4P9NA 3ZPXA 4QLOA 2O7VA 4Y7DA 4A23A 5HF9A 1A7UA 1L7AA 2OGZA 4UHHA 1THTA 3FCYA 3WWOA 1R50A 2Z8ZA 3MVEA 2HL6A 2R11A 5FXMA 1FSSA 1WHSA 2ZYRA 3VDXA 5AKEA 3R3ZA 1HBJA 4BAUA 3D7RA 2GBIA 4JEIA 1R9NA 3H0CA 1XZCA 4NMWA 4OPMA 4IH4A 2UZ0A 2NW6A 1MAAA 1BS9A 1FFDA 2XQFA 2JBWA 4EHBA 4WFJA 3TRDA 3ZV7A 4HRXA 2CB9A 3DD5A 5ALRA 1W1IA 4K6HA 1ZIXA 3ICVA 4KE9A 3F96A 2G63A 2GBCA 1ODTC 3ZLUA 3ZLTA 3WLAA 2WIDA 4UUQA 1UKCA 4GBGA 1PFQA 3NUZA 1TCBA 2PSHA 1SCQA 3N2ZB 4UFPA 1XRNA 2Z8XA 4HXGA 5CMLA 1GQSA 5JADA 3I2JA 2JEZA 2HADA 2DHDA 4GDMA 3MUNA 4B81A 3QMVA 4J0IA 3IURA 4HZGA 2XMSA 2PSJA 4X71A 2XQGA 5IVHA 2ONCA 1AURA 1MNAA 1E3QA 4CG1A 3SC2A 4U2DA 2XQKA 4Y2JA 2DHEA 3FYUC 3E1GA 4HXFB 5A7GA 4JUIA 3WYNA 5AH0A 2O2IA 2XQIA 5AI6A 2BGRA 1AUOA 3M82A 5C81A 1KU6A 1FFEA 1LBSA 1VZ2A 4F21A 1HLGA 2DCMA 1QIDA 4ARBA 1F0PA 4X6UA 3C6YA 4Q34A 5T4FA 3F98A 3WJ2A 1AQLA 3PFCA 5ALMA 4CG3A 2RONA 4PSUA 5DYTA 4CG2A 4EBBA 4U2GA 5LZ7A 5DLPA 5A62A 4IH1A 3IBTA 3IA2A 5DTJA 5LKRA 4EB0A 5C7YA 2WFLB 1QZ3A 4MYSA 4X93A 2JEYA 5C8XA 4J0JA 1WOMA 3KWFA 5DTIA 3UUFA 4DYHA 2C58A 2WILA 5AI8A 1ORVA 3H2HA 2H9YA 3OTQA 2BJHA 5LKAA 4EZIA 3C5VA 1N8SA 1CR6A 1IVYA 1WPRA 4G1FA 1GPLA 3V9AA 2QT9A 4B9AA 3O95A 4ZREA 2V96A 5AK5A 3V1KA 5JAUA 1XRMA 5I9IA 4LHEA 4E15A 2XT0A 2WSLA 2XUIA 2VTVA 1F0NA 1DTEA 1WB4A 4J0CA 4B85A 2AJLI 2BAGA 3U0VA 2H7XA 4BRZA 5I8PA 2WIFA 2WUFA 5ALYA 4OSEA 3B3QA 1HPLA 3VVMA 2C5FA 1ZD5A 4QNNA 3ZI7A 3D2BA 4K6KA 1XZDA 2ROQA 2VAXA 3R40A 3WWCA 2HRRA 5K3BA 4AN0A 3WZMA 4AMYA 1Q84A 2OG1A 4H7EA 2ZSIA 3G0DA 4P93A 1MPXA 1CPYA 4QE3A 5ALNA 5JYCA 5KBYA 2HA4A 4FLFA 3QYJA 3WZLA 3WJ1A 4H77A 3QBJA 5CXXA 5LZ2A 4UHCA 1YS2X 7YASA 3RKSA 3RARA 1CUGA 4BVLA 3STWA 1LPMA 1P0MA 4DSZA 3UUEA 4BDSA 5AK4A 1THGA 5HKBA 1LNSA 2BCEA 5AM2A 4UFNA 4OYLA 4DMHA 3WK9A 4DGQA 2JGEA 2Y6VA 4KYVA 5ALDA 3SWWA 2QTBA 3A2NA 5CH8A 5AO9A 1R1DA 5IH7A 1BEZA 4Q05A 2QVBA 4GHWA 1NX9A 4F0JA 1RYYA 5DYYA 2XUOA 2PSFA 2XMCA 4FHZA 3G9TA 5AKXA 2IIVA 5ALPA 1SC9A 4WCVA 2Y2VA 2QXTA 3VJMA 2DR0A 4CFSA 4BATA 1PJAA 4ZRDA 1RP1A 2H1IA 2VATA 4X6YA 4CI9A 5DNUA 2OGSA 2JGIA 2HHAA 2HU8A 1MTZA 1QIIA 3KOOA 1QTIA 2Z3WA 1QIJA 1Q0RA 1XLUA 4A5SA 3IULA 2RHTA 1VZ3A 2P8SA 4W1RA 5HFAA 3QMWA 1UK9A 5JZ9A 3R3VA 1EB8A 4OU4A 3WL7A 3AIOA 1AGYA 3DL7A 1B41A 3WWEA 1N5RA 4OU5A 4W9RA 1DWPA 3BIWA 1XQYA 2WIGA 2WIKA 2GBFA 2JGJA 1K8QA 2CBGA 1H2ZA 3PUHA 1E89A 1VJ5A 2XMQA 3C8DA 4XVCA 3ANSA 3TGLA 2PU5A 4LYDA 1TCAA 2XMZA 5AHXA 4PV7A 4DNPA 3Q0TA 2XUHA 4EA6A 5D6OA 5ALIA 2CZQA 4RE5A 2HU5A 3AILA 2I78A 3DKRA 2WJ6A 2WUEA 1J07A 5AKYA 4B82A 5SYNA 3WQHA 5ALJA 6YASA 2QKYA 2OCKA 1QE3A 4FOLA 2I3DA 4BBZA 1NU6A 1JMYA 1WPXA 4WDQA 2WFLA 5ALQA 3FNBA 2ZYSA 3LP5A 1TIBA 4H7JA 4RGYA 4GI1A 3O9MA 5E2IA 1SCIA 1XZHA 2WQZA 4XWGA 1JFRA 4BB0A 1XKLA 1VLQA 2V97A 4ETWA 1A8UA 5JZBA 3JYHA 4WFIA 4BAZA 3JW8A 3R3YA 2O2GA 5AOBA 1MT3A 2XUPA 3QZUA 3DEAA 3B5EA 3WMRA 5IKXA 1LPPA 4UBIA 4X92A 3W05A 5T4HA 1HKHA 4AMZA 3F8SA 1DU4A 2ZJ6A 3GZJA 4I3FA 2VF2A 1LGYA 3PF9A 3GUUA 4TPKA 3FWHA 5H3HA 5ALLA 4G4JA 4P08A 1MX9A 3I2HA 4AZ0A 2VJDA 5ISMA 5ESRA 2GYUA 5CH3A 1XRQA 1MX1A 3BJMA 3D2AA 4LKOA 4HS9A 2QUAA 4HAIA 5D3ZA 4L9AA 3C45A 5K5EA 4Q3KA 1QIHA 2PU7A 4N5IX 5AIAA 1QIFA 3W04A 3DDUA 5E4TA 3X3HA 4FNGA 2O2HA 1UK7A 4F5ZA 1EI9A 1MNQA 3PUIA 5LZ5A 2D5LA 4GXNA 4K6GA 1FFCA 3BDIA 3C8HA 3FSGD 1E66A 2EEPA 1GPKA 2WTMA 3G7NA 4AO6A 5DNVA 3K9BA 5ALTA 3IUJA 3QPAA 3IIIA 3PI6A 4B80A 4J7AA 3IUMA 1JMKC 4IQ4A 2J3QA 4QDOA 4O08A 1CUCA 4G5XA 3FBWA 5JAHA 4BCDA 4W1QA 2CMFA 3B12A 3G8YA 4J0DA 2X5XA 2PX6A 2WUDA 1TKRA 4PQEA 5HCUA 4NZZA 1XZEA 5LYYA 1HQDA 1QLWA 4DTCA 1YASA 4FFWA 2HIHA 4YASA 3WK5A 3D3NA 3WK4A 3FAKA 1TK3A 1C4XA 1IUPA 3G0CA 1A8QA 4J0GA 2G4LA 4N5HX 5HF6A 2I3ZA 3BE8A 5KWJA 4QLAA 1EDEA 3GELA 4XJVA 2RIPA 3I6MA 3H2GA 1A88A 4WFKA 2IX9A 4C4YA 1UXOA 2IITA 2HRQA 2XLCA 5AM3A 2W6CX 4LXGA 1D07A 2PUHA 2JGLA 3STUA 2GYWA 3O0DA 2AXEA 5DJ5A 1CUJA 3WK8A 2G5PA 4GWLA 1F8UA 3DNMA 2O7RA 1UFOA 4AB1A 2WG1A 1IMJA 3QH4A 5CT5A 2JIDA 1UOPA 4PNZA 2QJRA 2OCIA 4FKBA 1F6WA 3V1MA 4AX4A 1EVQA 2CEKA 3D59A 2QRUA 4EY4A 1H23A 1WB5A 2XUGA 4H7FA 2C5GA 3HSSA 2WJ3A 3O9VA 4AO7A 2HDWA 1W76A 3R3XA 2XI4A 1XRRA 4W1SA 3R41A 2WTNA 4WY5A 1DWQA 3G0GA 4YK7A 1QIMA 3KSRA 4KE7A 3O4IA 3D4LA 3A2LA 2ORYA 5LZ4A 1FJ2A 3AUKA 1ZGBA 4N8SA 3WKBA 1J06A 5JD5A 3STVA 5FV4A 1U65A 2DQYA 1E8DA 3I2GA 4X97A 3TEJA 2OLEA 3G9ZA 5AIBA 1UZAA 1FFAA 1T4MA 3FYTA 4G8BA 2GBGA 3WKAA 3H17A 1ZD2P 2OAGA 3HLKA 2AJCA 4BRSA 2BUCA 4X00A 4ZXFA 3WKCA 4ARAA 1MO2A 3H1AA 1EB9A 4IH9A 5AI0A 5AKGA 1XQWA 3OPMA 3C43A 5JASA 4PO3X 5EI5A 3V48A 4MYDA 3V1LA 3OM8A 3QPDA 4H7DA 2I03A 1O6GA 4M0EA 3HACA 5CH5A 5A6VA 1YCDA 4GEGA 1CUUA 4MQMA 1ZD3A 1EK1A 1GT6A 4QDZA 3QVMA 3DOHA 3WL5A 1CV2A 4BTVA 2G5TA 3HJUA 2JGFA 1USWA 3ANTA 1CUHA 4MWSA 1G5FA 4G4GA 2HFKA 4ZI5A 4BZWA 5DWDA 4FLMA 4F60A 3I2KA 4H7IA 4TVKA 3ESBA 2DHCA 3HXKA 3O4JA 5CRIA 1LZKA 3BDVA 3DLTA 1EDBA 3JWEA 4OCZA 2XE4A 1EH5A 2QJWA 1N1MA 1YAHA 3KXPA 1H2WA 1UT6A 2ZJ7A 2XUAA 2WFMA 2WHRA 1GKKA 3BF7A 3VJLA 4B0OA 1ZI9A 1L7RA 5EFZA 3FLAA 2Q0XA 1K4YA 1LPBB 3ICWA 4H35A 4KAAA 2JGKA 1J2EA 2WJ4A 1KEZA 1VOTA 2XLBA 3IUQA 4NS4A 1ACJA 3W2TA 1ETHA 4C89A 2WM2A 1AC5A 1E8NA 5HK8A 1EK2A 3STYA 5HQ3B 5JANA 4ZV7A 5HFNA 4B7ZA 2WFZA 1LPNA 1LZLA 5FP0A 4DNQA 4FWBA 5AKZA 2VSQA 3FLEA 4H0CA 4LXIA 3WWDA 2QOEA 4QZVA 1EVEA 3LIIA 3STTA 4BCBA 1K6EA 4BC1A 1CUEA 4KACA 5JD4A 4FFVA 2D0DA 2WIJA 1BROA 2ZJFA 1J1IA 4MQLA 2WHPB 4OB7A 2CKMA 5DNWA 5FRDA 2PSDA 4RNCA 2XMGA 1BN7A 5AM5A 5ALOA 5CURA 2OXEA 1LBTA 2OCLA 4EY6A 3WI7A 2WU4A 4MWTA 4P92A 3WKEA 3KWJA 1YAJA 5IVIA 4BYMA 3I28A 5ALZA 3R3WA 4CIBA 3G0BA 3M3DA 2E3JA 2HA0A 2CJPA 5ALVA 4OB8A 4MEAA 4BTLA 1YB7A 5FDFA 4QWMA 5LZ8A 3WIOA 2BKLA 5JAPA 1LLFA 1M33A 1EXWA 4JYPA 4C01A 4I19A 5JARA 5EGNA 4DNFA 3GFFA 5JIBA 2WUGA 4Q1VA 5AKIA 3OG9A 1U8EA 5ALSA 3QITA 3EQ8A 4M0MA 1A8SA 4DMKA 1B6GA 1DWOA 1XZKA 5A7HA 1CQWA 4K2AA 5EIHA 4UBLA 5HK9A 3LS2A 1Y7HA 3PFBA 4V2IA 4Q82A 5ALXA 3DJYA 2RGUA 1DQYA 5AM0A 3HABA 3F97A 1BRTA 2V9ZA 1ORWA 3VJKA 2J3DA 1GZ7A 4C4XA 5JATA 3IDAA 1WCYA 2FX5A 4Y2RA 4K5QA 5A7FA 1R4ZA 4EY5A 3PDCA 3C6ZA 4MEBA 3STXA 2PUJA 4B84A 5K3FA 5BWCA 3NWOA 3FLBA 1QFSA 3QMMA 1VA5A 3E3AA 4CCYA 3G9UA 3VVLA 5AP9A 1CFJA 2WU3A 1WHTA 2VJBA 5AM4A 1JT2A 1ZI6A 1CLEA 1HL7A 3L1IA 3D0KA 2OQIA 3AIMA 4B0PA 2ACEA 4JH0A 1MJ5A 1TRHA 3LLCA 2Z3ZA 3WK6A 1ZD4A 1AX9A 2PM8A 4ROTA
chains in the Genus database with same CATH superfamily
1PWEA 4B4DA 3ROEA 5A2QA 4L5AA 2OMEA 1CUZA 2PVSA 3UGKA 1BDHA 4ALNA 3KQWA 3RS4A 2W2LD 1U63A 4X20A 1YVEI 5EE5B 4MUJA 3V7YA 2YQ4A 5I7EA 4HEA6 4BKOA 3L0SA 3O8DA 3H3JA 4JI4B 1ATZA 1S1CA 2G9UA 4LOIA 3D6VA 1EWVA 1ZRHA 2RH4A 2VDRB 4OGKA 1ZXBA 1A7AA 3A4YA 1FRFS 1GPH1 2CKDA 2CLFB 3FSGA 3JAWA 4HGRA 2V0CA 4X7BA 2E4VA 4RQBA 1Y8QB 1UBCA 2NSHA 3FIJA 3BWXA 4C3UA 5JZSA 3F6PA 1WW3A 3AR7A 5HJ7A 3ER9A 4UW9A 1DQZA 3VH2A 1T26A 3ON5A 3AHGA 4HQKA 4Z8YA 4ZYXA 1V7CA 3DV9A 5BNTA 2JLSA 3HI4A 4L3OA 4A8JA 4OB6A 1T5OA 4DIKA 3KR1A 3MERA 1EJ0A 3NM4A 2E4XA 3C5WP 2POQX 3AWDA 4Y6OA 3TVDA 4AKIA 1FS6A 3VISA 3EOAI 1Y1TA 4ZKDA 3VVBA 5LQJA 1GXSA 3PZBA 4HT3B 2QP4A 1XLTA 4K9DA 2L0XA 5C1DA 1V1RB 3MUOA 4IVRA 1P1KA 3RLFA 4W5TA 2GAJA 3F3KA 1E2FA 4UHEA 3L7LA 1HDIA 4M21A 4U2CA 1V6SA 4ZU1X 4D6PA 2KWIA 4YIHA 2WU1A 3USCS 1WG8A 2EATA 2IPAB 1R27A 5E1DA 4DA7A 4YQFA 4K9PA 4FMDB 2J6BA 5CA0F 3ZEIA 3UMJA 2E4YA 1ZH0A 4KB5A 1YJ8A 1U4SA 3TDNA 4WT7A 1UZUA 2XJ9A 3EDQA 3M81A 5K0LA 2FDCA 3NGXA 5D3MB 4H31A 2ODWA 5CK4A 3O3MB 1L5WA 3FDXA 3R77A 4NG5A 5L7YA 3RDPA 3WYCA 3NEAA 3IUNA 5BOSA 2Z6UA 1ZD8A 2J30A 3JQFA 3LKZA 3C3DA 3GG9A 3LOUA 3KJNA 4U1RA 4LCBA 1KJIA 1DAGA 3WLRA 1BVUA 5JRDS 2GSWA 3A37A 3B7PA 2ZYVX 4HC4A 5DXJA 5J3JA 5AJWA 3GD5A 4HDRB 1LDNA 2A86A 3B9QA 3EXHB 4WESA 1EJ6A 1VL8A 2YY6A 4J1SA 5ELLA 3X1MA 5IPFA 2C04A 2HT6A 1A2BA 1BCSB 1GG8A 2HXYA 2H1LA 4E30A 5A4JA 1N9GB 2IYUA 5BWLA 2G07A 3GW8A 4R7GA 2JH8A 3NLLA 3VI4B 2IUUA 1TF5A 4K0RA 1K0FA 4PX2A 3G0IA 3OZRA 2VP6A 3IP8A 5LZ9A 2WMYA 3N6VA 2V7GA 5ERYA 5EJAA 5CVTA 5JPDA 2ZW9A 3SZUA 4JT8A 2BUBA 3MFQA 4AG5A 4B4UA 3DE7X 3TXAA 1KQOA 1V5EA 4JUCA 2HJHA 4YCNA 2J41A 3IIJA 3U9LA 3EGXB 3DZ8A 2W2VA 4B3SB 4BAGA 1OFTA 3K0FA 3TLGB 4JEHA 4DA8A 4ED9A 4EW6A 1I7QB 1JI3A 5C2JB 3R9WA 1U31A 2C9YA 4QBIA 4DMCA 2F8TA 3FMIA 3PC8A 3TAXA 4O4HB 1P3Y1 3ZZ0A 2JD0A 1FYWA 5TEVA 4JI6B 5CW1A 3WNDA 4DADA 2RD2A 5AXCA 1Q11A 3DUFB 4F3NA 2OOSA 4HQ6A 1FXWA 4LF9B 3HJGA 3WY9A 4ADSG 1D0VA 4G56A 3OLQA 4TTAA 4X5OA 5C7IO 5JV5A 3RABA 3F8TA 3JWIA 2C54A 4CCAA 3ORSA 5KQSA 4L6CA 1V4VA 4PHHA 4KNVA 1XDDA 3WWPA 4PYJA 2WKWA 1LDYA 2IA5A 1T9CA 4CKBB 2YOFA 2WHQA 2EHDA 1CUSA 2GHRA 1VCHA 1FFXB 4D44A 3VTAA 1KS9A 1IUNA 1AZSC 4M7PA 4BNTA 4JODA 2FGJA 3GEDA 3HY4A 1F1JA 4U6NA 5HF8A 4EB6A 4ZICA 2C4KA 5LA6F 2OORA 1RJ9B 1QCYA 4GVXA 4IIFA 3T61A 3LPAA 1YCHA 4BX9A 1R74A 3ZGZA 3O74A 2CXRA 4BMSA 3KFXA 5LMZA 1VYHA 1YU9A 2CJFA 4F2HA 4UEOA 4QSMA 1P4RA 5L4LA 1BFKA 3K1ZA 3UJ9A 1GITA 3VR5H 2ZVQX 3V97A 4BP8A 2MSWA 1S7CA 2PVCA 2AYXA 7REQB 4EMBA 2X40A 1I51A 2JFZA 1Y4DE 3NC0C 4G1UC 3ZXXA 3IT3A 2YY5A 3PBKA 3CNEA 3HG7A 4J1QA 2X6QA 1NOIA 1U7WA 3DCNA 3VR6D 4QODA 5EPOA 1OKKD 1UUFA 5EJGA 2C8KA 2XMDA 3H6HA 1JVSA 3E1SA 4PEVA 5E6SB 4EKEA 2QPLA 4D98A 3AHJA 3KKMA 3I2YX 4Q01A 1G6HA 2AZTA 1IJKA 5AHOA 1T9ZA 1F2VA 4ESOA 5L51A 3NVAA 3W78A 3BF8A 1RNLA 2QLTA 1J5PA 4Q3DA 4U2GA 1RBQA 5AW6A 2W2PA 1C1XA 1P8AA 4QUDA 4DC1A 1N75A 1DBRA 2Y4OA 4A6EA 4ALLA 1WABA 5B1HA 3X2FA 3GDGA 5G1OA 2CDRA 2ZU6A 2QM0A 1CRWG 1PL6A 3BXPA 3I9NA 3LYUA 4MYCA 4UPDA 4EARA 2JK1A 1FB5A 3K9NA 4JEMA 3GAFA 3REGA 4DCUA 2YYSA 4KNWA 1IQUA 1MABB 3QSGA 4GKAA 3DNFA 1V16B 1HK7A 1SHJA 2OCDA 2PGDA 3PL5A 1L5FA 1QX3A 2PS3A 2XUDA 3GRVA 3OOSA 4JUAA 3AF2A 1VJGA 3IB6A 3K9HA 3T1NA 1E0AA 4PFQA 5BURA 1PG0A 1LPSA 3N6XA 3HEAA 1JLHA 16PKA 4GI5A 2BBSA 5K0GA 3W0LB 1H2RS 4DOMA 2AXQA 1X1QA 3GLKA 2EJBA 3JVIA 3EEOA 1XZAA 4QREA 1RACA 1SKYE 3HM2A 2OBMA 2Q5HA 1NZFA 1W87A 1HDXA 2R8BA 3AOEA 1VKJA 4EYSA 3GHHA 2LWIA 2WD7A 4R0VA 4RADA 4HTAA 3F6EX 5M3BA 3IAUA 3VDRA 2X4LA 2YV5A 3ZZ1A 3AFGA 3DBOB 1QG0A 4A03A 2ZE6A 1YI1A 4DB4A 2J07A 4ROSA 2Y66A 1GAJA 1WXWA 5AKJA 4IJ6A 1U2GA 2QN2A 4Y2XA 3KD3A 2VIIA 1J9ZA 4X91A 1I32A 1MIOA 2GZSA 2GS9A 1ODSA 2R1VB 3EZ2A 4KN8A 5EWJB 2CJYA 1O8CA 5B4UA 2QTNA 3VOAA 5IW8A 5C5IA 2C1ZA 1KY5A 2PRJA 3GH3A 3QI2A 3JVUA 2ZYUX 4JI5B 3V00A 1WMSA 2B1QA 1N8TA 4JWKA 3LBFA 1M5UA 4M87A 3I72A 4WRRA 2ZZNA 5CLHA 5DMHA 3A6FA 3W1VA 4Q6WA 3A9CA 1VRWA 5EKUA 1WXFA 2GO1A 2DF8A 3D02A 3C87A 5BXQC 2C9DA 1W4ZA 3SS7X 1QHHB 3SBEA 2O54A 4RH1A 4K03A 1L7EA 1IHOA 1ZHFA 2H16A 4EDFA 3MPUA 3EF3A 1WDKA 1TTHA 2D5CA 3QE2A 3C14C 1JU3A 4KXUA 3L05A 1XTQA 5KTOA 4OJNA 4TV8F 4UAJA 3ANMA 5ALHA 5BN4B 4B71A 5F1KA 4DT1A 4FFBA 3EXFB 4G6ZA 5DZSA 4BE4A 3DOIA 1PWYE 4RDHA 5E4YA 1RWMA 3K0EA 4CM4A 3RAEC 4Q1EA 1D2MA 5F76A 8GPBA 1BX0A 3FFAA 3ETGA 4TV9B 4OHBA 1XNRB 3BXFA 3UOWA 2BFCB 4PS1A 1L7BA 3L3BA 1G18A 2HLHA 1ACLA 2Q6KA 4KK3A 3RHFA 3JTEA 4NEQA 5DTEA 1E1KA 2Y0BA 2YWGA 2JD1A 4BVKA 4G1VA 3SYNA 4G0VA 1AGRA 2KW5A 2ZPAA 3VDQA 2CFRA 1Y3FE 3WGTA 4NYIQ 1F5NA 1JLKA 3FKQA 1NLMA 2UVPA 1SQ5A 1ELOA 4IF6A 4BE9A 3EFOB 1X7XA 2I8LA 4LDNA 1LPOA 2G70A 5TDHA 3E9NA 3OAAD 4ZYVA 1BH6A 3E84A 2Z6VA 1C80A 3CGWA 3MRSA 5EMNA 4GMGA 4LS3A 4WOJA 1U0FA 1HUQA 3VPSA 2QSUA 3W7BA 3GLRA 4HNAA 4LJRA 4DJAA 1W85A 2C2YA 4XLLA 1W8DA 2VPWA 1G8MA 4YPVA 5LQSA 2FF5A 4EFDA 1PV4A 1N6RA 2HSEA 4UAUA 2UV8A 5H3CA 1SQGA 1OFUX 4D6XA 1MBZA 3E7PA 1I30A 3W9BA 4B2IA 2OK7A 3Q87B 3H7AA 3F6CA 3MMNA 2IHUA 4JGGA 2XDWA 2PT6A 4RA6A 4JI0B 4A16A 1SD2A 3PKIA 1DIHA 1V5IA 4D02A 1X70A 1Z63A 1EEHA 4QWWA 4Y6LA 2XXAB 3PXBA 2V4UA 2BUAA 1MUUA 2CLOB 4X7MA 8ABPA 2AMJA 4MVJA 4A7PA 1XT6A 3GMTA 4IWXA 4ISBA 5FD8A 3NO4A 5M34A 1M2KA 1P74A 4X1YA 4QVIA 3B3AA 3SF8B 3TTVA 2IQ5A 3FFBA 1EWKA 3DP9A 4BFYA 5LJLA 4EJ2A 5MF6A 3PIIA 4M88A 2VAPA 3SHFA 1P33A 3SOPA 4D1YA 5J47A 1DAMA 4URVR 1TAHA 3E5HA 4I7EA 3CNLA 3CGGA 4DAOA 5THQA 2RK6A 4RSGA 1YRWA 4IIHA 4PZEA 5K0FA 4R6WA 3UW3A 1NJ1A 3B82A 1RQLA 4GX0A 1GGMA 1KZ6A 1OILA 1T91A 4NTZA 4OHVA 3CSDA 3KD2A 6NULA 3ESDA 1GNVA 1R6BX 1KFKB 5KJ1A 1YZGA 2DR3A 1BDJA 1Z3IX 3GHYA 3UFXA 3F6YA 4BMXA 3VKGA 2BFDB 1K92A 4IHAA 2IYQA 3BPSA 3ND5A 3ELBA 2NO0A 4QDTA 4IZHA 5DGXA 1QPBA 4R98A 5JSYA 3KSZO 3SQDA 4CODB 5BSHA 1QHHA 5TMDA 4Z99A 4CM9A 4LSZA 3C5HA 1E79A 2H1WA 3T0FA 2H00A 1O95D 2QQEA 1U8FO 1NYQA 2VA8A 2VYQA 3H2ZA 1N0UA 2HMSA 4QO7A 2XYRA 3M4XA 2IZ7A 4RH0A 1X9IA 3WLQA 2FUKA 1TU3A 2GPWA 521PA 3CH7A 4MA4A 2YDXA 1GTMA 1P2VA 1DADA 2DUMA 5IMSA 4F4DA 1BE0A 4JYMA 4WACA 3C8MA 4GMHA 4JN6B 2RB4A 1AGXA 4RTLA 1CY2A 4OOFA 1E3WB 3S0JA 4QA9A 3PSAA 2HMAA 1UBFA 2CK3D 3WGVA 1H2BA 4D74A 1B23P 2JZNA 5AK6A 1IG0A 1L1EA 5FWYB 1L4LA 2XNDD 4MWEA 4P98A 5AVQA 2VTBA 1D3AA 3RAJA 4ZN6A 3THXA 4DNOA 1MPTA 1U5CA 3COZA 1ZH4A 4CU5A 4WK6A 5EIEA 3LPMA 2BKEA 4KR7A 3GGCA 1JQEA 1ZCAA 2VWHA 3DWEX 3K2BA 4NFLA 3VMMA 4RVGA 1CUXA 1JVNA 2A7QA 2Z5GA 3T52A 2D1RA 1HE3A 1M8PA 2JBAA 4F4HA 5LJIA 4DMGA 2BEKA 4I1YA 4MXDA 5IAOA 1C1DB 4ZQBA 2PRZA 1EDZA 3BJZA 4GQIA 3BBPA 4RDIA 5F1OA 3H2BA 2A3NA 2RSLA 3JQAA 3ZD6A 4AJOA 1MAHA 1N2ZA 5IT0A 4G4IA 3TOZA 1BHJA 4MB6A 1DPGA 1XXHA 1O94D 2XKAA 1K89A 2C07A 4HVAA 4DV2B 1GSOA 4B6GA 5HZKA 2QGFA 1O9HA 3ZBUA 4TWIA 1FIUA 1UBHS 3GRAA 5DGCA 2F7SA 4AZTA 1OIVA 2B20A 2F6RA 2WG2A 4NMXB 3LVRE 3M3PA 1E2PA 2J5BA 4DCSA 1ZMOA 1KMHA 4CTOA 5JSFA 3H18A 1AKRA 3CO0S 4DW8A 3AKDA 4CRWB 1NRJB 3HKBB 3DTVB 3MTEA 2R6HA 3RWOA 2HF7A 3C6BA 3EVBA 2H2WA 4RL6A 1WUJS 4TL9A 4U2BA 5LLSA 4B3FX 5D3KA 2HV9A 2A9PA 1GGFA 1HZJA 1KFBB 1XALA 2CNWD 4KFUA 1KO7A 2FJPA 4OATA 4ENTA 1RI3A 3IEVA 4KDCA 2MR6A 3A1DA 1KI6A 1S2MA 4Q03A 5D51S 5A71A 3HO1A 2P5UA 2W83A 2WB4A 3CKKA 3WWYA 4QOGA 4BVBA 4CQMB 4AC9A 5BVGB 2ZJZA 1OUMA 5A4FS 4J2OA 3WL6A 1YBAA 4EY7A 3RAPR 2DPMA 3F9CA 3M5PA 5AW5A 4JC0A 3GLSA 5LU8A 2NZUG 2DUNA 4DMFA 4YQYA 3OQIB 5AQ1A 1DAOA 1QB7A 2P4HX 1FFWA 4TWBA 3DDCA 4NJMB 5HKAA 4UQPA 2Q3CA 2A59A 4U5XA 2G72A 4FNAA 1EFUA 3SIPA 4LIPD 2X4GA 3YASA 2P68A 3F6SA 2MSEB 2X7XA 1OXUA 4NFHA 4Q93A 4Q15A 3L8FA 2VHCA 4BFSA 1I3NA 4EB6B 1O58A 2DTDA 4QOEA 1XU7A 5KHOC 1QO7A 3BN3A 4LYYA 5I7UA 2VRCD 2QUBA 4EVIA 4E5VA 1Z68A 2P9YA 2F43A 3TD9A 4WD3A 4UNIA 5CDYA 4QYWA 1OLSB 3L7JA 1VLZA 4FX5A 2YL2A 4MULA 1LQTA 3CT4A 4WI1A 5B3JA 3GEIA 3ZCPA 4D4JA 4P1ZA 2WJAA 5IHXA 4KAXA 2E1PA 2RHGB 3ZCVA 5F3DA 4CLRB 1T5BA 3EBLA 4QUAA 3DEZA 2J85A 3N3BC 4XCQA 3U7FB 2ZIFA 1TKAA 3DLCA 2ZM5A 3ZE1B 2DETA 3KHKA 2GKOA 3PFFA 5FI3A 5GVRA 3U3ZA 5HKKD 4WXEA 2WV9A 1V9SA 1VL2A 5E0OA 1BCSA 2BHLA 4C2AA 1WXIA 3C70A 1NLUA 3MJTA 4J0HA 1B16A 4X65B 1ZGJA 2CXPA 2WEKA 3PQ7A 2R5WA 5G0UA 3TTWA 4CIXA 1H0KA 1VE3A 3KOMA 4FMDF 2JVIA 1JW9B 4FW8A 4UBNA 3W2IA 2UU9B 5EE3A 2NU8B 4YA6A 2O3UA 4G0YA 2HU7A 5CD1A 4NX2A 1A98A 3DZJA 1PWHA 3EXHC 5ILGA 4NSNA 2I7VA 1VL1A 3ICOA 2B4KA 4BFCA 2ADMA 1DIAA 1P4SA 2CYBA 3AVWA 1O97D 1U9ZA 1H2YA 2JNWA 1PZNA 2HJWA 1VM6A 2RHRA 1XL0A 3BXZA 4FKZA 4Q4AA 5DEIA 1L9KA 1HGXA 1HG0A 2LKDA 4QEKA 1QTNA 5PGMA 4F84A 2GR9A 3U5TA 3H8JA 4BQFA 4HDRA 2XQJA 1JT9A 3OBBA 5EZQA 5GY7A 1E62A 3SXUB 3BJRA 2F59A 1CJCA 1FUUA 2XKJE 3QX7A 1JJVA 3Q7SA 1Y6JA 3CBGA 3GY0A 4JENA 2AEEA 2LP4Y 4YTEA 1E32A 2FPGA 3KAPA 1L5LA 4OQEA 1NUHA 1RRVA 3C4JA 4UJ5A 3UK1A 4IO0A 3TZKA 4J03A 4GX2A 1DINA 3O3CA 1UK6A 2DWQA 4U5QA 1UK8A 2N1BA 4TRMA 4HB2A 4EO7A 4JBIA 3PXGA 1FLNA 3OCXA 1NJ5A 4UTNA 2RHDA 2J9FA 4PSCA 3JWHA 4M38A 1J00A 3I2IA 3O2NA 1I4EB 2GK3A 4Y8VA 1RQGA 1KYWA 1P0IA 2XITA 4ZARA 3FMFA 4CMCA 3L8GA 4ETNA 4NFYA 3AVYA 1JDUA 2GHTA 4XYEA 5EHXA 3U3DA 1EXDA 1UXKA 3RVQA 2EFEB 1RXWA 4NZPA 2DSTA 3ZTYA 3BWCA 3VR4H 2R8ZA 3HRIA 3BTVA 3JQ9A 4LJ5A 5E4JA 4N41A 1WVMA 1W6RA 1NPDA 2P9EA 2Q6VA 3HNPA 4YP6A 5KCZA 3R5KA 1JIIA 1ONPA 4GO1A 4L3WA 4OI1A 3C24A 4RJIA 4Q3OA 3RBVA 3UK2A 1Z5PA 3O2QB 4DA0A 5BSEA 5KTNA 1C3LA 1X0XA 5GIPE 1ENOA 3LUGA 1GRNA 2M6SA 3RVSA 3UWDA 3E27A 3WISA 4ZHQA 4ZO8A 2FPMA 5A4MS 1DEAA 4E11A 2JLXA 1JIXA 2PBRA 3EC2A 2GX6A 4BCCA 1G9TA 2I4MA 3HVKA 5E1MA 4ZMRA 3T3PB 1XDUA 4BVEA 3O4HA 4IZOA 1IUOA 4BZZA 4LZZA 5KJ6A 3KETA 3P20A 3BK2A 3BSSA 5CTAA 5IJXA 3UJBA 1ZLYA 3W6NA 3P9PA 4WKBA 3W8RA 1RYEA 1RYBA 3ZJYA 1NVMB 3SZGA 1A7JA 3SIRA 1XHEA 3V8NA 1LF0A 2WE7A 2X8JB 3B5IA 4PZDA 2HY7A 4X63A 5ESDA 3UGTA 1JIQA 1AF4A 2JATA 2Y3IA 1R0BA 2LNDA 3Q12A 5JDIA 3I5YA 3QXSA 3MW8A 4OO3A 1RI5A 1TZCA 2EZ4A 2YCBA 1T34A 4IX9A 2FCRA 4E5UA 4I50B 2V3WA 3NBAA 3DMHA 1GTVA 1UPCA 3UMRA 4CDNA 4UUMA 4JJ8A 2B8JA 1IY9A 3N0VA 3FCCA 3LC2O 2KBEA 1X3SA 1BFUA 3ZD7A 3NEJA 3EG9A 1KIMA 3EZFA 4C0QC 2JC3A 4EI8A 1M34A 5K6AC 3LX4A 2H2AA 1G60A 4BQNA 5IDVA 3OCJA 1E1CB 3V4FA 1XR3A 1GPBA 3JASB 2DBQA 2WLSA 4DPKA 5A03A 4NOLA 3IUSA 5AHKA 2H51A 1ZUHA 3PD7A 3O21A 3A0RB 4YMUA 3V5NA 3P9IA 3LCUA 1X1AA 3HZZA 4PX5A 3KAKA 1WZCA 3VV3A 3IBYA 1C1YA 1R6VA 3DFUA 3S2YA 4B3IA 2QX6A 2ZRQA 4DCPA 4EUKA 1CQIA 2RBKA 4M0FA 2I2FA 2NU7A 3VYSB 5KQPA 3CKMA 3N5KA 4L0CA 4MAMA 3SLRA 1U7ZA 1E58A 3NHAA 2BFFA 1XNHA 4JCCA 3N8DA 3P9RA 4IDOA 1MC8A 3SCZA 1M2JA 2WYOA 4MR7A 4W5HA 2D2XA 3A1TA 3V4LA 2QPTA 2OV8A 1ZGZA 1X39A 3NBKA 4LV8B 2FMTA 2VWGA 1XNGA 1HDEA 1PW5A 4HMPA 4P3PA 4X7PA 2A0FA 1I3MA 2BHTA 3B8EA 3FX2A 3KLBA 3FHCB 3O4RA 1EBBA 3LHDA 4MVJI 5TEWA 2FWAA 4UM8B 2QPOA 3ILSA 4WA8A 5T4BA 1E4VA 4NATA 1UPUA 5EVJA 3B2QA 3RFVA 5K3DA 4KR9A 3ZK8A 3KT0A 3GA7A 3TR6A 5JLJA 1VI5A 2GCGA 3QYFA 4MNTA 3VYRB 1TA4A 1PJ8A 2Q2WA 4NQRA 4UU1A 3WB2A 5AUPB 1B74A 1UXIA 2JLAA 4NBVA 3R6WA 1YB5A 4B8ZA 4D99A 2Q29A 3CW8X 3DO6A 4Q0MA 4HX5A 5U4QA 3U4DA 3ODPA 2R5FA 3RTDA 1ZMRA 2ERCA 4LBVA 4C7BA 3CTMA 2YIMA 3KC2A 4MUMA 1M75A 4N0EA 4KRGA 4AU1A 3Q9NA 5E9JA 4CDGA 1SC3A 1SVWA 1GSAA 1VRVA 3IMKA 1KC3A 1RYHA 3HCPA 2G83A 4HEA1 5JS8A 5JJCA 1ID1A 1Z0UA 1AM4D 2QW0X 1N8NA 4LF5B 2DKNA 2H1VA 3CH6A 4M53A 3T4XA 2IP2A 1NW9B 4Y2YA 4QGGA 2BSQA 2A9OA 2QXYA 4IJVA 4UCWA 3NHJA 5IVKA 2J0UA 3NHBA 3KSAC 4OLHA 4MKGA 3WLEA 1PZHA 3SSNA 4CG0A 4KX3A 4XDGA 1EHYA 3OPYA 4OBEA 4WOPA 1D03A 2A1UB 3DS8A 1H6CA 2YJNA 2QTTA 4G8CA 4KXYA 3T7IA 3F1LA 3MLBA 1FUYB 1EPUA 1VGQA 2W70A 5ADUS 2ZSHA 5BVGA 1LLDA 2ZBVA 3V1NA 5A9SB 4KP7A 4OI4A 5LP6B 1G17A 2ZJAA 3GMDA 4IQGA 2G88A 4ZCQA 2HT1A 4ILKA 3UHPA 2OSVA 1IC6A 1A97A 4YJDA 1N9KA 3TB6A 5CYOA 4EGJA 1Z6PA 2HA6A 5FEUA 1U2DC 2CXXA 4W1PA 4YMVA 4YCJA 2FGKA 1TEVA 3WOHA 3I30X 4S2EA 1X15A 4DBZA 2JGMA 2XYGA 1ML3A 3FNEA 2A1IA 3HDGA 4FEEA 3MTGA 4KTTE 5G4LA 3DTVA 4WUVA 4W9MC 3WIDA 2QX7A 5KB3A 3M83A 2WG0A 4PCVA 4F4FA 5AI5A 1PT5A 4MQFB 1UMDA 3I4FA 4F3RA 3RPEA 4L50A 1Q50A 2WJJA 1JGTA 1N78A 1EZZA 1GT91 2PBFA 3TUZC 2R25B 2G82A 5FH9A 5AJYA 2PKRA 3O7WA 1Z0ZA 4KRXA 3ZXSA 5KJFA 5C3UA 2HTEA 3ZV6A 4EGCB 5AUNB 1YZKA 1PJRA 2OG2A 3LW7A 3THYA 3NIFB 4UTPA 1MN6A 1E4EB 1P0PA 1LVGA 4WZBA 4IL5A 3V1YA 1J2YA 2Y92A 3RD5A 2F8LA 2ZR7A 4G9EA 1PKEA 3V4VB 3CF2A 1PJ4A 3BRQA 4D9EA 3F9IA 2R96A 1Q83A 3OM1A 1PR9A 1BCRA 3HVJA 4I6EA 4L57A 4P3XA 5B64A 2FPLA 4YMTA 1C7QA 1V96A 4O25A 4LZPA 1N5OX 1YR8A 3BAFA 1QGDA 3R4CA 4TYNA 1J9GA 1SK8A 1QFZA 4LXYA 4NYJR 2V7PA 3OECA 4NXMB 4DZZA 2W6OA 2HW8A 5LP6C 3ICEA 1YQXA 2LKCA 1E3WA 4JZKA 1NUAA 1GZ4A 3PQ4A 4KG7A 3AHCA 4ZQGA 5LOVF 5CVUA 2Y1DA 2BE7A 1A4XA 2D06A 5HW0A 4QLOA 2J3LA 4Y7DA 1LC0A 5EOVA 4D0GA 3AI3A 1TEXA 3E9QA 4C2TA 2Y93A 1CERA 4YJ2A 1KPHA 4UHHA 5KWSA 5CNJA 5CVCA 4ZMBA 1RXEA 1UJ5A 4BUCA 1FSPA 4OMUA 5GZ1A 4FI3F 4FYHA 3I61A 3S2FA 4JDPA 2RAVA 4ZQHA 3WWOA 1U2PA 4K3UA 3MEQA 3DLBA 2HL6A 3CZRA 2PMFA 4GLLA 1KPGA 2GYYA 4EUFA 1S96A 4JP2A 3MOGA 1DDIA 1L7MA 3AY7A 1Z35A 2HSZA 3DD1A 4PPYA 3UH0A 1T1GA 3UAGA 5JW6A 4S3MA 3F6RA 1WF3A 3IEPA 4UEQA 1NG9A 1R8QA 2BFDA 2BH9A 1VLJA 2FV8A 1W35A 3D7RA 4NBTA 4DS3A 4POAA 5J2TA 2C3OA 1SCNE 3H0CA 1W1UA 1G8YA 1XZCA 2YVKA 4GD3Q 1OX4B 2MHCA 4GKBA 1ZQ1A 2XNDA 4KKXB 4TZTA 5H02A 5TR9A 2NZXA 3OQBA 4RM3A 4F6RA 1Y1QA 5KYYB 1TUGA 2B25A 1BS9A 4XSGA 3ZNPA 3ENNA 2YWCA 3UFBA 3U7GA 1FFDA 1I14A 4H1UA 1PVOA 1QAOA 5DXAA 2W4MA 3HFJA 2R9VA 5CM2Z 3NDBB 1P0FA 2AOWA 1EU1A 2IW1A 2R751 3CG4A 4QHTA 1W94A 5IFKA 2Q5LA 4YJKA 3WLLA 2XYPA 2ZR8A 3EVDA 1Y6QA 5JNRA 3PUYA 3HCRA 1F20A 3B48A 5K2MA 3SZMA 1G7CA 1ZIXA 3R5SA 4PCLA 2D2IA 1IN5A 2JJ2A 2G63A 1P80A 2H4XA 2OHXA 4OFXA 5HDBB 1AH2A 2IH2A 4E1BA 2A5JA 1SUBA 5CX4A 2PGOA 1BOOA 1LNZA 3AJ9A 2GZAA 4YY3B 3FOWA 4GBGA 2OYRA 3LXRA 4W5QA 5GJCA 2W6NA 1P1HA 3S2GA 4O2BF 4O2BB 1FDIA 1FC0A 4DM3A 4EKGA 2C2BA 3WHIA 3EWIA 3IL2A 2H1HA 3MIIA 3SC6A 3ZY4A 1E6LA 1NMEA 3IELA 1JKJA 4X24A 1FQKA 2JLZA 1DQRA 1YZHA 1Z26A 3KX2A 3NATA 1K5HA 4GLOA 4EI7A 1RXCA 2HAEA 2ZTLA 4HNRA 2WPDD 4DIEA 5B7PA 5KUTA 4Z4IA 3C5CA 3QMVA 2W2XA 4J0IA 4LK2A 4MVJD 2H65A 3A3OA 1E7QA 3MJ4A 3ESZA 3DQQA 2KBFA 3LX5A 4U7PB 2PSJA 3PWKA 4TM8A 2VQFB 3M1AA 5HZHA 2ID4A 5EJ2A 4W9NC 2ZS8A 4PYMA 3BEDA 4GWGA 4EW1A 1F8XA 5BMVA 4RK4A 4OX9B 3OTGA 2X2OA 1E3QA 1SCDA 3EVZA 3EGWA 4E94A 3GUHA 4MQFA 4RLSA 5KHLB 1VJRA 2CMDA 2OC9A 2G36A 1K5GA 1QRAA 2X3UA 5DGIA 5A5VA 1UC8A 1D4AA 3HKEB 2DHEA 3FYUC 5EC8A 1V8DA 3E1GA 1Z36A 4IDCA 1E6EA 5FI1B 4LNUB 2XRYA 5A7GA 3M0EA 4CL0A 2DPYA 5KNBH 2YKGA 2IDKA 4LDQA 3WYNA 4OGFA 3H75A 4C6RA 3F90A 1GEGA 4YLYA 4M1MA 1VE5A 2FFQA 2YW2A 3FAZA 1UJ4A 1XWWA 3NPAA 3M82A 3PPXA 5KPJA 4KIUA 2VJMB 2Y1EA 2EFHB 2C8LA 2BZGA 1NN3A 2BF4A 4K7JA 5GM1A 2FMHA 4L5JA 4C22A 4F21A 4MVJF 4XIGS 2OUIA 1TVKA 4Q3BA 2BLNA 3BL6A 4G65A 2JGAA 3F98A 3CEHA 1JQ5A 1AQLA 1F3OA 4JYAB 1KZGB 4HH0A 4B73A 3HFRA 1Q2XA 4Z3KA 1KI8A 2OHJA 5F9FA 3UKDA 3GNLA 4NNPA 4PN3A 4ZHSA 3TUIC 3K31A 2F8SA 5ITZB 1FTWA 3U7JA 4BKUA 4XPIB 2A1TR 5LZ7A 3OO1A 4BQQA 1GUBA 1ZMTA 3P2EA 5DLPA 1UPFA 5CCXA 4BJ3A 1OH8A 1VL6A 3IVCA 1D1PA 4OLBA 4AMVA 3DMNA 3MM4A 2WNHA 1YUBA 2OHFA 1GA6A 4YAJA 4FIDA 4EB0A 4IGKA 2J9RA 2OO3A 5C8YB 1ZQ9A 1ZH6A 1QZ3A 2RKWA 2GESA 4QX6A 4UMDA 1USGA 3U4QA 1LVUA 1PUIA 1ZM2A 4O1IA 3IOBA 1XYVA 3DZFA 2NXCA 4RIFA 4B3XA 1A5BB 4WOKA 4S24A 4X93A 2A9QA 1BMFD 1D2GA 3AO0B 4L08A 4MCHA 1M1YB 1KI7A 3NEPX 3KWFA 3KPWA 3WNBA 1W2HA 1S7GA 1NQXA 4KQIA 4UCFA 1VSUA 4LPSA 4MIKA 2FZWA 2WWWA 3DOEA 4YCBA 3T9FA 4L6IA 5AHWA 1ORVA 1M0WA 2D0OB 1W5BA 4ZEWA 4YCMA 1U0NA 2CC2A 1TM4E 1SBQA 1KFCB 3FWKA 4FZVA 4D5GA 2IU3A 5HGJA 2P79A 4E5KA 5DTQA 1ENYA 1F8YA 1KS2A 1ZW1A 2FSHA 3OQ1A 3CTPA 3M6UA 3LNCA 4HL6A 1V9LA 3U0BA 4PZ0A 3X1ZA 1IN1A 2WIAA 1VPWA 3IJEB 4F6RB 2AFIB 1P19A 4WLEA 4AW9A 1L4HA 3R76A 1C50A 3DM9B 1NT2A 4G1FA 3FPBA 2ZRKA 2G4CA 4PC3A 4FHGA 2G4VA 2EP8A 1ORIA 5G4KA 3L6EA 1G7RA 1B73A 2KLHA 2NVWA 4BE7B 1VKOA 4B9AA 2IV2X 5BV2P 2LBPA 4PG5A 1MHPA 2VK8A 3O95A 5IJ0A 3WLMA 4RF4A 2R79A 3ID6C 2OHHA 3EPPA 2O8BA 2VZ0A 3G82C 2TRSB 2JD2A 4TT3A 1C0LA 1XJWA 4LHZA 2NO6A 2QAIA 1SUIA 1GU7A 1K98A 4GOOD 5IAAA 4M22A 4BUZA 3C3KA 5JAUA 2HZBA 1WV1A 4H60A 3FGOA 1Z13A 1EJBA 3ZBPA 4CM8A 2XT0A 1ZJYA 3HO8A 1TADA 4IGAA 4NF2A 3VO2A 2GGSA 3WBKA 1L5QA 3FI9A 3OZXA 2W93A 3R7FA 1MQSA 4H17A 3KQKA 2UYHA 1F0NA 4J2TA 3HN7A 2LRHA 4J0CA 2OEPA 3B3GA 4HQLA 2ZTMA 3Q8MA 1BW9A 2WT9A 4KR2A 2O4CA 4K8RB 2DMRA 3PGJA 1Q57A 4WECA 3SM9A 2F8MA 1I7PA 1MOPA 2BN4A 5BQFA 3DTVD 5JECA 4R9NA 2JAQA 1ZCZA 2JZCA 2WUFA 3KT6A 4LKRA 2NPFA 2COUA 1QK5A 3E6AA 3QU4A 2I6FA 2C1XA 3GL9A 3NALA 1E1QA 5IT4A 4HDSA 3MT7A 4BLVA 4EYEA 3C6QA 4BNIA 1KDYA 3SR3A 3VVMA 2C5FA 3ZCQA 4IDHA 3D2BA 4K6KA 4PANA 4EPXA 1FFHA 2ROQA 1ZONA 2VAXA 3A14A 1JUDA 2AK2A 2OD9A 4Z1MD 5K3BA 3THYB 1RVV1 3PD1A 1DKOA 4BQSA 5KQGA 4HDNA 2OG1A 1RSZA 2XGJA 1A7KA 2NNLD 3DQPA 3L0YA 2ZSIA 1LJ8A 2PO7A 4IDQA 1MJGM 5UKDA 1JBQA 4CIDA 4LRYA 5F33A 4N7RA 2Z4SA 5IN4A 4ITRC 4WERA 4KOAA 4RTJA 5BN3A 4NCNA 1XPUA 2CHGA 2GPAA 2ZXUA 4OH1A 3BTOA 1JPUA 4FLFA 2RI0A 1CNEA 1RRGA 1Y9ZA 3EXHA 2FU5C 4IUDS 3CR3C 4L85A 4WESB 3TMYA 5HQTA 2C7PA 1CEYA 4U8GA 3E23A 4OHZA 1AOXA 3PGXA 1E94E 1N0VC 3IXMA 2I99A 3AKYA 3WL3A 4D2IA 2E4UA 2XAAA 2PWAA 5AYVA 5H68A 2CCKA 3S7ZA 3OPXA 4LJ8A 3STWA 4OXYA 1G20A 5F3RA 1WMBA 5DCWA 4MVJM 4CNBA 4MQEB 5DMXA 3C7CB 4PRLA 1CG6A 2OAQ1 3WGJA 3PIRA 3UHJA 1J56A 4C7MA 4EL5A 2UVDA 4PBRA 2UXBB 1TM3E 2HDNB 3AF4A 5HKBA 4WKNA 3G0HA 3IPAA 3E48A 5JOQA 4UFNA 5LNK1 1MLDA 2CLLB 5FFFA 3HCBA 4NHEA 3FTDA 1RRPA 1T0UA 4A2WA 3KKLA 4Q9IA 4OQPA 2WNIA 3ZDYB 1JWBB 3OD5A 4RABA 5BR7A 2NUAA 3DEKA 1NVXQ 1Z17A 2W0SA 3AEQB 3LM8A 1NURA 5CH8A 3DT6A 5AO9A 4CF7A 1R1DA 4TXNA 2QSYA 5JYBA 4TMXA 1LK7A 4EGQA 1YVUA 4PLPA 4Q05A 5I4KA 2O1XA 2QVBA 2I54A 4W4TA 1NX9A 2H92A 1M8GA 2G0AA 3C15C 2WT8A 3K5HA 4G5FA 1E20A 4NJOA 1L5GB 1SOUA 4EABA 1IOZA 3T12A 4YO7A 4FHZA 1FQOA 5CXSA 4B3MB 1PJBA 1KY3A 2C4TA 4FWIB 1K9VF 4M8NE 5DX1A 2CL0X 3W5SA 3ZJTA 4O4LB 2Y2VA 1I0ZA 2J08A 1AMOA 1NRWA 2WU0A 3JAWB 1KJ9A 1I4TD 2B5WA 2DR0A 2YHSA 4MVJP 1YJ5A 4TYQA 4NMMA 3PTAA 3RFTA 1Z5GA 1T6XA 2VATA 4X6YA 2YC4C 3OO0A 3HN6A 1CF4A 1ZESA 1SZCA 3PHLA 2ON6A 5TLSA 3K71B 1IONA 3W34A 4BV9A 1MTZA 1QIIA 2PIDA 2W9XA 5JH7A 2YJ5A 2HIMA 1QTIA 2IGTA 3WSWA 4E4TA 2EFCB 1OV4A 3MJHA 1OU0A 4D57A 4QOIA 3PUXA 2NXNA 2HMWA 1DC8A 1VZ3A 3NRCA 5BSVA 2PUFA 3KSBC 4WWHA 5ARDA 1REQB 2Z9BA 1M5TA 2CVFA 5BV8A 1D9XA 1N0HA 5H82A 1UK9A 2ZI6A 4LZNA 1SVOA 3TL2A 5JZ9A 3R3VA 5JNUA 4D8XA 2ONJA 1JHZA 4RH3A 1QBGA 2H57A 5JFOA 3TGPA 1FMJA 1PN3A 3VU9A 3WL7A 4LF6B 4TWRA 1W4RA 5F5LA 4X84A 2EWMA 2WY2D 4BZQA 2FZGA 3H9CA 3RTEA 1AKUA 4INJA 1M67A 1QV6A 1ULZA 2VPTA 6ABPA 4PZPA 3ILYA 2YC2C 2O57A 1Z4OA 3UB2A 5CFQA 3PEUA 1CU1A 5JMWA 4OU5A 2PQ0A 4W9RA 2ODNA 5IJ0B 2YS6A 5FX2A 4NENB 3BQ9A 2WIGA 2Z58A 3QBVA 5K2OA 2NZWA 1U7DA 4P4LA 1L7XA 3KYCB 4F2DA 4IBOA 3FM9A 4G3XA 2EV9A 4I14A 1K8QA 2CBGA 1YVDA 2ECQA 1H2ZA 1M6YA 2UZ1B 3BQMB 3PC7A 5DO9A 1E89A 1X1RA 1JDNA 3G7SA 2ZG6A 4LTDA 5EUCA 3H99A 4BQPA 1V4BA 3SU8A 2O06A 3RFFA 3TLGA 1WTAA 3RS5A 2J9XB 2ALJA 1ZM9A 3ORQA 2I6UA 4DLZA 2ORVA 5LM3A 3DJFA 1A9XB 1TCAA 2XMZA 3FZEA 3SVLA 4JELA 4HPXB 1N4DA 3B9BA 3O82A 1CP2A 1JIVA 3D4PA 1QV7A 1P9OA 4I8DA 1NNSA 4X1IB 2BEUB 2AWOA 3DEYX 2EQAA 3X43A 2IIPA 5AMXA 3K1YA 3T99A 3FCEA 3AP3A 4JLAA 1T8YA 2Y0CA 4FINA 4ZOLA 4KFTA 5J23A 3N0WA 1Q91A 4U00A 3EPLA 2WUEA 1FNSA 3ILXA 5IAJA 1EVYA 2PKWA 3DOUA 1EQUA 1MRZA 3ILVA 4MP3A 5BSFA 4JFAA 8ATCA 5JSUA 3ERCA 3WQHA 1KRXA 3K92A 3V32A 3FSRA 3IQDB 3Q6MA 3FRHA 2PMEA 3H5WA 3W5CA 2ZTUA 2OCKA 4FOLA 4NBNA 1QPGA 2NUAB 3M4YA 2I3DA 2P5SA 4OGGA 4V3BA 5FOWA 3N2GA 3RSFA 4MCAA 2W6JA 4O1MA 1WPXA 3QF4B 4WDQA 1T3TA 2HWYA 3F2VA 1R66A 3FNBA 1CBUA 4L4RA 4LSGA 1TT5B 2BRUC 4JQYA 1VECA 7MHTA 4H7JA 1DMSA 1IM2A 3MSCA 3ZYCA 1FDWA 4RD3A 3D81A 4MP6A 1T0HB 1SCIA 4UZFA 3DHWC 2ISCA 3NVKI 4RHFA 3QJ5A 3ZOKA 5B1SA 4CDMA 1SVNA 2EP7A 2MSNA 3OESA 4AT1A 1P7PA 3MWJA 1NR7A 2C9MA 1K7EB 1DTWA 3T38A 1S0UA 3CUWA 3E9RA 4HK4A 1TU0A 2YHBA 2JRCA 5IXJA 4L5CA 3D9QX 2MYPA 2JAXA 3W79A 1A8UA 4FGZA 4A92A 4HB4A 3JYHA 4Y9UA 5G41A 1RFLA 4LJLA 5KTRA 1AQJA 4BAZA 1Q77A 1DFIA 1ZHHA 2NSLA 1VGRA 1W2WB 2HK9A 2QE6A 4LNAA 1MJNA 4BVGA 1GNQA 1QH8B 4MPJA 2PFGA 2O2GA 2P1ZA 3P0FA 3U9TA 3L8HA 4DLUA 3IYLW 5K3SA 3GN2A 4DG5A 3WMRA 3UUWA 2VRCA 4ZDIA 5IKXA 3DE2X 5D1NA 1J7JA 3OY7A 4HMQA 4RAOA 3B1YA 2YJGA 3NJ8A 1Z88A 1N2CB 2I1WA 4UBIA 4F92B 5JH7F 2GLXA 4YP0A 3WNZA 3KWMA 1FSGA 1MJHA 2NZJA 4AFNA 4QPJC 2EIHA 2LCFA 3M9WA 4QBGB 5COAA 2G9QA 2V74B 4QPPA 3SXPA 4XD2A 3L9WA 4RVUA 4EEXA 2IBSA 5JUWA 5HG0A 1DU4A 2OB2A 2RFLA 2Y8EA 2KS6A 1JEJA 2ZJ6A 3D7NA 3GZJA 2HXSA 3OIGA 4GPD1 1KKUA 2C88A 3NIGB 3PF9A 3RTCA 2NT4A 2BWJA 4DCMA 4DIFA 3EQ6A 1WETA 3FWHA 4ZCRA 1WW8A 1A71A 2CNLA 4Q1BA 5EXSA 2UDPA 3N28A 1JHVA 4CLRA 1BMTA 4RENA 1GDDA 3GEPA 1YMUA 3T9DA 1ZIPA 4P08A 1P77A 1P1BA 3I2HA 1W49A 4AZ0A 3TK1A 2ZFUA 3IKTA 4YAOA 1EWTA 4X54A 1EG2A 2BEUA 1Z6XA 2AEFA 1MX1A 3OIWA 4Q7JB 4ZVRA 3RVNA 2IYTA 5CB4A 3C0KA 3D0QA 1UJ6A 2QUAA 3CRRA 5D3ZA 5JXGA 2P6PA 2AKYA 1VMKA 2G76A 2PGXA 2FPWA 5ES4B 1K6JA 1JQKA 3MSXA 4O2AF 4FJ1A 4ENPA 4D43A 2AYZA 3EODA 1GUFA 3AOGA 3C45A 1ECCA 4R1OA 3ROGA 5LQUA 4NJMA 1SEVA 1NSYA 1P2TA 4KFSA 5H0IA 5B3JC 4Q3KA 2ZITA 1O96A 4TZ0A 1EUCB 5I7SA 3ER8A 2NUPA 2W4IA 2XDAA 3GVXA 4N5IX 4AICA 5I7FA 3SDZA 1V8BA 3C8UA 3FB4A 3W04A 3SXJA 1SUSA 4WXPA 4Q3CA 4L8GA 4KC0A 2NV0A 3GLUA 1J0DA 2IF0A 2ZJBA 4WL0A 4B76A 1E5QA 1WQ4A 1PDWA 4OSOA 3KB6A 5KWVA 1M6NA 4Y9RA 1N2BA 3MWDB 4ALKA 1ARZA 1UK7A 5D5HA 1YL6A 1RI2A 4UQOA 1W0JA 2A5DA 1SBTA 1ZH8A 4MYUA 3IP3A 4XOUA 1VI2A 1ZUNB 4OLFA 5BVHA 4HAUA 3AR5A 3VR0A 2XCQA 3ZWYA 3FUWA 4D9CA 4HI0E 1QDUA 3PRHA 1TPZA 2D5LA 5E3JA 2Q1UA 3PEFA 3NAGA 1THZA 1RJDA 3OTWA 3DPSA 5JCJA 1GNLA 1Z3CA 4OTZA 3BDIA 2HHHB 1HURA 4PYLA 4AKEA 1PNOA 1JAHA 5JJBA 1TQ8A 2GZ2A 3ZDAA 2H08A 3T3EA 4MV0A 3ETHA 4J91A 2F2TA 4DKXA 1BEUB 1DBVO 1KO4A 1LK0A 1Y9AA 4DQUA 1WU7A 2H48A 3KSDO 4HAWA 5HX7A 2CXQA 3H13A 4LECA 1YZQA 4ZK2A 2GPBA 3VNVA 5ALTA 5EZ5A 4JBNA 3PI6A 4FHDA 2HWUA 4DQ0A 1OX6A 1O95A 1XMVA 3ESXA 1JFVA 3EDCA 1KZHA 2J3QA 4OHFA 1SPBS 3JZMA 3QQPA 3D8UA 4MLZA 2REQA 5L9AA 2CNKA 3OZEA 4BN0A 1E3LA 2CMFA 1UAYA 2HO5A 3NTRA 5KYUA 1RM5A 1KIFA 3D8TA 3OE1A 4L22A 3CVYA 2F4VB 1EFDN 2I80A 4YUVA 2ZSFA 1J8YF 3GJ3A 2CLMB 2HI0A 4BV3A 1ZCBA 1BKSB 2ZYGA 2Q1XA 3HBNA 1AXGA 3E3LA 2K4MA 4PQEA 2WZCA 2LDBA 2PH5A 2ZKLA 4NZZA 1WXDA 5BWOA 1R9GA 3RYFB 1MB3A 1MH1A 3TRKA 4IMRA 1H66A 5CLQA 3GGGA 3BOSA 1XZEA 5DLQC 3HKCA 3TYXA 3ABQB 1NY5A 5EWLB 4ZYYA 4MVYA 3CE9A 3PQCA 2ZUTA 4DTCA 2FA9A 1IPEA 4FFWA 4OM8A 1A82A 2AD5A 2JI8A 5HOQA 2O8CA 1PG2A 1NI3A 3D3NA 3PR1A 4II2A 5ICEA 5D86A 1L9XA 3JYNA 3FAKA 2GXQA 5GZ6A 3TNFA 3WK4A 1X0VA 4YMGA 3Q1LA 1O0BA 1A9YA 2CD7A 1C4XA 2R7NA 2CFOA 4TTTS 3DV0B 2I6SA 1A8QA 1KC1A 4YV0A 5FUQA 2DQKA 3UMMA 1J20A 1KOLA 3UAWA 3GFVA 4XCVA 3U39A 4HPWA 2CV0A 2NVUB 4TZ6A 1HX7A 2YXEA 5HF6A 4YAUA 3HFGA 4J7XA 1MA0A 3BE8A 3OCWA 4UARA 5KWJA 1KBQA 1SIWA 3I3SR 4PR0A 4RPLA 4CVNA 4Z4CA 5HIIA 4QU0A 3TRJA 3NYQA 1WDTA 5EZYB 1A88A 4WFKA 4XJTA 4D7AA 1MQ8B 2EJTA 1U3DA 1DG9A 2H63A 2VBCA 3CM0A 4CUZA 3CJQA 3RIGA 2IITA 2PV0A 2D2FA 4G0QA 4OXIA 4POOA 3VKWA 4ZCTA 2W6CX 4XIFA 3OAAA 1L6IA 2JJYA 5FL7D 1VJTA 3U7QB 3ZOZA 1LV8A 4DLYA 3SP1A 3CUYA 2EHJA 2ATVA 4U7DA 1QQ6A 2ORIA 1IAVA 2Q2NA 4IS2A 2GYWA 2ZJ2A 2BI8A 2YX1A 1ZINA 3IOCA 4LC1A 1XB2A 2AEMA 3AW8A 3L7BA 2C2MA 2G5PA 3LK7A 3Q6IA 4CV1A 5IK2D 1DXQA 3KWLA 1LJLA 1AQUA 3WIVA 4WBNB 3VM6A 1F8UA 1PR0A 2XOKA 2HMTA 2VP5A 5LDGA 1W5AA 1N6PA 2YS7A 3LGXA 4WKGA 3UWSA 2FEMA 5EWLA 2QF7A 4ND8A 3V55A 1O0CA 3GGDA 4LGCA 4EELA 5CT5A 2YJ4A 3K8ZA 3WWZA 3RHZA 2AN4A 2Q7XA 4OFBA 1Z39A 4PNZA 4CKBA 1GPAA 4R81A 4F9GA 2W42A 3SVTA 1IQ0A 3C7DB 1C3JA 2HCBA 3K2QA 3M34A 2OXFA 2QJRA 1ISIA 3FF4A 3CB2A 3ZY3A 4AS1A 3L04A 1L8XA 2PMBA 3K53A 2BY4A 4FKBA 3ADCA 5E9AA 4A9AA 3TLEA 1QZZA 4TX1A 5B2ZA 4YCSA 4F3YA 4AX4A 2Q4OA 1EVQA 2FR8A 4LOKA 3ET5A 1UM8A 3LRTA 4IFTA 1PQUA 1J49A 1WPQA 1K0UA 1PRYA 5KYUB 2ECKA 2UVPB 3TKYA 1WB5A 3W6ZA 2A8YA 3RSZA 1KK0A 1FBNA 3DZHA 3VSBA 4H7FA 4Z9XA 3WRXA 1XPRA 3REFA 2C5GA 1T4DA 4GXTA 2DG2A 1LSUA 2NTEA 2CZCA 3O9VA 1LSOA 4JMPA 1C3OA 2VKTA 4AO7A 4AS2A 5L40A 1SOVA 3OP1A 4XOIA 1NNEA 4KQKA 1A1VA 4MDYA 3M6MD 4YCCA 2EBFX 2O2SA 1U0GA 4Q4CA 4JLVA 3VPAA 1OTYA 3TW8B 3QEKA 1G21A 3RYCA 5KYYA 2WTNA 4WY5A 2PX5A 3KIPA 3NJRA 3M9XA 1DJMA 4KIWA 1BKYA 2J5XA 4M0DA 4YK7A 4DCVA 1FRZA 3EHDA 1RYFA 4V0LA 4CCSA 1SKAA 3DFZA 3K32A 1V47A 3QOFA 1QS0B 3RQIA 3TZCA 4BYGA 2DUJA 2PVPA 3NTVA 1KFEB 4B2LA 2FQWA 2QM7A 1L5HB 1Y1KE 2BFMA 5JSQA 3A2LA 2FNAA 2FPUA 1FJ2A 2ORYA 3DXZA 1WW2A 3AUKA 3HDJA 3LVFO 3S2SA 1OAOA 1X94A 1ZGBA 3FPJA 3WKBA 2W6QA 2HMYB 1T5IA 1J06A 3WBBA 1GKUB 1SQSA 1NKTA 3STVA 4R8VA 4IVQA 4KR6A 1IXZA 2I8CA 5K01A 3HP7A 4MWZA 3DXYA 2Y1XA 2KSQA 4KWHA 3ZWDA 4HDMA 1Z83A 1RTTA 1Y3DE 1EK0A 3CIOA 3QPWA 1HT2E 4JUDX 2Y1WA 3I34X 4KH1A 4PNEA 3N05A 3S68A 5C1PA 2NADA 3HB9A 4QXPA 5LMNB 1FRQA 3FCOA 5SICE 2AQKA 1BJTA 4JC8A 4MI1A 4DDTA 2H7VA 1R16A 2ZJ0A 2XTMA 1FFAA 3CWZA 4KPYA 1FRVA 1XO1A 3BMCA 3DMTC 4P32A 1QF9A 3JATB 3L4EA 1E9RA 1RE0A 4ZCLA 3MILA 3H17A 4GI3A 2ATIA 2OAGA 3TZQA 1P9WA 1UKVY 3HLKA 2CVQA 4QULA 2OBYA 1JG4A 2ZWMA 5F9MA 3TH5A 4AJHA 4LGVA 4R8MA 1XTBA 5ENVA 2IIBA 4GL4A 4N5MA 3I73A 3VR3A 3TVYA 1BCRB 1V8FA 5CVEA 1OKKA 2RGRA 5CB4B 4JP1A 2ADFA 1U2GC 3U1BA 3JV7A 1PBNA 4ER0A 2ID8A 4X8OA 2XF2A 2W0MA 3WYBA 5IKMA 4FZ3A 3OPMA 1QZTA 2OGUA 3M49A 5JASA 5EI5A 2X0IA 4LE2A 1ODIA 4YO8A 1KEEB 4MYDA 3R6TA 5DEOA 1Q0SA 1CDOA 3OM8A 5CM8B 3V1LA 3ORHA 2QY6A 2I03A 1O6GA 3HCDA 1SBIA 4ZXPA 2JLWA 4M0EA 4QT0A 4CMEA 4I4TA 3K4QA 1RAIA 1E0DA 3VAYA 2FB9A 3KB1A 4YV2A 3PDHA 3K8YA 4AWXA 1L6RA 1P2BA 2J87A 2YFQA 4WKOA 1ADGA 1Q3KA 2AE1A 4L4XA 3TDMA 3UH1A 1N3BA 2CVOA 3BXEA 3E22B 3QU9A 1EM8A 3LHFA 3OWXA 2ZQYA 4AP9A 4GIBA 2JLCA 2WUWE 1SXQA 1OH6A 1Q1NA 2G5TA 2I34A 3I9V6 2JGFA 5J59A 3WGYA 2CLDX 4U0KA 3P9XA 3L5KA 3W4JA 3AR9A 5TGZA 3AC0A 4TKMA 5I9MA 4G4GA 1A9RA 4GM0A 2HFKA 3FUXA 4ZI5A 1OLXB 3RS2A 3EIWA 5ECDA 5CBPB 5JRZA 3BULA 5EJ9A 3UV6A 2G7ZA 4FLMA 4B09A 2PV7A 1QHXA 3JZFA 3QKSB 4TKVB 2Y1LA 4PQFA 2X15A 2JCYA 4H7IA 4TVKA 1VL0A 2P6UA 3ESBA 3TAUA 4BVFA 4NBWA 4CKEA 5KX5B 2CSXA 1WSAA 4WNCA 3O4JA 5CRIA 3IKLA 7ADHA 4NE9A 3CVOA 4CL3A 3KNZA 1SKBA 2JASA 5EE1A 4YCAA 3P4YA 3C3BA 3OIFA 3RHTA 1FP1D 1HYBA 2F3TA 1RBMA 4P7JA 4CLOB 2QJWA 1KOJA 1PGQA 3ORFA 1BYIA 1ZLXA 1YAHA 3PHCA 5A9SA 3ZZUA 1Y1PA 2WP0A 4AMGA 2ERYA 3GT4A 3UYKA 1UT6A 4GKJB 2O0HA 2B6NA 2ZJ7A 4LN1A 4B3BA 3BBLA 4UMEA 5G0WA 4FYYA 4DV1B 3PFIA 5DYGA 4REOA 2JAWA 3A9WA 1BNCA 3UT6A 1COZA 3O8LA 1OQAA 4HNSA 3HVUA 5DHAA 3ROQA 1GKKA 1PQ4A 1Q7BA 4B0OA 1ZL0A 1FRNA 2AG6A 2ECOA 3D8RA 5K8CA 4KXXA 3FDFA 1YUNA 3LQ4A 2FPSA 5FT9A 3BD7A 4FYVA 1K66A 1T9GS 2BSXA 3K15A 4WGFA 5EFZA 3UY4A 2VPPA 1FPMA 2DYKA 1GFWA 3PLNA 1ISJA 4C0BA 4DG9A 1OYYA 2H3EA 3DOOA 2O14A 3ZHTA 4ERXA 3GAZA 3IR6A 4H35A 4ZZ3A 4GZMA 2JGKA 2WJ4A 1Q5PA 3MJDA 4Q21A 3GLIA 2OXTA 1EXNA 3P2IA 3PFKA 1HE1C 3VA7A 4R2IA 2BIFA 1ACJA 1KKLA 2NOAA 4BU0A 1ZKDA 1ULUA 2F1JA 1DKLA 1TZKA 2WTAA 4C89A 1E98A 3ONVA 4EL0A 2VRBA 3QGMA 5EHIA 2CF5A 2SHKA 4NECA 2VDUE 3KTAA 3STYA 3VUFA 5HQ3B 1F2TB 2VHTA 1H4TA 3L82B 5F77A 5IDQA 1TMGE 4IJMA 3UHFA 4ZV7A 3KLPX 3AEXA 4DCCA 4E03A 5KNDD 4LWQA 3W3ZB 2J3HA 4F3CA 3UKJA 3RRFA 3WP0A 2VBGA 1HT0A 3B6ZA 5FP0A 1JQDA 1UBUS 4QQKA 1XCOA 3U09A 3S8EA 3OUZA 2H5IA 2P2ZA 2ZI9A 4E2XA 3I23A 5HCIA 1RWKA 3Q6NA 2DBVO 3SY8A 1W0KA 2I71A 3TLJA 3TR5A 3NHRA 2QOEA 4IOMA 1K2WA 1OTHA 1CK4A 1VPEA 3LIIA 5D3MA 5CDSA 4QRIA 1JHRA 1XU9A 4TMVA 3RVMA 1KI6B 3ZGYA 3NOOA 1RHRA 4A6PA 1CZOA 2IUFA 2JKZA 3AL3A 3BCSA 3HU5A 3INGA 1JH8A 3MZ0A 1E0SA 4KACA 4B4WA 4FFVA 3AIIA 2QNRA 3E53A 2ETVA 4RKRA 3RHSA 4C0SA 3GZTB 3QXGA 3KJQA 4QGAA 4Y6PA 3D3KA 1KSJA 2MSDB 2NXEA 3SN6A 4JI1B 4EJMA 4FFRA 4ETMA 1GY8A 3G7UA 2EF0A 2AQHA 1FX1A 5FRDA 1T9GR 1UKZA 3BTUA 4GRAA 3E7WA 2QLJA 4X7RA 2E87A 1UPAA 3QLUC 2XWPA 3AQ4A 3KEQA 4B6OA 4EI9A 1BN7A 3LY8A 5AM5A 5ALOA 2P0AA 2OXEA 3O91A 3OQMA 2WB2A 4CEHB 2O1EA 2F62A 2FSUA 1D6JA 1V2HE 3MCVA 2VH1A 4B4OA 1PHRA 2A0YA 4HN2A 1QB8A 4TRRA 3T0GA 4PO8A 2WU4A 5IYZB 4GPAA 2PJZA 2QD2A 1BX1A 2X0FA 1LI4A 1QKJA 1HE2A 1NQUA 2C2XA 1EJ2A 4UD2A 3L6OO 4DA4A 2DHRA 5FLEX 5AJZA 3VMFA 3QRWA 1L8LA 2PZEA 4QFDA 2G3YA 4GKVA 1K8ZB 1CZLA 1RPTA 3DH0A 2GBLA 1JNXX 2C99A 4NWIA 4QEDA 4R1PA 3TFQA 3WKEA 4F1KA 2C7RA 3CKLA 2Y71A 1K2VN 2BR5A 2OECA 1GQYA 3LA6A 4CQMD 3FNRA 5ALZA 1KJNA 4RF2A 1CY8A 2YWBA 1M6HA 4B87A 3AXTA 3IXQA 3P1JA 4M8IA 4GMXA 5CG1A 5MHTA 4W82A 1N7HA 1P29A 3MINB 3W3AA 1SOAA 2Z43A 3T5DA 2FRVA 1NHGA 2AFIE 2VCHA 3AF1A 3HDVA 4QDKA 4RM2A 4BGUA 4DLTA 5J2UA 4BTLA 1NF8A 2V7BA 3DC2A 2DWPA 2IHTA 5CVJA 1M6WA 4HFNA 4IGEA 1RRKA 2VLBA 4G67A 2GF9A 2NV6A 2NYRA 2C2GA 2QRJA 4R54A 1A3CA 3WMEA 3C1TA 4V0QA 5IJWA 3W3AH 3U6KA 4D8UA 3AR8A 4YUWA 5FDFA 4UU0A 1YULA 2PNFA 3KR0A 1VSBA 2AGVA 2ILVA 1A77A 4I2VA 1CJSA 3EGOA 4QU8A 2O59A 3KELA 3JRNA 5BV0A 4MARA 2BKLA 2QP3A 1W4BA 1XAIA 3L0IB 3FGPA 1LLFA 1YZLA 3NHFA 4PSKA 1M33A 1EXWA 5COQA 4HDCA 4JYPA 3MCZA 1XWFA 4TKZA 5FBVB 3EGCA 2XTAA 3OLZA 1N5JA 3QVXA 1GQFA 1Q3HA 5IT9A 4EVQA 2WUGA 1G4AE 1QAQA 4KLZA 1Q1EA 4ZHQF 1GWNA 5AKIA 2YJ6A 4WX2B 1U8EA 4JNKA 1MG5A 4L02A 3WLHA 4H4DA 4JL8A 4A0RA 4YCLA 3MT8A 2FR1A 3R9XB 5AVJA 4TQUS 3VQTA 3N2KB 2AE2A 1G8FA 3ZGVA 2PQ6A 2REOA 3I6IA 4M1ZA 3T5MA 4M0MA 2Y67A 3RYCB 1A8SA 1X7YB 1VSTA 1U94A 1GEEA 1UQUA 2Y27A 3K1TA 1ZVQA 3AETA 1IEVA 1B6GA 1DWOA 2HBZA 5A7HA 1NBEA 3UMYA 1Z2PX 1XVTA 3TEFA 3V4PB 1G0NA 3GVHA 1CQWA 4NV0A 1BGVA 1K5DA 1S2DA 2G0TA 2WICA 2Z30A 4TLEA 3MAJA 2DC1A 3GWZA 2EYQA 3MNFA 5EIHA 5DASA 5BR4A 1XDZA 3I4LA 2O8VA 4FMCB 3VSEA 3GJ7A 4BKPA 5G1PA 1WUKS 2DVMA 3CNNA 1XTSA 4HWSA 4MPRA 4N5DA 4RAQA 3TZBA 1RE1A 5DP2A 3ZCTA 1LSSA 1QXSA 3TM4A 5KMGA 4HB3A 3DDWA 2F43B 2H2IA 2V6BA 2RGUA 1SXJB 5C8YF 3E61A 1DQYA 2N47A 2WD8A 5AM0A 1F7UA 5F23A 1QFYA 1MDBA 1A4RA 3RK1A 3F97A 3LPLA 4F4CA 3IQGX 2H1OA 3B6MA 3DZDA 3GRYA 3MJCA 4DCTA 3LBHA 4MR7B 1SCAA 3T5CA 4UM9B 3FOFC 3SLKA 4QRDA 2PO5A 1IPFA 3NT2A 1G3RA 3Q3CA 2PWPA 2RMKA 3JPWA 1JQAA 1E4YA 1NLFA 2R44A 4K5QA 4OOEA 3GP5A 4LVCA 2JFWA