1QZ3A

Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
309
structure length
309
Chain Sequence
PLDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVKKEPVAEVREFDMDLPGRTLKVRMYRPEGVEPPYPALVYYHGGGWVVGDLETHDPVCRVLAKDGRAVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAAVTSILAKERGGPALAFQLLIYPSTGYDPAHPPASIEENAEGYLLTGGMSLWFLDQYLNSLEELTHPWFSPVLYPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQFYSLSPGATKALVRIAEKLRDALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYLESTERASE EST2
publication title A substrate-induced switch in the reaction mechanism of a thermophilic esterase: kinetic evidences and structural basis.
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
molecule tags Hydrolase
total genus 110
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2003-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qz3A00
1DQYA 2XI4A 3ICWA 5C8XA 4MEBA 5AIAA 1QGED 2WM2A 3C6ZA 2XUGA 3F97A 1AGYA 4MEAA 3FSGD 3E0XA 1NX9A 2LIPA 2PBLA 3V48A 1AURA 4Q3OA 1DT5A 4EB0A 1ZI6A 2PKYX 1A8SA 1UFOA 1R4ZA 4BVJA 3TGLA 4AMZA 4UHEA 1X70A 4JNCA 5J3JA 2WIJA 1F6WA 1L7QA 3G9TA 2WFLB 1QLWA 1CLEA 4M0MA 3PDCA 4K5QA 4EY7A 2HADA 4ZI5A 4H7FA 3I1IA 3WKBA 1MT3A 3IIIA 1AKNA 1T2NA 2DFPA 1USWA 3IUNA 2C4HA 1ZD4A 4QNNA 1FSSA 3BE8A 1L7AA 4BDSA 5ALLA 1TQHA 2VAXA 4ZGBA 4WY8A 4FOLA 2OGSA 5E4JA 2OLEA 5AM0A 2HHAA 2AJDA 4MJ3A 1SFRA 3MVEA 4X6XA 3AIKA 4FLEA 4G5XA 3SK0A 1KU6A 1LPNA 3FCYA 3GELA 1J1IA 2XE4A 3C70A 3O9MA 3VISA 4F5ZA 1QO9A 1CUSA 5ALEA 5D7BA 1QIJA 4G8CA 4UBLA 2QR5A 3HC7A 3L1JA 3FNBA 2O2HA 1ZGBA 3G8YA 4YK7A 4GDMA 3FVRA 2DR0A 3VXKA 4J7AA 5JZ9A 5AJHA 2WFMA 1THTA 1XQXA 1W52X 3JWEA 2ES4A 2B9VA 3C8HA 3H17A 3AILA 2BJHA 5KWIA 3H1BA 1TK3A 5A6VA 1AZWA 4X92A 5IH7A 3WYNA 3ESCA 5CTAA 5HFAA 3IULA 2XUOA 4C88A 5BWCA 1UZAA 1G66A 1WPXA 4NVRA 3WZLA 3K2IA 4HZGA 5LZ2A 4O08A 2ONCA 2WJ4A 1XZMA 2G63A 1GKKA 2VQ6A 3IVMA 1YA8A 2WQZA 4WDRA 4Y2TA 5LKRA 3AUKA 3D5EA 3DL7A 1GPLA 1LPBB 2FJPA 1XRMA 1LGYA 4MYSA 4DM7A 5JATA 1ZICA 2IX9A 3U0VA 1W75A 2JBWA 4DTCA 3C6BA 1XRNA 1RYYA 5ALNA 1X2BA 1ZJ5A 1MNQA 1XZGA 5AK5A 3NOXA 2HU7A 4B9AA 4QDTA 5ALOA 2RIPA 2W22A 1XZJA 3MUNA 3WKDA 1BE0A 5FUMA 4JYMA 5HQ3B 2VT7A 4X6YA 1DINA 2C0PA 3DKKA 4WY5A 1F0PA 4FLFA 2V97A 1UOPA 1XROA 3LIPA 5JASA 2PSJA 1CUXA 4B0OA 5AOBA 1XRQA 4PSUA 2ZYSA 5AKZA 3R3YA 1QOZA 3QMWA 1EK2A 1NU8A 5ALSA 2EDAA 4N5HX 2AJLI 1QONA 2YYSA 1BN7A 5AM5A 3IBTA 4KE7A 4ZWNA 4KAFA 3OPMA 5K3AA 3WLAA 1BROA 3QZUA 1YSCA 5HFNA 5ESRA 3V9AA 4BB0A 1SC9A 3D3NA 4C87A 5AI8A 3VDXA 1JJBA 3STXA 1JMKC 3PUIA 1E66A 4E11A 3FYTA 4UFNA 2Y2VA 5C8ZA 4K6HA 2WKWA 1RP1A 2RI6A 4DNFA 2XMSA 4NMWA 5AKIA 4IH1A 1G4HA 4F60A 2W6CX 3MGAA 4BE9A 1U8EA 1MAAA 3WKAA 2XMGA 5I8PA 1K4YA 2PL5A 1QTIA 2XMCA 3C5VA 2NW6A 3HABA 4U2BA 3EQ9A 3PF8A 5EIHA 4UPDA 2XUQA 5DTJA 1XFDA 4CCYA 1ZD5A 5D3ZA 1TCCA 3G0IA 4Y2UA 5ALTA 4N5IX 3V1KA 1R3DA 2WTNA 4MQLA 1VZ2A 2CEKA 1BS9A 4BRZA 2DQZA 2G4LA 1VA4A 1B6GA 2I3ZA 3R41A 2Y6UA 1SCIA 3HI4A 1UKBA 3FSGA 3IUQA 2YXPX 3G02A 1CUBA 4X3CA 2Z8XA 3QM1A 1VE7A 2WUFA 3QPCA 3EF3A 2WSLA 4KAJA 1CUUA 3WL6A 5ALZA 3M82A 4X91A 1K8QA 5AKGA 3WL7A 4AN1A 1EA5A 3F96A 5ALFA 5ALHA 4OD0A 3DLTA 1XZFA 3WK5A 1DX4A 1QJ4A 4OB6A 4UHHA 3WK7A 5LZ9A 3LLCA 5CT6A 4P9NA 1XRRA 3R0VA 4G4GA 4DIUA 1LLFA 2WG0A 2XUDA 2WLSA 4FDMA 3FYUB 4AN0A 2QMQA 4QDZA 5EHXA 3PF9A 4LXIA 1W4LA 2WFZA 4FBMA 2PPLA 2OCGA 1EHYA 2BAGA 4BC0A 2I78A 1N5RA 1MX5A 3OC0A 1JJFA 2XLBA 4EBBA 5I7UA 3M81A 1UOQA 4DSZA 1XZLA 4E15A 2QXTA 1B41A 1ODCA 2JGLA 3HEAA 4FFVA 2IIVA 4XJVA 5JALA 1GPKA 2CJPA 3IURA 4H7DA 1XLVA 3ZI7A 2C5FA 5K3DA 3I6MA 5H3HA 1BEZA 1YB6A 3STVA 2J3QA 3Q0TA 4DSAA 1CUIA 1JKMA 3I2JA 4X00A 4QLOA 3D0KA 5ALGA 2GYWA 4M0FA 3G0DA 2Z5GA 2XDWA 5D3KA 5AKEA 3GA7A 3CCBA 5AKJA 4C89A 1DWPA 4JH0A 4PSCA 2DCMA 4MWSA 4DNOA 4Q3LA 4GWLA 1CV2A 3NGMA 4IHAA 1UKCA 2C5GA 3ESBA 1CUCA 2QM0A 4X94A 3QVMA 3QYJA 3IUJA 4CG3A 2X5XA 1P0IA 4B80A 4EY6A 1S8OA 4EY4A 4CCWA 2QRUA 1K63A 5HF8A 1FFEA 1GQRA 1QIDA 1THGA 4DYHA 1W1IA 4B84A 1IUNA 2VJCA 5CH8A 2VJAA 4RNCA 3CCCA 2V9ZA 5K3FB 5BV7A 2AJBA 3QPAA 1R50A 3PI6A 3EBLA 3QBJA 1JJIA 3KDAA 3FLAA 4LXHA 3RKSA 1L7RA 3G9XA 5ALPA 1HL7A 1XLUA 4FKBA 5HKAA 3WL8A 4K2AA 4ROTA 5C8VA 2K2QB 3QPDA 1EK1A 3W2TA 1O6GA 3WWPA 1E8NA 4EY8A 3W9BA 4W1PA 2H7XA 4P92A 3O0DA 3GBSA 3D2BA 2H7CA 3H2IA 2WILA 4AB1A 4YASA 3FYUA 4BE4A 1KU0A 5A7GA 1VLQA 4Y2RA 1ORVA 3FCXA 4UBIA 4BTVA 5DJ5A 4S0XA 4Y2YA 3IA2A 3BIWA 5AOAA 3H19A 1MNAA 3DKRA 3DNMA 5LYYA 1GPNA 2AJCA 5C7YA 4TGLA 2RONA 1QTRA 3GROA 2HU8A 1JU3A 2V96A 5LP1A 5AI5A 1YS2X 2YASA 2PUHA 4G9GA 1DWQA 2WHRA 4XIIA 1NU6A 3TRDA 2VSQA 1OCEA 4KRYA 5HF6A 1SCQA 2PM8A 2VT6A 4BVLA 2WIKA 1XQWA 1ZD2P 1EVQA 1Q0RA 5JARA 1EVEA 2ZYRA 1LNSA 4E14A 4RE6A 2C58A 3PICA 3G9ZA 2XB6A 1AC5A 3RK4A 2GBIA 3S8YA 4AQDA 2XMZA 5LIPA 3KWJA 4DNPA 1GT6A 5JD4A 3WJ1A 4X97A 2B61A 4BRSA 4X6UA 4MWTA 2HDWA 4J0IA 4LYDA 1E8DA 3I1YA 4HXFB 3ZV7A 1QE3A 2O7VA 3ESDA 3R3WA 4ZXFA 2XQGA 4X93A 3E1GA 4D9JA 1CUGA 4X95A 2BCEA 5FKJA 5AI9A 1JMYA 4C4ZA 1F8UA 1LPMA 4TVKA 3DCNA 4HXGA 4Y7DA 3I6YA 1EXWA 2WTMA 4UHFA 1PJAA 1TCAA 1QFMA 2PU5A 4NS4A 1QIIA 3BWXA 2VTVA 4U2FA 2G5TA 3L1HA 1W6RA 4QDOA 5FLKA 3FVTA 4G4IA 3VJLA 1GGVA 4MXDA 2OCKA 5FP0A 3IUMA 3W05A 4IH4A 2VJBA 3I2KA 3F98A 2V98A 1CUWA 5AKHA 1XZBA 3KOOA 1C7IA 5KWJA 4ZRDA 3G0GA 5EI5A 3SWWA 2RGUA 5CXXA 2DQYA 1XZIA 4CI9A 5K5EA 1MN6A 4EHBA 1VA5A 5CRIA 4NZZA 4Y2SA 4U2DA 4ETWA 2WFLA 3V1LA 1FFDA 2BGRA 1OILA 3NUZA 3RLIA 3T4UA 3H2GA 4G8BA 4H7HA 4UHDA 5AM1A 2AJ8A 4WCVA 5DWDA 1QIEA 5AKXA 2WHPB 5AI6A 4UFPA 3R3ZA 1TRHA 4PQEA 2Y2UA 5CH5A 3WYDA 4BZZA 5AI4A 2JEZA 1YA4A 2JGFA 2FJ0A 2ECFA 2C7BA 4JEIA 3Q8WA 1ZD3A 4AX4A 4QWMA 3O9VA 1ISPA 1YASA 2HU5A 1PV1A 3B3QA 1EDEA 3HXKA 1VXOA 4DNQA 4AO6A 4XWGA 2QVBA 3G0CA 4FWBA 5HCUA 2XLCA 3HYSA 4FHZA 3FLEA 5AI0A 3GZJA 2B4KA 4OPMA 1BCSA 5FPQA 5FRDA 2PSDA 3C6XA 1XLWA 3ZLVA 4BCDA 5DNWA 1MX9A 1XQVA 3WK6A 2WIGA 1U4NA 3BF7A 4X7BA 2WUEA 4J0DA 3UUEA 4CG1A 4W63A 4DGQA 3TEJA 1H2XA 2QT9A 2BKLA 4UHCA 4UFOA 3QMVA 2JF0A 5K3BA 1YAJA 1MTZA 3WQHA 2GYVA 4KE8A 1VE6A 2HRRA 5AKKA 2WG2A 3UMJA 1XRLA 5KREA 3BF8A 5AOCA 3FWHA 2GBFA 4DLNA 2XUHA 5EFZA 1Q0ZA 4H35A 1EINA 2PVSA 4C4XA 5BWBA 1HPLA 5AK6A 2G5PA 1Q83A 4B82A 5D6OA 3AINA 3F67A 4QDXA 2HA4A 5SYNA 4B9EA 4GBGA 4KACA 1CUHA 1ODSA 1UOOA 5ALXA 1ACJA 5ALYA 1U65A 2JGIA 5ALVA 4QA9A 5ALJA 4HS9A 1WB5A 1GXSA 4UBMA 4UHBA 4EA6A 1EDBA 4N8EA 3A2NA 2HM7A 1WB6A 4GEGA 5F4ZA 3WA7A 5ALDA 4KYVA 2WHPA 3GUUA 4GECA 4K6KA 4A23A 3STUA 4Q82A 1ZIYA 3DEAA 5HKBA 2Z3ZA 1TIBA 4C4YA 3AZPA 4QEKA 3VJKA 2H9YA 1E5TA 5CXUA 3AFIA 1OXMA 1DQZA 3R40A 3N2ZB 2PUJA 3SX4A 4ZV9A 1IZ7A 4W1QA 5HQ3A 2WU3A 4DMCA 2I03A 3CN9A 1VKHA 2HFJA 3PFBA 1IVYA 2XMDA 3C8DA 1XKTA 3O4JA 4C6HA 1ZI9A 5CURA 5ALWA 1WCYA 1UWCA 5A62A 5HK9A 4A16A 4X90A 4B85A 1ETHA 3PUHA 3LCRA 2XMQA 3WL5A 3D4LA 4WDQA 2ZSIA 5JAOA 1LZKA 2Q0XA 4JYPA 3WMRA 2OGZA 1YB7A 1MU0A 2HA5A 4INZA 3HJUA 5AICA 3O95A 5ALQA 3WI7A 3H2JA 4Q3KA 4Y9SA 3F9CA 2H1IA 2OCLA 3ICVA 4DMKA 5EIEA 3HZOA 2OQVA 5JIBA 2R11A 4FNGA 2WIDA 1AUOA 5ISMA 1ZOIA 4B83A 3WK8A 1MX1A 5ALIA 2JGKA 1YAHA 1EI9A 2VF2A 3AIOA 4WJLA 4G1FA 4KAAA 2OG1A 1EX9A 1E3QA 1HKHA 3L1IA 4UBOA 5K3CA 4M0EA 4J0HA 3DL4A 3H0CA 1BN6A 1HBJA 1SCKA 3V1NA 3W06A 2FUKA 3FOBA 4UBJA 1XZAA 1Y7IA 3ZWQA 4BZWA 3QH4A 4Y2XA 4AXBA 2BUCA 5KBYA 2J3DA 4UBKA 3DS8A 1C7JA 1QIMA 5CT4A 2XQKA 3UUFA 2GZRA 2XUAA 3EIOA 4IQ4A 4H7IA 2JGMA 1QIKA 2DHDA 4BVKA 1UT6A 3YASA 4J03A 4LYEA 1XQYA 5DLPA 5BOVA 2Y6VA 1MO2A 3I28A 1UK7A 5IVDA 2RAUA 5AK3A 5T4HA 4F21A 4AO8A 4MQMA 3AIMA 1H2ZA 1JU4A 5AKYA 4HXEB 5AH0A 4H0CA 2P8SA 2XUKA 5C81A 1G42A 3O4IA 1UK9A 3ANSA 3TJMA 5CW2A 4QWWA 2CUTA 2QKYA 4H7KA 1JI3A 4FNMA 4IO0A 5EHZA 4Q1VA 5ALUA 2ZSHA 4OB8A 2QUBA 5LZ7A 4B6GA 4BAUA 3I6ZA 5I9IA 1ZJ4A 3KD2A 1CQWA 1JT2A 4GI1A 2PU7A 2QOEA 3I2HA 4ARBA 1CIJA 2O7RA 1EB9A 4ZREA 1DWOA 1CPYA 3DDUA 2WG1A 4OSEA 5DNUA 1ZGCA 4J0JA 3D2AA 2XUJA 4J0CA 1P0PA 3WK9A 2JGJA 3W04A 2HA3A 1KEZA 3H04A 1RWQA 1UK8A 4AZ0A 5FV4A 4ARAA 2QS9A 1H22A 3G0BA 3F8SA 1XZKA 1GQSA 4LHEA 4CG2A 1A8QA 1EH5A 1E89A 3IDAA 2ACEA 3A2MA 3M83A 5DNVA 5AHXA 1YCDA 3LS2A 2WUDA 3PFCA 3VJMA 3D2CA 1AQLA 5LKAA 5DTIA 2JGEA 4KR0A 2QXUA 5SYMA 3AZQA 1J07A 3FYUC 3PE6A 2XQIA 4UBNA 1VOTA 4BC1A 5T4FA 2BFNA 4EUSA 4OCZA 1DT3A 4G8DA 1UK6A 4B81A 5JYCA 2ROQA 1WB4A 3OOSA 2EEPA 3U1TA 3A2LA 1TAHA 4GXNA 1LBTA 3WWOA 1IUPA 4PO3X 2D5LA 2OXEA 3DOIA 4I3FA 3AZOA 3BJRA 3T52A 5K3FA 5JAPA 1LZLA 3RARA 4XVCA 2VATA 1XZDA 3I2FA 5ALKA 3NWOA 2C0QA 4J0KA 4TPKA 1R9MA 4OU4A 1M33A 1YS1X 5AP9A 3N0TA 1UXOA 4OB7A 3A70A 1H2YA 2RHWA 3B5EA 5JANA 4HTAA 1BRTA 2JEYA 3BJMA 2OAGA 3DD5A 5AM4A 2HA7A 4W1SA 1TCBA 5DYYA 4KRXA 1CR6A 3P2MA 4FMPA 1CEXA 2GYUA 3VVLA 2XUIA 5EHQA 3WWDA 4HRYA 2HFKA 1XRPA 4WFJA 1N5MA 3C43A 1K6EA 1ZI8A 4L9AA 5JD5A 2E3JA 4J0GA 3KXPA 3DOHA 3DQZA 2PX6A 4CIBA 5JAUA 5CH3A 4DMHA 2OCIA 5ALRA 2BGNA 4L72A 1P0QA 4QDUA 4EZIA 6YASA 2Z3WA 4UUQA 1HLGA 4AZ3A 1Y7HA 1DX6A 3ANTA 4YX9A 1AMNA 4LIPD 5HZGA 3ILSA 5DYWA 4GW3A 2X76A 3WWCA 3FAKA 4BAGA 4H77A 4N8SA 3WIOA 1CUAA 1GKLA 3V1MA 4Y2VA 4CCYB 4QZVA 4RPCA 1N1MA 1WM1A 5AO9A 1SOMA 1JFRA 5A2GA 2DSNA 5LZ5A 5T4EA 4H7JA 1CUZA 2QUAA 1VJ5A 2R8BA 3H2KA 3CXUA 3E4DA 2ZJFA 4AMYA 1QIFA 3X3HA 3WWEA 5AIBA 2VA9A 1J06A 1AX9A 3MUOA 5LLSA 5IKXA 3I2IA 3R3XA 4G4JA 2CBGA 1LPAB 2XT0A 4XX1A 3B12A 1HDEA 4YPVA 5A7HA 1BU8A 1BCRA 3DYVA 1CQZA 1EB8A 4AO7A 1F0NA 4FLMA 5HF5A 2XMBA 5IVKA 1YR2A 1W76A 1XZCA 5E2IA 3R3VA 1DU4A 3S2ZA 1QIGA 2X8BA 4PNZA 1BEEA 4KEAA 4J3JA 5A71A 3LIIA 1G5FA 1EDDA 4EY5A 3HACA 1CUFA 1VZ3A 4BATA 2HA6A 3C5WP 3BXPA 1XKLA 2HA0A 5JD6A 5EGNA 3SC2A 2J4FA 2FX5A 5IVIA 4RGYA 4P08A 3KWFA 4B7ZA 5AM2A 1A88A 1FFAA 3OM8A 1ODTC 3HRHA 1H23A 5T4BA 3A6ZA 5CT9A 4PSDA 4Y2PA 4PV7A 4V2IA 2ZVDA 2OGTA 3H1AA 3QMMA 1XZHA 4U2CA 1CRLA 5CBKA 2IITA 3M3DA 4RE5A 4B0PA 4JUIA 1A7UA 4OUKX 1IMJA 2D0DA 3R3UA 3OG9A 5EHNA 3STYA 4CFSA 3C45A 1XZEA 3ZPXA 3BIXA 3O4GA 1Q84A 2CZQA 2PSEA 2GBGA 1TKRA 2J4CA 2I3DA 3K6KA 1FJ2A 4G9EA 1VXRA 4A5SA 1LPSA 1J2EA 4QE3A 2AXEA 3WIBA 2DHCA 4OU5A 4LKOA 4QLAA 4H18A 3C87A 3WKCA 2XQJA 2CKMA 3DJYA 4FBLA 1R9NA 1P0MA 2YH2A 3ESAA 3HSSA 1H2WA 3VVMA 2H7YA 4I19A 3ED1A 2OQIA 1LPOA 4DMFA 2HL6A 1QO7A 5FOQA 1LBSA 2QZPA 2QJRA 5AM3A 4ZV7A 4Q34A 4GLBA 5LZ4A 2ZYIA 4FFWA 4Y2QA 2ZYHA 2QJWA 3D59A 4ITVA 2VEOA 4WFKA 1O6FA 3KSRA 7YASA 4F0JA 4BP9A 2RHTA 1K5PA 3BDIA 4PF1A 1PFQA 2OAEA 5CMLA 1IUOA 1WHSA 5ALMA 1MAHA 1U2EA 4HAIA 3I2GA 5YASA 1IZ8A 3IB3A 3ZLUA 3G9UA 1HQDA 5EIAA 3HLKA 3STWA 1CUEA 1WPRA 3DYIA 1QFSA 3G7NA 4Z49A 2O2GA 1CUYA 4BYMA 4BAZA 3WKEA 2WHQA 5AK4A 4CIAA 3E3AA 1T4MA 2O2IA 4KE9A 4PW0A 2ZJ7A 2HRQA 4BP8A 4BBZA 2PSFA 1Y37A 2VAVA 1C4XA 2BUBA 1WOMA 3OTQA 4P93A 5FXMA 4W1RA 2ACKA 2WJ6A 4L0CA 5CT8A 2HIHA 4OYYA 5AKLA 3JW8A 5A7FA 2ZJ6A 1UKAA 3LP5A 1FFCA 2XUPA 2WJ3A 4I4CA 1D07A 5FPPA 2OPHA 1ZIXA 4C01A 2QTBA 4MYDA 1MPXA 5FDFA 5LZ8A 1CUJA 3D7RA 4X85A 1GZ7A 1ACLA 3AJAA 4HRXA 4WFIA 3ZLTA 5CT5A 3QITA 3BL8A 2JIDA 2Y1KA 2B20A 4FTWA 2XMRA 1CFJA 4W9RA 5HF9A 3WA6A 1I6WA 3VKFA 1WHTA 2WIFA 3GFFA 2ORYA 2UZ0A 3H18A 2PSHA 1E8MA 4U2EA 5K3EA 3C6YA 4OYLA 2WUGA 1ORWA 2WU4A 1LPPA 1QIHA 3BDVA 4Y2JA 3WZMA 3OURA 3WK4A 4IH9A 1CVLA 2XUFA 3EQ8A 4KE6A 5HK8A 3FLBA 2Z8ZA 3EQ7A 3JYHA 5E4YA 2GBCA 4BDTA 3RM3A 3K9BA 2EDCA 4H7EA 5DYTA 4L3WA 2GZSA 4N8DA 4E46A 4Q05A 5JZBA 1QZ3A 5JZSA 1Z68A 3H2HA 2DHEA 4K6GA 2XQFA 4KJXA 3WJ2A 5IVHA 5E4TA 4U2GA 5JAHA 4X71A 2CMFA 2VJDA 1X2EA 4BCCA 3W9UA 3O4HA 4LXGA 4BCBA 1DTEA 1FFBA 1R1DA 1R88A 4BTLA 2CB9A 4HVTA 3CN7A 3FBWA 5JADA 1A8UA 1N8SA 2HA2A 2BUAA 3STTA 1CUVA 1CUDA 1MJ5A 4GHWA
chains in the Genus database with same CATH superfamily
1DQYA 3IV7A 1FA9A 1NRWA 2AC2A 5C8XA 1P7PA 1Z35A 4MEBA 1NFFA 1PT7A 3ROXA 3OEEA 4HRVA 5K0EA 5IZ4A 1AKEA 2F3TA 1ZR2A 2DQKA 1KVTA 1QGED 5AYVA 3V8BA 5KYXB 3GDGA 1LDNA 2HH9A 3F97A 1AGYA 2QJOA 2HLPA 5CA0A 5B55A 3VAZA 3T1TA 3VR0A 3K70B 4DVJA 3K35A 4GI3A 5KWEA 3K9GA 2PBLA 4NCBA 4GX5A 1AURA 1ZIDA 2FP4A 2N1MA 3K53A 5DXJA 5GVSA 2GOYA 3T3NA 4CXMA 3HEMA 1MC4A 2QUHA 1FPMA 4IIGA 1KVSA 4OQYA 4G5RA 2A5DA 1H6AA 2HXSA 3RWMB 4MGHA 1I3OA 4C6TA 5JZVA 2ANBA 2ZGVA 1G59A 3OCJA 1GPMA 4L85A 4NENA 3M4NA 1IBMB 1DDIA 1A8SA 2ODEA 4N6OA 2EGHA 1RJEA 3IKLA 2Y0PA 2Y27A 3M4YA 4IDBA 4IJMA 4JVMA 2DSTA 4Q5IA 5CLLA 3GGGA 1BWRA 1P62B 2QY9A 3FFXA 1RU3A 5DOZA 1DAHA 1IEXA 2H54A 1YDWA 2ZT7A 5CLHA 2KBEA 5KYYA 3F3YA 3O7WA 4BQSA 2F1RA 1F6WA 3OSZA 3IE0A 3ED5A 3FVQA 1L7QA 1R4NB 1J2TA 2FE4A 4B6SA 5AVRA 4WKCA 1KOFA 1QLWA 2D13A 2IYPA 2HZBA 1N25A 4LWZA 1BJRE 5BN4B 1EGAA 5K0LA 1DJMA 2KQUA 1TE2A 2HWUA 2R6GA 1P2VA 3LOUA 4XB2A 2RCYA 2YNMA 4X20A 3SQLA 1HWYA 1GDTA 3WLPA 1BFUA 4IIUA 2IPNA 3UCEA 1QWSA 2NXWA 4Q15A 1KSJA 4NY1A 4R83A 4YJ3B 4FI3F 4LF6B 4G25A 1SIUA 2X9QA 1X1TA 1H42A 1D0SA 4J29A 1W8DA 3GCDA 5FQOA 1U3TA 3E3NA 2ESRA 1E6UA 5J5VA 1F60A 4DUPA 4B5KA 1I10A 2DE0X 2VXBA 5I45A 1L5MA 2IVZA 3ANXA 5J58A 4EG5A 1D2HA 2Y4OA 1Q6ZA 4N01A 2VPZA 3O91A 4E5VA 5K6AA 1QS0A 4QGBA 5ALLA 3UIEA 1WW8A 4YCDA 1XN4A 1CX9B 3F6SA 1JQKA 5CK4A 2UUBB 1PFYA 4H6PA 1CLUA 4RA6B 3AR6A 4QGGA 3V2GA 1V37A 4ZGBA 2H18A 3QNMA 2YJNA 2LKCA 3FDZA 3EPHA 3PJFA 2OGSA 5E4JA 4ZEXA 1E59A 4HBZA 3DZIA 4JWKA 4IIBA 5T41A 3S28A 3A9SA 1TJ3A 3L8CA 3LY5A 3H9BA 3HCWA 2O8BA 3TLBA 2OHJA 5EXEA 2V7BA 1VG1A 1YL7A 2AJDA 3REOA 2WF6A 1SIWA 4L6CA 1PWEA 4MJ3A 5HGJA 1SFRA 3NIFB 4QQ8A 2YXNA 10MHA 4N3AA 3LRPA 1NBWB 3MT0A 1AZLA 3BGOS 3MOGA 4M53A 4UEOA 5DNAA 2XBLA 3WNDA 2XBMA 5KYUB 4QSMA 3ITKA 3EN0A 3ZUGA 4B6RA 1K06A 1YZQA 2R8YA 5K4HA 4KTTE 3AR8A 3CWZA 1DJNA 1LK5A 1MQ8B 4BNFA 2XE4A 1IK4A 3O9MA 4M1KA 2QX8A 5FTJA 1C9JA 2JA1A 4WNCA 3U7QB 1CUSA 2HCJB 5CHYA 3ZBPA 3T15A 1JHOA 3JX9A 3DD1A 4BVAA 2QR5A 3PXGA 2B94A 1YACA 2VP6A 4ILKA 1P1HA 5DGHA 2BJVA 2O2HA 1YC5A 4OXKA 1W0JA 5L6LB 3GJ6A 3PQ5A 4O4HA 3ZIDA 2PGOA 5L3VA 5LQJA 4JV5B 1Z4OA 3PEYA 1BCSB 3H7IA 1GTJ1 3EXEA 1CF4A 2D3WA 1UJ5A 2O1XA 1FYXA 3GFPA 4UREA 5BNWA 4F91B 2H07A 2WFMA 1Y8QB 4BX2A 2KBFA 1M2EA 4YMUA 1LBIA 3IL2A 1R8SA 2VZ0A 5ES3A 4NESA 3UCXA 1XQXA 1W52X 5IVPA 2ZWIA 1SBHA 4OBBA 2XD4A 2B1GA 1CQJA 2XODA 2H5IA 2PA0A 5A0TA 4JIGA 2WI8A 4R98A 4PWZA 2BJHA 3A6LA 2H1FA 1KJJA 5A6VA 2XECA 1YZKA 4KQHA 3A3OA 3WNVA 3MWFA 5DXAA 4LBVA 2P0AA 2GVNA 3D31A 1QO0D 3G79A 4GMHA 5COBA 4WA7A 3ES9A 3IEXA 4CUJA 3NBMA 2VDKB 4RA9B 4PSVA 1FFGA 1QX3A 5BWCA 1QB8A 2Y93A 1ZN9A 3G2OA 4BKUA 1UZAA 5HBGA 1JLMA 1REQB 1WPXA 3EEOA 3VVCA 1HT2E 1HY3A 1O5OA 1R5JA 1XK6A 3BMXA 3KPUA 3VYWA 3BK2A 3H2SA 3MG9A 1DMRA 2B21A 3GGOA 3WMWA 2VYVD 1OH6A 3LUCA 4D8WA 1BE1A 4U6SA 2VUHB 3CPJB 2I65A 1RVDA 3ZCQA 1ESDA 4LF8B 1DRWA 1XZMA 2A0XA 3W6ZA 3MT7A 1PL8A 2G63A 4G36A 3H11B 1NNI1 3AHDA 5KDDA 1WOYA 3EQ6A 4G0MA 3N86A 1R12A 4RMIA 3D54D 4YQZA 1P1FA 2BC9A 5JBNA 2GS9A 1P3Y1 2I2AA 2JFVA 2C3PA 2XYPA 3EWSA 4LVOA 3RFCA 5IXJA 3E9EA 3RC8A 5LKRA 1V5GA 5DKFA 1FNBA 3AUKA 3D5EA 1GLVA 2R48A 1NY5A 4XRGA 1L5VA 3PJRA 3JQ7B 3DL7A 3EFHA 5D8DA 2IU0A 3NMUF 1E1DA 3RSGA 1NNEA 4Z9XA 5H7XA 2QAGA 4JS0A 1GPLA 3RSZA 1UDAA 2ON6A 3VPFA 4BEBA 5CAEA 4FM9A 4ZK6A 4QU0A 2P0EA 1HSZA 1Q19A 1R0YA 2IX9A 3KJGA 4WUVA 3GNTA 4TT3D 4I5GA 4DV1B 4LOHA 4E94A 2WKRA 2Z3VA 2PGJA 1T1RA 1UIMA 2Q4RA 4BNTA 3DUFA 3OUZA 3M5WA 4NBTA 4DTCA 4UOEA 8MHTA 1W5FA 3PHCA 3OZFA 3UTDA 5GV7A 3DMNA 2IOYA 3N07A 1TA9A 2I66A 1SIBE 2GM4A 2NZWA 1KGDA 3WGIA 2HMYB 3HR4A 2JHGA 2WWRA 3MRSA 3B1WA 4H16A 2AEMA 4BFYA 3HU5A 4H1WA 3ZDEA 4RD4A 5LJLA 3OA2A 4RD2A 3SGLA 1ZCZA 1COWD 4WOKA 5FX2A 2RD2A 1ZJ5A 1H93A 3DDZX 3OZCA 3QOYA 3N5KA 1P7CA 5G3ZA 3F6PA 4ZVNA 5IF3A 5T57A 5AK5A 5HS6A 4F2GA 3HNOA 2G06A 5HIAA 5BPHA 1SVUA 5KSOA 1L1EA 5HCNA 4R9SA 4AT1A 4OOEA 2AXPA 1VQ1A 4J1TC 2PLWA 3QVGB 2JATA 4NCNA 4BGEA 1DJQA 1LDBA 3AK4A 3WKDA 2G7ZA 2ATCA 5COQA 2WKSA 4Q3DA 4E70A 4JYMA 4WCDA 3TOVA 2IDZA 4O4JB 3WQRA 5JG7A 2VT7A 1ENYA 2Z2XA 3RHFA 5HQ3B 1RXVA 1DINA 2WJJA 3W7VA 2D00A 3OA0A 5IH3A 3HA3A 5FHQA 4B43A 4G5SA 3ZD6A 2M2IA 5C0OE 4FLFA 1Z7WA 1P1JA 4I7EA 5BYBA 3LQ4A 4KQIA 1TRKA 3R7LA 2W2VA 2BP7B 4EI2A 5KU1A 2ZJ8A 4EZEA 4R71A 1VB3A 2YZ2A 4NMLA 3KDPA 1YO6A 3T3MB 3G85A 2G25A 4B0OA 4YLEA 3F1KA 4OGLA 1L4YA 2VQEB 2DPYA 4FB5A 2JD1A 2R6ZA 1LRLA 4WNIA 5ITWA 2ZI6A 5GJBA 1R0KA 3R3JA 3CNNA 3R3YA 4I9GA 5MGBA 1LW6E 1D1QA 3GCZA 4E6PA 5FH9A 3E1SA 4MIEA 1NN1A 4RVDA 2A1UA 3K1TA 3PUJA 2VK2A 5TPZA 4ER6A 5F9HA 1RRFA 2XJ4A 3FETA 2VWHA 3BE5A 4FX2A 1QONA 1YR9A 2IUTA 1X7WA 3D4PA 3NKFA 1W1WA 4K6MA 5AM5A 3DMTC 2FSPA 1G18A 1T8YA 1DRKA 1U8UA 3EIQA 2ODTX 4MKZA 4YQEA 4CKWA 5IZCA 2EFYA 3UKJA 2IUSA 5JR3A 3OLCX 1FU4A 4LOLA 1FF9A 2EV9A 2WZCA 2M6SA 2X0KA 2EF0A 2Z8YM 4OHZA 1KR5A 5IJZA 3QZUA 1VPVA 1X3SA 3JRNA 3ZOKA 1YSCA 2G6BA 2VA8A 4Q4HA 4AY2A 4D8TA 1TU4A 2FW8A 3ON5A 4ITUA 1USGA 2PXAA 4FEAA 4LSZA 4ZO8A 1L7DA 2EP7A 3GLGB 3WJAA 4WN9B 4F97A 1ZR4A 5C7LO 3LTEA 1KH2A 2IBTA 2QTAA 4YRJA 5LUAA 4C87A 2QHXA 1IQUA 4LTNA 5GPBA 3WQQA 1G19A 1CSEE 4B7UA 2QRNA 3PXXA 4PHHA 1H2FA 3G7UA 3HDJA 3D6NB 4D57A 1ZXXA 5JOQA 2Y1GA 3S40A 1JMKC 4UTNA 3PR3A 4E11A 1BD4A 4YRMA 3HCBA 3I8SA 4IGAA 1H6CA 1HI9A 1QAOA 2DPLA 2VF4X 2Y2VA 2FN4A 3NIWA 3IODA 4MLDA 4K6HA 2ABWA 1MTOA 1KE1A 3REGA 2ISSD 2WKWA 3UWPA 4RWZA 3W5HA 5AD1A 3L6EA 3G2QA 1M8GA 4DNFA 5DF1A 1EVLA 4X1YA 3CSDA 3GD7A 4DMMA 4EG1A 4E30A 2NZVG 3AOEC 3LUJA 2XNJA 3QU4A 1R6UA 2XNHA 1KQ3A 3VH4A 2WVJA 4J7UA 1ISFA 3TR5A 2YWXA 1L1FA 4COKA 3P2YA 3UATA 4B3JA 2RJNA 5GM1A 1SG9A 1U8EA 2H5JA 1EQAA 2IP4A 3WKAA 4QTYA 3L7NA 5B1DA 1M1YE 1KXZA 2GXAA 4DILA 4XWTA 2V3VA 3CURA 4U7DA 3ROQA 4GQIA 5JFOA 3THOA 1GO2A 1JQDA 5I8PA 2B6HA 4RZHA 1OZGA 1QTIA 1V2GA 5BT8A 1G6HA 2VWQA 4MCHA 3JAWA 1FS4A 3C5VA 2EBWA 2NW6A 1ZXLA 3PQFA 3HABA 1T6XA 2R751 2RHJA 3HVIA 4RW0A 3VGPA 3M49A 1Y9JA 1GVHA 4H2DA 4R8KA 3QHPA 4HQ6A 3A2KA 1EJBA 1W59A 2ODPA 2IIPA 4D3YA 2PJRA 3L0YA 3VQTA 1EUQA 1KAGA 1XFDA 3HI6A 3SHWA 3HYRA 3PGA1 4AW9A 4CCYA 4FFRA 2B9EA 2ATVA 3G0IA 4Y2UA 3HUTA 3ZCXA 2E0IA 1KMIY 1QHGA 2OXRA 2QRVA 3DFIA 4HUJA 2WTNA 4MQLA 5BSGA 2UZ4A 3EULA 3LGXA 4IDPA 2CEKA 3GVXA 4W7IA 3ZY4A 1N92A 1N0VC 4BRZA 4N54A 1RW4A 3RSQA 1RXYA 4LS3A 4EYSA 3HUFA 5BR4A 2HT1A 1XYGA 4LISA 3FHLA 1VA4A 3FKSA 2VAWA 3HZZA 1Y3BE 2WSSA 4RBNA 1PV2A 3UUWA 4ZHQF 2QJFA 3LY7A 1PZEA 4RADA 1RSZA 3R41A 3BRQA 1AK9A 1SCIA 2AI3A 5NULA 3FSGA 7AT1A 2C98A 3ECCA 3IUQA 1DXYA 4PGAA 2HBRA 5A2QA 1J70A 1QVVA 1QANA 2LE0A 3R7SA 3VPHA 2Z8XA 4XASA 3JQ9C 4L2IA 3TN7A 2Z8YA 4D9BA 1B6TA 4BNJA 3PWTA 3O6VA 1JJVA 2JFUA 4N18A 4YJHA 3PUVA 3ZBQA 3PKJA 3WNBA 4D5GA 5IM4F 4HPJB 1I9GA 3U9SA 4O2RA 1T5SA 3FUVA 4KQ2A 2PUCA 1BKYA 2GRUA 4DDKA 5HXAA 3OOWA 1Y7PA 5BW5A 3IP5A 2ODAA 1OWOA 3M82A 4DE5A 2QF7A 5EP1A 1E2BA 1ML4A 2AB0A 3AFMA 2BM1A 3DZBA 3GCWA 3JQ6A 4HLUA 2Y4NA 1A5SB 2RC6A 3S2EA 1D0VA 4DM3A 2WZQA 3AL3A 1BDBA 1H3FA 3LYLA 1JQAA 2C3MA 2GT1A 3ROTA 3SZUA 3VNVA 2CVOA 4OV6B 3MYRA 3PWSA 3UMYA 1U9JA 4CL0A 2ONJA 3M1IA 2C8LA 1T34A 3QLVA 5G40A 1M8KA 3GFTA 3L2OB 4BV8A 3DFKA 1KNXA 1E4EB 1FNNA 3F96A 3NYWA 4CTJA 3IFSA 1BA2A 2O2SA 2C2BA 3QVVA 3DLTA 4JUBA 1F51E 1GCOA 3B1VA 2J85A 2QMHA 2OVFA 2ZYUX 3OM0A 1JDZA 4LVCA 1KC3A 5M5BA 1TTQB 3FHJA 2Q2OA 3T35A 1NF9A 1Q17A 1I1QB 2FDXA 3H3JA 3ROMA 1W30A 4IZOA 2BFMA 5ELMA 3ZZ1A 4PCUA 1SKYE 3SS8A 3VPBA 2CCGA 1XCGB 3QTBA 4Q21A 5CT6A 4P9NA 3IVRA 3RS0A 2H85A 3SQNA 4HXYA 4G4GA 1UMCA 2A8YA 1DARA 2WMOB 5KTNA 3P2JA 2ST1A 3DE3X 1LLFA 3FM9A 2WG0A 5K8JB 2I7DA 4EPVA 5EQDA 1GG2A 5J5AA 2Q1SA 3NTVA 3Q5GA 1PUJA 4FDMA 1SC6A 2MJLA 5E8JA 5LQCA 1RAFA 2QMQA 4LXQA 3WLSA 2I9KA 4QDZA 5EHXA 3NONA 1KZ6A 3BFKA 4LXIA 2CE2X 1OGJA 13PKA 4JI4B 3VAYA 1QVZA 1DB3A 1DFGA 2O4UX 3EIUA 3WS7A 3CVXA 4WCFC 1J00A 5D3QA 2INGX 2A14A 1ZM9A 3IKMB 3QUSA 1BYIA 4R51A 4R81A 1GHTA 2J0SA 1MX5A 5ADWA 2HRZA 1QLJA 1O5IA 4RJKA 3LKBA 4U2KA 2RGCA 5K09A 1UC9A 1KRHA 2ZULA 2P2NA 2DLDA 2DBZA 4E51A 3HKEA 1KMHA 4M4SA 3RUAA 4A2WA 1GQOA 1UOQA 5FTKA 3E03A 1XZLA 4DSZA 5JDCC 4F1KA 2P35A 1NW8A 1G38A 1L8QA 4I6EA 4DR3B 3AY0A 4YCJA 4FZJA 4XM2A 4AZ0B 3CWCA 3LFUA 4RZXA 4UQOA 4RJ2A 1XDDA 1FX0B 4KYUA 4INOA 4BN4A 2IXFA 4MYUA 2FLWA 3ZGYA 1G5HA 1Z8HA 1JKIA 4QRDA 4XJVA 4I66A 1OWLA 5JALA 3FVWA 3O4VA 2HUNA 3H6KA 4INJA 1DC8A 4JI5B 3HDVA 4J8PA 1J99A 5GOTA 2ZBQA 3Q3CA 1L5YA 2P4EA 1KI7A 1XQ9A 3BXHA 3N7UA 2QVLA 1Z0FA 1Q7EA 2KJQA 2VPIA 3KELA 4PNPA 5I9TA 3OKFA 5JE8A 3CJQA 4RD3A 1KMCA 5ERXA 1JT9A 1E1YA 1JW9B 3AYXB 5K0JA 4L28A 4X00A 3NRCA 1X15A 5ALGA 2GXUA 3ZCRA 1ZK3A 3FTFA 1QV9A 3VTAA 3PRJA 5A0VA 4K87A 2V7EA 4OREX 1F3LA 3S2YA 3UXYA 3CCBA 3MD0A 4B4UA 4AKIA 3AB3A 3GRPA 2PX4A 3Q3HA 1JXMA 2GTIA 3DLCA 1QHSA 4HVAA 4DNOA 3U44B 1KAOA 5JQWA 1JFTA 1DBRA 1MGOA 4WERA 4YQYA 4ZQIA 1CV2A 2I4OA 2V0NA 2WK1A 3WB2A 2JBHA 2XXAA 1J20A 1FFXA 1BMDA 3AEKA 1CUCA 1Z8NA 2EZ8A 4HGOA 3DBRA 1QNFA 1YCGA 4XGRA 4TOIA 5C3UA 4CM4A 5FHRA 2IZZA 2J0EA 3IDQA 1JU9A 4O2BA 4CEIB 1Q44A 4V1CI 2NPIA 3CE6A 3GB9A 2ZI3A 1YV9A 1T9BA 5IN4A 3FH0A 3HDYA 3LNCA 4OHWA 4RU1A 1XPJA 3IR5A 2XCTB 2YIMA 2IHYA 4FCWA 4B3CA 5CFNA 5IXSA 4MKXA 4I36A 4LVNA 3GLVA 4M9CA 1FFEA 1GQRA 1QIDA 3U3DA 4IHJF 5AQ1A 5AVKA 5A9RA 1CQIA 5G1OA 3VSCA 1NMXA 2FF5A 2RK4A 3ZU5A 4B79A 3PLNA 3TD9A 1Z5ZA 2V9ZA 3OPQA 4C20A 2L2QA 2QYOA 1R50A 3JVEA 4TLMB 1P74A 2NU6B 1JJIA 1O96A 3EBLA 3QBJA 4CMJA 1E5XA 1AF4A 1U9IA 1UZUA 3FLAA 3LVFO 4Z86A 2H57A 3RIGA 4C05A 3HPQA 3TL3A 4CDMA 4YAUA 2R68A 4GUDA 4FJ0A 1HL7A 3M1LA 4EK9A 5K01A 1HSOA 2Z9DA 3FRIA 4DLSA 3BSWA 4MYCA 1AK2A 3TDKA 4YXFA 1SOUA 4K2AA 4L75A 4ALJA 2IZ7A 5KNBH 3PNBA 1EJ2A 4IF4A 1JLSA 1WU7A 1NBEA 4HUTA 2W7TA 1RM0A 5LYJA 1JR3D 3E9ZA 1RBYA 1MFZA 5EUBA 3SP1A 2QW0X 3RJZA 3VNAA 5F23A 4HGNA 4FGWA 1K75A 1O6GA 1E8NA 1SURA 1ZM7A 2HCBA 4ID3A 4XGIA 4EY8A 3QSGA 3NOQA 3C39A 2O50A 3QWHA 4NCXA 1ZU4A 4W1PA 3K5WA 3O0DA 1YF3A 1PNTA 3OO0A 3ZU6A 1VPDA 2BEWA 4P98A 1WZ2A 1R4AA 3R5FA 5K1ZA 3MGKA 1I36A 3OQ6A 2GFIA 4TQ9A 1ABEA 1O0SA 5EZ6B 3ZQKA 3RC9A 5JT1A 5K0CA 1EZ1A 1S3GA 1SBIA 3TDMA 4CM6A 4IG9A 4WHMA 3M5CA 3TIGA 1GNSA 4BE4A 1PS9A 5LOVB 2WNHA 3FTEA 4INAA 3WMFA 4UTZA 1X74A 2OA0A 2ZUDA 3HCFA 2FLVA 3OQIA 3UXEA 1CNFA 1E94E 1VLQA 1NJ6A 1UKVY 2IL1A 2REXB 4NYIQ 2HMWA 2SCUA 5SZJA 5CD1A 5LXTB 1MEOA 2FQXA 2G28A 2JARA 3LY8A 2DWPA 3FTDA 2C8JA 3GAAA 3GUCA 3P26A 1WXIA 5D3MA 2PMCA 4TZ6A 1F6DA 5DE3A 2O07A 3WLJA 1J8FA 4DIOA 1K9VF 4LJ8A 2FB9A 2NTVA 1RRMA 3QVUA 3IA2A 2JGNA 3DDWA 2G1PA 4ES6A 1RQLA 3NWJA 2XRFA 5GAJA 4K6OA 4U6NA 1D5WA 1L7OA 2HOQA 2QUIA 3ZCPA 4RXTA 3DKRA 5I9NA 1J25A 1DJLA 4CL3A 4D7AA 3U4CA 1GPNA 1I5EA 1NF3A 2NV2B 1AGNA 4TXHA 2VP4A 3D1JA 3EAQA 1IHXA 4ONEA 3E35A 1O87A 1NUQA 1PNOA 2RH9B 2VP0A 1JU3A 2P6PA 3AJDA 3AF0A 3BJZA 3IP6A 4U0JA 3LRTA 5T3UA 2VNAA 4QG3A 3HP7A 5KNBD 5LP1A 5J2TA 5AI5A 5EP2A 2HSDA 5ITZA 1FVXA 4AYWA 2FZEA 3QI2A 4XIIA 2WHRA 1FW8A 2FH5B 4C4RA 4N5DA 1NU6A 3TRDA 3VHRA 1NMQA 2VDVE 3INNA 5HA5A 2RHCA 1OCEA 1MPTA 2JI8A 3X2FA 4LK2A 1EUCB 3AONB 2PGNA 4HFRA 5HF6A 3ABOB 1MEJA 3BJEA 4XR9A 4GWKA 4XXHA 5U1PA 4MUHA 3UJ8A 3B53X 3T5DA 3W8DA 1ECJA 1PW7A 1YCHA 4FI3C 2C94A 2WIKA 3PGKA 4W8HA 2O0JA 4BMSA 3RVMA 1R6XA 3TW8B 4LTMA 1JQJC 2V7GA 4TWJA 3V8NA 2O8DB 1C30A 3BDAA 3COVA 3KV3O 2C58A 3PICA 3QWBA 4ENUA 4EI8A 5BRAA 3ZKWB 1YD7A 1BU5A 5JNWA 2HI0A 3MS2A 3PP8A 2DOKA 1BOOA 3ETNA 4FR0A 3VU8A 2Q8QA 3HY4A 4GE0A 4NV1A 1X9HA 4TMZA 2O6LA 3ZVRA 3UKOA 3DZJA 3P9IA 4O8CA 2HZ7A 4XGNA 1F2UA 2BGJA 3S55A 4OQNA 3BZWA 3E2IA 1J24A 4WVFA 2JD2A 4KX3A 5C4MA 3KWJA 5EMHA 2JW5A 4I1YA 2VHYA 4WFQA 3WJ1A 4L9RA 4Q37A 4X7MA 4BO3A 4YMHA 4L6IA 2HDWA 3NGLA 4I14A 2GHTA 2OL4A 2IH2A 2JAPA 2Y1DA 3CEMA 1HQKA 2Q50A 4DCCA 3MXOA 4RK7A 2K87A 2X58A 3K32A 3SKYA 2ETXA 1QE3A 4R3WA 3PTAA 4IXWA 1QE5A 2JFOA 3R3WA 1UJBA 5C32A 221PA 3I9LA 2XWBF 3NKLA 4IMIB 4JEHA 3WFZA 3OLWA 1IQPA 4X93A 4BNGA 4D9JA 3FDIA 4W5OA 5DB4A 4X95A 1AY0A 3QOXA 2E4WA 1EM6A 2XGMA 3BWMA 4FQ7A 3DPUA 1N8KA 1YR3A 1M8PA 3G89A 1YQWA 1LFDB 4LYYA 1O2DA 3RSLA 3S1LA 4FEGA 2XNCA 1FL9A 3EZLA 1P45A 2X7JA 1E1KA 1ZISA 3QNWA 4HXGA 4G84A 1X8KA 3BORA 4KO8A 3ZGVA 1BXZA 1ADGA 4XH9B 5T67A 1BJKA 3H4MA 1Z73A 4S3MA 2AOUA 1LBHA 1MABB 3ICEA 1YB1A 3LDAA 4P4UA 3P0IA 4FKMA 3I6YA 1EXWA 3AR3A 3KJXA 5CD9A 4E4RA 3B60A 4K7JA 2H7VA 2AG1A 2OUIA 1GUYA 4EMTA 4FXPA 2OMKA 3H87A 3Q98A 4FGZA 1FLAA 1KPIA 4C0JA 3PDIA 3VDMA 1QIIA 3TAUA 2VTVA 4PO9A 3JQBC 2IYOA 3N8NA 2I34A 1K2WA 3JS5A 2O59A 1UBJS 5JYDA 4C3ZA 4ZMSA 5E6RA 5F1OA 3F47A 1Q57A 1NVAA 1W6RA 3OFSA 4Q12A 2CNOA 5FI1B 5TR9A 1X80B 2B5VA 4MQFA 3JD2A 3QVJA 1Z3IX 2B78A 2HJWA 2QQEA 4TQAA 1H6DA 1GGVA 3VJLA 1GPH1 2F3QA 3K0FA 4MR9A 2OCKA 2FFBA 3B6IA 3A3PA 3O1JC 4L5CA 4DS3A 1J4AA 1KVUA 3W05A 5BNTA 4J49A 2GWRA 2PZBA 4O33A 4WOPA 3QF4A 4YP7A 2V98A 1WUKS 4XPIA 1MIOB 5AKHA 3W4IA 1VJ1A 1XZBA 3L0BA 1R3UA 2W0MA 3PTLA 4TV8B 4A5OA 1E9DA 4CQMD 4ZRDA 3G0GA 821PA 4C78A 3IILA 3RE1A 4E4TA 5EI5A 1E2KA 3QY9A 2GCGA 4U6QA 2J41A 1EYZA 2I22A 3MRXA 2AX3A 1LH0A 1K5GA 3KXIA 5KYVA 4BMZA 3LUFA 4FXOA 4UXJA 2DERA 2RGUA 4WESB 4YJ2F 5T3YA 1SR8A 2OZEA 1XZIA 2PGDA 1EVZA 1NNLA 5F1YA 1FFWA 1JILA 4RJIA 1H2HA 1QYIA 4IJKA 3S5UA 3USZA 3OX4A 4DBZA 7GPBA 1J33A 1U63A 1XMVA 2CBXA 4HYYA 3O82A 2DGDA 3F90A 2Q5FA 3UO8B 4BFUA 4EHBA 1VA5A 3CZ4A 4X64B 4IM7A 2V1XA 2AHRA 1A9QA 4II7A 4DEVA 4F3NA 3K6SB 2IS4A 5CG1A 1E6LA 3IHKA 3Q10A 1ZN8A 2NV0A 4MW4A 4ETWA 3IQZA 5FF9A 2CVHA 2I7TA 1SXJC 1J9ZA 4QYMA 1PR2A 5JYEA 2YKGA 3CQ9A 3NUZA 3OQMA 1RJGA 2CKDA 4OLAA 3L0OA 3T4UA 3H2GA 1TA4A 3FZNA 3KEOA 4WASA 1QFJA 2XOXA 5DHAA 5DK4A 3ANNA 3I92A 5AM1A 3VM6A 3HK2A 2G9VA 5DWDA 5LVAA 2M98A 3A6GA 4GE3A 2PFGA 1SK9A 3G8BA 3O8QA 4FHEA 2G1UA 2I4NA 1V5FA 2KLBA 5IEJA 4MS1A 4RVNA 1R4MB 5ECGC 3R0JA 2N1BA 2KPOA 4RKYA 3TQIA 4OQQA 3QXXA 2DM6A 1PR5A 2C88A 4UFPA 3AUTA 1EGVB 5DHQA 2GRJA 1MDFA 1N3IA 3CLTC 5CH5A 4BV9A 3UG6A 2KHZA 5AI4A 1ZOLA 5IDYA 2QIOA 1KF0A 5AVUA 3VJRA 3WSVA 4IJ5A 2YXBA 1XDSA 4U7JA 3RYHA 2JFGA 4TROA 1S7CA 3R76A 4ZODA 4HDRB 3UJCA 4BLPA 5I9MA 2PEZA 4FMCF 4DA8A 2XCUA 2BIFA 1GZSA 1KMMA 2ECFA 3F4KA 3WGVA 2C7BA 1GCGA 2WABA 3PEUA 3ESZA 4BLOA 2JAQA 4OVKA 1DXQA 2ZATA 3A0UA 4TLBA 2UDPA 3WGZA 5JCZA 3E7WA 4G23A 2BTQA 3RSHA 2X0FA 1YASA 3JATA 1R27A 2HU5A 3IAAA 3KTDA 1SBTA 3S1AA 3L1KA 1UQRA 1QYRA 4XWKA 1EFAA 4E5YA 4OQMA 1V6SA 3RC2A 2AW5A 3C8ZA 4OUDB 3IT1A 2YJ4A 4NI5A 3RT7A 2JZOA 1TPZA 2ZW9A 2HX1A 2Q07A 2V4UA 2H1SA 1EK5A 2QI9F 3SE0A 3N0XA 1IJKA 1X13A 4E3ZA 5JZMA 1X77A 3AKYA 2VN8A 1CE8A 2FZLA 4YRNA 4D46A 2NU8A 3L41A 2OFWA 3DF9A 5JCJD 3L9WA 4PLVA 1WBDA 2AZDA 4OHXA 3TJZA 3TMKA 1OJLA 1E77A 1U2SA 2WC1A 4PNHA 2RHOA 3DW1X 3NORA 1A7AA 1G8KA 2VIIA 5F4BA 3UGTA 1PD0A 3LXMA 3RVLA 3PQ8A 5AI0A 2X42A 1GZ3A 3KZ1E 3SCZA 1XF9A 2ZWAA 3JD3A 2Y9PB 5FPQA 4FCVA 4PSAA 2QP9X 3MT8A 4QJ5A 3UVEA 1ZA2A 2IHJA 2PSDA 1A9ZA 2IW1A 1C3EA 3BGWA 4NJEB 1ZH0A 2JDID 2FKAA 4QBGB 8GPBA 1PLJA 3CJTA 2J30A 1KMQA 2DUWA 2GEVA 4MP6A 3ROZA 4CLRB 3GARA 1SVIA 1MX9A 2QNBA 3PQEA 4MB2A 3L7YA 3RQSA 3C1UA 5ESXA 4JD5A 3BTOA 4MVJG 1KEWA 2X0DA 1S8AA 4EYOA 3BF7A 5ELXA 1DV1A 4MUKA 4MRSA 2R1ZA 4KYIB 4Z4GA 2OC9A 4CG1A 1KH1A 1NQ5A 1TO6A 3TK1A 2VKTA 3V55A 2NSJA 2DEUA 4BBJA 3ZE6A 4DGQA 4L4YA 2I91A 2XADA 2R2AA 1DTWB 1SY7A 4KLCA 2TRSB 1N36B 2Q21A 4KPUB 4UAUA 3MB5A 4ZAGA 4UFOA 1G64A 2P3LA 3ZBTA 4HB2A 1SM4A 4HGRA 4DLYA 5D1HA 5FWYB 2BKAA 3T7AA 1AKVA 5K3BA 4EB8A 5GZ1A 1M34E 2W6PA 3EFEA 3K0AA 3HBFA 1IVNA 3T7RA 1NVFA 3R7FA 4ME6A 2EJVA 5K7SA 1H94A 2WEKA 4X1OA 4F4UA 3FN4A 4BV3A 3ZJUA 1E58A 1A1SA 3GNLA 3Q2OA 1LJUA 3OLXA 3QYFA 4U9HS 4CU5A 3F6EX 3K72B 2QJTA 4Q03A 3LCUA 3HXTA 2GBFA 3K9QO 2QRLA 4Y6LA 5FTNA 3VR1A 3AW9A 5EFZA 4X45A 4JX9A 4M1YA 1XZQA 4H35A 4V0QA 2Q41A 3NI2A 3MCTA 2FFJA 5CNKA 3TRKA 1J2RA 2IJGX 1ZCFA 1HPLA 4KPEC 1RC1A 2WD7A 3O93A 2YQ4A 4PHCA 3LPDA 2ZJYA 3QF7A 1N9GA 4EEZA 5J43A 3AUXA 2P6UA 3RTGA 2ZSJA 4GPAA 5D6OA 3L40A 4LBZA 4MGKR 4CKEA 4LDZA 4RTKA 1NYTA 4MVXA 2YRWA 3F67A 4QDXA 5SYNA 3IELA 4KACA 4V1CA 2P77A 5GONF 1ODSA 2PNJA 2TMDA 3JASB 5ALYA 5JY6A 1KTVA 3V6LA 2JGIA 2YZ7A 1XD2A 4LHWA 3VNSA 5GP1A 4FPXA 1QBKC 2XVXA 4EG3A 4UHBA 1Q3HA 1RAHA 3BCRA 2RBEA 5DHFA 4ZHSA 1VMIA 1J1UA 3TR6A 2PH7A 3H0KA 1NP7A 1ORIA 4RFSB 1WB6A 2GCOA 3L6UA 1F1BA 5HBRA 3SEQA 3T1HB 3EVFA 4LMRA 4U00A 2F9FA 3BERA 3O74A 3UPDA 3L4KA 1MO5A 1RBZA 2WHPA 2O20A 2VAPA 1J7JA 3HQ4O 2FUG1 2FPRA 1JA1A 2H00A 5E8RA 5C4IA 3GUUA 3L8ZA 4TM8A 4M49A 5JH7F 2DTEA 2QWXA 1HDOA 3QKRA 4K6KA 5FAXA 2XMPA 3IMCA 4G01B 1PN3A 2V03A 1L8XA 1MD9A 1V71A 2HV9A 3N6RA 4ZT3A 5JVDF 5K8TA 4C76A 5HKBA 2XIJA 4OLJA 4ALNA 5JSKA 3W0LB 3AZPA 3MOSA 4LC0A 4FX5A 2QG9A 3EW9A 3S8EA 5JJLA 4PR0A 2SECE 4RTSA 1GSIA 3JWIA 2H9YA 3VJKA 4EUEA 2IYXA 2A0UA 4Y6QA 2PS0A 5AVOA 3HS3A 5BV1A 3J80A 1GFIA 5KIAA 1WCIB 4N0DA 1DQZA 4FT2A 1DHTA 4P0TA 1EFVB 1G5RA 2JZCA 3R40A 4FYYA 4NU5A 4AC9A 4B7CA 1N77A 2FNAA 4GLFA 5HG0A 4CQMB 1QWOA 2HPZA 3FY4A 4ZV9A 3RS2A 4IFEA 4IOLA 4QUKA 4YTEA 1Y48E 5AJVB 5CDUA 3SVLA 3CMMA 3CN9A 1VKHA 1YRYE 3LK7A 4Z51A 2XMDA 3HNRA 4P83A 1TVKA 1P4SA 2H2GA 1DJOA 1GNQA 1JDUA 1MOQA 2ZJ4A 4PX5A 5MGNA 5E3JA 1S8FA 2GZHA 5M34A 5DGXA 2ECOA 1D2AA 1VL1A 1QYWA 2QPOA 4B3GA 4X1KB 3E3OA 1ULUA 4HNVA 2ZSUA 3GEMA 4JJKA 3ZHYA 3WGMA 1QZUA 1AGXA 2FXIA 2IXEA 4LC1A 1TADA 4U7WA 1OWNA 3JQCA 3GLIB 1P9NA 2C7GA 3O21A 4IJQA 5KYTA 1ZP6A 5KAPA 1H85A 4YV1A 4G5GA 1QF6A 1V1RB 1VLMA 3FMFA 2J9GA 2XMQA 3PKZA 2G82A 1P7WA 4EGAA 5K45A 5LM3A 4RTMA 4ARSA 2PBZA 3R9WA 1RRCA 1N5IA 5EWJA 4EFKA 1LZKA 1RIIA 1M2OA 2AL7A 3I9FA 3AF1A 5JXGA 3FRJA 1B0UA 3GG9A 1JEYA 4JZYA 1EVKA 2X9GA 3BULA 4WV3A 4E33A 1Y4AE 5AHRA 1P1CA 5JW6A 1YB7A 3SKXA 4ESVA 1TQ6A 2H17A 3EX7C 2RK3A 3RT1A 4NATA 5FBKA 5HRAA 2J9RA 3E9RA 1FS5A 1X7YA 3CO5A 4J4BA 3DV0A 3E5HA 5JXWA 2ZWMA 2WIAA 1GYPA 4ZQHA 3BD8A 1E2FA 2RBGA 1YDFA 3ORYA 3IO5A 3N3AC 3DT9A 3K2BA 5ALQA 4ZFNA 2F8TA 4Y9SA 1EFHA 4LGVA 4UE2A 2H1IA 1PT9A 4LSWA 1EM8A 4WSOA 5JIBA 1JTVA 3KPJA 1ODJA 2QN3A 2M32A 4G65A 2H65A 5KTRA 3VDQA 4C2AA 4BU1A 3T3EA 1Q91A 2I6SA 4I9NA 4FOOA 1YL5A 1VE3A 1WTCA 5CYOA 4C21A 2CXPA 4IJWA 2UXBB 3OMWA 4EYEA 1GPJA 3QX3A 2JFYA 2V7VA 5JEDA 4JBHA 2SKCA 1NONA 8ADHA 1HRDA 1CRQA 4KI7A 4RANA 1L0BA 3LWBA 4GDFA 5TJHA 2X6RA 4L8FA 5JS7A 5CA0B 4WK0B 1XVAA 2IPLA 1D2MA 3FZEA 3WGLA 2ZUBA 1PJTA 2BFFA 2CEAA 3L06A 1EXVA 4KAAA 4YT5A 2OG1A 1QTQA 4DXHA 1XALA 1SZDA 2ATXA 4Q7LA 3RVDA 4Q7EA 1XAHA 1KRXA 3FB1A 1QSGA 2KS6A 1ULSA 2QENA 1HKHA 2H52A 3B82A 3L1IA 4UBOA 4C6TB 4N41A 1ZGZA 1OFUX 3MYYA 1NIJA 3GK3A 3I05A 3LT2A 4AJ2A 4EF6A 4PNEA 5KYNA 5FOWA 3UJAA 4KBFA 4O3MA 2FFRA 3AEXA 4J0HA 5DLYA 1FBTA 1BN6A 1SCKA 2F00A 2XE8A 3HYTA 2HDOA 1A8IA 2WWWA 4ZVRA 4COOA 1HZJA 2BHNA 1EBBA 1HF3A 3E9YA 3JSAA 3LY9A 3CSSA 5I7AA 3VTKA 1JR4A 2NSLA 1I0ZA 1Y7IA 3V3KA 1JDPA 4EPRA 5AVXA 2Y1OA 1SJ9A 4HADA 3SIWA 4ZALA 2R7AA 1OKKA 3IXQA 5FNVB 2QPLA 3KB8A 4ALKA 5F77A 4X20B 1DKPA 4DLPA 1Z39A 2P9HA 2ZBFA 5EJGA 2CXTA 1M66A 1FJHA 3M0EA 2EX0A 4UBKA 2Q2QA 3DS8A 1TU3A 2P62A 1C7JA 3LDUA 4OSOA 4E5DA 1HDRA 2XZPA 5KI6A 4CR8A 4DB4A 1XBTA 1NI4A 1XNGA 1CR1A 5F2NA 2XQKA 4RQBA 1ZEJA 1A5AB 1Z22A 3PJGA 4KL8S 1T3LA 4Y6GB 1W4AA 1QAMA 2LV8A 3SHTA 5B2EA 1G2IA 1A4IA 1QS0B 2WU1A 4LRYA 3ZE8A 4QQFA 5CUQA 5L9AA 4J0FA 3SZRA 2JGMA 1AQNA 4BKMA 4PC7A 4BVKA 4IV8A 4B4DA 3KHTA 2NN3C 3MN1A 4ZVOA 1M34A 1XQYA 4Q9HA 2JS7A 3LCMA 3EQ2A 4TMTA 1E7WA 2JLZA 1VBMA 1N57A 4TKVA 3VU3A 4FJ2A 2DKOA 3PIDA 1USKA 2IXGA 4Q4LA 3Q0IA 3RVOA 2RGBA 3PSAA 1B26A 5G53C 3TLMA 4F85A 5DWVA 5L4SA 4W4TA 3R3SA 4W82A 3SDZA 2RAVA 2WUWE 3JCZA 1U3FA 1E6MA 2IA5A 3B2NA 1KWGA 5T4HA 1NSTA 3JQFA 2WPDA 3PQ4A 3CRQA 3IAHA 4FYMA 4AO8A 4DR7B 1U0RA 1JU4A 3PJEA 4Q3EA 3I9JA 1PLKA 2OCPA 3OHPA 2OQRA 3Q6MA 3UA4A 1GRNA 1RJWA 4A1OA 2C2ZA 2QLLA 2XUKA 1U80A 2NXEA 5IW8A 3WBBA 2IPMA 1G42A 2QU8A 4OQLA 3VPSA 1YRLA 3TLCA 3QEBZ 3RT9A 2PUVA 4G5QA 1CY0A 3HXOA 3D3WB 3OFNA 3KLNA 4LJLA 2I4IA 2E87A 2CJWA 1UK9A 4XCQA 5B6JA 2CNNA 3ANSA 1RYFA 3TJMA 2GESA 2GM3A 4ZQGA 4N40A 3B6JA 1BOFA 1WV0A 2FHPA 4TWBA 1TL7C 5HCIA 2PS3A 4M7RA 4AN4A 1BA3A 3VA7A 3EXEB 4HNRA 1V45E 1JI3A 1ONBA 2XNKA 3N7AA 2QE6A 4FNMA 4J07A 4LE2A 3RJTA 3V7WA 4NXMB 5EHZA 3OT1B 2QR2A 3IERA 1Y82A 2G4CA 4RHCA 4YP9A 5BSFA 2D1FA 1WWKA 2FGJA 1DC3A 1NW6A 1BZYA 1FBNA 1ODIA 1WUHS 3IV6A 3V7NA 4BVFA 4D0SA 5H70A 2QW8A 4JJZA 1UANA 1YQGA 3G23A 2GKSA 2ORVA 2MSNA 3ONDA 1ZD1A 4WK6A 1TVEA 1T8SA 3O4FA 3KETA 1TO1E 5L8VA 1IZZA 1FXSA 4Q4JA 1E62A 2ZWPA 4AJ1A 4E1BA 4Z4HA 1RVV1 1KORA 1QUFA 3UGKA 3KQNA 3BBLA 3RUHA 4RH0A 1DV2A 1P18A 1UM9A 3CBQA 4A0RA 5CNJA 4C0QC 5DNEA 4IX1A 5F5LA 1ONNA 3F0TA 1U1GA 2G04A 4OEHA 4ZI7A 2E89A 3DDUA 4N5LA 5ICCA 1Y5RA 4OSEA 4R7ZA 1K7XB 3BT7A 3FKSD 3D0RA 3QEOA 4QOHA 1XN1A 3O83A 4IDDA 2UZAA 1P80A 4J0JA 4IICA 3EGWA 1RXWA 2ZEJA 3HDQA 4YHBA 5ER9A 5TGZA 4MI1A 4BGDA 3AHJA 1E0SA 1OLOA 1Z36A 3M3PA 4P3YA 2V6FA 3ENQA 1Y8CA 4EHJA 2W83A 3LW7A 16PKA 3W04A 5C5CA 2HA3A 3FTPA 4AUMA 4K1XA 1TW3A 3BH6A 2EBFX 2FR8A 1VJ0A 2VYFA 3CEPB 2IW3A 4JA2A 4IUDS 4YO8A 4D4LA 1M8JA 2QS9A 4GXQA 3WGQA 2NU9B 1ST2A 2DWUA 3IP1A 1ZIOA 4A8JB 3LF1A 4C43A 1SU4A 3FPEA 4PPFA 3SY8A 2NZYA 5E4FA 2MMCA 3GLKA 1E2LA 1XZKA 4IGEA 1K6MA 1Q77A 2RGDA 4RM3A 3H3XA 3KJQA 1U3CA 1GQSA 3RUIA 5CLJA 3T0FA 1VKZA 1D04A 5DLDA 2D74A 5A4DA 5MFZA 2QAGB 1IOLA 1M1XB 2P4HX 3HMQA 2AZTA 3WR5A 5BV2P 1VYUA 2ZBGA 4ENRA 1VRCA 1R7RA 3IDAA 1YBFA 2WAYA 5J4KA 2ACEA 3A2MA 3B9BA 3R23A 2BW0A 3G2LA 3JQGB 3W2HA 4QATA 3WXBA 3TSOA 3LS2A 4WTOA 4JI8B 1NHWA 1ZZGA 3BJIC 3WYBA 3LG2A 5ENDA 1MIHA 2ADOA 1CF9A 3PFCA 4YRGA 2X77A 2V54A 5A9SB 5DO9A 4DG8A 4Q00A 3MCVA 3ZHOA 1W36B 3W5UA 1YUMA 1BNCA 1JJAA 2FVXA 3KV1A 2JGEA 4DW8A 2OQ2A 3LDGA 1IQ0A 1XCJA 3UJ6A 3GJ4A 1I7PA 5KX5A 4QTUB 5EP4A 2V9CA 4AS2A 3DKIA 1SOWA 3GMDA 4RX1A 4DJJA 1J07A 5JRJA 1P44A 3BX1A 1E6CA 2EKDA 1XEXA 4BFXA 4KXXA 2GH1A 5CEJA 2Z2KA 4F71A 1LA2A 3SNHA 1ZG3A 5D84A 1DIBA 5T4FA 4BC1A 1CR2A 3Q8MA 1NULA 3LQ2A 3R8CA 2ZIAA 2C1ZA 4RK0A 3ZCSA 1U7UA 4RVSA 4L5IA 3DE4X 5H81A 1X0XA 3KOWA 1NL3A 1TCVA 1UK6A 3A27A 3QA3E 1FMCA 5MN5A 3HJHA 1ONPA 2ROQA 2WJIA 2FQWA 1ETUA 2AVDA 4KFUA 4TSFA 5FPTA 1W0KA 1FXUA 2ZSDA 4QJ3A 3K0EA 2FG7C 4I4TB 1Q0LA 2H1VA 4IZIA 3LC0A 4OHMA 3EF0A 1JG1A 3I0ZA 2IYYA 3KVNA 4IWYA 1EWQA 3Q1LA 2VDUE 4GXNA 3R7WB 1ECGA 1O94A 1XB2A 5BUQA 3ZCTA 3DOIA 2XQVA 1XV5A 3WFJA 1MBZA 1SXGA 2JZNA 2GCIA 3BJRA 3PGMA 4EATA 2HPHA 3ZTTA 4HB4A 4NZ9A 4UULA 1D1TA 1P39A 2WA1A 3LQYA 4XVCA 2P30A 1UM8A 1MB9A 3DR3A 1DBIA 1XZDA 1K27A 3I12A 4J2TA 5ALKA 3U61B 3NWOA 1JBQA 1Y7LA 4PYNA 3ZW9A 2PRKA 5A3QA 5BW8A 5CLFA 5HKKD 1P61B 1YBAA 1DEOA 2CJYA 4RPGA 1DC5A 3I09A 3NALA 3EGOA 3AHGA 4C6SA 2RHMA 3AVUA 5HUHA 4RLSA 1WMEA 2WJVA 1TLTA 1T91A 1R10A 2RB5A 2GFQA 4BVGA 4XUDA 2A1UB 4WXYB 4CU2A 5DX0A 5KQPA 2J3IA 3LUPA 1KI2A 3A11A 4RF2A 4NKRA 2I76A 3I42A 4BQIA 1JE1A 3IEVA 2HSJA 3Q7EA 4F9TA 3Q9LA 3WHPA 1RMYA 1X7WB 3PUXA 4HQFA 3CNQS 4ZZIA 3CKLA 2HREA 4G6ZA 2E1RA 5D01A 3LO5A 1DKMA 5KYKA 3A70A 4DRXA 1YBMA 3RSOA 5JANA 2UYOA 2HXGA 4BP3A 4LQCA 4EA7A 3FDFA 4UKDA 4JY7A 4QYIA 3HXPA 4HZIA 1AHIA 1V95A 3HY3A 3N2GB 3R24A 2HY7A 2G3YA 2IYNA 4XIGS 4M1EA 4LE0A 3NHWA 4AP9A 4KRXA 2IY7A 4K26A 4Q4HB 4ZIRB 3H83A 1U2DC 5K8LA 2WA2A 4IF6A 3AQ4A 3ZWKA 4PG4A 3KUUA 1L5WA 4QARA 5C46F 3GFSA 2XUIA 3VVLA 2OV1A 3CPSA 3D43A 2N75A 2HFKA 3MWDA 5EHQA 3ROKA 3SIXA 5ED4A 4M76B 2XCQA 1XRPA 2QQ5A 1NVUQ 4WOBA 1PJ2A 1ZNZA 2XX3A 1DKQA 4L74A 5EZYA 5GZ6A 4F5EA 3I83A 2X0EA 1H66A 3C43A 1K6EA 3PQ7A 3RK0A 4PIMA 4MZXA 3AXTA 1AGPA 3EGIA 1NJFA 1PQUA 3LLVA 1QHHA 4W99A 4W8GA 4NV3A 4TL7A 5L3QA 4EUFA 4CN9A 5C3MA 3C3DA 2EVWX 2P11A 1JPJA 4X7RA 2PX6A 1XAIA 4WPGA 4CIBA 5JAUA 3FWPA 3HKDA 4LSMA 5B3JC 3F6YA 4PGMA 1JIKA 1NSFA 4NU8X 2P9JA 1P9RA 3V4SA 4KHPB 1Q12A 1N2HA 4YO7A 1TJYA 2ONZA 1Z06A 3A6KA 4L72A 5DVZA 5ELLA 3TZQA 2P6NA 3WP0A 4D4HA 3C7CB 1KK1A 3E2PA 2R6R1 4EENA 3F73A 4U7FA 4QDUA 3TMAA 3GQBB 1KKLA 1C5KA 1M9NA 2EZTA 3A06A 1LTHR 4PAMA 4EZIA 5E9WA 5FLYA 4OXQA 1XMPA 3PNLA 4JDUA 4WA8A 2Z3WA 4UUQA 3J81k 1SVLA 3RTBA 2OYSA 2W9XA 3L7LA 4GX1A 4KFCA 2NVUA 4HRAA 1PEAA 1WG8A 1N2ZA 2X2PA 3QLJA 4P54A 2ILVA 1KO1A 4YX9A 3IMFA 1ZH4A 3L18A 4LIPD 3B3GA 4YRQA 2CMHA 5JMWA 1U0FA 5FPYA 5IP5A 3G59A 3ND5A 1PYDA 3PC3A 2BFEA 4GW3A 4P3KA 6ADHA 3T9EA 1WU8A 1JAIA 2G1AA 1Z4LA 2KW5A 1WUYA 3JAWB 4C08A 4CGYA 2C8VA 2JIZA 4J9UE 4DPMA 3PGXA 2HDNB 2I54A 3JU3A 2C97A 4WXHA 4CTOA 2YDYA 3KE8A 1YTUA 2VKQA 5IAGA 3JD1A 1FP1D 1LTQA 4YXWA 1A0OA 1GKLA 1YFKA 2QTZA 4RL6A 4OFWA 3LUGA 4CCYB 5GGXA 1YU9A 4CE6A 4QZVA 4BMPB 2I6XA 3SQWA 4O5AA 2OP0A 3L7JA 1A9RA 1B1CA 1U0LA 4QXAA 2ATIA 5IC4A 2HGSA 5KOIA 5H8WA 2CN1A 2NNLD 5LZ5A 4CTNA 3DDNA 5T4EA 4MLPA 3EUFA 2JHPA 1VJ5A 1IJEA 1NR7A 2ECPA 2QLJA 3DAHA 4GP9A 3QX7A 4JR0A 4FQ8A 4KMRA 4Q9AA 3M5DA 4W6QA 1B2RA 3KKNA 4M87A 3VPGA 4NFSA 4NPCA 3E4DA 4RAOA 2VRCA 4DCOA 1T4BA 1NLFA 3IQXA 4AMYA 3V33A 1RCFA 1QDUA 4KGXA 1SD2A 3MUOA 1Z2OX 4IO1A 5F3RA 1U8TA 4XVQA 2BMWA 2JCSA 2C04A 4ARUA 5CB6A 1GLNA 3ZIAD 2VP9A 3OCUA 4JC8A 1N1DA 1G4UR 1OYWA 4RYLA 1Y3CE 4L2IB 1AXRA 1OPXA 4Q9NA 3WMGA 3DB1A 2BEUA 4EYGA 4IGKA 3DYVA 4RJLA 4KLAA 3WLIA 4I50A 4YJHB 4G81A 2J6BA 2PJZA 3CYFA 4FE7A 4MUAA 1Z7GA 3AG6A 4U1RA 5K9ZA 4HS4A 4KC0A 5IAKA 4BLSA 1E3IA 1I01A 1W94A 2R1TA 4EMSA 2G70A 2AW3A 5P21A 2AI1A 4BQNA 2WT8A 4BZXA 5HF5A 2Q6KA 1IWBB 1KEPA 2Q8PA 3WBFA 2W42A 4QU8A 4ER5A 1PTJC 1R6AA 3HCRA 5IN5A 5IVKA 2UYYA 1ICEA 5E2IA 3R3VA 4TLCA 4DIKA 1DU4A 2GAAA 2X8BA 4PNZA 1Y4UA 2AFRA 2QP4A 1GAJA 2BEVB 3KQPA 4LRUA 2COKA 4RAQA 4YROA 2CMGA 1R9JA 1GQFA 4Z0HO 1E6KA 4XQ0A 1FOEB 3L6OO 1G7SA 3AKEA 2NTNA 2ORWA 1JKJB 3BIJA 3QWAA 4YDSA 4RTJA 1CEQA 1Z2PX 4TYMA 1VZ3A 2G07A 1PDWA 5AVWA 2HA6A 3HO8A 2VNKA 1C29B 1OFVA 2MU1A 3LX4A 3R5HA 1ESNA 1ZC4A 4GSKA 4HQRA 4XYGA 1Z25A 2J1LA 3SC2A 3T99A 5JD6A 5E95A 1X7DA 2KE5A 1XVLA 1FVOA 3ZR4B 1UC5B 1FFSA 1W73A 1M3SA 1QQBA 2C5AA 1SG0A 1VCHA 3G2MA 1AK1A 3IEIA 4A15A 1A2QA 2MMGA 3KWFA 3UFXA 2Z2JA 4D0GA 4DG5A 4ZVMA 3FB4A 1P33A 1WUTA 1H23A 3MZ0A 1O58A 3U9TA 4DBVO 5K8VA 2IQ5A 3NT2A 4IOMA 1E63A 3RS7A 1V9CA 3U6KA 5FL7A 1OX5A 3G1WA 1VYTA 1DIHA 4RCZA 5U9CA 1JB1A 3LQQA 2EKQA 2AYYA 3ORQA 3BE6A 3W5IA 5IFKA 3MRVA 2OGTA 1LDYA 2B30A 2A4MA 1SUSA 2J9XB 1QX4A 3CCFA 1OU4A 4PSKA 3QMMA 3K0HA 2YBEA 1XZHA 5G41A 2CFCA 2OB1A 4XM1A 4AFNA 1GRRA 1JA0A 1O1YA 3Q72A 5EYPA 3PVCA 3TRIA 3CR7A 3RAGA 1SKBA 3F6BX 4IRUB 3M3DA 5FADA 4B0PA 1G21A 1JG2A 3FF4A 3MT9A 4URVR 2PVPA 4A27A 5CGQB 1U8YA 3EXHA 5SV2A 1IZYA 1N2IA 1SIOA 3OCWA 1WUJS 4JLMA 1BMFA 4PONA 3EZXA 2V3WA 5KS2A 5EIBC 1FB5A 3A6JA 3GA0A 3HN6A 3P5BA 4REQA 4BGVA 2PX2A 1CS0B 4B32A 2GLUA 4OI4A 3HKEB 4RDXA 3WRYA 5L3RA 3C45A 1HZZA 1XZEA 1US8A 3EGCA 4IDHA 1G8SA 4IMJB 5HJ7A 1Q84A 1P4GA 2NSHA 2HLDD 4JGBA 3RVSA 4Z1MD 1WF3A 4XSHA 2PSEA 4RZ2A 4DDWA 1TKRA 1W5SA 4E07A 4DABA 1V7PC 5BQXA 1XP5A 2OT3B 2V6JA 2XKBA 3AL2A 1TEXA 4CIVA 4EI7A 3WBKA 5C8YA 4A5SA 2GILA 4PAGA 1LPSA 1CY8A 1SUEA 1UC4B 2RB4A 1R2QA 1XDZA 4PS0A 4DLXA 1YIAA 1YZ3A 2R5FA 3BWVA 4U63A 2H4YA 1OXUA 4JDPA 4PZYA 1B4DA 2I67A 4P33A 2Z2YA 4IQGA 4PGGA 4QUBA 4QLAA 4KLRA 1T5DX 3C87A 4URWR 1TEVA 4XOIA 1Q21A 3DJYA 2ZYDA 2NWQA 4JBYA 3OZSA 4H31A 3X2EA 1FQWA 2B8TA 4HUQA 3HSSA 2RG1A 4IXNA 4UE3S 5CYPA 3ZXXA 1ABFA 1D6MA 3E3MA 2H7YA 1VFNA 1XZ8A 4BNNA 1WETA 1SCUA 2OZLA 4ZQBA 3D0QA 3BB3A 1KS2A 3KT0A 4JEUA 5DWQA 1ZVKA 4JROA 4DREA 1XTIA 4EO9A 3FWNA 4NSNA 2DY0A 5LZ4A 1NUSA 4KQ6A 4NFLA 3FF1A 5JJ5A 4FFWA 3OICA 4TMKA 4AZWA 2PWPA 4MO9A 1A2KC 4F72A 1TMOA 1O6FA 3EVZA 7YASA 1A4RA 2ZDGA 4RHTA 2XXAB 1FFXB 2EG9A 2GPAA 3AEKB 4XCXA 4URYR 4CM4B 1EWVA 2NQ2C 1Z26A 2YYYA 4NWIA 4OSPA 3W1WA 3ZNOA 4DY4A 2RHTA 3GJ5A 4O2BB 1K5PA 2OD7A 3AERA 1UXIA 4PF1A 4QOJA 3L8FA 1OPRA 2RAFA 3K9HA 4EG0A 4TL8A 4JI7B 3L8GA 1WHSA 4QUGA 1XZPA 5ALMA 3AR4A 1MAHA 5IYZB 3LGSA 2EFDB 1W85B 1GGEA 6ABPA 2IF2A 5TPWB 3EIWA 3D7LA 2F1OA 3T5MA 1DI0A 3D3KA 3T3GA 1JYEA 1ZN2A 2CD7A 4QASA 1Z6YA 3IUPA 3ZGLA 4E7OA 1ZVVA 3ODPA 2EFGA 4Q1CA 5K0ZA 1N2XA 5J2UB 3ZLUA 3ELUA 4OAPA 1HQDA 1PFKA 2WF5A 1CR0A 4YYZA 1NKSA 4LJ4A 1C1YA 1H2RS 2OD9A 2UYQA 1I5OA 2H5LA 5PNTA 3VR5A 3WLNA 2BZ0A 3EDRA 3WGOA 1O96B 4PTZA 5IKEA 1ZW1A 2BR5A 1CUEA 2XWQA 2E49A 5FUBA 3RROA 4YAGA 2O2ZA 1QFYA 4XEUA 4BJHB 1HDGO 2CMDA 2X2OA 1OW3B 1VM6A 1M1YB 2G08A 2XW6A 4LA4A 4ROSA 3L4JA 3FD8A 2JFQA 1ISMA 3QX9A 4HAWA 4D6YA 2QN7A 1ODFA 2XXJA 4EHHA 3U1BA 3D8RA 3ND9A 4TV9B 2B36A 4F4DA 3SFVA 3WIEA 4G4SO 3KYDA 4MW0A 1IVSA 5AK4A 3E3AA 2PRYA 3CZ5A 2O2IA 4QM7A 4FYWA 1ILEA 1IPHA 2W2LA 1VIYA 1N6OA 3JWJA 4NBLA 1P2BA 1Y37A 3LFHA 5FR2A 2VAVA 4A92A 1C4XA 1B8OA 3HRIA 6AT1A 2BUBA 4TXLA 1JHUA 3HCAA 4LQDA 1G3QA 1Z0JA 3SIRA 1VCOA 2YWGA 1GSHA 4DJEC 4EKYA 5FV4A 3V8EA 3CHYA 3BICA 2E1PA 1YUNA 1SUAA 1TU0A 2QRKA 3ZDRA 4L0CA 4QNRA 1VGVA 1YOVA 2FW9A 2D2IA 1IHDA 2RH5A 4OYYA 5CT8A 5FT9A 1JEAA 5HRCA 1MR3F 3HNPA 4C0LA 5JPDA 3D6AA 4YJGA 3TR0A 5IKOA 2GEBA 1DADA 3CF4G 3LP5A 3OQIB 4IZHA 4RMNA 2ZK7A 3AKDA 2NIPA 2SCUB 2FOXA 1A97A 2P8JA 3NFRA 4UJ5A 3HV2A 1ZIXA 5FPPA 1XKXA 2FXVA 1GUBA 2GRAA 2J3EA 2P75A 1PG2A 2QTBA 2YS7A 3M33A 3PT9A 4OHFA 5D3MB 5BV8A 1GDDA 1G8MA 1STOA 1W581 1V16B 3NP7A 3P2KA 3LX5A 3P5SA 5CA1B 1JEQA 1T1GA 4HWTA 2O3RA 5F5XA 1OFUA 4UM5A 5LZ8A 3OLZA 5FDFA 4OJNA 3DHEA 2IWHA 3WVNA 3F9RA 1CNMA 3AVTA 5EWMB 2VRWA 3SE7A 1Z5OA 4HB0A 4JB3A 1A9SA 2HD4A 1XPOA 2O8FA 2PD6A 3B89A 5F7ZA 1AV6A 3GO4A 4ZO6A 3SF8A 2P69A 3PFIA 3QITA 2JIDA 4ESHA 3MS7A 5KO2A 2BBWA 1YVUA 4Z2AA 2FG5A 1XR3A 2FR1A 3AHCA 4XD2A 1QG0A 1CFJA 5B1HA 3OE4A 3WA6A 3VKFA 3ZE2B 5IT0A 1FX1A 1GJRA 2C4WA 2XUZA 2UZ0A 4TS3A 3H18A 2XVAA 5BO5A 1E8MA 2J5KA 4GIBA 4AJHA 3L8EA 2WUGA 1ORWA 3H1FA 4CL2A 5KTKA 1EIWA 1LPPA 1NAIA 2X86A 4O4LA 2RAPA 3CH7A 4Y2JA 2R6AA 3MWJA 5KDLA 3K6RA 2VSOA 3GEIA 3OURA 4ARZA 3NXSA 4G24A 4BQQA 1UDBA 3IUEA 2BV3A 1MG5A 2I7XA 3ZXUB 2BH9A 1CY4A 3EZYA 3MMXA 1IUKA 4DLWA 4D9GA 1MO6A 4KE6A 4RHUA 4WXRA 4R8LA 4LOAA 1SKYB 2H51A 3EQ7A 3TLEA 4EPWA 3K8OE 4E88A 4C3OB 3PKIA 3OCXA 5DBIA 3RM3A 4XLZA 1HTTA 3FA2A 2GA8A 1IOZA 2ID7A 3B3AA 5LP6A 4CQLA 1GTZA 2CZGA 3IVGA 1WDMA 2NVOA 1PE0A 2R87A 2WT4A 3FIUA 5CCEA 2ZUFA 2ZUEA 3ZU4A 3NFYA 1T9GR 2W8ZA 3QE3A 4H7EA 4JJIA 2BRUC 1UPAA 4FYPA 1NGSA 4UDYX 1PJLA 1YKSA