The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
76
|
sequence length |
206
|
structure length |
206
|
Chain Sequence |
DMEIACLDLEGVLVPEIWIAFAEKTGIDALKATTRDIPDYDVLMKQRLRILDEHGLKLGDIQEVIATLKPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDDSDRVVGYQLRQKDPKRQSVIAFKSLYYRVIAAGDSYNDTTMLSEAHAGILFHAPENVIREFPQFPAVHTYEDLKREFLKASSRSLSL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The thrH Gene Product of Pseudomonas aeruginosa Is a Dual Activity Enzyme with a Novel Phosphoserine:Homoserine Phosphotransferase Activity.
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Pseudomonas aeruginosa
|
molecule keywords |
homoserine kinase
|
total genus |
76
|
structure length |
206
|
sequence length |
206
|
chains with identical sequence |
B
|
ec nomenclature |
ec
3.1.3.3: Phosphoserine phosphatase. |
pdb deposition date | 2003-11-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF12710 | HAD | haloacid dehalogenase-like hydrolase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HAD superfamily/HAD-like | ||
Alpha Beta | Alpha-Beta Complex | thrh gene product, domain 2 | thrh gene product, domain 2 |