2WAXA

Structure of the human ddx6 c-terminal domain in complex with an edc3- fdf peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
161
Chain Sequence
GVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Mutually Exclusive Anchoring of P Body Components Edc3 and Tral to the Dead Box Protein Ddx6/Me31B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE DDX6
total genus 55
structure length 161
sequence length 166
chains with identical sequence C
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2waxA00
1CJKC 3WHKA 1YR9A 2JLVA 4AKEA 1J2JA 2GJAA 1GOTA 821PA 2F1IA 4CW7A 5JHHB 3LLUA 1QHHB 2HDNB 5BN3A 1OSNA 2OG2A 2WAYA 4TLAA 2VSXA 5DHFA 1H8HD 1YVDA 2R6FA 2YINC 1AN0A 1LY1A 2BKEA 1W48A 4L4UA 1BO6A 4AIIA 3BB1A 3CONA 4D80A 4QJ4A 3PEWA 5AR1A 2PEYA 1ESNA 4PC1A 2RGAA 4HLDA 4XOIA 1ZCAA 3TVTA 1Z6XA 2E87A 4C0LA 2VEDA 2CL6X 3BD9A 4W9MC 4JS0A 5F9HA 1X8JA 1QHGA 4LWZA 4QBHA 1FUKA 3EPKA 2ZI7A 1SVKA 2WM9B 1ZM3A 1MH1A 1TEXA 3EWAA 3TRFA 2VHUA 1ZIOA 1W0JD 3VQTA 1KO4A 4YXWA 2VP4A 4N0DA 1UKEA 1QHIA 2YWHA 3GLFA 5FFMA 4Q19A 1OPXA 2ZUBA 3V9PA 4Q7MB 3SHWA 1NLFA 3O8CA 2BC9A 1NI3A 2B6HA 4DC9A 2J87A 1NG1A 2ZRAA 1SVMA 4I99A 2VTKA 4OQMA 5FTJA 3Q85A 2PH1A 2OILA 1HQCA 1P2SA 1YJ5A 2BWJA 3IQXA 4PPGA 4UKDA 1P3JA 4DDWA 2Q21A 3KKPA 3LY5A 3HU3A 3TQCA 2ZR7A 3WYFA 3AP1A 3B6EA 4RFVA 3TSWA 1VPLA 1PUJA 1WF3A 3Q5DA 4JBXA 1Z6AA 2ZJYA 3KKQA 5FL3A 3VFDA 1E69A 5FI0B 1XMSA 3AF0A 3ZZTA 4TYYA 3G82C 4Q4LA 3A1WA 2VHQA 4XH9B 4GMDA 1OB5A 1OYYA 2ZRGA 1GM5A 3QKSA 4E5UA 1U2RA 2IYUA 3SHFA 1BKDR 4I1OA 3VR1A 4DLVA 1W47A 1W4CA 1JALA 4JBYA 1ZJ6A 3LVQE 2D62A 4Z8YA 3ZH9B 3SJCA 2RGBA 5HCNA 3T1QA 4I81A 2QMUA 2VP0A 1K8RA 1EXMA 1ZRHA 5E3HA 4C4PA 2EWWA 3GJXC 2ZJAA 1E0SA 3GJ5A 2O5VA 4C3ZA 4DWJA 5BQ5A 2GHIA 5G53C 4B2IA 1M2OB 3RS3A 5FTLA 2QPTA 2BKUA 3T1OA 3NTUA 1OKKD 3R9WA 4HDQB 2D06A 4DDVA 3B1VA 2VF7A 1JQLB 4AYTA 1GZSA 4BLRA 1JPNA 1PLKA 5FOVA 3AB3A 4K8OA 2C99A 2CJWB 4DCTA 2GF0A 4NCHA 2G83A 4OKSA 5F3WB 1MO6A 3T06B 1AQYA 4M1OA 3THYB 4ZCLA 5JRJA 4QRHA 4A6PA 1E9EA 1TTTA 3UMSA 2VSOA 1Z47A 1Z8FA 4W5WA 1XNJA 2FZLA 4ZI2A 4TLBA 4ARZB 2IUSA 4UJ5A 3Q9LA 4HB0A 3V4FA 4D4JA 1I4TD 5CIWA 3KQNA 1OIVA 1XEWX 1US8A 1F5NA 2OO7A 4CEIB 1Z3IX 1E2FA 2L0XA 2DWOA 1A2BA 3MUFA 2IC5A 5KSPA 4D0LB 3DZDA 4KSBA 4RVCA 5BN5A 1QHNA 4ZIRA 2ZRKA 2WWYA 4OI2A 1FX0B 4ZO4A 2QQ0A 1IXRC 2GEVA 1KI2A 2R8RA 4KFRA 2ZRJA 3GLGB 4FCVA 2HT1A 4YDHB 1MR3F 1W4AA 2IYTA 4B2LA 2GETA 4FCTA 1EK0A 2NPFA 3GP8A 3KTAB 5E95A 2C95A 3SYNA 4UNPA 3HWSA 3WMFA 4QHTA 5EXTA 2CMKA 2FFBA 2ORIA 3QXXA 2CJWA 4MRPA 4Q9JA 2BVNA 5L3QB 4JLDA 4YDSA 3SZRA 2Z4SA 2VP9A 3QF4A 1E79D 3NVAA 3OIYA 4GNKA 2RGEA 5J4KA 5TMPA 1BOFA 2P5SA 2IXGA 3F5FA 4B3GA 4MYUA 2JDID 5LB2A 1KKLA 5EJEA 2J46A 5JSZB 3U3MA 2ZAMA 2OEPA 3MWKA 1DO2A 1EG7A 4PZYA 2XSZA 1XEXA 3TBKA 1G4UR 3IO5A 3U61B 2ZI9A 4D25A 1C1YA 1D6JA 1OH5A 4NCNA 1KI1A 2ORVA 3SR0A 1E32A 3KB1A 2OLKA 2RGXA 2QMOA 4EFLA 1KSHA 2N46A 1T8TA 2RMKA 3S1AB 4KITB 3B78A 1XJ0A 2X1VA 3RS5A 4PPFA 1Z2CA 3U7GA 1ZNZA 3O8RA 1CRQA 2TMKA 2ZI5A 3NC1C 4AKIA 3K9NA 3ZIAA 3THOA 3C41J 2GNOA 4LC1A 3NEJA 2QAJA 4QHSA 1G18A 4KO8A 2ZI4A 1UDXA 4PPQA 1XF9A 4IVPA 4RKEA 4Q1FA 4HZUA 3VR2A 1T3SA 3M4YA 1RZ3A 4IEIA 1I2DA 2YNMA 5E7JA 3EASA 4CDGA 1SXJC 5FTKA 3AF1A 4R9UC 4QM7A 1WA5A 1AKEA 4JKIA 1Q12A 1E2PA 5D3MA 3U6KA 4TYWA 4DIDA 4B44A 1NKSA 2E1RA 1E98A 3ADCA 1KO1A 2I1VB 1CKEA 4RD0A 1JQJC 1BYIA 2CNWA 4HI0E 1XWIA 3WBJA 2OHFA 4JKYA 4LYHA 4Q66C 5LPNA 3RSOA 2QL6A 2RKOA 2ZS9A 5EE1A 3UK6A 4BRWA 1OH7A 1ONBA 1Z29A 2FZ4A 2AD1A 5KNBA 1PV4A 2BBWA 2OBLA 2WPDA 3QENA 3J81k 4LHXA 5IRCD 2NO7A 5HTKA 4MA4A 3TSOA 2IS4A 5DE3A 3VHXA 4MRRA 4OQLA 2QORA 2QROA 5G3YA 2CLCX 2CVHA 1IY2A 2BHRA 5KTYA 1TU4A 4A0RA 4LPSA 1X1RA 1J90A 2XJ9A 5CITA 4NE2A 1QF9A 1FTSA 1PUIA 1H8HA 1E0AA 4MGYR 2O8DB 5CB8A 2AXPA 1MO4A 4Q21A 1AS0A 4UXJA 2FH5B 2XNSA 4PTLA 2VH5R 4LYAA 4HZUB 5KYKA 3ADBA 5FOTA 2WJGA 2DWQA 3FDIA 2GF9A 4PAQA 4Z51A 2H16A 3GJ4A 1VCIA 2ZYVX 3ASYA 2QP9X 5KPJA 4MDFA 2R62A 4H1VA 1KK3A 2XZPA 5JJLA 1Q1QA 1KKMA 1XD2A 2ZSEA 3B2EA 5FH9A 2ZUCA 3HPRA 1KSGA 3NG1A 3JVUA 1JEDA 4FWIB 5H1YA 1N25A 4MGIR 1ZM4A 4UNSA 4ZV4A 2OZEA 3KQKA 2FX3A 4F4CA 2ZETA 2ZRHA 3UG7A 4XSHA 3GEEA 1NMZA 2XTZA 1EFRA 4JLNA 4RZXA 1P73A 4J0QA 3HP1A 2W2VA 2W58A 3GLFE 1T3LA 2ZVPX 4BEBA 4PQFA 1HQYE 3FKQA 4FINA 2EWVA 1Z0DA 4I4LA 1XBTA 1YR6A 2R44A 2BBSA 3QKRB 3LXXA 1UJ2A 1B23P 2HV8A 3DKVA 4IOMA 4TLCA 1MO5A 3KZ1E 3NBZC 5BN4A 3U44B 4M1KA 4C30A 1NJGA 2YJTD 1W2HA 3QUSA 2FSHA 3IIKA 3MJRA 1E2HA 4HLUA 1XPRA 4PPNA 2J7PA 4IOLA 5CYPA 3N5CA 2RGCA 4O2RA 2P6UA 3DO6A 4Q4HA 4V0NA 5CIQA 3I62A 1G1MA 1X1SA 1ELOA 1XMVA 2W0SA 3B1XA 2ASEA 3KUCA 4OHWA 3BK7A 3SBDA 5JI3E 3N2EA 2PT7A 3RNLA 4CRWB 5EP1A 4C7OB 3P4XA 2G77B 2GESA 4DZZA 1VMAA 3L82B 4ZDKA 3B8HA 2VSFA 2ZJ5A 3U3OA 3D7MA 2BIFA 5AUOB 1ZP6A 4BE7B 2GWHA 4KVGA 4HLCA 2FPLA 1KHTA 4Q9HA 1II8B 2EFEB 2WZQA 4KJZA 1U99A 1NNEA 5G41A 1XCPA 1OB2A 1Z0IA 1VG8A 1LF5A 3EZFA 3B7GA 1DELA 3LBHA 2FGJA 3Q8XB 4U02A 3H4MA 2BEJA 3QY0A 1UKZA 4B2PA 3U3KA 4QBIA 3LNCA 4DSOA 3P4YA 3TUJC 3LQQA 4BRUA 1HUQA 3SYKA 1K5GA 3FMFA 4L15A 3RABA 3SOPA 2CBZA 3FMIA 1CULC 2IYLD 2GRJA 2O8CA 4G5OA 3W90A 1P9RA 2WJVA 1GG2A 1RRPA 4URVR 4EPRA 2CL7X 3VR5A 4L16A 2EW1A 4TMZA 1XEFA 2GVZC 1OH6A 2ONKA 1U9IC 3RDPA 4C7OA 2PCJA 1Z07A 4NBSA 1E2KA 4TQUS 4OI1A 4IFEA 2ZM5A 2JA1A 3L0IB 2KE5A 4P3YA 1ZD9A 2QGNA 2JEOA 4P31A 3DL0A 3C14C 3SJZA 3QXCA 1OXUA 1EX7A 2CE7A 4Z54A 1DAFA 4EPYA 2NGRA 3CO5A 2YOFA 4OK5A 4P4SA 4S35A 1CJVC 3MFYA 2VYFA 3OIUA 1TPZA 4BFXA 1SVWA 3BB4A 1D2MA 4BECA 2Z83A 3K0FA 1CF4A 4O2LA 3EC2A 4PFSA 4QGGA 3SS8A 1XX6A 3EZ9A 5FBWB 2FEOA 4O25A 3BXZA 1XPUA 1WXQA 3DM9B 3R8CA 3TR5A 3QQ5A 2VQSA 1E9DA 2F1HA 3AEZA 1CXZA 4URXR 3OHMA 3CPEA 2JLQA 2O8CB 4Q02A 3SYLA 3M0EA 1XEWY 1SVLA 1ZAKA 4EJSA 1XCMA 3L0OA 1G8HA 4TQAA 2O8BB 3SN6A 1YZLA 2WOJA 3KJIA 4JMPA 4MYHA 3D3QA 1AGRA 2DB3A 2Q6TA 3QPVA 5EP3A 4OHZA 1Z5ZA 2IS2A 1U94A 5KDLA 3P20A 1A7JA 3DEFA 1G3QA 2JJ8A 521PA 5AUPB 1PZNA 3KQLA 4JYCA 1F48A 3P1JA 3UANA 3KQHA 1T5IA 2HXYA 4ASUD 4DB2A 1DVRA 2RB4A 3T35A 2ZRCA 4UQOA 3ZS9A 2P0EA 1N3BA 1L4YA 1YZQA 4GOJA 4A8JA 4P4SB 5HPYB 2BJVA 1AJEA 1NSFA 5DNYB 4IDNA 1SHZA 4D4LA 1SXJB 5HE9A 2D4HA 4TT3A 4JLAA 3PENA 1P5ZB 1MABB 2OFXA 3FWYA 4JBWA 4LV5B 5CDFA 1PVOA 1ZD1A 1II0A 4RD2A 3AGPA 1WB9A 2HJGA 4QNMA 3CH4B 2JLXA 1UBCA 2GAOA 4X8MA 1NVVQ 2XEXA 1HEIA 2ODBA 3WMGA 3GFTA 5HKKD 4AI6A 2DFTA 2VO1A 4QGFA 1AS3A 4M22A 1E2NA 2Z6VA 3L43A 2GILA 2YWFA 2JATA 2JASA 5FUVA 3ZYCA 4F91B 4DRZA 4MITA 4JSTA 2WJJA 1TEVA 2ZE5A 4H9GA 3QPUA 2WKPA 1RYHA 1G9XA 4NKRA 4F93B 2Q9AA 1Q1ZA 2HT6A 3OAAA 4Q1CA 4BZQA 3T12A 5CJPA 2QI9C 3NH6A 2FV8A 4XD7A 5AJVB 3RS2A 3X1DA 121PA 4M9QA 2AHOA 4XWAA 1XTRA 1ZU4A 1QRAA 3UWKA 3EIEA 2CE2X 2PX0A 1E2DA 3P27A 5DI3A 1E79A 1I2MA 4QC2A 1E2JA 4X8HA 4LZZA 1E1RA 5K8LA 3QJYA 3VNVA 5EP4A 5KDOA 2NO0A 4XVRA 2ZE7A 4OL0A 1JR3D 3CH5A 4XWKA 5CK5A 5DYGA 5FUWA 4TYPA 4D0NA 2C5LA 1HA3A 5L8VA 2XJ4A 5DISB 2IS1A 3R8FA 1MRNA 1QHYA 1S3SA 1GP2A 3A6PC 1FMLA 2IYZA 1R0YA 3IPYA 4C2TA 4Z1MA 4EJSC 4TTQA 5FBQB 3KXLA 3U7EB 4QOSA 4QGAA 4DLZA 5F98A 1D5CA 2FA9A 3U4QA 1RFLA 2DPXA 2W6JA 2A5FA 2X2FA 4BEJA 3IHLA 3K9HA 2ATXA 2EYUA 4Q4AB 2REXB 3K70B 4IDQA 2HF8A 2CCKA 1NLZA 5JCPA 3K0AB 1AQUA 1HV8A 4YC7A 4RCYA 2GBLC 1P7CA 3KKOA 4W7SA 2ZJOA 2W6ID 4LBVA 1XXHB 3AVQA 4LK2A 4WZ6A 4UNRA 1Z2AA 3CBQA 4IDPA 1IM2A 1OHHD 2JJ1A 1E6CA 2WSSD 5TV2A 5KNCA 4CYMA 4DSUA 4HYYA 3DMDA 4FXPA 2AK2A 5JHGB 1A2KC 3FPAA 4LJ8A 3UXMA 4XTRA 1ZUNB 3ICQB 4NCKA 5JWHA 3B1ZA 4GZLA 2FU5C 4AD8A 4D26A 4OI0A 1CR2A 4EPWA 1KNXA 3QKTA 1ZNWA 1NMYA 3IDQA 4KCGA 4C0JA 4EAQA 4A15A 3RRYA 1Q1BA 3UMRA 5DHAA 1GNQA 2XITA 3BRWD 3CB4A 3GFPA 2J0QA 2DFNA 5E4FA 621PA 1R6BX 2QBYB 2RCNA 3WYAA 1IY0A 4B6EA 4GP6A 2GKSA 4A2QA 3QVUA 3ZQ6A 1DAIA 3JZAA 3KXKA 4M9XA 1J8YF 2KSQA 3CZQA 2QE7A 4IOKA 3TW4A 1V43A 3K0AA 4ESVA 3Q3JB 4KLZA 5KSYA 1U81A 3KKMA 3W6OA 1GKIA 3M1IA 4GT1A 3QOFA 1E1RD 4TMKA 4NPHA 2JJ2D 2C03A 4FN5A 1XCGB 1Z0FA 4W5JA 4IRUB 1NSTA 2J59A 4MKGA 2ZJBA 2FNAA 2YYZA 3NKVA 1ZW6A 2G88A 4JT4A 4ASUA 2C98A 4OHVA 2ZI6A 4XIGS 3WMEA 3NC0C 1J70A 3ADDA 4OHXA 4RD6A 4NTZA 4EPTA 1RRGA 4S2EA 4F4JA 1T91A 1Z63A 1W36D 2ECKA 5TARA 2Q0HA 5EQTA 1PJRA 1U0HC 2GXUA 4GPTA 4B3BA 2ZREA 2HXSA 5AUNB 1SXJE 4A82A 4R71A 3EA0A 1A4RA 4DLTA 3ZD7A 4A92A 3IPXA 4HB2A 1ZD8A 5AJZA 3WNDA 1D2NA 4DIEA 3K70C 3I61A 3QG1A 4LPKA 4F92B 2QBYA 1TADA 1T9HA 3CX6A 4PC6A 3KKNA 4V03A 4E09A 4NYMQ 4M2LA 5EZ6B 3H84A 1U98A 2OT3B 4MGZR 4MYTA 4JLPA 4XJXA 3CM0A 1G19A 1M7BA 1OXVA 3BH0A 1F2UA 4KHZA 2ZU0C 4LDJA 4TWZA 4NCIA 3REGA 1KO8A 2CXXA 1R5OA 5JEEA 5K8UA 4LI0A 1YR8A 1ZUIA 5L3VA 5JRZA 4BFZA 3ADKA 2OESA 4CT4B 3PEVA 5AWFC 3AF4A 4C0BA 4UNNA 4JVLA 3H86A 4RY2A 1C9KA 4I1UA 3ZS8A 3PG5A 1OFHA 2IUTA 721PA 2P65A 2QAGC 3BORA 3AVXA 1L7VC 2F1RA 5K8IA 4FW9A 3X1ZA 2HF9A 1Q3HA 4DHEA 1P60A 4LCBA 2EFHB 2D3WA 5IK2A 4HB4A 4US0R 1XU4A 3TLXA 3MAAC 3L8YA 4HDCA 3QEOA 3GJ6A 3TGPA 3R7WA 1P75A 3RRZA 4Q01A 3OE7D 3KL4A 3FVQA 4RD3A 4DLXA 2A5YB 4KBFA 1JECA 5CDFE 3SQXA 4LHZA 4D2IA 2RH5A 3O8DA 2IBMA 4N1AA 1ZUHA 2PZGA 2D74A 1ZYUA 4IDHA 4LSGA 1E96A 3OFND 4M53A 4FMBB 1HE1C 2GJSA 3T1VA 3LW8A 3SJAA 4QJ5A 1QHSA 2ZANA 4LJ4A 3AV0B 3SDZA 4EKDA 1KI6A 3LQRA 5H70A 1E9AA 1LS6A 3FGNA 4WXPA 3UKDA 3SEAA 1SKYE 1XPOA 3W5IA 3T1TA 2D7CA 4PX9A 2C96A 1S4QA 4A36A 5AK0A 4A2WA 2HLDD 2R6GA 2V54A 1G3UA 4PO9A 3PIRA 1NN1A 3WY9A 1SVIA 4UNQA 1JBKA 1F60A 1S1MA 3EXAA 3GLIE 3HJNA 2I1QA 4MQBA 5A5GA 3PQCA 5AUQA 5CK4A 3EARA 3AF2A 4OBEA 4M1WA 3DZ8A 1R2QA 3R7WB 2BMDA 2JLYA 1DARA 3MSXA 1JI0A 3ETLA 2ZYWX 5FBRB 1E9CA 2YV5A 4IDOA 2JJ2A 2ANCA 3VX4A 5KDDA 2OLJA 2MSEB 3DKPA 2AWOA 3ICEA 2QZ4A 3MWLA 4DT1B 3G5UA 1P72A 1XD8A 4BFYA 5DSZA 2PLRA 3EX7C 1LF0A 3K70D 5P21A 1R4AA 4DUGD 2NO9A 1Y63A 1NMXA 4BWYA 1D2EA 1FQJA 3GLHA 5JMTA 3RWMB 4YMSA 2XXAB 1FZQA 1N0VC 5TB5A 1YKSA 4A6XA 4B75A 4DXAA 1DG1G 1OXXK 1FX0A 4LHYA 3FOZA 3CW2A 1ZC4A 2VP2A 4D4KA 2O0KA 4NZYA 5LD2C 3I1FA 2A3RA 3NHAA 4PSVA 2P5TB 3AKCA 3LWNA 3QBTA 5GJBA 2J0VA 5E7MA 1Q44A 3B85A 4GZMA 3ECCA 4KSCA 3ZJYA 4BLOA 3BH6A 3FB4A 4QHYA 2WKQA 2IUUA 4LBYA 1A5TA 1YZUA 1YZGA 1NIPA 4IVQA 5EE0A 2ERYA 2ZYUX 3F3YA 4JLJA 1M74A 3KJEA 1KAOA 2RGNA 1NN0A 2CHQA 1Z0AA 2RGGA 3NDPA 5AJXA 3WNCA 5L3SB 4ZI3A 2LKCA 3CKLA 3AVVA 2IHBA 4G5SA 4OQFA 4AURA 2XTMA 4LHWA 2ZJ8A 5JJKA 2P3SA 4L8GA 1ZM9A 4DDTA 4LYJA 3TAHA 1KZGB 1EWQA 4DLYA 4JLKA 4FMCB 4PC3A 1J99A 3BFXA 1CLUA 1DAHA 1GIAA 2PJZA 3SFZA 3AP2A 3GCGA 3X2SA 1ODFA 4U00A 2ZI3A 2GXQA 2OV2A 3GLHB 4HLUC 4GL2A 3EPHA 4DCVA 1R5NA 2G0TA 3VR6A 5TXGA 3WNBA 5M04A 2FPKA 4RFSA 4CF7A 3ZLJA 1P9NA 1K5DA 2FF7A 4QGHA 5DIFA 2A7QA 3OZXA 1XRJA 3WXMA 4IXMA 1GITA 2CLSA 2GAAA 3ONWA 1OIXA 1DAEA 1XJQA 3U44A 1NN5A 2ZROA 1IOZA 3P32A 2GZDA 5FPHA 3QKUA 1E2LA 1I4LD 2Z0MA 2N42A 1EESA 2ZRPA 1Z06A 3QPWA 1XTQA 3DPUA 4PANA 1WDTA 1M6NA 1CR1A 4B3DA 1X86B 3PVSA 3AKYA 4M0LA 3QKSB 3REFA 4YMWA 2Q3FA 3KJHA 4NONA 2RGDA 2PZFA 3O47A 4AY2A 1Z83A 2JLWA 3OAAD 2IWRA 1KMHB 3CNOA 5SZHB 1Z0JA 3HR8A 3W6PA 3WBKA 1OHHA 2JJ1D 2VLIA 3HDTA 1XZPA 4LHVA 2KBEA 1G7RA 1G64A 1SQ5A 2HCJB 2J0UA 3NDBB 2GDJA 2W6JD 5JBQA 1IY1A 3UPUA 3C5HA 1II8A 5BWMA 4AYXA 1OLOA 3H1TA 1IBRA 4NYIR 2JDIA 4MUAA 1PLLA 2WVJA 2Q9BA 4A2PA 1AK2A 5DN6A 3FKSA 4NL4H 2JIZD 2XX3A 1R7RA 4B73A 4LYFA 4MKHA 2ANBA 2XNDD 4OJQA 3ZVNA 3K53A 1ZMXA 2A5DA 1H65A 3WP0A 1E9FA 3EPJA 2ZYTX 2ZJ2A 3MMPA 3IILA 3TSZA 1U8YA 1TF2A 3CX7A 4LJ7A 2CK3D 3VMFA 4L5BA 4LV8B 1WBBA 1TU3A 2QG6A 2FFHA 4JJKA 4DLUA 2BV3A 4RKFA 2V3CC 1F2TA 1OIWA 4X8OA 4BUJA 5AJYA 5GJVC 3IHWA 1AZTA 2YZ2A 3DHWC 2QT1A 4Q1DA 3AVPA 4Q7KA 2IW3A 3VKWA 4FMCF 2QTHA 4HAYA 2EFGA 4Y0VA 1COWA 4B76A 2O52A 2O8FB 2O0HA 5EXSA 5FOXA 4XD7D 3UMFA 4NU0A 3IUYA 4TL8A 3I72A 1GNPA 2GA8A 2J3EA 1N6KA 1LS1A 1MOZA 2C8VA 2FN4A 2JGNA 3LV8A 5HKKA 4MYCA 4Q1BA 3GLGA 1BMFD 3DDCA 5F9FA 1W2GA 3U3JA 3IEUA 1DEKA 1QZXA 4HDOB 3THWA 1NBME 3K0FB 1W5SA 4NMMA 2ZR9A 1KJYA 4IHQA 5IT5A 2NO6A 1S96A 2IYVA 1AA9A 3AQ4A 3CX8A 3N70A 2G9NA 1CJMA 5L3RA 4QKQA 2CEAA 4P0TA 4NYJR 1N5JA 3Q7QA 2VBCA 1JXOA 5L3QA 4N3NA 2J7KA 4WZBE 1FL9A 4CVNA 4D81A 4Q4JA 5K8TA 2OFOA 1XTIA 1TMKA 4PO8A 3CRRA 1FFHA 4B35A 1Z6YA 2G1JA 3AUXA 2BOVA 3OIVA 4IFBA 4BFWA 5J40A 2R6AA 3PEUA 1RRFA 3HU2A 1ZINA 4ZDJA 3CF2A 1UBGA 4GP7A 4RZ2A 2A30A 3A1UA 2GCNA 1F2TB 2R9VA 1L4UA 2CL0X 3BFKA 4HUQB 2YOHA 1L8QA 4V0KA 3GJ8A 4JLMA 5D3QA 4XSGA 4UXHA 1E94E 2AKYA 1WMSA 3F0TA 2E9SA 2ODNA 4Y0AA 1XP8A 4GOKA 2WWIA 3KX2A 2BEKA 2QT0A 4JIMA 1WRBA 3HR7A 2RHMA 5CB6A 1E2EA 1AZSC 3GPLA 1ZIPA 3A58B 3BE4A 4E07A 1T0JB 2VPPA 4LOAA 1VTKA 3K0CA 2REOA 3THWB 2F3RA 2QM7A 3QI2A 4OYHA 2OE2A 5JI2E 4D0GA 1W5TA 2FMXA 3EIQA 1N2CE 2ZXUA 3RWOA 4NYJQ 3GJ3A 2F3TA 2G1KA 1J7KA 2ZSFA 1GKUB 1T4GA 4LBZA 1CRPA 1Q0UA 4JL8A 2J41A 3U5ZB 4Q4JB 2QSYA 4WA7A 2OXCA 2H1LA 3R20A 1XMIA 1XTKA 4NYIQ 3OFNA 3PUZA 1NVVR 4LRWA 1IQPA 3IBGA 1S0UA 3GLHE 1KSFX 1TL7C 2C9YA 2FJUA 4TZ0A 3SFVA 1G7SA 4DDUA 4AYWA 3M6AA 1IN7A 4KFUA 1E2GA 4ACAA 4NCJA 2HUPA 3FFAA 5A4JA 1T8UA 3GJ0A 2LKDA 1E99A 4A9AA 1TF7A 2RAPA 4M1MA 4V0MA 1VYTA 2OM2A 4Q7LA 2Z4RA 2LWIA 4JVSB 3TW8B 4TL6A 5EE3A 3THXA 3IKJA 2NZJA 3QF7A 2GCOA 4BLTA 1NY5A 2XNDA 1G7CA 3RHFA 2UZIR 2ZRMA 4EQ6B 2BM1A 2Q3MA 2AD5A 5KUTA 4DUGA 3PEYA 1CU1A 1WE2A 4BLQA 3CRQA 1FOEB 2Y8EA 4C0SA 5DN6D 1NRJB 5FUYA 4B48A 5JLJA 3K1JA 1YHNA 5DO9A 3NBXX 3BERA 3IGFA 1GSIA 4F7WA 1KI9A 2G3YA 5ANRB 1GILA 3U6BA 4TMTA 1TAGA 2ZSAA 1OH8A 2ZU6A 4R2HA 4B3FX 3LA6A 3IIMA 3I3SR 1YE8A 1E0JA 3U3RA 1KO5A 1G8GA 2WWFA 5ELXA 3OEEA 1QG2A 4DKXA 2OUKA 1IAQA 2OCBA 2XAUA 2ZIAA 4EJSB 1NVUQ 5EP2A 2FSFA 4PZLA 1S8FA 1U0JA 1X6VA 1H8ED 4LJAA 2ZRNA 2ORWA 4KLNA 1IJFA 2SHKA 2AK3A 1UFQA 4Q4AA 1XD2B 5DH9A 4KYIB 1E2IA 4POAA 1Z08A 3HU1A 3MCAA 2WIBA 1KK1A 1UDWA 1KYIA 2QY9A 3N2IA 1YZNA 3BS4A 1KK2A 2H17A 2PMKA 3EZ6A 3UWOA 1N5LA 2I3BA 2NIPA 2OFWA 4JJZA 3FFBA 5B2ZA 1FUUA 2XTNA 3K09A 4IW3B 1WBDA 2JLZA 3OEED 1E2MA 2ZS7A 5GJWC 1YR7A 2GCPA 1GNRA 3UATA 2GJKA 2H57A 2R2AA 1W7AA 1T5LA 4P4UA 4BLPA 2XOKD 3TUIC 5J5CA 2VHCA 2VL7A 1G5TA 4FWTA 1CP2A 1QHHA 4JL5A 3CWQA 5CLLA 4DBLC 2B7BA 5H8WA 1QBKC 2OAP1 1A1VA 3WP1B 4B34A 1KI3A 1YRBA 4K46A 1GL7A 5C1BA 5B64A 1SKQA 2DCUA 3ZVMA 3LBNA 1P61B 1CIPA 4UXIA 4MKIA 1R5BA 2C77A 4BFUA 3BAFA 2CVFA 2F9MA 5KSZA 1SXJD 4PC2A 4MGKR 3RS7A 1IN5A 3LH5A 1HTWA 2FWRA 4EPXA 1P9WA 1ETUA 3CWZA 5UKDA 3R9IA 1UPTA 3A1TA 2V6JA 1S1CA 4TN1A 1G8FA 4P33A 3MWYW 3BB3A 5EXXA 5FBVB 3K09C 1M7GA 2VP5A 3MJHA 4TSFA 1ESMA 1JAHA 1U90A 2WHXA 4IVRA 2K5UA 1NLYA 2UKDA 4KXFB 4CEJA 3VKHA 3HPQA 2DR3A 3ZD6A 2A5GA 4URUR 2GXAA 4U5XA 2F1JA 3V4RA 2ZSBA 4K81B 1LNZA 1MV5A 1OFUX 4QFMA 2KB0A 1XTSA 1H8EA 2QQEA 3AKDA 2W2TA 3EWSA 4LJ9A 3NEYA 5FTMA 3MWJA 4YMTA 2NMVA 1X8LA 4PR0A 1KDOA 4TL9A 5CM8B 1UADA 4KFSA 1CR0A 1TNDA 1OW3B 3FMOB 1S9HA 4BFVA 2P6NA 2H7VA 1XZQA 2YHSA 1TQ4A 1ZNXA 2VIIA 4FIDA 4JT2A 4KBGA 4AK9A 1OFIA 4RD1A 3UG6A 4MKFA 2UZ3A 8OHMA 2EU8A 2DWPA 3AUYA 4TMWA 2B21A 2CNWD 1KJWA 1F2UB 1XFAA 4NYMR 3OIWA 4ZKEA 1DAGA 4ZCIA 2WPDD 1OF1A 3B60A 4PO1A 2KI5A 2R6CA 1SVSA 4AG6A 3E1SA 5EXPA 3KXIA 2FEMA 2ZRLA 3TIFA 4C0QC 4KAXA 2DFKB 1CJTC 3SQWA 1R0XA 2WTUA 3RLFA 4BQSA 3BIFA 1IXZA 2RGNC 1TUIA 4RSGA 1W36C 4PZZA 1LW7A 2QE7D 1KNQA 4DCSA 1VG1A 5HZKA 2WJIA 2LCFA 2IK8A 2V1UA 1GRNA 4HEJA 4QXAA 1DS6A 1U0LA 1N6LA 4B43A 2QUZA 2KWIA 2PZEA 2GZHA 5EUQB 2ZPTX 4AWXA 2V4ZA 3MLEA 1FNMA 3I5YA 1Q1EA 3DOFA 1SULA 1JPJA 2F43B 1L2TA 3HYTA 5DI9A 5BYKA 3SNHA 2HCBA 2ZRIA 5EE9A 2R6DA 1DAMA 3WRXC 3Q5EA 1N6IA 2ZVQX 2PBRA 4F4IA 1CBUA 4PHFA 3W3ZB 4ARZA 5SZIA 2OCAA 1KO7A 1Y3AA 1CS4C 4MRNA 1UEJA 3CPHA 4MDEA 1NG9A 4US2R 3VNUA 3W8RA 3NBYC 2NTYC 3OE7A 1A82A 1R10A 3BJIC 5JFGA 5TDHA 2GEUA 4HLQB 4M8NE 4HUTA 1KAGA 3AH8A 4BZXA 3AM1A 1RE0A 1WP9A 4LX0A 2OSBA 2WIAA 3AP3A 5G3ZA 4ZIRB 3LW7A 2V6IA 2ZITA 1QDEA 3NWJA 4EIWA 1JEEA 1OFTA 1V5WA 4JLBA 4TL7A 2ZE8A 3Q7PA 1NY6A 2WWGA 4Q18A 4OI4A 2W2XA 4B3CA 4US1R 1CTQA 5JWRA 1UKVY 4NP6A 3W8NA 3B1YA 3C16C 1YU9A 2GXSA 2J9RA 2P2LA 1KSJA 1C4OA 3CR7A 1RJ9B 4IJMA 2VRWA 3L0PA 3PJRA 4IKEA 1UBFA 2F43A 3RS0A 2MSDB 2QU8A 2VP6A 4Z1MD 1SKYB 4KV9A 1RKBA 2BCGY 1E2QA 1YZKA 4DSNA 1DOAA 3GD7A 3BH7A 3TE6A 3VHLB 1GKYA 2R65A 4G0NA 2IX3A 1IXSB 4JLVA 5CM9C 1EFCA 3GLGE 2IYQA 4NDZA 1JR6A 4C9BA 1EFHA 1Q20A 2AKAB 4DT1A 3W6NA 2QA5A 3PXGA 3C8UA 3AKEA 5H68A 4TQ9A 5GVSA 1XEXB 3LD9A 4ZDIA 2V7QD 3KJGA 3OEHD 4TYNA 3BC1A 4TLEA 4LJYA 1COWD 2ZS8A 3PCRB 3TR0A 4FI3C 2XXAA 1FMJA 2QNRA 4OK3A 1GVNB 3AF3A 4B33A 2IS6A 1VHTA 2ATVA 3B13B 3S1AA 2GTPA 3TKLA 3A4NA 5KSOA 1VCOA 4BZPA 2AX4A 2G0NA 4PC7A 2QP3A 4B3XA 2X8AA 4TSFD 2CK3A 2CHGA 1G8PA 1SHKA 4X8LA 3SJBA 3TVDA 4ERNA 1ZC3A 2ODWA 1P2VA 1DG3A 3W3AA 3BFVA 2EYQA 4CZ2A 2MMCA 2QRNA 3LBIA 4M1YA 2FFQA 4FMDB 1P4SA 2YWGA 1HT1E 3U4QB 1Q21A 3RVBA 2QN6A 5FOSA 3SI7A 5KO2A 4PQRA 5FTNA 2N1BA 4GRAA 3JZMA 5CYOA 1N6NA 1W0JA 4JZKA 1UKYA 4ABYA 1X8KA 4C2UA 1P62B 2NPIA 3GFOA 1XXHA 3PUWA 4Q47A 3TQFA 5GADl 4CEHA 3IBYA 2WICA 3IO3A 3SE0A 3QE0A 2ZSDA 4WW0A 3TUZC 5EZ5A 1E9BA 2NZ8A 3W5JA 3U7HB 2V9PA 1CEEA 1MT0A 2DHRA 1KY2A 2MMGA 2ZEJA 1DADA 2J45A 4AKHA 2QTFA 4RFSB 4GI7A 3KUDA 2AWNA 2AL7A 3NHBA 2DBYA 1JXMA 4DVGA 1VDZA 3PUYA 3TMKA 3EG5A 4N0EA 2WSSA 221PA 3FE2A 4II7A 4KU4A 2CLDX 5GJCA 4WAUA 2C9CA 1JJVA 1QG4A 2ZUDA 4PHTA 2O8DA 5JCZA 1MKYA 2W6IA 4DCNA 1XJCA 2Q9CA 5J4VA 2REBA 3X1YA 4HAWA 4B6FA 3KQUA 1TQ6A 1ZVQA 4HZIA 2EQBA 5LB4A 1Z0KA 4IEEA 1F6BA 4GMXA 4MRVA 3MG9A 1US8B 2QPOA 2NOAA 2WWHA 3LFUA 1SGWA 3LX5A 4F38A 5KNDA 4CEIA 1AGPA 1D8TA 1R8QA 4JLOA 5BYJA 3CNLA 3RSLA 1UAAA 2JAQA 2BM0A 2FFAA 5GVRA 3VAAA 1N0WA 5C18A 1LVGA 1VYVA 1CR4A 1D9XA 4Z8XA 1AIPA 4LV6A 4YXWD 4GBMA 2B92A 1GAJA 2IEZA 1G6HA 2IT1A 4TZ6A 4WIAA 3QNUA 5HR5A 1VCMA 4R98A 1W1WA 1B0UA 4QBFA 3W34A 3VTKA 4KYUA 3T5DA 1RPZA 4Q5IA 4HSEA 5IF9A 1JR3E 4WXRA 1S3GA 2IXEA 2WOOA 3VU9A 3SC3A 3PUXA 4V0LA 1N6OA 1TQ2A 2YKGA 1ZCBA 4B74A 3L2OB 2WWWA 4Q1EA 4I1SA 3NH9A 5JWOA 1Q22A 2ERXA 1DO0A 4PSAA 4EFNA 3B9PA 3MGCA 4RCZA 5AJWA 3RC8A 1M7HA 4A1FA 4ACBA 1EFTA 2BDTA 1TUEA 4ITRC 4EFMA 5KHOC 2FPMA 3UIEA 3ZQJA 4BFSA 2B8WA 2QSZA 4EDHA 1NKTA 1YRAA 1NN3A 4Q4HB 1U8ZA 1NP6A 2CDNA 2VHJA 1HY3A 5FL7A 4Q1AA 1XB2A 3GLIA 4A4DA 3OF5A 1OT3A 3AVTA 4XTCS 2EFDB 5B30A 1N5KA 1R0ZA 2A78A 2VHTA 2W0MA 3KB2A 4M9SA 3TK1A 4DCUA 4AKGA 3CRMA 4QBGB 4RZUA 3CLVA 2ZJZA 4PXAA 1KJZA 1GDDA 3I4LA 5C4GB 1W44A 4ON9A 2A2ZA 2FG5A 3U2QA 4PSKA 5FR1A 1OJLA 1UM8A 1G4AE 3RRMA 5JECA 4QJ3A 3C4JA 2G6BA 2PMDA 3JVVA 5SZKB 5FPTA 4YMUA 3G0HA 2OCPA 4MUBA 4YLGA 2HYIC 4ZDWA 4M4SA 3RAPR 2WJYA 3VU9B 1TX4B 2IF2A 1I4DD 3W9YA 4D6PA 4DLWA 2XZLA 1X3SA 3U7FB 1E4VA 4GOXA 3THYA 4YONB 1G6OA 2DFLA 4FD2A 4P32A 2PLFA 4ZPXA 4B32A 4WZAE 2IYWA 2J7PD 1R0WA 3DMNA 2D7DA 2JLUA 4DLRA 3L0SA 1KY3A 2W83A 2GK6A 1G291 3PITA 3EC1A 5JZVA 4EUNA 4R7ZA 3F8TA 1HE8B 3LLMA 3A1SA 3GLIB 2CCGA 2IYXA 1N5IA 2J1LA 1HURA 1KMHA 4G5QA 2JLRA 2GBLA 2ZRBA 4JVNA 3QG5A 4URWR 4XVQA 1E3MA 1KI6B 4D82A 2IXFA 2ZQ5A 4LUCA 3ND9A 4IOJA 4KI0A 4ZKDA 1E0KA 4TTPA 4AC9A 3ZZ0A 2YC4C 4E03A 2VA8A 5KOYA 2NG1A 2IL1A 1BMFA 1QVRA 4AG5A 3ZZUA 1CJUC 1NVXQ 4KODA 3KTAA 1DPFA 1G3MA 4WBSA 3ZDQA 3MD0A 3AVWA 1II9A 1E9RA 1KTVA 4DSTA 3R9XA 4KVAA 3EAQA 5JS7A 4URYR 2DYKA 2FGKA 4NHOA 2KJQA 4OQNA 5G40A 3EZ2A 1NL3A 1GRQA 1DBSA 4TMVA 5SZJA 3VR4A 1MO3A 1KI7A 4Q00A 5IK2D 3QF4B 4EPVA 4PAMA 2QMHA 1J8MF 2V55B 1DTSA 4BASA 1U8AA 4G5GA 3D8BA 4Q9KA 3CRVA 3I8SA 3KFVA 4A8JC 2CHVA 2WAXA 3WHLA 1OXSC 3KDSE 2IYRA 5JSZA 3EA5A 1OV4A 4UJ3A 2PEZA 5EUMA 1XMJA 1JB1A 1W0KD 2QAGA 1Z6GA 3CIOA 3LX8A 1ANKA 2EVWX 2B7CA 3THXB 3RRNA 2GCOB 3GEIA 1O87A 1HT2E 1W49A 2MSCB 4V0OA 4EQ6A 2AR7A 5C4MA 5FPKA 3K0CC 1VIYA 1ZBDA 5FBLB 4A8JB 1TQDA 2W00A 4LC0A 3C5CA 4M1SA 1G20E 4YMVA 3QKRA 3O8BA 1G41A 3LAWA 2WJHA 1Q57A 4HAUA 4BPBA 1VG9B 1VCNA 1Z28A 2AN9A 2H8KA 2GVDC 2PX3A 2HEIA 2QEQA 1MABA 2IWHA 3PUVA 2GJ9A 2ZRFA 1KIMA 5FL7D 5FR2A 3ZVRA 3QIAA 2B8TA 5KU1A 1W36B 4V0ME 4ILEA 3VR3A 2AFIE 4FMDF 1Q3TA 2F7SA 5DLQC 4Q7JB 2YOGA 4BFTA 2D2FA 4RD4A 4DEXA 4LGMA 4W5HA 1GWNA 3KFXA 5D3MB 3D6TB 5L3SA 4CGZA 2GEDA 3ZIAD 3VX3A 1EFUA 3A37A 2NQ2C 3K9GA 1M8PA 3E70C 1S2MA 1ZU5A 3A4MA 4G3XA 3IIJA 5B57C 4HUQA 1GFIA 5C46F 1DAKA 3BWDD 1KDPA 3WYGA 3BBPA 3IQWA 3V00A 1FQKA 2QAGB 4Q9IA 3QEJA 1RVDA 2J0SA 5FOWA 1WCV1 1XXHE 4G1UC 1LB1B 1JJ7A 4HATA 4IXNA 2OXRA 5DI3B 2BMFA 1IN8A 4RJLA 1Z6TA 2HJVA 3K0EA 3IEVA 1HH4A 1KK0A 2KBFA 1IN6A 2NO1A 3E5HA 3RYTC 2JLSA 5BW8A 1KDRA 4C0KA 1LFDB 5IHPA 1IONA 2OAQ1 3B9QA 3X1XA 1NBMD 2XGJA 1EGAA 1FNNA 2IF0A 2QGZA 3FHOA 1JR3A 1M34E 3CZPA 2YC2C 2AFHE 3RANA 2O8EA 1E9SA 1OXTA 3AVOA 2PCLA 3FMPB 1IJEA 4JYBA 1BH2A 1OE0A 4XVUA 2ODEA 1BYUA 2OBMA 2P67A 1FW6A 5LDDC 4MH0R 4YQFA 5FPYA 1NIJA 4BGDA 2XB2A 1ZNYA 2WMNB 3CUEF 4U7DA 2IA5A 2J0UB 2V7QA 4HAXA 4PHHA 3C7KA 4Q48A 2CCJA 3H0KA 4PAOA 1IN4A 1KGDA 1N6RA 2ZR0A 3QVVA 4O0MA 3TNFA 1U9IA 2OBNA 3LXRA 4OJKA 3ASZA 5IDVA 5LBIA 3CRW1 1GL6A 2ZRDA 1AM4D 2HYDA 3L8ZA 2GK7A 3QXHA 1G16A 2AXNA 1D9ZA 3H2YA 1T3HA 4O3MA 4BLSA 3SU8A 2F55A 4KFTA 1VG0B 2QTVB 3TAUA 4E22A 5LD2B 1G7TA 3I73A 3QSYA 4ZCMA 2QENA 2BCJQ 2BBOA 1KOFA 2X19A 4TLDA 3I5XA 2JIZA 1GTVA 2A9KA 1NBMA 2YVUA 1P2TA 1VHLA 3FKSD 5B58C 1RC8A 1E4YA 4GDFA 1VYUA 2FSGA 1VIAA 4FCWA 5DGXA 4QNRA 3E2IA 4V02A 2V8OA 4WVFA 3T34A 3AVUA 2O8BA 3RC3A 4TT3D 421PA 2FOLA 1S9DA 1VECA 2O0JA 2O8EB 3BGWA 5FOUA 1MRSA 2QMEA 2QRZA 2ZE6A 4G5RA 3AGQA 5CLQA 1N6HA 4A0GA 4B47A 1O3YA 3CF6R 3QBVA 4DEYA 2BBTA 2Z5FA 1XDBA 4URZR 3OESA 1OKKA 3I92A 1FPMA 2O8FA 3EPLA 1W4RA 3B82A 1G5PA 2GJ8A 2WWXA 2PL3A 1SZPA 3I8XA 4H1UA 4MRSA 3A36A 4LJ5A 5DYIA 5HZHA 3B1WA 2FDCA 1PLJA 4JVMA 3OEHA 2WMOB 2H18A 4L9SA 5J4YA 5JS8A 3HYRA 2J5XA 4OK6A 3QXJA 2IYYA 1KI4A 2BJWA 4M9ZA 4P4TA 1W46A 4R2IA 1G3IA 1K6MA 2IYSA 4M21A 2ZTSA 5HCIA 2C78A 2WSMA 1QHXA 3GMTA 4LJ6A 2GZAA 4M1TA 3U60B 2C9OA 4HAVA 5KPDA 4C0HA 4A0FA 1UF9A 1UEIA 2BMJA 4A0HA 1M1YE 3LRPA 5FPSA 2XSZD 2IEYA 1F3OA 3I32A 3CPJB 3EIHA 1FTNA 2F6RA 1G5RA 2WV9A 3A8TA 2WKRA 3A1VA 5C2JB 2H5EA 1NF3A 2I4IA 4L9WA 1ZM7A 5HE8A 5J4HA 3D31A 4LY6A 4Q03A 1E1QD 3T5GA 1VKJA 4GSYA 4QL3A 3P26A 3K0SA 3BOSA 2WBLC 2X2EA 4LBWA 3MRSA 3DVLA 4TYQA 1P2UA 4ESHA 1W0KA 4OQXA 3GEHA 2V1XA 4CT5A 3C15C 1NVWQ 1G3RA 1SVOA 4G01B 4Q9LA 5FI1B 4CEJB 1AKYA 4PQYA 3WRYC 1T6NA 2C2HA 3EW9A 4GFDA 5TVKA 1FP6A 5A0FA 1FP7A 1P6XA 1YZTA 4DB4A 3LVRE 1UBEA 3NXSA 3T61A 2XZOA 2QP4A 3SBEA 2YWEA 2IHYA 3X1WA 1HYQA 1WQ1R 3NIBA 1RJ9A 5JEDA 2ONJA 1XD9A 1RIFA 1IHUA 2ZAOA 2BMEA 3PV0A 3GQBA 1G8YA 3VKGA 1NJFA 2PJRA 4QM6A 2A5JA 4PHGA 5EE5B 2C04A 5J4LA 1W4BA 1DE0A 3T15A 1R8SA 4OHYA 3FYHA 4CIDA 1XTJA 4HB3A 1EWRA 1N6PA 5FUXA 1TF5A 4XWOA 1Z22A 3ZVLA 3FTQA 2JCSA 3GJ7A 4TTRA 1KMQA 2F9LA 5TY0A 3DOEA 5J47A 2PT5A 4HAZA 4QG7A 2EFCB 2X77A 1SXJA 3DM5A 1N0UA 1BS1A 4DJTA 1KZ7B 1RW4A 5BXQC 2FE4A 1LV7A 1JAIA 3FHCB 3NBFA 4B71A 1RYFA 1RRCA 1G17A 4RZ3A 2Z43A 3LDAA 4D4MA 4JSYA 2OCYC 1EX6A 3QXSA 4WOPA 6Q21A 2HLDA 2QPAA 2XB4A 4DLSA 1YQTA 3CNNA 1LTQA 2QM8A 3PR1A 3PFIA 2XOKA 3K9LA 1ZM2A 1G21E 1AS2A 1E1QA 2H92A 4C0AC 3ZGXA 2UVQA 2FSIA 4TMXA 1OYWA 2Q3HA 3Q72A 3TH5A 3CR8A 1EFRD 2DY1A 3A4LA 1GL9B 5F2EA 4NH0A 1BIFA 1GRRA 3GLFB 3B5JA 3LO5A 3ND8A 4CEHB 2VF8A 2D2EA 2RHDA 3CF0A 3EZ7A 4I1VA 3TJZA 1GUAA 3AVYA 3FHTA 5CJ2A 1KI8A 3RS4A 1QVAA 5E7IA 1KDTA 3K8YA 2P6RA 4JL6A 5JJIA 1T0HB 1JNYA
chains in the Genus database with same CATH superfamily
1A7UA 4U63A 1CJKC 2P8JA 3V1MA 4JUDX 3WHKA 4RTJA 1GNTA 4MEBA 4ZO6A 4X97A 821PA 2MSNA 3GJYA 4C6SA 3KPJA 1T25A 1BROA 3FN4A 1JDTA 1H1LB 4QU0A 2RI1A 1GUBA 1SOUA 2LD4A 4I4TB 1H8HD 1YVDA 3W2TA 2Y1CA 2R6FA 1Q1AA 2NU7B 2ZGVA 4P3KA 1AN0A 1HOTA 1BO6A 3WMXA 1Y8ZA 3CONA 1DP4A 4RHTA 2W48A 4EYSA 1B8VA 4ENSA 1R8JA 2KYRA 2ARKA 4PC1A 1XT6A 2RIRA 4O4IF 4XOIA 2E87A 1IBCA 3AU8A 5EHNA 3ZH2A 2O6HA 1PTKA 2AR0A 3DMPA 3W5DA 4RWEA 4ARVA 4CQNA 1Q77A 1A8SA 2R7KA 1GQSA 2A5LA 2ZCVA 1V7ZA 3D4IA 4L76A 3DOUA 2H4YA 2ZI7A 4LWZA 2PUHA 1ZM3A 5B7NA 1M76A 4DY6A 5TLSA 1EUQA 4R9SA 4CQJA 1W0JD 1KDYA 2WSIA 3W2GA 4PVCA 4Q19A 1OPXA 4YJ2A 4Q7MB 3SHWA 2HO4A 4BVHA 1PTJC 2FEWB 2H85A 1W35A 3H04A 3M9WA 1YZYA 1O1YA 5AHKA 2I9KA 4CM1A 1SVMA 2V7UA 2VTKA 2ZJ4A 4K1LA 2UXDB 2OILA 5KI6A 4U1RA 3DXYA 3INNA 3WA7A 1L9KA 2FWBA 3KKPA 4HGNA 4HK4A 3DLIA 3AOEA 4P5PA 3HU3A 3PSAA 2PDAA 1M3SA 3TEFA 3AP1A 3B6EA 4RFVA 3RT9A 4RIIA 1PUJA 2DFVA 3FYDA 2YVAA 1PBNA 5TX7A 3I0MA 2PXCA 1NW4A 2ZDHA 4JBXA 4CQMA 3KKQA 1PX0A 1X0XA 1U6JA 3NHKA 1UXJA 2P9QA 4JXJA 5CLFA 5LVAA 2X5KO 3ETNA 2VJQA 1E3WB 3GH3A 5DF1A 3V5NA 2YR0A 4TYYA 3DFIA 4Q4LA 2D2VA 3KNZA 3UMBA 2ENUA 1FNBA 3ED5A 1JS1X 3LQ4A 1RWXA 2H31A 4PONA 3SSAA 1QH0A 1M5UA 1OYYA 4ZU3A 4ZWNA 3AEQA 4MW1A 3STWA 1J0EA 3Q0TA 3QKSA 1L8LA 5IU6A 1AO0A 3PYLA 1OBCA 1U2RA 2IYUA 5BQOA 4C7JA 3ZU5A 1KA9H 2GMWA 1IPFA 3VR1A 2YYAA 3DJFA 3RG8A 1DKLA 4XGKA 2QD3A 4DLVA 1R0CA 1VFNA 3LVQE 4OQZA 5FAKA 2H63A 2OCXA 3N8KA 2RGBA 4MX8A 4Z8YA 2OV4A 4GSLA 4BX0A 4OSPA 4KR7A 5BV7A 2EAUA 2QMUA 2VP0A 3EEFA 4MKXA 3VPFA 1ZK1A 4PIMA 1ZRHA 4PXYA 3P9PA 3DGEC 4XQGA 1G5IA 1E0SA 3B20A 3BTVA 4E5NA 2Z57A 1YSCA 2R1TA 1P0PA 4C89A 1J97A 1MAVA 2NSHA 4PBSA 5G53C 5HOQA 3RS3A 5FTLA 1EHCA 2C1ZA 1SUIA 3G8DA 1OLSB 4D97A 3NHJA 1UDAA 1M6HA 1W85B 2D06A 5FB3A 3R9WA 1X7XB 5JVDB 4YCMA 3PUKA 4IG4A 4PEVA 1JPVA 5A9TA 1GZSA 1R27A 1PLKA 3HBFA 3L18A 1QLWA 4K8OA 3A4IA 1T8SA 4O1IA 2X1MA 4K9OA 2JLCA 2Z5LA 3MS4A 3SYTA 5F3WB 1AQYA 4BO5A 2AQKA 2YWCA 2HK7A 1DC3A 1P9OA 1U3GA 2P6PA 4ZCLA 4A6PA 3DTNA 4QAJA 1TTTA 8MHTA 5FX2A 4YVFA 4DM7A 4WADA 5CVUA 4F46A 4W5WA 5IJZA 3ZKWA 3LHIA 3JARA 1TZCA 4TLBA 2WU1A 3UTDA 2O2YA 4UJ5A 2O2EA 1D7AA 2PUJA 2G5GX 2CMDA 2XZDA 3C6BA 3KQNA 1OIVA 2LIPA 1US8A 3ENVA 1VMIA 1I7PA 1F5NA 1ZLYA 4RTSA 1Z3IX 4BWVA 2C2WA 1ZWKA 3GCXA 2DWOA 2K7ZA 3Q3EA 4CM8A 2HRQA 4FNGA 3O93A 3SC2B 4D0LB 1QLJA 4WLNA 2GHRA 5HKBA 5LU9A 4ZK2A 1XDUA 4YHHB 1J22A 1WW8A 2EFJA 5AKJA 4CGYA 1RQRA 3QFRA 1LDEA 1G66A 1Q84A 1V3QE 2FPSA 2NUAB 1GO2A 3EF3A 4XUDA 1P17A 2CF5A 1E4OA 4FEEA 4QOIA 1M1NB 3JQAD 2FZKA 3CEMA 1W8IA 4WUTA 2GEVA 4HWTA 1KI2A 2XE4A 3I4CA 1KORA 4ZEWA 2ZRJA 3GG9A 2RG1A 4OQDA 5LUBA 3UBTA 4KC0A 4W5NA 3I9MA 2QLMA 1JLKA 1M2KA 3FVWA 1ZH8A 1B1CA 3BWMA 4Q4DA 4FCTA 3I2FA 5KCZA 1EK0A 1JHZA 5IBPA 4XWTA 2NPFA 3TBHA 2FXIA 3T52A 3MQFA 3A9VA 3SYNA 1QXSA 3VYVA 4EHNA 2FFBA 2WKWA 3ROPA 2OHJA 3BEDA 2QRJA 2P4SA 1UKBA 3EDQA 4C7BA 2PXHA 4YDSA 1K7SN 3SVLA 1KEEA 4GECA 4GXNA 2QVCA 3QF4A 3B9BA 1E79D 4REQA 3OIYA 2RGEA 5J4KA 2ZBEA 3NHRA 5IJ0A 3RKUA 3EXHA 5HQTA 4OP3A 5KJCA 2V7EA 2HA5A 5F5NA 4BCCA 2OFFA 4MYUA 5ALJA 2JDID 4J29A 1H42A 2EZTA 3Q2IA 4N5DA 2QV0A 4OQPA 5LB2A 2RHBA 2TYSB 5JSZB 1UFKA 3OFKA 3W2EA 3HYLA 3CZ9A 3FZNA 5L53A 1RJGA 2XSZA 2Z9BA 2BR5A 3U61B 1R3UA 5BNZA 1QO7A 3FOCA 3SR0A 2OV8A 2OLKA 1W93A 2RGXA 4EFLA 2OCLA 4OY3A 1CQIA 1J56A 3NHWA 2W6ZA 4EHAA 1PGOA 3G5MA 3H5OA 1T2VA 1ZESA 1N9GA 3O8LA 3UPTA 4JXXA 1ZCJA 3UWDA 4BYMA 4KITB 4PPFA 1SK8A 2X4LA 4R6XA 2IEGA 4II2A 3UV3A 3PZBA 4EM6A 1QNFA 2CL5A 3NM6B 1M33A 1PDWA 1SBQA 1ZNZA 3EUFA 4N0QA 1BZYA 2ZI5A 4BJ6A 4ZOAA 2TMGA 2VBFA 2FPXA 3H1GA 4EL0A 2EJVA 4I9FA 4L5CA 1AMUA 1J8VA 2HA7A 3K9NA 5DP2A 2XUFA 2R84A 2GNOA 4MCHA 4YJHA 3GPLA 5F12A 3RIGA 5HG0A 3HWWA 3PXUA 4NPAA 4ZXPA 3EUWA 4YRJA 3U0BA 1CW2B 1UDXA 2ADOA 4H08A 4XJTA 2I4RA 3TPZA 3M4YA 3LDUA 2BFCB 1I2DA 4CDGA 2N1MA 2N47A 3D3EA 4A2CA 1DKNA 2Z2IA 4M8LA 4JKIA 4Y6OA 4KRYA 1EIZA 1H2HA 1G8SA 4TYWA 2UVPB 4KRXA 1DUVG 3SKYA 4B44A 5FDFA 1E98A 1CUCA 1Z7GA 2I1VB 4L3OA 4A0SA 1SBHA 5EZYB 1K8YB 1X74A 1YUBA 4LYHA 4Q66C 3QWAA 5KB3A 4C4TA 4EY4A 3K5HA 4LDQA 4MQLA 3S2SA 1D2HA 1GQYA 2VUUA 5IBQA 3GBPA 3UJNA 2WPDA 3PPIA 4EHJA 5LNK1 2AJ8A 1YIOA 4I5DA 3JR7A 1I5OA 1IVYA 2Q2OA 3SLRA 3ZV3A 4BNGA 3DV0B 2RHGB 1OXBB 3HB7A 1W6RA 2JK0A 3FKJA 1CVRA 1XPJA 2QUHA 1QYRA 3IPCA 1ZSYA 4U39A 4LPSA 1X1RA 1B15A 5BVGA 2V0NA 1J90A 4I0WB 4UZEA 3ZLTA 4DIBA 1F8YA 2XVMA 2EERA 4NE2A 2VDUE 1F6DA 1QF9A 1F12A 5BN4B 5CITA 3GY0A 5JC8A 3IUBA 4Z1OA 1ZG3A 3TI9A 2YJ3A 1TM4E 3L01A 4MGYR 4R6WA 3ZV6A 9LDBA 2I4LA 5CB8A 1IBKB 1GZ7A 4ZVKA 4Q21A 3VOSA 4HUJA 1AS0A 4ZK6A 4PTLA 5LIRA 5EHZA 1RS0A 1P29A 3FDIA 4EELA 4PAQA 2CXUA 1MQ9A 2HCRA 2NXNA 3F49S 3GJ4A 1U9ZA 1UBTS 2ZIGA 2ZYVX 3ZGNA 1TLLA 2PM8A 3LECA 2XT0A 3AHDA 2IZ7A 3TDKA 2I80A 4HPJB 4DCGA 1TMGE 2XZPA 3BMOA 5A02A 5JJLA 1RRVA 2ET6A 4FHDA 2IE0A 4MNTA 2ZSEA 5FH9A 2C7PA 1ZK0A 4WZAA 1DJNA 3T7JA 1KSGA 4K6OA 1N25A 4UNSA 4ZV4A 1OZHA 2ZETA 4KXQA 3UG7A 4WD3A 4XSHA 1JMKC 4AMUA 5BVHA 1XTUA 2OBYA 3ODPA 3S3TA 3FCYA 5HQJA 1P73A 1ZI6A 3HP1A 2W2VA 3IAXA 1T3LA 2ZVPX 3GARA 3LUJA 1BRTA 4W82A 3STHA 2OMKA 1TO2E 5JV5A 2F8TA 1YR6A 3PZRA 3LXUX 4ZYUA 3LXXA 3UB2A 4EKIA 2W8BB 4Q9NA 3QITA 4MR8A 1B23P 3PJGA 1RM5A 2HV8A 3AF5A 2D8AA 3A4VA 3DKVA 4P22A 4TLCA 5BSMA 5C5EA 2HU5A 3H8JA 4OJMX 4P9NA 4HXEB 4M1KA 1X8XA 5ER6A 3LQFA 3RYHB 4D92A 2QG9A 4X00A 2EX4A 2RFLA 4DARA 1AG9A 4PPNA 2J7PA 1BHO1 3N5CA 4M38A 4GMFA 2RGCA 4PRLA 4Q4HA 4QAQA 4DXDA 3DLAA 5BUZA 1G1MA 4NXNB 1ADFA 5AI6A 1SMKA 3BXEA 4OXXA 3M1AA 2QTMA 1IHXA 1JJAA 3D6AA 3I9JA 5JI3E 4PO3X 1QYWA 2EZ8A 2C2GA 2PT7A 1RWWA 2EIXA 3RNLA 4CRWB 5DX1A 5EWLB 4MSUA 1QTNA 1EDDA 2GSWA 2YXEA 4DZZA 1VMAA 1RACA 1ZZEA 2ZYIA 1T6BY 3CINA 3L82B 1FEZA 4HCJA 3K30A 3U3OA 3D7MA 4EENA 1RZRA 5AUOB 2ZJ3A 1ZP6A 4BNTA 2G4VA 3O8QB 4LOLA 3TR6A 4KVGA 3LCCA 1Y4DE 4IHKA 4BMVA 1MC4A 2PY6A 1N3IA 5H82A 1NNEA 1THMA 1DZIA 4L73A 2UYCA 4OXKA 1RI5A 2A1TS 1Y3IA 1LNSA 2I29A 3EZFA 3LBHA 3C3MA 5HUQA 1ST2A 2FGJA 4JEUA 4U02A 3H4MA 1XVVA 2BEJA 3W7AA 2R8YA 5KJFA 3U3KA 1C2TA 1RPAA 3LNCA 3DDZX 4RDCA 5BYBA 3L02A 5IXJA 2HJRA 2QB5A 5LYJF 3INYA 2QT9A 1O0CA 3T3DA 4HDAA 4NG4A 3FMFA 3RABA 1Z68A 4O4LF 1BAPA 1H2XA 2WILA 3T9CA 1WEKA 5BUCA 2H0RA 4ZT4A 3AUKA 4TMFA 1M73E 3MJDA 1KYQA 1I5EA 2QPLA 1TK9A 4RXMA 1H3EA 4YRKA 2C7RA 4NJEA 1H5UA 4M76B 4CMHA 2ZOSA 4ZXFA 4EG1A 1KYWA 4MRMA 3VR5A 4CKYA 3AXTA 1K08A 1JHRA 2I87A 2Q4TA 1XEFA 1DC4A 4JT9A 2ONKA 4TMZA 5E9QA 5GV7A 1OH6A 2AVDA 3ML1A 4WBNA 3IERA 4LNUA 4C07A 2DTDA 1V11B 1AZLA 1E2KA 1M1YB 1ZIXA 3IUEA 1AXEA 3MAJA 4KQGA 4P3YA 3L8EA 4ENQA 3MGAA 2JEOA 3DL0A 3KJNA 2C3OA 3SJZA 3QXCA 4MWOA 1OXUA 1EX7A 1SXGA 2CE7A 2I3ZA 2DM6A 2VRCD 3UFBA 3VZCA 3FOEC 2NGRA 1TIPA 4YJ3A 3LSYA 4BKPA 4CMJA 1AUPA 4WT7A 4ZYXA 2VDOB 3CLRD 1TPZA 3GG2A 4LMBA 3NMUF 1LLUA 3BB4A 1D2MA 4ZQHA 4BECA 3HM9A 4Q9AA 3EC2A 1YACA 4WBNF 2MYPA 1C9DB 3ZI4A 1K63A 2UYHA 4N7RA 5CDUA 5DHPA 2YXDA 5IJ9A 3QLUC 2Q1TA 3HVRA 3T5TA 1XPUA 3IQFA 1JG4A 1E64A 4W8HA 5AHXA 1EUDA 1TM2A 5HILA 4HWOA 5AHWA 5FOQA 3T4XA 3NAZA 4GX2A 5I01A 3L7NA 3IBSA 4RESA 3VZRA 2V58A 3AUJB 5BT9A 6REQB 4XM2A 4RJIA 1LX7A 4KNYA 2JFXA 1EBFA 2O3UA 3ND7A 1N5MA 1XEWY 2M6RA 1RMQA 1EU1A 1MIOB 1YL5A 1NRWA 1XCMA 3PFBA 1G8HA 4B5KA 1J5PA 3M82A 3KJIA 5AKXA 2CKDA 2CUZA 1L1EA 1ULSA 4HQFA 4H7EA 3RIMA 2Q6TA 1PCXA 4HY3A 1Z5ZA 4OHZA 5KDLA 1VE3A 4Y9RA 2XUDA 1A7JA 3ZUPA 4Z3OA 2C61A 1CUBA 1G3QA 3JTMA 3GNSA 2HEGA 3OT4A 5DFAA 3STTA 3TLZA 3WL7A 2OXEA 4ROTA 4AJOA 5HIAA 1F48A 3RAEC 4PV7A 1T5IA 2YY5A 1Z5NA 4WJLA 4X95A 2JAWA 4Z0NA 4BQFA 2FWMX 1C7RA 4MKZA 4UQOA 3ZS9A 2P0EA 3ZWVA 1N3BA 1YZQA 2QKYA 4YJ3B 2A35A 1X7WA 3B12A 4N0MA 3IUNA 4HH3C 1H1DA 1NJSA 2I3DA 2OVBA 3G59A 2D1SA 1BA3A 3KL2A 2D4HA 4YUZA 3PENA 4RJJA 5DHTA 3VH1A 4CTJA 3LBYA 4RLHA 3FWYA 4IWNA 5L95A 1MP0A 1U2TA 2HFJA 3HS3A 4JUAA 3EVGA 4FLMA 1II0A 1ECFA 4LV5B 2Q62A 4KOEC 3OOSA 4CM5A 4ZCSA 1WB9A 2GZRA 4QNMA 4UDYX 1ECJA 2JLXA 1NW7A 3MCTA 1NJ1A 4N0PA 3EMVA 2XEXA 2ODBA 4O2AA 4H1HA 3GFTA 3TNYA 4J3FA 4AI6A 1FLAA 2DFTA 2EV9A 2AJDA 3P9IA 3Q98A 1AS3A 2GH1A 4M22A 4PWZA 4Z86A 2Z6VA 1PL7A 3OQIA 1N8NA 2QZZA 3DFMA 4IGAA 2IOFK 4MITA 1FLNA 2WJJA 4NU8X 3I2YX 4H9GA 3X3HA 4BNUA 4H3HB 4I7EA 4BO3A 1S3IA 2OWDA 1ARZA 3IESA 4Y1FA 4F93B 4MWCA 5K0FA 3VPAA 2DQ4A 1RBQA 3G2KA 4JXKA 3QEBZ 1QTRA 4IVNA 5CJPA 3RS2A 5DVZA 1CUUA 3T5AA 1N1MA 1VB3A 3TQHA 2BDEA 3SMVA 4MO9A 1X1TA 1UBSB 1WSWA 3AFHA 5JAUA 4RVOA 1KIAA 2H5IA 1GUZA 3TLKA 3BQNB 2ZSKA 2N75A 1VI6A 3R2JA 3UCEA 2INGX 4QC2A 4LZZA 1E1RA 1U65A 2R48A 3CLUC 3SJ7A 2AIRA 2EJTA 2IODA 4ZOLB 3GMSA 2BSAA 5EP4A 1YBMA 4ARSA 2ROQA 4NULA 4ABTA 3WGLA 1EFPB 4FFWA 2RHOA 1JR3D 3CH5A 2UZAA 1ECBA 4OL0A 5JC1A 4XWKA 2O5RA 4TYPA 1Z4JA 1Q0RA 4TM7A 1FMFA 1Z12A 3KU1A 1P1FA 3RTBA 1POXA 5DISB 1QP4A 2IS1A 1MORA 1VB5A 3WK9A 4MS1B 3EUEA 1QHYA 2B69A 3MWEB 3R8FA 1FMLA 4CBVA 4OIMA 4ZFNA 1JV2B 3TZ6A 5BNTA 1LPBB 4W6QA 2WVHA 4LXHA 2ZKIA 5FBQB 4L2IA 1O6GA 5THXA 3U7EB 4A2PA 5J4YA 1VMDA 3L6CA 4DLZA 1S7GA 6ADHA 2X2FA 4QUGA 2A5FA 3QLTA 4TWIA 1DRKA 2ATXA 1P2BA 2EYUA 2J9ZB 3GEDA 4XQCA 4DQKA 2DLDA 1Y81A 1C30B 2HF8A 2XUZA 3H05A 3IDOA 3OM0A 3OTHA 3K0AB 3VR0A 2RC5A 3CMMA 3QWBA 3SIXA 1HV8A 1VL8A 3BGIA 3V6LA 1P7CA 4D4HA 2IIBA 4Z9YA 1XZHA 3SDSA 4JZYA 4LBVA 3QY9A 4DJEC 3AVQA 4FFBA 1Y9DA 4IYRA 5CNKA 3IVCA 1OHHD 1E6CA 3U4GA 1I2CA 5GQSA 4LRXA 5KNCA 3AUTA 3LY8A 2O8NA 4HYYA 4R83A 5T8KC 3V3TA 5AW8A 2AUTA 1MC1A 1NXWA 1ZZGA 2CW5A 3QPAA 4LJLA 3NHZA 5DYTA 4ZO9A 5JHGB 1A2KC 5JANA 2WAAA 2V5AA 3FPAA 3UXMA 2J9XB 4ZHQB 1ZUNB 4Y3UA 3GJRA 4OLHA 2QN2A 2EATA 4RM2A 3WC4A 4DLNA 3FCEA 3PJEA 2YV2A 2ZT5A 3HJAA 3JATA 1QQ7A 3O0DA 4Q93A 1N34B 1JIVA 3MB8A 3QKTA 1T26A 2AYYA 4UHJA 2HIGA 5ERXA 5C31A 3TZQA 3UMRA 5CVJA 4IUDS 2DUWA 3GFPA 5JUWA 1RXVA 2GNAA 2J0QA 4UFNA 4PGAA 3WYAA 4C76A 5HDBB 3RHTA 3QVUA 1BGWA 3ZQ6A 4PLGA 1Z4LA 2C2MA 1J8YF 1XKLA 2E4XA 2KSQA 3EQ8A 4H7PA 4R1LA 2DWUA 2J33A 4MR9A 4RORA 2H4FA 3WGZA 1YI1A 5KSYA 3MTBA 1U81A 4G6ZA 3WRXA 3ZX5A 3KKMA 5BUQA 2ALJA 4FBMA 1PJLA 1Z45A 3RODA 1I80A 4BX3A 3NKFA 1E1RD 5IM5A 5LQNA 2VFAA 1EX1A 4WFKA 2OOSA 1HKHA 4FN5A 2FPGA 2GD6A 3OTGA 5ABPA 1XZLA 1SKUA 2CDRA 3CCBA 3JV7A 4L4YA 4XYBA 5L6LB 4WK0B 4BO6A 4ZV9A 2H8GA 4MKGA 3A2KA 5B3AA 3A26A 2O5EA 4DANA 1YS7A 4JQSA 4NZNA 4HNTA 2JFWA 3N0VA 1IZ9A 4N82A 2AMVA 4OHVA 5IC5A 4XIGS 3LQKA 4ZREA 5ESWA 3K73O 4JU9A 3SD7A 4Z4IA 3L9WA 3I30X 2G80A 1Y1KE 2QW8A 2VPZA 4KGVA 1THZA 5LQJA 1PR6A 5IASA 4F4JA 1T91A 1PNOA 5TARA 5TGDA 1PR9A 1U0HC 3EOBI 2SKEA 4G9BA 4UUQA 1ONPA 2EHJA 1ZD5A 3DH0A 3W9UA 1A8IA 3GWGA 5IEJA 3V6MA 4A82A 1U7ZA 4CM6A 2EP5A 3CTPA 3H5RA 1CETA 2B1JA 2ODTX 4FOSA 5AJZA 3VYSB 3WNDA 5AM2A 2QBYA 3AHIA 4I5IA 1I7LA 1U2EA 4LPKA 4YJGB 5DNEA 3G5TA 2HGZA 3KKNA 1X14A 3LGSA 4RSMA 1XKTA 3ESBA 3F9CA 1UIMA 4NYMQ 4QBTA 1T15A 2HU7A 2OT3B 1TA4A 5BP7A 4MGZR 1CG6A 1WOYA 3DBLB 3JYLA 4E5MA 5DCLA 1CC1S 1M7BA 3BH0A 4ZAXA 3ROMA 5JALA 1FP4B 1NT4A 1FSZA 2QYHA 1HE4A 3HNOA 1Y80A 5JEEA 1FLVA 2QW1A 4D8YA 1JFRA 5HRAA 5L4NA 3WBFA 5CW1A 3C70A 1ZUIA 3PLRA 5L3VA 2O4CA 4GKBA 3ADKA 3H83A 1SXPA 3ANNA 4H17A 3T8YA 2X41A 3W2IA 4C0BA 4UNNA 5IAJA 4JVLA 3G02A 3DNFA 1ISHA 1C9KA 1HT0A 2PGAA 3GUHA 4GUDA 1Q0PA 4IFIA 2W4MA 3OE1A 3C3JA 4M37A 4QXOA 3BORA 3OJFA 2PH3A 4MVJD 1EXDA 2QTCA 2F1RA 3CF4G 5E3JA 5BORA 5K8IA 4FW9A 1XMOB 1U4NA 3ZHTA 2GFHA 1A50B 3DFFA 1P60A 2VOEA 3LWZA 3UOAB 2A1TR 1MGPA 2DH5A 3ZCTA 4K87A 4GDMA 1Z0ZA 2C4KA 2RI0A 1YQGA 2A4KA 1CD5A 5JTTA 1N2OA 1EVZA 5JAPA 3R7BA 3OE7D 4G0OA 4I08A 4PZEA 2NTNA 5HSGA 4RD3A 4KBFA 2Y92A 2VCHA 3MAGA 4PVDA 2CHUA 1N7GA 4LHZA 5HMLA 1Q50A 3EVNA 2FN7A 4QGSA 4YAKA 3TGLA 5AKGA 1ZUHA 1Z4PX 5TNXA 1ZYUA 2WU0A 4LSGA 4FFMA 3WFJA 2NXWA 3Q3IA 1UC4B 2OCGA 3AJRA 5I9MA 4DCMA 4MW5A 3KVRA 3CEAA 3JQ9C 5G0UA 1HE1C 1JIXA 1NU8A 5TMDA 3LW8A 1HNWB 4R31A 1JU3A 1Y6QA 4OJTA 2Q99A 2ZANA 1O58A 5E6RB 4YRNA 2B1IA 3RC9A 3SDZA 2YFYA 1SKAA 5H70A 3OOEA 1Y1PA 4HNSA 3O03A 5DT2A 2M6KA 3K32A 1MRZA 3IUPA 4LF5B 1XSEA 3V4LA 2WQ7A 1EG2A 1Y9EA 3ED1A 3SEAA 1KH1A 3HDVA 1FQWA 1WG8A 2R1TB 4IJVA 3MM4A 3K1AB 3WLTA 3BUSA 7MDHA 1JEYB 3TAUA 1JWAB 2FLKA 4BVBA 2R6GA 3QFFA 4UUAA 5JPCA 3MC1A 3V1YA 3H97A 1PJ4A 3NEPX 2ZSUA 4OV6B 1NN1A 2PSDA 4IIJA 3EXAA 4MQBA 4FHZA 5KNDA 3PQCA 5AUQA 2XNKA 4M1WA 3DZ8A 1AGXA 1N2XA 1R2QA 5FWYB 4OFZA 4D3SA 1U0BB 2BFCA 2V7PA 3BIWA 4LDNA 5F9MA 3SIWA 3OECA 1P0IA 4UMFA 4RPCA 1E9CA 4C87A 4WACA 2JJ2A 2QL9A 2NZYA 2OLJA 2D1FA 3KUXA 3LU1A 5DEOA 3O21A 4I8DA 2NPOA 1RC1A 3DKPA 3PT9A 2AWOA 1TT7A 5KMGB 2O8VA 3QVMA 1P72A 5DWVA 2QTLA 3QE4A 2C92A 4C3VA 1T2UA 5J1SB 2P35A 3IAM6 1CHDA 3QTBA 5P21A 3UAXA 1QRDA 1JBEA 4FZRA 2OK8A 4JUFA 4NAUA 4XASA 3LGAA 1NMXA 2HC9A 3V8RA 4Y0NA 4B83A 1J0CA 4YMSA 2XXAB 5KVVA 2CYCA 2WPNA 3MCVA 4KIFA 3RVNA 4DC1A 4B75A 4DXAA 1W581 1VZ2A 3EDCA 3KWLA 3JWHA 4EZIA 1RLOA 3L4EA 5EJAA 4XR9A 3CW2A 1CNMA 2AS0A 2Y2UA 4AZ3A 3L0BA 2GYWA 2O0KA 3F3MA 3QNMA 4NZYA 1QANA 3D6VA 4O29A 1K68A 2HA4A 4KQFA 3DBHA 1HFWA 2OORA 4X1YA 1WF6A 3AKCA 4QOFA 1P0FA 1YGPA 5TMEA 4MW2A 4FJ0A 3CXRA 1IXYA 2X6RA 1GYQA 4PYLA 1OZAA 3BKXA 1X80A 4IIJB 4KSCA 1O6ZA 3DZIA 3FB4A 4JJ7A 3DOJA 4XOUA 4PZ0A 3WK4A 4EBBA 3LTNC 2IUUA 1U0SY 3U1TA 2VJBA 4GYWA 4MS4B 2HSDA 1YZUA 2E0IA 3I52A 4X64B 3C4QA 4EHBA 4LFCB 3L1HA 1Y9ZA 3V8EA 1M74A 5K8VA 3T0IA 3QBJA 3DDSA 3HB9A 3SGLA 2CHQA 1EE1A 3LPMA 3HUFA 1VA5A 5AI9A 2RGGA 2XLBA 3NDPA 4O4JF 4Y2GA 3EBLA 2GSDA 4M83A 2WKSA 4DLAA 2ZVDA 4FZVA 4AURA 3DD5A 2ZJ8A 3HBJA 2NUBA 2ZJ0A 4JP2A 1DKRA 2H2FA 3UB3A 4ISBA 3G8CA 3M49A 3PE4A 4PC3A 5J2UA 4KK3A 5DM1A 4Q16A 1ZA2A 3CN7A 5JS2A 1HZJA 1YS9A 2YZ7A 4XIIA 2XMBA 2DPLA 4LTDA 2GXQA 2OV2A 3EQ7A 1EA7A 2HMSA 1FS6A 4O1HA 3BA6A 4GL2A 3D6FA 4OL9A 4J2TA 3VR6A 4CIBA 1YOVB 4RFSA 2XAAA 3Q2OA 3BIXA 1E61A 1P9NA 1REQA 1LVUA 4H1TA 3D4OA 4NOKA 3K4PA 1D3AA 1EP3B 2WZDA 4D46A 5DIFA 2A94A 2CMHA 4GNRA 4KKVA 3ZNQA 1A77A 3AJDA 2JS7A 3UJHA 2CMFA 1XRJA 3WXMA 4IXMA 5I47A 3ELYA 5BW4A 5THKA 3FM9A 1PWEA 3JU3A 4BATA 1VHQA 2ZROA 1EBUA 4KEAA 1E2LA 3E7FA 3Q1KA 3ZCRA 3WKEA 3WYBA 2X5OA 1I4LD 2N42A 4M0MA 3B2QA 3MS7A 3WRVA 4ZEVA 2JIPA 4PANA 1P1IA 4YP6A 1KY4A 1M6NA 1JG6A 3FH0A 3R5HA 3OPXA 1NULA 5I4CA 3GZJA 1DXOA 3IBCA 4M0LA 1EB8A 5IC4A 5FWXA 3JD0A 3I0ZA 4AY2A 1UMBA 1N2JA 2RI6A 2IWRA 1NF8A 2I8CA 4TM8A 3S44A 3WBKA 2JJ1D 2QK4A 3PA6A 3I3OA 1XZPA 3UAGA 1N75A 4EB3A 4BDSA 5E2BA 1ZOSA 1BC5A 4GPAA 1SC4A 1RJFA 3SZMA 4JJAA 2B37A 2W6JD 3N7AA 5JBQA 3VMMA 3U16A 3DW1X 2RK3A 2OO5C 4QFDA 1XTZA 2PVPA 1UJNA 1GD1O 1M54A 1YFKA 2Y66A 4U2BA 5IDXA 3C3XA 3H1TA 3O2SB 4HGQA 3WYDA 4QDTA 3BF7A 2KQUA 1PLLA 3I6QA 2VPWA 1OI7A 3ZU3A 4E2XA 5TT0A 3FPLA 4PG7A 2P5UA 3N6VA 4KQWA 1UKAA 3AY6A 1WCIB 4NL4H 3DV9A 3NB0A 1N2HA 4GGOA 3E9MA 4PG5A 3THRA 2YWDA 1WETA 4B73A 4YP5A 5KYUB 4MKHA 1RYZA 3OTQA 3G2QA 4OAQA 1GCOA 3K53A 2IQIA 1E7QA 3NATA 2EF1A 2PX8A 4L4SA 4ND3A 1S6YA 2B78A 1JMVA 3KZOA 3MMPA 3HWRA 1AZWA 2BFBA 1V1RA 4GXQA 3SZOA 1PYGA 1U8YA 3FCSB 2IPXA 5IT9A 1EDBA 4KAFA 3UK7A 1WBBA 3RJZA 1W9HA 1C4KA 1XYVA 1WUKS 2QG6A 3RUDA 3ZDDA 3FTNA 1QE5A 1FNSA 1B3BA 3IODA 4DLUA 3T94A 1F2TA 1R4ZA 2AB0A 4X8OA 1HR0B 1U28C 1HK7A 1SC6A 3O8OA 3JQAA 3DHWC 3E7XA 1K75A 3KETA 1JW9B 3AVPA 1X1QA 3RBVA 4HGOA 2AX3A 1SCIA 4A6EA 1L5KA 4Y0VA 3O3MB 1A71A 1OAOA 2O52A 3H5AA 4GRIA 2O0HA 4YACA 3U17A 1JQEA 5FI3A 4JASB 3TMAA 3R5FA 3TSCA 4UEQA 2VDWB 4NU0A 1GFWA 3SX0A 3G1UA 1GNPA 3L6OO 2WD7A 1ZGGA 2FN4A 2J3EA 5SYNA 3ZDXB 2CT8A 3LV8A 4UPDA 4MYCA 1ID8A 5CT5A 1C7ZA 3UAVA 3SK0A 1W2GA 2XA9A 1QZXA 3E22A 1C2YA 3K0FB 2VJAA 4YK7A 4BIIA 5MN6A 3F47A 4HMPA 4PU0A 2ICAA 2VAMA 5B6PA 5IT5A 2CYBA 4C21A 1ZH4A 3PNPA 3AQ4A 3CX8A 1GZVA 5L3RA 4NYJR 1SZCA 3X44A 1R74A 2VBCA 2X15A 1JXOA 5G4KB 4A5OA 3KT6A 5LNK6 2D5AA 2GZ1A 3A28A 2O2ZA 2Q5LA 3BXFA 2PO7A 4MVJP 5EFOA 3UZUA 5EZQA 4YV7A 4K9KA 1LQUA 5IWAB 6REQA 2F17A 1PVVA 4PO8A 2G5CA 2Z58A 1MAAA 2BFBB 2G1JA 2SKCA 5AM1A 4IFBA 3UUWA 5KVSA 2AZXA 3ZDRA 1ENPA 1MIOA 5BV1A 2RBGA 2VHXA 4F12A 2WFAA 1WHTB 1XWWA 2KPOA 3BE6A 4Y6PA 3GI1A 3CF2A 1UBGA 3O1HB 4ZANA 1FVXA 1ML3A 1QYDA 2A30A 3A05A 3A1UA 3AY7A 3JYOA 4FILA 1ORTA 3GLKA 1BDHA 2CL0X 3F6SA 3I39X 3PE3A 3U4AA 3BFKA 5A6SB 2WFZA 1Y4UA 2YOHA 4F38A 3OJ0A 1I7DA 1CY0A 2VBIA 2XHZA 4CKEB 1E94E 2Y99A 1BOOA 2X9LA 1A9PA 3F0TA 3A9WA 2AJLI 2WRZA 4GPIB 4K2HA 2XA2A 4W7IA 4QLBA 1M72A 1QWSA 4J0IA 3D6JA 4KACA 3ZXSA 1TGVA 3AKZA 4RHXA 1VJGA 1EX9A 3FCXA 5CB6A 2CXTA 4J3NA 3QEAZ 1UBRS 4YAEA 1RI2A 1YS2X 4LOAA 2BZSA 3K0CA 3DTYA 4LF6B 3S2EA 4HEA6 4OYHA 1W5TA 1D5WA 1NWCA 2WWVD 5B1SA 2VAVA 2ZXUA 4Z7JA 1SEVA 4NYJQ 3RWOA 1Z0UA 2G17A 3TPCA 3COJA 2AW5A 3GFGA 3U0VA 1GKUB 2EP7A 2YQ4A 1RQ2A 1DKQA 3VDMA 1UMDB 1Z6PA 4JL8A 4WDQA 4P2GA 2Q6LA 1IDOA 3JXEA 1X9GA 1WMAA 4WA7A 1DIGA 2CDBA 3IB3A 3UPDA 4BQRA 1GV1A 3AG5A 1T9GR 1WABA 2W5UA 4D8WA 4CF5A 1XMIA 1KPGA 1XTKA 4LRWA 3IBGA 3P45A 3TQQA 3WK7A 3EDYA 1VJ1A 5MF6A 3C45A 4CIXA 3GLHE 1KSFX 1W5BA 4DV5B 3SFVA 1G7SA 4DRXA 5K01A 1PR0A 3ZK9A 1E2GA 3HXMA 2HUPA 1XCOA 5A4JA 3OD5A 2LKDA 1GL3A 3KDAA 1CF9A 1M1YA 2PU5A 2VCYA 1L7OA 1VYTA 1RQGA 2OM2A 1PG5A 2Z4RA 3DCIA 1XZDA 2C3MA 4Q7LA 4AXBA 5KOJB 5DNVA 1T35A 3Q88A 3IKJA 2NZJA 2R8PA 4ZEXA 2H06A 4HL6A 4I1YA 4AF7A 4DLPA 2XNDA 2JIMA 1G7CA 4X1IB 3MOIA 3MWDA 1PEKE 4EQ6B 1PQWA 1N78A 5BMVA 3LCUA 2C9BA 2Y1WA 5KUTA 4IS3A 4BAZA 1WPRA 1E4EB 1CU1A 1F2DA 4BLQA 2Y8EA 4C0SA 1QGED 1NRJB 4IIVA 5JLJA 5J3JA 1H4TA 4KDRA 1B6GA 5DO9A 2WLSA 3NBXX 2JH3A 5KTOA 1GSIA 4QEZA 1KI9A 3PX3A 3BAZA 3L77A 1DNPA 3JQ7A 1J2YA 4WKGA 5B58T 3K94A 2ZSAA 5HNKA 1RQNA 5F2KA 2J6HA 1RXSA 3MWEA 4RH1A 1L1QA 5GAJA 4FYHA 3U3RA 4JCCA 1KO5A 3UJAA 4R0NA 3D4LA 1C3LA 1Y89A 2BEUA 1G9TA 3OEEA 4AQYB 3V42A 2FB9A 1SXHA 2OUKA 3WZMA 4CTMA 2MINA 4PR3A 3SYMA 1NVUQ 1OFGA 1IEXA 3QEMB 3G3EA 3ETHA 3MF4A 1H8ED 3MW8A 2WDZA 3OPMA 4CQMD 4EGAA 1G63A 2XQIA 2SHKA 4K6CA 1NATA 1P80A 1UFQA 4YJ2F 3TFQA 1H23A 5CFRA 4KX3A 1Q15A 2PWPA 4WZAB 2ZK7A 1M8KA 2GCGA 1IK6A 3VR3D 3FFXA 4D6YA 3KB6A 4FDLA 4FGSA 1KK1A 4B87A 1CY7A 1T0PA 2QY9A 5BVHB 4OLBA 1NX9A 3GELA 1O94D 1SD5A 2H17A 2WHPA 3EZ6A 4FGLA 1N5LA 3H7IA 1CEYA 1RT9A 4HDKA 5I7EA 5EJFA 1QK5A 4PYQA 5EIFA 1IAVA 4I5EA 4BBPA 3K09A 4JY7A 5KWVA 4Y30A 1J42A 4JOBA 1GNRA 2R7AA 4UMVA 4NARA 3SFTA 2CXNA 2H5