2MYUA

An arsenate reductase in oxidized state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
131
structure length
131
Chain Sequence
MKKVMFVSKRNSSRSQMAEGFAKTLGAGKIAVTSSGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin arsenate reductase
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 49
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2myuA00
4TMYA 4D6YA 3QEMB 1DC7A 1AB5A 3O2JA 2E4VA 3K9CA 1YK0A 4RY9A 4DN6A 1PUXA 4Y9TA 4YLEA 4MQEA 3JVIA 1ABEA 3EDCA 3MYYA 1URPA 1K66A 3A0UA 4N03A 3NNNA 1Z2DA 5TPZA 3C3KA 1RZRA 1EWKA 1NTRA 1YMUA 4E7PA 5ABPA 5IUNC 4RU1A 1QNLA 3G1WA 2E4XA 4KPYA 3F7NA 3UUGA 3LUFA 4MS4B 4KZKA 4UHKA 4DQDA 4F11A 4ZMRA 3T38A 1SXIA 3RVOA 3CG0A 3TD9A 1BVHA 1NXWA 4JB0A 1YS6A 3SY8A 3FFWA 2FLWA 4MR8A 2QV0A 2JVKA 3FFXA 4EYOA 4F8JA 1ZVVA 3CZ5A 1BDHA 3QELA 3L6UA 4GPAA 3RVSA 3EQ2A 1M5UA 5B3JA 3OM1A 4KV7A 1GCAA 3OLXA 4YGXB 3HXMA 5D2CA 3H5IA 1FQWA 3GWGA 4OG2A 6CHYA 3RVJA 5TPWA 3KYIB 1TJYA 3QLVC 4ETNA 5TQ0B 3W9SA 4IMJB 2H0AA 1VLZA 5BR1A 3DGEC 4XXHA 4Z0NA 1BDJA 1XHFA 3GV0A 1B00A 2H3HA 3HDVA 4RXTA 4Z4CA 3MM4A 3DLBA 3HCWA 4MR9B 3TO5A 5JNTA 4RDCA 1ZGGA 2RJOA 2TMYA 3K4HA 4EVSA 5E3JA 3Q7RA 4MLDA 5EWJA 4FB4A 7ABPA 3LUDA 3RQIA 3N6VA 1BA2A 1JHZA 5BRJA 3NNSA 1NY5A 4YP9A 1P2FA 1W9HA 5FWYB 5KQLA 2FXIA 4Z4GA 5C5EA 2NUBA 4WWHA 5TQ2A 4EUKA 1F51E 4RK7A 3JTEA 3URMA 2HPHA 5KQMA 4NQRA 3SG0A 1LBHA 3T6KA 2MSWA 2BGGA 3NHMA 3HV2A 2PAFA 4EYKA 3OQMA 1ZESA 2PJUA 3RVQA 3LKVA 4ZJPA 3M9XA 2L17A 2IYNA 2VUHB 3HZHA 3MQ4A 4Q6WA 4LX8A 1TMYA 3P9YA 4G0ZA 4YS6A 1I3CA 1S8NA 5DGCA 3GA5A 3H5LA 2IDMA 3A10A 2QSJA 3EULA 4LE1A 5I4CA 4N41A 1ZY2A 2FMHA 1JFVA 3N53A 3CKMA 5GQSA 2PUAA 3F6PA 4EYGA 1KRWA 3D8UA 1GCGA 3KJXA 4RV5A 3HUUA 4TN5A 3LFTA 1USKA 2VUIB 1DCKA 3FGZA 1DJMA 3QEMA 1JDPA 5DCLA 1HEYA 4O1HA 2J48A 4RK6A 2IPLA 1R8JA 3RVLA 1QQAA 3DZDA 3GRCA 4H3KB 4YCSA 1GLGA 8ABPA 4E7OA 3O2SB 4WZZA 1APBA 1PHRA 2Q5CA 1EWTA 2N9UA 3H5TA 2M1ZA 5HM6A 3QEKA 4HNSA 2WJAA 3KYJB 2JVIA 3JVDA 3OLYA 1PNTA 2PKXA 3GBVA 3H5WA 4Q7EA 2HQRA 4QYWA 2MYPA 4MS4A 4YRZA 3LUCA 4MQFB 3FMVA 3FDFA 2W42A 4PZ0A 2FKAA 3C3WA 2GKGA 1L5YA 1PEYA 2R48A 3H75A 3OO1A 3Q7TA 3MF4A 5IEBA 3H5VA 2HJ9A 1LJLA 3OLZA 1DBPA 1U2QA 1XHEA 1Z13A 3LOPA 4JOQA 3BBLA 1VKRA 2PUCA 5BRAA 3E3MA 4F12A 3NNDA 3ILHA 4EYQA 4XAQA 1P6UA 4P1ZA 4JA2A 4Q6BA 1ZGZA 2AYZA 3DBIA 1DCMA 4RK5A 5DLEA 4IF4A 5T3YA 1DZ3A 4Z4FA 3O1JC 1DBQA 4LDAA 2QVCA 3H6HA 2B4AA 3OM0A 4RSMA 3QK7A 3OQOA 1TVMA 4RKRA 3DLHA 5TQ0A 5KQGA 3CG4A 1NXPA 3CTPA 1UDRA 2ZAYA 1E6LA 1MB3A 2A9OA 4W5TA 1JWLA 2WJWA 1QMPA 4IRXA 2E4ZA 1OXBB 3LTEA 3LUJA 4GNRA 2MSKA 4MR9A 1RNLA 4QYMA 4CBVA 3LKBA 3SM9A 4KK3A 1JLKA 1JFSA 4JAVC 3BRSA 2KYRA 1YIOA 1QQBA 1FFWA 1JBEA 1CYEA 3CNBA 1KRXA 3EGCA 2FTKE 2MYTA 5FWYA 1MB0A 3T95A 4QICA 1SXHA 2FVYA 5IC5A 1EHCA 4JASB 1FFSA 3F73A 4NCBA 4KK4A 2FN8A 4MRMB 3I42A 1FSPA 2ID7A 3QLUC 3HO1A 3O74A 2PUEA 1H9CA 3ROFA 4PE5B 1TLFA 2F8TA 3IP7A 2FMIA 3KCNA 2JK1A 4RZSA 4XARA 1QP4A 1DC8A 3Q15C 1YMVA 2P9HA 4RK4A 4P98A 2R47A 3UKJA 1EAYA 2LIVA 4WUTA 2GI4A 2HQOA 3SQNA 4Z9AA 2IKSA 4M88A 3HK2A 1WETA 4F06A 3C97A 4ML3A 9ABPA 4Z4IA 4PEVA 5HKOA 2V0NA 1SRRA 3E61A 1ISRA 1DCFA 3F6CA 2I6FA 3M9WA 2FQXA 1Z25A 1JF8A 1CEYA 2RGYA 4LE0A 4Z9BA 5IULC 4YWHA 3UK0A 3HM9A 3SAJA 4G0XA 3IDOA 1M2FA 1GUDA 3VNAA 1MVOA 2CD7A 2FEKA 3H1GA 1DG9A 4OATA 1JDNA 2E4YA 1DRKA 2E4WA 3D02A 2JBAB 1D1PA 3M6MD 4B09A 1EFAA 1PNRA 2PUGA 3Q41A 2GBPA 5HSGA 1L5ZA 3O1IC 3B2NA 4MQFA 5FBHA 5TE9A 3SNKA 2A9QA 5JNRA 1ABFA 4PYRA 2QR3A 2E4UA 1A2OA 4JP1A 2VYCA 1IIBA 4F3TA 1BAPA 1D1QA 2RJNA 3I5AA 3G85A 1Z16A 3CFYA 4O1IA 5KC9A 1LJUA 3RVRA 5EWLB 5KQPA 2ID9A 4H3HB 4RKQA 1YVUA 1MIHA 3OO0A 5ED4A 1GUBA 2PLNA 5JNVA 3C3MA 1C4WA 3HEBA 5GOTA 5JS2A 4NCAA 1QP0A 4KRFA 2PL9A 3EODA 1U0SY 1ZH2A 5HQJA 1U04A 4HNQA 3QX9A 1AB6A 4FE7A 2FSPA 1ZAYA 4QPJC 1RZRD 3CS3A 4KVFA 4EVQA 5KWSA 2CHEA 4LZLA 4D6XA 4IGAA 1JH9A 1NXOA 5JNSA 1USIA 4W5OA 3I45A 3T8YA 3DGFC 1USGA 2MYUA 3CU5A 3JY6A 4XLTA 4S04A 4IILA 5T7BA 4LDZA 2YHBA 2X7XA 1SXGA 4Z99A 5TQJA 4KFCA 1ZHHA 2FEPA 2NZVG 2NZUG 1D5WA 2FEWB 1RXEA 2GWRA 3IP9A 2PMCA 4MS3B 3LUHA 1TM2A 3LUGA 2PUDA 4L85A 2VK2A 3EAFA 4EY3A 3JPWA 1Z17A 4OLAA 4RXMA 2JCGA 3BILA 2A9RA 1K68A 3O1HB 4HNRA 2O20A 1NXSA 5BQ3A 4W5RA 2MSLA 5FBKA 3RVPA 3CZCA 5KI6A 2A9PA 3MMNA 3BRQA 2QW1A 4MRMA 4MR7B 2HSGA 3IPCA 1W25A 1NXVA 4XFKA 4W5QA 3TMYA 2FMKA 1P6QA 3IP5A 2YHAA 4MLCA 4KNYA 5JNUA 2LUOA 4OBBA 4G0OA 4RXUA 1XWWA 1ZITA 1DP4A 1NXXA 1ISSA 1ZN2A 2R4QA 4H60A 2IPAB 2QU7A 4WXEA 2WY2D 4FE4A 3H1EA 2LP4Y 3KHTA 1Z12A 6ABPA 4PICA 1FFGA 3HSYA 3JS5A 4G0PA 3H6GA 2OQRA 2XDYA 4G86A 1JL3A 4MS1B 2FQWA 5FWXB 1KGSA 4LRQA 4WT7A 4KREA 3N8IA 4MYRA 1RPJA 4RK1A 5EWMB 3EJWA 3N0RA 1QO0D 3NBMA 5JS1A 1Z26A 3O2QB 4RY8A 2FW0A 3O21A 3CHYA 1MAVA 4OTZA 3QLUA 1D4ZA 1JX6A 3QLVA 3GL9A 3IPAA 1E2BA 2PL1A 3Q9SA 5IBQA 4N47A 5JNWA 1BDIA 4HYEA 1E6MA 2RDMA 4G0MA 1ZH4A 4KMRA 3OMXA 1YTUA 3RVNA 2PUFA 4L4UA 4MQEB 3OLWA 5B3JC 2GX6A 2MYNA 5C5CA 1A0OA 2JBAA 3HDGA 4ZYLA 1NATA 3CLKA 1LK0A 3HS3A 2IPMA 3RH0A 2PUBA 1T34A 4RS3A 3CRNA 2OENG 1C0EA 3H1FA 4RY0A 5F64A 1Z18A 2FN9A 2JRLA 5DTEA 2WRZA 3L49A 1NXTA 2WWVD 1D2AA 3EQZA 3TB6A 3HJFA 4O5AA 5EWLA 4N76A 2FLKA 2L2QA 4TLMB 1QPZA 1LBIA 1ZDMA 3HUTA 4MPTA 3MIZA 1F4VA 3VNBA 3KS9A 4MR8B 3A3KA 5KC8A 4JB2A 3N75A 5IUJC 4G0QA 1EWVA 2M98A 4EVRA 5CNIA 4D74A 3GYBA 3GT7A 3QELB 1CHNA 4MGEA 5PNTA 1QP7A 2HQBA 1RXIA 3Q7SA 2PE5A 1QO0A 2CHFA 4TLLB 2LPMA 4G0YA 3BREA 3MA0A 2LBPA 1YK1A 2QXYA 2IPNA 5TPWB 5CHYA 1U8TA 2ZWMA 3KKEA 3KLOA 3LUAA 3R0JA 2QVGA 3KSMA 2JVJA 3JPYA 4RK0A 4ZPJA 1VPWA 4MS3A 3H5OA 1J56A 3OMWA 2L18A 4NV3A 2P4UA 3KTOA 4ETMA 3QX8A 3A0RB 2DRIA 1A04A 1E6KA 1QKKA 3KLNA 3KG2A 3O75A 3QLTA 5EWJB 4MAAA 2F8SA 5TPZD 3C6QA 1U2PA 4UHJA 5CNJA 1M2EA 1SD5A 4WXMA 3LUKA 3N0WA 4IMIB 3TX6A 3N0XA 5CNMA 2QZJA 3FFTA 1OXKB 2NT4A 3NHZA 4KQ9A 4MR7A 4NICA 3ILYA 4N0QA 4ETIA 1JYEA 4Z4EA 3LMKA 1JYFA 1Z2EA 4RWEA 1JFTA 5TQ2B 4KQCA 3OLVA 4YV7A 5IX8A 1DBWA 4DADA 1Y1LA 5IEJA 1P8AA 1YS7A 5DKFA 2FQYA 4ZMSA 2NT3A 2CWDA 4S05A 4OLBA 1M5TA 4YO7A 3ROTA 2FMFA 4EGSA 1PEAA 4MS1A 3OQNA 5FWXA 2R25B 3S99A 4LE2A 2WMYA 3RVMA 4W5NA 1Z15A 2WB4A 4Z4HA 3I09A 3GBPA 3RVKA 5EWMA 1KMIY 2IOYA 4XASA 5IUKC 4YR7A 2L19A 1DRJA 2B1JA 3HVRA 1VRVA 2AYXA 4G97A 5CNKA 4N0PA 2JB9A 3IP6A
chains in the Genus database with same CATH superfamily
5P21A 4KKVA 1PR0A 2QNBA 4EIWA 2RKBA 3FCOA 3LT1A 2YQZA 4LA4A 2R84A 2X3FA 4G5QA 3C6BA 1Z0SA 1GYQA 2J46A 3NXSA 3PDJA 1J6UA 3DZIA 4FDMA 4GRDA 4GYJA 4NWIA 4P32A 4DN6A 3ONNA 3DD5A 2CJYA 4DJEC 1OYYA 2Q1YA 3FMIA 5IXSA 1OTXA 2V45A 3RW9A 3M6IA 5FD8A 3H2ZA 1QS0A 2O50A 1A9QA 2YHIB 3K32A 3K53A 3ZHBA 2B5VA 4HNGA 3EFOA 4JJZA 4D97A 1M34E 3HR7A 2YQ5A 1AV7A 2HD4A 1O94C 3H65A 1ONOA 1NRJB 3QUQA 3WKCA 4EJ6A 4LBZA 5C81A 2RC5A 4OLHA 1ZL0A 3T3HA 1FFCA 1WUTA 4FR5A 1AF4A 3WTCA 2CXUA 1XAHA 3GI1A 1TKCA 4EEZA 2YIJA 4LOHA 4I19A 3IS3A 5EIBD 5L7YA 1UC8A 4N0DA 4BLPA 2QTAA 4COOA 5AVWA 3QI2A 1Q77A 1YA8A 4HTAA 2RHJA 5EY5B 2FWBA 4XPZA 4DNOA 3ZDYB 1CU1A 2TMDA 1RHUA 2PV7A 2AOVA 1CVIA 4UVGA 3R09A 4MHSA 3RVDA 1MZPA 1QH1A 3L6UA 4GPAA 1PT7A 4Q9KA 3TW4A 3N2ZB 4CLRA 3VOAA 4MLPA 5GV8A 3KAJA 4EW1A 4G89A 1FSGA 2A35A 3CBQA 1PG5A 3HKEB 4M7OA 4OY3A 1YR7A 3AXSA 4OG2A 1BWQA 5K99A 5KJCA 4KR7A 3AY0A 1XPUA 4TWZA 2WWIA 1GZ3A 1XXHE 2QVXX 3OTHA 1EK0A 4H4DA 1EFRD 3WKAA 1XU4A 3FAZA 1BDJA 4G0NA 2CW5A 5D8DA 1RLMA 3DLBA 3RG2A 2A7QA 4Y7CA 3Q1LA 3UWDA 4DVGA 4YRGA 4RBNA 1V8OA 3O92A 1H2HA 1RC1A 2PZ8A 5EWJA 2C9CA 1PRYA 1CFJA 2E85A 1RMTA 4ZAGA 1SXJD 1G9XA 1GR1A 1IY2A 1P2FA 1W9HA 1PQPA 5FPTA 3S5JA 4IOLA 2PKQO 1FS4A 1SUCA 1K5PA 2ZUUA 1YB1A 1QVRA 4JEMA 4RS4A 4RK7A 4BGDA 2BFNA 1UZUA 3QYAA 4QUJA 2CLIB 3T6KA 5EA2A 2PA3A 1JHMA 1VL2A 1YZGA 2IHJA 1K7YA 4D43A 4LISA 1HYGA 3PCRB 3ZQ4A 5H81A 2VTEA 1RRKA 4OUDA 3MQ4A 4TL9A 2PR7A 3L7DA 4FBMA 2QT0A 4HQNA 4X00A 1JFRA 4HZIA 2FEXA 3FPEA 4PCVA 3QU9A 1KR5A 2ZJAA 3F2VA 5ICEA 1ZGHA 2KM1A 2OXEA 1J97A 2QG6A 5COQA 3UPUA 4IH9A 4QDTA 1ZRMA 3E9CA 4TQ9A 2CUKA 1E3IA 3D8BA 4RKFA 4BGEA 1GA6A 3EIWA 1R5NA 3JQBA 4HB4A 4XVRA 1E79A 3N2KA 2FW8A 1GCGA 3KJXA 4FKMA 4G5RA 3QU4A 5T57A 1NMEA 1IATA 4C2TA 1M8JA 5IZCC 3NBXX 1ZMTA 2B99A 1XRPA 4X90A 4YACA 5CDSA 5IJWA 3VKWA 4B6QA 4H6VA 3PNOA 4OSPA 2OKCA 3S44A 1NPDA 3JQ7B 1WIWA 4WZZA 4TVBA 4G8CA 2WF9A 3OCYA 3WIOA 5JDIC 2OL4A 1RI3A 2PX3A 2WJAA 4HAOA 1KJYA 1B6RA 2MINA 4JB8A 1E32A 1RLUA 4NDNE 3RLFA 2IHNA 4Y6OA 4O2AB 5DYGA 1T1EA 3PXGA 2YWBA 1Q1AA 4D9GA 2Q7DA 1FUIA 1PYOA 4TRRA 3V2HA 1OIVA 1U3FA 4NU5A 1TAGA 1WXIA 1YR8A 4ZDWA 1Y98A 1E9BA 4KB5A 2W6JA 4NYMQ 4ZV9A 2O1XA 3R6TA 4ZD6A 4UHCA 3P0IA 4RFVA 2MCFA 4YUVA 3W2GA 1KMCA 4E5UA 5B2FA 1ZCBA 1I4OA 2M6SA 5EXDA 2JZNA 5ALWA 1UADA 2YJZA 2YC2C 5AOAA 4CI9A 1ZGZA 2AYZA 4DNXA 2DBQA 3T5CA 3MS7A 1XCJA 1WWKA 2QRPA 1OAKA 2ODNA 3QPCA 1DKLA 1DINA 1IOVA 4UHFA 5T3YA 1L5SA 3IEPA 3WL8A 2Q62A 3DMPA 1TX4B 4FYIA 4JKOA 1RAFA 4JLMA 1GFSA 4MICA 5DOVA 4N48A 1GKYA 1TUEA 3IJRA 3U37A 1A9PA 4FOSA 3TGWA 5JH7A 4D2IA 1O94A 1QVZA 1KFBB 2VNJA 1Z28A 4IIJA 4E22A 2GCPA 3FIUA 4W5TA 2WJWA 3HU1A 3CSSA 4G0VA 4LX0A 1X7DA 3AR6A 2HLNA 1FUKA 1WB6A 3MINA 4LMBA 4R98A 5F98A 1PFUA 3H5RA 5JH7F 3AKCA 4PNPA 4IIJF 3FCCA 3BRSA 3QHAA 5C1IA 1L0BA 2A59A 1K7EB 2O05A 5DCWA 4EHBA 1Z4LA 2FZ4A 2PWPA 4MVJD 3VYSB 4WLUA 4PAWA 4RVUA 3WGMA 1QOZA 3EHDA 1GUFA 4XJSA 3C3JA 2F67A 2REQB 3PITA 3T95A 4Q7MB 5CR9A 2ZJ2A 4JASB 3ENWA 1TEZA 4Z9YA 1YB2A 4MV5A 3VTZA 3RK4A 4BLQA 1HE3A 3IDAA 1C50A 2ZJ1A 1OT3A 3B1VA 4HNAB 4MRMB 4CKZA 1OV6A 3WLHA 2G9VA 1DPGA 3UPDA 1BG6A 2JHPA 3DCJA 4BP9A 2FJPA 3LXXA 1SY7A 1YE8A 1M33A 2HXYA 1W93A 2HXGA 3KCNA 1UWCA 1O5TA 1T5TA 3HJNA 4P98A 3ZG6A 4KR6A 4EB6A 2JFGA 2C99A 1P8JA 2A5JA 2LIVA 1WXDA 4LSMA 2WYIA 4IVRA 3G49A 3H2IA 4BJHB 1MFZA 5KDOA 2XMSA 5DGTA 4Z9AA 5BUSA 2HUPA 5J40A 3ZLUA 4KPEC 4GIBA 1ZD9A 3U3ZA 2C95A 3GRVA 2A1IA 5JY1A 2GHTA 1R88A 4Z6KA 2X23A 1XBTA 1A1VA 2GM5A 1PT8A 1HDCA 2H1RA 5ER6A 2A5GA 2OG2A 1F5NA 1DCFA 5FP0A 4ASUD 1Z25A 3TI7A 1QNFA 3IOBA 2ZK7A 2D13A 2H06A 3EVDA 2P1DA 3FN4A 4MWCA 2YJ4A 3W7AA 1HQYE 2I67A 2ZAMA 2O07A 1FFBA 3GGGA 4UCFA 1JZTA 1HYHA 3U4CA 2ZTLA 1GUDA 1YZHA 4WBSA 4YCDA 3BWYA 4X6XA 3ZJUA 4R8KA 3I6QA 2ZZKA 1TPYA 2Z09A 5ECDA 3RIEA 2IXBA 2VHJA 1NHWA 3RC1A 1W8IA 4PC3A 2W2KA 4HG2A 4Q39A 4BNVA 4DXDA 2NZYA 4PR0A 4F6RB 3I2IA 2A4MA 4O0LA 1EWYA 5FHQA 3MUFA 4KO8A 4M8SA 1DKUA 1XLTC 2FH5B 2I87A 3OZDA 3SNKA 2AG5A 2HL6A 3I23A 3QXHA 2B3TA 3PT5A 5JBNA 3CCCA 4YMTA 5K3AA 5ITWA 3CUYA 4Q03A 5IWAB 1HNXB 3GCWA 4FYPA 4XB2A 4Z0TA 4XVHA 5KVQA 5DSXA 5EWLB 5FI5A 3RVRA 1ISFA 3T52A 1CUFA 2ID9A 1NVEA 1PGJA 1PJ3A 2I7DA 2V5VA 3ABQB 3MPUA 3OO0A 1W87A 1YJ8A 2H1VA 4RLHA 5DSZA 5FA5A 1DFIA 1J2TA 1R8SA 2I80A 3ZLBA 1TRHA 4TVSA 3WNQA 4OP3A 5MDHA 1AB6A 1KYTA 4M22A 2WHPB 3AEQB 1NDUA 5EE3A 2GK4A 3D6HA 3GJYA 1CQPA 3OUTA 4IEEA 4P4GA 4G5OA 4RPJA 2SKDA 4C6HA 3UMFA 3G8CA 1KTIA 4TKLA 2ZAGA 3SSAA 2GZRA 2HMTA 3JY6A 1HZZA 5CCBA 1N34B 2PZBA 2WVAA 2H7CA 3PGA1 5JE8A 1QHFA 4D92A 4FONA 1E7MA 2ZIAA 5FLKA 2ZS8A 4RHXA 1N2IA 3OPMA 2QM7A 3CNLA 1X7XA 5FNZA 4BVLA 5L3QA 2VJNA 1SIWA 3OWOA 3DDZX 4ZO8A 4BJ5A 5HUQA 3M6AA 3NAQA 4MS3B 1JR4A 1JU3A 2Y6VA 4F4UA 2YHSA 4ZI7A 5EJGA 3SLRA 4AZ3A 1CJVC 4QJ5A 1DG3A 3R4VA 4YECA 1SRQA 5B30A 4YAKA 4WOBA 1F60A 1Z6AA 5DHFA 4J0EA 4HDNA 3W77A 1KOJA 4PX2A 4PIPA 1K68A 3H9JA 1NIPA 4BATA 3JQAB 3PPXA 4URZR 5GAJA 2WFAA 3CZCA 1QZUA 4ZI7F 1KHTA 3BRQA 4MK4A 2R66A 2BR4A 5HF9A 3R9XA 3IPCA 4YI3A 4R01A 2HKIA 1E59A 4R0MA 4CEJB 2JASA 2OA0A 3LY5A 4JK3A 4J2OA 3N5KA 3JQQA 1H0SA 1E2NA 1S2NA 1ZCJA 2A9FA 2AQIA 3KHKA 4MRSA 5A7HA 1U7XA 4WXEA 2OSVA 5BW8A 4HXGA 4YR9A 1Y6FA 1Y6ZA 3CPHA 1FDIA 4EFLA 1UXIA 4ZCSA 5D3MA 1CZRA 1XTKA 2IYVA 4C6TA 1L4BA 1O97C 2Z9CA 4NZ9A 3AIMA 1ZOLA 2W90A 1XWFA 4RHFA 2OCIA 1DX6A 4BNJA 1MN6A 2UZ3A 4J7XA 3IAXA 4Y6LA 1PJBA 2H63A 4HD8A 4AQYB 1JKJA 2E1PA 1J33A 3ONDA 4LJ9A 5A62A 1MAUA 1U28A 2QAGC 2VSYA 3IUBA 4M8KA 4FVTA 1ODIA 4NOMA 4WY8A 3SS9X 3SIPA 3K9QO 2X41A 4DZRA 3O4VA 3KQWA 2RC6A 2Z2IA 3ETNA 5DYNA 2C4MA 2IP1A 1TVEA 2YYZA 1SVIA 2VZ8A 4UAGA 3H9CA 4WZAE 4CL2A 5FX2A 1AZLA 1BDIA 4V0ME 2OFFA 3GK3A 4XUEA 3RFXA 4JI1B 3ZW8A 3C4JA 4KIUA 3Q2IA 5C5CA 3PC7A 2WFLA 3E9NA 5DXAA 1E2QA 4B79A 5BXQC 2OVFA 5LNK1 2C82A 2XF8A 1XL1A 3DFZA 5AM2A 1ICEA 3CRNA 1WMDA 2RHHA 3OTOB 5K01A 1NVBA 2C77A 3LK6A 3MTAA 1JLLA 3ICCA 5KWEA 2WRZA 4LV5B 3UWOA 1QPBA 4F2DA 4UVDA 2X2FA 2XGGA 4D4JA 3V3TA 1YF3A 3DMGA 5CB4A 5JRDS 1U3GA 1ZNZA 3EC7A 3UV3A 4NZNA 4N76A 3OTGA 2PT9A 2ZS7A 1H2WA 2PV0A 3LPCA 3OCWA 4IUDS 3DB2A 3OZGA 4EUNA 2IX3A 1L4EA 2FPPA 1L7OA 1MUUA 1SVMA 3GA0A 3IPYA 4GR4A 4IJWA 4JB2A 4K1XA 4RCYA 5FWAA 1RPTA 3KYBA 2J85A 3U4IA 3UAGA 1Z2OX 1ECJA 4HH1A 5AKZA 2FJ0A 4ZGWA 2C2OA 1NW6A 3R20A 5CB4F 4FZVA 1FTQA 3LCMA 4UOZA 4OXKA 3P94A 4RD1A 1DL5A 3AY6A 3VX3A 1XLTA 4LZAA 1C9EA 5B7GA 4RORA 1BXRA 1M0WA 5L6MB 3R0JA 4NKRA 1GUZA 3KSMA 5EPEA 4ZPJA 1ZQ9A 1MX3A 5BYJA 1AGPA 2ERYA 4GMKA 4RGBA 1G16A 2IK8A 2XUAA 3HR8A 4OB6A 1MJ5A 3MQ2A 4NPHA 5AI0A 2PVSA 5LCXA 4JNCA 1PJ2A 4MWEA 1RYHA 2P2NA 4DIMA 3VI4B 1T1IA 1P72A 4HNUA 2N75A 5DGIA 2CHVA 3R3YA 1QKKA 4J3NA 1XTUA 1FYVA 1TECE 2DUNA 2NQTA 4DV3B 4BP1A 4HUQB 5NLLA 4OI2A 1QTQA 3HCOA 2O3TA 3SHVA 1VM6A 1TKAA 2PQMA 1OA1A 4U2KA 1NIJA 3NDJA 5IT0A 2IS1A 5T4FA 4BE7B 4J1TC 1M5RA 3AOEC 3EMBA 4KLAA 1KQOA 5YASA 5BWBA 4WBXC 4Z4EA 1H9BA 2PDAA 2IP4A 3EF1A 1UM9A 2DEUA 4HFRA 4RE6A 3UAOA 5BWNA 1FJGB 2NUPB 2WKRA 1BHJA 5K0BA 3GWZA 4Q82A 2OCLA 4Y1RA 4NVRA 2CLLB 3G13A 1P8AA 1JKIA 3ZWNA 4R7ZA 3G2MA 1J06A 2HWUA 1VL8A 2O1SA 2XECA 4NFSA 4ND8B 5FR2A 3TE6A 3W3AH 3WDMA 3I61A 1IQ0A 3H0EA 3P7MA 5CLIA 5F2OA 4GZMA 1E5TA 4GNKA 4EG1A 2JLUA 3ICQB 1FXSA 1XVTA 2PTGA 4FUTA 3DLAA 1B3BA 2R25B 2HT6A 3OIFA 4JXKA 2ECOA 3P2YA 2NVUB 1JQ3A 3NKLA 2WB4A 4ME6A 1YCGA 2CZCA 2ORYA 3SHOA 3M70A 4YR7A 3AG5A 4MVJH 1ILEA 3DBLA 1UKAA 2HJSA 2J5XA 1PW7A 4MSUA 3RIHA 1KZYC 3K16A 3TJRA 1MJHA 1OW3B 2ZBGA 3RV3A 1F7VA 2EFGA 2CLEB 5DYWA 4V0NA 16PKA 2VNIA 4P7FA 3CMMA 3K9CA 3LRTA 4CM9D 5BN4A 3AVPA 4FOOA 3S8EA 3R9WA 3O9MA 4I50B 1OI2A 4LFAB 4QUGA 1ABEA 1U0FA 1WZEA 4G1EB 3ES9A 3GLHB 4Y2VA 3ER6A 1YQGA 2R62A 1F8XA 1DAEA 4QLBA 1JG7A 4L3OA 3C3YA 1W85B 3Q4GA 5JSUA 3DCNA 8ADHA 4F9GA 2W93A 2XQGA 2XMRA 4YT4A 4J0DA 1QNLA 3ADDA 4IXNA 1UBGA 2E4AA 3AR2A 3EYAA 3ODPA 4UBOA 4CMCA 2CSXA 4F60A 2YMQA 1ONNA 1PFVA 2A94A 1VBKA 1GFWA 4P0PB 3FHTA 3IODA 3QIAA 3GCGA 4I1YA 1NJSA 3P2KA 4MAFA 5GGYA 1E64A 3CG0A 5UKDA 4DCUA 5HKAA 2VWHA 1Z73A 1JIIA 1QHEA 3LCCA 1QO7A 2HNBA 2OBNA 4GI2A 5FTJA 5KOHB 2QK4A 3AUFA 2BKLA 3NBAA 1UKEA 3MWKA 4A26A 4EYOA 5CAEA 1QTNA 1RJFA 4BQSA 5JPDA 5IJAA 3I32A 3GXBA 5AK3A 3HHEA 4PZDA 3W6OA 3I6ZA 3QF7A 2FU5C 3AGQA 4KO1S 4H16A 4Q1AA 3ZXSA 3WBKA 2Y0BA 1S2DA 4FCVA 4LDRA 3UNXA 2XQIA 1KEZA 1HG1A 4XLLA 2FR8C 2FZ5A 1XVVA 2V4ZA 3PF8A 3R40A 1W5FA 3FGPA 3PEFA 3RUEA 3TRJA 5D5QA 3SP1A 3EVNA 4RF3A 3SF8B 1BCSA 2OV8A 4AS2A 2IE0A 2V3VA 5H68A 5IC4A 4X8MA 1HNNA 1XDDA 2UVDA 3MC1A 4V2IA 1IXZA 4OQ4A 1X15A 4MRAA 2C98A 4S1VA 2QAGB 4IIXA 4GXNA 1X1EA 3JQ8A 1YDWA 3NP9A 2GA9A 5F73A 2HR1A 1YL7A 3GHYA 5ALKA 5JZOA 2HM7A 1PFKA 3NEJA 2C2KA 3AZOA 4QU9A 5P8WA 3AP2A 5E3JA 4CV3A 3FW1A 4FB4A 5FH9A 3W7BA 2GASA 3CLUD 3HC7A 3O3MB 4IV0A 4M0DA 3V42A 4BFSA 1ZN9A 2VXBA 5AVXA 4GAEA 5K8CA 2BBOA 5J3JA 2Z3WA 4D3SA 1P4SA 5DU2A 3R7LA 4UBNA 2QR2A 1Q7GA 2DHQA 3NV9A 1UP4A 4JGIA 5HS6A 4XGRA 3WWCA 1H4TA 1MH1A 4ECEA 5E4JA 1KZ9A 1CY4A 1QLHA 3HLKA 3KQOA 2J3MA 5AUNB 5I8ZA 4XWKA 1DOAA 1RXYA 3BN3A 1HNWB 1PNVA 1IZ0A 1RXSA 1SC4A 3SG0A 3V8RA 1TCVA 2IPOA 3WLIA 4FEGA 3CO5A 4MQLA 3DVSX 2G76A 2VBIA 3MIIA 3OP4A 1A3CA 4RH1A 4UAJA 3TL6A 3DEZA 4I4CA 1KC3A 1SC3A 4PANA 2NU6B 1J8MF 3LKVA 2WF8A 1TMYA 4Y3UA 2RI0A 2VFAA 3GPLA 2R1TB 2HK7A 2SCUA 3EXFA 4ZYWA 3W78A 3Q8XB 1T6YA 3A10A 1M1UA 1X80B 3P0FA 4HAZA 1NVTA 5G1OA 1XG5A 2AXPA 2HF7A 3LA8A 4OA8A 5I4IA 2ACWA 3CKMA 3BHIA 4N3GA 5A6SA 4NAUA 4L9RA 2YMLA 4AKSA 4J1TA 1H3FA 3HUUA 2FZCA 3AOEA 1REQB 2CNLA 3OPXA 4LBVA 5AW5A 3ZVRA 4EUSA 1SHZA 3GDGA 4KIJA 4Z7JA 5DCLA 4AX4A 5G4LA 1W19A 4GOXA 4QXMA 1Y7HA 2IPLA 2BKXA 3RSHA 1NUAA 1NKTA 2QMUA 5I45A 5JATA 1YQXA 2AX3A 1KORA 1N8SA 4DDMA 1DPFA 4UEJA 2PU5A 2QY6A 3L06A 3QPDA 2ZJ5A 4BHTA 1E1QD 3OEED 3F7OA 4X3CA 3OJ0A 5CVTA 3H5TA 5HHTA 3W5DA 1FNNA 3OC6A 4M86A 5IDVA 3DXFA 3E03A 5KPDA 2XCTB 1KYIA 2JVIA 3I73A 4QU8A 2LZ0A 3ROXA 3AEUA 3FCEA 1DAGA 1XKQA 4M36A 4R16A 2IYTA 4XW2A 4LKOA 4ZJZA 1WDTA 2ZWPA 3FNFA 5BV8A 1Z6GA 3LUCA 3FMVA 2P7IA 2XCLA 2CMKA 2FKAA 5EE5B 2PMEA 3IUEA 4CL8A 4XDYA 3QOWA 4MUMA 2F3SA 1TI7A 3HYNA 3S28A 3KE9A 1JG4A 2QTFA 3G5TA 3TECE 1N8TA 3C39A 2IJGX 1G21B 4B6PA 3NOOA 3I2JA 2X0IA 3S55A 5HCUA 1YH3A 2VHQA 3V2GA 1P6UA 3PQDA 4O4JB 4CCYB 4EJSA 4QGSA 3QEBZ 4CMIB 4LPSA 4URYR 1KO5A 4IW3B 3T0GA 4PHHA 3KQHA 4EQ6B 3BDAA 3VDNB 5F9FA 1PDVA 3H18A 1DZ3A 3G6KA 3FSGD 1USWA 1B3RA 3L43A 4KYUA 1W6RA 5DLDA 1Z36A 4LDAA 3WVNA 5AO9A 1QHYA 4FJ0A 4MWGA 1SZCA 3SJZA 4DXAA 5EMJA 4CEHB 1M73E 2PZKA 1TFRA 4UU0A 4QGHA 3H05A 5LD2B 3KJHA 1SBNE 3FTFA 4MQUA 2FPUA 4Y67A 3LPDA 2HQSA 3CTPA 4IMRA 4O25A 4I5EA 3WIDA 1JPVA 2WJYA 2OUIA 2PCJA 4B34A 2AFIE 1IZ8A 3M6LA 2UYQA 1AHPA 2XAAA 3F6EX 2O8DA 1RNLA 2V7TA 4ZQCB 4FYMA 4ZAXA 3WWDA 3HZRA 1Q16A 2EFDB 2O23A 3B1KA 4CLEA 1GUYA 2BD0A 2HH9A 2KYRA 4G0WA 2OORA 2HA3A 1QG6A 4N5NA 4M7RA 1L4YA 2FTKE 2QTNA 3ZE0B 2AE2A 3FVWA 4NP6A 2A9KA 4QICA 1EHCA 4UMDA 1ZMRA 1EA5A 1JR3D 2DHEA 1Q1GA 4IIDA 4JZYA 4MVCA 2FR8A 2XZPA 4FC7A 4OHYA 3PB3A 3SC6A 3QLUC 1BHO1 2ZREA 3OPVA 4FFBA 5CM2Z 3D4PA 4D4IA 5I48A 3K70D 4C2BA 5LOVB 3O2NA 3V9AA 4I8DA 3GG9A 4MGKR 4RZSA 4N7MA 3TOXA 2GPBA 2ETXA 4TSFD 3RLIA 3DZKA 4OA5A 4XQEA 1U9YA 4P8RA 1XTRA 4QXAA 3MT9A 1YDFA 4IYJA 3UKJA 3N6XA 4AQDA 4UREA 2JGMA 1WCV1 4TT3D 2I62A 1O8CA 5ALJA 3TL2A 3V7UA 3IDSA 3ZKWA 3RIXA 1AZWA 3I1YA 1W48A 4MX8A 4RQBA 5GONA 1LD3A 4IGKA 4EMUA 3HK2A 1AF7A 4EJ0A 1VJGA 4P0TA 3DCYA 2IRWA 4HOYA 1DBSA 2ZS9A 1ZEMA 3AQ4A 3GP5A 2WUVA 1O8BA 3NKVA 4NC9A 3GUUA 1X14A 2WDPA 4M0LA 2JIQA 3TRKA 2D2EA 3B5JA 1CEYA 1JF8A 3IO5A 2QRVA 1CCWA 5GONF 1NMXA 1TMGE 4PM4A 4X20A 4ARAA 1O4VA 4A2PA 2BM9A 2VRCD 4RJKA 3TIXB 3LP5A 4YRBA 3WA7A 4BAZA 4BMDA 3U7QB 2WTEA 4G5XA 4E11A 3EA4A 1ZZGA 4EL0A 2XBLA 1T2FA 1N5MA 2WD9A 2K2WA 1AS3A 3L7IA 4KJZA 4P58A 1P17A 2JBAB 1FLDA 4DUGD 3RRFA 2B69A 1F06A 1GVHA 2V58A 2PIDA 3MD9A 4GMXA 4WTOA 4BRZA 1QUEA 1WABA 2WE8A 4YJDA 1AQUA 3J81k 1OE0A 3QEJA 3DTVD 4Y0NA 3BJEA 4K9SA 3UTDA 1LPOA 1V8ZA 3GH1A 3GW8A 4K6OA 1IXRC 3L84A 2Q0HA 1K0FA 3RKRA 4JFAA 4JI5B 1LJUA 3R8XA 1SEPA 2VJDA 3UMBA 1JG6A 3ZNQA 4AQ7A 1O54A 3C8ZA 1EFVA 5FCDA 5AK5A 2HO4A 4NMHA 1B1CA 2IL1A 2P9JA 2PLNA 3FWYA 4QUBA 4DAEA 3L4KA 3NIWA 2P0EA 1GA4A 4O29A 4XI9A 3DMRA 3FWNA 1XVUA 4QDKA 4ZT5A 1FVHA 2YBDA 1FSZA 1NNEA 3DPUA 3PRHA 1ZCFA 2CFOA 2P9BA 4QPJC 1J2EA 4QDUA 1WZNA 3CZRA 3PPIA 2SECE 3HFJA 5EHIA 3X1YA 3EPPA 3JALA 3FZGA 2VPXA 4DYHA 1VBMA 1W52X 3MLEA 2MYUA 3CE6A 4Q3NA 1E3SA 3PFHA 1GR0A 2I3ZA 4DCNA 4MUFA 3OJXA 2YHBA 1O96A 2B5WA 1J1IA 1Y4DE 1RLJA 3LDGA 5AK4A 5LZ8A 4BTEA 4YMWA 4F04A 2H59A 2FUNB 4M9CA 3L9XA 4O8ZA 4CKWB 4K9OA 2O0KA 4R05A 4MUEA 1ITZA 2RGEA 3ESDA 4XTCS 1CJSA 1R0CA 1ULSA 2RHLA 3B8EA 2RB4A 3JPWA 1A69A 4GQBA 4L6AA 2BBSA 1VE3A 3LZ6A 1SBTA 4D96A 4OQXA 1S3GA 2WAXA 2PO7A 3Q9NA 4HEA1 4DABA 1T4BA 3A4TA 5B58C 1JE1A 2C3PA 2LCIA 4OFZA 1DMSA 1UJ2A 2JCSA 2Z2YA 1GQQA 4LYAA 3REOA 3VOBA 1VHLA 1EGVB 1Z5WA 2AFHB 2B35A 2BJHA 1GILA 2PCLA 2XD4A 1NXVA 2XEXA 4Q3BA 4QNMA 4B6RA 1EUYA 1N4AA 1GSOA 2FMKA 3NWEA 1EK6A 4AFNA 5C8DA 5KBYA 2K6GA 5DCYA 1G3IA 4PLPA 4P3NA 3N74A 5LZ5A 4ALIA 2QU7A 1P0PA 2R8XA 2WY2D 2JK0A 4FE4A 1IAVA 2NNLD 3PC3A 5A5GA 4LOAA 3PWTA 3PRKE 2C54A 2VF5X 1G8GA 6ABPA 5LSAA 1DDIA 3ILVA 5CURA 1ES9A 2HWYA 1YUNA 2VJAA 3NRCA 1ETUA 4XX0A 2W48A 2UUOA 3BWXA 1QOQB 3VPHA 1X1QA 4X9XA 2PRZA 4A0GA 2V6GA 3E5HA 1MCZA 3N8IA 2FEOA 2H1SA 3JARB 2I3AA 4LZJA 4MYRA 4RMJA 5AJYA 4KV9A 2KMLA 3N7UA 1WULS 2HWKA 3UAZA 1L7AA 1Z34A 4AJEA 1LBQA 2LDXA 1F2TB 3GFGA 2NU8B 5DM60 2YNMC 1ZR4A 1U9CA 3QLUA 2IUEA 3IPAA 4TKVB 4NCNA 2OBLA 2VZLA 2ZZMA 1T0BA 5K0FA 3OUUA 4MKIA 5JSFA 3T94A 4ZODA 5AVQA 1PTKA 2XOXA 2J3DA 2B6HA 3BJZA 4NOKA 1YAHA 1G1MA 1NE2A 1SUBA 1UCFA 3FTPA 5CITA 1Z4QA 2MDTA 3DKPA 3ML1A 4ZYLA 1U1DA 1HDGO 1E99A 2XB2A 4AMUA 1U3UA 3K5IA 3HRIA 2YYYA 2H54A 4G5SA 4H4CA 3WKBA 3AU8A 1IBSA 1K27A 1XZGA 4B35A 1XI2A 4RO0A 4BNDA 2PYZA 2Y3IA 3LNCA 2ZVJA 1XXLA 4XRGA 4UUPA 1T29A 5GTDA 1YR9A 4WKCA 2BM0A 3F3MA 2ADFA 2EXXA 3RBZA 4I3HA 1I13A 1TUBA 2NZXA 1IK6A 2XZDA 2WA2A 1XE3A 4IIYA 2W6CX 1VA5A 1CIVA 4B3TB 1V1JA 3K2BA 4XCQA 5ALRA 4IG4A 2FUCA 1M2VB 5KNLA 1ZVMA 3G0DA 3FF4A 4ZVOA 3CWZA 1CRQA 2O3JA 3MUEA 5PNTA 5DIFA 2QRHA 1LDEA 1DUSA 1QP8A 3K9WA 5LXTA 2QGZA 4JXJA 2AQHA 3GRFA 1SCJA 3ZW7A 2J59A 1I3NA 2ILVA 3TBHA 3FUWA 3U1TA 4QPZA 3VGJA 4B9AA 1P5HA 2D2VA 1G4AE 1IHYA 1TQ4A 3P2OA 4O1MA 2ZBFA 1NLFA 4EHAA 3VM6A 1WF6A 3KPVA 3UJ9A 4GOOD 4E46A 4X3OA 3NVDA 4L3VA 3WRVA 3BGWA 3Q2KA 5LXTF 3KWMA 2ID8A 4FEYA 1JZSA 1PJZA 1U2GC 4OLFA 3RS0A 4BE9A 4IIGA 2XT0A 4RZXA 4GPEA 1N8NA 1UZAA 4GZLA 4YAOA 3P0EA 5ECGC 1P31A 1QXSA 4BDSA 5KDDA 4MMYB 2YXEA 1R0ZA 1CB0A 1XMIA 3JATA 1SUIA 4U7JA 1GL9B 3R1IA 3PPWA 4OHRA 5LL6P 1X77A 3MWDB 4Z1OA 1SD5A 3TX6A 3BD9A 3V7WA 3F47A 3S3TA 3D5QA 2HZBA 3DMTA 4BEJA 3SYRA 2DR2A 3F8TA 4PYMA 5EINA 3ZZMA 3EGXB 1MRSA 3KBBA 5CDGA 4OX9B 3LUBA 2VHTA 1P1HA 4D9KA 5LB4A 1I8TA 1ULUA 3WNDA 2HWXA 1O9HA 2AIRA 1KH3A 3EPRA 4HSEA 4K2AA 5EAIA 3D4IA 2HEGA 3DDUA 4AICA 1W36D 5FNVB 4QT0A 1EVJA 4KPFC 4S05A 3LTNC 2EF1A 1TCCA 4M7PA 3IAM1 3AJ8A 3LSTA 4ZICA 2FMFA 1PEAA 1XCLA 2WTAA 3K20A 4IPTA 3GRPA 3Q0TA 1VE5A 1AUOA 2Q1TA 2XYRA 2XT6A 5E8RA 1Z08A 1KL7A 3WGLA 3ZZ1A 3IE2A 4D44A 4XASA 3A28A 3P32A 1U9JA 3OZWA 1J0CA 2XUFA 3SE7A 2QE7A 2J9RA 4JLAA 4PSUA 4M9SA 4DB4A 1L1FA 4YMGA 1R0KA 3A8TA 3K2IA 2QRQA 1NL3A 1YRYE 4N7JA 4XCXA 3QEMB 1LDNA 2NO5A 2XDAA 4K7JA 3LYAA 5IMSA 1Z06A 5B36A 2BKEA 2Z6QA 1VI5A 1E5QA 1YK0A 4F96A 4IG9A 3NIGB 1VHJA 3A1SA 4URWR 4O2BA 4D3XA 1DJPA 5A9TA 4L02A 5H0IA 2QF7A 2QN3A 5LQKA 1XA3A 5T8KA 1IBMB 1OHHA 3EOBI 4UDYX 3RYCA 1YMUA 5TMEA 1FNSA 4OBEA 5HG0A 4WLOA 4OIFA 1EI9A 1JEAA 1V6AA 2NZ8A 2C4NA 3L4BA 1NRIA 3B9RA 4ZREA 4ZVUA 2QX4A 1QDLB 2R6FA 1A50B 2WM8A 3AI1A 3GEMA 4Q4JB 1CY1A 1LFAA 5JAQA 3SQWA 1YB6A 3TD9A 3TFQA 3V1NA 3GJ8A 3Q7IA 1XZHA 2Q5IA 1G55A 2YNMA 1EG2A 3SY8A 3SS7X 2CWWA 1N9GA 1OQAA 1QU2A 4C7VA 1ZK3A 3MS4A 3T7TA 2GTPA 3CUKA 2P9ZA 2Z4RA 5MHTA 3WIVA 1LVHA 3BHJA 1FLAA 1M5UA 1P7WA 1Z5UA 2QQEA 1MNQA 4NZMA 4QOJA 4A0QA 3ZJYA 1B43A 2ECPA 1RWPA 4JL6A 4QQKA 2FUKA 2PBFA 2C4HA 3TEMA 1A96A 1ZH0A 2ZIXA 4RDHA 1A8IA 4LF7B 1SG6A 2VR1A 4AP9A 1QR6A 2MMCA 3QLVC 1DADA 1QJCA 5G1PA 5K51A 1N2SA 1LI5A 1Y42X 5BR1A 1VLVA 4QHSA 4BB6A 4GM4A 3HB1A 4Q9LA 2MR5A 2IXEA 4L72A 2P6NA 5A1TA 2R751 2NOAA 1T8PA 3GPBA 4QFCA 4RNCA 5HIMA 3UGJA 1W88B 4RDCA 1ENYA 1ZGGA 3DE3X 3K4HA 3VPXA 5DK4A 5HX7A 3HCAA 1C0KA 3BL5A 2COEA 1L4HA 3GQBB 1RRGA 2ZKIA 3H99A 3JQPA 3K0HA 4KE8A 1FP4B 4LDJA 1F8GA 2ODQA 5U4XA 4HTFA 2HHCA 1T91A 4EA6A 2KI5A 4FSHA 4IDFA 4KZPA 4OQDA 3NWPA 4UEOA 2VDNB 5K3SA 3T12A 2XVYA 4EG3A 3PQ3A 5TQ2A 2QN6A 3GGSA 4I1UA 3ZWVA 4MUGA 3I2FA 1SA0B 4BNZA 1XZFA 2AA3A 1LV7A 2Q0SA 2YJ5A 2C2MA 4OOFA 5C2JB 3BF8A 3ZXYA 3HV2A 1XD8A 3FPKA 1U0RA 3IAHA 3L7NA 4BN0A 3HDQA 2NSLA 1K97A 3BX1A 1CR4A 4MA0A 3M9XA 2HC9A 3D6MA 3WE7A 1NBIA 4IQ4A 1EKXA 4XB1A 3G8BA 3BL6A 4JEHA 4BO9A 4YONB 3VGPA 3K0SA 1O2DA 2CVOA 1E7QA 3IPXA 1UMDA 3UJPA 5LYJB 1K89A 1S8NA 5DLYA 2GPAA 2XHZA 4I4TB 4KQFA 2I4IA 1TU3A 3TLXA 3ZXXA 5IDQA 5J59A 3QGMA 3U13A 5J4LA 2IYRA 4LE1A 1E8MA 2WUGA 2I65A 1JFVA 2HLDD 1KEWA 4KRXA 4ENUA 4PXSA 3A26A 2EZUA 3ZBTA 5TSDA 2NTVA 1V8BA 3H4TA 1MDFA 5J4HA 2FR1A 2Z9BA 4E5PA 4O1HA 2OYCA 4M87A 1QIMA 3VNRA 2F1OA 2Q5HA 1C9MA 2O6HA 3G2PA 4M1SA 4F5ZA 3JYPA 2DGDA 2BGMA 1YQUA 4EF6A 4B5LA 1II9A 5JJKA 2YYAA 3LY8A 4IIFA 4ESOA 3IDZA 3ZS8A 1APBA 1QU3A 1G7SA 1W8DA 2WJZB 1EZ1A 2MHCA 3U7JA 3DZ8A 1BGXT 3Q7QA 4BQPA 3NBZC 1IVYA 3OLYA 1UJ5A 5I9SA 2X5XA 3CRQA 1OX4B 3B52X 4B74A 3K73O 1E61A 1SVNA 2DBVO 3MRXA 4P80A 2H2FA 2QX7A 5DW0A 3CF0A 2RH8A 3SPXA 3OFJA 4YCCA 4OI0A 2ZPTX 3EXAA 1TYZA 3H5VA 5CG1A 1QF6A 3A70A 1U2QA 5EJ5A 1PTJC 3BBLA 4GI3A 4C3ZA 1YI1A 2Q3HA 3S70A 1OWMA 4F12A 4YCAA 1T15A 4P6VF 4XYLA 4YX9A 5KTOA 1T3HA 5F1YA 1JXAA 2PLFA 3JZDA 2VJPA 3DVAB 4BO7A 3WLJA 1E4EB 4EITA 1RJWA 2FWNA 4O6VA 3QXCA 5IKPA 1FYFA 1D2CA 2O7RA 4PLYA 5KNCA 1GTJ1 1JB9A 2I7XA 1OIXA 4PVCA 5I7AA 1I9CA 2AHRA 2Y1XA 1J8VA 4PHGA 5KYTA 2X5OA 2B4AA 2YXPX 4MYTA 4GWLA 1NZFA 2HBQA 1Q3TA 3GY0A 2BCEA 3PJDA 1R10A 3QVOA 3CO0S 4PONA 3QM1A 2OV4A 3DLHA 2HBYA 5GY7A 2I2FA 4KPUB 1S6YA 4O4IB 1Z8NA 3IVGA 3UK1A 5HTOA 1JWLA 5HOEA 2A3NA 3KR1A 1SHUX 5EKTA 3F9CA 4EENA 2VSQA 3TOVA 3TRFA 3A3NA 3TRHA 5CDTA 2G04A 2OLKA 1KZ1A 3QKUA 4BX9A 1SEVA 3EK2A 3FCAA 2BDTA 4U7HA 4UARA 5I7OA 4F97A 2O2GA 1ADJA 5FB3A 1Y4UA 3T3PB 3UXMA 4B5KA 1QQBA 5ES3A 1GJRA 1HWYA 2YV4A 2H18A 4IMPA 4KXLA 1XJCA 2EIHA 4CL0A 5AUQA 3W3ZB 2F1JA 4L57A 1G5TA 2WTMA 4MULA 4Q4AB 1MB0A 4AI6A 3CEMA 1CUVA 1G7CA 2CY0A 1CRPA 1FVFA 4LW8A 2C03A 3PR3A 1UFKA 4HADA 4GSLA 2XVXA 4GBJA 4KK4A 2B8WA 4YFYA 4ALJA 4A2QA 1LK7A 1DEKA 1A82A 3FMGA 3GFSA 5FOXA 3A4VA 2JIZD 1KZGB 3QA9A 3AETA 3VX4A 5ES4B 2X22A 1LF5A 1R37A 1ZD1A 3PUHA 4KSCA 4MHOA 4MWTA 1U63A 2EJCA 1Y4ZA 1WZIA 3FFBA 3FOAA 5EZQA 5KYWA 2PZAA 2ATEA 1VPLA 4XARA 3I5XA 4DV2B 5K1ZA 2VF8A 4E1VA 1MAWA 2O8BB 5LFAA 3Q8LA 1O87A 3EWIA 2OBMA 421PA 2IOHA 5TEWA 4WXYB 3IJ5A 1QRDA 5IN5A 2Q0QA 1RHQA 1M0SA 1R16A 4BKUA 4GOLD 1DRWA 2C1ZA 5KIAA 1Y3IA 2XJ4A 4LQDA 2BMJA 5KB3A 5DIZA 4F71A 2POQX 3L5OA 4IAOA 1BHSA 1YC2A 3ZHYA 1HFEL 1TKBA 2ZATA 1EG7A 4Z3KA 3UJHA 3GAZA 1GPJA 4MUHA 1TCBA 3R0QA 3IT1A 3M9WA 3GDHA 3BMQA 3O5AA 4D9BA 4P0QB 2ZVPX 4B6JA 2OMEA 3KQPA 3TZCA 1D1TA 5CDUA 1NW5A 2AR0A 1QIKA 4RVGA 2B1RA 1YGYA 3QVKA 5A71A 4CODB 5E7JA 1PGNA 2JAPA 2FWAA 5FOVA 1RLTA 2QTMA 2H29A 3COZA 2FW6A 4OV6B 5H83A 3UY4A 1NP6A 3ISJA 1T3ZA 2AN1A 5TMPA 1V1MB 5E9JA 3SJUA 3CNEA 2WG2A 4I1OA 1CY0A 1TK2A 1ZGAA 2HMWA 3OKAA 4AWXA 2G5CA 5K03A 1EEXB 3RUCA 3DEHA 3FSJX 3OF5A 4C2AA 1YRWA 4BYMA 1T8TA 2D2XA 2QKYA 5TE9A 5JYEA 1U6KA 5EIBC 2G40A 3AP3A 4PYRA 1KOLA 2IH2A 2VYCA 3MJFA 1AH2A 5L6LB 1K75A 3LC1O 3Q3IA 4R1LA 5CX1B 1GD1O 3PGKA 5BP7A 2QTVA 3JQGA 2X5JO 3W8FA 2P8JA 2VVTA 5KQPA 2Q21A 2W71A 1QMGA 2QSUA 2YVLA 3V4PB 1X87A 4GPTA 1YVPA 3V4LA 4A3SA 1CUGA 3EG9B 4JQCA 1KPHA 1YCDA 3O4RA 5JTTA 3QXJA 3RUFA 1O9GA 1RWXA 3I0NA 2PUWA 4MQ5A 3H3FA 3TDNA 1Y3CE 5KS2A 1GPNA 3GLRA 2PUVA 2RK4A 1L3BA 4Y6GB 3B2EA 3KJGA 1ATIA 1UEIA 2HCTA 4LZLA 5ANRB 2Q49A 7MHTA 3BL8A 1NV9A 4ARCA 4PC2A 1WLSA 2FP3A 2YRFA 1AQYA 4PSCA 2O8FB 2O7VA 4NYMR 4B8YA 3EX7C 1BKDR 4LDZA 4UQLA 3PJGA 3N8HA 2HSZA 2JJ2D 1VIVA 1U5AA 2X7XA 5FTMA 4J2TA 3NBFA 1UOPA 3PXUA 2NP7A 1FRQA 2UZ0A 1GKUB 2F8MA 1NMZA 3PNYA 1W5AA 3P4UA 1FBTA 4JV5B 1PTJA 3F6RA 4LKRA 4GGOA 2FPGB 4M9RA 5SZHB 1YJBA 4AO8A 3NGLA 5ELLA 1E0JA 1WPQA 3ILSA 4L74A 3BQMB 4G5YA 4B7CA 3GLHE 2RCYA 3IAUA 4WKPA 1UEJA 2O0LA 3F5DA 1CBUA 3WGYA 1PFWA 2J9YB 1VKOA 3PYLA 3FNIA 3RVPA 4BO0A 3GUVA 2QMQA 4H0CA 3RTAA 4UMEA 1D7AA 2V98A 1OWLA 3V00A 1P6QA 4PRYA 3GMSA 5GPBA 1KYQA 2Z5LA 3E22B 4N7BA 1INLA 4DLUA 3G0GA 4G84A 4B45A 1Z5GA 3HNOA 3K6SB 1EB8A 3WMWA 1ACLA 3GZTB 1OWPA 4N3NA 1UFRA 2JJ1A 3TTUA 2AI3A 3OZTA 4JYAB 4N18A 1XEFA 4W5HA 1LWOA 3HA5A 3W8DA 1T43A 1ZM7A 4GRIA 2ZG6A 4MGHA 1V9CA 1OX5A 2YXDA 1CQIA 2Q6TA 3VSCA 5H80A 1TYEB 4D0GA 4YALA 2R1ZA 2NUAA 4HYQA 5MN4A 2DBZA 1I30A 3DDWA 2VF7A 5BWMA 5AW4A 4XWTA 4OPMA 1IHXA 4FBLA 4MNTA 3VV2A 3OOYA 1IUPA 3E9EA 3QVSA 4E6PA 3O2QB 4CF7A 5IDWA 1F2UB 4MJ3A 1Z7WA 1MAVA 5HXAA 1P1RA 1ZCAA 3ZY6A 1AHHA 2VDWB 3HJBA 4RAQA 5H1YA 2PT7A 3RE1A 5EJIA 4IFBA 1ZD4A 1E2KA 4PGGA 2WSYB 4EJ2A 3ANTA 3JAKA 3HWWA 3Q5GA 2EJVA 4U02A 4EZBA 4G0MA 1ZH4A 4M49A 5D1NA 5I7EA 3B5EA 2NXCA 3DYVA 1D1SA 3AESB 4FEAA 3WLFA 1CUHA 3GVCA 3OLWA 1KFKB 1TXGA 2G9UA 1MO4A 7MDHA 1TZCA 1HX7A 4DIBA 1NATA 4UFOA 3RRYA 2RGNC 4IDQA 5AXBA 5IH3A 1LK0A 2J9FB 3DKVA 5DWQA 2A0XA 5K20A 3AJDA 5ALDA 1AN0A 2ZYDA 1PR2A 4KYTA 3DHWC 3U80A 3ZHRA 3UMJA 3C6XA 2ZUEA 1VSUA 4XYEA 1N3IA 4EKNB 2J0VA 5FJIA 3D3NA 1Q74A 1ELOA 2HCFA 1EINA 2CFRA 3G9ZA 4Q24A 1HSOA 1IFXA 2DUUA 1T5DX 3VR3A 5B12A 2IV3A 3AF6A 5FR1A 3VNBA 4L28A 3PUVA 2PQ0A 2KX7A 4ZCLA 3A3KA 4YT5A 4NHOA 1DQNA 3WWPA 4ZDIA 1KK0A 3VPGA 4RVCA 3EXIB 1EWVA 4DLRA 4DS3A 3OLCX 4HXEB 1GLVA 2CJWA 4BN5A 1HTBA 5HJ5A 4JLNA 4MGEA 1NVUQ 2DFDA 2QTHA 3ABOB 5AOCA 1K63A 5J5VA 4PIMA 4JELA 1A8HA 2PE5A 3KM0A 4XCVA 3CUUA 3DOUA 2H48A 3UAYA 3WK8A 1LX6A 1BDBA 1R4NA 2CNOA 1U0EA 2AB0A 4PU0A 5JALA 3EPKA 3QNMA 1KYXA 1P4GA 3ZNNA 4I9NA 1UDAA 3PCXA 3VHRA 3BTVA 2B61A 1JECA 3DAFA 1B0UA 2GXAA 4I9GA 1E9EA 3L01A 1R66A 2VEDA 1LS6A 2GEUA 3ZQJA 8AT1A 2JLZA 1C4OA 4CG3A 4EYEA 4YJ3B 1L7DA 1Z63A 1OBHA 1C2TA 3BZBA 2F8SA 2HFKA 2R4UA 4WE3A 3IVRA 4JVOA 3VHLB 1ZP6A 2VPTA 1N36B 2PX5A 1EDDA 1OR8A 3DWEX 1GGNA 3KEMA 3O4JA 1H8EA 4IMIB 4L5CA 4N65A 4TMXA 4GUAA 2V7EA 2FSVA 4I1VA 4GDFA 1M6VB 1E1LA 1T1JA 1BW9B 2PXXA 1FC0A 2J6BA 1KY3A 1XZBA 2VBFA 3QFFA 4GMFA 4UU1A 3AWIA 3KFLA 1LPMA 4P4TA 4UXJA 3EZFA 2DPGA 4D3YA 4P81A 3FM9A 1GIAA 1LPNA 3JWIA 4DDVA 1PJ4A 1PL8A 3HJTA 4GKAA 1WMBA 3GNQA 2DETA 1HRKA 4K05A 4BFYA 4WHMA 2P4EA 4AMZA 2CXQA 2W2QA 3TK1A 2J9ZB 4R8SA 3UT5B 4A82A 3HMQA 1IUNA 1M5TA 3AG6A 3GMIA 3REGA 4UZSA 4X1IB 3FDXA 2I1LA 1H1LA 1R3UA 3F3KA 4US0R 4BO1A 3GJSA 3CR3C 3MCAA 1T35A 1FX0B 1U7HA 3W4JA 3CUTA 3PGMA 3E53A 3Q5DA 2DE0X 4BZQA 4D3FA 1V5EA 1S89A 1Z37A 3BE8A 4JMLA 3HVRA 4LQLA 1ZPDA 1VRVA 1G5IA 1ZI8A 4M3NA 3ZZNA 4IZIA 4N8SA 3L46A 2VA9A 3KXKA 4PHTA 1P1IA 3EMDA 1YXMA 1LQUA 3P9KA 4ZU1X 3ODGA 4PQEA 3GIWA 4W8GA 5BN3A 1AB5A 1E2DA 2VC2B 3DQPA 1WB5A 2H4JA 2VPQA 3ZDAA 4EOGA 2PH1A 3SR3A 3T9FA 1JFFA 3D8NA 3KXLA 4XH9B 1WUIS 4FBGA 4F5YA 3EDCA 3HH8A 2Q7XA 3A4MA 3MRSA 4QASA 1AKRA 1OAOA 1U5BA 3A0UA 3CZMA 3NNNA 5CP8A 1A7AA 2QDKA 4EJFA 8OHMA 1YU9A 2V6BA 5A5VA 3GMTA 2NQ8A 3ONVA 2GHRA 1SCUB 2CXXA 4OSEA 2VAPA 5EP1A 1KIFA 4PC1A 5KAPA 4MROA 4RGQA 4B7UA 2UYOA 2EZ8A 2I3BA 3KZKA 4L4RA 4Q19A 2ALJA 4RABA 3V4OA 1HRDA 4PG4A 1N25A 1A5SB 1YL5A 2CMDA 5DHQA 2VWQA 5F1PA 1VMIA 3AYXB 5AJVB 3EXHC 3HN6A 2XE7A 2JCXA 4FT4A 1CY2A 2WAAA 2VXYA 4KZKA 4LJYA 4I9UA 4U63A 4DW8A 5HUHA 2H9IA 2UAGA 3R5KA 3RG8A 1FUYB 1AKNA 2A33A 2EKDA 5D85A 4AY2A 1EDOA 2BFAA 2ZYGA 1RM4A 3GEGA 1QYCA 5FORA 3EWNA 4MR8A 2QV0A 4YMIA 1J70A 2X0KA 3D31A 2XQKA 1L5HA 3NJRA 3QJ5A 4F8JA 2K7FA 1JFFB 1GN9A 2VI5A 1BH6A 1KJIA 1QIHA 3EEQA 3ETLA 2ZETA 1ENZA 1V16B 1MABA 3IV9A 2OBFA 3GPCA 4FLFA 3BD8A 4KO2S 2IXTA 4F2PA 1R0WA 2Z0MA 2P91A 3CLTD 5EJ9A 1AK1A 4JLOA 4YQYA 5DTRA 4CQMB 1ACMA 1DC4A 1E6WA 3TTVA 2OPBA 4QM6A 3PL1A 3KL4A 5I4KA 3KYIB 3R8FA 3VR5D 2IP2A 2BTQB 1XCGB 5EUMA 1W75A 1VL0A 5EI5A 3PHIA 4MKFA 4Q4HB 5K0ZA 1OBCA 3ZGYA 5H02A 3A7EA 4L2IA 2C7VA 5H8WA 4JOCA 4NPCA 2ZT5A 2WUDA 3TO5A 4QJ3A 4E15A 3H8SA 1NW7A 3VR4A 1UT5A 3KBOA 4PPGA 1KYVA 4HH3C 1QC5A 5ICCA 2B7CA 2JEYA 3QUBA 3MWFA 1H0HA 4PF1A 5GADl 4HUJA 3RAGA 5DP2A 4IZOA 2HRZA 1FBNA 2QU8A 4D79A 4E51A 4X3PA 2ZRIA 5EN4A 1XYYA 4K46A 3WBJA 3H11A 1NBHA 3NTQA 2VTBA 1B76A 3DUWA 4X7MA 3S1SA 1VG0B 3L0DA 4ND3A 2RKWA 4B3MB 3JTEA 1DTWB 1PT6A 3F5QA 4K03A 1S2IA 4Q3OA 4CEIB 3Q9UA 4R2MA 2YRXA 4LUCA 3D0KA 4EHHA 3PZBA 1JEJA 2BGGA 1RC8A 2JGIA 3UJ7A 1DHRA 1JJVA 3DF9A 2NMVA 5KSYA 1SVKA 3RVQA 4ZWNA 3H9GA 4O0MA 2ADOA 1NBOA 3EGOA 3R24A 1DELA 3JVEA 3K0CC 1K08A 1CRLA 1DOHA 2YCLA 1JVBA 2B78A 1X1DA 2AC7A 3EAGA 1GPLA 3KT0A 1D9XA 1I3CA 2C3OA 3MWEA 1SQ0A 1PNQA 2GKOA 3IR5A 1B6GA 4XJXA 4CR7A 2C00A 2V7QA 4EUFA 4UOEA 4XYGA 4DF3A 1GXSB 1LVUA 3K8ZA 3WTBA 4DY4A 1RBQA 4RTNA 4N41A 1LC0A 1CR2A 1R12A 1ZBDA 3BKXA 3UJ3X 3QE0A 4PAGA 1Y8QB 2WWXA 3TIGA 3L0ZA 3W0LB 3AF4A 3AUSA 4RV5A 1KMNA 4TN5A 2GK6A 2YY6A 4JR0A 3S7ZA 1JEQA 5B4UA 5DM70 2Q4RA 4KIFA 4JVMA 3BMCB 4C4AA 5FL7A 3WLNA 3A6KA 2AT1A 1FQJA 2J48A 3MWGA 4BNWA 1AQJA 3GLFA 1F12A 2JATA 3LH5A 3RVLA 3PP8A 5KYXB 4CIYA 1K9SA 1LS1A 3I9V1 4NAHA 1GCOA 3IV6A 3ORSA 3RU2A 3I6BA 4LRWA 3RC9A 3O2SB 1U5CA 1PDOA 3CX7A 1UJCA 3QV2A 1Z88A 3HPQA 4G4SO 4HZUB 4Z0PA 2ES4A 1KKMA 3TOSA 4G63A 4KR2A 3SYKA 1HT2E 3UMCA 3DNPA 2OHFA 1V7ZA 3M6FA 5BW5A 4FHGA 2B82A 4K9LA 2W42A 2FJUA 3FHLA 4MQFB 3WYNA 1I32A 1USUA 1RYNA 4EAAA 2JRCA 4B84A 4YV1A 1GTG1 5L3ZA 3TLYA 2D5IA 3FLEA 1VHQA 3MGBA 4OQQA 4BLOA 4P4SB 2W2LD 3DTTA 4EA8A 5ITZA 3AI3A 1KRHA 1LPPA 1YGPA 2ZSDA 4ZVSA 1YDMA 1SVUA 2QI9F 3UAWA 2PU7A 4R2WA 1N4DA 4RPIA 1D2NA 1YQTA 4R6WA 1LF0A 4J0KA 2F2TA 4JYMA 1NVFA 3CLHA 4MDYA 3KO8A 4M0CA 4YRFA 3V46A 1O95C 3LHKA 2OGWA 3H86A 1H4SA 3FRHA 2BSQA 3WJAA 4LSWA 1TM7E 1U65A 4RKRA 5BV2P 5KQSA 3WR5A 2NU7B 3D0OA 1SQGA 3BTSA 4WNIA 4TV8B 2BSXA 1JLSA 4AMYA 1WY7A 1I1QB 4WN9B 4CN8A 1RPZA 1GYPA 4LZZA 3NUQA 3ZDEA 1ML3A 3G0BA 3W5BA 1TU4A 1H2XA 3R9IA 4F45A 3ROPA 4WK0B 4XWWA 2YDYA 2IZ6A 4D41A 1N0UA 5KOIA 3D6TB 4D25A 4UZFA 4X8OA 1EFUA 4ETWA 2ZU6A 1GAQA 3H5AA 1TJNA 2K2QB 3PNSA 2V97A 1QIEA 3TNYA 1MO6A 2HMUA 1GQ2A 1N7GA 4CF5A 4NCIA 3DV9A 4J43A 1EK1A 4GPBA 3SQOA 4AN1A 1LDMA 1YB5A 3FB4A 3KRTA 3DV2A 3H6KA 2BEJA 1OC4A 2LR0A 4KNWA 3CRW1 3RFUA 4BU0A 1P5ZB 3KIPA 3PSHA 2F1HA 5H7XA 3BD7A 3KJQA 1QHIA 1TLFA 4E94A 3GRAA 4WK4B 2X1MA 3EXHB 2AOTB 1TZKA 2HSEA 2VIIA 1XJ0A 3ANSA 4UTRA 2DC1A 2R87A 1FE8A 1UPBA 1QCCA 3SLGA 4BAGA 1ZM3A 2QGFA 4AJ9A 2UXBB 2PNFA 1YR1A 3W7VA 4PZEA 4NBWA 5AW1A 3AHHA 1K8QA 1R9NA 2LRHA 1YB7A 3LY9A 1BQ3A 5G0TA 2GI4A 4RVSA 2QUIA 5IKOA 5GVRA 1KDOA 5GWXA 4K6FA 1FTWA 3N8GA 1UP7A 2ST1A 2VATA 5L3SB 3ZNOA 3ZE6A 2B4KA 1QF7A 2XDWA 3DV0A 2PWYA 1GV0A 3GFVA 4G6ZA 2MSEB 5AKLA 4U0KA 5KVCA 1RQGA 1W0JD 2V0NA 3ELYA 1A88A 3B7PA 3CR7A 2BM1A 1IHPA 1B8NA 3PQ5A 5IVPA 5JAMA 5DX1A 1K6IA 1NZJA 1SVOA 4Z9BA 4GMDA 5IULC 1ORRA 1SOVA 2ZAOA 3QVLA 2MMGA 4RJ2A 3L0YA 1ZMBA 1NRXA 5AVOA 1AGRA 3QX7A 5IW8A 4NOLA 3ZU3A 1NKSA 4YDSA 2XITA 3CSDA 5HRCA 3K0CA 3PFFA 1EUQA 4RUKA 4FZJA 1P2UA 2QQ0A 4YXWD 1XHLA 1QAQA 3BZWA 2WJGA 1QFMA 2QW8A 1KEPA 4HY3A 5CLGA 3W5HA 5GIOE 4DBLC 2C2GA 1EK5A 2G9QA 2X8JB 3IP3A 1NVWQ 1MEEA 3S68A 5JNRA 4N4AA 2O8VA 2RHBA 1WSWA 1BRMA 2PX8A 3GZNB 3LCUA 4QDOA 4DLZA 3OX2A 1II8A 1RWWA 1OZ0A 1W49A 2EFCB 2YWEA 3BMOA 1L4MA 3D6NB 4OHFA 3JRNA 4QUDA 3G85A 4UAVA 4CKBA 4O1IA 5EZ5A 5JJCA 1GNVA 2J3EA 2V59A 3NTLA 4DANA 3P2MA 2CNNA 5ALSA 2BHNA 1T0UA 1GCUA 5CXXA 5L3VA 3EH1A 2I3GA 1GDDA 5ALZA 2XKKA 1L5WA 3QG5A 3WSTA 5HQJA 5K6AA 1L7MA 1K7CA 1EP3B 5B4TA 4KLNA 2WYUA 4LV8B 4DCVA 1OREA 1SK9A 4EG6A 2CCGA 5I47A 4OSOA 4I6GA 1N77A 1C81A 3WLPA 1AKWA 3H87A 3PXAA 5C37A 5EHGA 1NXOA 2WTXA 3K4QA 1P60A 3OIVA 4IKPA 1DAMA 1P62B 2Q5QA 2QORA 4P84A 4KAXA 5BSUA 4EX6A 1YNOA 2HGSA 1TZBA 1HYEA 3DQQA 2OAQ1 1HNZB 5FEUA 2IYXA 1KMMA 1RYBA 1OF1A 2QUBA 3O7MA 2VTDA 2YASA 3DSRA 3CX8A 4LQ4A 3X43A 2UU9B 2VK1A 3G8DA 3JQ9C 1P29A 3CLUC 3QWHA 4LYGA 1WXWA 4XWGA 3ROQA 3MTBA 1T8SA 2IU3A 5AQEA 3D3KA 1SXQA 2AYYA 2YZMA 2QM8A 3E5RA 3O93A 1N0IA 2XTAA 4L85A 4L95C 1B15A 4EKEA 3O4FA 2GSWA 3PFIA 3I9FA 3UUEA 3BK2A 2DLNA 3OU2A 5BQ3A 1OH7A 3HA7A 2PMFA 2RH9B 5IDXA 3H2SA 4FX5A 2D5AA 3KB1A 4LF9B 3RR2A 4HEQA 1GUAA 4LJLA 3RTEA 1QB8A 1XZAA 3HQ4O 4HXFB 4K5QA 4Q9DA 2ONKA 4BGUA 1O95A 4DR3B 4MR7B 5DN9A 2G71A 4TZTA 2AL7A 1WKVA 4Q93A 4ZAVA 2L69A 3AZQA 5KNDA 4K1LA 1EP1B 3T1YB 2W2VA 4OBBA 2F90A 2JZOA 5CDHA 4Z7NB 1R9GA 1UJBA 2IZ5A 3G59A 1BXGA 3DLCA 5K0SA 4D0SA 4BXOA 4FZRA 3E35A 2HIGA 1BN7A 1UIRA 4UPEA 1HLDA 1R4AA 2ZYVX 3JASA 2I4OA 4LNUA 4MPDA 4EF5A 1AT1A 4XFDA 7REQB 1I7QB 4JC0A 3MCZA 1E2IA 1FSFA 1Q0LA 1DKOA 1QGED 4OJKA 5AVSA 1WBBA 3EXEB 5AW6A 3FI0A 2ZUFA 4WT7A 3V1LA 4HDSB 3NR2A 3QXXA 5A4MS 4YDQA 3KAKA 3EFHA 5HGJA 3T4PA 5DO9A 2BC9A 5BSEA 1NJ2A 1KH2A 2FDRA 3HWSA 4LRUA 5JSQA 4RY8A 5L4NA 5JS1A 1L7BA 2FW0A 4HAVA 3BBPA 3EIUA 1KI3A 3LP8A 1E2JA 1KO1A 1JDVA 2FWIA 3FPJA 2GLUA 1S1CA 4ZIRB 3N5CA 3GL9A 2IZ1A 2PL1A 1U80A 3V33A 1RVV1 1W0KA 2J0UA 1FYWA 3Q9SA 3K94A 3TD6A 4DIDA 1U02A 1XZCA 3U4QB 2GM9A 2ZYRA 1EA7A 4QBFA 3W2EA 5JCOC 4IVNA 4DLLA 3O84A 3EIQA 3E9MA 1XTSA 5HW0A 3FMOB 5CT5A 4L4UA 4KXXA 4XLZA 5F2EA 1QM5A 3TLEA 4BLWA 3GP8A 3EFEA 1V2HE 4BKQA 1DGQA 3HBLA 1DTSA 3OC0A 3PS9A 1UWLA 2ZR0A 4II7A 4Z8YA 5E7IA 2OENG 4A4DA 5F64A 1G20A 1LDGA 4OI1A 2G25A 3I1FA 3L6DA 4TM8A 5AM0A 3TM4A 3HO8A 5CB0A 1JIXA 1ECBA 4R3WA 5IKEA 2A0KA 2I2CA 3ZEIA 1MKYA 5JIBA 3O8QA 5D6NA 3CUSA 4PBTA 4BS9A 3OFKA 5HZMA 2WKQA 1L1QA 1XK7A 1C41A 5CMLA 4XQCA 3H19A 5CCDA 3SXJA 3FOEC 1GY8A 2NSYA 5KSOA 2XDQB 2IW3A 5CNIA 5A9SA 3AL2A 4LY3A 1CYDA 5DYYA 3THYB 4EPRA 1RT9A 4WZBA 3GNSA 4LTNA 4Z7QB 1NBMA 2BFFA 1K7FB 1W94A 2I4MA 3AEYA 3CWQA 4IZHA 3RT7A 2V6FA 1F20A 2CNWD 5DF1A 3TINA 3BSWA 2B9VA 3IRUA 4YRKA 4OHWA 2HMAA 1N2CA 1F0NA 3O9ZA 4NK5A 1JSLA 1N1GA 4U9UA 2RHTA 4F46A 4FGSA 2H7VA 2ZWMA 3KKEA 4G41A 4YB8A 4P31A 1FU4A 1EDEA 5CJJA 3Q8WA 1EVEA 1YS4A 2QRZA 1BJRE 1DC6A 2WSSA 3ZK7A 4EW3A 2HRRA 4ZYXA 2X2PA 3IMKA 5JG7A 4PS1A 5TV2A 1FUEA 3R7WA 1KQFA 3GPDG 1W5BA 3LXRA 3L1JA 1RM0A 4LHEA 1DXYA 5EG5A 4KN8A 3RHZA 3U7RA 3AYZB 3KKQA 2ODTX 2X9QA 4LAFA 4LECA 4Q16A 1YV9A 3KTAB 2OAEA 4IIUA 3KYCA 4PQRA 3SDBA 2W83A 5HCNA 1U2PA 5CNJA 2IXGA 5ARCA 1N7HA 2CCJA 1M2EA 3T7AA 1JNYA 1HTTA 2RMKA 1MORA 3II6X 2QZJA 1WBJB 3QPUA 1OXKB 2Z3VA 4N82A 4Q21A 5LA6B 1CS0A 1EX6A 4YP0A 3ZV6A 3KL2A 4YMVA 2K87A 3ERCA 1YC5A 2JGLA 4FFMA 1Z2EA 2AWOA 1UK8A 2OILA 1MEOA 1ZUWA 1RKBA 2HU2A 9GPBA 4ZXFA 1VHWA 3KDAA 1DBWA 1CTQA 3KELA 3GYGA 3N87A 3RYHB 1CK4A 3DZGA 3CZAA 2ZYAA 4UNSA 3ZWPA 1UBLS 5F5XA 4TYWA 3V4FA 4ARZA 3CF4A 3O8RA 5K0NA 1T2NA 5LP6C 5HILA 1H93A 4MKXA 2B36A 2CT8A 3SZUA 3M4NA 2BGJA 2KS6A 3V97A 4K6KA 4H1VA 1LWNA 1V5IA 3TAUA 3VJKA 4DC0A 1YRHA 2C04A 3IBCA 1MC4A 1WPGA 4KDCA 5FWXA 1QE3A 2PRKA 3AY3A 3C8MA 3SYMA 2YIMA 3DL7A 5ESWA 2PKWA 1CUXA 2H9YA 4WGFA 3ADBA 2BTOA 1MIOA 1PYDA 3AERB 4LYDA 2H11A 4DV5B 1QFJA 1QBKC 1X7ZA 1ZGBA 4N3AA 4MWZA 3DB1A 4DLWA 4ZKDA 2IEDA 4LGCA 3WLRA 1DHTA 1WO8A 4NXMB 2RIRA 4OYYA 1G59A 5AKHA 3MCWA 1J9ZA 2PMBA 1KJ8A 3MRVA 3VVLA 3PFBA 4BECA 3DDCA 4DEXA 4AP5A 1QHXA 1JNXX 2YY5A 2BFDA 2LNDA 4GVLA 5AI4A 3TR6A 1ODKA 1V7QA 5DE3A 4Q3AA 1GPUA 4LTDA 3ZYCA 3HTXA 2UYHA 2WPDA 3NP7A 5E2AA 1XEXA 3IR7A 1UZLA 4LVNA 3E81A 2A1UA 3C3KA 4OFBA 3ZUPA 1P74A 3BJRA 3M5PA 4JT9A 4O8CA 4DEVA 4TMTA 4YRAA 2JFWA 1EMDA 4ZVKA 4X54A 5B55A 3U60B 1JHAA 1I2BA 1NVVQ 2FP4B 1RRPA 2XCSB 4C7JA 1UQRA 2R7AA 3FYCA 3I2YX 3W1WA 3OZSA 1H8HA 3KZNA 4ENTA 3ASYA 5CH8A 5LKAA 3V7NA 4H6XA 5EKDA 5T5QA 4JJFA 4U8GA 3HCRA 1XZMA 2ZPUA 5M2QA 3R7DA 5J47A 2O8CB 2J30A 5D3QA 1NN1A 3OCJA 4Y9DA 1J09A 4YXFA 3SXUB 3U44B 1JFTA 4GKBA 2AR7A 1XNHA 4GKJB 5FUXA 4LRTB 4U7TB 3UFBA 1VP3A 3RCBA 2BGKA 4BIIA 3OM1A 1NBAA 3V9PA 4CNBA 1R50A 3OLXA 3GFOA 4LEIA 4K9DA 1N2ZA 1PK8A 1ZR2A 1IG0A 2EKZA 3TN7A 1NF3A 3REQB 3ZDFA 6CHYA 4D8VA 4AUKA 3T3OA 3RVJA 5TPWA 4P4LA 4LI3X 3ZW9A 5B5SA 3EYWA 1WEHA 2PWAA 4JBXA 1Z6TA 4DADA 4IMJB 4S0XA 5CFZA 1PW5A 2XRYA 4IX9A 4XB6B 3UK7A 5A9RA 1XHFA 3DONA 4FPXA 3VYTB 2QD1A 4B2LA 4ESEA 1I4WA 1Q95A 1US8A 4RXTA 2Q9CA 1Z56C 2X3YA 2XGSA 1OU4A 4G8JA 5JLJA 4R1TA 2HBRA 3V8NA 4I7EA 2J31A 2Y9PB 1G8PA 1J21A 3BMNA 4ZTZB 2Q28A 1BVYF 2N46A 4CMEC 4ZEMA 4PLZA 1SBIA 2O14A 5KVVA 3R6LA 2WIDA 4AROA 2CHGA 2D0DA 2NUBA 4RZUA 5EEGA 3CF4G 4YJGB 3ADCA 4CKEB 1JHUA 1D3AA 1Z4MA 2JGEA 4OP2A 4PYJA 1QOPB 3SEAA 3DG9A 2HYIC 5TDHA 2GGSA 1I3MA 2ISCA 2P6OA 3GLGB 1WB4A 1E1CB 2BWJA 3G5UA 4TZKA 1LBTA 1E4YA 1E1NA 2XNHA 1T3GA 4GX1A 5ICSA 3COPA 4OGWA 4OK5A 1TGYA 3Q88A 4YAEA 5FKJA 4XD7A 3W5VA 4W9RA 3HKDA 3FX2A 1QV9A 3L8FA 3RHFA 1RXCA 4EI2A 1KETA 2CDBA 3COJA 3TDKA 3W4KA 1A7UA 4K9MA 3GD7A 2ECKA 2IPXA 3DEIA 3Q12A 4H27A 3DW3X 3A6LA 5AQ1A 1IXYA 2C0CA 1XDSA 2EATA 4GOJA 4BNHA 2YJNA 1KRWA 1U7WA 3ZY3A 3LPLA 4ESHA 4POAA 1O94D 3CUVA 3C15C 3FGZA 3NVKI 1JDPA 4HB2A 3LLMA 3W8EA 2GYYA 3F67A 3AZPA 4ZEWA 3RNOA 1ODSA 1KDZA 2O2XA 1TK9A 3CISA 1DLIA 3OOSA 3U7GA 3IKMB 3QFTA 1UINA 2JI7A 2CSUA 4OHOA 5LP6A 2CUTA 1EFPB 2KW5A 3RHTA 3SQLA 4C3OB 1H2EA 3B13B 4PWZA 4XVQA 1X1BA 5A3RA 1A2QA 2O1EA 3ANYB 4OQFA 2ZDQA 3UCXA 2WHEA 4DDHA 1XK6A 4AZTA 3INYA 3K0EA 3TNLA 2QJTA 3HY3A 1K5GA 4MIKA 1DQYA 2HSJA 1VMKA 2IIBA 3IE1A 1KF0A 1NVGA 3FDFA 2FSHA 4IBOA 3ZH2A 5IJ0A 5LP6F 3AL0C 5IEBA 3K70B 1C7QA 5FO0A 4A10A 1SNYA 1Z38A 2H00A 2JFHA 1U2ZA 3IVCA 1BDMA 1PQ4A 2PXHA 1XHEA 2WJVA 3NLLA 3N2IA 2A9JA 2QZPA 2VQEB 2R8RA 4FMDB 5CYFA 5FI1B 1SG9A 4ZAWA 3HBFA 2YWXA 4KNVA 1YBVA 1PJCA 3G9XA 3BJIC 2IOQA 4EYQA 1PX2A 4ZVRA 2OFOA 3ZBUA 5MGBA 5LDHA 2GF2A 4CKCB 1EAMA 3T4XA 3X44A 1IM2A 3K6RA 3AKEA 2O5RA 5DLEA 5BMOA 4ROSA 4H9GA 1T3LA 5IT9A 1M0EA 1G5FA 1VFNA 3AUXA 4F8EA 3HP7A 1RIIA 4B32A 3EBLA 4V24A 4HDAA 3TWOA 3K9BA 4BFTA 5JO0A 3OM0A 3RIYA 2OBXA 4RJJA 3HU3A 3VH3A 1BS1A 1M1NB 3FOBA 5COBA 4ALLA 5AXAA 1QH9A 4V0LA 1NXPA 4LSZA 4DT1B 3ZWDA 1LLUA 4J1QA 4L5IA 3PA8A 2HHJA 3NYRA 2Q50A 3X3HA 3GU3A 4E4YA 3R5HA 5IC6A 3W9YA 2VN8A 1Y8RA 1OXBB 1ZJ5A 4CWAA 1UXKA 4A8PA 4GNRA 1L4GA 2G0AA 3OPYB 1SC1A 2YOGA 4CBVA 3GR6A 3VC3A 3CZ9A 4KK3A 4DSUA 5JQGB 1BOOA 4L51A 1NVAA 4ER5A 5M5BA 3HJAA 2VYVD 2O2IA 5FBQB 4QBHA 3PKIA 1DVRA 1T2DA 2MT9A 4M6WA 5F52A 3Q7PA 1JVNA 5IK2A 5TT1A 1QRTA 3HSKA 1C1XB 3I34X 4J4TA 3WGUA 2YRWA 4U0JA 1H0RA 2DPXA 4WASA 3TB4A 2IIPA 2HA6A 1UMBB 4DLSA 3DTVB 2FN8A 5GOZA 3QSGA 3DW1X 1PLKA 2ID7A 3HXQA 2PUEA 5TEVA 4M53A 3CVYA 4PNZA 4PX9A 5CB6A 1V3TA 1X6VA 1C3VA 2AF4C 3HFSA 3JSXA 2VQDA 3WYGA 2OZLB 2GN2A 5TLSA 2W2NA 3CGWA 1N6PA 2VPZA 2ZDHA 5CW2A 1JAYA 2Q2QA