1QZ3A

Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
309
structure length
309
Chain Sequence
PLDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVKKEPVAEVREFDMDLPGRTLKVRMYRPEGVEPPYPALVYYHGGGWVVGDLETHDPVCRVLAKDGRAVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAAVTSILAKERGGPALAFQLLIYPSTGYDPAHPPASIEENAEGYLLTGGMSLWFLDQYLNSLEELTHPWFSPVLYPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQFYSLSPGATKALVRIAEKLRDALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYLESTERASE EST2
publication title A substrate-induced switch in the reaction mechanism of a thermophilic esterase: kinetic evidences and structural basis.
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
molecule tags Hydrolase
total genus 110
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qz3A00
1UOOA 2CUTA 1R4ZA 3F67A 1ORVA 2LIPA 2HFJA 3FYUA 2J4CA 1AUOA 3V1LA 1VXRA 3I1YA 5BWCA 5CBKA 3P2MA 1E89A 3G0BA 2DHCA 3Q8WA 4LKOA 5AKGA 1UK8A 5LZ7A 5C8XA 3D2CA 4FLEA 1JFRA 2H7XA 4AO7A 1CUVA 4CCYB 4EZIA 2FX5A 4EY5A 3FCYA 3QITA 5CT4A 3WK4A 1XQWA 3BJMA 4EY6A 5ALWA 2OGSA 1L7RA 3C70A 4KE6A 3O4HA 1USWA 1UWCA 1W4LA 5C8ZA 1UK6A 2R11A 2WHPA 1BRTA 3AIMA 4ZV9A 1E8DA 5JAUA 1QO9A 5LZ8A 3IURA 1QIJA 3STUA 4TVKA 1HDEA 5AI4A 2HA6A 5JD6A 4HVTA 4GXNA 2DFPA 1QLWA 5ALVA 1DTEA 1XQVA 4JH0A 4BC1A 3O4IA 5C81A 4J0IA 3D5EA 2Y6VA 2WFLB 3WLAA 3WWOA 1K5PA 1ETHA 5AI8A 4BE9A 2HHAA 4OD0A 4ITVA 5JAHA 2D5LA 1JJFA 1VE6A 1IUOA 5ALKA 3H2KA 1W75A 4MWTA 4IH9A 3IDAA 1EB8A 4G4IA 1AGYA 1AKNA 3CCCA 5HF9A 2QS9A 3ESAA 5AI0A 5BV7A 2HU5A 4UFNA 2BUCA 1MU0A 2FJ0A 2WIJA 2BFNA 3I6ZA 5CXXA 2WHQA 4X95A 1PFQA 4BCDA 1B41A 2QJWA 2CZQA 2QRUA 2XUQA 1EINA 4I4CA 3GZJA 3ILSA 3FVRA 3E3AA 1JMYA 1XZCA 2VJAA 2AJ8A 1EDEA 3FSGA 5ALGA 5C7YA 5T4EA 3HACA 2RIPA 3QMVA 3FSGD 1C7JA 2XUOA 5HF8A 1Y37A 1U65A 3KDAA 4C6HA 3HI4A 5A7HA 1SC9A 1UKAA 3A6ZA 5AICA 3BE8A 4CCYA 2PBLA 5FPPA 4GI1A 3STVA 2WILA 5D7BA 3V1MA 1ZI8A 4DYHA 1VLQA 3FCXA 4B82A 2BUAA 5FV4A 3MUOA 1XLWA 1XZAA 2QXTA 4KE8A 3I2IA 2XUGA 4Y2QA 1Z68A 5ISMA 2C4HA 2CKMA 2WUEA 3WKAA 4YASA 4MXDA 1EXWA 1X2BA 1GQRA 5ALNA 4H7IA 1L7QA 1TKRA 4G1FA 2PPLA 4H77A 4OU4A 4INZA 4ZGBA 1CEXA 2WFMA 3PUHA 1HPLA 1OILA 5AI9A 5HK9A 1OXMA 5AHXA 2VEOA 4A5SA 5EIEA 2AXEA 2WFLA 1VA5A 3UMJA 5CURA 5CT9A 1YAHA 5AIBA 2WIDA 1OCEA 1MO2A 1WOMA 2QXUA 1QZ3A 5HCUA 4H7JA 3K9BA 4Q3LA 1XZJA 4Q3OA 4IH1A 3FLAA 5BOVA 4QDOA 2WG0A 3O0DA 4FBMA 2ZSHA 2BUBA 2OCLA 2VAVA 5AKHA 3BDVA 3BF8A 5AK4A 5CT5A 4BC0A 3A2LA 4UHHA 4Z49A 1A7UA 4C4ZA 3G0CA 3N0TA 4X7BA 1BCRA 3ZLVA 3GUUA 3DEAA 4FLFA 4B80A 3R3WA 1F0NA 3R40A 3FBWA 4X97A 2PUJA 2G63A 1ZGCA 3PUIA 2ES4A 1ORWA 2E3JA 1CFJA 1CQWA 1YCDA 3ESDA 4TGLA 3C45A 1H2WA 5KBYA 3SWWA 4J03A 5K5EA 2HU8A 3C8HA 1MAHA 2XUHA 1Q0RA 3G8YA 5JAPA 4B6GA 5AK6A 2ECFA 4YPVA 5HQ3B 3DNMA 2XUFA 1WPXA 2JGJA 5E4JA 5AKJA 2WTMA 4DMFA 2O7VA 2B9VA 4OPMA 5HFNA 5A2GA 5JIBA 1TAHA 3BIWA 4C01A 5KREA 1YB6A 5IH7A 4CG2A 2WIFA 4RE6A 3DL7A 5A6VA 5HF6A 3LP5A 4Q1VA 3I2KA 1XRPA 5FRDA 4YX9A 5AM3A 3L1IA 1CUGA 5CRIA 1SFRA 1QE3A 5ALQA 2EDCA 3N2ZB 3IVMA 3JYHA 2J3QA 1KEZA 2YXPX 3HYSA 1YSCA 4Y2JA 5FPQA 5K3DA 3IUQA 1T2NA 2EEPA 1LPNA 1CV2A 2XI4A 4U2DA 1A8SA 5HKBA 5LZ5A 3AUKA 3WK6A 4BRSA 1F0PA 3H04A 2K2QB 2XUPA 1MX5A 1K6EA 1ZJ4A 2PSHA 4FMPA 4TPKA 2YYSA 2VA9A 5KWJA 1XZFA 4H7EA 3C5WP 1DWPA 1ISPA 1W52X 1ZIYA 1CPYA 3GA7A 3WKDA 2X8BA 1I6WA 4EA6A 3ZWQA 5JANA 4LXGA 2I3DA 5DTIA 3QMMA 3C87A 2XMSA 3VJMA 1TK3A 1Q84A 2RONA 2VAXA 1TCCA 1UK7A 2V9ZA 4IQ4A 1R9MA 4Y2VA 2QTBA 1FFCA 4ZI5A 4WCVA 3R3XA 4B0PA 3ANTA 5ALHA 3WL8A 5I9IA 2ZSIA 2HA4A 1AQLA 3C43A 1XZGA 3B5EA 2XQGA 2FJPA 1YA8A 3GFFA 3WL6A 5ALDA 3AIKA 3OM8A 2CJPA 5HQ3A 2G5TA 3LLCA 3E4DA 1E5TA 5DYYA 3VDXA 1THTA 4HS9A 3RKSA 1NU6A 1QO7A 2HA7A 1BS9A 2CBGA 4UPDA 3WWEA 5CMLA 4LYDA 3WWDA 4B7ZA 3DOHA 3OTQA 4FFWA 1ZD4A 1ZJ5A 1WPRA 1DX4A 2J4FA 4DSZA 3IUMA 3G0GA 3QPCA 2OQIA 4L0CA 2RAUA 4B9AA 5JALA 3PI6A 5ALSA 1EK2A 4DIUA 1XRRA 3CN9A 2WHRA 1FSSA 2HU7A 2OG1A 3HRHA 3TJMA 3A2NA 2BKLA 1Q0ZA 2XDWA 4H7DA 5AO9A 3WZMA 1E3QA 1A8UA 2Z3WA 2PUHA 5F4ZA 3QM1A 3T52A 2PSEA 4QLAA 4HRXA 4DNQA 4EY7A 4MQLA 5JADA 1R1DA 4OB6A 2OCIA 1TCAA 4JEIA 5IVIA 2H7YA 3FAKA 3WI7A 5LIPA 3DDUA 5K3FB 1CUEA 4W1QA 2B20A 3H2JA 2HRQA 1O6FA 4X85A 2XMRA 2I3ZA 2GBIA 2PX6A 4AMZA 3EQ8A 3IIIA 3VVLA 3D2AA 4AMYA 1GXSA 1CUXA 4BZWA 5FLKA 3WKBA 4DSAA 2Y1KA 3DD5A 4QDUA 1WHSA 2VJBA 4Y2RA 1MAAA 1BEEA 2XE4A 3BDIA 2BAGA 1LPAB 4GW3A 4LXHA 2CB9A 2JGMA 4Y7DA 1EVQA 1QIIA 1R88A 5AH0A 2ZJFA 1ODTC 5AKYA 4DMHA 3FWHA 3C6XA 4OYYA 4J0JA 3WJ1A 1XRMA 4DMKA 1EDBA 2GBCA 3OC0A 4DM7A 4RGYA 5EHQA 3B3QA 3QMWA 4AXBA 5A62A 1CVLA 2Q0XA 3K6KA 3HJUA 2B61A 4GHWA 5LP1A 4BBZA 2C5FA 5JD4A 2C0PA 4MEAA 3W06A 3UUEA 4J0GA 1LPMA 5EFZA 3R0VA 2AJCA 5FOQA 2WFZA 4F60A 3V1NA 3F96A 1EK1A 4KEAA 2CMFA 5CT8A 5CH8A 2QUAA 1JU3A 3WA6A 2DHDA 4BZZA 3STTA 3HABA 3E0XA 4BP9A 3F9CA 5AM4A 4DNFA 3NUZA 4Y2SA 2QKYA 3O4GA 1XFDA 4PV7A 1BU8A 3GBSA 1LNSA 1VXOA 4EY8A 2IITA 4M0FA 3R3ZA 4X92A 4KE9A 4UBNA 5AK5A 3RK4A 1LPPA 3FVTA 3ICWA 5EHXA 1VKHA 5AKKA 4G8CA 1DT5A 1XKTA 7YASA 2BGNA 4P9NA 4C89A 1DWOA 3EBLA 4CI9A 3H2IA 4KAFA 4NMWA 1AX9A 1DT3A 5KWIA 4BYMA 5K3FA 3STXA 1L7AA 4L9AA 5JZ9A 4M0EA 5HF5A 4KRYA 3WZLA 1CUHA 5ALYA 5AKZA 4ZWNA 4MYSA 2I78A 5AM2A 3I28A 4P08A 1W76A 1EVEA 1BEZA 6YASA 5A71A 4U2CA 4G4GA 3G9XA 3G7NA 1NU8A 3WA7A 3LCRA 4J7AA 1JKMA 3WIOA 4X90A 2ONCA 2WG1A 4AN1A 4IHAA 2HDWA 4BVJA 1RYYA 2GYUA 1LBTA 4MWSA 4P93A 4PSUA 3U1TA 3FYUC 5I7UA 2JGIA 2Z8ZA 3W9UA 1P0PA 1F6WA 4UBKA 5AI6A 5D3KA 3DKRA 3JWEA 4B9EA 1Q83A 3AZPA 4H35A 5CH3A 3BL8A 3M83A 2ZJ7A 3GELA 1CUJA 1CUFA 4ZREA 5ALRA 1XROA 3DQZA 4UHFA 4W9RA 2V97A 3QPDA 1G4HA 1JJBA 3W04A 4OYLA 2PSJA 4BVKA 3M3DA 4EHBA 4KRXA 4O08A 3AFIA 2JEYA 1QFMA 2ACEA 1MNQA 3DCNA 4PSDA 3AIOA 4FNMA 4CIAA 1LPBB 2XMZA 2JGEA 3V48A 2BJHA 3PF8A 4UBJA 2DQZA 1MN6A 4LYEA 3H1BA 3O4JA 4IO0A 3I1IA 2O2IA 2Z3ZA 2HL6A 2WQZA 1CUSA 5JAOA 1ZIXA 2HA0A 1GQSA 1R50A 1BN6A 4GBGA 4D9JA 5BWBA 2XLBA 4NVRA 5LZ9A 2JGFA 4KR0A 4BAGA 2GBFA 1S8OA 4H0CA 3IA2A 4X00A 3NOXA 4DGQA 3NWOA 2H7CA 3WJ2A 1QIFA 1LBSA 2OQVA 2JIDA 3BJRA 2ROQA 1CUAA 4G5XA 1XZEA 1EB9A 2WUGA 1AC5A 1DWQA 4ZRDA 5D3ZA 1MTZA 2BCEA 1ACLA 4FDMA 2V98A 4GECA 3WYNA 1VZ2A 4BTLA 5AK3A 2WM2A 4F21A 3FLBA 4GLBA 4QA9A 2OLEA 3AILA 1GPNA 5ALEA 4W1PA 4G4JA 2RHWA 1W6RA 3WL7A 5DTJA 3W05A 4UFOA 4B81A 1ZGBA 3SC2A 2D0DA 2WLSA 4EY4A 4L3WA 1AZWA 4PSCA 3DKKA 1QIDA 2QZPA 4AN0A 5IVKA 4QDZA 4B83A 4BRZA 2XQFA 4E46A 2YASA 4H7FA 4X93A 2C0QA 4UHEA 2VTVA 4NZZA 1GPLA 4J3JA 4DNOA 4RNCA 1JMKC 4LIPD 1IZ7A 2XUDA 4G8DA 3OURA 1QTRA 2O2HA 2GZRA 1AURA 4WJLA 4FTWA 2Z8XA 5A7FA 2JEZA 4IH4A 1FFEA 1B6GA 2HRRA 4X6UA 1XLUA 2G4LA 4W63A 3WIBA 2WSLA 1NX9A 1QIGA 3JW8A 4BATA 4HRYA 5T4BA 1UOPA 2QMQA 3CXUA 3VXKA 3RARA 4UHBA 4Y2XA 5HKAA 1XRNA 1E66A 3WK8A 1GT6A 3D2BA 2C58A 3HLKA 1GKLA 4A23A 3IUJA 5JYCA 3O9VA 1C4XA 4E14A 4OUKX 5AM1A 2I03A 4FOLA 1BE0A 1QONA 2XUIA 3PFBA 2RHTA 5LZ4A 3FLEA 4N5IX 1R9NA 5C8VA 3I6MA 3LIIA 1VJ5A 3HSSA 1VA4A 4N5HX 4WY8A 1LLFA 2ZYRA 4QNNA 2YH2A 3I2JA 2OAEA 2ZYHA 1QGED 1UZAA 3R3YA 4ROTA 4FNGA 4AZ3A 3DOIA 5LLSA 2OCGA 5FP0A 4QLOA 3OG9A 4ETWA 4CG1A 1H2XA 1QIEA 3DL4A 1MX1A 2VATA 4HTAA 4DMCA 3VJKA 5AI5A 3F98A 3SK0A 4BDSA 5JZSA 4GDMA 1CUWA 4QZVA 4P92A 1JI3A 2OGZA 3FOBA 4Y2TA 4QDTA 5J3JA 5SYMA 3QYJA 5YASA 1GKKA 4J0CA 5K3AA 1XZLA 1DQYA 4HXGA 2WIKA 4ARAA 4KJXA 1QFSA 1FFAA 4JUIA 3WQHA 1MJ5A 1T4MA 3ZI7A 4EB0A 1FFDA 3DS8A 2XUAA 5LYYA 1J2EA 2VSQA 4G8BA 1ZI6A 2QT9A 2OGTA 5LZ2A 4U2EA 4HXFB 3SX4A 1QIHA 2PSDA 2QVBA 4B0OA 3IBTA 1YASA 5ALMA 2JBWA 2FUKA 3ESBA 3WKCA 5ALFA 4LHEA 1G5FA 4X91A 2XLCA 4CCWA 2WU3A 1TRHA 1IVYA 1GGVA 1FJ2A 1H2YA 3KD2A 4J0KA 3X3HA 1DX6A 2WTNA 5K3EA 2OCKA 1WM1A 2HA3A 1ZD2P 4S0XA 1BROA 3QPAA 4E11A 1M33A 3BWXA 2DCMA 4N8SA 2NW6A 5AOBA 3I2GA 2QR5A 1Y7IA 2BGRA 5CT6A 1N5RA 1CLEA 4DLNA 4XX1A 5FXMA 2Y6UA 2IIVA 4BP8A 4DTCA 1WB6A 2J3DA 4K6KA 1VE7A 1QIMA 3DJYA 1ZD3A 5E4YA 4CG3A 3T4UA 5AJHA 4BAZA 3AINA 3S2ZA 1MPXA 5IVHA 3WL5A 3A2MA 1HKHA 1LPOA 4F0JA 5JATA 1XZHA 1CUBA 4C4XA 5T4FA 1XZMA 3PE6A 4L72A 4V2IA 3ICVA 3D7RA 4G9EA 1UXOA 2AJLI 2OAGA 3E1GA 1XZIA 2DR0A 5CTAA 5CW2A 4FFVA 4XIIA 4BCCA 5AKEA 4Y2YA 4RE5A 2VT7A 1XLVA 1DQZA 2HM7A 4UBIA 4Y2UA 5AKLA 4QWMA 2ZYSA 3F97A 5ESRA 3WYDA 2PM8A 4HAIA 2HADA 4H7HA 4XVCA 3W9BA 2Z5GA 2QM0A 4JNCA 4HXEB 1VOTA 2DQYA 4I3FA 1C7IA 2QJRA 3U0VA 3C6BA 1CIJA 3QZUA 3LIPA 5HZGA 4GWLA 3KSRA 1G66A 2PVSA 1ACJA 4QE3A 5ALXA 3QBJA 5AIAA 1XZKA 4BE4A 3DYIA 3TGLA 2IX9A 3VKFA 4XJVA 4BB0A 3G9TA 5JARA 2ZVDA 4KACA 3L1HA 4N8DA 5AKIA 4W1SA 1AMNA 1U2EA 3ZLUA 3W2TA 3L1JA 2AJBA 4M0MA 1CRLA 5E4TA 2XMBA 5ALUA 1EI9A 2WG2A 4Q82A 1YS2X 1G42A 4EBBA 1K63A 3HC7A 3STYA 5JD5A 1XQYA 3STWA 3PDCA 3HEAA 4GEGA 1CUCA 4K6HA 1R3DA 1J1IA 3HZOA 1EX9A 1JU4A 5JZBA 2ACKA 5EI5A 2VJDA 2WUDA 4AO8A 3AZQA 1IUPA 3FYTA 3KXPA 1UFOA 2WKWA 1Y7HA 3G9ZA 2VT6A 1UKCA 1CUZA 1ZI9A 3H17A 1GZ7A 3G0IA 5AM0A 4UHCA 1EDDA 2WU4A 3ANSA 4MEBA 4JYPA 1HL7A 2WIGA 3WKEA 1O6GA 3D59A 1YAJA 3MUNA 2R8BA 3ZLTA 4AX4A 5EHNA 1MNAA 4HZGA 3H18A 4PW0A 1SCKA 1XRQA 3H2HA 4X94A 3IUNA 4Y9SA 4KAJA 4U2FA 1FFBA 4N8EA 2VQ6A 2G5PA 2XQIA 4OB8A 3QH4A 4Q3KA 3FNBA 3V9AA 2VJCA 4MJ3A 1MT3A 2C5GA 1WHTA 5IVDA 3F8SA 4BTVA 4BCBA 2XQJA 3O9MA 5CXUA 1U4NA 3CCBA 5ALIA 4RPCA 3BIXA 4C4YA 1IZ8A 2O7RA 4PF1A 4WFIA 1K4YA 3PICA 1N5MA 4JYMA 3EQ7A 1UOQA 1F8UA 1XKLA 3IB3A 3NGMA 2HFKA 1XZDA 5DNUA 1UK9A 3UUFA 1EA5A 1K8QA 4QEKA 5ALZA 1XZBA 3Q0TA 3TEJA 1EHYA 5CH5A 1H22A 4AO6A 4PNZA 5ALTA 2JF0A 2B4KA 2HIHA 1HBJA 3C8DA 3BF7A 1ODSA 1PV1A 2W6CX 2XMDA 3LS2A 3IULA 1TCBA 4OB7A 4PO3X 5AOCA 1MX9A 1CR6A 4OCZA 1SCQA 2XMQA 3ESCA 1CQZA 1X2EA 2GYWA 3MGAA 3I2FA 3R41A 4FKBA 1YA4A 3WK5A 1LZLA 2XT0A 3DLTA 1RP1A 2GZSA 4FLMA 1QTIA 3B12A 2DSNA 4W1RA 3YASA 1JJIA 2PU5A 3C6ZA 2PKYX 4KAAA 3RM3A 4MQMA 2OXEA 4A16A 4BAUA 2V96A 4KE7A 3MVEA 4KYVA 3WWPA 1J06A 5EIAA 3DYVA 3KOOA 1JT2A 1PJAA 5A7GA 3WWCA 5DLPA 1ODCA 5FDFA 5K3CA 5ALOA 2QUBA 2UZ0A 2GYVA 4FHZA 3OPMA 2H9YA 4Y2PA 3EIOA 4UUQA 1THGA 2HA5A 2W22A 4WFKA 5T4HA 4C88A 4QDXA 2XMGA 4K5QA 3A70A 1IUNA 5SYNA 3WK7A 1QOZA 4BVLA 4UHDA 3C5VA 5I8PA 1BCSA 1IMJA 1J07A 4UBMA 4PQEA 4WFJA 5ALLA 4AQDA 4XWGA 4I19A 1XQXA 3CN7A 3AJAA 1W1IA 4ZV7A 3KWJA 1UKBA 3ZV7A 3GROA 5EGNA 4K2AA 1LZKA 1ZOIA 2Y2UA 3BXPA 1A8QA 4YK7A 1YS1X 1CUDA 1DU4A 1EH5A 3D0KA 1P0MA 3VJLA 4Q34A 5AKXA 1P0IA 1LPSA 4J0DA 3K2IA 3WK9A 1N8SA 1U8EA 1BN7A 3G02A 3VVMA 2X5XA 2WUFA 4WDRA 4MYDA 4J0HA 4FWBA 4OU5A 1UT6A 5FUMA 3PFCA 3HXKA 1HQDA 3M82A 4Q05A 1P0QA 2WJ4A 3FYUB 1TQHA 3G0DA 1E8NA 3I6YA 5HFAA 4X3CA 1WB5A 5DNWA 4EUSA 3QVMA 2OPHA 5FKJA 5H3HA 4E15A 2WJ3A 4U2BA 4ZXFA 4UFPA 1DINA 5DJ5A 1KU0A 3H19A 3TRDA 2ZYIA 3C6YA 5LKRA 1CUYA 4X71A 3O95A 5DNVA 1QJ4A 1SOMA 3H2GA 3EF3A 2DHEA 1D07A 3OOSA 2CEKA 4X6XA 2ZJ6A 4G9GA 4B84A 5IKXA 4B85A 1WB4A 1ZICA 1E8MA 2XUJA 5JASA 5AOAA 2XMCA 5DYWA 4LXIA 4AB1A 2XB6A 2HA2A 1A88A 2O2GA 2P8SA 3ZPXA 3S8YA 1KU6A 3AZOA 2EDAA 4WY5A 2WHPB 5EHZA 2AJDA 4WDQA 3G9UA 5DWDA 2PL5A 2C7BA 2H1IA 1YB7A 3R3UA 5K3BA 5D6OA 3ED1A 2XQKA 3EQ9A 1RWQA 4NS4A 4QWWA 2PU7A 4U2GA 5ALPA 1TIBA 1VZ3A 4UBLA 3WMRA 4H7KA 3PF9A 3KWFA 1H23A 2PSFA 3VISA 3R3VA 2WJ6A 2GBGA 4CIBA 2Y2VA 3D4LA 2XUKA 4CFSA 3I2HA 4BDTA 2RGUA 3M81A 3V1KA 5DYTA 1QIKA 4UBOA 2JGLA 1ZD5A 2QOEA 5HK8A 4K6GA 4X6YA 4ARBA 2RI6A 3D3NA 1WCYA 3H1AA 5AM5A 4H18A 5ALJA 1LGYA 1X70A 1GPKA 3H0CA 5E2IA 4DNPA 4C87A 1YR2A 5EIHA 2X76A 1CUUA 5LKAA 4FBLA 4F5ZA 2ORYA 4OSEA 2VF2A 5AP9A 4AZ0A 3RLIA 2JGKA 1CUIA 1HLGA 1H2ZA 1SCIA 1N1MA 1XRLA
chains in the Genus database with same CATH superfamily
4U7TB 3OBIA 3CW8X 1T6ZA 4PCAA 4K9KA 2HHHB 3MZ0A 2AVDA 3F67A 4IX1A 1KBOA 1K66A 1PLJA 1G6OA 3PENA 4YCNA 1HDZA 1A1SA 4XCXA 3GZ4A 3NV7A 1GD1O 3UGJA 5KSOA 1OPXA 4QXRA 3S1AB 3TNJA 3V1LA 4YRKA 4ERXA 2YIVX 1PSZA 5AQ1A 3AO0B 2FRVA 4LYAA 1FSZA 1S4QA 3ITEA 2J6IA 1E4OA 2DQKA 3WIVA 1M2EA 2CHQA 3P2MA 3SR3A 2C07A 1LKZA 5A4DA 3K8ZA 1TA4A 4R9VA 4R0NA 4O25A 5AKGA 3OCXA 2ZIEA 1CY2A 3V9PA 4ENWA 1ISHA 4WBSA 1ZVJA 1Y98A 1EE2A 2B0CA 2QRMA 3ENQA 3OTGA 2I8CA 3GGJA 5JYEA 5A4JA 1XE3A 2JAQA 3LC0A 2QI9F 2LE0A 2IP2A 1BHQ1 3EDQA 4HGPA 3B89A 4N3AA 5I7SA 2GHRA 4RAOA 3KLPX 4EY5A 3IV6A 1IATA 3FCYA 4NZOA 3QITA 1V5WA 3UKOA 5KKNB 4E22A 1QYCA 2LD4A 2PS9A 1Q19A 1TAUA 4ZA2A 2VF7A 3BRWA 2ZIUB 1AN0A 1ID1A 2CCKA 3U4CA 5A3JA 4ER6A 1SC3A 3Q8MA 3AVVA 1U6IA 4ILKA 2BFPA 1K8ZB 2Q0QA 4C20A 4P8RA 1ZUIA 3ONDA 4Z0TA 1BQ3A 4D79A 1F51E 2G67A 2Q9AA 3TVYA 4YS6A 3SY8A 3P9PA 1UWCA 2FZEA 1B6TA 1KH1A 2JFFA 3HPQA 2GERA 2GLXA 2G0NA 2YWEA 1BRTA 4AI6A 3LT0A 2GYYA 2QUJA 3OPXA 4YBRA 4E70A 4AS1A 1MIOB 1RPZA 4ZV9A 3EFHA 4OHKA 1O3YA 3RW9A 2PZAA 2B92A 3NHFA 4HX5A 1QO9A 1WUHS 1F14A 4ZTUB 1FS5A 5B3KA 3NAQA 4P38A 4EB6A 3BYZA 4N01A 2FPGB 1MJFA 1HDEA 1BKSB 4MKRA 3FMVA 5A4AA 1H8HD 1KH3A 3P94A 2B1GA 2CYBA 2FEKA 1Z8NA 1C1DA 2P9HA 5DK4A 3I9LA 3G2IA 1QCYA 5AW1A 3WRYC 5JH7F 3OEYA 3V8NA 5C7OO 3I42A 4MRAA 3KQLA 1IDN1 3ETDA 1QHGA 3FZEA 1JFTA 4ZN6A 5ALVA 3Q7PA 4NXNB 1DTEA 1RYBA 6AT1A 1XQVA 2RC5A 4PR0A 1VHLA 3LUPA 3IT1A 2L18A 4ZQBA 4PIPA 3GPLA 2P6RA 1GU1A 2EP7A 1YOVB 4CM8A 5A5VA 5HWSA 5E9AA 4MI3A 3O4IA 1XFAA 3K9LA 2Z3VA 2WFLB 3NTQA 2R6R1 4FGSA 1R0CA 1UBUS 1S3FA 1SCJA 4KGZA 2CLOB 3NJ8A 1ETHA 1T2AA 2REXB 1G98A 5C31A 2HHAA 4YIKA 4CM6A 2YICA 1K4MA 1SXIA 1CRQA 3G85A 3ZHSA 3NHYA 3PHGA 1ZK0A 2ZK7A 2QIOA 1M67A 3WLRA 5I01A 2QI9C 4W5OA 5KAMA 3AKCA 2A3RA 2P6MA 2QYHA 4J2TA 1PWXA 4GLJA 4Y1GA 3FPBA 4ZCPA 3KNZA 4RV4A 1IN5A 3TQHA 2EBHX 2OQRA 3EEBA 2X7XA 4V02A 3PDHA 4DA7A 1F60A 3D8RA 3T7RA 2YXDA 4GKBA 4A26A 1IB6A 1W75A 4EA7A 4CN8A 3AKYA 3IDAA 3RUDA 3RVPA 2I2AA 4KXFB 5C32A 3P2IA 3NC1C 1T6BY 5HQTA 5JV5A 1KQPA 3VZSA 2ZSDA 2AFIE 3IUYA 4CKBA 2RH4A 1LH0A 1AKNA 4IPTA 5P8WA 3FBTA 2O8EB 1ZOLA 1X7YA 3O4FA 3CCCA 2EEZA 2PMKA 3ZX4A 2J3JA 3GCWA 4R7ZA 1Y3BE 2NYVA 3W6NA 1ECLA 1QH1A 1RWBA 4H0FA 2PH5A 1VECA 2R1VA 5I5EA 5BV7A 2D7JA 4GRDA 2JFBA 4UFNA 1H2AS 3KALA 2O2SA 3FSRA 3MGBA 5F7JA 5FQNA 5IAKA 3ZDEA 5B55A 2QE7A 2WIJA 2ZJOA 4YONB 4JBYA 4RS3A 2IXAA 3JPWA 3ZGVA 1VSTA 1QKIA 2ID8A 4AT1A 2GN0A 2OVBA 2W48A 4UDNA 3W9YA 4A03A 1FNCA 4EYSA 5KSWB 3FPAA 2GF0A 4URUR 5IYZB 4UOEA 2PV0A 5KPJA 5M2QA 2ZRNA 5DM60 4NC9A 1RZRD 2BJWA 1VYHA 3IMFA 4TM8A 5SY4A 4I4CA 4BN4A 2A58A 4D4IA 3I9V1 4KREA 2GN1A 3ILSA 5B1SA 4ZI7B 1RI1A 3ZGZA 1Z2CA 5DFAA 4DCJA 2JA2A 3CEPB 1XZCA 2AJ8A 1EDEA 2FSFA 2CXSA 3MS2A 3OFVA 3GGDA 5TS3A 1MPTA 5IKMA 3NALA 4GZ6A 4WACA 4NE7A 2Q41A 4ZJYA 5BW4A 3TZEA 4GPBA 1JTVA 2Z4TA 4RVHA 3IKTA 4G86A 4CJXA 1U2TA 3U5TA 1U7UA 3AXTA 1C7JA 4NCNA 2QMHA 4IVNA 1VG0B 2OP0A 4DL9A 5L4NA 5HF8A 1N2CA 1L5QA 2IHJA 1QUEA 3NHKA 4IAOA 3RHSA 2R87A 3AJ8A 4M1TA 5FPYA 1XA0A 1KJJA 3JD1A 1FSFA 2JH9A 2VHVA 3W5HA 1GYRA 5GONF 1USGA 4ER3A 5FX2A 1XMVA 4ALJA 4HNGA 3DL0A 3SVLA 3ADPA 3ZE7A 1N0UA 1SVNA 3CZ4A 1IFXA 3HI4A 3HB7A 4H27A 4JLAA 5D85A 4FNOA 1V11A 5DYGA 3MT8A 4ZAFA 3LC7O 4WKOA 5HGJA 3ESYA 1OH5A 5ADUS 1NF8A 2D0OB 2QRJA 2UDPA 1Z83A 3RE1A 1SKQA 5IF3A 5AICA 1NMZA 5EP1A 2VKTA 4CCYA 4KZKA 3LX8A 3PYMA 1W5TA 1A5TA 1FS4A 3WTCA 4EI8A 2H5JA 5FPPA 2WAYA 4QFMA 1WZ2A 3ZGYA 3BE5A 3V6LA 4QICA 2AR7A 5D7BA 4DBVO 2R0QC 1EFUA 1FSGA 1WV1A 3MAGA 3TTXA 4Q9AA 5FV4A 3E0QA 5SZIA 2IBMA 1PFGA 3EIWA 3EPPA 1N6RA 3JZMA 4DUPA 3V6MA 1Q91A 2QXTA 3KETA 1MUUA 3AHCA 5TJHA 1CNFA 4I14A 1E32A 3S8EA 2XUGA 1JGTA 1NPYA 4FQ7A 2CLDX 1UM9B 2F3RA 4CWAA 5CXSA 3RAFC 3SXUB 2C7RA 3OZGA 1UJ4A 1NBMA 1XVVA 1Z68A 4IDAA 4BBAA 1RHKA 3AYZB 3F78A 2RGAA 2CKMA 4JEHA 4QXOA 1NJ2A 3AFGA 1CSEE 4Y6PA 4BWYA 4PHFA 5ESWA 1DKLA 2JHGA 2VYVA 2AEMA 3HVUA 1EXWA 1LVUA 4MXDA 5G2OA 4ZVPA 4A7PA 4YRZA 2K4MA 5FL3A 1E9SA 2W2LD 3LPMA 2EKPA 4P0TA 3FUWA 1TKRA 2GKGA 4L07A 1Q0UA 1VP3A 2WFAA 3PKZA 5E7QA 3JD0A 3HA7A 4H77A 5DWQA 3FOCA 3H3FA 4HDMA 3U31A 1CW2B 3QXJA 5CJPA 4OBXA 3OESA 3HFGA 2YZKA 3ZHTA 4C3UA 5CLJA 4YV0A 3GMIA 3TPZA 1BW9B 3DOEA 1DG1G 3PUHA 4C7OA 1VHJA 1FFXA 3BIFA 3ROXA 3UFXA 1YGPA 5JFTA 3AEUA 3T3OA 4FE7A 3N76A 4EKEA 1FXWF 4ND7A 5HK9A 4ZPXA 3V4VB 2CMDA 4H2DA 4RVNA 4KO2S 2YWRA 5JVDA 4S1WA 4UZFA 2QUHA 3OCJA 4JROA 5AHXA 2WJPA 3UMRA 3A1FA 1IY1A 4A5SA 1W36D 3AUUA 2EF0A 3QPBA 1PE0A 3F6EX 4OFBA 1NA5A 5CURA 1FP7A 1YAHA 5AIBA 3SJBA 3KTAA 4CUJA 1ESDA 1LFDB 3ZI4A 1HYGA 3I5XA 1MO2A 2DWOA 4X61A 3VX3A 2QZ9A 3NHUA 3FGOA 5HCUA 5J43A 4F3NA 4UULA 2H1RA 4WAUA 3ZBUA 5LMCA 4XM1A 1CF2O 1IM5A 1WXWA 3PYXA 5EXDA 1SHTX 3QKTA 1XZJA 2C2XA 5LJLA 4DUYB 4ND1A 4IH1A 4BB6A 5CEFA 3VGPA 4MKFA 3PSAA 5F5LA 5BN4A 4P4GA 2EP8A 3PT9A 4J6EA 5GJBA 2XXBA 4HTFA 1A97A 3BZWA 4GG1A 4FDVA 4QDOA 5BOVA 4BFCA 3P0JA 3CZCA 2XB9A 2RCNA 5ERGB 1I2ZA 3V80A 4P0QB 3O0DA 4UTRA 1P31A 2O48X 3DEYX 3HBFA 5BWLA 2HYIC 1B6RA 2X77A 3QKRA 3VU9B 5A5GA 4B6QA 3FPHA 2HR1A 1CR0A 1O8BA 2YHAA 1IZZA 2GN4A 2GZ3A 2HMWA 2IHVA 5AK4A 3RSSA 3CPSA 4NK5A 4BC0A 1SPBS 1P4GA 2VDRB 2YJTD 3IYLW 4DDHA 4TMWA 2J7PA 4E7OA 3PTAA 3N2IA 4IM7A 1Q57A 5DK6A 3V3TA 4P4LA 3LYLA 3MRVA 3RAJA 3S1SA 4AG6A 3G0CA 1E6EA 1GSHA 1Q7RA 2H4XA 5H9VA 4DMLA 3FA2A 5KCZA 4REMA 1OU4A 1A5AB 3Q5DA 3ZXUB 2NADA 1W29A 4YAFA 2UV8A 1HA3A 3M4YA 3ZWDA 3J81k 3UJ3X 4FLFA 1EFVA 4M89A 4O1HA 1F0NA 2VF8A 4KBFA 3MCWA 5DI9A 5FWDA 1P2UA 1PS8A 2B7BA 1O94A 2ENUA 1UJ2A 3FBWA 4FUQA 5G1NA 1TEVA 4ZKEA 2BF4A 2BDTA 5K6TA 2PWYA 2PUJA 3JQAB 4MUMA 1ZGCA 3U7IA 3MT0A 3A1DA 2E3JA 3PTZA 2LXNA 4N5LA 4PAQA 4UC0A 5HIJA 5C1IA 2PN1A 2RAFA 1UBLS 2NQ2C 3KYJB 4AW9A 4EYKA 2CMHA 1XTRA 5GIPE 4QU0A 3ESDA 4TGLA 3X43A 3IMEA 4OA5A 3GR6A 1D2RA 2VXBA 2DB3A 3JU3A 3SWWA 3BM5A 4OJKA 3U49A 3F1KA 1U1IA 5LXTA 3C8HA 3E9RA 4PSVA 4UTZA 5HM6A 1MAHA 2JNWA 5JJKA 2ERXA 2ZAMA 1P3DA 2EWWA 2ZFUA 4OXXA 3OIFA 5AK6A 3VOSA 3DF9A 1NPTO 4XQGA 3CNBA 1F4LA 1V4NA 4ZT7A 2FWMX 1SWVA 1E1CA 5HQ3B 1DV2A 1GRNA 1YZ3A 4GQAA 4WNAB 2UXDB 3Q7SA 2XUFA 3O31A 4NR0A 4S3MA 4MOWA 1K08A 2N9UA 4Z0NA 3U3MA 2CV1A 4IUYA 2B37A 2FW8A 4EAAA 2JLWA 3UANA 2WTMA 4HX2A 5E6RA 4RPIA 3T9BA 4DMFA 4EYEA 1TMGE 4F56A 5A4IS 1UBFA 4EKDA 1GRRA 5HFNA 2XE8A 3TZLA 1I0ZA 4MTCA 5A2GA 5JIBA 2BMJA 3EXHA 1IVNA 1D5WA 1XMIA 2ZU6A 2PBRA 1L4LA 1BOOA 1R6BX 4C7MA 4Q3DA 3R7AA 1QHFA 3C6QA 4TXJA 1IXSB 3EXIB 4UM9B 1AZTA 1DBWA 3CH5A 5DBHX 3QX9A 1DDOA 2RHCA 5IH7A 1W8DA 4JLOA 4CG2A 2AMLA 3D5TA 3A6HA 1N2OA 4G5SA 3DHEA 4Q4CA 4M22A 1NXQA 4NULA 2NZ2A 2B25A 5IKPA 3OLCX 3LP5A 2Y4NA 4M0CA 4D8YA 4EMUA 1HK7A 4YRBA 4M8KA 5B30A 3WLSA 2BBSA 2X40A 4RH1A 4YX9A 3L1IA 3BTOA 2FY8A 2HCRA 3L6CA 2QWXA 3VU3A 1UQUA 2XDAA 4WKGA 2JLQA 4YP7A 3ODGA 1Z5ZA 4PZZA 4OIMA 4DA4A 1R0XA 1QE3A 4S2EA 5TEVA 3KVVA 2O2EA 4UTXA 1FX1A 2FSUA 1KEZA 2YXPX 2C88A 4LVOA 1YSCA 4Y2JA 3L7AA 3BIJA 3LT1A 3VC2A 3ZW7A 3T9DA 2D1FA 2LUOA 1K88A 3IUQA 3QVGA 2VYCA 3V4PB 2C1XA 3AEQA 4ZQFA 3DTTA 3TNYA 2EEPA 4A82A 1XEFA 3CE9A 3UWDA 3DOUA 3VR3D 3DC2A 3PE4A 2DG2A 4OHFA 2NVUB 1L9XA 3EAGA 4UEJA 2IU0A 1CETA 4F04A 4U2DA 2P3LA 5AT1A 1ZGAA 2NU7A 5HKBA 2W6JD 3HL4A 1C4WA 1JHQA 1SOVA 4XPZA 1G64A 3NZEA 3WK6A 3NIDB 1YRAA 4PLZA 1MQAA 1J9GA 1M76A 1P2SA 2O52A 2PD4A 1C3LA 2Z8YA 2IXFA 3GAAA 3L02A 4GRIA 3U9LA 4YJ2A 2PUBA 2PVPA 1K6EA 2GPYA 1J5XA 3CC8A 2PSHA 3U2QA 2ZZKA 1PYDA 4YMTA 1UBEA 1ZNWA 3DZBA 1OX5A 5JH7B 1H9BA 3HBJA 4FQ5A 4IIYA 2YYSA 2VA9A 5ARCA 3ORQA 4J2HA 4AS3A 4BLQA 3A9RA 2ZAYA 4ALMA 3C5WP 4YFYA 4QAJA 3O3MB 2CDNA 4P22A 1DWPA 3FHJA 3OUTA 5CIWA 2GUGA 4B3MB 4FOSA 4MQEA 1GXSB 2YBEA 5G4LA 4Q7KA 4FX5A 1CPYA 2JI4A 3GA7A 5F7ZA 2A0YA 2RHJA 3Q8KA 1B43A 1JKIA 4JOSA 1TCVA 3NBMA 3ASYA 3U1BA 2VC2B 1JEDA 1TKBA 4I1RA 5EQTA 3QEKA 1KETA 2VHEA 4G23A 3UB4A 3TGPA 3RAEC 5CIQA 3DZHA 3MERA 4H3VA 3TTWA 1FTGA 1XDUA 16PKA 2ZJ4A 3FCAA 4NMMA 3U6KA 2PJUA 3L8MA 5BXYA 4QJ3A 1H4TA 2ECQA 3HYNA 3HXLA 2AYYA 4U7HA 1OLUA 4LOHA 5THXA 1T9CA 5B7NA 5KYXB 1TK2A 3KSDO 1H1DA 4LSGA 4JU8A 1Y9DA 2D6FA 2OO3A 2V03A 1NP3A 2VAXA 3FPEA 1MEJA 4PBSA 3R3SA 3IFSA 4B6EA 4CW7A 1FUUA 3A32A 1EXNA 2OBBA 4OLJA 4R8RA 1D1TA 2EKDA 2OZLB 4L5JA 2QSZA 4E5MA 5LU9A 4F2HA 5A05A 2BZSA 1JHDA 2RBEA 2V9ZA 3CZPA 2C78A 3F6CA 2JLBA 1N8NA 1KQGA 3OD5A 2PH1A 2QTBA 4HDKA 4Y2VA 1FFCA 4EPVA 4GZLA 2H06A 3JZDA 4TQAA 1RQXA 5M04A 4B0PA 1J42A 3ANTA 4LJKA 5A0VA 4TLBA 4KMOA 1XTUA 1ZVQA 3PXCX 4M38A 3WL8A 3V46A 4CT0A 4LNUA 1XN4A 1II8B 4HUQB 5IC4A 1UT8A 1LNQA 1NY5A 1XZ8A 2PMDA 2G06A 3O8QB 4M87A 2C8VA 1BMFD 1LF0A 3C43A 3B5EA 2XQGA 2FJPA 1YA8A 3H9QA 5BT8A 3EXFA 4INPA 2QQGA 1P5RA 1M0TA 1ZM9A 5ALDA 5F3RA 3T1QA 3OM8A 4R1LA 4UM7A 4WZAE 2WP8J 1M83A 4NCIA 5H4HA 2HHLA 3SC4A 1TJPB 2G5TA 3TW4A 3TVTA 4FEGA 3S2YA 3WLLA 2JJ8A 5DYYA 4DJFC 4BX3A 3W5SA 3ECCA 2F4NA 1UDCA 5G53C 5DGXA 3LQ4A 1EXDA 1NU6A 1RZUA 1HDIA 3UH1A 1TLLA 1E1YA 5H3LA 1SXJE 3N2EA 2C9MA 4A1FA 4ZZ0A 3K0HA 1JLHA 1MP0A 3A1SA 3IE2A 1NVFA 5A3SA 4B7ZA 4PE5B 5ELXA 3RWBA 1O0SA 1U1GA 2CXXA 2BBWA 1ZJ5A 2HRDA 4KH1A 4Q1CA 2NU8B 4I3HA 3TFOA 2A1TS 4OEHA 3AC0A 5K8TA 4HWTA 5GONB 3T94A 3HP7A 3Q3CA 1H1LA 3DEIA 3Q3HA 4Y1RB 4YALA 2FPKA 1HI9A 1TM3E 2PL1A 2GETA 3FVVA 3IUMA 3GJXC 3QENA 4KNVA 5CYFA 5AW4A 1M5RA 3AM1A 1RM3A 1Y3CE 4V2UA 2VK2A 4YCSA 2VZEA 1N6HA 1C80A 4M9UA 4X9XA 5DHPA 4WZZA 4N0EA 2PWZA 5C4MA 1K4KA 1V48A 2Q5LA 1ONBA 3L6OO 3PI6A 4Q7LA 2M98A 1N1DA 4TTSA 1CRPA 3JYPA 2BH9A 4FXPA 4AZWA 1XRRA 1T8TA 1BVRA 3H4IA 2QPAA 1QZTA 3HZRA 3Q7QA 4RBNA 3I53A 1SJ9A 4JUDX 1ABEA 2AOUA 2PH3A 5FUVA 2RD2A 1MV8A 3RG2A 4R9RA 5KSPA 3WHIA 1FF9A 1TZBA 2A9PA 2BKXA 3BMQA 1KAQA 4PU0A 2GZDA 4US0R 3T1NA 1VJDA 3S1LA 4QLAA 3BK1A 1NRWA 3C3AA 2XRMA 4XGQA 4AL4A 4WJZA 3MELA 5AXBA 4ZHQA 2X5JO 3AWIA 1N57A 5B58C 5BSMA 3W8RA 4F6RB 3SYNA 2XH8A 1NR7A 4TRNA 1RE1A 2Y1XA 1ULSA 2OCIA 3EHDA 3Q9SA 1OA1A 4OLFA 1CS0A 4RM3A 2J9RA 2VDMB 1TCAA 5TF0A 4R6XA 5B4TA 1ILEA 4PLTA 3FAKA 1XX6A 4HT3B 1UF9A 3E9EA 1VFPA 2CD9A 4R8SA 4K8OA 3TINA 3PR3A 4QTXA 5K45A 3GN1A 4CMIB 3R9XA 3ADBA 1MAVA 2AI3A 3NOVA 4XM2A 3IT3A 2B20A 4IZIA 3SC6A 2VQEB 1WXXA 3H5TA 2JLVA 1SNYA 2QHXA 4XUGB 1S2GA 3U1VA 4D9IA 1H05A 4CKWA 3SYKA 1KZ9A 3C1AA 4GP6A 2XNHA 1DJOA 1VIAA 1JFFB 2O8DA 2I3ZA 2GBIA 1Y1PA 5IHPA 3PRYA 4FFNA 2X86A 4RC9A 3F3MA 2YN4A 3QEOA 2WKPA 3JQ8B 3JVIA 1TO1E 3EQ8A 3GA0A 1T3SA 1TXGA 4HWRA 1W7AA 3D2AA 4UCXA 3AESB 1V7PC 1R6AA 1K92A 1KZ1A 1QORA 3DMDA 1LLCA 4IDOA 1C3EA 2WVGA 3CRQA 1CUXA 3CH6A 3T1TA 1GFZA 3FOEC 2XZPA 2F1IA 2F48A 3FUUA 3WKBA 4D42A 3E48A 1Z13A 3HCPA 4QDUA 2DE0X 1CVRA 1GADO 1WHSA 3K0KA 3PT5A 3E5MA 4RETA 1DKOA 1S2LA 1KXZA 2AK2A 2G83A 2UZ3A 1BA2A 1BEEA 1HF3A 1KF0A 3AV3A 4GI7A 4C08A 5C1OA 2XE4A 5HIKA 1BX0A 2JB9A 2DWCA 5IBRA 2XQVA 4P4SA 3SHTA 3TEFA 1LPAB 2WJGA 6Q21A 4CMKA 1MEOA 5B7QA 1QP7A 3T0GA 3EVAA 3UJ6A 1QF6A 1E2PA 3N74A 4Y7DA 1EGQA 3BAZA 4RH3A 1HNNA 3TUIC 3PLRA 2F59A 4OHRA 4HQOA 4I1SA 4H59A 4A2PA 3ZZ0A 5GP1A 5IM4F 3M6UA 4B3XA 2WWXA 4P4UA 4D9BA 3A05A 4BV3A 3FWHA 1NUTA 4HN2A 1C9NA 3PA8A 4YIHA 3QUCA 3WRWA 3WAGA 4GEKA 5I9MA 4ES6A 1DI0A 3DW3X 4J76A 4LQ4A 3IR5A 3QVTA 3HBAA 3QYAA 2I4RA 4AWAA 1I80A 4IL5A 3L8DA 5KNDD 1CYEA 2OR3A 1RJWA 1GKUB 1SVLA 1T9ZA 3M89A 4W6QA 2O8FB 5GY7A 1E3EA 2EHJA 1MA3A 3KB2A 1W1UA 2X8JA 4BRUA 5HTKA 3FB1A 4F5WA 1QHNA 4QKQA 1P1BA 3OEHD 3B3QA 2PBZA 4EVSA 3V8MA 3OY2A 5FH9A 2Y77A 5ED4A 3AVTA 1CVLA 1J90A 4P4TA 1FDTA 1TGVA 3JRWA 3K6KA 3L1KA 2CWDA 3ZCPA 3KLNA 3HJUA 4KXXA 3T5MA 2IELA 1NLUA 2B61A 4ENQA 5KVAA 4EP1A 4KOAA 4O2BA 3LO8A 4BBZA 3BQNB 3LGAA 4MINA 4MEAA 2AX3A 4X45A 3RT7A 5BN5B 2CWWA 2WD7A 2D06A 1YJAA 1A71A 1NM5C 4QQRA 2JD1A 3SQDA 3R0VA 2FVYA 3RU7A 1SPXA 2IY8A 4YACA 3EJWA 1CRZA 3QWFA 3WDSA 1EBUA 2CMFA 3FM9A 2B35A 3CQ9A 3KYIB 2X3FA 2VRCD 1JU3A 1MTOA 3OJLA 2PWBA 4RIHA 1RCFA 2F9LA 4O4HF 1RC0A 4NBTA 4Y6RA 3TW8A 3STTA 4CF6A 1G19A 2FG7C 4PVDA 3HABA 3PLNA 4I6EA 4CFYA 4EG8A 4V1CB 2XB2A 3BE6A 5AW5A 2IYUA 2PFSA 2C00A 4NIMA 1X1RA 3NNDA 4M0UA 4DNFA 1O6ZA 3FPKA 1I6KA 1N75A 4PZAA 3ZU2A 5F77A 3RS2A 1N77A 1ZXLA 1EVZA 4L8YA 2H4YA 2PANA 2Y0PA 3LQKA 1RXCA 4G5OA 1DEHA 1LNSA 4MPTA 1Y5IA 2XOKD 1VBNA 3GZNB 1NZFA 3CBGA 3PUZA 4UU1A 2IITA 4REQB 5ILGA 3T7IA 1M34E 2EJWA 4QO8A 5T67A 2ZTMA 3OIVA 3WZ2A 4DCVA 1WSAA 1Y4DE 2ZRPA 2IOFA 3M70A 1P75A 1Z5OA 3FRIA 4YMVA 1QJCA 2VPZA 3KSMA 4BBJA 1VTKA 3GNQA 4IBOA 2DF8A 1RHUA 3C3MA 3ZDZB 4M0PA 5CA0F 2J9FA 3C39A 3K30A 1T9HA 5AK5A 3FVTA 1U2SA 3NM6B 3ZLBA 1RWPA 3ICWA 2WQ6A 1W4CA 3QOFA 4NOMA 3OZFA 1VKHA 3LX5A 3TOZA 2XZOA 1DT5A 5TJ9A 5J2UA 2AMFA 1Y9EA 2ZSBA 1JDPA 1VFNA 2EJTA 1AQYA 2AYXA 2ZDGA 3SIRA 2FN7A 2N46A 1FNNA 4WBNA 2ILTA 4C89A 2E2WA 4ID9A 5IT4A 1LDGA 2F6RA 4CODB 4UU8A 3QF4A 3EBLA 3RVNA 1HH4A 4A0SA 3DE6X 1N8KA 2P6UA 1T3HA 1V39A 3L4SO 4RA6B 5F51A 4AULA 4CI9A 2J5RA 4IUBS 2W2MA 3B1VA 4RSHA 3OZVA 3FMIA 5C8YF 2L2QA 3L79A 1H66A 1DAFA 3KYCB 2EV9A 3LXUX 1RAAA 2AWNA 3E9YA 5K3FA 4BYMA 4FCVA 2J0UA 4I1OA 1L7AA 5BR8B 3ZTWA 4L9AA 3ZBPA 1WBBA 2I0FA 2Z4RA 4QQNA 1LBQA 1PWHA 2DKNA 1D2CA 3UT0A 5L3RA 3T06B 5JJCA 4IEIA 1M1ZA 4NLLA 5F9MA 3ROQA 2QMYA 5HMLA 1C29B 2FSPA 3SMQA 1OHHA 1NKTA 1ZN2A 2QROA 1OFVA 5KNDH 2ACWA 3N9IA 4BFZA 5JR3A 4FJ0A 4KQXA 3D1VA 5LUBA 3RH0A 1GEGA 1KIMA 2DHQA 4P08A 4U0JA 2XTNA 4UUPA 3RTAA 1EVEA 4G09A 2CJXA 3DFMA 1TW2A 4GBJA 2X9VA 3UM9A 4I4IA 1R4NB 4W5JA 3WXBA 3TE6A 4AP9A 3UV3A 1E7MA 4LZAA 3THXA 1FVFA 2C5BA 3D0OA 1FRQA 2W37A 1BEZA 4IIFA 5D1NA 4JR2A 2E4AA 2W2KB 2EJBA 3LL7A 4CF5A 5JCOC 4BVAA 1X9IA 1O4VA 2ZG6A 1MORA 3GI1A 1FTQA 4IDNA 4OBEA 421PA 4E2FA 3DO6A 4YAIA 3LA6A 1G63A 4GNKA 1U0TA 1UP4A 3H0EA 5HBGA 4MWOA 2FSVC 1YE3A 2YWBA 2ZBUA 2COEA 2GVNA 1AQ6A 2JFWA 3WGLA 3ZDAA 5TR9A 1Y5MA 3UK0A 1ZBQA 4TWBA 1WW8A 2ONCA 4YMSA 4ZMRA 4IHAA 1Y1RA 4XW2A 2X4GA 4OI4A 4X3PA 1HO3A 5FYDA 3ZD8A 4URVR 1YI0A 4CM9D 5KHLB 3WGGA 1EFHA 4HDSA 5FTWA 4RZIA 4NU5A 2ZTLA 1CF9A 1RYYA 2GYUA 4P93A 2ZREA 4A4DA 3JYLA 4KQ9A 3SC2B 1JEJA 1YFZA 1QDUA 2Q1YA 2QD4A 3AHEA 5JNLA 4IIJF 1HNZB 1MVOA 2GI4A 1PEDA 3QXCA 5I7UA 1UMBB 4P3OA 4YPOA 3A04A 4UVDA 3SDSA 3FCCA 4WADA 3W9UA 4C7XA 5AJXA 4MAFA 4WK2B 2ZSUA 1LTKA 5D8DA 3DBRB 1XCMA 1P0PA 2JCSA 3IAM1 3NHPA 5D3KA 3OT1B 1NWHA 1YB2A 3JWEA 4Z8YA 1HV8A 4PC6A 3RTDA 3ZH9B 5K8CA 3VNVA 2NTEA 2OXIA 3CW2A 1S8NA 1X7XB 3A6DA 4KGVA 1PL7A 1PZFA 1EVYA 2CCJA 3EQZA 3KL2A 4JDPA 3ELDA 2OQ2A 4WNIA 5BSGA 3LHFA 2QLBA 4XYBA 4XD7D 1I6MA 3BULA 3BWCA 1JJBA 4MQ6A 1M6YA 3W04A 4XVUA 1N5JA 1B8PA 3M9WA 1XD2B 1XJCA 3GP5A 3OF5A 3SBDA 4RZHA 2PZBA 4Q9DA 3M6IA 4OTZA 4DA6A 1RQ7A 4EGJA 1YFJA 3MMZA 3BD6A 1VE5A 4B2PA 4XYEA 4P5PA 4L4YA 2HRBA 3CX8A 4BO6A 3QV1A 4LXQA 2F3SA 3NDRA 2SICE 3Q9NA 1NUQA 4BMVA 1SD5A 2FWIA 3LVRE 1AXRA 2INGX 1RBZA 3TOCA 4G1EB 2XWJI 1TM5E 1OWMA 4QNRA 2A35A 4CCAA 4B8WA 4AC9A 1E59A 3AIOA 4FNMA 4XASA 2NTYC 4IX9A 2XMZA 3WQRA 4YFVA 1RQLA 3V48A 3AETA 4HNQA 5JECA 3FYDA 2QGFA 1OKKA 2O2JA 3SKXA 1TD1A 3CUWA 3KJNA 3O2JA 4WLEA 2EX4A 3ETJA 3AY7A 4NABA 3TNFA 2DQZA 3MK31 1R6DA 5ICEA 2HBRA 1MN6A 5TGZA 1CX9B 3JQCA 1SUIA 4LYEA 2JC3A 2Q62A 2B8JA 3L7OA 1ATIA 4JP3A 3TJZA 4NF2A 3W2EA 3ZXSA 4F3KA 3OE4A 3HNRA 2GCOA 2GA9A 2PKWA 2O2IA 3SZUA 1DRWA 4OXRA 2IT1A 2HL6A 1URPA 2ZB4A 2PFKA 4EBFA 3VR2A 2PMCA 1E5LA 1ZIXA 2APJA 3JYNA 2DPYA 3T7AA 2IYRA 4DARA 1WUKS 3BA6A 4YCLA 1BN6A 2CW5A 3MGGA 4N0PA 5EWLA 1T2VA 1A4RA 1ZM3A 4CLDA 3O8BA 2D3WA 4OK5A 4OP1A 4PN3A 2AX4A 3T5BA 3O8OB 3MIIA 2YRFA 4V0KA 1Q7EA 4NVRA 1V37A 1T8SA 1A2OA 2MMCA 4HYYA 4A0RA 4WLOA 4KQHA 2AFIB 3OFNA 4Z51A 2BV3A 5BXQC 1ST3A 2JGFA 1IN6A 3ZGNA 1N5OX 4BAGA 4BLSA 3KXDA 3EFOB 4KIJA 4LZJA 4RHUA 1QVVA 4X00A 3DAYA 2ZB2A 4DGQA 2GM3A 2QTWB 1X8LA 1KFBB 1LK7A 1X0XA 2H57A 1ZISA 2VHQA 1JYSA 3D8TA 4G8JA 1V25A 2H7CA 1SBTA 4ZO8A 1XVIA 2JAWA 2OQVA 1MZVA 3NHBA 3WLMA 2O3QA 3BJRA 2ROQA 5NULA 1ZP6A 1CUAA 1H93A 5AJYA 1AUPA 1XZEA 3BILA 4LV5B 3U7EB 3B36A 4DCTA 4HWPA 1EB9A 1T3ZA 3KAPA 5K0ZA 5L3SB 1AC5A 3CZMA 1PJ2A 3AI3A 5CLGA 3FG9A 1I0IA 3K6SB 3VHXB 4CM1A 1KQNA 4MVJD 3V8BA 4BQIA 2ZVPX 5JRZA 2C3OA 4UJ5A 1EP3B 3LOUA 2YS7A 2X1MA 1ACLA 1TZCA 4EGCB 2NP7A 4FDMA 2V98A 2HCTA 1L4GA 2OXRA 5JFGA 1SUSA 3BGIA 3SSOA 1YR8A 4EG3A 2YJZA 4BHTA 2C92A 2ISQA 3ZWXA 3LUJA 4B3SB 2IHTA 2Z09A 1NJ6A 4AS2A 3FZGA 1PBNA 3FKSA 5K05A 3EWNA 3HTXA 3QQPA 1DC3A 1DOAA 4LHXA 5JBNA 2HXSA 4EPYA 3JTEA 2ZB8A 4J0FA 2J31A 4C5CA 4D9NA 4C4AA 5BQ3A 3UUWA 4G4JA 1Q1AA 4HN9A 3NVKI 2QAJA 4PLVA 3WL7A 4BQOA 1PJQA 1AB6A 1JWLA 3W05A 3ZN2A 2W6ZA 4BNXA 3ADKA 4CMCA 2QTHA 4U3JA 4N49A 1A1VA 1O96B 3Q0IA 1GN9A 2XBUA 4V0NA 1CIPA 1TAQA 1BMDA 4PFKA 5TPWA 3UMYA 1ULUA 1R9JA 4TXNA 5EXSA 2HV9A 3NMUF 1CHNA 4CKCB 1AZWA 4JUAA 4E5KA 1Y1TA 2HSJA 4QPNA 1QIDA 3FDIA 2QTRA 5JVDF 4YLEA 1XMQB 1EFPA 4LDPA 1NOKA 2XIJA 4G5FA 4GM4A 4KC0A 2ANCA 2IXGA 2OUIA 2WOJA 3T5AA 1YRYE 4RZXA 3ER6A 2UZ1B 2EL9A 4CPDA 5A4MS 2XQFA 5B3LA 2CK3D 5KNCD 4KXNA 1ZUWA 4PC3A 4UOZA 1PNRA 3WGOA 1XSEA 2O14A 1QFXA 1MVNA 1T0HB 4NZZA 4ML3A 4O4LA 3JV7A 2QN7A 1GPLA 3CJRA 5D2CA 4DN6A 1NW6A 2UYYA 4J3JA 1M72A 3DTVA 4DNOA 5ITVA 4JX8A 4RNCA 5J9FA 3RIHA 5JXWA 1YIOA 3KKLA 1DBQA 1RYZA 5JT1A 2JLRA 3ANMA 5EKDA 2XYVA 3FYHA 4PLYA 4YMIA 4B75A 3OURA 5K1ZA 1QTRA 1Y8QB 1ZVKA 3ONVA 5CFZA 2ZUWA 1L1QA 3H8JA 2O7NA 4WJLA 5C3MA 4LF4B 1MJHA 3EN0A 1XPOA 4IS3A 4FTWA 1PV4A 4E0BA 2VSYA 4FGZA 1DFIA 3T4EA 5KOJB 3QEMA 4IH4A 3DDWA 1OQAA 3HVKA 1GNQA 3ZW8A 2YJNA 3IO5A 4HK4A 1W85A 4RULA 3NP9A 1Z34A 4GPAA 1XLUA 5JAMA 3N0VA 1CD5A 4I5FA 4XZ3A 4E88A 2WSLA 1NX9A 2CCGA 3PR1A 3JW8A 5CVCA 4KQGA 5T4BA 4TVOA 5KKCA 5KTRA 1PCXA 3IP8A 1A7KA 1WMSA 1PWYE 2OOKA 4OMDA 2VDPB 3UEOA 1EGAA 5THQA 3CXUA 3VXKA 1W88A 4RCYA 2PL3A 2BTQA 4U9IS 4UHBA 3LQ2A 4FJ1A 3RUFA 5HKAA 4DIOA 1U31A 1HNWB 4EO7A 4A36A 4M4SA 4CUZA 3ZUPA 1SCUA 5EQDA 1O4WA 3USCS 1QQ7A 1GT6A 2GCPA 5L53A 3GAZA 1V6SA 2YNMA 2VDLB 2ZITA 2ZR0A 1GKLA 1U9ZA 2AKYA 2QN8A 3HKBA 3IQDB 3IUJA 4P32A 5DH9A 4A23A 4KCGA 4DCOA 2I66A 2I1VB 3COJA 3EGXA 3HN6A 1GZ5A 3IBYA 5EWMB 4E14A 4MVJH 4EI2A 2O8CA 4OUKX 1E62A 1J00A 2QX9A 5AM1A 4FOLA 4ESEA 3RJ9A 3ZQJA 3FGPA 1ZAKA 4MV0A 2FPPB 3IR7A 1HWYA 2AZTA 5FO0A 2ZRKA 4Q7QA 3EEOA 3MWEA 1W19A 2XUIA 1R00A 4EJFA 2C4UA 5LXTF 3H1TA 1RYNA 3PFBA 5T3UA 2N3ZA 2FN3A 2QEQA 3LQYA 1Q1BA 4BNFA 3HQ4O 3I83A 1WMEA 3NBZC 4GMGA 5C8VA 2Q5JA 3H75A 3S3TA 5K2OA 4KVFA 4YQYA 3T9EA 4CLRB 2CHGA 1KQFA 1CDEA 2OKCA 1Z2AA 2JBAB 5F76A 1I7DA 4HB2A 4URHA 2FB9A 4IMIB 4WY8A 4AJ9A 1LLFA 4KQ1A 3B9RA 4GC5A 1SCDA 2Q0SA 4MW4A 4NENB 4TYPA 2OENG 3M49A 1PGNA 5KYWA 1SCAA 1VQ1A 4PVCA 3UTDA 4AYXA 4MW7A 2VTBA 1W49A 5C8YB 3PS9A 3FPGA 3WS7A 3PVCA 2G4CA 1CVIA 4ROTA 1I4LD 1OZAA 4AZ3A 4E5VA 5KHOC 3DMFA 1W96A 5TV2A 1JR4A 3AEYA 4MA5A 5EIBC 3GP8A 4W5HA 3DBLA 5KU7A 3CG4A 1FMCA 2O4CA 1TQ6A 1U6JA 3MCUA 4M83A 3WYCA 4CRWB 5HJ7A 5JCJD 5JBQA 1R4MB 1T9BA 3MJVA 3ZXYA 2I76A 3Q6IA 2D74A 4BMNA 3GEGA 3DL4A 3GJTA 1FXUA 4WK6A 1SBYA 3F1LA 4HTAA 4OSOA 2BT4A 2QN1A 3QY9A 4PZUA 4FYXA 4H60A 2IS4A 4IV5A 4BUZA 3KOUA 4E2YA 3VJKA 4EL5A 5KNCH 3SK0A 1ZXXA 2FK8A 3RUHA 1K5GA 2YXBA 1U2PA 3VR5A 4BDSA 4B7CA 4GDMA 5TNXA 3FFWA 2BSAA 2JGDB 2ID7A 2OGZA 4ID3A 1KI8A 1HYBA 1LVGA 4K9NA 4X66B 4QDTA 3CVVA 4N5NA 3ZK7A 5DT9A 2Q45A 1N0IA 1YZNA 4KDEA 3TDNA 3GIDA 4MVJG 1MLDA 1TZKA 4BNTA 4JJ7A 5SYMA 1J09A 2GB4A 2JIBA 1O94C 1ISMA 3FF4A 3G89A 3QYJA 5YASA 2H2AA 2CV2A 1EM6A 5C53B 1VJ1A 5K3AA 4RQUA 3L8YA 3HJBA 4GNRA 4A0QA 1Z3IX 1Q1ZA 1QCZA 3MJSA 2ZKIA 5TSDA 5JI2E 3NKFA 4A8HA 5CP8A 5E3JA 4WLUA 1JQ3A 2G0AA 3AM5A 3I9NA 4KJXA 3WGHA 1FFAA 3AKEA 4ACAA 1CJCA 2X8LA 4RD3A 2SKDA 3MMPA 4JUIA 5C7LO 5IHXA 5K8IA 1WE2A 3ABZA 4ZIRA 1MJ5A 3K9FC 3SKVA 3C6MA 3DS8A 4YJ2F 5I8ZA 2YV1A 1VIVA 4LOIA 5JEEA 1KWGA 2X4DA 4OYHA 5TF4A 4PGAA 3HNOA 2B30A 1U9YA 2W2NA 4B87A 5LYYA 1EAMA 1JXAA 1KZ4A 4QO7A 4G8BA 1WEHA 4IIJB 1SC6A 3SAJA 5H8WA 1XAIA 5DM70 1U94A 2UU9B 5JDCA 3SXPA 2OGTA 4AKEA 1O1YA 5B1DA 1SGWA 2YFQA 4M2LA 5EVJA 1RWVA 1WCV1 1B73A 3EXHC 4M1QA 4DW8A 2YOHA 4JMPA 5F1YA 3KJGA 4PHCA 2GHQA 5DLQC 4Z3KA 2GEBA 1PT6A 1V8DA 2Q8PA 2PX4A 3GD5A 4ND3A 4QL3A 2BVNA 3NHZA 1RT9A 4XWYA 3UYKA 4N3NA 1GGMA 1QFZA 4LRYA 4M7OA 4RD1A 3AP1A 4Q9LA 2G3YA 3AR2A 3IESA 3GDOA 2JBWA 2FUKA 1WCIB 4C0AC 3CO0S 1M1YA 3JD3A 1KNQA 2LNDA 4DR4B 1UPCA 3EA4A 3IEXA 3OUUA 1G5FA 1WOYA 3DLBA 4BYGA 4GP9A 3O75A 3FN4A 4RVCA 3UPDA 2BR4A 2WTUA 1MD9A 1PRYA 1ODJA 4M9RA 5BVHB 1IVYA 1H2YA 1M2VA 3RC3A 1XB2A 4I1VA 4NOKA 5ITZA 1DX6A 2IUUA 2WTNA 2AKEA 1C2TA 2FW6A 5CEJA 3PR2B 1PR5A 3LNTA 3ELBA 3QLJA 3L1UA 1ZD2P 3T3HA 2B1IA 1D2AA 4PWZA 3UAGA 1PAUA 4DXHA 4A73A 2EFGA 3H84A 1UR5A 3H42B 1YT5A 2CVOA 2DU8A 4NJMA 5LWHA 4TSFA 3GLFB 4FOTA 3MHTA 4N8SA 3OTHA 8GPBA 2NW6A 2Y99A 4NYJR 4ALNA 4M8SA 4R4JA 3L9XA 2VYFA 3DBOB 3FGZA 3DPUA 2R1ZA 3LQFA 1N5LA 1IBMB 4BP1A 3VYWA 1PX0A 1U5CA 2VIIA 1HDYA 3QTBA 3C3WA 3SLKA 4A5OA 4OH1A 4B3CA 1GP2A 3B78A 1QQBA 1Z6QA 2QTAA 3ESXA 5LUAA 4A15A 1AV6A 1XF1A 3P2YA 4BDTA 1RSZA 4QATA 1JAXA 1X38A 2G9ZA 2IOHA 4QNMA 1T2DA 4DCPA 4DLNA 3HB0A 5MHTA 2H65A 2I6GA 3R1IA 2XNJA 1T6YA 2NSJA 5IS2A 2Y6UA 3LUCA 4GI2A 1RMTA 4MA0A 1ONNA 4EENA 1F06A 3FOFC 3CVUA 1JZQA 4KXWA 1HFEL 2BDUA 1WB6A 2HBQA 2QTLA 1ND5A 4MCIA 1QIMA 5CNKA 2PUWA 2HI0A 2ADMA 1JEYA 3N2KA 1V5GA 3G13A 4TSRA 4ZGGA 1D0IA 5DN6D 4JI7B 1MPXA 3B60A 4D6YA 4DLZA 2X4LA 1L7EA 2IJGX 2FFHA 3WL5A 4PPGA 1LPOA 4RD2A 1SULA 1U5BB 2GXSA 2WAXA 1XEWY 2B82A 3G88A 1G20A 4J1NA 4C4XA 5T4FA 3EVNA 4GGOA 4O4IF 1K8YB 2YCLA 1WDWB 3ZCQA 4DQKA 4V2IA 1I9GA 1P17A 1QHYA 2H1SA 4O8ZA 3P19A 2RGNA 3JVEA 1HC7A 3G5TA 4G9EA 4IINA 5EJGA 4PX5A 3T61A 1G8HA 2NN3C 3E1GA 3I64A 4IJKA 4ZCMA 5HCNA 3II6X 2YMQA 2IW1A 2DR0A 3FNRA 2OGUA 2HWYA 2WPDD 4RNDB 4F4CA 3ZD6A 1UPBA 1LBHA 4DRXA 1C41A 4FFVA 2DUUA 2GEFA 2R48A 1U2GA 2NG1A 2WWWA 4LDAA 2ZXUA 2JH8A 3TTTA 4CTMA 2JCBA 3GJ4A 4ZJPA 2P91A 3HCEA 4WZAB 2AW3A 4Y2GA 2Z6QA 5AOVA 1XLVA 3EFEA 3LWDA 1A8PA 3PQ3A 2OB2A 4HB3A 2AZMA 4MITA 4QWMA 5AKLA 3ROKA 5B12A 2VDOB 3F97A 1G41A 1ZA1A 1BGXT 2PM8A 2XCQA 2Z6VA 1SY7A 2DGDA 3MYYA 1NMYA 1WQ1R 4FEEA 2HADA 3KG2A 4HAIA 4Q4HB 4YDHB 4H7HA 5CDUA 4XVCA 1C7RA 1FY2A 2RAPA 2Z5GA 3G2LA 4I4TA 2YQZA 1QLJA 1AXGA 1SXJB 1VOTA 1KJ9A 3GY0A 1EX1A 4QUAA 4I3FA 4L5CA 3FAZA 1XMXA 3UIEA 3GLQA 1Z6YA 4ZVOA 5CT4A 1ABFA 4LGCA 1NNSA 1JTFA 3IS3A 3C6BA 2QYTA 1ISJA 1D04A 1NIPA 3MIZA 1FX0A 2EKLA 3A6FA 4RD0A 4BO9A 1VPWA 1CP2A 1KJYA 4KQMA 4KR9A 2JAPA 3ZK9A 2VCEA 1IAVA 4CNQA 4JL8A 1UJNA 1W35A 3RVRA 3EGIA 1W0KD 5FUXA 2OFFA 3QBJA 4W7SA 3G17A 4MVJM 3KPWA 1T35A 3PXBA 3PDIB 4MP3A 1DE0A 3TAXA 4TLDA 4LDQA 4GPTA 4PG4A 2YXEA 3RYIB 3HBNA 1XZKA 4TSKA 2O5EA 4GO1A 1XEAA 1JR3A 1P7ZA 4O29A 4O02B 4TKZA 4J4HA 4QQ8A 4E2WA 2V7BA 3ZE0B 5D87A 1EFRA 3F3KA 2A30A 3GWZA 1M1NA 3ANLA 1WF3A 1G7RA 4FZRA 4UUMA 1Z2OX 4J3NA 4PHHA 3DVRX 3K1JA 4D4MA 3WLHA 2ZVDA 3CR7A 5JARA 3NI2A 1GA6A 2HWUA 2L0XA 4KACA 1IIRA 1WP9A 3QW4B 1Z22A 4R0MA 4BGVA 3H11A 4LA4A 4Q4JB 3BUSA 1YMQA 1U3CA 3JQ7B 4N8DA 5AKIA 4EELA 3L8FA 2C96A 3DB2A 3ZW9A 1JQKA 2ZRHA 3L8ZA 2GCEA 2ZT5A 3AHFA 4LMBA 3NRBA 1NOJA 5EJIA 3FI9A 2C4MA 4JVSB 4KN5A 2H51A 1Y9AA 3W2TA 2CXNA 1CB0A 5EY5B 1WSBA 4M0MA 3ZK8A 4E09A 4PFJA 2O8NA 5E4TA 4EARA 3WGVA 2WVHA 1TA9A 3K1AA 3KWLA 4IIEA 5EQJB 1NKVA 5K2MA 1L5RA 1V35A 1VIYA 4UZSA 5B36A 4A0HA 3CKMA 3GGSA 1XXHA 1T3TA 5FB3A 5KC9A 1WULS 5PNTA 1VIMA 5JD5A 5KYKA 2ZJYA 1NTOA 3STWA 4BL5A 2XCSB 4JSTA 1V7CA 3E81A 3R0JA 5H82A 3V7FA 3HEAA 2XNSA 4JIGA 2GTPA 3AUAA 5BNFA 4C1BA 3FSJX 4DRYA 2F3UA 5B2EA 6REQB 2O19A 5CNIA 1F9AA 2ZJ2A 3UWSA 2YXLA 1GNPA 1R3DA 1J1IA 4RV9A 4AWBA 2A0KA 5KOYA 3E58A 2J5XA 1MO5A 3EVFA 3F8WA 4MLCA 4AXXA 4EDHA 2D00A 2ACKA 3LFTA 2D8MA 4C3ZA 2VJDA 4QU5A 4DV3B 1LQ2A 4RMGA 1IUPA 3D3QA 1GCIA 2B2XA 1J2UA 2JLSA 2PRYA 3PIIA 4YUVA 3N0RA 4BX8A 4ZMSA 3KXPA 2IDZA 1JB1A 2EQBA 1UFOA 5AVQA 1RBYA 3G9ZA 4EF6A 5TQVA 5EZSA 5LQNA 3AF4A 1IPEA 1XVLA 3CKLA 3O2NA 4WN9B 5A0TA 1MDFA 1ZI9A 1GZ7A 2I34A 3F0TA 3KKPA 4D26A 3P7MA 1Z6XA 4AROA 4UHCA 1Q1NA 3GMDA 3DZGA 4RPGA 5BORA 3TRJA 2AR0A 5AYVA 4MEBA 5FNVA 3RYFB 1NN5A 1QE0A 3KD3A 1M2OA 4JYPA 5FI1B 3T5PA 2WIGA 5IBPA 1L5HA 3Q5GA 1O6GA 1UZUA 1Y6JA 3KZCA 4PPFA 1I3KA 2DFLA 1IHYA 1DBRA 5CX1B 1D2GA 3FMOB 4XGIA 4U6NA 3TOVA 3ZLTA 4CUKA 5AW0A 3LL4A 1X9HA 1FJXA 2CMKA 1WU8A 4WESA 4B5KA 3K32A 3HCRA 3ENZA 4BMCA 3VAZA 4CT4B 2VWGA 3B38A 3W5AA 2HO5A 4WJKB 4OJNA 3H18A 2YJGA 5DX1A 3IERA 4JBLA 3MEQA 4ZVKA 5IK2D 5JMTA 2FE4A 3R9IA 4MR7A 3W5JA 3BTVA 1KK3A 1MRNA 1M73E 1SCKA 1W93A 3IVXA 3K5PA 3O7WA 5CDFE 3H2HA 4JB2A 1SVMA 2I6SA 5BO5A 4RHXA 4RSGA 3G0HA 4K3UA 4U2FA 2MSNA 2AE2A 5GJCA 1FFBA 1EM8B 2ZYAA 5TEWA 4DV2B 2QORA 3EGEA 4L27A 2IV3A 3QH4A 4C6TA 1KO4A 3ICCA 5HKKD 1JYEA 1SR8A 4WLFA 1A3CA 1BOFA 1MT3A 1W9HA 2RHOA 2CC2A 3KJFA 5M34A 4WRRA 1XTVA 5J2UF 3FB4A 5AMXA 1HT0A 2A14A 1QFYA 2QMOA 4WBNF 4PN7A 4AMUA 5C3UA 3ZJVA 1RJFA 1TJNA 3CCBA 1RJEA 5CDTA 3M6VA 2B0JA 2ZJBA 1FRVA 2FVXA 2PEZA 4HKTA 3B2QA 3VKVA 2D13A 3UT5B 4C4YA 1IZ8A 3DEHA 2IY7A 2P7HA 3GU3A 2V6GA 1ECBA 1JF8A 4HVLA 4P2GA 4BO3A 4PF1A 4KWCA 4DR2B 3W8EA 4Q0MA 5DNYB 1K4YA 3CTMA 4QBTA 4DREA 1N5MA 1UFVA 1ZS9A 2AQIA 3HJGA 3OZSA 4TQGA 5I51A 4G63A 5B1YA 4DV5B 5CA1A 1D7AA 3HR7A 4H0NA 1P7WA 3AVOA 3THOA 2PKQO 3IPLA 4G5HA 2HFKA 3IUBA 2OCDA 4Q9KA 3E7FA 4YBZA 5F5XA 1M34B 2F1HA 4JT4A 4AJ4A 1P1JA 1XL0A 1Z17A 4JAVC 4D3DA 3IQHX 5DNUA 1P9LA 2OCAA 1E2FA 2JKZA 1DKUA 1NQTA 2E1PA 1B2LA 2IF0A 1ODLA 1I5OA 1DXQA 1EA5A 3MF4A 1CQXA 3ZR4B 5K9ZA 5ALZA 4EH1A 2Q9UA 4EHKA 1S1CA 4BJ1A 1G2QA 1PZGA 4WZ6A 1BFDA 1UQRA 1NUPA 2H1LA 3SCZA 5DM0A 4GM0A 4LBZA 3KKOA 2B4KA 1NVAA 2DY1A 2OSBA 5LQMA 4O4JA 4A8JB 4YRRA 1PV1A 3TLKA 3WWYA 2OFXA 2AEEA 1Q5PA 5FI5A 4FILA 2W6CX 2NZUG 5EZYA 1C7ZA 1Q11A 3LHDA 5J5AA 4AJHA 3DVAA 2XMDA 4DJAA 5IKEA 4KYTA 5JNUA 1PP4A 3LS2A 3GMSA 4JWTA 1YJQA 4OB7A 7MHTA 3AB7A 1KOFA 2PLFA 3C97A 4LJAA 4YP0A 2M1ZA 3LM8A 3DKVA 4TZ6A 3LSTA 4UW9A 3KP1A 2IWRA 1GLVA 2X0EA 4HAUA 1GL9B 4MV9A 3KUDA 4OCZA 2XMQA 2ZYDA 3W4IA 2AZ4A 3WP0A 3U4DA 4QUDA 4TVBA 1X2EA 5F3DA 3R41A 1QZXA 3I2FA 5JAZA 3SF8A 4F1WA 1Z0FA 3UJ9A 5LOVA 1V41E 4JP2A 4Z53A 1KHTA 1UC4B 2FQWA 4LJ8A 4YJGB 3I52A 4LF7B 1QYVA 4QUBA 4MB0A 4D81A 1QTIA 2YBDA 3HKCA 2FMTA 3GO4A 2R84A 3ZDQA 3SQLA 1NDQA 4R3NA 2PU5A 3ZJTA 1PJ8A 4CMJA 1XTSA 2PKYX 2W8BB 4EFDA 5L8VA 1J1UA 3LX6A 5AESA 1JN0A 2VS1A 2EG9A 3RM3A 4M6WA 4G1CA 4MQMA 1J99A 1SCBA 2ZIGA 3QELA 1GV0A 5GVRA 3SHQA 4BVEA 3EPHA 1NF2A 1U0LA 2FQXA 3OKCA 4IOJA 4TKUA 1CQJB 4YJFA 4B4OA 5BPFA 3KJEA 4Z4QA 4PHGA 1TI7A 2FWJA 3H65A 1T2EA 1TNDA 4IJMA 4KBGA 3RIEA 2BM1A 3TG8A 1I2BA 3PXUA 1IJEA 2I71A 2PS0A 3E15A 3DM5A 2VPTA 4DEYA 3ORYA 2H8GA 2TMGA 3OQ1A 3SR4A 4QRIA 1J06A 3DYVA 3IP6A 1D1PA 5IXJA 3GEHA 4ZEMA 4RKQA 2VP6A 1N2GA 2YZGA 4NFLA 4AG3A 5L51A 2W2TA 1PEAA 1QRSA 1US8A 1PLKA 2RHDA 1IOLA 1JPNA 1JT2A 1N6PA 1PJAA 2E4XA 3I5AA 3V4ZA 3PEVA 2B4TO 4BV9A 1IEWA 1ODCA 2Q3HA 1YK0A 1DFGA 3AKDA 2A6PA 3CURA 4G0PA 2R5WA 3OKAA 1OZ0A 2PMWB 1OX4B 2UZ0A 3EXFB 1FW8A 3KKQA 4R2HA 3T5TA 2P3QA 3WNVA 2DWUA 1JDZA 2E89A 2Z9BA 2ZUBA 5D5PA 4F5EA 2GYVA 1DKMA 2ZT8A 4PG7A 3LW7A 3ZHYA 5CCBA 4FHEA 4AM8A 3I01A 2B8WA 1OAKA 3H16A 2NP6A 3CNNA 4FHZA 3PFFA 4W5RA 5LBTA 5JSQA 3EWIA 1NP7A 1KFEB 3AI2A 3PKJA 1ISFA 2PKQP 3SX2A 3TOXA 2PR2A 1GUFA 2HA5A 2PZ8A 4DBLE 1POWA 3C15C 3EH2A 1RJDA 3HR8A 3IPRA 3KT3A 4ZT3A 4C88A 1KI1A 4HB0A 3B70A 4BNHA 3P9CA 3RJTA 3K6RA 5CGZA 5F2OA 4ZZ2A 5SYNA 3HU5A 3SOZA 2AHRA 1OYVA 2ODPA 2C1EA 2F64A 2GRUA 5F35A 1SMKA 4GDFA 1GUYA 3OCUA 1Z2PX 4RSMA 3C5VA 4EQ6A 4O4IB 2OV3A 4LCBA 3X1WA 2P4EA 3FDZA 2CXPA 3OT5A 4D96A 1BCSA 1A9XA 1EVLA 3CEMA 5BNTA 4AQDA 4L6CA 3LG2A 5KTTA 3HFRA 3IELA 4KQCA 2P5TB 4D92A 2PRZA 3EOZA 3TQTA 2ZE5A 1AUXA 3TFQA 5DYNA 1OV6A 4UNPA 5B3JA 1H6AA 2XADA 4I99A 1XQXA 3C3YA 4EVIA 2BGMA 4M76B 2P2YA 4IR7A 3KWJA 2N1MA 5FCDA 1UKBA 1SUPA 1VKOA 1A69A 4FW9A 4JBIA 5TRTA 4W9MC 2UZIR 1ZRHA 1K27A 2HJRA 4DLAA 2B5WA 1BIFA 3TL2A 3ROTA 2ZULA 2BFFA 1IM2A 1ZCZA 2A92A 1RMYA 3DB1A 5HRAA 5CB4B 2AN9A 1SCNE 3AHJA 2CY0A 5DYIA 3KYDB 1KMCA 3EEQA 5AXAA 1ZIPA 2Q46A 3BWMA 2VA8A 2CVZA 2CHFA 3QXGA 4MULA 1JIIA 2SCUB 2XVYA 3LY5A 4M9QA 3IDQA 4YWHA 3TLGA 5JRDS 4R2LA 1B2RA 5AKXA 1OB2A 1EP1B 1R5OA 1GNRA 4NYMQ 3VUEA 5IJ9B 4GZ5A 1NMXA 4K6OA 3U4QA 1PT5A 1KZ6A 2QRHA 1PQWA 3IVAA 2JAHA 1OB5A 2X0JA 1HL3A 1PNQA 2OO5A 2PEYA 1NSFA 4MO2A 4AZSA 3IB6A 3WDKA 4RDHA 3WJ7A 4D0SA 1Z9BA 3LYUA 1IBKB 2C5AA 2D54A 1UBOS 3BHJA 1XXHE 5T6MA 3O3OB 3WDMA 1JNXX 2GEKA 3BL6A 3D4OA 2Q6TA 4WDRA 2GHIA 4DT1B 5I7EA 3KCNA 4MYDA 2G88A 2YOFA 1QQ5A 1D4ZA 1UT6A 4OU5A 1JYFA 1RBMA 2VJLA 2EGUA 4MS4B 3FYCA 3LOPA 5DSZA 5A1TA 4H6XA 3UNXA 5FUMA 4OUDA 1D2HA 4Q19A 3PRJA 1GPYA 4DV7B 2NACA 3S55A 1F12A 3D8SA 3QKSA 4HLNA 1D4OA 1E3MA 2WNSA 2G9UA 5BNWA 3AR9A 4IHJA 1JUDA 3WV4A 3ZV5A 3E5NA 2DWQA 4L75A 3S28A 4EX7A 4LFBB 3B82A 2GNOA 3ASZA 2K5UA 3DHVA 1N6LA 2JHPA 3FUXA 1JXQA 1YQTA 4UXHA 4X1IB 1SK8A 1TQHA 2NV2B 3VR4H 1X86B 3KAQA 3OM9A 4G97A 1CTQA 3C7KA 3AX6A 1J0XO 1E8NA 1NRIA 2NX2A 2VHYA 5HFAA 4ZDKA 5K0BA 5I4BA 3OZEA 1WB5A 4ISCA 2VSOA 4R8LA 3DE2X 3I30X 1RRCA 2A9FA 1DZIA 3MJFA 3KOWA 4HGOA 5FKJA 4D9KA 4E15A 3VAAA 4ZMBA 4U2BA 2ZZNA 2J5KA 3DZCA 3KE9A 4KJZA 4TRJA 4ZXFA 1I01A 1NW7A 2ZDQA 3H19A 1AU9A 3WP1B 1TU4A 2I7CA 2OV8A 4MKHA 2V5UA 1NNI1 4X71A 5FWNA 4MUEA 4X64B 3OLVA 1ZQ1A 3JPYA 3OE7A 4IO1A 4C0SA 3EF3A 4IIHA 1FZQA 3B1JA 4W7IA 5JXIA 4HQFA 3RANA 2DHEA 3N5CA 3WGQA 3OOSA 2CEKA 2YZNA 4XDZA 4PHTA 4Y98A 1P1IA 1YJBA 1TPYA 5E6SB 2C98A 4YREA 2DBZA 2ZJ6A 3BTSA 3VFDA 1WVGA 3ZWKA 4ARVA 1OR8A 4D4LA 4JLWA 5IKXA 5JS2A 2QIPA 3KQSA 1KEEA 1ZICA 1E8MA 2XUJA 4O4LF 1O9BA 2P62A 2RKOA 3R77A 4ZO7A 4N5DA 3X1KA 4D9MA 3PNYA 4UMVA 4HZUB 4LXIA 2QW8A 1CR2A 2P5UA 1X9GA 2ZRJA 1MDBA 1E61A 1YCGA 1YRQA 2GZ1A 2HA2A 1A88A 1EHCA 2CL5A 13PKA 1II0A 2OBLA 1G0OA 1FNDA 5EEGA 4RFSB 1N9ZA 4I50F 4D4JA 1QM5A 1U3GA 3MILA 2BI8A 2EDAA 3AF0A 4XUCA 1CJTC 3RU3A 5EHZA 1WVMA 3RSQA 3D31A 1N3YA 1S7CA 9GPBA 3S99A 2GLUA 4TL6A 5DWDA 2C61A 1XNJA 1ACMA 2FWNA 4R83A 4WXMA 4ZVNA 3QF7A 4GAEA 4M1KA 2JLAA 1TJ4A 2O3UA 3GLHE 2NV6A 1YB7A 4P80A 5JISA 4BEBA 2GLTA 1IY9A 1CU1A 3C8ZA 3CWCA 3IIJA 5K3BA 3HVRA 4OI0A 4GKJB 1M7GA 1GTG1 4MKZA 2W6IA 4NMLA 3A7DA 1RWQA 3DUWA 3DV2A 5U4QA 1COWD 2YIJA 5DTEA 4C30A 3G8AA 4XDGA 4U2GA 3I05A 3Q72A 4MKGA 4QUKA 3G1UA 4YRFA