2WAXA

Structure of the human ddx6 c-terminal domain in complex with an edc3- fdf peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
161
Chain Sequence
GVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE DDX6
publication title Structural Basis for the Mutually Exclusive Anchoring of P Body Components Edc3 and Tral to the Dead Box Protein Ddx6/Me31B.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 161
sequence length 166
chains with identical sequence C
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2waxA00
4MKGA 1AJEA 3FGNA 4CRWB 2PJZA 3Q9LA 4LBZA 4DSNA 1DOAA 4TL7A 1DVRA 4B3DA 3DM5A 2B8TA 2FF7A 1KAGA 5CIQA 2I1QA 5LBIA 1G3MA 4MH0R 1XTKA 1UM8A 1E79A 3T15A 3A1UA 4A0GA 2CK3A 4URUR 1RJ9B 3RWMB 2QSZA 1H65A 4WOPA 4C2TA 2RGCA 2QNRA 4FINA 4X8MA 4H1UA 2B92A 1R5BA 2KE5A 4GOKA 4BFWA 2F1IA 2V8OA 3NHBA 4QHSA 5TV2A 4U5XA 3VU9B 4PC7A 4NTZA 2O8DA 1YHNA 3HYRA 1AZTA 2PZGA 1P75A 5GJWC 2HYDA 3GLIE 2BOVA 5K8UA 5TVKA 2NO6A 1XTJA 2ZJBA 5P21A 1XMSA 2QMEA 3DMNA 4US0R 4XVUA 4IOJA 2DBYA 1IN7A 2O8FA 4BLQA 1BS1A 4V0OA 1KMQA 3UK6A 3AUYA 1RVDA 1OXXK 1SKYE 2OBNA 2VH5R 4QM7A 1FTSA 5J5CA 4NCHA 2BMEA 3AVVA 3CKLA 3QY0A 4DB2A 4TQUS 3X1YA 3UG7A 1SXJE 3BXZA 5FL3A 4QJ5A 1SGWA 5FTJA 3AP3A 721PA 1JBKA 1C1YA 4BLPA 4XH9B 1DARA 4QL3A 1E0SA 1TEXA 2EVWX 5KPJA 4D0NA 1GRQA 2HT1A 4LGMA 1CKEA 3NBYC 1E2LA 2AKAB 1PZNA 2CLDX 1O87A 4R2IA 1OH5A 4TSFA 3THXB 2O8CA 1GFIA 5C4MA 3FDIA 2FMXA 3P4XA 4ARZB 4EPRA 4M1YA 3NBXX 5FOTA 2O8EB 4U02A 1ZIPA 2J3EA 2ODEA 1CR1A 2VF8A 4FCVA 4RFVA 1X86B 3NHAA 4DIEA 1DAMA 1KAOA 4BFYA 1D2MA 1OKKA 3AF0A 3THYA 1S4QA 4NCJA 1YR9A 4TMVA 2OFOA 1ZM9A 3AF2A 3SJAA 3CF0A 4TYYA 1D9ZA 1UBEA 2HJGA 1Y63A 3LNCA 4WXRA 3R8CA 3B1VA 2DCUA 4LZZA 1YR6A 3WYFA 1DAIA 1EFHA 5G40A 4BE7B 4D0LB 3CWQA 3KDSE 1W44A 3TSZA 2CCJA 2J46A 1G3UA 2ANBA 4LHXA 2EYQA 4ZCMA 3OF5A 4G0NA 3JZMA 3VFDA 3R9WA 4X8HA 1NVVR 1UBFA 1WP9A 1TMKA 1E2EA 5DIFA 2RAPA 1W0JA 1NRJB 4HB0A 1DO2A 2QENA 3WBJA 4QJ3A 3EZ2A 3U4QA 4DEXA 1SULA 4NE2A 5EXPA 1W5SA 1F2UA 2H7VA 4IVQA 4N3NA 5L3SA 3K1JA 2PMKA 4DBLC 2AR7A 4D2IA 1I4TD 2HLDD 3AVUA 3O8RA 3HR7A 4NYIR 4HEJA 3TE6A 2CL6X 2QPOA 3KJHA 2PX0A 2BJWA 1SHKA 4F93B 3K9GA 2ZE8A 2QA5A 1A82A 4LYHA 1NBME 2E9SA 2IA5A 2WKQA 3X2SA 3P4YA 1KKLA 3FFBA 1A2KC 2GETA 2N42A 3TVTA 3QG5A 4XSGA 2GXSA 4TL6A 3C16C 2AKYA 3LX8A 5DHAA 3I5XA 4TQ9A 4B34A 4CIDA 3EPLA 1G8PA 1RPZA 3W6PA 2QTFA 4RD2A 4D0GA 2C9YA 1TEVA 2Z43A 4AG5A 1MO6A 4EFNA 1JEDA 1EXMA 1IONA 5AWFC 1YRBA 3B85A 3IILA 5D3QA 2C95A 5EP2A 1KYIA 4RJLA 5F9FA 1MO4A 1XD2A 2NZJA 4F91B 5DI9A 4G5OA 4IVPA 1KK1A 4L9WA 3SU8A 4DLUA 1NVUQ 4POAA 3CRRA 2ONKA 1VCIA 4LRWA 4OJKA 2CLSA 1HV8A 4CZ2A 1NG1A 3NTUA 4B76A 5FUYA 1OB5A 4CEJA 3A1WA 1XJ0A 1KI6A 4F4IA 4FMDF 5LB2A 3WYAA 2R9VA 2ZAMA 2IXFA 1KSJA 3BS4A 4EPWA 1KO7A 1R0ZA 2JDIA 4UKDA 5H1YA 3U2QA 2IEZA 1XPUA 3VX4A 3GCGA 2YINC 1KKMA 1MRNA 2XZLA 2ZU6A 1G8FA 1UKZA 1Z29A 2D4HA 2GVDC 4DLVA 4QNRA 1T3SA 4MUAA 1G6HA 4M0LA 1NKTA 3IBGA 3B5JA 4LHZA 4XTRA 2JLZA 1X1RA 1U98A 2V55B 3TW8B 1UBCA 5BQ5A 2QP4A 1EFRD 3RYTC 5LB4A 3VNUA 1HT1E 2R65A 4C0SA 3L0PA 2W58A 3Q5DA 3BBPA 4PC1A 1JR3A 4LPSA 3J81k 5JWHA 1W4AA 3SN6A 4HB2A 5BN3A 1US8B 3L0SA 1OPXA 1BMFA 3ICQB 3K0FA 1XEWY 3W8NA 1ODFA 1FX0B 2A78A 1LV7A 2QGNA 4QHYA 4URZR 1FP7A 1CJVC 4NYMQ 1QHSA 1YZTA 1SVOA 2A7QA 3OIWA 3IEUA 4LYFA 5EE1A 1CJKC 4YMVA 4B35A 3I72A 2W6JA 4OI0A 4WAUA 3AH8A 2IF2A 4Q7JB 5FBWB 4LYAA 4ESHA 3ADBA 5HE9A 3EZ6A 4M8NE 2IK8A 1GM5A 1R0YA 1HYQA 1I2DA 4M1WA 3PV0A 3EWSA 1OIVA 1SVWA 2ZYTX 2XTNA 3CRMA 3OAAD 3R8FA 3SQXA 4NMMA 2KBFA 2B21A 1P9NA 3QBTA 4B75A 4QC2A 1Q57A 1EESA 1LNZA 4NBSA 3ZVMA 1RRCA 1Z0FA 2A5DA 3WRXC 4LC1A 2OM2A 2WBLC 1WQ1R 3AF3A 3ASZA 4Q02A 3EIQA 4X8OA 1IY2A 3CX6A 3A1VA 1G7CA 5JCPA 1TL7C 1QZXA 4XD7D 1ELOA 4IDOA 1ZC3A 1DG3A 1N25A 2XJ4A 2W2TA 4D6PA 5DN6A 2XXAB 5JJLA 2V1XA 2O8DB 4JSTA 4ZDWA 4IXNA 2IWRA 3RS2A 1VG9B 2FPMA 4ZI2A 1KO4A 1CF4A 1R7RA 1T8UA 3BRWD 1GIAA 1TU3A 3IQXA 4A1FA 4QG7A 2ZYVX 1DS6A 2ASEA 1KI8A 2RMKA 2BCGY 1ZAKA 2Q3HA 2ZRMA 3WNCA 5KDOA 3CRW1 2NO7A 1OB2A 1UBGA 5FI1B 1E99A 4C0HA 2DR3A 1T4GA 2WWWA 2XGJA 2H17A 1R6BX 4L16A 1Z83A 2QN6A 5DE3A 1NNEA 1PLKA 4KFSA 3EG5A 3OFND 2ZRNA 3BC1A 1A5TA 2XJ9A 1DTSA 2GVZC 2AK3A 2H57A 4BWYA 2WJIA 2YOFA 2EFCB 4TMZA 5FR1A 1XEXB 2ZRCA 1XCGB 5FTKA 3I8SA 2D74A 1NY5A 4AYXA 4Q4HA 1E9EA 2FDCA 1XTQA 1CIPA 2AWNA 4XIGS 4A0RA 2YKGA 1GAJA 4Q47A 3TR5A 4P0TA 3M4YA 3RRZA 1ESMA 3WHKA 4P4SA 2F55A 3FMFA 4DJTA 2QAJA 1TX4B 3X1ZA 4KXFB 2REXB 3L8ZA 4TTPA 4FI3C 3TK1A 3HDTA 2O52A 1ZP6A 2W6ID 4HAYA 1CBUA 3AGQA 1U0LA 4JLBA 2X8AA 1TUIA 4A36A 3CPEA 1E4YA 2G3YA 1ZU4A 3MGCA 1F60A 4TLEA 3OEED 4EQ6A 3DKVA 3SJCA 4GT1A 4DLTA 3BB4A 5BN5A 4YLGA 4CGZA 1M8PA 5G3YA 1AGRA 3GJ0A 4PSKA 2QT1A 1E79D 4ESVA 3B60A 2H92A 2EQBA 2MMGA 4L4UA 2DFTA 4E22A 1OF1A 1T5IA 2JLSA 3E1SA 4TWZA 5FUXA 3ZIAA 3I5YA 1UDXA 1NVVQ 5J47A 1E2IA 1GNQA 2UZIR 1VIAA 1RJ9A 2P3SA 4N0EA 1NP6A 4MRVA 4QGGA 4WBSA 2CHVA 2WWYA 2WHXA 2WPDD 3K0EA 2C98A 4LX0A 4IJMA 1ETUA 1P9RA 5FI0B 3EC1A 1R10A 3VU9A 4HLUA 2Q3FA 1AKYA 4N1AA 4CF7A 4NYIQ 1KI2A 2G83A 1YVDA 4Q00A 2HF9A 3FYHA 2WSSA 4Q7LA 4BLRA 5BWMA 2VHTA 4Q4LA 1GP2A 4B33A 4JL6A 3OIYA 6Q21A 4Q4AB 4DEYA 1FUKA 4PHFA 4RD0A 3WHLA 3BFKA 2IUUA 5JBQA 2JLVA 5HR5A 3UANA 3HU1A 4JVSB 2PT7A 3CNNA 1RRPA 4NCIA 3MWJA 4CEIB 1KSGA 3T35A 2Q9CA 3QG1A 5KNCA 3CRQA 3GMTA 4MRPA 5K8TA 4DLWA 3MG9A 1XNJA 1ZVQA 4GRAA 2ERYA 3U44B 2IHYA 4O25A 3PUWA 4LBVA 4YXWD 5FTMA 4ZV4A 2FSHA 1NSFA 2F43B 3B1XA 2VHUA 2J59A 3RABA 3THXA 2BMFA 2YC4C 1UKVY 3TSOA 1TTTA 1COWD 2RCNA 1X8KA 5AK0A 1Q21A 2JJ8A 4ILEA 4ARZA 1QG2A 4HLUC 5CM9C 4XSHA 4TMKA 2O8EA 1GVNB 4DCTA 1OKKD 2I3BA 3VTKA 2QZ4A 3VHXA 4URXR 3KX2A 2ZS9A 1F48A 2C96A 3TH5A 5JECA 3LDAA 2XITA 4LSGA 2KWIA 4Z1MA 1WA5A 2WIAA 2CDNA 5AJZA 5FOUA 1DPFA 3RNLA 5EXTA 1JQLB 4G5GA 1U99A 4KFRA 4BECA 3NKVA 4Q03A 3EASA 3PG5A 4RCZA 3QPUA 2GNOA 1Z28A 1FTNA 1NLYA 2R6GA 1MO3A 1Q3HA 2JJ1D 4GL2A 4B3BA 3CF6R 3R20A 4DCUA 1P61B 3F8TA 3PIRA 1Q44A 2GDJA 3Q3JB 1J70A 4LJ5A 3FMPB 3VR3A 3NC0C 1W49A 1ZJ6A 4C0JA 1EFRA 1V5WA 3NH9A 2IX3A 5CK4A 4YMWA 4QBHA 2VO1A 4HB4A 1EX7A 2BDTA 3BIFA 2GWHA 1Z47A 4FWIB 4JLDA 1CULC 4PHHA 2P6UA 1CJTC 2NMVA 1VG0B 2AN9A 4DHEA 2MSEB 1PUIA 4LK2A 2EU8A 4XVQA 3PEUA 3SYKA 1XRJA 1W5TA 2QE7D 3K0CA 4KFUA 4L15A 4OK6A 5JRJA 3IIMA 2XSZD 4ZCLA 4HUTA 4ZDIA 2IYLD 3IQWA 4US1R 2OFWA 1PLLA 1ZIOA 2OEPA 1IN5A 1JB1A 2VIIA 1G5TA 4L9SA 4PX9A 4B3GA 5TXGA 3OAAA 1FP6A 2HJVA 4JLAA 2YJTD 2IYYA 1OXUA 3IIJA 4ASUD 4XWKA 2WICA 4JBYA 2NGRA 3ADCA 1CP2A 4QBGB 4Q1BA 1FL9A 2IYZA 1HY3A 1D6JA 4KU4A 2A5FA 3NBFA 1I2MA 4LI0A 2BBSA 4DSUA 4MRRA 3B9QA 3QE0A 4OHWA 2OCPA 1OW3B 2REBA 1RYHA 4H1VA 4KSBA 1ZUHA 2GZHA 2A2ZA 4JBWA 4XD7A 1R5OA 3QPWA 3FE2A 4IFEA 1NN5A 4A82A 1D5CA 2ANCA 2OZEA 3D8BA 1E9SA 4V0MA 5EE0A 2IWHA 4AY2A 4PR0A 2UVQA 2JDID 2BEJA 2ZSEA 1T3LA 4FWTA 1CU1A 4OHVA 2MMCA 4NYJQ 2J7PD 4HDOB 1E69A 1JPNA 2DPXA 1GZSA 1G7RA 4M9XA 5BYJA 2IXGA 2ZROA 1B0UA 2ZUBA 2MSCB 5AUNB 1WXQA 3LVQE 4Q7KA 3F5FA 1U9IA 2VRWA 3K0CC 3EAQA 3QENA 3HP1A 4FXPA 2VP0A 3U7FB 2F7SA 2OBLA 1G8HA 1Q22A 1ZD8A 1G18A 3X1DA 3OFNA 3NWJA 3QEOA 1U8AA 3CPJB 1G4AE 3UWOA 1NI3A 4RFSB 2V7QD 2X19A 3HPRA 4LWZA 2IYQA 2J9RA 5M04A 2JA1A 4A15A 2J45A 3D6TB 5DSZA 4WXPA 2C2HA 3Q5EA 3GLFB 1RW4A 2WJYA 2ZSBA 4JLJA 1US8A 2FWRA 5E4FA 4E09A 3LBIA 3CPHA 5EUMA 1GKYA 4IW3B 2IYVA 1FX0A 2V4ZA 2PCLA 1IJFA 4NYMR 4UQOA 1KO8A 5EXSA 1KDOA 2FFHA 3QKRB 4HB3A 2ZIAA 5ELXA 4QGAA 4RCYA 1IN4A 3NVAA 4FW9A 1YJ5A 2FZLA 3WP0A 2W6IA 421PA 3TAHA 1QVRA 2XX3A 1KI1A 2IYWA 4BRWA 1BH2A 1D2EA 4P3YA 1G291 2JLQA 2ZE7A 1GDDA 2WIBA 1JJ7A 3RS7A 5GVRA 1OFTA 4M1KA 1S3SA 3OEEA 1DO0A 3A8TA 5HCNA 1L8QA 2GK7A 1DAGA 4RD4A 3U3OA 3AVXA 1II8B 1JECA 1N2CE 2J87A 2EWWA 1ESNA 1U9IC 3LXRA 4JVLA 1Z8FA 2GEUA 1U81A 3SI7A 5CM8B 4Y0VA 5JZVA 3RSOA 2REOA 3V4FA 4KO8A 2R44A 1XD8A 3PUZA 2VQSA 4TL9A 3ZZ0A 2Q9AA 3EIEA 3RS3A 1C4OA 3KKNA 2ZI3A 1KI3A 2VHCA 3C5HA 4NPHA 3UATA 1VPLA 1N0VC 3RS0A 5DN6D 3KUDA 3RRYA 2OSBA 1QDEA 1KSHA 2WPDA 4D4MA 1Q1BA 2XXAA 1GNPA 2ZRPA 3BFVA 1GNRA 3N70A 2ZITA 4LJ6A 2WWGA 3G82C 2PLRA 4H9GA 3ADDA 4PC6A 2IW3A 3HYTA 5C4GB 1FQKA 2W00A 1WDTA 4GI7A 4PPGA 3U6BA 4Q1AA 1V43A 3ND8A 2GZAA 2FSIA 5G41A 2GRJA 1W0KA 1R4AA 2ZRBA 5KTYA 1E2GA 1U8YA 1HURA 1N6KA 2VBCA 1F5NA 1G3RA 5CLLA 3QXSA 1L2TA 3U3JA 2QRNA 3TVDA 4A2PA 4KBFA 3SJZA 4U00A 1WB9A 1OXSC 3WP1B 2SHKA 2VL7A 3H2YA 5AUPB 1XEXA 2FOLA 3DDCA 1XZQA 1E32A 4QBIA 1G64A 821PA 4AD8A 1UFQA 2FFQA 1SVSA 1R0XA 1ONBA 3CIOA 3WMFA 1E2DA 4MYTA 2GJSA 2ORWA 4YXWA 3UWKA 3LVRE 1F3OA 1FFHA 3O47A 1MR3F 3LX5A 3ZVNA 3EARA 4FCWA 1KIMA 2ZR0A 3VKHA 4WW0A 2NPFA 1COWA 3SBEA 1W4BA 3AKCA 5CJ2A 2FGJA 3HJNA 4GOJA 4TMWA 3FHOA 4TYQA 1T91A 1HE8B 3DHWC 2BWJA 2F3RA 4BZPA 3JZAA 4S2EA 4GP7A 5SZIA 4CT5A 2CE2X 3FVQA 2WJGA 1XJCA 3LAWA 5DLQC 2OILA 4GOXA 1FOEB 3L43A 5KDLA 4A6PA 5HKKD 2G88A 2V6IA 4G3XA 4TQAA 1KY3A 2ATXA 3HU3A 2W0MA 4J0QA 3VR1A 3SR0A 1N6HA 3TRFA 4B3CA 4UJ3A 4AG6A 5GVSA 4GPTA 3MUFA 4C0QC 2ORIA 3I1FA 3ZIAD 2P6RA 1DBSA 2ZRLA 1OLOA 3BAFA 5JFGA 4DT1B 3LWNA 5JSZB 2PZFA 2CL0X 5B57C 3GLIB 2CXXA 2BBWA 4HAWA 3MAAC 2JJ1A 5IDVA 2XEXA 4UXJA 2W83A 2JLXA 3FFAA 4C0AC 2WJVA 2K5UA 1MABB 1SVKA 1IN8A 4IOKA 4OKSA 3VR5A 5AJWA 3CX7A 2GA8A 4PQYA 1A7JA 4HI0E 4IKEA 4FMCF 4GNKA 3U3RA 1BYIA 3GD7A 1E98A 4EKDA 3AF4A 1U0HC 1XPOA 3LBNA 1N6NA 4DUGA 4KLNA 4NZYA 4OHZA 1N0UA 5L3QB 3QF7A 2RGAA 2ZR7A 2WSSD 4TTRA 2B6HA 5H70A 3GP8A 3KQLA 3K70B 1ZNXA 3MFYA 3U3MA 4M1OA 1MRSA 1G9XA 1SXJB 1XCMA 3QVVA 4KSCA 3W9YA 5BYKA 2F3TA 2JJ2D 3H4MA 4KBGA 1Q3TA 3GJXC 3T1OA 4F4JA 4A9AA 5JMTA 2PX3A 4DVGA 5EQTA 4Q4AA 1W4RA 1DADA 2YZ2A 4M9QA 4K8OA 1U8ZA 2BHRA 2OCYC 2QE7A 3H84A 3MJHA 1P2UA 4R2HA 2XSZA 5CK5A 1VG1A 3L0OA 4CEIA 2BM0A 3KXLA 4V02A 1ZNWA 2HXYA 4HZIA 2DYKA 2ZVQX 1HA3A 4YC7A 4HUQB 3U44A 3QKSB 3ASYA 1Z06A 4ASUA 2UZ3A 3GEHA 4IEEA 4EIWA 1N3BA 4C30A 1ZNYA 1K5GA 4BLOA 2ZRAA 5KYKA 3ZS9A 2F43A 4B2IA 1WCV1 2ZI4A 4P31A 4TLDA 1TF2A 4O2LA 3FTQA 1E0KA 4AKEA 4RKEA 1KJYA 4PZZA 2WM9B 2V6JA 1G3IA 1PLJA 4GFDA 2R2AA 1FW6A 5DGXA 4PHTA 4MKFA 3LLMA 2EFDB 3H86A 4PQFA 2BMDA 4I1OA 4BZXA 4Z1MD 4OQNA 2IUSA 2AX4A 4EJSC 2QP3A 3LY5A 4NDZA 1A1VA 2KB0A 1FUUA 2ZRIA 3VR6A 1OFUX 1X6VA 4B48A 2J7PA 3QQ5A 2BJVA 3LLUA 5F2EA 1OSNA 4Q48A 4JVMA 2OXRA 4B44A 1K8RA 1EFTA 1KZ7B 2NQ2C 4DRZA 5FR2A 4HZUB 3B1YA 2RGGA 3GJ7A 1GILA 3LQQA 2RGDA 3BWDD 4Z8XA 1DAEA 1J99A 3N2EA 1WRBA 3EZ7A 2KBEA 4F92B 2IS2A 4FIDA 2XNSA 3TIFA 5CB8A 4B74A 2IYRA 4URYR 5LDDC 1OIXA 4LJAA 2G9NA 4A2QA 4DCVA 3B1WA 3W5IA 4ERNA 5IK2D 3GLGB 4AKHA 3OIVA 3FMIA 3QUSA 5EP4A 1P73A 2GXUA 3AB3A 2JLUA 2ONJA 1D2NA 1Z0KA 1NSTA 1J8YF 5KNBA 2VHJA 1FMJA 3QJYA 1E2JA 2V7QA 1LS6A 5EZ6B 4EPXA 3ETLA 2Z4RA 4TTQA 1CJUC 1YKSA 3GLHB 1OHHA 3K70D 4YDHB 3LW8A 2A5JA 2GTPA 3U7GA 5KHOC 5FBVB 1QHHA 3V00A 2E1RA 4Q9JA 2HF8A 1NMYA 3ZZTA 2DFNA 3GJ8A 521PA 3P1JA 3S1AB 2FFBA 4HLCA 3GFOA 1IN6A 1DAFA 1XEWX 3CO5A 2KSQA 4PPNA 3D3QA 1E9DA 2P67A 3W8RA 2HUPA 3SFVA 2QEQA 1AQUA 4KJZA 2IF0A 3FKQA 4RD3A 3CH4B 4GMXA 2X2FA 3SNHA 2V9PA 3W6OA 2BCJQ 1FNMA 4OL0A 1GG2A 1HEIA 4WVFA 2WAXA 2OLJA 2GF0A 2OAP1 2OLKA 3IHWA 5EUQB 4KITB 3NH6A 4A8JB 4DKXA 3QF4B 4OI2A 5KSZA 2D3WA 1U94A 2O0JA 4MUBA 3WMEA 2WVJA 1XWIA 3QKUA 1OV4A 1ZM7A 5B2ZA 2WWFA 3AKYA 2GJ9A 2W2XA 3RWOA 1EK0A 3H0KA 2R6FA 2IXEA 3T5GA 2G1JA 3X1XA 2ORVA 1XFAA 4ON9A 4RD1A 3EPKA 2OBMA 3AV0B 4O3MA 1XMVA 2QL6A 4NYJR 4LDJA 4PSVA 3UMSA 4NKRA 1T5LA 3A6PC 5DNYB 3O8CA 2B7BA 3OIUA 3RRMA 3MWKA 4DDWA 5D3MA 3VAAA 4DB4A 5IHPA 3WNDA 3AGPA 3KJEA 4DSOA 2D06A 1BKDR 3HWSA 1UEJA 5GJVC 1Z6XA 5AJXA 2J41A 4DLSA 4M2LA 4IDPA 2J0SA 3W3ZB 5CYOA 4Y0AA 3P27A 1KDTA 1AA9A 1G41A 3VR4A 1UADA 5E95A 4RFSA 1L4YA 1N6IA 4ZPXA 4ZO4A 3QBVA 3U7EB 3UG6A 4LJYA 2QMHA 5DYGA 1E9FA 1UF9A 1I4LD 2P5SA 4A92A 3A4MA 4TMXA 5FBQB 2F9LA 1DAKA 1LTQA 3GLFA 4KFTA 4X8LA 3Q8XB 4W9MC 3FWYA 4BUJA 3AVOA 5C46F 2GEVA 2RGNA 2WKRA 4Q4JB 3LO5A 2NO0A 4FD2A 1M7HA 1XCPA 2BBTA 2YNMA 2I4IA 3QKRA 2QAGB 1E1QD 1E4VA 5H8WA 4BFSA 2E87A 2CMKA 4HAVA 4LY6A 1P4SA 3NIBA 4OQXA 1NVWQ 3KZ1E 1D8TA 2GF9A 4G5QA 2QPTA 2RHDA 1M74A 2AHOA 2FA9A 1G5PA 2ZI7A 3VKWA 2ZQ5A 2BBOA 2ZE6A 1SQ5A 1L7VC 5G53C 5HKKA 1MV5A 4A0HA 1TQ2A 4O2RA 3W34A 2O8BB 2VLIA 1KDRA 3OHMA 1KOFA 3BH0A 3WRYC 5JWRA 1Z07A 2GCNA 1II8A 3VKGA 3QVUA 1OT3A 1P2TA 3ADKA 3CBQA 1GKIA 1IOZA 2OCAA 1NJFA 3LBHA 3TQCA 2HXSA 1SVMA 3FB4A 4LV8B 1BOFA 4XVRA 1GL7A 3QXXA 4ZI3A 1T6NA 4QKQA 1UEIA 4MGIR 3TLXA 1JQJC 4EJSA 1LY1A 1ZU5A 3KQNA 1WBBA 3IHLA 5FPTA 1P60A 4YQFA 3NDBB 1MOZA 2GXAA 2DFLA 3LA6A 4JLMA 3SFZA 1EWQA 5JHGB 2PCJA 4LOAA 3EPHA 4R9UC 2AXNA 3SQWA 1EFCA 2NTYC 1JXMA 1S3GA 4LJ4A 5TDHA 3CB4A 4B43A 2GCOB 4EAQA 1YQTA 2DWPA 5FOWA 2FV8A 1DEKA 2AD1A 4IFBA 3ZQJA 1E9CA 1YE8A 2RGNC 2ERXA 4EJSB 2VP9A 3NBZC 2ZANA 4KAXA 2BC9A 3WY9A 1NIJA 1G20E 1W0KD 4E07A 3KFVA 1E9BA 1ZBDA 1R0WA 2YC2C 3JVVA 5KO2A 2JJ2A 2G6BA 1E3MA 4PPFA 3RS5A 3WXMA 2WZQA 1E2QA 5CJPA 2ZSAA 3A36A 3E70C 2D2FA 3F0TA 4PZYA 2KI5A 5FOXA 5C2JB 1UAAA 1RIFA 3PEVA 4UNSA 3ZLJA 5DO9A 3Q85A 2Q21A 1T8TA 2FEMA 2WTUA 3AM1A 4L5BA 1HT2E 4C0LA 3NEYA 4TLAA 3VX3A 4MITA 1XJQA 3TW4A 1IY0A 4P32A 2Z0MA 1JR3E 3WYGA 3EWAA 4ZCIA 4D82A 1CS4C 3AP1A 1VKJA 1O3YA 3FMOB 3T06B 1TU4A 3RHFA 4GDFA 4QGHA 3FKSD 5CITA 3PUVA 2NO1A 2AL7A 2ZPTX 3PUXA 5FOSA 1R2QA 2AK2A 4W5HA 1IM2A 4PFSA 2QU8A 2WMNB 2ZSFA 5J4HA 4AKGA 4AIIA 2F6RA 2IYSA 3PVSA 1XXHB 3BGWA 4GP6A 3ZVLA 2FPLA 1OXTA 4YDSA 3WNBA 2ZSDA 4KI0A 1SHZA 2RGBA 4M21A 2FNAA 3MRSA 4II7A 1Q1EA 3TBKA 2ZJAA 5FFMA 2CVFA 4C7OB 2VSOA 2VSFA 2V1UA 5L3RA 2GHIA 4WIAA 1XBTA 2ZRDA 3U7HB 5SZKB 3F3YA 2QI9C 5KOYA 2QMUA 3MJRA 4DT1A 2Q3MA 5JSZA 2GBLA 3K9NA 4KODA 4MKIA 3T34A 3GLIA 3SE0A 4BFUA 2O0KA 4IRUB 1TUEA 1G1MA 2IT1A 2J5XA 2P0EA 1AZSC 3KKPA 2BIFA 2JCSA 4PXAA 1MABA 2O0HA 1BYUA 1ZC4A 4JSYA 4AC9A 2B7CA 5IK2A 2V54A 1GRRA 4K46A 4L8GA 3TAUA 4DUGD 5B30A 1Z6GA 2ZREA 2ZR9A 2PL3A 2XNDA 4G1UC 1QHGA 3SS8A 5L3QA 5FOVA 4DLZA 2FSFA 4D26A 4A6XA 4PPQA 1QHHB 5F98A 1KK2A 1VYTA 3SYNA 1SXJA 2P65A 2ZU0C 2J7KA 3LD9A 1M6NA 3O8DA 1EWRA 2NG1A 4HATA 2J0QA 4BZQA 1JNYA 4PTLA 3GQBA 4TT3A 1N5IA 2X2EA 4YMTA 1JI0A 2VSXA 3EC2A 5FUWA 2ZTSA 3DPUA 1X1SA 3RRNA 1Q1ZA 1U2RA 2NOAA 4AKIA 3GEIA 2QSYA 4M22A 1U0JA 2JIZA 5AR1A 3BK7A 1IAQA 4D25A 3AQ4A 4DCSA 4Q1EA 2GBLC 2GAAA 3MLEA 4HUQA 3QKSA 4MRNA 4NP6A 3TJZA 4HSEA 3GLFE 5JJIA 4Q66C 3THWB 1YZLA 1JEEA 2OFXA 1OE0A 3RSLA 2RKOA 2OE2A 1Z08A 1P7CA 2FSGA 2C03A 3KKMA 3TGPA 5JJKA 3GEEA 2GCPA 4PZLA 3PEWA 2B8WA 1OJLA 1OIWA 1HTWA 2HDNB 4V0LA 4EPVA 2QBYB 1A4RA 2BVNA 1CLUA 1LS1A 2NO9A 5DI3B 1KI7A 3CW2A 2D2EA 4MRSA 1MH1A 3CZPA 1E6CA 1P2VA 5EE3A 3QEJA 2D7DA 1VECA 3B9PA 3KFXA 4HLDA 3K70C 1S0UA 1SXJC 5CLQA 4LHWA 2ZS8A 5FPHA 5GJCA 3KL4A 1Z6YA 5D3MB 2QQ0A 1ZW6A 1QF9A 1KO5A 2IL1A 2J1LA 1MT0A 3IGFA 4LUCA 1XPRA 1XDBA 1T0HB 1C9KA 4HZUA 3ZYCA 2C5LA 2PT5A 1HUQA 4NH0A 3VHLB 1IXRC 4JMPA 1JAHA 1NN1A 3AF1A 4MYUA 1N5JA 4LHVA 2H1LA 1UPTA 2IYXA 1XMJA 3V9PA 1DELA 3QXJA 3ZQ6A 2FJUA 5EXXA 5GADl 4BGDA 1TNDA 3GLGA 4Q9IA 1SKQA 4D4KA 2NIPA 2ZJYA 4LHYA 4Q1DA 2ODNA 5HPYB 3CX8A 3T1QA 4DWJA 4AWXA 2C99A 2OV2A 4M1TA 4OQLA 1OHHD 3AP2A 4CDGA 2ODWA 1Z2AA 4NL4H 3R7WB 1KK0A 1AK2A 5JRZA 1G19A 4JKYA 3OEHD 3GLHA 3W5JA 4JS0A 4BFTA 1CXZA 4TLCA 4BEBA 2OUKA 3DEFA 4HYYA 1VMAA 1OH7A 2GKSA 3K09A 4PSAA 1AS3A 2IEYA 3S1AA 2QP9X 4DLYA 1MKYA 4JLPA 1E1QA 1FQJA 2G77B 4EUNA 1RFLA 1PVOA 4XWOA 3MD0A 4MDFA 1Z0IA 2VHQA 1QG4A 1RZ3A 4C2UA 1N6RA 1W36B 1KDPA 3TUJC 2XB2A 2HCBA 2A3RA 2H16A 1GKUB 1KTVA 2OAQ1 3LQRA 2IS6A 4RZUA 2Z6VA 3ZJYA 2G0TA 3AKEA 1Z3IX 4NCKA 4B2PA 1W47A 4A4DA 1TPZA 4W5WA 1LB1B 4OI4A 2XZOA 4A8JA 3QF4A 4M1SA 4OK5A 4Q5IA 1KI9A 4UXHA 1HH4A 4C4PA 3MWLA 1VCOA 4FMBB 1SVLA 1AN0A 1TQ6A 2C04A 1GL9B 5CYPA 2CBZA 3B1ZA 3AKDA 1PUJA 5A0FA 2R6AA 3KJIA 4KVGA 2H8KA 4Z8YA 3L82B 1DE0A 4OQFA 5E7IA 1G8GA 5HCIA 3VNVA 2XZPA 5G3ZA 1P9WA 4ACBA 5JEEA 4LV5B 1FNNA 3C41J 2YVUA 4JLNA 4JYBA 3K0AB 5CDFA 4YONB 5E3HA 2PZEA 2ZI9A 3K09C 5KSOA 1G8YA 1OYYA 4QNMA 4BLTA 5L8VA 4FN5A 1Z0AA 2KJQA 3C4JA 4KVAA 3MSXA 4AK9A 2ZJ2A 1FMLA 5AJVB 3GJ3A 1RYFA 4IDQA 3E2IA 2VEDA 3LXXA 4YMUA 2J0UB 3IKJA 1KZGB 2QTVB 4DIDA 2A30A 3Q72A 1CRPA 3RC8A 2XOKD 5J4YA 3QKTA 3FHTA 3ND9A 1JALA 4RY2A 4QFMA 3K9LA 1X3SA 2WV9A 4EDHA 2QTHA 2ZRGA 3BH7A 1XTIA 2CJWB 3CUEF 1R8QA 1P5ZB 2CHQA 2WAYA 3C8UA 3IDQA 4FCTA 5FBRB 5UKDA 1Z6AA 4A8JC 1ZUNB 3NEJA 2CL7X 2GJKA 1Z22A 4JJZA 4G5RA 1ZUIA 1GWNA 1N6LA 4IXMA 3FKSA 4IOMA 4IDHA 4WZBE 1S8FA 5FPKA 5FPSA 4LYJA 3RDPA 5F3WB 1GITA 4HAUA 4Q4JA 2YWFA 1W7AA 1NKSA 2QAGA 2PJRA 4LPKA 5JHHB 1JR6A 2F1RA 2J0VA 3KXIA 3U60B 2ZRKA 1KK3A 2IS4A 1ZD9A 3GPLA 3M1IA 3EPJA 5DISB 4LCBA 3B6EA 1W36D 1CR2A 2JLWA 3T1TA 1ANKA 4Q9KA 5DHFA 4ZIRB 2LKDA 1OFIA 1NL3A 5TMPA 4GBMA 4KV9A 3SEAA 3TMKA 2O8BA 3KTAB 3BD9A 4HAXA 5JI3E 4I81A 3KKOA 3KQUA 3A1SA 3E5HA 3Q7QA 1G4UR 4ZKEA 3ONWA 2QY9A 4JT4A 2YV5A 1AQYA 3TNFA 3AVYA 3IO5A 2GJ8A 2Z4SA 3HPQA 3K8YA 2QT0A 2QM7A 4ZDKA 1T0JB 3R9XA 3RAPR 4QXAA 2R6DA 4QM6A 1E96A 1YZKA 4LC0A 2CEAA 4OHYA 3DL0A 1ZNZA 4G5SA 1XTRA 2N1BA 4V0ME 1SKYB 3VQTA 1KMHB 1XF9A 2CE7A 3DM9B 3GFTA 2HEIA 4B73A 5B58C 4D4JA 4MYCA 3KJGA 2GCOA 2QORA 3UKDA 3DKPA 3AVWA 3BB1A 1N0WA 2ZYWX 3H1TA 2G0NA 4NCNA 2A5YB 3X1WA 3THOA 3SBDA 2QAGC 3KB1A 4WA7A 3TKLA 4WZ6A 1X8JA 1YRAA 4IDNA 4KHZA 4E5UA 3DOEA 3IO3A 2EYUA 4RZ2A 5TARA 1CEEA 4R7ZA 5C1BA 1NJGA 4G01B 1JAIA 2C9OA 2QG6A 5FL7D 1N6PA 2HCJB 4EFMA 3IPYA 2ECKA 3JVUA 1SVIA 3NXSA 4W5JA 2ZS7A 2ATVA 3HR8A 3QOFA 3GLGE 3CM0A 3ICEA 3DZDA 2ZM5A 3C14C 2FFAA 3SJBA 4PO9A 1N5LA 1KNQA 4DDVA 4JBXA 3B7GA 1IXSB 1KNXA 4QHTA 3EXAA 1XU4A 1NG9A 3BFXA 1S2MA 3PR1A 3CH5A 1G21E 1I4DD 3AUXA 3BORA 4F4CA 3GLHE 1RRGA 2JEOA 4JYCA 3PEYA 3IEVA 1UKEA 3QSYA 3GJ4A 5AUOB 3ECCA 1EGAA 1M34E 1P6XA 2CNWD 3L2OB 3LRPA 4ITRC 1CR4A 1YR7A 1CTQA 1NMXA 3TR0A 3LH5A 1XXHA 1Q20A 2OXCA 2CCGA 5BW8A 2QGZA 2QQEA 4E03A 4B32A 5IF9A 4IHQA 2EWVA 5FTLA 3OE7A 1NLFA 1IQPA 2FPKA 4C7OA 2WMOB 2OT3B 3L0IB 5KSYA 1XD9A 4DDTA 1J8MF 5A4JA 2X77A 2GAOA 2PEZA 3A58B 3B82A 2VYFA 4HAZA 3HU2A 2JAQA 3UIEA 4K81B 3CNOA 4UNRA 3LW7A 2JLRA 4TYNA 4B47A 1ZMXA 1F2TB 1XTSA 1LF5A 1ZD1A 2YOHA 4CVNA 4QBFA 2XNDD 3DO6A 2ODBA 4BLSA 3ZH9B 2RHMA 4MGYR 2ZYUX 1H8HA 5E7MA 4IOLA 4TYPA 4GZLA 1VHLA 1II9A 5CDFE 1SXJD 4MA4A 1KY2A 5K8LA 2A9KA 3O8BA 1OFHA 2LKCA 3OEHA 4URWR 4US2R 2QM8A 2CCKA 4P33A 3DOFA 5SZJA 4OQMA 1VYUA 2BV3A 4TT3D 1E0JA 1UJ2A 2IYTA 2RGXA 1UDWA 4PO1A 5IRCD 3UXMA 1PV4A 4QGFA 1LFDB 1E2PA 1W1WA 3QNUA 3QPVA 4V03A 4ABYA 1G7SA 4UXIA 5FPYA 1W4CA 4TLBA 3SC3A 3L8YA 2JIZD 3OESA 3RC3A 1XMIA 2YYZA 3I4LA 4URVR 5C18A 1QHXA 4I1SA 3CZQA 1TAGA 3I8XA 3LV8A 1F6BA 4CEHB 1CRQA 4LJ8A 1LW7A 4B3FX 4AYTA 3K0SA 3I92A 2XTZA 5DH9A 4ACAA 4DLXA 4MQBA 2R6CA 3AVQA 2IUTA 2ZRJA 4M4SA 2YWGA 5KNDA 3THWA 1WF3A 1Q1QA 3AVTA 1P3JA 1E2HA 3ZD6A 3EX7C 1G17A 1NY6A 2R62A 2VA8A 2GXQA 3GJ6A 1NIPA 1OYWA 2BKUA 2FG5A 5ANRB 2ZJOA 4C0KA 2QBYA 4MGKR 2ZJ5A 1E2NA 3LFUA 5DI3A 3QIAA 4RSGA 3RS4A 4KCGA 3SDZA 3REGA 3KKQA 3VR2A 5KUTA 2ZEJA 2ZJ8A 3GJ5A 3G5UA 3AEZA 3CF2A 4JLVA 4KLZA 2AFHE 1ZCAA 4PC3A 1W2HA 2YWHA 2YOGA 5HTKA 5HE8A 1QHIA 3M0EA 2WWHA 3P26A 4B2LA 3AVPA 1AKEA 3CWZA 1II0A 1M2OB 1QVAA 2DWOA 3CLVA 1E1RD 4RZXA 2AFIE 5EJEA 4DC9A 3MCAA 1JJVA 4DLRA 2YHSA 1QRAA 1S96A 4P4UA 1PJRA 1Z6TA 1XB2A 2EFHB 1WBDA 2UKDA 5JCZA 4QOSA 3A37A 4BQSA 2O8FB 3PENA 1YU9A 4I4LA 4BASA 4OJQA 1M7BA 3T5DA 1DG1G 2XOKA 1W48A 3UPUA 2IHBA 1NBMD 4ZKDA 5JI2E 4C3ZA 3DZ8A 4GZMA 2H5EA 3PQCA 5DYIA 1R5NA 1VG8A 5IT5A 4NONA 3A4LA 1P2SA 4OK3A 3IBYA 1Z0DA 1N6OA 4Q18A 3R7WA 2ZRHA 2CHGA 4BPBA 5KSPA 3T61A 3CONA 2V3CC 4DXAA 4D81A 4OHXA 3U6KA 5JWOA 1IXZA 5AJYA 1J7KA 3B2EA 621PA 3SZRA 1HE1C 2GESA 4LJ9A 3CRVA 3U61B 1IY1A 1VYVA 2ZXUA 3QI2A 3MMPA 1VCNA 1EG7A 5BXQC 2O8CB 1E0AA 1Q0UA 2WKPA 3G0HA 4C9BA 4F38A 3SYLA 2FGKA 3TUIC 1AS2A 2PMDA 2Q6TA 1ZM3A 2W2VA 3BB3A 1RE0A 2BMJA 1H8ED 3SHFA 1J2JA 1Z0JA 5KDDA 5KPDA 2A5GA 1XP8A 2NPIA 5E7JA 1VHTA 3C15C 3THYB 1KJZA 1T9HA 4V0NA 1ZYUA 1DAHA 3A4NA 4CYMA 4I1UA 1RC8A 3ZZUA 2AD5A 2DHRA 2VP6A 1S9DA 1SZPA 3NC1C 4NU0A 1B23P 5JLJA 1XXHE 1J90A 2QPAA 4IVRA 2CK3D 2JASA 2AWOA 2WJJA 2ZUDA 1UKYA 1JXOA 3P32A 5FH9A 1K5DA 4UNPA 5EE9A 3K0AA 4N0DA 1AGPA 1ZM4A 1KO1A 3U4QB 1M1YE 1NVXQ 5F9HA 1F2UB 4HLQB 4Q21A 5L3SB 1KSFX 1YR8A 3EZFA 3KQKA 3TQFA 3I73A 3ZGXA 2BKEA 2CVHA 2XTMA 1KHTA 1RRFA 1EX6A 1XEFA 2J0UA 4C0BA 4Q9HA 3TUZC 3SHWA 5LD2C 2DY1A 5A5GA 4AI6A 4F7WA 4I1VA 3UMFA 5LPNA 1OH6A 2HLDA 4V0KA 5FL7A 2VP2A 1W36C 2GZDA 2EFEB 2ZI5A 4LBWA 2FZ4A 4RD6A 2ZETA 1Z2CA 2OO7A 1NN3A 3QXCA 2HV8A 1EFUA 1ZM2A 4TN1A 3RLFA 1QHYA 2W0SA 2C8VA 2FN4A 3FPAA 2CJWA 4PANA 1VCMA 1AM4D 4CW7A 1Q12A 4LJ7A 5JS8A 2O5VA 3W3AA 4DCNA 2FU5C 4JZKA 2PH1A 3RVBA 4B71A 4BRUA 5K8IA 2JATA 1IBRA 1GTVA 3R9IA 4Q9LA 3B78A 121PA 3U3KA 5BN4A 4DSTA 4RKFA 3GFPA 3ZD7A 5EP3A 2CNWA 3CR8A 3U5ZB 4TZ0A 1MO5A 1HQYE 4MYHA 4KYIB 4TL8A 1KGDA 2Z5FA 4O0MA 4AURA 4DZZA 1G5RA 1TADA 2G1KA 2AXPA 3D7MA 3PCRB 1GSIA 4TSFD 1XD2B 2WSMA 4U7DA 2LWIA 3WMGA 4CT4B 4JJKA 1RKBA 2OESA 3B13B 4TMTA 1QHNA 3TSWA 1AS0A 1G7TA 8OHMA 1FPMA 4ZIRA 3KUCA 5SZHB 4UJ5A 2QUZA 3KTAA 4RVCA 4CEJB 1M7GA 2OHFA 1CJMA 1KI6B 4B3XA 3ZVRA 1WE2A 2ZRFA 3NDPA 1E9RA 1U90A 1LVGA 4W7SA 3KB2A 1ZINA 2F9MA 2OCBA 1Z63A 4JL5A 3VMFA 4HDCA 2XAUA 4KYUA 5HZKA 2PEYA 1XX6A 1K6MA 4JIMA 2FE4A 2Z83A 4IEIA 4WZAE 3UMRA 2BEKA 4EPTA 1E94E 4XWAA 1OXVA 3K53A 2DWQA 2JGNA 1KMHA 221PA 2CLCX 2H18A 2IBMA 4OYHA 4PC2A 4I99A 4TZ6A 5TY0A 1VIYA 1W0JD 1ZCBA 3BH6A 5J4LA 4JLOA 1JPJA 4GMDA 4Z51A 1R8SA 2F1HA 1T3HA 2X1VA 5EZ5A 1IJEA 2ZUCA 2R8RA 3M6AA 2GILA 3B8HA 1XZPA 3REFA 4Q7MB 2EFGA 3N2IA 4B6FA 2JLYA 3BERA 5KU1A 4JLKA 1TF5A 1OH8A 1TQ4A 3K0FB 1GL6A 2P6NA 4PO8A 1VTKA 1D9XA 3C7KA 4OBEA 4XJXA 2ZAOA 3P20A 4PHGA 4OI1A 3BJIC 1S9HA 3OZXA 2RGEA 1CR0A 2C77A 4RZ3A 4A2WA 4FMCB 5HZHA 2GK6A 1NN0A 3K9HA 2IS1A 2WJHA 1S1MA 3SOPA 3V4RA 5CB6A 4NHOA 2D7CA 2ZVPX 2FX3A 5H68A 1YZUA 5FUVA 4TYWA 2GJAA 2P2LA 2C9CA 2IC5A 3Q7PA 3ZS8A 2I1VB 5CIWA 2QMOA 3EZ9A 1TQDA 1L4UA 4B6EA 3PJRA 1E9AA 4LV6A 1BIFA 4M9SA 3IPXA 4DDUA 5B64A 3FHCB 4PQRA 4LBYA 4EFLA 2VP5A 5FBLB 3DMDA 3OE7D 1A2BA 3I62A 3EIHA 2QROA 1E2FA 3RANA 1G3QA 1BO6A 4QRHA 4MGZR 2ZJZA 5L3VA 1E2MA 2ZE5A 3D31A 4XOIA 4BFVA 4Z54A 3EA5A 1HQCA 2PLFA 3IUYA 3MWYW 4JT2A 3T1VA 1E1RA 2P5TB 2Q9BA 4BEJA 1ZRHA 2ZI6A 2RH5A 1E2KA 1LF0A 3EA0A 3QXHA 2RB4A 5J40A 3W90A 4UNNA 4XTCS 3FOZA 4Q19A 3W6NA 2L0XA 2F1JA 3IIKA 4M1MA 1F2TA 2VP4A 4P4TA 3WBKA 3NG1A 2MSDB 2VTKA 3CNLA 4D80A 2LCFA 4R98A 2WOOA 3PUYA 1GOTA 2HT6A 1IHUA 1YZQA 1NBMA 1NMZA 1QBKC 2VPPA 2VF7A 2XB4A 1H8HD 4BFZA 2PBRA 4M53A 4MDEA 1X8LA 4S35A 3I3SR 4GSYA 1GRNA 2BM1A 4FMDB 2NZ8A 4R71A 1G16A 3CR7A 3KQHA 5EE5B 2WOJA 5J4VA 5JS7A 4JKIA 1P62B 2HYIC 3I61A 1GUAA 5J4KA 1KI4A 3KXKA 4JL8A 4UNQA 4Q1CA 1JR3D 4HDQB 1N5KA 1W2GA 4MKHA 3BOSA 4Q4HB 2N46A 3I32A 1G6OA 2FH5B 3C5CA 1S1CA 3A1TA 4YMSA 2Q0HA 2YWEA 1BMFD 4PAOA 4D4LA 1KJWA 3PXGA 5JEDA 2QRZA 1VDZA 2TMKA 4EPYA 5LD2B 1P72A 2GEDA 1FZQA 2Y8EA 4P4SB 1NLZA 4Q1FA 3ZDQA 4A0FA 1YZGA 3EW9A 4Q01A 3T12A 5GJBA 2C78A 4JVNA 4BFXA 1Z5ZA 3BE4A 5EP1A 4M9ZA 2W6JD 4CEHA 2IYUA 1WMSA 1H8EA 1Y3AA 2EW1A 3N5CA 3PITA 2FEOA 2WWIA 1AIPA 3DVLA 2DFKB 1YZNA 5AUQA 2OG2A 3PFIA 4QJ4A 2WWXA 4PAMA 1TF7A 4EQ6B 5TB5A 1W46A 4AYWA 5FTNA 4ZDJA 2D62A 2DB3A 1NF3A 4PAQA
chains in the Genus database with same CATH superfamily
2FW9A 3PNKA 1KQPA 4Q3KA 4CRWB 2PJZA 4LBZA 4X94A 4CKBA 1SK9A 4KPFC 3B9RA 3DM5A 4MQEB 2GOYA 5CIQA 3LNTA 4QFCA 5A2QA 3PHBE 4LTDA 1G3MA 4MH0R 1XTKA 3MYYA 3T7SA 3VU8A 3A1UA 4A0GA 1PRYA 1RJ9B 1REQB 2O2HA 1S02A 4YV0A 2RGCA 1C30A 3L9WA 3H1FA 4B4DA 3KD2A 4EL5A 3A32A 4H7IA 2WVAA 1OPRA 1KWGA 2KE5A 4BJ6A 2B4AA 4IMJB 3ABQB 1ZUD1 3LF1A 4BFWA 4QHSA 1T4DA 1TM4E 2DUWA 4NTZA 3TW0A 1RJDA 1K08A 3V1YA 1AZTA 2PZGA 1TUBA 5GJWC 2VA9A 2HYDA 4DIBA 4L78A 5P21A 2GN1A 4C1NA 1K8XB 2DBYA 4YMIA 4AY3A 2QE6A 4B46A 4BLQA 4V0OA 1EE1A 1PZEA 1KE2A 7ABPA 4WLUA 2YQZA 2PTGA 3AUYA 5FCDA 2F00A 2NAFA 1V5IA 1LPMA 1SKYE 2CKDA 3OUTA 4C1BA 1MHTA 3TTSA 4QM7A 1LLUA 2WIFA 3OQHA 4NCHA 2ZZMA 1YR2A 2XRYA 1MC5A 4DB2A 3OOJA 7AT1A 1H4QA 5E3JA 4HRYA 2Q4TA 4RDXA 3UV3A 3KOMA 3HO8A 3FD8A 4R2MA 2O6HA 5F3RA 5DCWA 1K66A 1HE4A 3CKYA 1ONPA 1PD1A 4EZIA 4XH9B 1E0SA 1MJGA 1XCLA 4ND3A 2EC5A 1PJBA 4KW7A 1LPPA 4HMQA 4GWLA 2NSJA 1GPDG 1UPFA 4QT0A 1EVJA 1CKEA 4Q24A 3VJKA 1J9ZA 2XGMA 5BVHB 1AN9A 1UM9B 1PVDA 1IVNA 2CLDX 4PG5A 3TN7A 4R2IA 1PQYA 1NOJA 4Q05A 4Z2YA 1OH5A 3MNFA 4TKUB 3TIXB 3A0UA 1X1AA 2V6MA 3FDIA 2GYVA 2WNHA 3EXG1 2EBHX 3E1GA 4MQFB 5JZSA 1I7DA 1HC7A 1GYQA 3JZIA 5IBRA 1YB7A 1KMCA 2NVUA 1GPMA 1URPA 5CTAA 4JV5B 3I9OA 3UGKA 1KAOA 4FOOA 1NQAO 4REQA 1WXFA 4BFYA 1D2MA 1OKKA 1S4QA 2XOEA 1YR9A 2IITA 2OFOA 5E6SA 1IMOA 4TYYA 3N05A 4JGBA 1UBEA 1W88A 4MICA 3IR7A 5J2TF 3ZWVA 4WXRA 3THSA 2LGJA 4DOMA 2BFPA 3UMGA 3R8CA 2W6OA 2QD3A 1RACA 4WX2B 1NXXA 1YR6A 1J2TA 3WYFA 4W63A 5G40A 4R9SA 3CWQA 3KDSE 1W44A 1Q5PA 1N2ZA 2CCJA 3VU3A 2Q45A 3HB4X 1QAQA 2EYQA 1QV9A 4UBIA 1HRKA 4Q1VA 4DQKA 4TLLB 4KMRA 4JI4B 1E3SA 2AE1A 2EIHA 4X8HA 2J48A 1UBFA 2W2LD 1G59A 4J3FA 4UFPA 5G4KB 1DBIA 1GTG1 3CG0A 1DV2A 1KEVA 4YFVA 4PYQA 1SUPA 3HY6A 1EUDB 5D5HA 3ZLVA 1DO2A 2QZJA 3E9DA 2FETA 3WBJA 4BVLA 2Q5IA 1M10A 3U4QA 2OLEA 1T10A 3E2MA 3OBIA 1T5HX 1GFZA 1U7XA 1YUBA 3OZVA 4UE2A 3STWA 4N3NA 5L3SA 3VR0A 1ST3A 2K4MA 2PMKA 3JARB 3ZNNA 1BD3A 4EG1A 2AR7A 3G7UA 4GC5A 5CW2A 5EJAA 4DA0A 5K0EA 1TKAA 1TYEB 2HBQA 3VPSA 1ODKA 3QHAA 3QWHA 2QRHA 5AVTA 4E15A 4WNIA 5IYZF 1VJTA 2C8KA 1EU1A 3R3YA 2PX0A 1NLUA 2BJWA 2NUPB 4F93B 4RGQA 4PYMA 2C0CA 3TZ6A 3KSUA 1KRXA 2BGWA 3DFUA 2CV1A 4LYHA 1EGQA 5AT1A 4D5GA 1NBME 2E9SA 2IA5A 4YQYA 3P4YA 1KKLA 1GGVA 3FFBA 3M6MD 3MYRA 5CRIA 4CF5A 3F6RA 3TVTA 2BP7A 4MRAA 3OZWA 4KR0A 5FO1A 4JB2A 2OP1A 2C9BA 2CKMA 4I5IA 4XIFA 1I3KA 1I3MA 1QGAA 2GXSA 2CFSA 3AXTA 3QFFA 3IS3A 4G4SO 3LX8A 5DYNA 1OTXA 3EGWA 3QUTA 3NVMB 4TQ9A 3FNGA 4ZU3A 4B34A 4CIDA 3P9ZA 4MS4A 4JHXA 5G0TA 3HXMA 5H7XA 2XRMA 2VPWA 3PA6A 2C9YA 1VC2A 1TEVA 4G07A 1KIAA 1FVFA 4HRXA 1C0KA 2Z43A 1ZRSA 3O1HB 4X62B 4I9FA 2G82A 4FGLA 1T4MA 2WWRA 3EQ9A 4QWWA 3MOGA 4JJEA 5AWFC 3DYIA 3B85A 3GUZA 4UTRA 1FUYB 5KU7A 1ZIYA 1KYIA 5IUKC 1KFEB 1XD2A 1KYZA 4RHYA 3GPBA 1ZOSA 1X1BA 1GGEA 3GH1A 1C9YA 2XMDA 4YRIA 4Y8VA 5AVQA 3SU8A 1ATIA 3E8SA 1G98A 3FTDA 2XNHA 1VE9A 3CRRA 1C0PA 4OJKA 3JV7A 5SY6A 4J8PA 1NZDA 1NUTA 3FCSB 3NTUA 2ZP1A 1T3GA 3O2SB 4J0FA 3FOBA 3QWIA 4PGMA 4RQBA 4UVIA 3IOEA 4XB1A 1XJ0A 3GP3A 1JLSA 3PGLA 1UMCA 4K9KA 5LB2A 2D4AA 2HJ9A 2R9VA 2G63A 2ZCUA 1VJRA 2FW6A 3IEXA 1QCDA 3KR1A 3RR2A 3WC4A 2HHCA 3V8BA 5BY2A 5AKYA 4EPWA 1KO7A 4IDEA 4LRQA 3ZHOA 1JPVA 4RVFA 3ER8A 2IEZA 2FW7A 4KQMA 4RFLA 1MRNA 3ZR4B 3AFNA 3HGMA 1Z29A 2QSUA 2GVDC 5I9IA 4DLVA 2VWHA 2WC1A 1T3SA 4V1CI 5DBEX 3AIKA 3GZNA 4RELA 5F21A 2ZVDA 4WY8A 3ROEA 3VU1A 4TUYA 4WXHA 3TQQA 3CJTA 4C5AA 4LHZA 2Y92A 3T7KA 4PM4A 1M72A 1FYDA 2V55B 4R2KA 2Q6IA 4I2NA 3WBBA 2VF4X 2IHZA 3D6MA 1M0TA 2AYYA 3DKIA 3HLYA 4QZVA 4EG0A 5BQ5A 5LB4A 2ZZKA 2QJFA 5KOIA 3VNUA 3IAS6 1M6HA 1CUSA 3L0PA 4L8FA 3KU4A 4RX1A 5JO9A 2KPOA 3QYFA 1GQFA 1XALA 3RKSA 2FZEA 4XXHA 1US8B 2AXQA 2BFDB 2BHSA 1U3TA 1L1RA 4YP7A 2UXBB 4IEFB 3W8NA 1QB7A 3OZUA 3OQNA 1S7GA 3LK6A 1WBJB 3QYJA 1OLXB 1Z82A 2P79A 4QHYA 3T3DA 2SKEA 1AKWA 1FP7A 1I0LA 1M0WA 2I5PO 3BXEA 1QHSA 1YZTA 2EJVA 3A04A 2X9NA 4KPGA 1GR0A 3EDYA 4LYFA 2Q5FA 4CM9A 4CN9A 4NLLA 4RU1A 3NZEA 5J1TB 1N7GA 1WQ3A 3CUSA 5DHUA 2H1OA 1JKMA 4AU1A 5FBWB 4Q7JB 1DKOA 1YQGA 4G86A 3TIIA 4UBNA 4M8NE 1E8DA 2IK8A 3DXFA 4KN8A 5DHTA 1N5MA 3WLNA 1GM5A 4M1WA 3BL5A 3A9UA 3EWSA 3UWDA 3HY3A 3IQFA 4GBGA 2CXHA 3UVEA 3R8FA 1AB5A 4QU5A 4B3HA 3TOCA 4NMMA 4D41A 3SQXA 2IJGX 2B21A 3HDVA 4J3NA 1LWOA 1LBTA 2X5OA 2XWJI 3T5AA 2Z57A 4FK8A 3RV4A 1QUFA 1Z0FA 2A5DA 1YIDA 3G17A 1KU0A 2W90A 5AM5A 2VT7A 4LJLA 3R3VA 4KSYA 4YRQA 3AF3A 4DJDC 4Q02A 4X8OA 1H93A 1FXUA 3I0ZA 2CEKA 5JCPA 1SB8A 1TL7C 3OC6A 4IL5A 3L0ZA 3MPUA 5F77A 3L18A 3KVVA 1KEWA 1N25A 1T8RA 4S05A 1YJAA 2CWWA 2W2TA 3R0JA 3L1JA 1IXKA 3U56A 5EIXA 3LM8A 4YT8A 4JSTA 2PUBA 1SVNA 3I2KA 1EHIA 4OJNA 9MHTA 1F8FA 1KO4A 2ZWIA 4WECA 3HO6A 4F3TA 3KOOA 1T8UA 1YK0A 4ND7A 5YASA 1JIUA 2YXBA 2ZYVX 5LLTA 4MV0A 3PPVA 2ZRMA 2BCGY 1FMTA 2Q3HA 5H0IA 4MQ4A 1J9GA 3AOGA 4Y9UA 2HB6A 1E99A 2L2QA 4QARA 5FI1B 5FUQA 3VO8A 1ZJJA 2ODQA 2WWWA 1FVOA 4OKNA 2H17A 4EMBA 1RM4A 4RBNA 3SNKA 5GIPE 1L5OA 4J91A 2QN6A 5DE3A 3F67A 4BAGA 1NNEA 2WU4A 5CH3A 4KFSA 5HUJA 2I54A 3OT5A 4RLFA 4A23A 4MQUA 3OFND 3DLBA 1F6WA 2GVZC 2SKCA 4YAKA 2YOFA 2QXUA 5G1PA 2EFCB 2CN1A 2XYHA 4IV8A 2I55A 4EENA 3C7CB 2ZRCA 2AFRA 4M8KA 3WK9A 4UVHA 1NY5A 2H4YA 4LGCA 3W77A 1B0PA 3ZBQA 3C74A 2ZWMA 2O3SA 4Q4HA 1E9EA 5ED0A 3KM0A 1EVLA 2D2IA 1SG6A 4Q47A 4BO0A 2A4KA 3TR5A 2AOTA 3N2GB 1J39A 2MINB 5AHOA 2B0CA 3FOFC 3TQHA 2I33A 1MDBA 4CMEC 2XZTA 3OD1A 1S8AA 1XRQA 2JAHA 3LQYA 5AKLA 2J0EA 1VGVA 5AIAA 2GPWA 3L8ZA 4JROA 1QZTA 2R79A 4G1MB 1NTRA 4LQLA 1AD2A 4OTZA 4TTPA 4F21A 5A04A 5J3JA 1NV9A 1T29A 1ZP6A 4DDMA 4RPGA 1CBUA 3AGQA 1P45A 4H0FA 1N36B 1F9EA 2IYPA 4IIFA 1MX5A 4C05A 1NUPA 3WK8A 1BFKA 1AMNA 3NYWA 3NRCA 2ZIXB 3K9WA 1HO3A 1ZU4A 1WB5A 3A9WA 4EQ6A 1JVSA 3DKVA 5DBOA 1P1IA 3C3PA 4GT1A 2C2KA 3HBNA 4YLGA 5ES3A 2VZ9A 5H3HA 1M8PA 3M6LA 3GJ0A 3RFFA 1HDYA 1WW8A 2XUJA 1YCFA 2R84A 2HWKA 4JQOA 1E79D 4R8SA 3UWSA 4E88A 3B60A 3S4YA 3E81A 3O90A 2EQBA 1DP4A 2ZATA 5H3LA 4FHCA 2Q1WA 1H1LB 1X70A 4JKOA 1T5IA 5JIBA 4YWHA 4TWZA 1R3DA 3I5YA 4OLAA 4WUVA 1NVVQ 4AJJA 5J47A 4K0RA 4OJTA 1D4OA 2Y27A 2J07A 1X7WB 1JDVA 4P82A 3OX2A 5I9LA 3H11A 3N9IA 4K9PA 4DL9A 2WWYA 2WPDD 3UAVA 2XQFA 2NM0A 5MFZA 3QVGB 5T8KC 1YI8A 2I7XA 3HRKA 1MEOA 1ODCA 1PFWA 5TRTA 2A1TR 4HLUA 2QG9A 3H4IA 5DZSA 2QLBA 4R54A 3TZCA 3ZV5A 4L5CA 2AC4A 2QRJA 5E6UB 2DZDA 5CB4B 1MP0A 1KI2A 1T0IA 1YO6A 4NYIQ 3D0OA 1YVDA 1SH7A 4Q00A 1HKUA 1PQUA 2SKDA 3GZTB 4X9XA 4ZI7F 3GP5A 4RJJA 5JD5A 1SBZA 2GPYA 4J0JA 4C0XA 1L5YA 3CZRA 4UTNA 2WIJA 2GH1A 2LRHA 1DTWB 4JL6A 3UJ7A 3M3PA 4O1IA 1P1BA 1X92A 2GD0A 3EN0A 3AK4A 3RAFC 5C52B 4E31A 2IUUA 3W1WA 4TXLA 2OCXA 2JFBA 5J9FA 3IL2A 4KR6A 1E7WA 1V4NA 2MSWA 1FW8A 3E3LA 4JVSB 4O4LB 1BXZA 4EY4A 5HR5A 4ZEXA 3RC1A 1N3YA 2YFYA 1E1YA 3KEMA 4LS3A 4GI2A 1W6UA 4CEIB 3HACA 3T35A 1GD1O 3NBQA 1YFZA 1Q84A 1RKQA 1TU0A 3M1YA 3AHEA 3PFBA 4JNCA 4UPVA 4WA8A 2PGAA 4DLWA 5K8TA 3BSYA 4L3WA 2X9VA 4O25A 1VPWA 1SWVA 1J5PA 4YXWD 5LOVB 4KQ1A 2W9XA 4II2A 4ZV4A 2FSHA 3D1VA 3HCBA 4CNBA 1WMAA 1YA6A 3IA7A 2FPIA 4UHBA 2BGMA 4EHDA 3THXA 2I2FA 2AQIA 2FEWB 1UKVY 2VSNA 3EZGA 4I3GA 5EVJA 3EDMA 1TTTA 3IVAA 4ILEA 3A6JA 3K6SB 3PU6A 4INAA 4AMGA 2Y0PA 3W2TA 1V8ZA 3UJ6A 2O8EA 3Q6NA 1GVNB 1R9JA 4A8PA 1MGOA 2Q4BA 3E18A 5H5JA 1JHDA 3D4NA 3VHXA 1HNZB 2C8LA 2Q41A 1IBKB 1XZAA 1AF7A 3LDAA 1QC5B 2FFJA 3SF8A 1LLDA 1WA5A 2CDNA 1Z33A 4HXYA 4NZOA 1DLIA 1F4LA 3FWPA 4O1MA 1ZONA 4CMHA 3NV7A 1JQLB 4G5GA 3TNYA 4I5GA 3NKVA 1YC2A 3AV3A 3HCEA 5HGJA 3VYVA 2IOFK 4Q03A 3A9VA 1T8YA 3QPUA 3BAZA 1LRJA 1VL6A 1AKTA 1JF8A 4LZNA 4ML3A 2PMBA 2YXDA 4E1VA 2HU8A 1NLYA 5ADWA 1GAQA 3BICA 3B2NA 3UJDA 4U7TB 4UE6A 3UUWA 4LF5B 4DCUA 4J0GA 5BVGB 1SXHA 5JU6A 5L4LA 5FI5A 1PEKE 2GDJA 3NTOA 3NFYA 1XE3A 4YEDA 3VR3A 1ZCZA 4C4SA 3V8NA 1W49A 1ZJ6A 4R1UA 5DOZA 3B70A 5CK4A 3PD0A 1ADGA 1PL6A 5F5XA 2PT9A 1MAVA 2PHZA 1FBTA 4JI2B 1UCFA 1EX7A 3QX8A 4MQ6A 2JHGA 3GGCA 3PUIA 2ET6A 2AN5A 4X1KB 5IAGA 4ZXPA 5HQJA 4H4DA 3IT0A 3VZPA 5HQ3B 4EMUA 1EK6A 1Z5PA 2PKCA 2DRIA 3DV9A 4H4EA 1U9JA 3RJZA 1I3CA 3H5VA 1XZCA 2AN9A 1DHTA 2MSEB 4HWSA 3AHIA 1E3IA 2CXOA 3VPBA 3NXKA 1XRJA 3K6KA 2QE7D 4HQOA 1JUDA 2VJMA 1N7IA 3DL2A 5JRJA 1OWPA 4ZCLA 4XUCA 3BSFA 3IUMA 4Q3AA 4A8HA 3QW4B 1O4VA 3L84A 2JH9A 4US1R 1PLLA 3RT9A 4ZCPA 5BR1A 1ZIOA 3P9XA 3TBHA 4AQ7A 1WXHA 5JCJA 4D8UA 2VIIA 1G5TA 1AQ6A 1B2RA 4E14A 3OAAA 1FP6A 1K6IA 1WVIA 1U7PA 1ZOOA 2HJVA 4IHJB 5KKAA 2IYYA 1EXDA 4QSHA 2X5NA 2HT1A 1KQOA 2PU7A 2NGRA 2AI2A 1GCGA 1KIFA 2HF7A 3UJ9A 4UULA 4LCJA 1FL9A 1WO8A 1HY3A 4TVKA 2G9RA 3NBFA 6ADHA 4TXNA 1SWWA 1GLGA 3FGOA 1CRLA 1PU2A 2OCPA 2ZJFA 4RORA 2YR0A 1BS9A 1YZFA 4QUJA 2ONCA 2ZUVA 5CG1A 1ZUHA 2M6SA 5BO5A 3QPWA 1IU9A 2H7XA 3VDXA 1F0NA 3F71A 2C7QA 1NN5A 1PJQA 2JCXA 1E6KA 2DG2A 5CA1A 2W2KB 2ANCA 2WWTA 5KOHB 1XNRB 3IXMA 4RY8A 4AY2A 1IEVA 4QTXA 1P0CA 3FPLA 3IALA 1NU8A 4KQWA 1HPLA 1AC5A 1KR5A 4JEUA 4OHVA 2GBFA 4UVGA 3F7TA 3NONA 2JIQA 4NYJQ 1JU9A 5D8DA 5AM2A 5ICCA 4Y2TA 2I80A 2VJNA 2IXGA 3ET5A 3DHEA 3TGWA 4Q4CA 1B0UA 5AUNB 4XJSA 1NWCA 3OZ7A 3LVQE 1O9BA 1EKXA 3F5FA 3G8DA 3E9MA 3GRCA 1SPXA 3INYA 2I87A 3EAQA 5AKIA 4G8JA 1M2FA 3REQB 4FXPA 5LR6A 4U2DA 1C29B 1O6CA 2MT9A 2PA0A 4HN2A 2P2CA 1ZD8A 4Z9YA 2QVLA 5KX5B 1TZMA 4W9NA 4PYIA 3NWJA 3QEOA 4M7RA 2C7RA 4CCAA 3QA3E 4IY1A 5FWYA 4HQFA 3ROFA 5KNBD 1WDWB 1DT5A 1N4DA 1RBMA 3WWEA 5A1TA 2QVZX 4CR7A 2J9RA 10MHA 1JB9A 2PYDA 1ZH8A 4P08A 3WGNA 3TZLA 5MGNA 1DKQA 1UC8A 3D6TB 4MVYA 5DSZA 2F9FA 4RY0A 1QIMA 3Q5EA 9GPBA 1UC9A 1RW4A 4C5CA 2ZSBA 4JLJA 5HF5A 5IU6A 1PDWA 4OQDA 3P9QA 1G21A 3LCVB 4G4JA 2RG1A 2Q6LA 1GKYA 5JMWA 3WMWA 2JFFA 4V24A 2P4SA 3KYDA 1GAWA 1W76A 2VZLA 4OH1A 2V4ZA 2PCLA 4UQOA 5EXSA 3RTAA 4F5DA 4GHWA 2FFHA 4GX2A 2WYVA 4ENRA 2ZIAA 5ELXA 1GV1A 2GZRA 1QFXA 1TIBA 2HMWA 2DETA 1CWUA 4FW9A 2NZVG 3L8HA 2RGWA 4NI5A 5DNUA 3RROA 3AI2A 1QVRA 3KUXA 1SCBA 5JTTA 5ALJA 2WW8A 2FN7A 1JJ7A 3U4HA 4PN3A 3RS7A 1ORIA 5AVKA 2GKOA 1N9GA 3KBBA 3M7IA 3I04M 4LXHA 1JDBC 2PRYA 1L8QA 2BR3A 1XMQB 3M8KA 3PHIA 3PGA1 1JECA 2J87A 1QYWA 1C1DB 2CSUA 3LXRA 5E1BA 3SZLA 1U81A 4UM9D 5G0WA 1TIKA 2I1WA 5CM8B 3ZGOA 4Y0VA 1JA1A 5DM60 3NVKI 4JLUA 3UMMA 2FHPA 5E9JA 4UOZA 1CIJA 5I7VA 1K8YB 1XD8A 1QYXA 3MWDA 1YOVA 3ABZA 5BPFA 3ZZ0A 1P7PA 1Z36A 4CMCA 1QG0A 1C4OA 4NBWA 4MOWA 5A3VA 3ETDA 2UUOA 1Z6QA 5EXEA 3TTUA 3KUDA 1Z4QA 3GD5A 4M7WA 4ND8A 3K71B 4KXLA 1KSHA 2NSYA 2QZZA 3G9UA 5LXTF 2A1UA 2O2XA 5C8YF 4RL6A 4UVDA 1THGA 4PF1A 3RUPA 3A9RA 4BBZA 3BFVA 3RAGA 1GFWA 4CLEA 4QPJC 2VDJA 3PNSA 3RBXA 2WF7A 3DFZA 5TSDA 4AJ4A 4LJ6A 2WWGA 3A14A 3ETCA 3G82C 1F14A 3HWRA 1C9EA 4H9GA 3IEIA 3ADDA 4XPIA 3SC2B 4OGWA 1IZ8A 1CUXA 3GA0A 2AC2A 4HNSA 5MF6A 1KQFA 1H5QA 1V43A 1NULA 2Y1XA 3CGGA 5IN4A 3HFGA 1NE7A 2XXBA 1ZXLA 4FZRA 5G41A 5AICA 3BXHA 3ZWOA 4BB5A 2C4TA 2COKA 1W0KA 3QJ5A 5SICE 2H65A 3Q98A 4Z0PA 4ZK2A 4TTAA 5BR8B 1ENYA 1B8PA 1QAMA 1OZHA 2GYWA 1L5HA 4C6TB 2YQ4A 2QUAA 1F5NA 3EJ6A 1SHTX 1BFUA 1V6SA 4WDQA 3ED5A 1QO9A 2QRNA 4EF4A 4GKAA 5A3RA 2QZPA 4ARAA 3ZWKA 2VL7A 1K0FA 4CLOB 2NNLD 3V7WA 4MQ5A 2FOLA 5KWJA 3DDCA 2QRLA 3NOVA 4KXVA 1HFKA 2RSLA 3PTZA 1GQQA 2ISCA 4AD8A 4X7PA 3PF8A 4PW0A 5BWCA 1O1YA 4UCXA 1QFYA 3PI7A 1SVSA 4IJWA 1ONBA 1NC3A 3CIOA 8ABPA 2OZVA 2GJSA 3HCWA 5JAPA 2BGRA 4PCVA 4I3FA 1AQNA 2AN1A 3P8ZA 3LPNA 2XWSA 3ABIA 1FFHA 3LX5A 1PJCA 2AJBA 3L7YA 2JC3A 3MCVA 3VISA 1AHNA 5GIOE 1NUAA 2UZAA 2CYCA 4KAJA 1TVEA 5I48A 1W4BA 5CDGA 1AV7A 3AL0C 4HNQA 1HMPA 3B51X 4TMWA 3W5VA 4HNTA 4K28A 3VJRA 2CMFA 1XLVA 1PFKA 3JZAA 3IT2A 2WTBA 3USES 4KUEA 5EZYA 2WJGA 1XJCA 4FFMA 2DKNA 5DLQC 1FOEB 3L43A 2CZGA 4FDVA 2V6IA 4G3XA 3UYKA 1KY3A 4I4TF 2ATXA 3HU3A 4J0QA 3VR1A 1JG3A 1N6HA 5AQEA 2BSAA 4ITVA 3TRFA 4AG6A 4NNPA 3ML1A 2DP4E 2PKRA 4LQ4A 5KSWB 3PPYA 2J4CA 1NV8A 3QU5A 4PG6A 4WKOA 4HAIA 4RTLA 4RTOA 2PX8A 5HJEA 3ZI0A 2RDMA 4Y67A 1U7OA 4DT1B 4IDCA 4GD3Q 2OK8A 2JFPA 2NVOA 1KAHA 4NZZA 3VH3A 3GLIB 3B48A 4DV5B 2CXXA 1ECFA 1Y8ZA 2PKWA 1QH8B 4DHWA 2XEXA 4XX1A 4HDNA 4YJ3A 3H97A 2B7LA 3N8GA 3DOHA 4FHGA 1IN8A 5EMKA 1L9KA 1W30A 1E6MA 5L7YA 4RW0A 4TX1A 2GA8A 4PQYA 4RIIA 2OO5C 1UP6A 1JQEA 1V3UA 3R0VA 1CZKA 4N8SA 3HBLA 4QOIA 3AF4A 1H2WA 1U0HC 2GO7A 4Z49A 4DR1B 2HRQA 1M2GA 1RPJA 2HRDA 3N0TA 4DUGA 4NZYA 4RVNA 4ZRNA 5IHXA 4BAUA 3AEQB 2XB9A 2I7VA 2RGAA 2G9ZA 4NFHA 3FW1A 3GP8A 4QAJA 4UCWA 2M6RA 4EJSA 2OV1A 1QHEA 1XCMA 4KSCA 3AR7A 1ZJ5A 1CVIA 1WKCA 3RFXA 4P6VF 1YMUA 2VDPB 2MOKA 1K7YA 4S24A 3IP6A 3QLTA 1TOAA 1MF7A 2POCA 4K9NA 4F4JA 5HM8A 1PKXA 2GLTA 2VZ0A 3TTWA 4DVGA 5EQTA 2RC6A 3UQYS 1JAZA 1W4RA 2P2SA 1V1MB 5JNWA 1PGJA 4K8OA 4UHCA 2C7PA 4RIFA 2AOXA 5JJBA 1ISHA 4DYHA 2AOUA 3JSAA 2DTXA 2QW0X 1P2UA 4R2HA 3HB9A 3O2JA 3IB6A 2XSZA 3CZAA 3PNYA 4LXGA 1TYCA 2V5VA 5CK5A 1ADFA 4RHXA 2QLFA 2YJZA 3E9ZA 1U1EA 1MPTA 3OZTA 4OA5A 4EQZA 3WLJA 1HDZA 2FMFA 2PV0A 4L5IA 3JW8A 2ZJ3A 1AKMA 1PFQA 2JAOA 4KMSA 2RKWA 4WN9A 4HUQB 3QKSB 4FDMA 1KGSA 3I04A 1VB3A 1CIVA 2UZ3A 3QOXA 5BSTA 2VHZA 2WD7B 4C30A 1K5GA 1LLCA 3QFRA 3ZE8A 1X2BA 5ESWA 1RM5A 4TLDA 4YP9A 2XKKA 4O2LA 2X6RA 1E0KA 2C7GA 1CUYA 3FOAA 3HXLA 1IOWA 1KJYA 4RKEA 4D4IA 4PZZA 2WK1A 4GFDA 1G3IA 1MW8X 4QXQA 3IH5A 4FOTA 4PHTA 2AH5A 1EK1A 3DF9A 2A84A 1LRLA 1AZLA 1KEEB 2BMDA 2N75A 2X0KA 4OQNA 2IUSA 1PV2A 1U5BB 2P1RA 2IKQA 3L05A 5ER9A 3W5BA 5FBHA 4FGZA 4NDZA 5C1PA 2KB0A 1FUUA 2ZRIA 1RLOA 3GAFA 3W4IA 3OOYA 5DK6A 3FZEA 4B48A 2JGKA 3LLUA 4L8VA 3U31A 3FSEA 4KYVA 5JYBA 5CVTA 4CTJA 4Q48A 3C85A 4JVMA 4G81A 2OXRA 4K40A 4OU5A 1K8RA 1EFTA 2CZCA 2NQ2C 4XASA 4N7BA 5FR2A 4HZUB 1VE7A 4PSDA 4CHGA 3LQQA 2RGDA 1YHZA 1DAEA 1UK8A 1J99A 1PT9A 2Z5GA 2Z1DA 4LRTB 4LZJA 1YDFA 4NMXB 5ELMA 3ILVA 4NCBA 1D6NA 4M8IA 1I7NA 4FIDA 4TS4A 2XNSA 4XFKA 5DWDA 3DL7A 4OSOA 3FF1A 1N2SA 4Y7DA 4AWAA 1QORA 2XNJA 2IYRA 5LDDC 1ILWA 3TKYA 4A2QA 3W5IA 1WKBA 3ELBA 3WLHA 3HMKA 3V7YA 4YHBA 3QUSA 4I08A 1P73A 4HDRA 3QWFA 3BUSA 4ARVA 4JJ7A 2ONJA 1Z0KA 1NSTA 1J8YF 1T2NA 3TBFA 3V1NA 2VHJA 1KEUA 1E2JA 2DFVA 1EGMB 1KA9H 1MUUA 2A9OA 1I0IA 5F76A 3RRFA 1A9XB 1OU0A 1RPAA 3CEPB 1SCKA 1QB8A 1VA4A 3GLHB 4WCFA 2R00C 3TXYA 3LW8A 3C2QA 1ACMA 4QQ8A 2EQ5A 3KLPX 5FBVB 5EJ2A 1XHFA 2EV9A 4IJUA 2E1RA 3V00A 4BQRA 1M34B 2QUHA 3OJXA 1KOJA 1IOLA 1K3FA 1Y6JA 2HF8A 2IH2A 3TR6A 3S44A 2J09A 1MIOB 2D1QA 2G1UA 2QN3A 4IBOA 1CUDA 2WEKA 1FRZA 3EVNA 5JAUA 2VAXA 5BNFA 3RYFA 2P68A 3GFOA 1IN6A 2B61A 3PQ8A 3QLUA 4K9RA 2IELA 3CO5A 2VNJA 2KSQA 2QU7A 2ID7A 2AFVA 2C3PA 2J6CA 4BNFA 4POOA 4DG8A 1E9DA 2P9GA 3ZZNA 1PWEA 4NFLA 2NSHA 4HZGA 2Z3WA 4ZARA 4ZAVA 3REOA 4RD3A 5M3BA 3T9EA 2P8SA 4GMXA 1RYNA 2WG1A 3UHFA 1FNMA 1GG2A 1MXHA 1VSUA 3VAZA 1VGRA 2WAXA 1T9GR 4FYMA 2OAP1 4RGBA 4PS0A 5T6MA 1P1FA 1Y98A 2ETVA 3IHWA 3RYIA 5K8CA 5JG7A 1LDEA 4H18A 1OLUA 4TV9B 2WIKA 2V8BA 1A5BB 1PFUA 3FAZA 4KITB 1GO2A 5IKEA 4QXRA 2R8ZA 3OTIA 4YRBA 2Q1XA 4IGFA 2Z8XA 4JJFA 2PH3A 4CMGA 3ZOZA 3GNTA 4EUFA 4M46A 4ROSA 1XWIA 4F9TA 3QKUA 3LIIA 4GH5A 1OV6A 1HFEL 3QVLA 1ZM7A 5B2ZA 4YCNA 4BC0A 3PQEA 1I4WA 3L4EA 2W2XA 2UXCB 4YROA 2D5LA 5K3AA 1EK0A 2FSPA 3H0KA 4MNTA 4QXPA 4B7XA 5LIPA 5CMLA 3DQZA 2CJYA 2IXEA 5A03A 3V8PA 3ZKAA 3O74A 3X1XA 3DNPA 4EARA 5JZOA 3OTHA 5HK9A 3AB8A 5FFFA 2OD2A 1BW9B 3TLBA 2QL6A 2DKFA 1Y4UA 3C97A 3F78A 5EKTA 1XTBA 2Y4OA 4PSVA 4R9RA 1S4MA 3KQOA 1TPYA 4EELA 4YRAA 3OE5A 3BD6A 2GPAA 3RTGA 2B7BA 2R47A 1BN7A 2W6QA 1L8AA 3RRMA 3QEAZ 2WYUA 4YCAA 3HCNA 2FPPB 1YWGO 1MA0A 3GGOA 4GP9A 3VAAA 3WNDA 3NBKA 3AGPA 5IHPA 2ADOA 3BCHA 3HHPA 4DLNA 5B3KA 3RVSA 1T9AA 1UEJA 3BRCA 3SLGA 2ICAA 3WLMA 1CCWA 2X7JA 1OWNA 3V34A 3WGMA 4IIJF 4KXWA 2ECQA 2X15A 2J41A 3HCDA 4DLSA 4QEKA 3GQVA 5L45A 3EBPA 3STVA 3W3ZB 5CYOA 1L5VA 5B1SA 5ESXA 3W9BA 4K2AA 3VR4A 2FDXA 2GN6A 1UADA 2CYAA 4HL6A 4JR2A 4NESA 1KBZA 5E95A 3RU7A 3SJ7A 3FPCA 1U28C 4ZPXA 2UZ1A 3QBVA 4ZO4A 4MV3A 5AVZA 4RSRA 1E9FA 2ECFA 2DHEA 3KV3O 1RC0A 2B99A 2P5SA 4A92A 2LNDA 4B7UA 1DAKA 1DWUA 3RF6A 5EYPA 4D9BA 3CJQA 4R0MA 1P91A 4X8LA 1SXIA 3Q8XB 2P6OA 4QOGA 3VV3A 1NI4B 2HFJA 3STHA 3X1KA 3RM3A 2OB1A 2IDMA 1M7HA 1XCPA 3U7IA 1K4KA 2I4IA 3QKRA 3U40A 1E1QD 3NHZA 5KYWA 1AQJA 3R3ZA 4J07A 4ZU1X 4IM7A 2CMKA 4DGQA 1TJYA 1P4SA 3QE4A 5CXSA 3QW2A 1D8TA 1SRRA 2ZR8A 3NHKA 1D2CA 1A96A 2GF9A 4G5QA 2F3UA 2BLNA 1JHZA 2AHOA 2ZI7A 4F2GA 1IEWA 2AFHB 4MB6A 1SQ5A 1L7VC 1ZX1A 2AJLI 4KWTA 2ZTMA 4DR4B 5I8WA 3BDAA 1KDRA 1OWMA 1KOFA 1VM6A 2W8BB 3GAAA 5JWRA 1DMRA 1II8A 2DGDA 1Q83A 3QVUA 4C08A 2C57A 3PI6A 4H17A 4B8YA 3NP9A 3OX3A 3VZSA 2M1XA 3R24A 2QRVB 1SVMA 2AF3C 2PYZA 1Y1KE 1BOFA 5C8DA 1ECGA 5JXIA 4DMKA 1GL7A 1G8MA 4J7UA 3GLKA 3ZUGA 4BKMA 1Z34A 3Q88A 3O3MB 3AFGA 1Z39A 5JXGA 2Y2UA 2XUQA 4Y6PA 2YW9A 4Q3DA 2PPVA 2Q1UA 3ETEA 4XCXA 1WBBA 3IHLA 5FPTA 4YQFA 3LJKA 3PHGA 3NDBB 2WQ6A 1MOZA 1UUFA 3LA6A 3SFZA 3RF7A 2PLNA 5IH7A 4WFQA 1C80A 2NYVA 1DXQA 5JYEA 2CVOA 3SQWA 4JLWA 4C3VA 2AEEA 1JH8A 5TDHA 4B43A 2AG0A 3V80A 1YQTA 1Y3CE 2FV8A 4LN1A 5FOWA 4OX9B 1N2EA 1MA3A 4J7AA 3VDMA 1YE8A 5FWDA 5I4CA 1Y7HA 1RLMA 2FK7A 4R6WA 2ZANA 2BC9A 2VK2A 1TYDE 1S6YA 1F8GA 1G20E 1U8FO 4ZGGA 1E4OA 4L28A 4E07A 3U3ZA 1E9BA 1T6YA 1X7ZB 5KO2A 2FKNA 2JJ2A 4GOOD 2FOXA 2WZCA 3RS5A 1E3EA 2BTQB 1FDVA 4RQTA 3WIVA 3E9QA 3WXMA 4ARSA 4OUDA 1QTQA 4PWZA 3DP7A 3W7AA 1XNHA 1HBJA 4PZYA 4Y1RA 2D2FA 5KAMA 3MAGA 5LCXA 2UUCB 5ES4B 1QANA 3K5IA 2Q21A 1TD9A 2WTUA 4L5BA 4HDSA 1AE1A 3FUXA 3O4JA 2IPXA 3E5RA 3TW4A 4KRGA 3ISVA 1IY0A 4GPD1 4L0QA 4FS3A 2V7XA 4F04A 4Y1GA 2XQKA 5KOJB 3UC9A 3WDKA 3T06B 5TGTA 1DC4A 1JKJA 1UPAA 3O4VA 5JS6A 5CITA 2NO1A 1TO6A 3MJTA 4UAUA 4CL3A 3SZMA 3PUXA 4G23A 3E58A 3JTEA 2RHCA 3PDWA 1FDRA 5GONA 4ZMBA 1X19A 3PB3A 4PFSA 4TV8B 2ZSFA 2WMNB 5C7LO 4GZ5A 3T4PA 2AR0A 3ASVA 3EEBA 4MWBA 5CYFA 1U1CA 2BONA 2R1VB 1UFKA 3SBOA 3PD7A 3BGWA 3BGVA 1NX9A 3DXYA 1U4SA 3EIUA 3H2ZA 4FZ5A 1ZK4A 4CXMA 5EWJB 5HOQA 3U13A 2DPHA 3Q9NA 5AW8A 4EW2A 2VXOA 4MW4A 2O6LA 3LQ2A 2RGBA 3QA9A 3S5JA 4II7A 1QUEA 3V4PB 3HBMA 4RDCA 4FNAA 1JQBA 1R0BA 5LWQA 3H3XA 4WIAA 3MUOA 1VBFA 5DRYA 2VUHB 4D9KA 1ZS9A 4KKXB 4K7JA 5SZKB 3ZWPA 5CX1A 5IAJA 1NW8A 3O75A 1XTTA 3F3YA 1WTAA 3OT1B 1M8FA 4AUNA 3ZDYB 4C43A 3F1LA 2R4TA 2AN3A 4MKIA 3SE0A 3PYLA 4P1ZA 2O0KA 3OPYA 3FYUB 4IRUB 1T5BA 2J5XA 1LKZA 3QLJA 4Y6QA 2H7YA 5E6RB 1FFWA 1MABA