2MYUA

An arsenate reductase in oxidized state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
131
structure length
131
Chain Sequence
MKKVMFVSKRNSSRSQMAEGFAKTLGAGKIAVTSSGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Oxidoreductase
molecule keywords Glutaredoxin arsenate reductase
total genus 49
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2myuA00
2WY2D 3OQMA 5EWLA 4XLTA 4ZYLA 1LK0A 1Z12A 4Q7EA 3KG2A 2NZUG 4F3TA 4Z4GA 1JLKA 1SXIA 2QSJA 4RWEA 4ETNA 4MS3B 2DRIA 1QO0A 4O5AA 5FWYB 4XFKA 5CNMA 1P8AA 4H3HB 5KC9A 5FBHA 2VYCA 4EYGA 4ETMA 1ABFA 3IP7A 3ILYA 3Q7RA 3QEMB 5EWJA 5EWJB 4EYQA 3RQIA 2FMKA 3OLZA 4RY0A 5IUJC 4S04A 1DCKA 3OLXA 1T34A 3RVSA 2PAFA 4XASA 4RU1A 5HQJA 4MS1B 1NXTA 2V0NA 3KYJB 2J48A 4OTZA 2E4XA 4FE4A 4QYMA 2CD7A 2ID9A 3KCNA 4RKQA 1W9HA 1W25A 3EODA 2LPMA 4CBVA 4G0PA 3IPCA 1YMUA 3MF4A 5EWMB 1SD5A 5CNJA 3EAFA 3H5LA 4DADA 5EWLB 3HUUA 4YWHA 3LUJA 2B1JA 4NV3A 2B4AA 4G0MA 2WWVD 3KLNA 4JOQA 3O1JC 5D2CA 3LUCA 4YLEA 2YHAA 1EWKA 3N6VA 1LJUA 2RJOA 3OO0A 5KQGA 4N76A 3VNBA 3QX8A 1P6UA 3GV0A 4MS4B 2R47A 3OMXA 1QKKA 4MLDA 4UHJA 1S8NA 2WB4A 1TVMA 2AYZA 1F51E 4W5TA 5C5CA 1MB0A 4YGXB 2PUDA 3O75A 4RXMA 3Q9SA 1RZRA 4GPAA 1A0OA 4G97A 3C3KA 5PNTA 2JVKA 3HVRA 3QLUC 1DC8A 4TMYA 3OQNA 1XHEA 3JPYA 4F11A 3Q41A 5TPZA 1DJMA 3Q7TA 1R8JA 1NXWA 1JBEA 2PL9A 5KQLA 4IRXA 4RKRA 5TE9A 4YCSA 1EFAA 3URMA 3UK0A 2E4ZA 2P9HA 3RVKA 2IDMA 3EQ2A 5IC5A 3TO5A 5CNIA 3KYIB 3QLTA 1LJLA 4KV7A 4EYKA 3BBLA 1F4VA 4FB4A 4O1IA 4RDCA 1JX6A 4Z4IA 2PMCA 4LE1A 1USGA 2QW1A 1PNRA 4OATA 1M2EA 3MA0A 4JB0A 1DC7A 1Z26A 3D02A 4JAVC 2L17A 2VK2A 1YVUA 3G85A 3GYBA 3HZHA 2CHEA 3LTEA 4KK4A 5DLEA 2MSKA 5GQSA 1ZN2A 3DLBA 2CHFA 5FWXB 1Z25A 4W5RA 5BQ3A 2QR3A 2PUBA 3GL9A 1CYEA 3RVJA 5IEJA 2PL1A 2NT3A 4KZKA 4MS4A 1RXEA 3N75A 1Z15A 3IP9A 3OLYA 1LBIA 4TLLB 4RK4A 5DTEA 3I09A 1VKRA 2PE5A 1E2BA 2W42A 2FEKA 4MQFB 1QP0A 2JRLA 5BRJA 1KRXA 1P2FA 3ILHA 1NXVA 1USKA 2RDMA 4EUKA 2PUAA 3HM9A 3HCWA 3BREA 2LBPA 4ZPJA 1ZDMA 5ED4A 5TPWB 1MAVA 1JYFA 1P6QA 1RNLA 2WJAA 1XHFA 1YS6A 3A3KA 3UUGA 1Z2DA 4WT7A 1APBA 3BRSA 1U0SY 2QU7A 2GWRA 3LUHA 2WMYA 2YHBA 4KMRA 4RY8A 4LE2A 3MM4A 4RK5A 1FQWA 2HPHA 1JFVA 1GCAA 1YIOA 2LIVA 4YO7A 2FLWA 3LOPA 2HQBA 2IPMA 3IP6A 1DBQA 3A10A 2FN8A 5JNVA 1TMYA 3SY8A 3LKVA 1QNLA 3QLVA 4HNRA 1JFTA 2XDYA 3RVQA 4KVFA 2IPNA 5TQ0A 2PKXA 4MRMA 1JL3A 3CFYA 3HS3A 3QELA 4MRMB 4LRQA 2NUBA 3DGEC 3JY6A 3HK2A 3T38A 5IEBA 4EY3A 1ABEA 2FVYA 1DZ3A 3RVLA 2QVGA 3T8YA 1CEYA 5DKFA 4ZMRA 5FBKA 1D1PA 6ABPA 3RVMA 4HNSA 1H9CA 1NATA 1RZRD 4O1HA 4OLBA 1B00A 1AB6A 1DCFA 1SRRA 3QLUA 3KHTA 3H6HA 2OQRA 2FSPA 2FLKA 1OXBB 3E3MA 3MMNA 2GKGA 4OBBA 3O2QB 2IKSA 3W9SA 5KWSA 4TN5A 1K66A 4PZ0A 2QVCA 3LKBA 5EWMA 5TPWA 4JB2A 4F12A 3QEKA 3L6UA 2IPLA 1U2PA 3LFTA 5F64A 5IULC 2NZVG 1VRVA 3P9YA 3G1WA 4Q6BA 2KYRA 2NT4A 1EWTA 3F73A 5IBQA 2JVJA 2MSWA 2PUEA 5JNRA 5B3JA 4XXHA 4Z4HA 3CNBA 1A04A 2PUGA 3QEMA 3JTEA 2MYUA 2IYNA 3A0RB 2A9QA 4N03A 4PYRA 4MYRA 1WETA 2FKAA 1RPJA 1ZGZA 5FWXA 4YP9A 1VLZA 1Z18A 2N9UA 3OLVA 3A0UA 4D6XA 3NNDA 2L19A 1SXGA 3DBIA 3HEBA 2MYNA 2RJNA 4IF4A 5DCLA 5TQJA 1KMIY 2FEPA 4LDZA 3DLHA 4NCBA 4RXUA 3O2SB 1PEAA 2E4WA 4N0PA 4RK7A 4QYWA 3TMYA 4KNYA 1PUXA 1GCGA 5DGCA 4YRZA 3R0JA 1URPA 1L5YA 4H3KB 1ZITA 1I3CA 5BRAA 3EDCA 1LBHA 4MR7A 3JVDA 4H60A 2GX6A 4ETIA 2E4UA 3N0WA 4JA2A 1DRKA 4Z4EA 1YK0A 4OG2A 3SNKA 1ZHHA 1QMPA 3NHMA 2MSLA 3QX9A 4IMIB 4MLCA 3CG0A 4KK3A 3N53A 4RZSA 3I5AA 4EVSA 3TB6A 3OQOA 2PUCA 1D4ZA 3OM1A 1PHRA 2E4VA 3GWGA 4LE0A 5KC8A 4Z99A 2WRZA 3OO1A 4MR8A 2FQWA 2Q5CA 3I42A 4RK1A 2A9RA 1D5WA 2PJUA 3IP5A 4N47A 2H0AA 1EAYA 3CZ5A 3H5VA 2HJ9A 3N0RA 2JBAB 4PICA 3Q7SA 1U8TA 4MQFA 3F7NA 2TMYA 1K68A 4Q6WA 3BRQA 5JS2A 1L5ZA 2IPAB 4JASB 1JDNA 2HQRA 2R48A 3CLKA 1Y1LA 2FMHA 1JDPA 1QO0D 3HSYA 3F6PA 5TQ0B 4KPYA 4Z4CA 2M1ZA 3Q15C 3QLVC 3RVRA 3SM9A 1QP7A 2O20A 1OXKB 4MQEB 3SG0A 1JH9A 1MB3A 3TX6A 5FWYA 5IUNC 1YK1A 4RSMA 3FDFA 3CHYA 3EULA 3H6GA 3JS5A 4G0QA 1YTUA 4YV7A 3ROFA 2FEWB 4MR9B 1U04A 1YS7A 3O1HB 1FFSA 5TPZD 3O1IC 3H1EA 4G0XA 3FGZA 2R25B 3C3MA 3QELB 4MGEA 3IDOA 8ABPA 1VPWA 2E4YA 2A9OA 4ML3A 4B09A 1GUBA 2L18A 6CHYA 3CTPA 4KQ9A 1DBPA 3QK7A 5KQMA 3M9WA 1DBWA 3M6MD 3RVPA 4NICA 3TD9A 1Z13A 4F06A 3F6CA 4N0QA 4JP1A 1MVOA 1GUDA 1FSPA 1J56A 1USIA 3CKMA 4MS1A 1BAPA 3MIZA 5HKOA 1ZH4A 2FMFA 2I6FA 2QZJA 4G0OA 1DG9A 1DRJA 1HEYA 2FXIA 3GA5A 3H5WA 1ZGGA 5T7BA 1NTRA 4YR7A 4FE7A 3HUTA 4Z4FA 1FFWA 2A9PA 3C6QA 4LDAA 4RV5A 1KRWA 1ISRA 3LUKA 3DGFC 1FFGA 3N8IA 4ZJPA 5JNUA 4ZMSA 4MS3A 4WXMA 3FFWA 4HYEA 4L85A 4P1ZA 4QICA 5KQPA 3ROTA 3SQNA 4G86A 3MQ4A 4XARA 3N0XA 4PEVA 3LUDA 3KLOA 4IMJB 4EVRA 1NY5A 5B3JC 4G0YA 4M88A 4KREA 4W5NA 1Z2EA 2QV0A 3UKJA 1BDIA 5IX8A 1QQBA 2PUFA 4MAAA 5CNKA 4LZLA 2ID7A 3O2JA 1PEYA 3LUAA 5ABPA 7ABPA 4KFCA 2F8SA 4KRFA 1RXIA 2FQXA 5CHYA 1IIBA 3OMWA 5C5EA 1TM2A 4TLMB 4Z9BA 1QP4A 2CWDA 4F8JA 2HSGA 3O21A 4WZZA 3T95A 4DN6A 2HQOA 3GT7A 2AYXA 3C97A 3LUFA 2MYTA 4EVQA 3B2NA 2LUOA 1QPZA 4IILA 3MYYA 1E6KA 1ZVVA 5GOTA 5HSGA 4D74A 5I4CA 3JVIA 3RVOA 4IGAA 2MYPA 4Z9AA 1JF8A 4EGSA 3RH0A 3K9CA 1XWWA 3H1FA 2IOYA 2FN9A 1U2QA 2OENG 2JK1A 4G0ZA 5JNSA 2FW0A 4L4UA 4W5OA 1NXSA 1A2OA 3FFTA 3NHZA 1ZY2A 2JCGA 4S05A 2LP4Y 3KKEA 4P98A 2VUIB 1DP4A 2WJWA 1M2FA 4MPTA 2JB9A 3OLWA 2FTKE 3JPWA 3NNSA 1NXXA 4MQEA 2GBPA 3GBPA 3VNAA 4PE5B 1DCMA 1TJYA 2RGYA 4NQRA 3KJXA 4MR8B 3EJWA 4EYOA 4RS3A 4WWHA 4XAQA 5KI6A 4DQDA 4MR9A 1AB5A 9ABPA 1ISSA 1BA2A 1NXOA 2FQYA 3GRCA 3CRNA 4HNQA 1TLFA 1MIHA 2GI4A 2JBAA 5JNTA 2VUHB 1JFSA 2F8TA 1JYEA 1PNTA 5TQ2B 4UHKA 1NXPA 3OM0A 3RVNA 3I45A 2ZAYA 4YS6A 4NCAA 1ZESA 2BGGA 3FFXA 3CZCA 4GNRA 5HM6A 3L49A 2L2QA 3EQZA 3S99A 1JWLA 1Z16A 3KSMA 3C3WA 1YMVA 2QXYA 3H1GA 1CHNA 3E61A 2M98A 2H3HA 2X7XA 4E7OA 2FMIA 4E7PA 4W5QA 3M9XA 3H5TA 4RK6A 5T3YA 3FMVA 3EGCA 4WUTA 3HDVA 4Z0NA 3HJFA 3CS3A 4KQCA 4QPJC 1EHCA 3GBVA 3KTOA 3SAJA 2P4UA 2PLNA 1KGSA 1D2AA 4LX8A 3T6KA 4N41A 3DZDA 4OLAA 4RY9A 5E3JA 5JS1A 3LMKA 4Y9TA 4WXEA 3H75A 1JHZA 1SXHA 3CG4A 2ZWMA 1GLGA 1M5UA 3NNNA 3IPAA 5BR1A 1Z17A 1UDRA 1M5TA 3H5OA 3NBMA 1BVHA 3HV2A 3D8UA 1BDHA 3CU5A 3O74A 1C0EA 5TQ2A 5IUKC 4RXTA 3HO1A 3LUGA 1BDJA 3K4HA 1E6LA 1ZH2A 1D1QA 1E6MA 1EWVA 3BILA 5JNWA 1QQAA 4MR7B 4D6YA 3HDGA 1ZAYA 3HXMA 3H5IA 3KS9A 1C4WA 2JVIA 2R4QA 4RK0A
chains in the Genus database with same CATH superfamily
5KHOC 4TTAA 5EWLA 1KI6A 2BMVA 1IHOA 2PT7A 2BTEA 4ZOLA 2F7SA 3E8SA 3CCBA 3ZHOA 8MHTA 3F90A 4F4UA 3N3BC 1CF4A 1W0CA 3GVIA 1GV1A 1WCWA 3OJEA 4Z3DA 4Z4GA 4PIPA 4NIMA 2DLDA 5EUCA 1PFWA 1Z0FA 5KC9A 3TOSA 3I2JA 1HQDA 2WG1A 1VSBA 2DY0A 2I71A 1WZUA 3HLYA 1IQPA 3NEPX 3EGXA 1D9XA 3QFHA 5T67A 4MW6A 1JG1A 1V5EA 4C29A 1V71A 3HZRA 3Q7RA 1OD6A 2WHPB 3SZUA 1ECPA 5FHQA 4EYQA 2UUCB 5IS2A 3I9KA 3W06A 2DFNA 1BE1A 4F96A 1UZLA 4S04A 3THWB 3UT6A 5IJ0A 4HBGA 3DVAA 1K0FA 4DRXB 2V0NA 3UV6A 3SBOA 1TI7A 2I66A 3IO5A 4P4TA 1ZJ5A 4L7VA 2A7XA 4EZBA 1PJSA 3R3YA 5EPUA 3GFGA 1J07A 4KACA 4LWZA 4UVHA 3VR5D 2I1VB 4JNCA 4US2R 3HU5A 1RAAA 1RTKA 2JH9A 2VPQA 3ZWAA 5A6SA 3M49A 1SD5A 3EAFA 3R0VA 3H5LA 4YPOA 3LDHA 3CX7A 4R2JA 5EWLB 4EPYA 1N57A 2E7ZA 3MLAA 5L95A 4PRKA 3K1JA 3HU2A 4CQLA 2WWXA 4TKUB 3A4MA 1M1YE 1WV1A 2ZZMA 3D0OA 3EF0A 3EPPA 2O0LA 3HEMA 4G2NA 1KK1A 5GTDA 4QHTA 5LQNA 3NTOA 3FLAA 5C18A 3MWJA 4NENA 3KQLA 3RS3A 3N6VA 1QGDA 3SVTA 2ZE7A 2RJOA 3QJGA 2BT4A 3OO0A 2JLWA 4N5DA 2RB5A 2J0VA 3DTVD 3DULA 3NJ4A 2Y27A 1OC4A 3MJTA 4PLYA 1RPAA 4I6GA 4DR7B 4J90A 2R47A 5CURA 3O03A 1E0DA 4AY2A 4BZPA 4DGQA 1TVMA 3EF1A 4ZU3A 2IVZA 3FWNA 4V24A 1QE3A 4ND5A 4QYXA 4PC7A 3L05A 2IYYA 1Y42X 3DMPA 1UADA 1M10A 1HFJA 1Y5NA 4MO2A 4QXMA 1J21A 4EIWA 1FFAA 3LX6A 5KTRA 3Q9SA 2Y68A 3REGA 4AP6A 2C00A 5GONA 2PBFA 3DBOB 4BECA 2PDAA 4Q18A 1LVUA 2OXEA 1TADA 4W9NA 2OPHA 3UWOA 1DTEA 4WBSA 2DXIA 1JVBA 2PL9A 3DE6X 3L6OO 4ISCA 4YWJA 4EBBA 5KQLA 3JAMA 1L4LA 3TWOA 1L3IA 4PCLA 3ZHYA 1Q0QA 4B6EA 3EUWA 4CKEA 2PFKA 5JJLA 4C04A 5JE8A 1JECA 4LGVA 4C0WA 3KT0A 3ZGNA 3UJHA 2WQ6A 2BSXA 3QLTA 4RFSA 3PXGA 1II8B 1A95A 4F3NA 2NM0A 3BBLA 4RANA 4FBLA 1JX6A 1MEOA 2PQMA 3ADPA 3C87A 3LT2A 3PKJA 3QVXA 4NBNA 4FNOA 5C4GB 1DC7A 2Z6AA 3SK0A 3U9LA 3H16A 4A92A 2X3UA 4L16A 2W83A 3DLBA 2HWXA 1YE8A 2CHFA 4YJFB 1TPYA 1W36D 4XTRA 2W8BB 4W5RA 1K9VF 2ACVA 4TUYB 5EZYF 5BQ3A 1SUDA 5I51A 2ZATA 2HNKA 4GOND 2HRBA 4TWIA 1YWGO 2HDHA 2LTAA 3VFDA 5E1BA 5IEJA 3FGNA 3IUEA 4KDCA 1GZ6A 1H2RS 2CUZA 2DT8A 1RXEA 1WCIA 2AMYA 4JI6B 1KNQA 1CUHA 3IP9A 3QOWA 2PSDA 3FGPA 3MCVA 2Z8YA 4A0GA 4KXLA 2YJNA 2BCJQ 3OM8A 2PVPA 3BK1A 4P5PA 2X42A 3F1LA 5K20A 3JZFA 3S6JA 3HCWA 5JAUA 3FDXA 4C6RA 1XP8A 3DV0B 4QRHA 1RYFA 3WK5A 1U3FA 3EZ9A 1RAFA 1C3EA 4NLLA 1ZJYA 4Q1DA 4QIHA 4EABA 4YMSA 1TZJA 4HYTA 4RVFA 3H2HA 3V1TC 3DKKA 3RRFA 2GXUA 1VKNA 2XUPA 4JYBA 4JK3A 4YRSA 5BP7A 4EGJA 3O83A 3NIBA 2ZXUA 4FI3C 2IUEA 2IW3A 1L7MA 2W0MA 2QP3A 4JVMA 2K6GA 4JUIA 3K71B 4EL5A 4YQEA 3MXTA 5L6MB 3A70A 1QONA 1XL1A 1XPJA 1BJKA 1DI0A 3U13A 1O0SA 2IPNA 4C0KA 2P6OA 2BEVA 2PKXA 4XIIA 4LRQA 1QDLB 3RDPA 4F6RA 4ZC8A 3ZW9A 1GNRA 4B4DA 1XHLA 5IP5A 2OZKA 5F5XA 4HNGA 4BQOA 1R9NA 3GN1A 4Q3EA 2QVGA 4X65B 5DKFA 1RCUA 2GTIA 2H4JA 4DMGA 3O4IA 1H2AS 1WSAA 3IAEA 4MYCA 4ARBA 5DU2A 4UARA 4UUAA 4HN9A 1KAQA 2X8BA 4OLBA 4Q3LA 4YYEA 1D2MA 3SLRA 4WNIA 3SJBA 3C16C 5CFLA 1WXIA 4PAQA 1KSGA 2RK6A 2BFCB 1RJDA 3NR2A 3KT6A 4M0FA 4TKLA 2UXBB 3C41J 2EZTA 3QPAA 4R01A 3RYIB 2B6NA 1F0NA 1R6XA 2W2OA 3NDJA 1DADA 2FSVC 1ZIDA 2I4RA 2NZVG 4K6GA 5G2OA 3COJA 1P7YA 1L5SA 3FUCA 2YXDA 3BMOA 2P4HX 4K86A 2C61A 4N82A 4X0EA 5B6IA 2VXCA 2MSWA 5KWIA 2DUUA 2VA9A 2XNKA 2VKQA 1E2GA 1VXRA 1AXRA 1QGZA 1JPVA 1UBFA 3P9CA 1KETA 3QVTA 3R6TA 3CJTA 2HB6A 3ON5A 3Q7PA 2MYUA 4HNAA 4PYRA 2A9QA 3EXIA 5ADWA 1VIYA 1XT6A 1ZZEA 2GBLA 3R7NA 3QKWA 3V4OA 4A26A 2GPYA 4JJ8A 4BQRA 3FTFA 5D2CA 1M1YB 3ORFA 1QVZA 4ZAVA 2P1ZA 1E3WB 1G0NA 1SZJG 3F4BA 1Q0PA 3KU1A 1Z38A 2H9IA 4IJQA 4KQEA 5KNBD 2I4IA 2PGJA 1SU4A 1R66A 3LT5A 1OLOA 4RVSA 4QZVA 1J2JA 3OJWA 3IODA 5AJXA 4C0LA 4YT8A 1Z5ZA 1G21E 1SOMA 2V8BA 2W70A 2PGLA 4J2OA 3DLHA 2BW0A 3ZJUA 1LDBA 2I78A 4I9GA 3WMWA 1P81A 4FZRA 4ETWA 1TD1A 5CA0A 1VP3A 1CUZA 1L5MA 1O4VA 1PUXA 2JF0A 4QULA 3I1JA 4PR3A 3IB6A 3B1VA 1ZITA 4LC1A 1RMYA 1BX1A 3EDCA 4XCQA 1PQUA 1J8QA 1I14A 3L04A 4F9GA 2GX6A 4RACA 1FP1D 4R2WA 2Y67A 3NP9A 4G4SO 4ER3A 4C3UA 1NOJA 1KI1A 1ZHHA 5EZYA 3VTKA 2J46A 2P6UA 3W34A 1T0PA 3O1LA 1WSWA 4BFLA 4MW7A 3K9LA 3K72B 2H8GA 4PANA 4KE9A 3AU8A 4TMTA 2AW3A 3VZDA 2H48A 1EVKA 2DH6A 1QF9A 1C8VB 5D86A 3I83A 1A8PA 1AUXA 1UKBA 2O3JA 4I99A 4C08A 2WRZA 4F4IA 1Y6QA 3PEFA 3CR3C 4ZVKA 2D7CA 3I42A 4HQNA 1PX0A 4IVQA 4OUDA 3T4UA 4FCCA 1NHGA 2HQSA 5F7JA 2VNSA 3DOJA 3NUQA 2MSDB 4QLOA 5SYAA 5IWAB 4MA4A 2YRXA 1L4GA 3CEJA 3MIIA 1S3SA 3T06B 2HJ9A 2HREA 3K1YA 1CNFA 1HK7A 1V4BA 3ESZA 3F7NA 1PL6A 4EA8A 5LR6A 1JSLA 1JAXA 4UAVA 1UPCA 2QNIA 4GBGA 3D8HA 5DULA 3RSHA 2HBZA 2W2NA 3LPMA 4QEKA 4KPUA 1OFGA 1QO0D 1UZAA 3HSYA 1J0CA 3HU3A 5A5FA 2IC5A 1I7LA 2WHXA 4BNZA 1WBBA 4P2BA 1A9RA 3LP6A 2Q5LA 3VR2D 4DA0A 3DDWA 3RLFA 2GBGA 3A3OA 4JELA 3B1ZA 1M8JA 1G8SA 2QRVA 4NDNE 3W2EA 2H4XA 2RG7A 1RLJA 1J1ZA 4RAQA 3DM5A 4G0QA 3P2KA 2PK3A 5K0CA 3SYKA 2OC9A 4GPIB 2ZBVA 3U4GA 4YRGA 1UFKA 3I5YA 1WTAA 1GG8A 2PBLA 4OLFA 4GLBA 2JGFA 1BWSA 2QTZA 1TLLA 3SX2A 1UXOA 3D3JA 1T29A 4Q05A 3ZY5A 5B30A 3DHNA 2JKZA 1OWNA 3ESYA 3KKPA 3FRHA 4KQ9A 3K6KA 1LRJA 2XDAA 3VO1A 4M99A 3S2UA 4MVXA 3B3JA 2PTHA 4WERA 3TD9A 1AGNA 1SGWA 3DYVA 4G41A 4A1FA 2ZJAA 4RA6B 3WYFA 4DCMA 4EBFA 1GZHB 2XX3A 1XVAA 4J6EA 5H3LA 5K8VA 4YJ3A 2NPOA 1MX5A 3CKMA 2YNMC 2V03A 5F1OA 3THOA 4BFXA 2PGNA 3WLQA 4EL0A 1O8BA 1JAIA 1REQA 1C9NA 2XGOA 3GOHA 4PRYA 3WOHA 1JJ7A 2AHOA 4TL9A 4CDGA 3H9JA 2JJ1D 1NTRA 2IYRA 4WLVA 1ZOPA 1UFRA 3CYFA 1CZRA 4WNAA 1LU9A 4HLNA 4Y2HA 4A10A 1K86A 1AKUA 1BZYA 1Y81A 3F67A 4IIDA 4PPQA 4EUFA 3DGFC 3NIGB 2FZ5A 4ZYUA 2QTVA 1N5MA 3LVQE 4WH0A 4IAOA 1SVMA 1PYDA 2B1GA 1Z4PX 4R1TA 4CLRB 3OM9A 3U4IA 4XWWA 4HXGA 2Z9DA 3A9TA 3E23A 4XARA 4YQYA 1G4UR 2NSHA 3N0XA 4QGGA 2XI4A 3NX4A 4NENB 4KTTE 1LDMA 5K4AA 3F49S 1V48A 2LV8A 3F96A 3PNKA 3AFHA 1COZA 1OC2A 4OYLA 3W79A 1AOXA 1UMCB 5EMLA 1RYZA 2VHJA 4D82A 4EGAA 4D8VA 1J33A 4GUDA 3OY2A 4UULA 1R12A 3Q3EA 4K9KA 3HY6A 1PEYA 1U0GA 2HSDA 1GKKA 1YJ5A 2FPXA 4UQOA 3OX3A 4ZHQA 2KMLA 4P83A 4FFSA 2NTVA 4WADA 3S81A 2V4UA 3GH1A 2Q1UA 1IZ9A 3KETA 3LFHA 1M75A 1XTQA 4EHJA 4F71A 4NAUA 4E22A 2PJDA 5GOTA 1NWCA 1HMPA 1SCNE 1N3LA 4UHCA 1LV7A 1KKLA 1VIDA 2C3MA 2LKCA 4N5LA 1E64A 1UK9A 3QF4B 4Z8YA 3IB3A 3RNLA 3W5DA 2XMQA 5ESRA 1M72A 3URKA 1NVAA 1GXSA 2WUWE 4QO8A 5K3EA 1COWA 2YUTA 3PFFA 3UENA 4WKPA 4DWJA 3A4LA 3DT9A 2HADA 3FTCA 1UODA 1LI7A 3BWDD 2YINC 2OY0A 3UWMA 3MAAC 5HKKA 2VQ6A 3ZQJA 4BRUA 1T25A 3QU2A 4MPTA 5ELXA 2FTKE 3QPWA 4FLEA 5LP1A 1PL7A 2HMUA 2C3YA 1T1SA 5IVPA 1A7AA 2ZVPX 4AT1A 4DLLA 1IRXA 5IT9A 1XYYA 2FFAA 1U9IA 2FW6A 3FLMA 1M0SA 3G6KA 3HNRA 1I2ZA 1FNNA 1B43A 1O58A 1NQTA 1SOVA 2CN1A 1UBKS 1XMXA 2XQIA 3G17A 3I76A 3N1UA 3TCKA 1JB1A 1WNTA 1F12A 1GZ4A 2PV7A 5LQCA 4HUQB 2A1UA 4NG4A 4TWZA 4DCSA 2QE7A 3AR4A 4WZAE 4Z0TA 3CEAA 5CBKA 1OILA 3RYHB 3LCRA 2NU7A 2OCPA 1J24A 2N47A 3HWSA 1SXPA 3FZNA 3VV3A 1FDSA 2A92A 1Z5VA 4JLDA 4OA5A 1Y8QA 3EZ2A 1Q7TA 5CM8B 3VKWA 5HR5A 4H16A 3K0BA 1OZ0A 1G5HA 2COKA 2WSIA 3L79A 4G5SA 1W44A 2R6CA 3AIMA 2R1UA 4QXOA 4DLKA 2B99A 5IDQA 2H3HA 3LLMA 2ZIZA 3ABRB 4P3OA 4I3HA 1Z5NA 1TVEA 2IXBA 4N3BA 3HXKA 4NWIA 3RW9A 4KOEC 3WFIA 3WISA 1N1MA 4BVKA 4UEQA 3H9CA 1LC3A 4HDNB 1CPYA 2RGDA 3HKDA 3JAWA 3HVJA 1EHCA 1JBKA 1XEXB 2XVZA 3GBVA 4M7OA 3EZ7A 4HVCA 1EUDA 1OBCA 2OM6A 4P0PB 1D2RA 1A71A 4PG8A 1SHKA 2NSJA 1DUVG 4OLAA 2RARA 2DPYA 5HJEA 4Y9TA 2EGHA 3PGJA 2Z2JA 3KHKA 4AN1A 3H75A 2MMCA 1LF0A 5JZBA 4CT5A 1X80B 1NQAO 1SURA 3COZA 2HGZA 3WP1B 4CCYB 4MB0A 5INTA 2PKQP 1DIGA 2VDUE 2ZUFA 1E1CA 5EI5A 2H2AA 2ZB7A 4J7UA 4JQSA 3FZQA 4FUQA 3HZZA 1ECLA 1SC9A 4WSOA 5C2JB 1C0EA 1HYEA 2NQTA 4H7HA 4KUHA 4PHTA 4KFUA 2BLLA 1VPTA 4M98A 3U3OA 3Q3CA 1ZH2A 1ZK2A 3BTSA 4P36A 3QKRB 1OKKA 5SY6A 4R2XA 4IDGA 4B83A 5CA0F 3IAM6 1QX3A 1SK8A 2V7WA 3P2YA 3FYUC 3K0FB 2GEUA 4RK0A 5ALGA 5EFOA 5BNTA 1E98A 1LK0A 1WQ3A 2WIBA 3KPVA 4X6YA 1D0IA 4EB3A 3IKTA 3ENVA 2Z8YM 4XWTA 2YFKA 4YJKA 4BWVA 1WUIS 2IRWA 5JAQA 3F78A 4YXFA 1RRPA 2FUKA 3INYA 1RDFA 4R0NA 1ISHA 1Z28A 1C3JA 3ISVA 3IULA 4Z1MA 3RHSA 1ZMRA 2FZ4A 4NATA 4EHLA 5DCUA 3CV3A 3FSEA 4XFKA 1MPTA 4F46A 2VYCA 4YPVA 3R09A 5DGTA 4RZHA 3STVA 5CUQA 4HXFB 1JHUA 3JQBC 2G63A 2DWQA 4OB8A 1F06A 3Q88A 4N01A 3DBVO 3JZMA 1KK0A 1KVQA 3JARA 2KW5A 3QUQA 2KS6A 2Z8ZA 1DT3A 1UP4A 2AEJA 2I5PO 2WICA 4K9SA 5C8YF 4JJ6A 3T9DA 4XASA 4DTCA 3GROA 1JN0A 2J48A 4L07A 3NVKI 4BQQA 4ZT5A 3TECE 2QRPA 1WDTA 5A62A 1NMEA 2PYIA 4PG6A 5REQA 1K75A 3J81A 4K1XA 4FBMA 4RZUA 4TMFA 5TGZA 3GLGE 2F3RA 4BCBA 1XRRA 5CX1B 4FBGA 2XYPA 3DZKA 2QVLA 3N2GB 4QXAA 4Y6SA 4Y98A 1DOHA 3V9PA 1A8SA 2C2XA 3CJRA 3V4LA 2DUNA 5BN4B 4EEXA 5CA0B 1FX0B 3D6HA 3SLKA 3N8NA 2JJMA 1OI4A 1MTZA 4LVCA 4MUYA 3SX0A 4D41A 5L3QA 4E5KA 2V6IA 3PEYA 4CNQA 2IEAA 4N3GA 1P1IA 2A5DA 4GPBA 2A6PA 5EVCA 2J67A 1G5FA 1I2AA 2F00A 1RSZA 1T0HB 3KQNA 1TQ2A 4MS4B 1TQDA 3IDSA 3GFFA 5AXAA 3VX4A 5G1NA 4HK4A 3Q9NA 2R9VA 3DXXA 3K1AB 2QENA 3FAZA 2ZBFA 3I0NA 4M1MA 4PRLA 3PGLA 2R1VA 1XCBA 4OJYA 4RE6A 3UHOA 2QBYB 2EG9A 2VF8A 3VOBA 5ALHA 1FMTA 2FFRA 2IZ5A 1MNQA 2LRHA 2P2CA 4B3JA 1YE5A 3N2LA 2VDOB 1PFVA 2OK8A 3MG9A 4GW3A 1HLDA 3OH8A 4N8EA 5F52A 3SPXA 5CFZA 4R98A 1RLUA 1DJMA 4KX3A 1RFGE 5EAIA 1P4RA 4BY9E 3OD1A 1FJHA 5K8LA 5TMBA 2GHTA 2O8VA 2E0IA 4JBXA 4YJDA 4U8GA 3I5XA 3ZCXA 2DF8A 3ZDAA 3DFMA 1HEUA 1C50A 1RD4A 4CGYA 4MDEA 3HP1A 4X95A 1GRVA 4HJXA 1K7CA 1DHRA 1T1GA 2BP7A 3RYTC 4KV7A 3TO5A 4DMCA 3HYTA 4D6PA 4EYKA 1V3TA 1JDSA 1JT2A 1RKXA 4O1IA 3LX4A 5AXDA 2QW1A 4IXMA 1PNRA 1QVVA 4BVJA 4JI7B 5AKKA 1OZFA 3RVDA 1XF9A 3C1TA 3B20A 2WYIA 2O23A 1WVGA 1P0IA 3BXGA 2H4ZA 1ATIA 2PRYA 1RJ9B 2RBKA 3G79A 4MEAA 4TZ6A 3NWEA 2XOXA 4KGZA 5IYZB 4TQAA 2ZSEA 1E2FA 1T6YA 1EX7A 3O3NB 3RSZA 1N2CA 4BO5A 4ZI3A 1GRRA 1Y8RB 3ZH2A 5AI9A 1GVHA 3GA0A 3C4VA 4H18A 2BIFA 4TLLB 2IOFA 3CRZA 1NBWB 5ITWA 4YRTA 1E1DA 5IKXA 3PLAE 4B3RB 2FEKA 2RAFA 3QM1A 2XT0A 1F1BA 1RABA 1SWWA 2HPAA 4R51A 4C3VA 5BRJA 4EYOA 3K9WA 1ZGHA 1F2TA 2QNBA 3DE2X 5FTJA 1MBZA 2RDMA 2AH5A 4JXKA 3ICOA 3G7NA 2FKNA 4FB5A 2Z3VA 4N7JA 1LS6A 3MAJA 2PWBA 1M2GA 4OI4A 3N8HA 3FNFA 5J5VA 3ZNQA 1FP7A 1WXGA 2UUBB 1YVRA 4QTZA 2GWRA 4IKEA 2EC5A 4CKZA 5C8ZA 1X1CA 2I03A 3EPRA 2UUAB 2YZNA 5L3VA 1XEWY 2Z9BA 4FEYA 2H85A 4GEKA 2ZUCA 3KUXA 3ETCA 3TZBA 3LBNA 2B3DA 2JGLA 3BGIA 3S2ZA 5E9QA 4EW2A 3UWSA 3DZJA 3CE6A 4OYRA 3TZEA 1MHTA 4Y6PA 1AKYA 2QMYA 2NZJA 1MPXA 5EJ2A 5AYVA 1KP9A 1P0PA 1KU6A 2QIOA 3L82B 1E4VA 1R9JA 3HS3A 4LI3X 4WXHA 5G02A 5LFAA 4TTVA 3P1JA 1D6NA 3UYKA 1S02A 3SR0A 3O3MB 1TIBA 1S4QA 2NZXA 3VTFA 4EY3A 1ABEA 5KMGA 2BUBA 4E1AA 3MQ2A 2FXVA 3G0IA 4ZMRA 1KXZA 4GRIA 1L4YA 1P0QA 5FL3A 4C7VA 2K7FA 1ZVJA 1TFRA 1YC5A 3ROGA 1R5NA 3PUXA 3TM4A 4EMBA 1C3LA 2FZEA 1U1CA 4ALKA 1SRRA 3MFYA 3KHTA 1J2YA 4WNYA 5DXFA 1PV1A 1R0RE 2FDXA 2VOEA 4QL3A 4ZQHA 5HIMA 4O63O 3RUHA 1WEHA 2X1MA 3OE4A 1U90A 4MQMA 4ND8B 1K66A 1SHLA 1V6AA 3HPQA 2GA9A 3TW8B 2WAAA 3IBTA 2ZK7A 1HDZA 1BDBA 3ET4A 4GR9A 4A36A 2HCBA 1MAAA 1Y3AA 4E2FA 3HL0A 1CB0A 1NUUA 1HE2A 3A05A 2EW2A 3QRWA 2J4DA 4ZO8A 5BWNA 1JTEA 5CVJA 3M4YA 1R15A 2D1YA 3KTAA 3RC2A 5MDHA 4LXXA 4U3JA 3G1WA 4FPXA 2GN6A 4P31A 3TOVA 1EJ2A 3HCPA 5KTMA 1UMDB 4UDNA 1OBVA 5DEOA 3RKRA 1M8PA 1A4IA 1ZXBA 2J7PA 4WKGA 2CL6X 3IQGX 2HV9A 1SKQA 1F5SA 1LB1B 1NNLA 3ANTA 3CSSA 1YZGA 1DTWB 2ON6A 4IHJA 4KSYA 2ZYTX 1FXWF 4YDQA 5BR4A 5D8DA 4B17A 4TWRA 4Y1RA 4QARA 4WJLA 5EUQB 3WBBA 1QFZA 2I3AA 1II9A 2G80A 1V37A 2AXEA 2CMGA 2PU5A 1QDEA 1YRHA 4OJTA 2YKGA 3BMQA 1I51A 4FMDF 4G5XA 4ILEA 1U7PA 2HF2A 4XUGB 3W8DA 1XXLA 1IOVA 3U19A 5BUQA 1C9YA 1ZK1A 2J9FB 1KO5A 2OBNA 3IQEA 4XRGA 2LGJA 5JADA 2PMFA 2JI6A 1P9NA 2CNLA 2IEBA 4IIFA 4LXHA 3WHKA 3H11B 1S1CA 1PK7A 2IS1A 4J1QA 1PU2A 1IBKB 4HTFA 3I1IA 2QYSA 4CL0A 4MR7A 2AK3A 1MJGA 4DMFA 2QOEA 4E4RA 4TLDA 1OMOA 4LZOA 1NWHA 1TEVA 2ZUWA 1GSAA 4ED9A 5D3MA 5J4LA 1GPKA 3KR2A 1CKEA 2GLUA 3M1IA 4NBSA 4IMIB 4ZI5A 3AV0B 1RKVA 3AETA 4MIOA 1N6NA 3CLTC 4LOAA 4I0WB 2BHRA 2D4AA 4LYEA 1ORRA 3I5AA 4PC1A 4TLAA 4ZEVA 2I91A 5A0VA 2MOKA 1IEQA 1O94C 3TTVA 3P9ZA 4YRAA 1ULHA 5B57C 2WWYA 4CWAA 4ABTA 5JO9A 3MC1A 3QJ5A 3MRXA 3OSZA 5IF3A 3FHJA 4J0EA 2GSWA 3FI9A 1W5EA 3LT4A 1DKQA 3B70A 4PLZA 1JU3A 2RGGA 2WF9A 3FBTA 4QOFA 5YASA 2RKWA 3ORRA 3UGJA 4G2TA 3BZUA 2PPVA 1SFRA 3OSUA 4LF8B 3CZ5A 1Y3IA 2GCEA 3GDHA 4HZUB 1Q1ZA 1U8TA 3PXUA 3G8YA 1O54A 2C84A 2PMDA 3N74A 3PYXA 3RRMA 2HHLA 2IITA 3ZBPA 1THGA 3CLVA 3FFBA 2WEKA 4ZJYA 1EG2A 1AY0A 3GPIA 1T5OA 4GZ5A 3RBAA 3K6SA 4J3NA 2YN0A 2OM2A 1OX4A 5E0OA 4AKTA 3IVXA 5E4TA 3CZ9A 5C1PA 2XH8A 3HRHA 3TUZC 3RRBA 3TX6A 3UY4A 1FOEB 2ERCA 4D7AA 1SZPA 1GCUA 1HWYA 2P2GA 4KDRA 3PIIA 5A7HA 4UOQA 1EK1A 1K8QA 1KO4A 2EFHB 4IMPA 2G9NA 3UAOA 3UC5A 1GQQA 4C3ZA 4E94A 2FEWB 4HYQA 4MVJI 2PR2A 3WK9A 1KO7A 3YASA 3ZLTA 3QELB 2REXB 1VPWA 3ZCQA 2XWPA 1VJGA 3D3NA 3DFZA 1J22A 4WXYB 4OX9B 1MX3A 5LWHA 2BM1A 2WSBA 4DA6A 3KVOA 4HEQA 2X9QA 4MKHA 4L6IA 1UBEA 1P9RA 1ZICA 4LQDA 2XT6A 4YXWA 3O4VA 4R05A 3W7VA 2PX0A 2ZFUA 4N0QA 4JP1A 4GXRA 3EMDA 2ZETA 2HHJA 3OZIA 4E14A 2BGRA 1Y5LA 3OF3A 2P2YA 4U7DA 3G2IA 4K88A 2WSSA 5F5NA 5CD9A 4KI7A 2XB2A 2V1XA 3CCFA 3ZCTA 2ETVA 4F1KA 1NRXA 4IR7A 1HEYA 1V8ZA 3H5WA 4HXEB 4K3VA 5EE9A 5GJWC 1ZVQA 2A2ZA 3G2KA 1ULBA 2PXAA 4YAOA 1XF1A 4RH1A 4RH3A 5T7BA 3KD2A 3VPFA 2AWNA 1GUFA 1VIMA 4Q01A 2R65A 4B6FA 4OV6B 4A91A 3RC7A 2JJ1A 1BFDA 3F5SA 5B3KA 3THXB 1O0CA 1M2VA 1IZZA 4MIYA 4BMZA 4F7DA 5GZ3A 5DM2A 3TAHA 2A9JA 3ADOA 2IHNA 3IUPA 1ZM7A 2G9QA 2H0QA 1UPFA 4GP9A 5J5CA 4EPXA 2GERA 1L5QA 1KJ9A 2X19A 4HLDA 1A5AB 3SVLA 3KWLA 2YZ2A 2GXQA 4YCDA 5LXTB 1PZEA 3D4BA 2ABWA 5P8WA 2O1XA 3Q7IA 2WT4A 3JQBA 5DLPA 2EQ5A 2VQFB 1BXGB 3EC1A 4H6WA 1RW4A 1MT3A 1XRMA 1Y9DA 4XYMA 4Y6LA 4DIFA 1XDSA 3AY0A 4KFCA 1HUQA 4D9CA 1BA3A 4PHGA 5JYEA 3N2EA 1IIBA 4MINA 3IOYA 1U0JA 1Z0JA 5EJGA 2B7LA 5CBPA 1RWOA 2CWDA 2FR8C 2DOKA 3R3XA 3RSOA 3ZG6A 1F7VA 3EXHA 2AKEA 4UTRA 3GT7A 4J3JA 4J7AA 1ZUIA 2CLMB 1YASA 1NUQA 3W2FA 2MYTA 4HADA 3OEED 4B6GA 3F97A 1WCYA 4KWTA 3T7RA 1XTJA 3TJRA 3NV7A 4BPBA 2YOGA 2M6LA 2ZXEA 4NYJR 3PHBE 3I4FA 3VBCA 4ZI7B 5B2EA 1C7FA 1GPYA 4QGFA 1XVLA 1THTA 4EHHA 3K9CA 3TTWA 2WM3A 1GU0A 3FNQA 1J2RA 4Q66C 1A8IA 1NJGA 1O94D 2JCGA 2VAWA 3KD3A 3PI7A 3D6AA 4IOJA 5AOCA 5SY4A 1TTQB 1ZU4A 3NH6A 3EC2A 1V41E 3OCWA 2VBCA 1SVIA 1C3OA 3G7UA 3TB4A 3U80A 1UAYA 1VSVA 1COWD 2UZ1B 4BP3A 3QZUA 2JB9A 2B8NA 1TUGA 1PWYE 2CJPA 4MQEA 3UW1A 4I1SA 3IA7A 1EFLA 3GRAA 3NVAA 1DCMA 3EXFA 4PE5B 4B3BA 3TFOA 4FM9A 2QE6A 2IY9A 4B84A 3CVWA 2GAFA 2WKPA 3B52X 2YW2A 4F4HA 2Z3ZA 3PX7A 1UJ5A 1EUCA 4LOKA 5BW8A 4RVOA 1ZAKA 3WLLA 1HV8A 4X1OA 1YHZA 4YJHA 4B6QA 2EGGA 1PQWA 4L5AA 2IW1A 4TRJA 3KOMA 4W6ZA 2DQYA 5JNTA 5JS7A 1H8HA 1LLDA 1S8FA 8ADHA 1KARA 1YH3A 2HIGA 2OKCA 4Q5IA 5IZCA 3HKBA 1L5HA 2FPOA 5CLHA 1FL9A 4QUBA 2PAAA 1QIHA 4DJAA 2DSTA 4HLCA 4PLCA 4CV3A 4XOIA 5FLEX 3L49A 1G20A 1PTKA 2CFOA 2AHRA 4N48A 3TZQA 4RZIA 5IW8A 1OZHA 1JIQA 2NIPA 4MDYA 4DR2B 1N2XA 3ASYA 2X7XA 2ZUEA 4L9AA 3O3CA 3H9BA 1C9EA 3ETDA 3DXZA 3HDTA 3OCJA 4WUTA 2IXTA 4XLLA 3OAAD 1XQVA 1XTBA 2E48A 2EFGA 4QFCA 3PHCA 3E0XA 1E3TA 3RU3A 1CEQA 3CUVA 1RQXA 5K5EA 1H6AA 1E99A 3Q2KA 2JFUA 1TJ4A 2VP2A 2RGWA 3ODPA 1FXWA 1KJIA 4S35A 3MYRA 3HCOA 4TTJA 4COOA 1JHZA 1SXHA 4KO8A 2AD5A 3FNHA 3PUHA 2P6RA 4I4TB 4MIKA 3GLKA 3MD0A 4CEIB 1UJ4A 3INRA 3OJCA 1X87A 3H5OA 3NHPA 4HDSA 3ST7A 5BR8B 2B4TO 4NBVA 1A9YA 3GRUA 2BI4A 3KELA 1Y63A 3FDJA 3T4EA 1Y1TA 1Z73A 2BAGA 1E6MA 2DWOA 2BEUB 1YZKA 4RTPA 1Y9EA 1G7SA 1U28A 2CL0X 2GEJA 2HYDA 3P2IA 4V2UA 4G4GA 1E58A 4AZ0B 1G98A 3OOHA 2BOVA 5A3VA 5EIBD 2WAOA 4AICA 4K05A 4W5JA 1BX3A 1K6MA 1VRCA 1GFZA 4V0OA 1IOWA 2R7KA 3D2CA 4BEVA 1FRQA 2ZR0A 4MMZB 3VRHA 3SHFA 2O54A 4FXOA 2JFPA 1JSRA 2KWIA 1PF7E 2DRIA 5JIBA 4HYYA 4XW2A 3P8ZA 1SVOA 2AJBA 1PT9A 3A9SA 1XJ5A 3JX9A 1ULSA 1XQ9A 3HEAA 4ITRC 4ZDWA 3L1VA 1QE5A 3CSDA 4Z1MD 3LQQA 1A77A 2VPTA 5I7UA 4EJ0A 1PTJA 2B9VA 3IBYA 5DBEX 2REQA 4GPZA 4NE7A 1DAOA 5B12A 2MIIA 5AD1A 4LC0A 3ZHSA 3C5EA 3P0HA 3I2FA 2XE7A 4F3YA 3W77A 2AJLI 4B2PA 4DGSA 1IG0A 5T41A 4QLBA 2D5IA 2X8AA 4AZVA 2EZUA 4H4DA 5JZSA 4BATA 3KYJB 1ESCA 5KX5F 3IMFA 5A5VA 3G82C 2C5GA 5IKEA 1AA6A 3EGIA 4FYYA 4DDMA 4JN6B 1ZQ9A 5BQXA 1QAOA 3K9NA 3QVOA 4GZ6A 1EA5A 4NCIA 5DK4A 2FVXA 3IPCA 2GNPA 3VKUA 3UAGA 3ZZNA 4Q9DA 3FRJA 3DTYA 4PO3X 4URFA 2I6GA 3B9BA 2IV3A 3DONA 3MLEA 1XZLA 1EGAA 4JY7A 3GDFA 4PR0A 3I5UA 4GX0A 1H4SA 3CLUC 2JGKA 2G4VA 5JPCA 3BZBA 4OVKA 4UASA 4CTOA 1KR2A 1E9EA 2X14A 4MGZR 3VHQA 3PUIA 1QWOA 1YULA 1Y6RA 4FYKA 2I2DA 4FR2A 4NXMB 2RHDA 1Z0UA 4M8LA 3U56A 1YBVA 4FFBA 3BXOA 1W30A 2G76A 5FNVB 1B8OA 1SBIA 1V6CA 1RU3A 5FTLA 5FULA 2C1ZA 1Y9AA 3ZLUA 1ZK4A 3HCBA 1QKKA 3OMXA 1LDGA 4MLDA 2WU1A 5TSDA 4KQKA 3EPHA 1X9IA 3BUSA 3DMTC 4N49A 5E1OA 2NOAA 4K8OA 4TS3A 4W5TA 3UKOA 5DBOA 4EI2A 1DIOB 5F78A 3ZTWA 4DLWA 1PJBA 2PUDA 1T91A 1G1AA 3RTAA 4LDRA 2FG6C 1K89A 1UKVY 3S55A 3H99A 2XDWA 4MJ3A 1L5LA 1PGPA 3DL7A 4AW9A 2EP8A 1T3HA 5EOVA 1UKZA 3F8SA 1OIVA 2GA8A 2WM8A 2VJCA 1E79A 3PUYA 4LK2A 4PHHA 5FUYA 3VAZA 1E1QD 5BNFA 4URXR 1NU6A 1ZHOA 3R5KA 5ENVA 3BEDA 5G0TA 2WKRA 2EXXA 3NHRA 4OGKA 5ESWA 2MSNA 621PA 2XYRA 4X94A 2Q3EA 1VA5A 3SHQA 4QGHA 1RRFA 2YWJA 4B3CA 1GHTA 1MO4A 1Q0LA 3F6SA 1KF0A 1DMRA 4LXIA 5J43A 1RQRA 1DARA 1ZCFA 3BGOS 4BNTA 2E1RA 4X20A 1T3TA 4HVAA 2PYDA 3FPKA 3DAYA 2Z5FA 3IIMA 3QLJA 1M2EA 1A7KA 3ELUA 1IM2A 1BWRA 3HMKA 4DILA 3GC6A 1UT8A 2FZWA 3H3FA 1FSZA 3DE7X 1CIJA 4M4SA 3A6JA 3ITKA 4E15A 3SQXA 3WMGA 4L28A 1GILA 4B46A 1DC4A 4Q9AA 1YB7A 1JIUA 3AWDA 4LJ6A 5JHHB 3DAOA 3LUPA 3DV2A 3OJOA 4L02A 3A1DA 2V6JA 3I9V6 2ONKA 4DY6A 2LDBA 3DLPX 1RCTE 4CN9A 4EKYA 2QVZX 1GTG1 3GYGA 4FD3A 1MKYA 2CZQA 3DDHA 4JLSA 2J9FA 2PR7A 5DTEA 4EB0A 1E2BA 3DVLA 3SQDA 4BZZA 4Q4HA 4ZRDA 3EGDB 3LDUA 4IHQA 1ORWA 4CUKA 3C0KA 1Z0DA 1SD2A 2HX1A 4Z86A 3C3YA 1P72A 2PUAA 5GWXA 1HE1C 2Q3FA 4HMQA 3VOTA 4D8WA 1SK9A 5JSUA 3U6KA 1Q77A 2N1MA 3VYWA 1N5LA 1A82A 3FTDA 4BEBA 4Q34A 1KR5A 3PRKE 1BWQA 1RHQA 3CEHA 4WT7A 2ZQ5A 3SOPA 1YQXA 2J59A 4L8GA 3OPNA 4CEHA 2WOJA 1EHIA 4J0HA 1N3BA 5JMTA 5HILA 1SHJA 2DC1A 3RRZA 4D57A 2FJ0A 4HAXA 1CU1A 1N6LA 4E0BA 3NU1A 4EHBA 1PYGA 4B9EA 3F5DA 4RC9A 1B1CA 3H17A 4IIUA 4LVUA 2D3TA 1XU9A 5ALFA 5IMBA 1G21B 1T0JB 2I1LA 3PDHA 4D0SA 5KTTA 1BO6A 1M2OB 4B4OA 1SCUA 5ADVA 5IG2A 3X2SA 5JH7F 1H8EA 821PA 1I4DD 2C8LA 5TQ0A 1DEAA 3L43A 1XVIA 2C5AA 3CWCA 3DCYA 3L02A 4MRMA 4MMYB 3W78A 4C5BA 2AI3A 2VK4A 5D6OA 1KQOA 5FCDA 4YONB 2R00A 4IV8A 2NYAA 4OQDA 4L0MA 2EW8A 3AFMA 4O4HA 3U62A 4CM8A 1ZGCA 4I50F 1CEYA 2Q29A 3I05A 3RVMA 5KJ6A 1X7YB 3QBEA 1C7IA 5LQRA 1HYGA 1PHPA 3DKPA 4EW3A 3A6LA 4IPTA 2VZ8A 5GADl 4LVNA 4MRVA 1CVRA 5J58A 4EUSA 1KHTA 1T6NA 2XB6A 2FGJA 3G6WA 5EP3A 4DJ5X 1RXVA 1NUPA 2B6HA 3IHKA 5G0WA 3KQTA 1LTQA 2VEDA 3UHJA 2BR3A 2YY5A 3SE7A 2P40A 5JCOA 5TPWA 3S70A 1H22A 2IQ5A 2C9CA 4DT1A 1Y7IA 1OYWA 3SJCA 1WPXA 1U2PA 4G56A 2RI0A 3SFTA 3LYUA 1Z63A 3W90A 1G3UA 1VRVA 1ZVKA 3LA6A 4E08A 1U3UA 5CB0A 5IANA 2BELA 1I1QB 3HXTA 4JXXA 2OO5C 4XUEA 5JDIA 2CV2A 4QGBA 3LX8A 3DO5A 3HFGA 4M0DA 2XMCA 4LX0A 4UUNA 5BSHA 1XYVA 5TS2A 2QEQA 3Q1LA 2O52A 4UCXA 4M89A 5F23A 3W2IA 1KSHA 2R3SA 4EMTA 2H1FA 3QV2A 2VSFA 1U5BA 3IPYA 3FDZB 1IAVA 4I8DA 5L4SA 4L8VA 3G0HA 2FDRA 1XEWX 1UAGA 3GR6A 4UAGA 2NZYA 3NWOA 3ODGA 1EIWA 4RGQA 1SUFA 3ZN2A 4JDPA 2V59A 5LJLA 4TM8A 1JIVA 1NFQA 1U11A 4EYEA 3WO1A 3GMTA 1YKGA 5ICGA 2WYHA 5F2EA 3W5SA 4BGUA 2J0UB 4E5NA 1VPDA 2G0NA 2OOKA 1ZK3A 1PJRA 4IDAA 3AKZA 2P79A 3IBFA 4C2UA 1I0LA 1D8AA 4WFKA 4LYFA 1FYFA 5KHAA 5A3QA 4IV0A 3INGA 4MRNA 1Q7GA 5KTNA 1DWPA 4IQ8A 5JO0A 4WLEA 3I0ZA 1MABA 1SU6A 3OCZA 2VWQA 2WZQA 1QMPA 5JAHA 2PS9A 1RBMA 3I58A 4WOCA 1VE1A 4YMVA 3T0IA 4Y8VA 1QHNA 4HDSB 1Z39A 4I1PA 1SQFA 1EVJA 1MA0A 2IYFA 1SXJC 3HJBA 3OZ7A 5AVUA 3EPLA 3FB4A 3Q6IA 4LZAA 4BV9A 1ECBA 2Y1WA 2FPGB 2HEIA 3E82A 4PIMA 3V8NA 4WBNB 2P9JA 5JCJD 4ARZB 1UKAA 2R8BA 3JQ8A 4MH0R 3M33A 4QQRA 4TRMA 2ST1A 4GRDA 4MI1A 5GV7A 1XKQA 4MWOA 5TEWA 2FNAA 3HY4A 3AFGA 4FVTA 3EZGA 4L4XA 4Y0NA 4Y2RA 5EJFA 3VGJA 5C8XA 5ITSA 1GLVA 3E05A 1VJRA 3K6RA 2RD2A 1ZNXA 4LJYA 4RHUA 2C2GA 2FQ1A 3H5VA 4UDOA 1UEXC 5K3SA 2QBYA 2YL2A 4LRTB 3TAXA 5KNDD 1RI3A 1GDHA 1GP2A 2QLNA 3BT7A 4JYMA 3ZW8A 2IPAB 3N87A 1YOVB 2Q3HA 5L53A 2O1EA 2AR0A 4GOLD 3NTUA 3ND6A 4L9SA 2FMHA 4PCVA 2CB0A 2XVAA 1GG9A 1GPJA 2VH1A 5AICA 1ZOLA 1Z4OA 1CZHA 1GV0A 1Q22A 2EGUA 3ZLBA 5BV7A 3ZNNA 1OBOA 4DM4A 2Y8EA 3IELA 3ZCSA 2O20A 5IF9A 2BFMA 1L7EA 3RYFB 1AF4A 4IIJB 2ZRHA 3MTAA 4CUJA 1W93A 5I7VA 4UU1A 2V97A 4Q7MB 3MINB 2DP4E 1STOA 1G3MA 2FUCA 2H2IA 2Z3WA 1RWXA 1JUDA 1C0LA 2XNDA 4AJOA 3ZVMA 2PZJA 1XTRA 2YZMA 4WEQA 1XZAA 5FR2A 3M82A 2GQ0A 2WP8J 3MCAA 4YMGA 1B16A 3E7FA 2XHEA 4GWLA 2MR5A 4FQ7A 3L4EA 3W6NA 1QYVA 3CVJA 1DBWA 3M6MD 3TTTA 3SS9X 1JLSA 3FOBA 3PZBA 3Q11A 2N0SA 1Y8CA 4EB8A 2Q21A 3LFUA 5GY7A 1N4DA 1C8KA 5F7OA 3BMCB 4LAFA 3UB3A 4YMLA 1N75A 3FF4A 4L15A 3MIZA 3TZLA 2I6FA 2YUIA 1W52X 3DCIA 2CZCA 3NG1A 2CFCA 2XGGA 3IQDB 4GSLA 5FPYA 5BNZA 4DKXA 1QZUA 5KJFA 2HL6A 3IUJA 2QJTA 4BMPB 1JMKC 4ZTUB 3AILA 3OZRA 4AN4A 3FJOA 1B8UA 3ZQ4A 1E5VA 5ADHA 5A9SB 1XNGA 4X8MA 3WBJA 5DXAA 4IBOA 2C94A 5LMCA 2XDQA 3M1YA 3EX7C 5THKA 1FVXA 4JBIA 3DTNA 3V6LA 1CRPA 4RVDA 3QGMA 2NP6A 3WHPA 4UW9A 2R0QC 3M7IA 4EVRA 2OD7A 5BSVA 1NZDA 3MERA 4MLPA 1NY6A 1SPXA 1WZEA 3R9XB 4S3MA 3WGYA 1Q1AA 2Z09A 4MZDA 4UHEA 3CNNA 5C0OE 2J3QA 5I4KA 1BXGA 2CUTA 2OP1A 2B4YA 2Z2KA 2EWVA 2C4HA 1P5FA 2D59A 4Q4DA 5B6PA 3LCVB 1VKOA 5IKPA 1J99A 2X2FA 4KKVA 3TTYA 3TIGA 4REOA 4MVJE 3ECAA 5C5EA 1NUTA 4PNZA 1TM2A 2AQ8A 1UXKA 3D6VA 1BMFD 1LUAA 1DAFA 1IN8A 4Z9XA 2O2JA 4KN8A 4O3MA 3IQIX 2LUOA 4F72A 3QUCA 4GWGA 4JEUA 4IDNA 2BD0A 1YB2A 4AWXA 1PVVA 3A9UA 1KP2A 3FYTA 3JVIA 1RRMA 4OKNA 4UBMA 2V58A 3CZ4A 2CE7A 4RQTA 1WULS 4J91A 3BKWA 1VPEA 2JK1A 4P4SB 1XEXA 4L4UA 2Y0DA 1Y4DE 1D6SA 3USZA 3WLJA 4EB6B 4BFYA 2GFIA 3RUAA 3AR9A 5I9MA 3IUYA 4NX2A 3FOWA 4XDYA 3SXUB 4PZEA 2Q5OA 1UMBA 1HO3A 2V1UA 3LIPA 4MVJA 2C0PA 1PG5A 2FE4A 3Q5EA 5AWFC 2WUEA 1WD7A 3WVNA 1EM8A 2I99A 3GNLA 3RUPA 1ORIA 4YI5A 3FYDA 4RM3A 5KJEA 3TIVA 4LHYA 3IR7A 4RLQA 1E2QA 1QIDA 1XD2A 2LNDA 1SBQA 4CR8A 5HGJA 4LQ4A 5BPHA 3HUFA 3W9UA 121PA 2ATIA 2OCBA 1Y33E 4W99A 3OUZA 3SQOA 4NONA 2VUHB 2F8TA 3OOWA 1X42A 1FDIA 3V55A 5AVYA 1Q7CA 3OM0A 3N2KB 4CDMA 3PE4A 4LHXA 2BUCA 2YWGA 4MUJA 3WLPA 4JKYA 1N9GB 1RAIA 4URWR 1QC5A 1U0EA 3IBSA 4FFPA 1SC3A 4GLJA 1JWLA 3RU2A 1XNJA 3KLMX 4X44A 2IBSA 2CCJA 5JH7B 3H1GA 3NTRA 4ECAA 1OLUB 1F1JA 2ZRJA 3I37X 3UXYA 1CUSA 2C07A 3OHPA 4O33A 3HJUA 4JKIA 4A7PA 4E7OA 1NBAA 1JKFA 2OLJA 1M67A 3H5TA 3FMVA 4MUAA 4Z5XA 8OHMA 1Q2UA 4MWSA 1C9KA 5DHFA 4I1UA 1I1HA 4OHUA 1TL7C 4OY3A 4C1BA 1FXSA 2GNAA 2HRCA 2PX6A 4NKRA 5DO9A 4ZVPA 3VBEA 1UBUS 3TF5A 3RJTA 4LX8A 3EZ6A 3R9IA 3QG5A 2IV2X 3EXHC 1KZ6A 5K0JA 3VSDA 5KJ1A 1OT5A 2FR8A 1PZMA 3HMQA 5LC1A 3WLRA 4C1NA 4L3WA 3NB0A 3HR8A 2GHQA 4HEA1 1R0SA 4RELA 2FPIB 3A1TA 4U7PB 1N9KA 2RAVA 4FYXA 1NMQA 2A33A 1Z17A 3L0BA 3MWKA 1HNWB 3LHDA 1BVHA 4LTDA 3LT1A 1WR8A 2G4LA 4UTXA 5HJ7A 4GF5A 3ED5A 3MK31 4JVNA 5TQ2A 3AHGA 3IAS1 5DN9A 3ZKWB 1LRKA 1EWVA 1PNVA 3O4JA 4JYPA 3OE5A 1TTPB 2PX4A 4MR7B 1Z7GA 2JBWA 3HDGA 3GJ3A 4QOJA 4HDCA 4K9PA 5AKZA 4G0VA 5DISB 1TC1A 4O0LA 1UMCA 4FDVA 3QE2A 4KXVA 4QPZA 4ZYLA 2XKKA 1E9SA 2J3IA 2JIPA 1Z29A 4KR0A 2QDXA 4L73A 1NLFA 4C5CA 2ZYUX 4QU5A 4YRCA 5KVSA 1FQKA 3FYUA 4X24A 1V1MB 3VZPA 1CK4A 2GMWA 3LLSA 4S12A 1I32A 5A71A 2R11A 4ETNA 4XZ3A 4KDEA 1F2DA 2HR1A 1QQTA 1QLJA 2QUJA 4PPNA 1TQ8A 2QVYX 5E6SA 5GZ6A 1O3YA 4EYGA 2J3EA 1RRKA 5A5EA 3UAYA 4DQLA 1A9PA 2VSQA 3IP7A 221PA 3ILYA 3D4PA 3WO0A 1U3VA 3N07A 1FNDA 4WVFA 3K09C 5GONF 5EWJB 4BLUA 3K0KA 3K0AB 2O4CA 3QPBA 2ZI6A 5KYVA 3RQIA 1FMFA 5CEFA 1P3Y1 4KE8A 1XK7A 1LA2A 1Q6ZA 2MHCA 4S2EA 3UK1A 3V8MA 1IY2A 2GM3A 1DXHA 3CB4A 3T0FA 1T1RA 1YI0A 2ZIFA 3RD5A 4BU0A 2QN6A 1DEOA 1QR6A 3LYAA 1WF6A 4TLBA 5CITA 3VC1A 3O3OB 3WWOA 2XNDD 1TAHA 4EPTA 2VR1A 5HE8A 3T5CA 4B4UA 3IUMA 5ALXA 1X1BA 2PD6A 3O0DA 2Q41A 1V2HE 1IJEA 1D9ZA 1IB6A 1WWKA 2AW5A 1XZHA 2BHLA 3KQQA 4LSMA 4RKEA 4ZT7A 1C2YA 3NJ8A 4M7RA 3ZV3A 4OSPA 4A15A 4G1BA 3ZIAD 4RZQA 1CEXA 5H68A 4WLOA 1UBCA 4L76A 1BJTA 2ZTLA 1TMGE 4AURA 1OJLA 1MGOA 1BU5A 1B15A 1OAKA 3V8BA 2AZTA 1NQUA 1PWZA 4EATA 1I7QB 1W5FA 1AN0A 2OP0A 5CTJA 4KZPA 2N42A 4F3KA 1BVRA 1P6UA 4PSAA 4C7MA 5IVKA 4OI0A 2WZDA 3JQFC 4RQAA 4FMPA 4DV6B 3K0AA 1FY2A 2HXSA 3PGMA 1V8OA 1TA9A 3RBXA 1N6OA 3SM3A 3R7WB 2IIPA 1GG5A 3H97A 1NW7A 2K2WA 5IABA 2CW5A 1T9KA 1WHTB 4GL4A 1N0IA 4BYGA 1D0SA 1ONOA 3WHLA 4JU8A 4NJMB 1U28C 2OHHA 3OX2A 3PR1A 1RZRA 2GRAA 1QKJA 2VI5A 3CISA 5AOAA 1QE0A 1EEXB 4N0EA 5EMNA 4H3VA 4GZ3A 5TPZA 1C7QA 5DB4A 4BLVA 3Q1KA 1OHHD 1GAEO 4B6PA 3HH8A 5KSOA 3KJFA 5F9HA 1PR6A 1OOEA 3OQIA 2Y3IA 2E4ZA 4Q16A 5EE1A 4BZWA 4MWZA 4UAUA 1E79D 2BDTA 2OB1A 1TFUA 3AL2A 3H18A 3NHBA 3QKTA 3RAJA 5K8JB 5KTOA 4U7TB 4KDFA 4D9FA 3PJGA 1FZQA 2CLHB 4ZCPA 4CF7A 3ROEA 3HUEA 3IQXA 4U6SA 1GTZA 2QAGB 2GARA 4GI1A 4AS2A 4W1QA 3FPCA 4OATA 1JHYA 3HV0A 5TVGA 4EARA 4ENWA 1E9VA 2NZ8A 3CGGA 4ZK2A 1T9GS 3RVBA 5FL7A 3HZHA 4JLVA 3W5IA 1EHYA 5DLEA 3WWCA 4F0JA 1VLQA 1UBRS 4L74A 1KK3A 3EVAA 3ETHA 5IXSA 1NBMD 3BMNB 4P84A 5J23A 5FWXB 3VSBA 4LY3A 5B7NA 2I6SA 2XRMA 2PUBA 2R8ZA 4GKKB 3WL6A 1EESA 5IN5A 4QBTA 5TXGA 3RROA 3TSCA 2ASEA 1KIMA 3A2LA 1NDHA 3GCGA 4MV7A 4BHTA 1LC0A 2H06A 4G24A 4JGIA 4PWZA 4DM3A 4QU8A 2IHUA 3BSFA 3C6YA 3NT5A 3H4IA 5C80A 4HQ0A 2ESRA 1N1DA 1X7YA 1J8DA 2F1OA 1ZIYA 1CUVA 1OXTA 1K7SN 2WHYA 2WPDD 2FU5C 2HNBA 4M55A 4Z8XA 4C7BA 2IBTA 1P31A 3JW8A 2J5BA 1IPEA 3LW7A 4EUKA 3JWHA 3BE8A 4ZYZA 1HSZA 4CI0B 4UMEA 1KPHA 1RHMA 4QDKA 5I8PA 1Q15A 2OV8A 4KEAA 3EDRA 2B0JA 2QLMA 1Z2DA 3BFVA 3QIAA 4P3NA 2PBRA 3CLTD 4K87A 3G2JA 3LYHA 2KX7A 1I0IA 4J49A 4L8WB 1IWPB 2DHRA 1FMJA 3W2TA 4TS4A 4HZUA 2WAXA 4UXJA 2ZS8A 2ZRFA 3VDXA 3CVUA 1UAAA 3L0IB 1EZ1A 1DBQA 3A10A 1LPBB 3L1KA 2NTJA 2IXFA 2ZCVA 5TX7A 1QTRA 3IC5A 1B0AA 3QLVA 1N5IA 3K1AA 3I4LA 3R3UA 1OYVA 1F17A 1XP5A 4JC0A 4QHYA 4W7IA 4WLFA 3QEAZ 4R7TA 2IXDA 4RBNA 2AR7A 4RIFA 1W5BA 2LDXA 5CA1A 2ZE5A 4HQRA 5EKDA 4RPLA 1VC2A 2ZEJA 4MJLA 4BB6A 3L06A 5FUQA 3JVUA 4R3UC 4TWJA 1IHPA 1SC6A 4M49A 5H0IA 2Q46A 1RPZA 2XZDA 1Y4UA 4PTZA 3U1TA 4BX0A 2Q0HA 4OXQA 5I8WA 4CL8A 1EVYA 1TM1E 5JPIA 3AVYA 3IOBA 1E18A 3O2QB 3T12A 1W4AA 1PI3A 1XTZA 3T5GA 2C7RA 4N9WA 1XZGA 2ZULA 4YDHB 3CZMA 5EWMA 4CKBA 1KH3A 3M9LA 3T3PB 4CODB 2JI7A 3ZWQA 1MA3A 3G8BA 4YECA 3WYNA 1ZSNA 1EA7A 2Q1TA 2OAQ1 2YC4C 3ENWA 1NJ2A 5GIPE 1QTIA 1ZI6A 2I6TA 3OZCA 4JL6A 2NT4A 1RJGA 5IDYA 3JALA 4GPTA 5BWLA 4G8JA 5JNRA 3KWFA 2Q2OA 4MUXA 2A30A 1RQ7A 4YAFA 2VQSA 4FDTA 4J0IA 4LHSA 5AVJA 5E1DA 5GM1A 5DRTA 4R3WA 3NAGA 3MWLA 2Q6LA 1J5EB 3WYAA 4KIUA 2VNKA 2I2BA 3R9XA 2M9MA 4GDMA 1QG4A 2NYRA 3OLVA 3A0UA 2O8EB 1DO2A 3RIHA 3OFJA 3TLJA 2JIDA 4QYTA 1W8DA 2N75A 1Q1GA 3AUFA 4INAA 5K05A 3DV9A 4ITVA 4O0MA 1QSGA 3CXUA 5DCLA 5TQJA 4OQXA 3UMVA 3PNVA 2X1VA 4OM8A 5KVCA 3B36A 4LNHA 1WW2A 1C7JA 1GNPA 1Q57A 1HEIA 3VC3A 4L2IB 3PUWA 3UWDA 5KQRA 5CDFA 2DPMA 2NTYC 1VI6A 3KFVA 1YDEA 2XTNA 1WQ1R 1KAGA 3NIWA 4M0KA 4YRZA 4YRKA 1Z6YA 4ZJUA 2VHEA 1JIXA 4MWGA 1NAIA 1HFWA 5BMVF 4B3MB 2VEOA 3T7DA 2OHGA 3THYB 2PSEA 3N8GA 2JHAA 3DAPA 3TQSA 2PT6A 2P6MA 4E3ZA 1K27A 4X6XA 3JWPA 4XDGA 3FZYA 2YWFA 3OZGA 1H4QA 4PNPA 3NHMA 3CLSD 3RUCA 1IN1A 2FSVA 3GJYA 2FY8A 3BD8A 4I9HA 5EQTA 2PA3A 3ECCA 4HWTA 2CLCX 5T64A 4YQFA 3CG0A 2Y1XA 3VVCA 4RFSB 4BKMA 3IP3A 1P7PA 2HKIA 1TC2A 4EVSA 2ZCJA 3EOBI 3R23A 4QT0A 3A3YA 3T3GA 1J0BA 2OORA 1OVMA 1LSJA 4UJ5A 3O7WA 2YRWA 1EFRA 3BCRA 4KX5A 3MQFA 5HXAA 2QRQA 3WHIA 1OV4A 4FHZA 1LS1A 1D1SA 2B4QA 3BD9A 3F1KA 2ZAGA 2I9KA 3ETEA 3VKFA 1Q1NA 3BHIA 1DGQA 1USUA 2O2CA 4ZAGA 3RRYA 4BGEA 1NR1A 3ZCPA 4DC9A 4KHZA 3ISTA 3F8TA 1GQOA 1N5RA 1PG0A 2XQJA 3ME5A 4Z7OB 2TMYA 2QGZA 4MYSA 2VPXA 3PUVA 4K3UA 1VI5A 3FTQA 1J8MF 4Q6WA 4B6OA 4CQJA 3QIVA 4BLWA 3AEKB 3ULKA 1KPIA 1IWBB 2HQRA 3C7CB 3CLKA 4RYLA 4EYSA 5HM8A 2GO1A 3GO4A 3C43A 4ZVSA 1B6SA 3V80A 1KNXA 4P8RA 3DOOA 4ZQCB 5T4FA 5CIWA 1OH7A 2M1ZA 3SBDA 1R6AA 1MO5A 2WIFA 2QSZA 2ZR7A 5HUJA 2D3WA 3GFOA 4AMYA 4GMKA 4XRRA 3RTEA 4PGGA 2M6SA 4CF4A 3T7KA 4TS9A 1TKBA 2ONZA 2VA8A 1YZLA 4R2IA 2W6CX 3RK4A 3R5JA 2HT1A 4YROA 3ZY4A 1X70A 2Y1DA 3PR2B 1YS7A 2HMAA 2PEZA 4CV0A 4FX5A 1ADCA 3H1EA 5EFZA 1GFIA 5FDFA 3SIWA 1T43A 2X86A 2PZAA 4G9GA 2ANBA 3QK7A 1WXDA 5EJAA 3M4ZA 3OA2A 1ULUA 1YB5A 4JLNA 2QLBA 3NJRA 4NZ9A 4RH0A 4X63A 5TJHA 2OFFA 1Z13A 3QVVA 3EAGA 3BXPA 1ZMTA 1SG9A 2ZVQX 4OGGA 4DF3A 1GUDA 1U9YA 4B0OA 3BYZA 3EA5A 3L0DA 3K5HA 4BBPA 4ZDJA 1Q0SA 4MYTA 2VUTA 3ASVA 4PO1A 1ZH4A 4FN5A 1JXAA 2G9UA 4BAUA 2IP2A 4ND2A 3SZGA 3FB1A 3V1KA 4PFJA 1OVGA 1HH4A 1G20E 3LC7O 4QT4A 3QE0A 1Z62A 2BDUA 4J0KA 4LDAA 1KRWA 1VPLA 3V6MA 1MGPA 2G88A 1EE1A 3ETNA 4M0CA 4NULA 3TLYA 5K4GA 2H31A 1P2BA 1L7NA 4XI9A 5DNUA 3O9ZA 3I32A 2Q4TA 4MW0A 5JAPA 4HX5A 4PTYA 5L4NA 4CIWA 3AP3A 1V3UA 3NKFA 3OIUA 1VQ1A 3LUDA 1GPMA 1TQ4A 2QTHA 2OYRA 3ZU5A 2IUYA 4U00A 5TT1A 3U0BA 4U2BA 4C2BA 1SB9A 4B35A 3PL1A 1G8GA 4Q3BA 2Q4BA 2X23A 4ZGGA 4UCWA 3VOAA 3PPVA 3JR3A 5K51A 1TA0A 3DE4X 3UAWA 3BA1A 4IEFB 4OU5A 4IZIA 2G0TA 4D45A 1ZM2A 1W87A 1E1KA 1LSUA 3FPLA 4TLMB 4TKVA 1J0EA 1R4ZA 2C82A 2IY7A 4MI3A 2Z2ZA 2JATA 3O4GA 3EVNA 3NHLA 4URUR 1ESNA 2HK7A 2IZ0A 2KB0A 4NL4H 4XQEA 2QRMA 3QW2A 4XQCA 4U7WA 2W71A 3DMTA 4QTYA 3G0GA 3U2QA 1R4AA 4F5EA 4ES6A 4C07A 2FWJA 1IIRA 4KPEC 2YX1A 2OBFA 2JDID 4D8UA 2FW0A 1NXSA 3VYTB 3PC4A 1A5BB 5IBPA 3OFND 3CX6A 4IZ6A 1PFQA 4RVUA 3V8VA 1ZKDA 4U3JB 1J0AA 1Z47A 4AO6A 1X3LA 3HDYA 5C7YA 5COBA 3DEFA 4ZTBA 2OKGA 3FCXA 1NXXA 2BKAA 1CG6A 1JAZA 2ODNA 4LCEA 4CMEC 1DZIA 4R54A 2R8YA 3CX4A 5F2OA 4G5HA 1FUEA 2VN8A 3R3HA 4NYIQ 4DB2A 5ECYA 4RS3A 2ZGVA 5JFTA 1SCUB 4CGZA 2VDJA 1PS8A 1I94B 2IU0A 4OXRA 1KQGA 4R4JA 4H59A 2ZYGA 2R6AA 1BKSB 1XFDA 2VSNA 3KJEA 4FEEA 4NNJA 2YHIB 2JI9A 3W4IA 4DMUB 2HCFA 5I5EA 2R5WA 1EGVB 1GWNA 2Y1FA 2OB2A 3AVVA 1NXPA 1IVYA 1ACLA 3BHNA 3ND8A 2YASA 3C3BA 1PZXA 5KNCA 1ZUHA 1QO9A 1XIVA 2C2MA 2QRGA 4GNRA 5FAXA 3U39A 1E0KA 1EINA 1KYXA 4U5QA 2V4MA 3FETA 1OIWA 4HRXA 3KXDA 1CCWA 1QH9A 1CHNA 2HZ7A 1GLNA 1Q7EA 1KHHA 5G0SA 4DXAA 1ODTC 3OHSX 1I9GA 3PFIA 3U4QB 5ICMA 3VPGA 3A1VA 3DHYA 3GUUA 5FYQA 1F14A 3VAAA 4YR9A 4TKVB 2CLSA 1DFIA 4QPCA 4TQGA 3EEYA 5DGXA 1UK7A 4NYJQ 5CP8A 4XCVA 1FU4A 3EWIA 1JZTA 1OXVA 2AN1A 4JJ7A 5JW6A 4FYJA 1R7RA 1IN6A 1UFOA 1R8YA 2V9CA 3F5FA 3G2NA 3IT0A 1HC7A 1X1AA 1ODIA 3IPAA 5C9ZA 2ZYAA 3T61A 1M5TA 2CVHA 3DAFA 3UPDA 2FN7A 3I04A 3EY4A 1BDHA 1V95A 2DETA 1V8PA 1SMKA 2XSZA 4MB6A 6PFKA 3NC1C 4GKVA 1ZXXA 4NNPA 1OTYA 5K6RA 3VDNB 4D25A 1ORHA 4AZ0A 4PZUA 2CCKA 4L08A 2HY7A 5I7SA 2R8OA 3H5IA 1EK0A 1XI2A 3B6IA 4BO6A 4IJ5A 1E2JA 2C2OA 5CXXA 1D2GA 1M83A 3R75A 3RUDA 3QKSA 2ZUSA 4YAEA 3QY0A 2MT9A 1NYRA 2DUWA 4D9BA 3E35A 4GVPA 1Y7PA 4YPFA 1OX5A 1KEPA 2GXAA 3PENA 1U8YA 3PRJA 1GT6A 1JLKA 1MH1A 2IYLD 5ES4B 1CZOA 2UZ3A 3HRIA 4GLLA 4P4LA 4XIFA 1QQ7A 1AU9A 4LK3A 3R4CA 5AW8A 1J2UA 2B3TA 3WLMA 4ETMA 3UCXA 3Q3VA 4B7XA 2EJWA 3QVGB 1IL0A 4FFOA 1IPHA 3WQRA 4YYZA 4WQMA 3UZUA 3U9SA 3X43A 1KFKB 1G60A 4MW4A 5T57A 1IOZA 4KFRA 5EZSA 3QG1A 4M86A 1T34A 3N2KA 5HQ3B 1O89A 1ESEA 3K2IA 2SNIE 3O26A 4Q3OA 3PVCA 1MP0A 1JKIA 1X7HA 5ALUA 2Z6QA 3OT4A 2CEAA 1JT9A 4U2EA 3BXEA 2X0IA 2XAAA 1BX0A 1R4NB 1YQEA 2QTBA 3PD0A 3PGA1 4G81A 4WZBE 3DUWA 4A2QA 4TTRA 4K6CA 3FM9A 3MWGA 2W2LD 3KZNA 3NTXA 1CERA 5JJ5A 3E1SA 3BFPA 4N0MA 2EJBA 2G1UA 2H1WA 1IU9A 2QKYA 2B4AA 1N0UA 2P5TB 2H9AA 5G1OA 3TSOA 3BMNA 1SG0A 1TUIA 3WL7A 4ESOA 1YFJA 1GZ5A 4X7PA 4ND1A 4Y2QA 3RTDA 1KBOA 2GRUA 2VDWA 4NS4A 3V4RA 2E85A 1WO8A 1E9AA 3NT4A 3SXJA 4IIGA 5DW0A 2X2EA 3AHJA 5LQUA 4N76A 2FZLA 3NZEA 3DP9A 3N0VA 1FX0A 3EPJA 2DPHA 4K03A 4ZICA 1ZD5A 3DDNA 2AFRA 5DIZA 2OUIA 1DB3A 3QEOA 3UCEA 2WKWA 1M34B 3S7ZA 4XTCS 4IVRA 3ZCVA 4ZWNA 1XN1A 5KKCA 1E6CA 2WDZA 3NDIA 4HQOA 1DJNA 4NOKA 3VR4A 3MJ4A 1P7VA 5GAJA 2HO4A 4CG3A 4H1VA 4URZR 1R9GA 4DBLC 2NPIA 3KKKA 4ZCMA 1IVSA 4HVTA 4CTJA 1OIXA 1UQTA 3OEYA 3CLRD 3K0HA 4HFMA 3GNTA 2ZRLA 4JJAA 4O3FA 4ZVNA 5PNTA 1LZKA 1TYCA 3PQ3A 1NHWA 1P4AA 2ODPA 4TMYA 5DTRA 3V4FA 3WJ7A 3VYSB 1F5NA 2C7VA 1AS0A 2I3DA 4TV8A 3RODA 5LL6P 3T3DA 1E69A 1BH2A 2ZRKA 4EY5A 1OXMA 2LCFA 2RHLA 2Z4SA 4P3PA 5L3RA 6GPBA 3URMA 5JDCC 1N0HA 3DV0A 3KM0A 4DQKA 3V00A 2XAUA 4L2IA 1I4OA 5ICCA 3QBTA 421PA 3ZE2B 2FI1A 4ZOAA 1T0IA 5E9AA 3LU1A 1K4KA 1HQYE 3A9VA 2Q5QA 2ZI9A 4ALMA 3LIIA 5IJ9B 3EGWA 1L2TA 2GBFA 5HMLA 3GLIA 3N3AC 3TPFA 5CLJA 2UZ4A 2BI7A 2PLWA 1ADBA 3A3NA 3LGXA 4QQKA 1ZD1A 2V65A 5BR7A 1LLUA 1SXJB 1OYOA 1CE8B 4I4TA 4QDOA 4JCCA 4B32A 4DQUA 4KQ2A 4CEIA 4EA7A 3B2EA 3D5TA 4OIMA 4TYMA 3BD7A 2GN0A 3KL2A 2OBYA 4QOEA 1A98A 1UC5B 3N6XA 4B4WA 4BO8A 1YAJA 4JMPA 4MDFA 3BK7A 4N4AA 1ZJ6A 3OTHA 1P33A 1T1JA 1MJNA 3MBKA 3OLYA 1USWA 1OH8A 3JR7A 2QIPA 1GZ7A 1E3DA 2AEEA 5EINA 2JRLA 2BMFA 1X38A 4Y6GB 3K9GA 4BNDB 1V7CA 1RQGA 1WCXA 2IP1A 4GG1A 4MVWA 1QFMA 1UJBA 2ZIUB 1AKNA 5AI5A 2WIDA 3KXLA 4GL2A 4H7FA 4DG8A 1VMIA 2IE0A 3DAGA 2TMDA 1JDBC 3FIJA 4D42A 4FOTA 6LDHA 1TCBA 4FGJA 4GD3Q 4QGAA 3KBBA 5KCZA 1E62A 3ZDQA 3DLIA 3I6ZA 3TLXA 3T4PA 2C4TA 2JFNA 4GX1A 1HL7A 2XMSA 2ZJ7A 2BJVA 4BNJA 2HU2A 1FP6A 4IDFA 3NVDA 3ZDFA 5ERXA 3WMEA 3ZE0B 3IP6A 3I61A 1DT5A 4LFCB 1DXYA 3VMFA 4HB4A 5AM3A 5KINB 3I62A 5ENZA 2NTNA 2H5EA 4IFEA 3L4BA 1EFUA 3GOQA 4DNPA 4BIMA 2AZXA 1RBZA 4MGIR 1PJ8A 4ENUA 5HPYB 1JIKA 3CINA 3TQFA 5L7TA 3L8EA 5D3QA 4OLHA 2QT0A 1Y7TA 3IJPA 1SO8A 3O8QA 1TJNA 3QX7A 1KU0A 4DDKA 3FMOB 1QRUA 2BZ1A 5JJIA 3P0JA 2ZJZA 2XADA 2QMQA 3CNLA 3WSWA 3OZDA 1H9CA 3ASUA 1GPUA 2C7GA 2Z0MA 3A9WA 3MILA 1GGKA 4ZD6A 1XB2A 4AZTA 3BE5A 3RFCA 3DD1A 1R74A 2ZAMA 4X1YA 1VXOA 2ZSBA 2I8AA 1XAHA 2EEZA 5FA8A 1GZUA 4XH9B 5EKSA 2FSPA 2FLKA 2BVNA 2II6A 2V4ZA 3T1YB 4CEJA 1YAHA 4LDPA 5CYPA 4PGFA 1XQ1A 3CURA 2SICE 2GETA 2PU7A 1TM4E 2OCAA 3ILSA 3K2QA 3QEKA 4NK5A 5IARA 1SB8A 2JAOA 4XIGS 3CKYA 1VG1A 2PO7A 4CTKA 1YZHA 1FPQA 4DYHA 5IULC 5F77A 3LCMA 1QOZA 3KPUA 2IUUA 1GZVA 1Z68A 5IJZA 4LDQA 2QSUA 5FOQA 2HU7A 1Z6ZA 3P9KA 1WUHS 1K8YB 5IJ0B 3HA5A 3A25A 4R83A 3STWA 4RMGA 1T8UA 3ABQB 4FZJA 3OJXA 4G1EB 4FHEA 2IOQA 1UDBA 3U60B 2QT9A 1CQWA 1T4CA 4RJJA 1FIUA 2CLOB 2ATEA 2WD8A 4LJ5A 4B8YA 4I36A 4RDHA 1DKMA 2I76A 3KHUA 5AM0A 2P0YA 5DJ5A 2XXBA 5CLGA 1N3IA 3K8QA 2OLKA 3AEZA 3L07A 5E4JA 2OAGA 4CLEA 1FEZA 4G6ZA 1WOMA 1WZNA 4GM0A 3EY9A 3HEBA 1JKXA 3F2IA 1E2PA 4J29A 3ZE8A 2YR0A 3D8RA 3EH1A 5G4KA 1SKMA 2QD2A 4LF9B 3OFKA 4PLWA 1PLKA 4K8RB 3FDZA 2AKAB 3I64A 3RS8A 1NFRA 4BRZA 1EXMA 4V02A 5ARCA 3NXKA 4LJ4A 3WP0A 4F1JA 5AVXA 1YXMA 3QNWA 1IQ0A 5I4IA 3OWHA 4NAVA 1O8CA 4M0LA 2YJ6A 1FDRA 4UQPA 1OFVA 3ZWNA 1JHVA 4FS3A 1JNXX 2ZWOA 4S1OA 1XD9A 4HAZA 2HWWA 3U37A 1X7ZB 1G18A 2D2IA 4Z7NB 1A5SB 1UMBB 3MUNA 3DEIA 3GXOA 3RS2A 1KFBB 3VNRA 4DSTA 3MJHA 2ZAIA 3E9QA 3PGKA 1BVUA 3VO8A 2XGSA 4I5DA 4NAHA 3UATA 2E4VA 1AJEA 3NO4A 3O90A 4BNHA 3IP1A 2IE8A 1YU6A 1P4SA 3QBJA 1MJGM 1GPH1 2MSEB 4TL7A 3L46A 1EE9A 1F4LA 4TTQA 3T7CA 1I30A 4BFVA 3F98A 1NQOA 5BSRA 3K31A 3ZDCA 4JITA 4JS0A 1EQUA 3TRIA 2D6FA 1KZYC 1VL0A