2WAXA

Structure of the human ddx6 c-terminal domain in complex with an edc3- fdf peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
161
Chain Sequence
b'GVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-DEPENDENT RNA HELICASE DDX6
publication title Structural Basis for the Mutually Exclusive Anchoring of P Body Components Edc3 and Tral to the Dead Box Protein Ddx6/Me31B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 161
sequence length 166
chains with identical sequence C
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2waxA00
3QXSA 2ZJBA 4ESHA 5EXSA 4HZIA 3BAFA 1RRFA 4WXPA 3KKPA 2YOFA 2YV5A 2BJVA 2ZRBA 3F5FA 4QFMA 4LHXA 4QXAA 4RFVA 2CLCX 1GDDA 1XDBA 1W48A 1ZD1A 4M1WA 2ZM5A 1I2MA 4A36A 1Z0FA 4QRHA 1XPUA 4ASUA 3SYNA 2IF0A 4IRUB 1ONBA 3H1TA 4PC6A 4I1OA 1ETUA 3I1FA 5FI0B 5D3MA 3LRPA 3EZ9A 2IXGA 3CPHA 3CM0A 2VHCA 1MRNA 1W49A 5JI2E 1Z2CA 1SKYB 1RW4A 2XZOA 1TPZA 2REOA 1X86B 5DNYB 2WOJA 3KKQA 4JVMA 1LS6A 621PA 1PLKA 1UBCA 1UF9A 4M4SA 3U7FB 1CR0A 5L3SB 2PCJA 4TTPA 3B85A 3S1AA 4XOIA 5BYKA 1P2UA 1F5NA 3KJGA 1KSGA 3UANA 4BZPA 1OH8A 2CJWA 2OSBA 3ZLJA 3A1SA 3VR3A 4BLOA 3LDAA 4UNPA 4HB0A 4A6XA 3MD0A 3BFXA 4IDQA 4PAMA 3BRWD 4TQ9A 3JVUA 4V0LA 2V6JA 2NO0A 2WZQA 3RHFA 1EFHA 3HWSA 3SFZA 2Q6TA 1CKEA 3NDBB 1EX7A 1KIMA 2GJKA 2OO7A 2ZSEA 1IY0A 2EW1A 3HYRA 2JLWA 1NL3A 4RFSA 3L0IB 4HUTA 1ZNZA 3SR0A 2FSFA 2XB4A 1OHHD 3QVUA 2GHIA 1JALA 4KXFB 3UG7A 3L0PA 3CW2A 4FCWA 2OBNA 1E2NA 3T5GA 1U9IA 4G5QA 1LFDB 5JRJA 1PVOA 1YVDA 1C1YA 1S1CA 2C5LA 3HDTA 1N2CE 2JIZD 4B6EA 1AKEA 2DCUA 4NPHA 2D74A 3WBJA 2ERXA 1IAQA 1GP2A 2X77A 4V03A 1IJEA 1W1WA 3VHXA 2JJ2D 2DB3A 3FWYA 2BMFA 5HTKA 4BFSA 3AVYA 3BFVA 4Z8XA 3ZIAA 3GLHA 3ZYCA 3QBTA 4GNKA 5FBRB 1GNQA 3V9PA 4YLGA 3ZVNA 4BE7B 2IC5A 4JZKA 1YU9A 2PX0A 4KV9A 2OM2A 1G3IA 1JXMA 2WTUA 4DB2A 3LVRE 1JAIA 1JXOA 2F43B 3B7GA 1OIWA 1JR3E 3NEJA 4MYUA 3REGA 2AK3A 1SVKA 2D06A 5LBIA 1IXRC 2AD5A 3LAWA 3QNUA 1ZUIA 4B35A 2RH5A 1NN5A 1X1SA 2N1BA 3IBYA 3UWKA 1YR6A 4B44A 2ZJAA 5J4YA 2XB2A 1GG2A 4JYBA 3TUJC 3VTKA 5M04A 1E2HA 3GJ3A 1LS1A 1T3HA 3B78A 1ZINA 2B7BA 4E03A 2WMNB 4Q9IA 2K5UA 3DOEA 3OIYA 4DWJA 1KNXA 4B2LA 1G5TA 3EPLA 4TLCA 4JMPA 3Q9LA 2WWXA 2HF9A 2CBZA 4NCIA 5SZIA 2ZE8A 4LJ8A 2OBLA 5K8LA 3QKRA 3BB1A 3K70C 1UJ2A 3GEIA 1LF5A 1SXJE 4PSVA 3OIVA 4KFUA 5L3SA 4ZI3A 4B3DA 5G40A 3LFUA 3P26A 4A8JC 1LB1B 1FTSA 1EG7A 1FL9A 1EWRA 1QG2A 4DLZA 2F1IA 2PBRA 3SU8A 4GZLA 1L8QA 1E98A 1TMKA 2BEKA 2QMUA 3C4JA 3DZ8A 1XTKA 1YR9A 4DB4A 1Q20A 4IXMA 4LPKA 4JJZA 1G8YA 2QMOA 3RDPA 2ASEA 2R62A 4FMCF 2WOOA 1J70A 2C78A 4HAYA 4B2PA 5C18A 2IX3A 4LZZA 3LH5A 3B5JA 4B3XA 1IY1A 1Z6GA 2G3YA 3BC1A 3K09A 4P4UA 2ZJOA 3NBFA 1P75A 4WA7A 2W2XA 3MWLA 2IYRA 2FOLA 4U7DA 2X1VA 4URXR 4G01B 421PA 4EJSC 3THWB 2RGBA 3Q3JB 4A15A 4Q1CA 3TAHA 1Q1QA 1KZ7B 5KNBA 4GL2A 2ZI9A 3AKCA 3DMNA 2OT3B 4OHVA 3X1YA 1IN7A 1DOAA 4GP6A 4OI2A 4NCHA 1FQKA 2C96A 2IYQA 4PZZA 2W6JD 1SKQA 2YOGA 2C8VA 5HZKA 3F8TA 3LW7A 4JBWA 3IIKA 2I1VB 3SEAA 1YE8A 3GLIA 1H8HD 1F2TA 5P21A 1CJVC 3LLUA 1D6JA 1U2RA 4Z1MA 1GNRA 3BH6A 3FHTA 4YONB 3IIMA 4ITRC 2BWJA 4B2IA 1O3YA 1EESA 2ZITA 4N1AA 2QQ0A 3K53A 2O8DB 2FWRA 3FOZA 5BQ5A 4PX9A 1ZNXA 3U3RA 4CZ2A 1HV8A 4M2LA 2VL7A 5AJWA 4DXAA 1E99A 2F43A 4TZ0A 1E2EA 2FSHA 4D0GA 1ZVQA 1PLLA 2OG2A 1W0KA 2QZ4A 4TL7A 4EPYA 3Q5DA 2IUUA 1GSIA 3BH0A 1QHYA 3NBXX 3AKYA 4MRNA 4A0GA 4DDVA 1G3MA 1XJ0A 2VF8A 1SXJB 1MR3F 4MKHA 4B3FX 4DCUA 2IS2A 5JHHB 1KAGA 4HAVA 1ZMXA 2ERYA 2YWEA 4EKDA 5LDDC 1RIFA 1OKKD 2RKOA 1EWQA 4A4DA 4DCNA 3U7HB 5EP3A 4ZCLA 1XBTA 2PLRA 1CBUA 2N46A 3HPRA 3TKLA 4DBLC 3MCAA 2HCJB 1DAKA 3KTAA 2GZAA 3Q85A 2OE2A 2R6FA 1GIAA 3GJ7A 1GL6A 1LTQA 2ODWA 1TAGA 5HE9A 3QXJA 1U8AA 3OEHD 4HAZA 2HT6A 2CNWD 1H8ED 1E94E 4TL8A 2I4IA 1VYUA 3KB1A 3QBVA 2C2HA 3DKPA 2QTHA 3SJCA 1NLZA 2VPPA 3QKTA 2G77B 1MKYA 4Q48A 4IEIA 1G7CA 5CJPA 1OXUA 1M7BA 2BOVA 2R44A 5SZKB 2WWWA 5DLQC 3L82B 1A2BA 1AM4D 1NBMD 3NWJA 3NHAA 3QY0A 3U3OA 2VRWA 1E1RD 1U0HC 1AS2A 5FR2A 4DSNA 1P3JA 1J99A 4F93B 3R20A 2RAPA 2O52A 2CHVA 2IYSA 1OHHA 2L0XA 4HZUA 4JL6A 1VIAA 4KFTA 4NHOA 2PZEA 4UJ5A 4B33A 5KDOA 1Q1ZA 3T1OA 4HLUC 1ZNYA 2XX3A 4MGIR 4C0AC 4IOKA 3WHKA 5HR5A 1W4BA 5J5CA 3WXMA 3CX6A 1CIPA 4HB4A 2O0JA 3SYKA 1K8RA 4D4KA 1KI6A 2NO6A 2JIZA 2OAP1 3LD9A 5AWFC 2P0EA 2D2EA 1SULA 5F98A 4ZDIA 3LQQA 4HB2A 4QJ3A 4JLBA 2GVZC 2BC9A 2XTNA 2B8TA 4RSGA 3RABA 3UWOA 4PO1A 2O8FA 3X1DA 1ELOA 3NHBA 2PMDA 2RGCA 3I4LA 1GITA 4CIDA 1Q12A 1G8FA 1UBGA 2F1JA 1WB9A 4YXWD 4JSYA 4LBZA 2C9CA 2IEYA 4EIWA 4RZUA 4WVFA 1W44A 4TMXA 1TUEA 4G0NA 4NONA 1NP6A 5EXXA 4C4PA 5FOSA 1RZ3A 1GILA 3W34A 1KSHA 3DVLA 3ZZUA 1E4VA 3VR6A 5CM9C 1UKYA 4QBFA 1E2GA 1BS1A 4TTQA 1M8PA 3THXA 3AF0A 1VTKA 1P2SA 4OQXA 3FHOA 3K9GA 3MFYA 1X8JA 4ON9A 3VX3A 3PV0A 1N6RA 1GL9B 2RGNA 3KX2A 4YMSA 1OFHA 2QORA 2YYZA 5LPNA 1VIYA 1YZGA 1Z28A 4CRWB 1S4QA 3AQ4A 2J59A 2FPMA 5EP4A 1UBEA 4WOPA 5TXGA 4RZXA 3AVWA 4I4LA 4PZYA 2B6HA 5A0FA 4DVGA 3GJXC 3OESA 2OCYC 1AJEA 2ZRHA 4PPGA 1EX6A 3U44A 2RGEA 4LRWA 1FNMA 1ZJ6A 1YQTA 3LV8A 1R6BX 3AVPA 1M34E 5H68A 2WJHA 2XNDD 5JI3E 5J4LA 3H84A 1QZXA 3IDQA 2QAGB 3MSXA 3MGCA 3OFNA 4LBWA 4PHFA 2OFWA 4MA4A 1Z0KA 2P6UA 4Q9LA 5F3WB 3W6NA 4H1VA 4TTRA 1SVLA 1UKEA 2ODNA 3TLXA 1GVNB 1Q1BA 5EZ6B 3JVVA 2ZRNA 3T34A 1P6XA 3AGQA 5FTKA 1XNJA 3T12A 1DE0A 5L3RA 1W5TA 4TLEA 2P6NA 1XX6A 3U6KA 5CLLA 1XRJA 3LX8A 4PHHA 4QHYA 1MO4A 1WCV1 4S35A 3A37A 3TR5A 3PIRA 1Z0AA 4GFDA 3A1UA 1NVVR 1G20E 2KBFA 4V02A 2W6JA 3BD9A 3PFIA 2KSQA 4YMTA 3GQBA 4OQNA 3BXZA 4BUJA 4LJ9A 5HZHA 1UKVY 3WRXC 3LW8A 2OUKA 3O8BA 4US1R 1KK3A 3GFPA 1G6HA 2ZSDA 4JBYA 1H8HA 4TSFD 3H4MA 1A1VA 2GCNA 4P33A 1Z5ZA 5FL7A 4AI6A 3VFDA 4D26A 3ZZTA 4LHYA 3SN6A 1II9A 2G0NA 4JLOA 3LX5A 1U98A 4TYNA 4ZO4A 2V1XA 4LJYA 2IHYA 4CEIA 4M22A 2F9LA 2H17A 2VH5R 3K9NA 1QVRA 3LBHA 3Q7PA 1R7RA 4Q1EA 4UXHA 1UFQA 3C41J 1E79D 4CDGA 3AGPA 4M9ZA 1QF9A 1XCGB 3UMSA 3T15A 4URVR 3C5HA 4EPRA 2PX3A 2WJIA 1Z6AA 4JLDA 4HAWA 1N0UA 1OKKA 5E4FA 2XEXA 3T06B 5DISB 3WY9A 4OHYA 1QHHB 1JPNA 2IWRA 4PQFA 3EARA 3PXGA 5G53C 3QG5A 3EAQA 3TAUA 1AS0A 4DKXA 4QBHA 1TEVA 2V55B 4HAXA 1KDRA 1KYIA 3UATA 3IILA 5BN5A 4OHXA 2A5JA 5DE3A 3RRYA 2FPLA 1OB2A 3OEHA 4JKYA 5FOVA 5F2EA 2PCLA 2E1RA 1E9AA 3SC3A 1DO2A 3DMDA 1YZNA 2CNWA 1H8EA 1X8KA 1CEEA 5JS8A 3UKDA 1DBSA 4JLKA 4X8HA 5F9FA 5GADl 1YHNA 2FH5B 1JBKA 4PPFA 3WNDA 1KI1A 1W46A 3MUFA 4F4IA 3SNHA 3W6OA 4PTLA 2NO9A 2GWHA 2ZRFA 3TVTA 1KY3A 2ATVA 2QAGA 3QPVA 1DEKA 2FU5C 4P4TA 2NZJA 1E1RA 4D2IA 3VR1A 1XEWY 3ND8A 2BKEA 4PO8A 5LB2A 2J0QA 2MSCB 3TH5A 4D6PA 2JATA 1IJFA 1FQJA 1SZPA 3B8HA 4XD7D 3QI2A 3U7EB 4HLCA 4LV6A 4OL0A 2FDCA 5CM8B 3A36A 5FPHA 3ADKA 4NYMR 1M1YE 3Q8XB 3EIEA 1XMSA 2YOHA 2YWFA 3D8BA 2NTYC 5TB5A 3VR4A 4H1UA 4FWIB 3SFVA 2HDNB 3EW9A 1IN4A 3BFKA 1OW3B 3KKMA 4DIEA 2W58A 4KODA 1BH2A 1MO6A 3I5XA 5D3MB 3VR2A 2CCKA 1DTSA 1DPFA 2J7PA 1NVVQ 2PT5A 2R6CA 4WW0A 4MUBA 2J7KA 4QNRA 3IUYA 3MRSA 5DH9A 1KO8A 1XD9A 4YXWA 2H8KA 2QM8A 4JSTA 4LY6A 2GK7A 1XZPA 2ZI4A 1NKSA 4XTCS 1E0KA 2CJWB 2OESA 4Y0AA 4BWYA 4QG7A 1E2LA 3HPQA 3RC8A 1KOFA 1ZU5A 1EFTA 4JKIA 3MJRA 1AS3A 4KHZA 5JEEA 1J8YF 4AG6A 2CVFA 4J0QA 4LC0A 2FSIA 4LI0A 1OH6A 3LBNA 1HEIA 3Q5EA 4Q4JA 4Q7LA 4G5RA 3I92A 2BCJQ 3BERA 3V00A 2HUPA 2QSYA 1FW6A 1TU3A 1GM5A 3QKUA 1W5SA 2AD1A 4AKHA 2B7CA 2AWOA 1NI3A 1F3OA 1F2UB 4EAQA 2JGNA 2AKYA 2C98A 2QGNA 4CT5A 1W4AA 4O2RA 4DCSA 1ZM4A 5JWOA 4K81B 1E9SA 1PLJA 3BK7A 1YRAA 5KPJA 1JQJC 5KOYA 4LJ4A 4TMTA 1A2KC 3ZS9A 2I3BA 1X1RA 4PXAA 4BLQA 1GZSA 2GILA 2ODEA 5IDVA 3RAPR 1W36C 4B3CA 2XNDA 3QVVA 4B48A 4W5HA 4TZ6A 2R6AA 3WRYC 1P9NA 2Q3FA 4ZCMA 1NVUQ 4XTRA 3HYTA 1N5LA 1JI0A 2LKDA 2ZAMA 2BM0A 4ZIRA 2ZEJA 3RS3A 3T1TA 2QPAA 2QL6A 4IVPA 4FI3C 4M1YA 4MKGA 4OJKA 2QP9X 1UDXA 4KBGA 1WMSA 3OIUA 5BWMA 1CRPA 4A0RA 2FMXA 4JS0A 2FA9A 4LYHA 3RS7A 3CPJB 4G5SA 2RHMA 4PR0A 5K8UA 3QF4A 3K70D 1NN1A 3CWQA 3FKSD 4FINA 4JL5A 4OK6A 2O8BA 5D3QA 4BEBA 4H9GA 4HDCA 4NYMQ 1NN0A 4D4JA 3QXCA 4C0HA 1WA5A 1WBDA 2B92A 4US0R 2Q21A 4IOMA 1CU1A 3GEEA 3OEED 4TSFA 1CTQA 3KXLA 2GJ8A 2WICA 3NH9A 4GP7A 1M6NA 3NG1A 4Q02A 1DADA 5TDHA 3SBEA 3QKRB 2V54A 5GJCA 5CLQA 1UKZA 2PMKA 5AJXA 3CBQA 3HP1A 4QL3A 3W90A 2GXSA 1SVMA 5CB6A 2OILA 1XTRA 2QP4A 4UNNA 2LKCA 2C04A 4F91B 2ZXUA 1G21E 1KJZA 1FTNA 4Q1BA 5A5GA 1Z83A 4C0BA 3WMFA 3DEFA 1AKYA 1UADA 1XP8A 1PZNA 5KSYA 1D5CA 3O8RA 2O8CA 2ZSBA 1J8MF 3CZPA 1JEDA 5FBWB 2NO7A 3ASZA 2GAOA 1GKUB 3EG5A 5KU1A 2R2AA 4IFEA 4B3GA 4F7WA 3U4QA 1BKDR 1XTJA 1KK2A 2O0HA 3U3KA 3GEHA 3RS2A 2OV2A 4TMVA 4AYXA 2DYKA 5FPSA 3AF1A 3AM1A 1JPJA 2ZSFA 1OFTA 2GAAA 2HV8A 3GFOA 2QN6A 1WRBA 1F2UA 3Q72A 1N6KA 4IOJA 1P9RA 2NPIA 1VHTA 3LWNA 1OXXK 1M7GA 2CK3D 2IYZA 2J46A 2RMKA 3T61A 2XTZA 4DSUA 2ZJ2A 3SZRA 2H18A 2ZRPA 4RD1A 1X6VA 1T0JB 3NH6A 1GRQA 2ZRMA 2CLSA 2UZIR 3IO5A 4RD3A 3K0EA 4GOXA 2PH1A 3GLIB 3DZDA 4NBSA 1F2TB 1D2NA 5GJBA 2CCJA 3QPWA 1NVXQ 3PEWA 2XAUA 4GBMA 1DARA 2OBMA 5CIQA 5JSZB 2NIPA 2OXCA 3AUXA 3QXXA 4BFUA 1Q0UA 3CF2A 4EFLA 4LSGA 2QAJA 3BWDD 4XWKA 4V0NA 4JLVA 4HAUA 2W00A 3MAAC 4I81A 3BJIC 5GVSA 3WNCA 1W0JA 2G88A 1RYFA 4XD7A 2GJAA 1FP7A 1I4TD 2OCAA 1XB2A 3O8DA 3RSLA 4BQSA 2AK2A 4TLAA 1CR2A 4M1OA 1Q57A 2DHRA 3U3MA 3N5CA 2ZJYA 3VKHA 4LJ6A 1S3SA 4IVRA 1XTQA 2CEAA 2CE2X 2ZE6A 1TEXA 3K0SA 4W5WA 1Q44A 3CWZA 4WIAA 1CJMA 1EFRD 1LV7A 2IYUA 4M0LA 2WKRA 3U6BA 1NN3A 4DEYA 1G5PA 2WJGA 3CR8A 3RRNA 3LNCA 4C30A 5FPYA 4NYJR 3KXIA 3JZAA 1P60A 1FNNA 2PJZA 3KTAB 3SQXA 1SVSA 3IPYA 3MWJA 4URYR 4P32A 2ZR0A 3FPAA 2D7DA 1QVAA 4DT1A 3NVAA 3OF5A 2A9KA 5CYPA 4DZZA 5FUXA 4DLYA 3WNBA 1BMFA 1E1QD 1TL7C 1W4RA 5H70A 1UDWA 4Q9JA 3AVXA 3L0OA 3FVQA 5SZJA 3LXXA 2H16A 3L43A 3M4YA 1L2TA 4M9XA 3CB4A 1FFHA 2ZREA 5LD2C 4P4SB 3G5UA 5KSOA 4O3MA 3RS5A 4HDOB 3I62A 2EFDB 5G41A 3I3SR 1HA3A 5G3ZA 4ZI2A 5IK2A 3ZD6A 3GD7A 1DAIA 3KJEA 1KJYA 2EVWX 3I32A 2PL3A 4HZUB 1TQ6A 3P4YA 3DO6A 1HT2E 3HU2A 1N0VC 3ZVLA 5IF9A 4CVNA 1P5ZB 2WSSD 4RZ3A 2QGZA 1IN6A 4BFWA 3C14C 1KI6B 2ZS7A 2ZAOA 5KHOC 1MO3A 1NG1A 1SHKA 4LYAA 2FNAA 2E87A 1YKSA 3B13B 4JVLA 3WMEA 2C9OA 3QKSB 2HCBA 5FUVA 2IYXA 4I99A 1SVWA 2J5XA 3QEOA 3TR0A 2VP6A 3K9HA 4B3BA 1HUQA 1W2GA 4GDFA 2O8FB 1E9BA 3GJ0A 4IXNA 5E7JA 5F9HA 3OZXA 4A6PA 4TQUS 1Z6XA 2QMEA 1B23P 1TTTA 2ZRDA 1N5IA 2AX4A 2ZI5A 2IUTA 1KO1A 4PO9A 5JSZA 1GWNA 1JJVA 1CJUC 3W5JA 1OFIA 4MH0R 1YR7A 5L3QA 4Q1AA 4MKFA 5HKKD 3R8FA 1G6OA 3P4XA 4CYMA 2JASA 5TMPA 5AJZA 5FUWA 4IJMA 1UPTA 1ZBDA 1QHIA 2IF2A 4HDQB 5BYJA 5LB4A 2ZYVX 2JLZA 4Z54A 2XJ9A 4ARZB 2ANCA 3CZQA 3THXB 3R9XA 2BIFA 3FKSA 3C7KA 3KFVA 3M0EA 1HURA 3BORA 2V9PA 4TYPA 2JLYA 4BFVA 4G5OA 8OHMA 4FIDA 2IYYA 3AVQA 5FR1A 5J40A 2EU8A 4A8JA 3FTQA 2R6GA 3EIQA 3RRMA 3TVDA 3OEEA 3AB3A 1KNQA 1KDTA 2VP4A 2VHJA 2C03A 3PITA 3IEUA 2GESA 4Z51A 4PFSA 1NJGA 2ONKA 3NIBA 2EQBA 221PA 1II0A 1ZRHA 3IHLA 3K0CC 1D2EA 5E7MA 2PEZA 4IDPA 3ZS8A 5J47A 4NYJQ 1XWIA 5DYGA 1VG1A 1Z08A 1N6IA 4FMBB 2OCPA 3W9YA 3U44B 2VLIA 2QTVB 1OPXA 4Q01A 3B9QA 4UNSA 3KB2A 1BO6A 3GLIE 1I4DD 1KSJA 4JL8A 1R0YA 4RY2A 4JJKA 5JS7A 1G41A 3AP1A 1W47A 2OFXA 4LWZA 2QEQA 4EJSA 3QF7A 4DLXA 4LV5B 1VDZA 1T8UA 4P4SA 4DDUA 1L4UA 2HJGA 3SI7A 3K0AA 2FZLA 4URZR 3FMFA 4D81A 1SXJC 4FCVA 1NIPA 2BBOA 3ICEA 3QJYA 1ZD8A 4WZBE 2A78A 4JYCA 3DOFA 5FOWA 5CYOA 1IHUA 1AA9A 1YRBA 1T6NA 1QHNA 4FD2A 1XZQA 3X1ZA 4G1UC 4LBVA 5GVRA 2WWGA 4U5XA 1IXSB 2CK3A 1SHZA 4KVGA 4BFZA 2QNRA 2F1RA 3CX7A 5UKDA 4C0KA 4W7SA 2D2FA 1NBME 1VG0B 3PQCA 4HUQB 3ZVMA 4NU0A 3L2OB 2ZUCA 4S2EA 2DY1A 2GETA 3QKSA 3TQCA 4DUGD 5FOTA 4PAQA 5JCPA 2JJ2A 2QSZA 3ETLA 4KVAA 1KGDA 2WWFA 2YINC 4ZDJA 3QENA 3ZZ0A 4FN5A 3TIFA 2G83A 2GCOA 2HLDD 2A30A 5FUYA 1G7TA 4E09A 1TF5A 5FOXA 3FFAA 1V5WA 4CEIB 3B1YA 2PZFA 3T5DA 5KNCA 1U94A 1GNPA 5CJ2A 1P4SA 5DI3A 3E70C 1P73A 3C16C 4A9AA 5CB8A 2FFQA 3U61B 3CKLA 4FCTA 1T5LA 4BFTA 1AZTA 2PJRA 2Z4SA 2P5SA 2QENA 4P0TA 2OLJA 2FGKA 3E2IA 1WBBA 4PPQA 1KMQA 4ARZA 1M7HA 1TADA 2JAQA 4P31A 1IQPA 4XJXA 4EPTA 3G0HA 4GSYA 2IS4A 3EA5A 4BFYA 2QE7D 1II8B 5FL3A 2JCSA 4LHZA 4R2HA 2VP0A 4FMDB 1G16A 5TV2A 2P67A 1GOTA 1AN0A 3DM5A 5C4GB 2AR7A 3B9PA 1P7CA 4RKEA 2X8AA 3T35A 1R0WA 4K8OA 2VP5A 4BPBA 4GT1A 2KI5A 3IKJA 1E2PA 5HPYB 2Z43A 1Y3AA 3EC2A 4Q1FA 2G0TA 4MDEA 1G8PA 1ESMA 2Y8EA 1XD2A 2GF0A 2R65A 1NSFA 1OV4A 1G291 5FOUA 2C99A 1IONA 2VBCA 4MRRA 4AK9A 4CEJB 2HEIA 1YZQA 4QC2A 4IDHA 3I72A 4HLUA 2AL7A 4D0NA 4II7A 1V43A 3BB3A 3X1XA 4Q7MB 1Z0JA 2IXEA 4Q9HA 3LBIA 4TLDA 3KFXA 3CIOA 4ZKEA 1XMJA 2LCFA 4LJAA 3KXKA 1S9DA 3RNLA 1QRAA 1Y63A 1VECA 2IUSA 2VHTA 4JVNA 2WMOB 3H2YA 2Q9CA 5SZHB 5IRCD 2BVNA 3FMOB 1G3QA 5HE8A 4BZQA 3HR8A 1R4AA 5KDLA 2RGGA 5L8VA 1OFUX 3A1VA 3PEVA 4G3XA 2CL7X 2W83A 3ONWA 3NXSA 2F7SA 4HUQA 1COWD 1E9EA 3RLFA 1TQ2A 1GKYA 3QUSA 1E9FA 1J90A 1FZQA 1VYVA 2GCPA 1BYUA 3BIFA 3Q7QA 1U8ZA 5DSZA 2CVHA 1DVRA 5E3HA 2P5TB 4Q4HA 1XCPA 4Q9KA 2AKAB 3KQUA 1U0LA 2NG1A 1D9XA 1ESNA 2BM1A 1D2MA 4LJ7A 1KAOA 1XMIA 4LHWA 4NYIR 4PC1A 3PCRB 5HKKA 2NOAA 1OT3A 1KKLA 3KJIA 4GRAA 3W8NA 1P61B 1IM2A 4FW9A 4B47A 2D62A 3CH4B 1CR1A 1K5DA 4Q4JB 2EYQA 1XXHE 1SGWA 3BOSA 3D6TB 2ZS8A 3UG6A 4ZV4A 2IT1A 2NZ8A 3G82C 3OE7D 2F9MA 3GLFE 1Q3HA 2OZEA 3R7WA 1KI4A 4IKEA 4DLRA 1S1MA 1IY2A 1KI9A 1NRJB 3U7GA 4AC9A 3VAAA 2BMJA 3IBGA 2GRJA 2XOKD 721PA 1II8A 1GKIA 1ZC4A 3NKVA 4RD6A 3DL0A 4WZ6A 1W36D 1NKTA 1S9HA 2WPDD 2C77A 3GLGE 5GJWC 1FP6A 3UPUA 3AVVA 1ZM2A 4EPVA 4D80A 4TWZA 2FG5A 3MLEA 1OXVA 3ND9A 4MYHA 1E96A 4Q7JB 4XSHA 4OI0A 1FOEB 3U3JA 1P2TA 2W6ID 5CK4A 2FJUA 5DGXA 2Q3MA 2A5DA 1N6NA 3FYHA 2JLVA 1G4UR 1BYIA 4YMWA 1UEIA 4XH9B 4B76A 2RCNA 4Q5IA 4F4CA 4CEJA 1WE2A 4N0EA 3CR7A 2MMGA 5J4HA 1RJ9A 1P72A 2X19A 1Q1EA 2ZANA 4QM6A 1CR4A 2XITA 1A82A 1KHTA 3QG1A 4BRUA 4NKRA 1AK2A 4UQOA 4HB3A 4R7ZA 1ZYUA 3PUYA 4ZIRB 1WQ1R 2YWGA 2FFBA 1NBMA 4KFSA 4TN1A 2CMKA 2YVUA 4A2WA 1OSNA 3TSWA 4AKIA 3FKQA 1MOZA 4DLSA 1EGAA 2JLXA 3CONA 2GEDA 2EFEB 2BJWA 3MWYW 3ZGXA 1TF7A 1YZLA 2WBLC 1R2QA 1N5JA 5DHAA 1KK1A 1R8QA 1G18A 3KUCA 4LX0A 2P2LA 4KCGA 3QF4B 3TJZA 2DPXA 2O8BB 4LHVA 3TMKA 2C95A 3IEVA 1N5KA 1S8FA 2VO1A 2J0UA 4QBGB 1CF4A 3IO3A 5DO9A 1KDPA 1G17A 4DUGA 1U90A 1TQDA 3A1WA 4KO8A 1DAEA 4OQFA 2BMDA 1CJTC 2F3RA 2GK6A 2WKQA 5EE3A 3RWMB 4ACBA 1NNEA 4PC3A 3PUXA 1GL7A 4PHGA 4A82A 1FPMA 4NTZA 2V4ZA 1E2KA 1OYYA 2V3CC 3ZD7A 3I73A 4IEEA 4ILEA 3KQNA 1OB5A 2LWIA 2D7CA 3SS8A 2HLDA 4QHSA 1E2DA 3EPHA 1N6HA 3K0FB 3B6EA 1ZIPA 1DAMA 3FMPB 2ORIA 3AVTA 1LF0A 4RJLA 2GBLC 3CRMA 3C15C 1DAGA 1ZAKA 4RCZA 3K9LA 4BLSA 1NF3A 2VYFA 2VHQA 5EE5B 2GXAA 4HLQB 4YMUA 4CW7A 2ZE7A 1S0UA 3BH7A 4NYIQ 4L5BA 1E9RA 4DSTA 5KSZA 4C9BA 4FWTA 2BCGY 4A0HA 4Q18A 2O8CB 2WVJA 1B0UA 1WXQA 1RVDA 4B32A 2N42A 4JLAA 4JIMA 1KI3A 1F6BA 2VSXA 3N2IA 4MGKR 3RANA 4NP6A 2QE7A 1G3RA 3U4QB 3MJHA 1AQYA 1N6PA 4BZXA 4UNRA 4U02A 3GP8A 1SQ5A 2UVQA 3AVOA 3NEYA 3RS0A 6Q21A 3PENA 4KJZA 3PUWA 3PJRA 5B30A 4TYWA 1I2DA 3F0TA 3TBKA 3ZVRA 3CRW1 3CNOA 3ZH9B 2WM9B 1GAJA 3QXHA 4EFNA 2XTMA 3SYLA 1FUUA 2A5FA 2DBYA 3DM9B 4MYTA 2UZ3A 1XTSA 1J2JA 2JLRA 4B6FA 1KI7A 2IBMA 2HYIC 1G64A 1FUKA 1VCOA 2HXYA 3FHCB 1RC8A 5EJEA 4M1SA 4Q19A 4Q1DA 5EZ5A 4DLUA 2IYLD 1KO7A 2KB0A 4TQAA 3REFA 2JLUA 2QTFA 1OJLA 2ZR7A 5JJLA 3T1VA 1CXZA 2ZYUX 2J41A 3EPJA 4KSCA 4CT4B 2JA1A 3KL4A 4OK3A 2KWIA 4W9MC 1Z47A 5FTJA 4MDFA 1L7VC 2J0VA 1F48A 1XU4A 2ANBA 2CL0X 2MSEB 2HJVA 4BFXA 2ZI3A 4V0KA 3ZJYA 2FF7A 2FFAA 2RB4A 1XF9A 3L0SA 1M74A 3P32A 4URWR 4LGMA 1NJFA 1Z6YA 2J9RA 4FMCB 3AKEA 3RWOA 2KE5A 1HE8B 2SHKA 3T1QA 4B34A 2OXRA 2IW3A 2W0MA 1S3GA 1TF2A 1U9IC 5FFMA 3E1SA 1R0XA 3LY5A 1COWA 1G9XA 1T8TA 1TQ4A 2JJ8A 2Q0HA 5JEDA 2ZR9A 3IQWA 2O8EB 3A4NA 3VKGA 1Z07A 3CPEA 4MKIA 3KQKA 1MT0A 3AEZA 1DO0A 3THYA 1XMVA 1XXHA 2BBTA 2WAYA 3RYTC 1A4RA 1L4YA 4RVCA 2QU8A 1W0KD 4DT1B 2ZETA 3FMIA 3RRZA 4ZCIA 3R9IA 4A2PA 3GLFA 4YQFA 1XCMA 4NDZA 5EP2A 3TNFA 4DLVA 4LDJA 4D4MA 1XTIA 4E5UA 1XD8A 5K8IA 1UEJA 3K0FA 1E32A 4YDHB 5EXTA 4D25A 1T5IA 5BXQC 2HF8A 5JHGB 1NVWQ 5FPKA 4HATA 4QJ4A 2CXXA 1KSFX 2QRNA 4WXRA 3GLGA 1G7RA 3W5IA 1Z3IX 3WP0A 5C2JB 1E79A 4M9QA 5H1YA 1ZUHA 1MABA 1RYHA 3OE7A 2XGJA 2HXSA 1C9KA 2ZRKA 2A5GA 1KDOA 2ZRJA 3K8YA 4HYYA 1OXSC 521PA 2V8OA 3VHLB 3EZ7A 4B71A 2XOKA 2FPKA 5K8TA 4R98A 3GJ5A 4KLZA 2WPDA 4POAA 5L3VA 2RGDA 2BHRA 1NG9A 4C0JA 2JLSA 3VMFA 4BASA 1RRCA 1RE0A 4PAOA 1OLOA 1RKBA 3SHFA 1G5RA 4GMXA 2W6IA 1Q22A 4KSBA 3U60B 2EYUA 4L8GA 4A2QA 3FGNA 4GOKA 4XIGS 4A1FA 2OHFA 5BW8A 3VKWA 1NY5A 1UM8A 1ZNWA 1R5BA 5FI1B 2EFHB 1GRRA 2IXFA 5HCIA 2D4HA 4RD4A 1K6MA 1P62B 2ZUBA 2H1LA 2PEYA 2O0KA 3VU9A 1E3MA 3CH5A 1XFAA 1QHSA 1K5GA 1US8B 1IXZA 3BE4A 5J4KA 5KO2A 3I8SA 3SE0A 3GFTA 1F60A 1C4OA 3AP2A 1E2QA 3WHLA 3L8ZA 4ACAA 4XWOA 5L3QB 2EWVA 4EFMA 3EIHA 1ZCAA 3VNUA 3AF4A 3I8XA 2I1QA 4AYTA 4GMDA 3NBYC 3K09C 5A4JA 4XVUA 1JR3D 2XXAA 3U5ZB 4GZMA 2F1HA 5AK0A 1OIVA 3P1JA 3P27A 3K70B 1IN8A 4LYFA 1E9CA 3N2EA 1CP2A 4LCBA 1RRPA 4M53A 4C7OA 3BBPA 4JT2A 4E22A 4F4JA 4A8JB 4C0LA 1J7KA 2WWHA 3QIAA 1Z2AA 1G1MA 2QMHA 4LPSA 4M8NE 4OI4A 1FX0B 2O8EA 1E4YA 3LVQE 3PUVA 4R71A 5LD2B 1N6OA 5JMTA 3D31A 1XEXA 1U81A 2IL1A 5AUNB 1VG9B 2ATXA 3KKOA 1JQLB 1QDEA 1A7JA 2B21A 3D3QA 4M9SA 5HCNA 4KU4A 1EFCA 2CLDX 4L15A 1GTVA 4QM7A 1ZIOA 1EFUA 1R10A 5DIFA 3TSZA 1SXJD 5B57C 3I61A 5GJVC 5FBVB 2DR3A 2YJTD 3A6PC 4Q7KA 2ODBA 1JB1A 2ZI6A 4NZYA 5JWHA 4EJSB 4YMVA 1AIPA 3W3ZB 5BN4A 3FE2A 3SDZA 2R6DA 2R8RA 2XSZD 3QEJA 3CO5A 2BV3A 1E0SA 2F55A 1LY1A 1VHLA 2IEZA 3UIEA 3K0AB 4MGYR 2DFTA 2GA8A 2VQSA 3JZMA 5C1BA 4KLNA 1OXTA 3WYGA 4HI0E 5JRZA 2QROA 4Z8YA 2F6RA 3TK1A 1XPOA 3PEYA 1A5TA 2WJVA 4QHTA 3ZQJA 3B2EA 2ORWA 4UXIA 3KQLA 4PSKA 1R0ZA 4BLPA 3GJ8A 1PV4A 2ORVA 1VCIA 121PA 2P65A 2ZRIA 3L8YA 4DIDA 3PR1A 2ZU6A 1KO5A 1E2IA 3ASYA 3H86A 1KJWA 1S96A 1KKMA 1Z6TA 2OCBA 2YWHA 3B1VA 3LXRA 4DCTA 4KBFA 2WIBA 5EE0A 4TT3D 2QPOA 4P3YA 2GTPA 4KFRA 3M1IA 5B58C 4AIIA 4O2LA 3OFND 4UJ3A 5EQTA 2WV9A 1JEEA 3AP3A 3GJ6A 5EE9A 1MRSA 5C4MA 1UAAA 4MGZR 4LJ5A 2CDNA 2ZRAA 2FEOA 2V7QD 3LLMA 2GDJA 2Z0MA 4I1UA 1W4CA 2ZIAA 4QGFA 3C8UA 1NMYA 1Z0IA 1ZP6A 3W8RA 3GCGA 1IN5A 5DN6D 2REXB 2GCOB 3C5CA 1SVOA 5JWRA 4OK5A 1KTVA 1I4LD 2J1LA 1US8A 1TNDA 4R9UC 1DG1G 1E9DA 4XVQA 3HR7A 3ZQ6A 2VA8A 2R9VA 1HYQA 3IPXA 3SJBA 4MYCA 3X1WA 4JVSB 2WWIA 1QBKC 1RRGA 4RD2A 5DI3B 5DHFA 2G1KA 1N3BA 2O5VA 3PEUA 1G8GA 1TU4A 2QUZA 3EWSA 3NC0C 1XPRA 3A4MA 5JECA 4NCNA 5J4VA 3ADDA 4C3ZA 2RGAA 4OKSA 4B74A 2ZYWX 4XSGA 5FL7D 2JJ1D 3VX4A 4DHEA 2QY9A 4DDWA 1T0HB 1T3SA 1EXMA 2ZVPX 1VKJA 1Z8FA 2GEVA 1ZC3A 1FX0A 1QG4A 2AFIE 3BB4A 3BGWA 2GXUA 3R9WA 4QNMA 3VQTA 4G5GA 4E07A 2JEOA 1ZM7A 2VTKA 1ZW6A 2J45A 1ZUNB 4NCJA 3F3YA 4I1SA 4CEHB 1Z0DA 3KKNA 1JJ7A 4DC9A 2WJYA 4IW3B 1XD2B 1YZTA 2IYTA 3IHWA 4IFBA 3WYAA 1OIXA 2CL6X 3WBKA 4D0LB 3AVUA 5AR1A 4RCYA 1ZM9A 2IHBA 4M1MA 5FTMA 2JDID 4Q00A 2VHUA 3AH8A 4LBYA 5AUPB 4JLMA 2Q3HA 3AV0B 4GOJA 2Z6VA 3AKDA 4PQRA 5KUTA 4JT4A 2NMVA 3DKVA 1KMHB 1KZGB 5AUQA 2BMEA 3FDIA 2KBEA 4MRPA 4DCVA 5KPDA 4V0ME 1QHGA 4CF7A 2DWOA 1Z06A 2RGNC 4AKEA 1Z29A 4AURA 2OLKA 5DYIA 2QBYB 4X8OA 1W2HA 3BS4A 2QPTA 3PUZA 4W5JA 1YJ5A 2ZTSA 5TVKA 5EUQB 5IHPA 4QKQA 2IA5A 4PSAA 3ADBA 2YNMA 4OYHA 3EX7C 2C9YA 4PANA 1HT1E 2J3EA 4O25A 1ANKA 5AJYA 1X3SA 1VG8A 4AYWA 4UKDA 3SQWA 3QQ5A 4BLTA 4Q4HB 4B75A 1UBFA 5FTLA 2J0SA 3HU3A 2GJ9A 3TE6A 1G19A 2FGJA 2ONJA 3HJNA 3EWAA 1AGPA 3KUDA 3THWA 3CRQA 4F92B 4LC1A 4OHZA 1PUJA 3CX8A 3EPKA 2IS1A 2H57A 1E0JA 2H7VA 4IOLA 4L9WA 5FBLB 1TUIA 4QOSA 1U0JA 5KDDA 1NSTA 2G6BA 5FTNA 4B43A 1JR3A 2VIIA 3P20A 2FE4A 4DLWA 2QT1A 3K0CA 4PHTA 2J7PD 4C0QC 1YZUA 5IT5A 1AQUA 4X8MA 1DS6A 2WJJA 2ZROA 3W3AA 2NPFA 3R7WB 1EFRA 4IHQA 4L9SA 1MV5A 1HH4A 3E5HA 4NCKA 3B82A 4X8LA 1TX4B 2OFOA 4RD0A 4A0FA 4OI1A 2ZSAA 2IYVA 4JLNA 2GZDA 3TW8B 4Q4LA 3QOFA 5EE1A 2O8DA 4UXJA 1NMZA 3NBZC 1RPZA 4L4UA 2AWNA 1G7SA 2YC4C 2ZQ5A 4DJTA 5FBQB 4C2TA 3SHWA 4OBEA 3RS4A 4ERNA 2XJ4A 1E1QA 4KI0A 4DRZA 4KYIB 1SXJA 2WWYA 1CJKC 1NLYA 2ZRLA 4CEHA 2B8WA 2HYDA 3DPUA 2Z83A 3AUYA 5JJIA 4WAUA 1RJ9B 4ZPXA 1BOFA 3KDSE 1O87A 2ZPTX 1JNYA 2GEUA 4ABYA 2XSZA 2ZE5A 4AY2A 1NMXA 2F3TA 5EP1A 2FZ4A 1VYTA 2ZJ8A 3N70A 4JLJA 1KY2A 2W0SA 5ELXA 4JBXA 4GPTA 3B1XA 1KMHA 2G9NA 4RZ2A 3EASA 4PC7A 2Z5FA 5KYKA 5JLJA 1AZSC 1YR8A 4OHWA 1Q21A 1XJCA 1CLUA 1N0WA 2AN9A 3NDPA 2X2EA 1N6LA 3CUEF 4Q66C 1MH1A 2FX3A 3IIJA 5E95A 4MQBA 2WSSA 2QBYA 4C2UA 1CULC 4AD8A 4OQLA 3OAAD 4TT3A 1P9WA 2DFLA 2J0UB 2WAXA 1FMJA 2QA5A 3CRVA 3TSOA 4ESVA 3H0KA 5CDFE 2W2VA 1EK0A 2E9SA 2QI9C 1OH5A 2QQEA 1HQCA 2V7QA 1HY3A 4AG5A 3ICQB 2DFKB 2PLFA 2A7QA 2WIAA 2GXQA 2DFNA 2ECKA 3A4LA 2Q9BA 3HU1A 4I1VA 5DN6A 3UK6A 2FEMA 3UXMA 3THOA 2TMKA 3TUIC 2CE7A 5B64A 3TGPA 3KQHA 2P3SA 3EZ2A 1XEFA 3B60A 2YHSA 3ADCA 2BEJA 3TRFA 4K46A 2QAGC 3EZ6A 5AJVB 4A92A 4ASUD 3RSOA 2NGRA 4ZKDA 4HSEA 3KZ1E 2V6IA 3EA0A 4CGZA 4EQ6B 4HLDA 4WBSA 1OH7A 1OF1A 1CRQA 3QSYA 3VR5A 4AKGA 3W6PA 1LNZA 1IBRA 2HT1A 5JZVA 4ZDKA 4JLPA 2JJ1A 3UMRA 1LVGA 4BEJA 1Z22A 4QBIA 3A1TA 3ZDQA 3MWKA 2ZU0C 4QGHA 2JLQA 3D7MA 2Z4RA 4BRWA 5JJKA 3SBDA 2ZVQX 4BLRA 3O47A 4LUCA 1U99A 3IQXA 5C46F 2CCGA 1T3LA 2ZYTX 5ANRB 5H8WA 1W7AA 2H92A 2ZI7A 4Q4AB 4BECA 1DAFA 3AF3A 2GKSA 2XZPA 3KJHA 1G3UA 4M1TA 3CLVA 3SOPA 1XEWX 2V1UA 4V0MA 1N25A 4L16A 1G8HA 3LA6A 4M21A 5DI9A 4NMMA 1GFIA 1ZD9A 1S2MA 2PZGA 4TLBA 3LO5A 2JDIA 3LQRA 2BKUA 2RHDA 1KK0A 2BBWA 2EWWA 3SJZA 4C0SA 1OE0A 5KSPA 3O8CA 3CNNA 2AHOA 3U2QA 4NE2A 4OJQA 1E2FA 3R8CA 2QP3A 5G3YA 2IYWA 1HQYE 3B1WA 4KITB 4QJ5A 5B2ZA 4XWAA 1ODFA 4M1KA 1NY6A 2QG6A 3WMGA 2W2TA 4EUNA 1GRNA 1NLFA 4UNQA 1KI2A 2X2FA 4Q03A 2VF7A 4BGDA 2QM7A 4OQMA 4EPXA 1GUAA 4EDHA 1T9HA 4R2IA 2PT7A 3CF0A 3GMTA 4DLTA 3ZIAD 1ZU4A 4TMWA 4XVRA 2UKDA 1JR6A 4YC7A 3I5YA 2CHGA 1R5OA 1IOZA 1D8TA 1HE1C 1HTWA 2XNSA 2WKPA 1XJQA 2GJSA 2OAQ1 1E2MA 3OHMA 3OIWA 2Q9AA 3TQFA 1W0JD 3THYB 1XXHB 1Z63A 4O0MA 3QE0A 1G4AE 1ZCBA 3DHWC 4D4LA 1PUIA 2FN4A 2YC2C 3J81k 3GLFB 2ZJZA 3IGFA 3WYFA 3FFBA 1VCMA 4U00A 2ZS9A 4FMDF 1JECA 3GLHE 2KJQA 4N0DA 2AXPA 3PVSA 3GPLA 2ZRCA 2J87A 1LW7A 5KNDA 1E69A 2VP9A 1D9ZA 2BDTA 3GLGB 3WP1B 3FB4A 1DELA 4TL9A 5JBQA 1R5NA 4D82A 1NIJA 2QT0A 4PQYA 1X8LA 3V4FA 1MABB 3MMPA 1CS4C 4EQ6A 1M2OB 1VCNA 3M6AA 4IVQA 4KAXA 4PPNA 4DEXA 4PZLA 3X2SA 2A2ZA 4LOAA 5CIWA 2AXNA 2DWPA 1H65A 2EFCB 3S1AB 1DG3A 3MG9A 3SJAA 3UMFA 2YKGA 1WF3A 1BMFD 4TYYA 3TUZC 4KYUA 2YZ2A 1KI8A 4PC2A 1W36B 2VSFA 4MRSA 1ZM3A 2GNOA 1FMLA 3RVBA 4TL6A 5CITA 4ZDWA 1JAHA 4MRVA 1E6CA 2GZHA 4TMKA 3K1JA 2AFHE 2GVDC 1MO5A 3RC3A 2ZRGA 5EUMA 2A3RA 4URUR 1VPLA 4V0OA 1E2JA 4LK2A 4AWXA 5JCZA 1SKYE 1WP9A 4Q4AA 4B73A 5E7IA 3CF6R 1E0AA 1BIFA 2VSOA 3B1ZA 3CNLA 4RFSB 1VMAA 5IK2D 1QHHA 1SVIA 2XZLA 3ECCA 3NC1C 1YZKA 2G1JA 3VU9B 2IS6A 2VEDA 4Y0VA 2REBA 2P6RA 821PA 1QHXA 1T91A 2WSMA 4GI7A 1Q3TA 4TMZA 1PJRA 4QGGA 4YDSA 5BN3A 4Q47A 2NQ2C 2RGXA 5CK5A 3CRRA 5CDFA 1WDTA 1DAHA 3NTUA 4IDNA 4QGAA 1U8YA 1OYWA 5KTYA 2QRZA 4LYJA 3AF2A 3VNVA 4WZAE 2A5YB 2GF9A 4N3NA 5FPTA 2XXAB 2DWQA 2H5EA 1R8SA 2FFHA 2NO1A 2OEPA 1RFLA 5FH9A 4US2R 1KO4A 5TARA 3EXAA 4NL4H 1P2VA 3GLHB 4FXPA 2VP2A 3OAAA 2BBSA 3QPUA 4DSOA 4F38A 4C7OB 2FSGA 3DDCA 5AUOB 3PG5A 4RKFA 2ZJ5A 3GJ4A 2GBLA 4Z1MD 4DDTA 2IK8A 4Q21A 2IWHA 4NH0A 5JFGA 3A8TA 2MMCA 2ZUDA 5EXPA 1XEXB 4MUAA 4TYQA 2CHQA 4MITA 3A58B 2EFGA 4IDOA 3V4RA 1AGRA 2WHXA 3EZFA 3TW4A 1T4GA 2MSDB 4EPWA 2D3WA 4HEJA 5TY0A 2FV8A 4LV8B 3EC1A
chains in the Genus database with same CATH superfamily
5IZCA 2JAPA 4RK7A 2PMWB 3R7NA 2HBRA 2VJCA 1BMDA 3LE8A 1GQRA 2BMWA 4H3KB 3KYCA 4HZIA 5EXSA 5F77A 3KKPA 5AVRA 2BM8A 3B6KA 2BFDA 4QFMA 3FPHA 4RFVA 3VNBA 1FS6A 2CLCX 1PFYA 3OA0A 2JFVA 1HT3A 2IITA 4QRHA 2K2WA 2YRXA 4OOEA 3HB4X 1QYVA 1ETUA 4B3SB 5FI0B 3TLKA 3P9ZA 3P9RA 3IERA 4JP8A 1BU5A 2PTHA 3AUAA 2VHCA 3CM0A 2FQYA 2DUWA 3F6EX 4LVCA 4HMPA 5JI2E 5LSAA 4B4KA 4E30A 4DR3B 4KHPB 2NNWB 3I9OA 3W2TA 4JVMA 4JAVC 621PA 1PLKA 4AWAA 1UF9A 3MCZA 2OY0A 4HVAA 4M4SA 4QO8A 1BMQA 1Z13A 4XOIA 3S1AA 4PPYA 1TUBB 1CWUA 4ILKA 4JDPA 3BHJA 1OGYA 2NP6A 3KBOA 4ZAWA 3LY8A 4HB0A 4HH3C 3MD0A 4A6XA 2YXLA 2CLFB 1OTXA 1CV2A 2OLEA 3H1FA 4PAMA 2JGMA 3QWHA 4FKBA 3LYHA 4QU0A 3QU5A 1Z2OX 2OV4A 2V6JA 3RHFA 2BR4A 2HGSA 2AJLI 1U8CB 2BGTA 2OCDA 2FZKA 4KNVA 4X9XA 3VH4A 5HS4A 1AH2A 1ADGA 2AEMA 2H4JA 1LV8A 2Q6TA 1CVLA 1U3WA 2E4XA 4MUHA 3SFZA 3UCXA 2YY6A 3TAXA 4YMIA 3AI3A 3HZHA 1PEAA 3NGMA 3HYRA 4YJFB 4D3XA 5CFMA 5I7FA 2JLWA 2Y71A 1NL3A 1QJCA 2Y1DA 3W8EA 5CBKA 4G89A 1V1JA 4NOJA 4G4SO 3SR0A 2I67A 3RVOA 4BMPB 1OHHD 4ZYVA 4EYGA 1B1CA 4X97A 2GHIA 3UG7A 3CW2A 5IH7A 4FCWA 4YCJA 2OBNA 1V3QE 4NHEA 3RAFC 1U9IA 3HRKA 5JRJA 3MUEA 2GLUA 1YVDA 3ZHSA 1FTWA 4ZT5A 5C51B 4M9UA 2V96A 4EENA 1XK7A 2IY9A 2JBHA 2JIZD 1YJAA 5F1PA 3PTAA 2FEAA 2BEVA 4NPHA 2HIHA 2HMAA 1EVEA 2JGJA 2NTEA 2O7VA 4FX5A 3LBYA 1TKRA 2XA2A 2PO7A 4Q6BA 3ROKA 1REQA 5MF6A 4IICA 4AAYA 4V03A 3HA7A 1IJEA 3RM3A 3WHPA 3V1UA 4D3DA 2DB3A 1MTZA 3QE3A 4XX0B 1AN9A 1SD2A 3I04A 3BFVA 4F3TA 3QYJA 7MHTA 4JUIA 2JIRA 3V7YA 4I14A 4AZ0B 1Q2XA 3EXFA 2OAGA 3SSAA 4GNKA 1H4SA 1GT91 5FBRB 3FGPA 4YLGA 4WINA 1VFNA 3U16A 2FRDC 4J0FA 1KWKA 5HM6A 2EGUA 2Q1WA 3MBIA 3NHZA 4KV9A 1G3IA 1JXMA 1RLIA 2HK8A 3AIOA 4MS3B 1B15A 4X3OA 3GDGA 1L4LA 1IPFA 4EW2A 3HYLA 3S2ZA 4K28A 3UENA 2VCEA 5KNCD 4IIFA 4E2WA 1XK6A 2H4XA 4QPJC 4U3JA 5E1DA 3REQB 1D6SA 1PKEA 1E6KA 1T25A 4CQMD 3HBJA 4B79A 1SVKA 1JIVA 1HSOA 2OVBA 3QNUA 4JEHA 1WEHA 3HCWA 3OQBA 2X15A 1X1SA 1DB3A 3TRHA 2ZJAA 3V97A 1KERA 2GSDA 4LHSA 1IJKA 4N7BA 4QTTB 2PZJA 1PTKA 2OD9A 3DXZA 1E2HA 3TUJC 3VTKA 3K6SA 1T3HA 4TS3A 2VXYA 3RR2A 1ZINA 5B7PA 5JANA 3ZY2A 2CEKA 1HK7A 1EWYA 2BDEA 4JGIA 3VH1A 3WLQA 4Q9IA 4DWJA 1DQYA 5ALSA 4NJOA 3PFFA 1Z6ZA 2WUDA 4KREA 3GVXA 3WICA 2GAFA 2WWXA 3WI7A 2GA9A 2CBZA 4NCIA 4LF8B 2GN2A 5K8LA 4RJ2A 3BB1A 1UJ2A 3GEIA 1P1KA 3LRXA 4K1LA 1IHYA 4PSVA 4LRTB 1PD0A 3OIVA 4RVOA 4XAQA 5ENZA 1K0FA 3W9BA 3LS2A 5L3SA 4WH0A 5DFAA 4K87A 3LFUA 1QE3A 1DOHA 4Z4EA 1T6BY 1U2ZA 4EGJA 2LXNA 5K51A 2GB4A 1LB1B 1Q19A 1C9MA 4WBNA 1AA6A 4KXXA 2V3WA 4KOEC 3DEYX 3SU8A 4E46A 2GARA 2RCYA 4Y98A 2P6OA 1E98A 1TMKA 5BR8B 1CT9A 2H51A 3WAGA 4DB4A 1J0AA 2I2DA 3VNQA 1Q20A 3E9QA 1T8WA 3NCTA 1T0PA 1V16B 2ASEA 3R09A 1X2BA 2R62A 3F4BA 3IS3A 4QAJA 4C4OA 2XKAA 3ND5A 3I37X 1FU8A 4HGNA 4OJNA 4GBJA 4B2PA 3AQIA 5C18A 1RQXA 3BC1A 4XJTA 1KXZA 2DAPA 4WA7A 2GVNA 2JIPA 1P75A 5H3HA 2BLLA 3FYTA 4NMWA 4G9GA 4RYDA 3KNZA 4HKTA 4G01B 2BEWA 1GR1A 2FB9A 1OI4A 2HSEA 5H16A 1L6IA 2J6CA 3R40A 4M1ZA 1U8XX 3ELYA 4CT0A 1Q1QA 1EAYA 5KNBA 1VKZA 1T9ZA 3IAEA 3UWMA 1RCUA 1U65A 1QO0D 2OT3B 2P3LA 3DG9A 1NW5A 2UZ0A 3X2EA 4DNXA 5IX8A 2H08A 2PX6A 2RH8A 4ID3A 1BX1A 2DGDA 4E6EA 1EGVB 3GRPA 2W6JD 5I6DA 3UHPA 5IBCA 2YOGA 2C8VA 3JALB 5A04A 5AI4A 2DY0A 2LZ0A 3V8EA 3H1GA 4CQNA 3N8HA 4LI3X 5JYEA 1DO8A 5I4CA 1N57A 1SHJA 1YE8A 4BTEA 2XMCA 4I5IA 3GLIA 3QK7A 1EH5A 3V4VB 1B73A 2WTBA 1CJVC 1X7YB 5JCOA 1GSAA 1L5VA 1UZUA 2VUTA 1D6JA 2XMDA 3CC8A 1WXFA 4OYRA 1GNRA 1R00A 1RJFA 3EXEB 5BOVA 2GAJA 1MLDA 3HH8A 4B2IA 4BN5A 4N1AA 3DCNA 3TQRA 3DSRA 1Y6FA 3NFRA 4GGMX 1EX9A 2ZATA 4O08A 4BLVA 3P0HA 4CZ2A 5KX5B 1KJQA 1LNQA 1EVZA 4M2LA 1SOVA 5AJWA 1E6LA 2QW1A 4TZ0A 1CNEA 2B98A 4ZARA 1OZAA 3G3EA 4IH1A 1UC4B 2AF3C 3KB6A 5CUQA 2BUAA 3P2OA 2AT1A 3Q5DA 3GUUA 4LW8A 2PGXA 4MRNA 4DDVA 4MKHA 4HFJA 2HN9A 1FU7A 1MR3F 1ZK1A 4B3FX 3M1LA 5LMZA 2VWQA 3R0XA 4C03A 5JHHB 3EY4A 3LXUX 1LX7A 2ERYA 1YRYE 2W2QA 1KJIA 4PICA 1OKKD 5DK4A 3PRKE 3I42A 1X7XA 3VC3A 2RBGA 1NA5A 5H5JA 2B1RA 1K7FB 3BD7A 3F2VA 3HWX1 1L7QA 4UM7A 4ZCLA 3AKZA 1XBTA 2VT2A 4KC0A 2A67A 4MKXA 4MVJE 5CVUA 2POQX 4LCEA 1JDTA 4CPDA 4IAOA 3MCAA 5K1ZA 1DAKA 1GA4A 3KTAA 4N54A 4ZHQA 3ED5A 1RI3A 2ATEA 2OE2A 1NVKA 4L3WA 2BGJA 4BIIA 1A50B 1GL6A 1LTQA 4B6RA 2ODWA 3D1VA 4F71A 2VLBA 1BX3A 3E4CA 4WQMA 4Y2RA 2P9TA 5LU9A 2OB1A 5BQ3A 3G2JA 1LPMA 4X7RA 1M8FA 4AMUA 4I9HA 3EBLA 4KO3S 4TL8A 4RX1A 2R60A 1VYUA 3WIEA 3KB1A 3OETA 2QZSA 3QBVA 1TJ4A 4B4WA 3I2JA 3QKTA 2XUQA 4ND6A 2G77B 6REQB 4IEIA 5DTQA 4BQIA 1OXUA 1M7BA 1XRLA 3BE5A 4HNGA 4N9WA 4QOHA 5SZKB 2OA0A 4KIUA 2IU0A 1FQOA 4B5LA 2AZ4A 2I80A 4N47A 3UXHA 1ZL0A 3HC7A 1N2CA 2A7XA 4ZO8A 4ZVPA 4UM8B 3NHAA 3LSTA 3VJKA 5HX7A 1VLVA 4DSNA 2R7KA 2OQVA 4QDXA 4F93B 1XV5A 3HN7A 1NPDA 4AZ3A 3QV1A 2WHQA 3TX6A 3KKKA 1O6FA 4IJWA 5B3AA 1T3ZA 3V4LA 4K05A 3WDSA 1J2YA 4MGIR 5BSFA 1YUNA 1PSZA 3GJZA 3WHKA 1JKMA 5HR5A 1KYWA 3FPLA 3TPCA 1PZEA 4MRMB 4KKXB 5A1TA 3QW4B 2VUIB 3PQ6A 2O6LA 4HK4A 3OCUA 2G8LA 2ZUWA 4FSXA 1A9TA 1I1HA 2MR5A 1MFPA 4S1PA 5AWFC 3H3XA 4LE2A 1SULA 3GQBB 4R51A 5EQFA 4ZDIA 1TYAE 5F98A 2DQKA 3IVRA 1GPUA 4AULA 4F4UA 1FE8A 4D9FA 5ILQA 3VR2D 4RSGA 1JKJB 3RABA 2EJVA 3BGOS 2VI5A 3PPIA 4M37A 5GOTA 2PKQP 3G8DA 3NHBA 4L78A 1WKVA 4H27A 2FN8A 1V41E 4QREA 3ZD8A 3VH3A 4TXLA 4LBZA 1ORDA 5HBGA 3PEEA 4G23A 2GWRA 3DJYA 1LEHA 1Z7WA 2QN7A 3T7KA 5HJ7A 2R8OA 1GUFA 4IJKA 3HB7A 4RZUA 1W44A 1GZ6A 4TMXA 1O4WA 4NONA 2VTBA 2E7ZA 3N76A 1FUYB 1YQWA 2HKIA 1RZ3A 3I76A 4PR3A 1GILA 2G8NA 4M88A 1W8DA 2H1SA 3H2IA 3DR5A 5EA2A 3QMWA 4F85A 1E4VA 3NT2A 1ATIA 4E32A 5MN4A 1A4UA 3JR3A 4JT9A 4KXUA 5HA5A 3OT5A 4HNTA 4HADA 1M8PA 3KT6A 1P1IA 1Y1LA 1UPBA 2G9QA 3HL0A 3AF0A 1VTKA 1P2SA 2JAOA 4HX2A 4OQXA 4R9NA 5JH7B 1YQUA 2Z1MA 1X8JA 3OHPA 4YJ3F 2VSYA 4HYTA 4ON9A 4YO7A 1W59A 2YN4A 4DMMA 3MVEA 3KX2A 4OX9B 2DHEA 3F67A 3F78A 5F5NA 1NBHA 4Y9RA 5BOSA 1OFHA 4TVBA 3D7LA 3IOEA 1VJGA 4GG1A 3REOA 4CRWB 1GT6A 3D7SA 1ZMOA 3TQIA 3LHSA 5BRAA 3O9VA 1EI9A 1LTKA 1N9GB 3SHVA 1UQUA 4RZXA 1FVFA 2Y9MB 3FDZA 3MLAA 3VVLA 4H4DA 2I5PO 4I4LA 1SM4A 4YPOA 1J8QA 4ZCTA 3R0VA 2Z04A 4W5QA 5DGDA 1EFLA 3MAJA 5DTMA 5ILGA 4E5MA 2HF7A 2OCYC 2K7ZA 1AJEA 3U3ZA 1O0SA 1PEDA 2NT3A 3EDCA 3L92A 2HZBA 2QIPA 4KVZA 5HF6A 3ZNOA 2RGEA 2QTVA 3G13A 4GVLA 4LRWA 3RBAA 1YC2A 1CDZA 2ENUA 1XNQB 5JI3E 4S3MA 4HGOA 1LBEA 2QJWA 2NPOA 3OOEA 4C7VA 3N2GA 1K66A 3IDQA 2Z8XA 2Y1EA 4ENRA 4G0PA 1T8PA 1IZZA 1W76A 4LSWA 1DTWA 1DBWA 3E7FA 3O4HA 4P1ZA 5I4KA 4I1YA 4KWEA 2VJBA 4H7FA 2Y66A 1QV9A 3W6NA 4BQQA 3EK2A 1FXWA 1UKEA 2ODNA 3H6GA 1X14A 1Q1BA 2Y0PA 4DCJA 1CUIA 2QS9A 2C5GA 4N4AA 1XNJA 3BKWA 3T12A 3IQIX 4YT4A 4K2HA 1FFBA 1W5TA 3C24A 4I66A 4WE3A 4D3YA 1MCZA 5CVJA 3SQMA 2I2WA 3TR5A 1WCV1 5BR7A 2NP7A 3A37A 2PS9A 1MG5A 3CA8A 3O4IA 4H4CA 3RVKA 1P4GA 5LXTA 4JJAA 3A1UA 3U7IA 4Y1RA 1NVVR 4RESA 4P36A 4B6GA 1RQPA 1HFEL 1RBQA 2FQ1A 2W6QA 3L7JA 2PR7A 4OQNA 1LLFA 1A7KA 2ZJFA 2OUKA 4ACBA 5HRUA 4AO6A 1RP7A 5A06A 5D00A 4P86A 3ZOKA 2W7TA 2XCQA 3G5TA 2O19A 3RKSA 2JFXA 3H4MA 4AN1A 1ZGJA 4P33A 4YR7A 4IDBA 4AO8A 4J7UA 3FVTA 4D26A 2IRWA 4RVSA 3ZZTA 4DM7A 3CLSD 1EE9A 3MTDA 3KHUA 4HXEB 1YOVA 1U98A 1UZNA 2P4HX 3AFNA 3HJGA 4EVRA 4TYNA 2V1XA 4LJYA 2IHYA 4W5NA 1I0LA 2VH5R 3K9NA 3WLMA 1PR6A 3MRVA 4MEBA 4TSRA 2ZTUA 1TMOA 4Q1EA 3PBKA 4PX2A 3ZJ4A 1E79D 3QEMB 4L8WB 3W5CA 2HHHB 1NQ5A 4M9ZA 3UCFA 3D6FA 4AJIA 4PGFA 1XCGB 2HCFA 3BF7A 4NH4A 1OWNA 4TXNA 2JCXA 4DCGA 1H1TA 4EPRA 1Z6AA 4HAWA 1N0UA 4KMMA 3QH4A 1UMDA 5E4FA 3WY9A 4D3ZA 1HE3A 1SC9A 3BK2A 1FSFA 1MTOA 5JZ9A 3EARA 2G09A 1F6WA 1LPAB 1FFDA 2VH1A 3LC2O 4OXYA 4QDTA 5A3RA 4B7ZA 3OCWA 1M34B 4GE3A 4HAXA 1RCTE 4A23A 2AKEA 3UATA 3ZE6A 4JOBA 2J9FB 2EBUA 5BN5A 4OHXA 1UOOA 3CNHA 3M4XA 4LKRA 3ZKWA 2WNIA 3FYDA 3SQWA 5BN3B 2ZBEA 3IMKA 1KYXA 3FJ1A 1OB2A 1LC3A 2DBRA 5FBHA 1J2UA 2Z2JA 4I2NA 5F2EA 5FOVA 3S2IA 4DMKA 4ZYLA 5JADA 2ZLBA 1DO2A 1YZNA 2CNWA 3JD2A 3SG0A 5DTJA 1CEEA 1U0TA 2C2GA 2BGIA 4WGFA 2PUAA 4MQ5A 4BO5A 3JX9A 3GK3A 4PY2A 1QGYA 3DPIA 3C6YA 3E61A 4WDRA 5DMXA 3MUFA 3S4YA 4DSTA 3NIWA 5LQDA 3GFVA 2BRUC 4LSZA 2ORYA 2IDZA 3BHIA 3VPCA 1KVSA 2D13A 5IG2A 4Q34A 2FWNA 3DGEC 1ZN8A 2VYQA 4IHAA 1KY3A 2QAGA 3NP9A 3IESA 4BPRA 1BW9A 3GR6A 4IWNA 4LRYA 1Q95A 2JATA 3M9WA 5T6BA 1L5FA 3QI2A 2NO5A 2PBFA 3WWCA 1RC1A 5IYZB 5CM8B 1T2UA 1KFKB 3HGTA 4G5FA 5DGIA 5IU6A 4KQ9A 4YRFA 3D8RA 1H2YA 2XYHA 3Q8XB 4YR9A 3EIEA 4AZWA 2YWFA 1D8AA 3D8BA 5TB5A 2K87A 5BQOA 3PGXA 4XRGA 4A0QA 3TEMA 4B17A 4E21A 3DXYA 1S5PA 5JAIA 1XHLA 2JZNA 1UJ6A 3BFKA 1NXSA 3DZKA 2X5KO 2Z95A 4DIEA 1Y5NA 4OB6A 1JJAA 3MTBA 1BH2A 4J0EA 3F71A 3BX1A 1XZFA 4FGJA 5D3MB 3H2BA 2LW7A 3UJDA 2AG6A 4MR7A 2J7PA 1IM5A 1UP6A 4LDPA 1DKUA 4OU4A 3AG5A 2PT5A 4QXRA 4YCBA 1FFCA 4MUBA 4QNRA 1O95C 1U5BB 5EJ6A 3FCXA 2CUTA 2JLCA 2C61A 3EN0A 2H8KA 4G0MA 1Q0RA 4LY6A 4YXWA 3T7SA 1NKSA 1XQWA 5CU7A 4ZI5A 1JR2A 5K20A 1JZQA 4XTCS 2CJWB 4RTLA 4BWVA 1PUXA 1E2LA 2WWRA 4Q3NA 4RKWA 4DIUA 5KKCA 4JKIA 4MEJA 3KKLA 1AS3A 4LZPA 4BXOB 2B1IA 1R0LA 4J0QA 3N0WA 4HEA6 1GZUA 4LC0A 4QWWA 5LP1A 4R1PA 1XKTA 1RE1A 3Q5EA 4Q7LA 4FZJA 1JHVA 3JWHA 4G0OA 2EKZA 3DT6A 3Q2IA 2VJQA 3A4YA 3NTOA 2CL5A 3S29A 2R1TB 4CM5A 4FE4A 1FW6A 1GZDA 2YRWA 2OGUA 3FTCA 2MSNA 2VYCA 2Z57A 1YUMA 4D8WA 3H2GA 2ZT6A 1GM5A 2OBFA 1XKXA 2OMKA 1NXXA 1SK9A 4OFBA 2AOWA 2HSDA 4GW3A 5CT8A 1H2AS 2VATA 2PUTA 2I6QA 1BQ3A 4MWTA 1VQ1A 1EWKA 1F2UB 1D5WA 2VH2A 3FWPA 4UNIA 1YQ9A 4FBMA 2QGNA 4DTCA 1RWWA 4O2RA 4OGWA 2RAFA 1UUFA 3SKVA 2RARA 1ZM4A 4M6WA 3DLCA 3IUQA 5B3JA 4WT7A 3SC2B 4E88A 2VHEA 1PLJA 1E64A 5H80A 3GAAA 1CNFA 1JQJC 1Q0LA 2XE8A 5KOYA 3L77A 2A1UB 5D87A 2O2IA 5IDVA 3DBHB 3BF8A 3JVEA 1JLMA 1J9ZA 2YXDA 4B3CA 2AUNA 3W2EA 3MEQA 3QVVA 5E3IA 4B48A 4ZGWA 4BJ3A 4LF7B 3RARA 2EJTA 1P9NA 2Q3FA 3P97A 3BE6A 5BSWA 5CH8A 2UUCB 4F46A 2ZAMA 4G0YA 2HIMA 1VE9A 1NXVA 2QX8A 3L04A 3OZVA 4H18A 4L28A 2JD2A 2C9ZA 2X2OA 4OAQA 4O4JF 5IAKA 3T1TA 2QL6A 1VM6A 2JJMA 5ESDA 5LQJA 4FI3C 1T5DX 3GVPA 2QKYA 4OJKA 4TS1A 2WYUA 4PQGA 1ZD3A 2Z2KA 4KBGA 1KVRA 3O7WA 3OIUA 2XPCA 7GPBA 1ZISA 1Z75A 4I3FA 2NX2A 1IHOA 2RGWA 4DMUB 3BGVA 5KQGA 3F6PA 2JFUA 1BN6A 1XWWA 2FMXA 3N2KA 4LYHA 3COVA 4G5SA 2Y1LA 4V39A 4JR2A 4FINA 5C81A 2O8BA 2B5WA 4X6XA 5GPBA 1ZGBA 4NECA 5D3QA 4BEBA 3FYSA 1IXKA 5K3BA 5F2KA 5BNZA 4RTNA 1C7IA 4DW8A 4FKZA 2Q21A 1RZRD 1KMCA 1H0KA 3OEED 4JOCA 4I5EA 4JWTA 4J3FA 4RGVA 2EF0A 4I55F 3NG1A 1JDPA 3BCUA 3Q6MA 1QZ3A 3KQSA 3QKRB 2OCKA 5CLQA 2PMKA 1EXVA 3ZUGA 5AJXA 4GPBA 4L5YA 3DA8A 1Z45A 2C5EA 1YI8A 1ZRNA 1SVMA 1PI3A 3BL6A 3I1IA 4FFOA 3KTOA 2QP4A 3UAYA 2LKCA 3IE2A 3OJOA 5FFFA 4F91B 2IBTA 3MB8A 3NKFA 1KJZA 1WQ3A 2RHLA 3W1VA 4FQ8A 4KN6A 1MPXA 5A5GA 2J09A 3DVSX 4NJMA 2ZRQA 1XN4A 1EFKA 3UA3A 5CMLA 2H2FA 4DJFC 2ACEA 4ZD6A 1ECLA 2HMUA 1UADA 4ZOBA 5KSYA 1D5CA 2PLWA 2V65A 1TT5B 2B30A 4WFIA 1OXKB 3O8RA 4D6YA 2BH2A 5ARBA 3PFCA 3LLVA 4GX0A 5FBWB 2UU9B 3ASZA 1E6UA 1JL3A 1GKUB 5KU1A 5EYPA 5C9ZA 1TGYA 1M5UA 4QJBA 3AY0A 1IB0A 1RAIA 1SBQA 3UV7A 1KFEB 1P2FA 1XTJA 2EX1A 4L0DA 4DABA 3U3KA 2O0HA 4KQHA 2OV2A 4ETNA 2ODQA 3AF1A 1JPJA 4M0EA 1ORHA 4IXWA 4Y2JA 3WLHA 1EXWA 4YUWA 2R87A 2QN6A 1O6GA 1NF2A 1WRBA 2NTVA 2RJNA 3AHEA 1VHTA 1LK0A 2A92A 2GPBA 2OVFA 2VDMB 3TM5A 3U4CA 3DTVB 2IYZA 5A2GA 1H4VB 2J46A 2RMKA 1T2DA 3O1LA 4PNPA 4BNVA 4RCVA 4RD1A 4R9RA 1A2QA 2CXUA 2G40A 2IV3A 3W2HA 3PCXA 3WLLA 5IKOA 1T0JB 1GRQA 4OEHA 2CLSA 4W9NC 3M1YA 2A8YA 3IO5A 3Q1LA 2PWBA 4GOXA 2PH1A 2AS0A 4KXQA 4NBSA 1M1YA 1BGVA 2M98A 2O7RA 3QPWA 3SY8A 5GJBA 4FR2A 4TTVA 1Y81A 2PM8A 4B80A 3PSHA 3V7FA 3MERA 3ZHVA 5BP7A 1I6LA 1DARA 4YCCA 3EOBI 2OXCA 3Q6IA 5BORA 2QVCA 3CF2A 1GQOA 3H83A 1A7AA 1OZ0A 1WU7A 2W6CX 2FG7C 1SVUA 2ZTLA 1DKPA 4I81A 4D42A 1G2OA 5GVSA 3RD5A 4D96A 2B8NA 2JGKA 1W0JA 1GCAA 1R9GA 3IEKA 3MRTA 3WA6A 4FOOA 1DIGA 1GNVA 1I4TD 1QTQA 2NSYA 4AQ7A 5BSEA 1BCSB 2XNJA 1Q57A 3E82A 2Y0EA 4M1OA 4DNPA 5H7XA 3VU1A 5BV7A 4Z86A 1PNTA 3VKHA 3PT9A 4IVRA 2V03A 1LFAA 1CQJB 1TEXA 1U6IA 3CUSA 3CWZA 3WGJA 1MAWA 3CEAA 3OUUA 4WIAA 4PTZA 5EJMA 4FGSA 3JQ6A 1LQ2A 1ID8A 4JENA 2CXRA 1RQ2A 1D4AA 4AMZA 4XVCA 3DLHA 2XUPA 4F84A 1NN3A 4YVFA 4CMIA 4DEYA 3I6QA 2ZT7A 2HNBA 3HEBA 3IPCA 2FPWA 1YVUA 3OQPA 3K2IA 4C30A 3RRNA 3W78A 4LFBB 1IOWA 3H9EO 3LJKA 4TWJA 4FI3F 1PJ2A 2TRSB 2BGNA 2C3UA 5CEEA 5K3FB 1C41A 5FWDA 4DYHA 3ZZNA 4YUZA 4OKIA 4TV8F 3EW7A 3SQXA 1ZH0A 5J58A 3A2NA 3KZMA 4MUGA 1JSLA 2BI7A 3F49S 4GMGA 1BD3A 2B0CA 3GC6A 2D7DA 1EUCB 4EA8A 2C59A 5CYPA 4DT1A 4BE4A 1GY8A 3T7DA 1TL7C 5HUHA 1AOXA 1W4RA 3T6KA 5AM0A 4O6VA 1UDWA 1RXUA 5IBRA 1AO3A 2FZGA 1JQ3A 2QLTA 1QX4A 4QU9A 5EJ5A 1NVBA 1ABEA 2XA1A 3LXXA 4NSNA 4WOBA 1IOLA 1A9ZA 1LRKA 4M9XA 3O75A 3B48A 3ZDBA 4IS2A 3V33A 1L5HA 3FSEA 1RRVA 4GM4A 4ARVA 2YIMA 3EMVA 2BTQB 2FLWA 1RMTA 1YT5A 5C37A 3G5UA 1WSAA 5KSOA 2VJPA 5FWYB 3RS5A 4KR9A 4JYMA 4WESA 3PNLA 2EFDB 4HY3A 5G41A 5G3ZA 1F2DA 5CURA 4IUDS 3MTQA 5AVJA 1UPFA 1DAIA 2AXQA 4B3HA 1PZHA 5LOVA 3IEPA 3R5TA 4R1QA 2PL3A 4F7DA 1XMQB 1TQ6A 3P4YA 2YJZA 3DO6A 1U0BB 5F21A 4X94A 4RHUA 3SKYA 1N0VC 1XQ6A 3AJDA 4KNYA 3KQYA 4I8XA 3L7IA 1QOZA 2NWQA 1IN6A 3DNMA 2Y1OA 2ZS7A 4EX7A 3AL2A 1MO3A 1ZEJA 4I4TB 3GUZA 3GGDA 2FNAA 5AKZA 3EC7A 1W6UA 4JVLA 1Q2UA 1RHKA 1XU7A 2YX1A 3GEGA 4XSVA 5ECGC 1DT3A 2PKXA 2Q6VA 3UV6A 1PRYA 1LBQA 1U2PA 3OEYA 1DZ3A 1XL0A 2X3UA 3FRIA 3QEOA 3UWSA 2FLKA 2BUBA 4P3NA 1M75A 5AM5A 5FF9A 4PLCA 2G5TA 5F9HA 3P9IA 4PLYA 3WSTA 1SUPA 4TQUS 1T9GS 3C8HA 4DDKA 2ZRDA 4W1QA 4J2TA 5C4IA 2G0AA 3QYPA 5FI3A 4OMCA 5TPWA 4HAIA 5JSZA 5B6IA 3QYAA 2XKJE 3N8GA 4G1EB 3TFWA 1APBA 2V7UA 2G5CA 5FPPA 4IJUA 1OJ7A 1RWOA 3O5AA 4WA8A 3GDHA 3R8FA 2ZBRA 3K2EA 4IJMA 2FEPA 4HDQB 4JCCA 4OTZA 1OLXA 1K8XB 4XB2A 4BQOA 5K0SA 2JLZA 1HKHA 1NI5A 1YB5A 5TRTA 3RIHA 2ON6A 3EQ6A 3ECAA 1JU9A 3THXB 3R9XA 2BIFA 4WBNF 3C7KA 3KFVA 2Y67A 5LQNA 1O0CA 2AG8A 4JXKA 3BORA 5HTOA 2JLYA 1MOQA 2E2WA 3I5UA 1EE2A 4RDIA 4FIDA 5FR1A 2OBXA 3HB1A 3FM9A 5J40A 1XVUA 1M2FA 4EMSA 3GG9A 1IQUA 1XLVA 2NAFA 3I6IA 4A2CA 5HCUA 3JD4A 3TGLA 2R8YA 1YR1A 3HG7A 3NGLA 1HI9A 2VP4A 4L0QA 2DE0X 1B76A 2QMQA 3PITA 3IEUA 1MGOA 5T57A 4PFSA 4DCOA 4K9SA 4Z51A 1F8FA 3CX3A 3HN6A 5FA5A 4DV5B 1U1GA 1II0A 3OT4A 3IHLA 3SR4A 3E05A 1D2EA 5TQ2B 3SLRA 1SCJA 5ALFA 2UXCB 4NYJQ 4RM3A 4WV3A 3GJSA 4LDNA 4EG7A 4MI9A 2ZBFA 1VG1A 5LBTA 3RH0A 2XW6A 4BAGA 1HNNA 4IYRA 3OX2A 4ZEVA 2AN4A 4FZVA 1JG6A 3TMAA 4H59A 1PBTA 4JB0A 3W9YA 3U44B 5F1OA 3RUAA 1Y4UA 2P9ZA 1OPXA 4MS4A 3TNLA 5IJ0B 3KB2A 3ABOB 3PC7A 3JQEA 4H1TA 1G41A 1GA1A 1OCEA 4DLXA 4YGXB 1BWRA 5EQDA 4RQUA 2XLBA 1RJWA 1NGSA 1X9IA 3Q3GE 4P4SA 1I33A 1ODCA 3E9MA 4PIVA 4EA9A 2CDCA 5MGNA 2FWMX 2FZLA 3RRXA 2IVFA 5I51A 3QMPA 1X19A 4ZV7A 3SLKA 4D9EA 5C8YB 1NIPA 4ZN6A 2J33A 3QJYA 2DPLA 3JQ8B 4N9QA 3KPJA 4KMSA 1LPSA 3S55A 3O03A 1AHIA 5FOWA 3QBEA 4EG5A 1JFRA 4KZKA 4QXMA 3DBIA 1U5CA 4QOIA 3OM9A 1YRBA 1ONPA 4QICA 3EXG1 3RTAA 2QVXX 5DGHA 4D4GA 1QHNA 3LBFA 1KZ9A 3EF0A 3FNRA 1E4EB 1WL8A 4MAFA 1IXSB 2CK3A 5JNVA 5KJ6A 1QIJA 4FONA 3SZLA 2QNRA 2XCLA 3EWNA 4B46A 2IEIA 2E4ZA 5EJ9A 1VG0B 2Y76A 3PQCA 4JXJA 4HUQB 5CDTA 3PC8A 4NU0A 1BWSA 1JDBB 1AF4A 1NZJA 2P41A 3QKSA 3H16A 3T0GA 5CG2A 1BHO1 3R0QA 5C5EA 4M3NA 3KBBA 4MUYA 1PSDA 3S2UA 2QSZA 4BVKA 3LLCA 3RRBA 5K6AA 1NNUA 1KGDA 3JQDA 2YINC 5HIKA 1DCKA 2W6MA 3BDVA 3ESCA 1T8SA 4FN5A 5H9VA 3TIFA 4EG4A 1SRRA 4DADA 2I55A 4ZQHA 1U7UA 3IPLA 5A3SA 4OFXA 2O2DA 4BEVA 2FUG6 2EZTA 4IHJB 3DXXA 1G7TA 1TF5A 5FOXA 3KJFA 3TRKA 1V5WA 5EHGA 2B83A 8MHTA 4L6IA 3AM5A 2MSKA 3INYA 4YRCA 3UGTA 5FA8A 2VAXA 5HGXA 4PM4A 3L8DA 5KNCA 5CJ2A 1FC0A 2I4OA 4HEHA 5DI3A 3E6AA 1E7RA 4CGYA 1L7RA 4O4HB 2OLJA 1BEEA 2DTEA 1KMQA 3KETA 4NBNA 1SBHA 1U3DA 3IP8A 1TADA 1Z2EA 2PL1A 4Q4DA 5GGXA 1B8PA 1EEXB 1DKQA 2JNWA 2YFHA 4GSYA 5IM5A 3RW9A 3EA5A 4AX8A 2IS4A 4BFYA 2EEZA 2QE7D 2JHAA 5FL3A 1B6GA 2RHTA 4LHZA 2H59A 2XAAA 2ZIGA 3EVGA 3WL6A 2IZZA 5TV2A 1HZJA 1GOTA 1R0BA 1AN0A 1O8CA 2AXEA 4REOA 2PU5A 5KWSA 2OC4A 2PKRA 2PGIA 1RHJA 2QUKA 4JI6B 3DT9A 1Z4JA 3LUJA 1CDEA 3IKJA 1E2PA 3ROTA 2Z43A 3QTLA 3TG2A 2Y0DA 4NZ9A 4Q1FA 4MDEA 3JQFC 3VU3A 3ZGZA 2AJCA 3VVBA 1P74A 2OGZA 1IVNA 3H8VA 4DLLA 1IONA 2BGUA 2D1FA 3L5KA 3CB2A 4MRRA 2H07A 2CHUA 3IJRA 4ND2A 4A10A 1FIUA 2ZWIA 4HDKA 3I72A 1NTRA 3DEJA 4IDHA 4MMXB 4HLUA 2I6TA 3H2KA 3VYSB 1P1BA 3MB5A 2GD1O 4UAJA 1V43A 3FWHA 3BB3A 3S1LA 3E35A 3X1XA 3ZE0B 4Q7MB 5C32A 2R1VB 5FJIA 1C30A 2PA3A 1Z0ZA 1NE2A 4FLMA 2IXEA 4J6FA 2NUAB 5TMEA 3T7IA 3WJ7A 4OX9Y 3L49A 2LCFA 3EPPA 3KFLA 4LJAA 2CJPA 4CLOB 1SELA 3WLRA 1QRAA 3G2KA 3WFZA 3DT8A 2HREA 4NDNE 4OBXA 3K73O 5DN9A 5ALGA 3BK1A 2VHTA 2CVPA 3MCWA 1ZI6A 1BDIA 1YFKA 5INTA 1LSJA 2O2ZA 2AGVA 1UANA 2EDCA 3NJ4A 4KMRA 4JP1A 4Y2SA 3ZX4A 4BZQA 4BS9A 3SHOA 4TTIA 4ZWNA 5JS6A 1JKFA 4KNWA 4ME6A 4PE5B 1PNVA 4Y1EA 1SA0B 4OJMX 4MR8B 5AICA 5L8VA 3ICPA 3PA8A 2W83A 2XUFA 1YS2X 3C3CA 4ENTA 1SIUA 2Y1GA 4ZXPA 1N2HA 2F7SA 1BS9A 2IKQA 4KJXA 4IIEA 1TQ2A 3AXSA 4FYXA 3VYRB 4F6RB 4LYYA 5FLXA 2DQSA 1L7EA 3BIFA 5DSZA 5DWVA 5DM70 2AMJA 1KR2A 1NLMA 5E3HA 2ETVA 2P5TB 4Q4HA 2JEZA 5BWLA 1AKWA 2ZB7A 1CUEA 1T1EA 3KQUA 1U0LA 1C0IA 4CLXA 5AXCA 1D9XA 4RMGA 2OORC 4BQEA 1WBJB 2WB2A 1A27A 1DBRA 2IODA 4URFA 4ZQBA 5JPCA 1EAMA 1KAOA 4NYIR 4LHWA 2CUNA 2C1EA 2LDBA 3GL9A 1OT3A 2AC4A 1BSVA 1KKLA 1YCFA 4Q3OA 4BVHA 3AILA 5AKJA 1IM2A 4XIJA 4PX5A 1GXSB 4KR7A 1UBHS 1AKRA 4B47A 2AOTA 1PFGA 3EUFA 1M1ZA 1EINA 1TLLA 4P3XA 5I45A 3SIRA 1Y3CE 2IT1A 3EDMA 5U1PA 5TS3A 3M5CA 1SC6A 3X3HA 2C2XA 4U2GA 1ZJ5A 3MTIA 2OZEA 3C85A 3R7WA 3VO2A 2G07A 4DLRA 3GLFE 2OTCA 1RI2A 2VYND 4AC9A 3K9BA 1JU3A 1DPGA 2BMJA 1J56A 3BXOA 1SCQA 2GRJA 4WFKA 3KD2A 3OWHA 2OHOA 1Z12A 1U0SY 1II8A 1RHUA 2QUJA 2XOKD 3EVTA 721PA 2HB6A 3TW8A 4G1FA 3K9FC 1S9HA 4EJ2A 2B4QA 2AG5A 2C77A 2OZKA 1F8YA 1PV1A 2BGRA 2IHVA 3FUUA 1XDWA 3IKLA 3UUEA 3ZWOA 4PONA 3UPUA 4D80A 3WE7A 3WWPA 1NP3A 1P77A 2FG5A 4XPIA 5F7ZA 5IVDA 5EMHA 2IDMA 2YBEA 4IQFA 1P2TA 1JIUA 2UYOA 2W6ID 3U3JA 4BNMA 4C5AA 4KPUA 2WG0A 4UTXA 1TK2A 4B7CA 3SQNA 1R4NA 3BXFA 3FYHA 3SMVA 2E18A 4ROSA 5ITZB 2W93A 1E5XA 1G4UR 4YMWA 3KWLA 4J1QA 2WHPB 4U2CA 4XH9B 5LXTF 4B76A 1F8XA 1WE2A 5U4XA 2MMGA 3GRVA 3LY7A 4P35A 3NC4A 1Q1EA 4FGKA 3U0BA 1PL7A 1NF9A 4HWKA 5IAJA 3ZYZA 5HEKA 3ZLUA 1A82A 1EMDA 4NKRA