1RKVA

Structure of phosphate complex of thrh from pseudomonas aeruginosa
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
206
structure length
206
Chain Sequence
DMEIACLDLEGVLVPEIWIAFAEKTGIDALKATTRDIPDYDVLMKQRLRILDEHGLKLGDIQEVIATLKPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDDSDRVVGYQLRQKDPKRQSVIAFKSLYYRVIAAGDSYNDTTMLSEAHAGILFHAPENVIREFPQFPAVHTYEDLKREFLKASSRSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords homoserine kinase
publication title The thrH Gene Product of Pseudomonas aeruginosa Is a Dual Activity Enzyme with a Novel Phosphoserine:Homoserine Phosphotransferase Activity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 76
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2003-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rkvA01
3.90.1470.10 Alpha Beta Alpha-Beta Complex thrh gene product, domain 2 thrh gene product, domain 2 1rkvA02
3J7TA 4ZEVA 1QQ7A 1LTQA 4Y2QA 3WK4A 1AQ6A 3ZTWA 3QU5A 3NALA 3U13A 5ALTA 2WF6A 3ONNA 4NV0A 3FPBA 4OCZA 2MU1A 2EARA 4BEWA 5T41A 1Z5GA 3KOOA 4BBJA 1NF2A 4IG4A 3B8EA 3TLMA 4UM7A 2I54A 5ALWA 4HGNA 1O08A 1Z4OA 3NIWA 1RPZA 3M9LA 3L5KA 4UW9A 4Y2RA 4GXTA 1WPGA 2B0CA 1TE2A 2YMMA 4JB3A 3PCTA 2C4NA 4L6AA 4BX2A 2P27A 3A1DA 3UMGA 4YCMA 3P96A 3E58A 5AVXA 2W11A 3KZXA 4Y2VA 4F72A 1L8LA 4YCNA 4CF3A 2ZXEA 3F9RA 4FE3A 4Y2SA 5AM4A 4EEKA 5AVWA 2HI0A 5AKLA 2B1QA 4Y3UA 1TA0A 3RFUA 2NO4A 2QYHA 5ALGA 5ALYA 4UARA 1L7PA 5AKZA 2D2VA 5AICA 1ZOLA 2P9JA 4UMVA 2YJ4A 1J8DA 3UM9A 2OBBA 2HX1A 2WF9A 1YDFA 5ALXA 3DDHA 2W43A 4KNWA 1QQ5A 2YBDA 1RQNA 1YS9A 2B1RA 3BA6A 3QU4A 2B8EA 5AESA 1N9KA 4KN8A 2I7DA 5AM5A 4I9GA 2C8LA 2ZBFA 3AR4A 1RKVA 3U19A 3QNMA 3ED5A 1Z4QA 2ODAA 5AVSA 5AI8A 2DQSA 2P69A 3MN1A 4HGOA 2WHEA 1RLTA 4CE6A 1VJ5A 5AI9A 3DAOA 3QLEA 1S2OA 4DWOA 3FPSA 4L57A 1RKUA 2JAUA 3MMZA 5ALHA 2AGVA 5AI6A 4DFDA 2HEGA 4GIBA 3R9KA 3WKDA 5IT4A 4BX3A 2OYCA 4IFTA 1VJRA 2WF8A 1RDFA 4UAUA 2OA0A 3FGOA 5AK5A 4RESA 5AVVA 3SMVA 3OPXA 1LVHA 4C4RA 3U7FB 4NFLA 4KYTA 3L8HA 1CR6A 2YJ6A 4FFDA 2PKEA 2GO7A 4HGQA 4J2TA 1RLOA 5AW0A 4CF5A 3EPRA 5ALOA 2YMPA 3L0BA 3QU9A 3FM9A 3E8MA 1J97A 4F71A 1WVIA 3ZVMA 2YJ5A 1L8OA 3L8FA 1NNLA 3AR2A 5AVUA 3ET5A 4J03A 5ALDA 1YJ5A 5IS2A 5ALUA 3ZUPA 5ALKA 3AR9A 3L8EA 1RLMA 3OCVA 3QUQA 2BDUA 1RQLA 1N8NA 1XPJA 2G06A 4HYTA 2G0AA 2B8JA 2IOFA 5AVQA 3DV9A 3WK7A 2G07A 3IJ5A 3S6JA 4XOUA 1QQ6A 5AM3A 2PQ0A 2Q4RA 5AW7A 5FP0A 2G1AA 3IRUA 1IWOA 1O03A 4DCCA 4G9BA 3PGVA 5JJBA 4XQ0A 3WKBA 3WGVA 2X4DA 5A3RA 4KX3A 3I1YA 1S8OA 5AW6A 1T5SA 4XPZA 3L1UA 2VKQA 1WR8A 2HO4A 2RB5A 3CZ4A 2GFHA 4YIHA 3WK5A 2WM8A 3PDWA 2NO5A 3U26A 4EELA 5AW2A 3HYCA 4AS3A 4FYPA 2IA5A 3RF6A 4YCLA 4MWOA 3ZX5A 2JAWA 3N28A 3NUQA 4I9FA 5ALJA 2I33A 1YV9A 2YMLA 4CNQA 3MC1A 3N8GA 4O8CA 2G08A 5ALZA 2ZOSA 3E84A 5AW3A 2YY6A 2R8EA 5A3SA 2B82A 1ZD4A 5AI4A 3L8GA 3UMCA 1YMQA 4MUMA 3L0YA 1Z4PX 2FPWA 2JAOA 3K1ZA 4HGPA 1SU4A 2HF7A 4YGYA 4EZEA 1ZJJA 3B9BA 2G09A 5AKJA 3U7EB 3OCYA 2CFSA 3I28A 3WGUA 4H1WA 3KD3A 5AM2A 5ALVA 1PW5A 1TJ4A 3QX7A 4OHFA 5AKHA 3IB6A 4OD0A 5AM0A 2FPSA 3FVVA 3W5CA 2G80A 3NAMA 1EK1A 3DNPA 4Y2JA 4UATA 2FPUA 5ALRA 3ZWDA 4OFZA 3U7HB 3N5KA 5AK4A 3ZTYA 4C4TA 2Q4TA 3SF0A 3WK8A 4HGRA 4UMEA 3OCZA 1RMTA 2HOQA 3HLTA 5ALIA 1QYIA 3QUBA 5AKKA 2CN1A 3SLRA 2JGAA 1Q91A 2EATA 1SWWA 3AR3A 1Q92A 2HF2A 4NWIA 4KX5A 4B6JA 2IOFK 4YIKA 5AIAA 1F5SA 5ALFA 5ALNA 3N07A 3N1UA 4UM5A 1RMYA 2B30A 2IYEA 1QH9A 3A1CA 1TJ3A 4XE5A 2C9MA 3A3YA 5AVRA 5AVZA 5E0OA 4UU0A 3FZQA 2HCFA 4KNVA 4JDPA 1X42A 2I34A 4BYGA 3ZU6A 3WKEA 4ZEXA 4HAIA 3BWVA 4UASA 2R8YA 4AP9A 1L7NA 1RKQA 5AW4A 3AR7A 3ZW7A 3KDPA 1U7PA 5AHXA 2RAVA 3R09A 4QJBA 5ALEA 5AW8A 2AUTA 2Q5EA 3NANA 2QLTA 4Y2UA 5AKYA 5ALQA 3ESRA 1WZCA 3AR6A 2BY4A 1Z4JA 5AK3A 2WF7A 1U02A 2GHQA 3QUTA 5AK6A 1ZS9A 3VAYA 4NABA 3QGMA 4Y2PA 3EF1A 1XP5A 3ESQA 2FDRA 3ZI4A 4BX0A 2HDOA 1RRCA 2MSNA 2ZBGA 1U2SA 4EX7A 4G63A 4NAVA 1Z4IA 5A3QA 1L7OA 3W5DA 4ZEWA 4PNHA 3L1VA 5ALLA 4Y2YA 3AR8A 5AW5A 2R8ZA 3L7YA 1CQZA 5AI5A 1FEZA 5AW1A 1T5TA 3OCXA 1EK2A 5AM1A 3W5BA 5AKIA 4QQFA 4UMFA 3U7GA 2WF5A 2FPRA 5ALMA 4C4SA 3NASA 3ZWKA 1U7OA 4BEVA 3B9RA 3GYGA 2C8KA 2FEAA 3E81A 3SHQA 4BNDA 3I6BA 1Y8AA 5AKEA 1Z4LA 2GMWA 2C88A 3QU2A 1SWVA 5AKGA 5IT0A 2EAUA 3QXGA 3QUCA 3R4CA 4EENA 4L6CA 2PR7A 4UAVA 4Y2XA 5AIBA 1T9ZA 1Z4KA 1L6RA 3MPOA 1ZD3A 3OCUA 2FUEA 4EX6A 2R8XA 3QYPA 2O2XA 1KYTA 2AH5A 2AMYA 5AI0A 5AVTA 1ZRNA 4DW8A 2JARA 3D6JA 4BKMA 3ZVNA 1JUDA 2YN4A 2FI1A 1Z4NA 3NRJA 2YMQA 3WK6A 2HSZA 3QU7A 2FPXA 3OTQA 5AKXA 3WKCA 2I55A 3A1EA 1ZRMA 1RMQA 3OCWA 1ZD2P 1Z88A 4UMDA 1U2TA 4RETA 3ZX4A 2P11A 2NYVA 3CNHA 3WKAA 3SKYA 3SD7A 3W5AA 4BNDB 3I76A 1YNSA 5AW9A 4UU1A 3SKXA 1Z5UA 3UMBA 1ZD5A 2YJ3A 2ZBEA 4CF4A 1L7MA 2CFRA 2CFTA 2I6XA 4E88A 5AVYA 2FUCA 3M1YA 1RC8A 2WFAA 2ZG6A 3KBBA 2O9JA 2IOHA 2OM6A 3PGLA 5ALSA 2RBKA 3ET4A 3KC2A 4YH1A 2GHTA 5ALPA 1TJ5A 3WK9A 4AS2A 3ZVLA 3EF0A 1K1EA 1Z4MA 3L0CA 1MH9A 1XVIA 2BDEA 2RARA 2ZBDA 2HHLA 4Y2TA 1VFPA 3AR5A 2W4MA 3EWIA 1NRWA 2YFYA
chains in the Genus database with same CATH superfamily
2J3KA 3PR2B 4FDUA 1PJ2A 1V48A 4ZEVA 2ZM5A 2ZBVA 3C43A 5B3LA 2W22A 4QU9A 3NPMA 1TFUA 3DBIA 3HK2A 3ZEAA 1EQAA 2Z56A 1HGXA 3AI1A 2XXBA 1CEYA 1KZ9A 3TVYA 3ZHSA 1XVTA 1D2AA 1ZM2A 3KQVA 4D7AA 4AJPA 4RTKA 4EJFA 4M8LA 5DGXA 2VAPA 1E4YA 1Z82A 4RA9B 5DB4A 2XUIA 1QF6A 2PG3A 4C0SA 1XEFA 2ZIVB 4C21A 4R40A 2YXDA 4TSRA 4UHFA 2AKEA 3SNHA 3GUUA 3R8XA 3O26A 1GUYA 3WDKA 1ECPA 1FSZA 4IDAA 1IJKA 1TADA 2IPXA 1AKMA 1ZMTA 4QDTA 3ZE8A 2BSXA 4RVUA 2AQHA 4TM7A 1TE2A 4YHHB 3EGDA 1ATIA 1P9OA 5SYMA 2R6JA 1DBWA 5JH7F 1POWA 5AVXA 3Q2IA 4TMVA 4B9EA 4D8TA 3PKIA 3RIEA 1DDGA 4FZ3A 4F72A 1J42A 2EGHA 1R4MA 2JI8A 4MWGA 4WOPA 3PNQA 1GTZA 1R4NB 1R64A 1NYLA 2JJMA 1NATA 1ZK4A 2F90A 3NU1A 3WMXA 4BZWA 4DSAA 1KI2A 3NONA 4ENWA 2XMQA 3IOBA 4QOJA 2YVQA 2ZUBA 5C8YB 4KR6A 1D9XA 4RK7A 3IT0A 3NOOA 2VF4X 4NDNE 3RS0A 3AFOA 3QOFA 2QAGB 4ZT3A 2A4KA 2WUVA 1JDNA 1CC1S 3GUYA 4Q9JA 1CY2A 1KFJB 1OUMA 2BLLA 5FTKA 4DMKA 5FI0B 2DZDA 3L4BA 4DSTA 2CL7X 4B4VA 4H3VA 4K6GA 3RVJA 1TCVA 4JOSA 4N1AA 4JR1A 4LVNA 5EWMA 3IPCA 3M0EA 3DLIA 3PRYA 3WGHA 2Q3FA 3BAZA 1QIJA 2B1RA 5JXWA 3AGPA 1Q7RA 3IHWA 4NNJA 3Q3VA 4Q4AA 4GHWA 5AESA 3AYXB 1BAPA 4G1UC 4GXRA 3GLFE 2Q5JA 2JIRA 4CKZA 2EERA 5HKKD 5F5XA 1ND6A 2OBLA 1ZBDA 1U9IC 3U19A 2OWDA 4JLAA 4WEQA 3EDOA 3ECSA 3PEWA 5ICEA 3DBVO 3V1LA 1QX4A 4F6RB 5JPDA 1I3MA 2V7QA 4RNCA 1WF3A 5FWXB 1DKMA 5AHRA 1R15A 1L5ZA 5KYTA 3H2IA 4ZQFA 1Z2EA 3K6KA 3PK0A 3Q7TA 4LQ4A 1WZUA 4H2DA 4ZP1A 3ZHRA 1ZAYA 1E0JA 2FSUA 1OWNA 1AA6A 3TB4A 1VLVA 3O03A 2VH1A 5L3QA 1RWWA 2H00A 1P2SA 1G8GA 1IBRA 4NOLA 4Z9AA 2Y8EA 3BWYA 4X00A 5EQDA 2NGRA 2X7XA 3AVWA 4YONB 2JGKA 1SVKA 2Q6KA 2B8NA 3C7KA 1HR0B 3ME5A 1J56A 2V7TA 4Y0AA 1N5JA 3LH5A 1MPTA 3GT3A 3A1NA 1RHQA 4BMYA 4DFDA 5LKRA 4MUGA 2ZUDA 3VKFA 3ZKWA 3PC3A 2EP8A 3C8MA 3OIUA 4EGJA 5IAJA 4F93B 1QPGA 3N05A 1XALA 3O84A 4AJHA 3Q6IA 4C6SA 1LX7A 3L1HA 5CB8A 1BA3A 1YCDA 4CZ2A 4TMFA 2DSNA 4D9HA 1GTL1 3K9NA 4DYVA 3QE9Y 4RMGA 1TUGA 4DUGA 1MXHA 4PIVA 3ZQJA 4FFDA 2PKEA 2JFZA 3M6MD 3RVMA 1ECGA 3WRVA 2C9YA 4I2VA 5F2OA 1I8TA 3D6HA 3SLGA 2CMGA 2VJBA 1SG6A 1KYWA 3IIEA 4X1IA 4DHEA 1DQNA 2R4UA 1U0SY 3AUSA 1H2WA 1NFRA 3LYAA 5B2ZA 5K4AA 3FTFA 4F71A 3ZVMA 3CGGA 2Q27A 3SWWA 5JD3A 3MWEB 4DLVA 4E6EA 4NEGA 4I5GA 1E58A 3AFNA 1Q0RA 2PUJA 4Q03A 5K03A 3EW9A 2JKVA 4DWWA 5B53A 4CLHA 4US2R 4HQ6A 4KIJA 5CEEA 3C4VA 3OEHD 2HU2A 2VT6A 2Q4BA 5KNLA 3UGQA 2XY4A 1LXCA 4ILKA 1RHMA 3X1WA 1YZKA 4H6WA 1S89A 4QA9A 3TM4A 1TT7A 4XYLA 1P18A 3SJCA 2HQBA 3WFIA 3GFVA 3ETHA 1U4SA 4DZZA 1PS9A 3D4NA 2HHJA 3LDFA 3RSZA 2OXFA 3I2JA 3S6JA 4EG7A 1H6AA 2UXCB 2NACA 2Q1YA 4W1QA 4RD2A 4OBBA 5HK8A 1G8HA 3IDOA 3JSXA 4U3JA 3FCYA 1VE3A 4GVPA 2FR0A 4HJRA 4KN6A 2FFJA 3K0HA 3PGVA 3HBLA 1IY9A 4BMNA 2YASA 3ZY3A 2K5UA 4A8PA 2G25A 1XQYA 2H29A 1BDJA 2VDLB 4FYXA 4A0SA 2O1XA 4ASUD 3ZIAA 4UXJA 5KJ1A 1YF3A 2DR2A 2HA5A 4M9QA 4BRWA 4CDGA 2P9FA 3BWCA 2PMCA 1XQ6A 5CIQA 3ZD8A 3U3OA 1UBMS 4FSDA 2MDTA 3T38A 3KT6A 3IAEA 2EBHX 1W46A 4I3GA 4KVFA 3B1VA 4BN0A 1NG9A 1V8PA 1R0YA 1TW2A 2O1SA 2RONA 2IA5A 4FYPA 4IXWA 3UF0A 5C18A 4YCLA 1CUFA 3FWNA 1UP6A 1LLUA 3G0BA 3V1MA 4JT4A 1ZCAA 3DQPA 1M67A 1RXUA 4G4JA 5TY0A 5ALJA 2MYTA 3GAMA 1TM7E 5JW6A 3V8PA 5HR5A 3EXEB 5LZ8A 2UZAA 5B7NA 1QAOA 4J0KA 4GYYA 1K75A 4MS3B 1KI3A 2A67A 1SQ0A 3KJIA 4HQLA 5ICSA 1HOTA 2B9VA 2J7PA 5CUQA 4O4HB 4HZGA 1Y6QA 1I1OA 4XQGA 1G20B 2QRGA 5AQEA 2QG6A 4B1FA 3G7UA 4XYEA 3VOAA 4BLVA 1E60A 4QDZA 4Q24A 3UJAA 5T8KA 2J0EA 2E48A 2Z9CA 4FCVA 2GETA 3WB1A 5H1YA 4EPVA 4IJKA 1FYEA 5IKPA 1QH1B 3KVVA 3UMCA 5BNWA 4Z4IA 1A0OA 1IOVA 2JCVA 2VI5A 2WM9B 3G8AA 4HGPA 4XSHA 4XIIA 3SYMA 2Z6UA 4G26A 3B70A 2CMKA 3M3PA 4TLEA 5TQJA 5A0FA 4JA0A 3H1BA 3VPAA 3CSDA 5FTWA 4BLOA 5FNVA 4F2PA 5CDUA 3C1AA 5HGJA 2R6CA 4URFA 4BDSA 1V2GA 2I99A 1OI7A 3P2KA 5KTTA 2HT1A 4R54A 2VJMA 2Z8ZA 5LQSA 2GNAA 4PYMA 3RK4A 1K6IA 1OYVA 5ES4B 3UA3A 5DHQA 3UC9A 1LEHA 1A2BA 4C0XA 3IB6A 3VU3A 3HU2A 2O50A 3L2OB 1JJVA 4ZDKA 3PUYA 1XDZA 3T7RA 1FCJA 3QKSA 1Q44A 5CYGA 3U44B 1H8ED 1PLLA 4F1WA 1VJ0A 2YWJA 2HWYA 2OLEA 1EVJA 1JVSA 2VHCA 1NQXA 1OLXA 2XE7A 3C3BA 1X2EA 3IAAA 3R5JA 4X1KB 2YH2A 2YWDA 3L3BA 4U7JA 3VOSA 4CLRB 4OFZA 5ANRB 3RTAA 3WSVA 2V6IA 2JFPA 4PEVA 4G4SO 1HMYA 3PJGA 3ZDBA 3DBRA 1RE0A 3EPPA 3BGOS 4XVRA 5F3DA 2D1FA 3D6AA 4RANA 3SF0A 3HCNA 3IAM1 4PC1A 3HU1A 4YT4A 4ZK2A 4UMEA 1PZXA 4QATA 2YL2A 2Q41A 1I13A 1X7XB 3LWBA 4DVGA 2ZRNA 2IYZA 4Q5IA 1PGJA 5IKOA 2JLVA 2CJYA 4FHZA 4KMMA 3RSLA 1NOKA 4ES6A 4F91B 3AYZB 2O52A 5KCMA 3BN3A 3HLYA 3CN9A 4N41A 1UFVA 2R8BA 3CU5A 5IVPA 1Q91A 2YVKA 1H1LB 4KQXA 4KX5A 2BCEA 3BD8A 3EMBA 2NVUA 3KXDA 3DKPA 5EIXA 4U2DA 4YALA 1HG0A 3U17A 3ZE9A 2O8CA 1M2OA 4MCHA 2WP8J 1US8A 2QSYA 4OBWA 3KE9A 1REQA 1CZRA 2REQB 3G6WA 2HFJA 2IZOA 3I6MA 1JI0A 4JJ4A 2YV4A 2HMAA 1OB2A 2R44A 3Q85A 1RXCA 5TX7A 2HIHA 2HWUA 3GNQA 1A4XA 3QLUC 3H2ZA 4JBGA 1PNTA 1XQXA 3FNRA 4XIYA 1RXEA 3EH1A 1NRXA 3QVXA 1VYTA 4F1KA 5YASA 2R8YA 3MQ4A 4PVDA 5CH8A 5HF6A 3CVVA 2XUFA 3AR7A 2C61A 3FDZB 4HXFB 4DPKA 2D0IA 4JKIA 5B1EA 2IZ0A 5EG5A 2FHPA 1UQRA 4EFLA 4ER6A 1CUBA 2ACWA 3DYBA 3WNDA 1XTUA 2ACVA 2IU3A 5BSWA 4GUAA 1Z7BA 2BKXA 3AEZA 3A4IA 1B3BA 3F1LA 3ID6C 4BV2A 1W4RA 2I8CA 3CG4A 1Z16A 1IZ9A 4R0VA 1KFEB 4EGSA 2AN1A 3B1JA 2CVFA 1JFFA 2NOAA 1O2DA 4CVNA 5FTLA 1ZIYA 2FUKA 3DZFA 3WRYA 3DMPA 4MGYR 1B8UA 2H1LA 2WINI 1FXWA 1DIBA 3S7ZA 3WYGA 2FJ0A 5JRDS 5JAIA 1GARA 3RQSA 4LJ6A 4UQLA 3E4DA 1JU9A 3ZY5A 1E0DA 3HNPA 3GVXA 5FPYA 2QRQA 3VUEA 2UYHA 2QWXA 1E94E 3KT8A 1N34B 1VGRA 4RZQA 2JNWA 3ZYCA 2XUGA 4PNHA 4TROA 2UUCB 2H4WA 1M7BA 3A1TA 1MG0A 3QTBA 1GDHA 3OZAA 4INPA 4EECA 2XCUA 3ND7A 5CDSA 1X1BA 3FGNA 3H2YA 4I4TB 2CHUA 3C7TA 1DJMA 3ILVA 1N1GA 4MZXA 3U7GA 1CEQA 3JWPA 3RI3A 3ABZA 2EHJA 1S02A 3NDJA 3AU9A 4JBYA 4QECA 4BVKA 3B5IA 2C9CA 1GPNA 1PZFA 3QVGA 4LMBA 4P5PA 5K3AA 4U8HA 1J39A 4H31A 3W4IA 1C3EA 2HA6A 3BXXA 3IV9A 4CM8B 1KP3A 3DCIA 3T9AA 1J8YF 3UV6A 1NTRA 2JDID 1U0RA 2DF8A 4BQNA 1E1YA 1Z4LA 2YY7A 1H6CA 5B1HA 1LZKA 3AU8A 4BFZA 1JJIA 2IS1A 3HWRA 4C9BA 1JT9A 1CRQA 4H7JA 3KPVA 4JQZA 3SPXA 3NS7A 1GUAA 5AOAA 1B15A 4JN6B 2WLSA 3B85A 2WG0A 3D3KA 4NENA 2C57A 2QSJA 1PQPA 4X7RA 4NOKA 5F76A 5FOXA 4BNIA 1CUXA 3ZHVA 4RHCA 1HTTA 4KKXB 3KD2A 4LN1A 4W9RA 2JATA 3CJQA 2UXDB 4EHBA 4DPMA 2WR8A 1XCLA 2IHTA 2EF0A 1W36C 3CINA 1EFKA 3ZGOA 4KFCA 3I2KA 2B7CA 1Z62A 3JQFA 4P98A 3RUAA 4DJDC 4F4FA 4GC5A 1QTQA 3IEVA 4KQ9A 3V32A 3NBZC 2Q6OA 3OD5A 1QS0B 3AVUA 1VIAA 1ISIA 1FFSA 5EIFA 2PV7A 1JFVA 4YRMA 5MN4A 3P1JA 1WD7A 1XV5A 2VZ0A 2AFIB 3MWFA 5DSTA 2X6QA 4LF6B 1U63A 2XYPA 2CNLA 2C03A 4R68A 2IU6A 1NVBA 2WAYA 4ETWA 3HCCA 3L46A 3WQHA 1C0KA 4O08A 4AQ7A 3KQWA 1ZJWA 2RCYA 1V1RB 3CWZA 4DR6B 2HA7A 5JAUA 1TYBE 4IJUA 2H06A 1HEIA 1ETHA 3ZX4A 4ZYUA 4B47A 1DC6A 2H5JA 3QVWA 5A4AA 4N5NA 4PFSA 1QE5A 4L50A 4HB4A 1QFMA 1RPAA 3L7CA 3S3TA 2YV2A 2QJWA 3AEYA 2P7IA 3BK7A 4L9RA 1P7VA 1U90A 5HS4A 3RVKA 1JAXA 4QTYA 3VZQA 1FW8A 4ZOEA 3HKBB 1A5SB 4Q66C 1T9HA 2C00A 3KB6A 1FU4A 2VHQA 1AURA 3SIPA 4E7PA 1R6BX 2PKCA 1E1RA 3R0QA 4TMWA 2HBRA 1G2QA 1R4NA 1BHJA 2YYZA 2BEVA 1EH5A 2VDMB 3H4VA 1ZHOA 2OLKA 2B83A 2GBPA 2OM6A 4ZCMA 2AFHB 3E1SA 2RGYA 1BOOA 3ET4A 4RSGA 4YLGA 1FFYA 1JA9A 2GHTA 3ZCTA 1RQXA 4NZPA 1E9BA 2Y93A 2JEZA 2WT4A 4V0SA 3AFIA 2AOVA 4DDVA 2G72A 2VP4A 2D4AA 3AESB 4RIGA 2DFLA 1KXJA 5C9ZA 2FNAA 4OGGA 2BJVA 3VFDA 3VR0A 2IUUA 4MWDA 1W9HA 3P0JA 2YFYA 3WLJA 5C1OA 5H80A 3NRBA 2AF4C 4L8FA 4OK5A 4OSEA 4ETMA 3VPCA 4R51A 4CCYA 2CB9A 3C41J 1ONBA 1L4YA 2R8OA 1ZLXA 2PAFA 4EF5A 1E2BA 3SP1A 5JMWA 1UOEA 2IGBA 1ZQ9A 4M54A 3R5FA 4RABA 4HEA6 4U02A 3N53A 4PANA 1V8BA 2ZR9A 5JADA 2OQIA 4FOPA 2O1WA 2ZI3A 3CRW1 2OBFA 3UFBA 1TZCA 4DXDA 2OO5A 1YA4A 2EARA 2XMSA 3LCJA 2VHEA 3PXDA 4FUTA 4UUQA 4YRFA 3VNRA 4M8NE 4BBJA 4DJ5X 1GVHA 4ACAA 4EY3A 1B2RA 5CEFA 3TUZC 1YR3A 5G4KA 1Q17A 1BHO1 2LV8A 4KTVE 1EVIA 4YUAA 2ES4A 3I6IA 2OXCA 3KLPX 2YVUA 3I4FA 2WBLC 5JZOA 4X71A 4XWGA 1GT6A 3I6ZA 1AB6A 1NP7A 3M6UA 3OMXA 2D3WA 3UJ8A 5BR1A 1E4OA 1JEQA 3D1VA 4A2WA 2RMKA 3CZPA 3FWHA 1PD1A 3ITDA 4DCGA 3BTVA 4P35A 3VKHA 2PD6A 1FUUA 3BE5A 3WNCA 5DWDA 1HWYA 3FHTA 4X64B 1M1XB 3ESBA 3WICA 1CHDA 3Q72A 4YCNA 4AY5A 2XGGA 4KXNA 4KYVA 4HV4A 5KTMA 3F9RA 3OWXA 1XAGA 4FE3A 4EFMA 5KUTA 2X0RA 5FH9A 2VP3A 1IXSB 2H1OA 2GZ2A 2TS1A 2GK4A 3MXTA 3JTMA 1GCUA 3S5JA 1GUZA 3IDAA 3RC1A 4IPTA 4L28A 3GLHB 1P1CA 3HCRA 2EQAA 4EI2A 3F0TA 4BIMA 3AUJB 1QRDA 3OZEA 1UPBA 2P9JA 3MOSA 2II6A 2IIQA 1X7GA 1I2BA 3BHIA 1NJFA 3HCFA 4B3RB 5GZ6A 4PXAA 1G9TA 1G7TA 3MJ4A 2XB6A 3LHSA 3ZLBA 4RL4A 4E5KA 3R9IA 3Q7RA 1NY6A 4WLFA 4RELA 2I71A 1MW8X 1GHTA 4NYMQ 1DXYA 2BFBB 3HJHA 3NGXA 4D74A 5BUCA 5A62A 5TS3A 3I39X 3UK7A 3ZNNA 1NE2A 1N5KA 1XXHA 2YZ7A 1D1TA 1I9CA 1N2CB 5AUQA 3WHPA 4CRWB 3HJFA 1TAUA 4BJ1A 2ZBFA 1JSCA 5HBRA 2ZB2A 2WU3A 2B6NA 3DEHA 3KNZA 1K27A 5DCUA 5J2UB 2P40A 5KQGA 4URHA 5CT6A 2DQKA 1SY7A 1QG6A 3OAAA 3TBHA 2A8YA 1GSOA 3MW8A 4IV0A 4AF8A 4D9KA 1J90A 2QUJA 5A4FS 3GLGA 4EW3A 1CIJA 1YRWA 3H05A 5D3QA 3GLSA 1PNRA 2CV1A 1IBSA 1Z07A 1LRKA 3SBOA 3D8BA 2BBSA 2VWPA 4LTDA 2QGNA 1ILWA 2I0FA 1ZSYA 3COYA 3OCJA 4Y18A 1KE1A 3TO5A 3JRWA 2JRLA 1GO2A 4DWOA 2OXTA 1M75A 3SIRA 4AN4A 3PNMA 5K4GA 3MFQA 1QC5A 4B82A 3ELBA 1GQ2A 1K8YB 4HWOA 3BQ9A 2BW0A 1U6IA 3EN0A 4I4CA 1XEWY 2GTHA 1DARA 4FMDB 3TTSA 3A6FA 1C0LA 2PK3A 1N6IA 4D9GA 4TZTA 5DEIA 3CLTC 5JQGA 1BFUA 2R8PA 1X7WA 2VDWA 4Q7KA 1DRUA 4S0XA 5CLHA 4YMVA 3RJTA 3PIIA 2OGWA 3L0OA 4NBUA 4MRVA 3OF3A 1XZKA 1JEJA 5AK5A 2NU8A 3JQBC 4DARA 1TAHA 5FL7A 3V8EA 4IMPA 2EZUA 3WGNA 2HCTA 4C08A 1ZM3A 2Q9BA 4GP6A 1CU1A 3FB1A 1N2XA 2IFTA 2J41A 1Z2DA 2VDOB 3LMKA 4I1IA 3WP0A 1RLOA 4PHHA 3EPRA 3RADC 3OLZA 2XH8A 4GXQA 5ALOA 1U3GA 3IAS1 3IE2A 4L6IA 1TYCA 3IOMA 4Y9TA 5D7NA 4C6TB 2XDAA 1GNRA 5C4MA 2WWVD 3W1EA 3IUQA 4MS3A 3IVCA 3R7NA 4AMVA 2B4QA 2FV8A 2F3PA 3E9NA 3LY8A 3AF2A 3OZTA 3M6XA 4BLSA 1TLFA 3OKAA 4BZPA 1F51E 2I4LA 1ZA1A 2OXRA 1TM4E 4UQPA 3ZIUA 3IE1A 4NBWA 4CV1A 1EIZA 5KBYA 2G88A 2VYND 3AFMA 4LJ4A 4V02A 1YB1A 3ZS8A 1GPH1 3GRRA 3KQTA 2OUIA 2HSWA 2BR5A 1NVUQ 3GRKA 4YCSA 3K0SA 4AQYB 4QHSA 4HXYA 4CDRA 5IH3A 3PEFA 2E1RA 3PIDA 4W9MC 1EBFA 1NBMA 3QKIA 4XJTA 5J2TB 3I04A 1BJTA 1WETA 1MB3A 2GNOA 2I3DA 1GCOA 3PWKA 1PTKA 3IRUA 3IQGX 2DBZA 1A77A 4Q1FA 4WN9A 2XVYA 3S2ZA 3ABRB 4TS1A 4DCPA 1AK2A 2WKSA 3LA8A 3NWJA 3ZHYA 2XKKA 1WRBA 4WJKB 4I1RA 3LY7A 4X3PA 3HDGA 1KJJA 2XNCA 3N2GA 4G5QA 4HEA1 4IW3B 3IVGA 3SSOA 5DCYA 4CLRA 1J0DA 1EVLA 4LMRA 1NTOA 2CVZA 1W30A 3F5QA 1R0CA 4LHWA 2HF8A 3DA8A 1QR2A 3U3RA 2HMVA 3SQDA 4BNFA 4F85A 1RLJA 1E2EA 2XEDA 5G4KB 4GL2A 2PIDA 1TTQB 1MRZA 5GONA 4PLVA 3I8OA 1A9OA 2GVZC 3QYJA 4DR3B 1NQUA 1OZGA 1P4RA 2OE2A 1Z5PA 2IL1A 4YP0A 1N7HA 2RHWA 5AWFC 1XZMA 5A4DA 3BB3A 1VHJA 2HGZA 3DG9A 4QJ5A 3H8JA 3CB4A 3AETB 2R11A 1A5TA 2RHBA 3D0QA 5BMVB 2X86A 3GNLA 1J09A 1WCIB 2BSAA 4UFOA 2BFDA 1PS8A 2FSIA 3DB1A 1H0SA 5KB3A 5ALZA 3A6JA 2RBEA 2IHBA 3QOYA 3GG9A 4NONA 4YREA 5K3DA 1Z13A 3FY4A 3T7KA 2QN9A 1O7JA 4D3YA 2H4XA 1JWBB 3IPYA 4L8VA 3LHKA 4ZVQA 3OMLA 5HOEA 4C2TA 2PQ2A 3T0FA 1B0UA 4LG1A 5IEBA 5HTKA 4XWOA 5E3IA 1DOZA 2L82A 5C4GB 1RBZA 3REGA 4B4DA 1QRTA 1VG0B 4K9DA 4TKLA 2VRBA 1WBDA 1P5FA 4WL0A 1FLVA 4V03A 4EIWA 3VU1A 4ZHQF 2DMRA 1CJBA 2ZYVX 4R2HA 1V47A 3C6MA 4XWYA 2H1CA 4U7TB 2ALJA 4PXYA 5CIWA 2UUAB 3PHHA 4DAEA 1PUIA 3UCFA 2VTEA 4BNKA 3PC6A 3GJYA 1IM8A 1JZSA 4E1AA 1X2BA 3LXRA 1KQGA 1YCHA 2VAVA 1VPDA 1ICEA 4K8RB 5FPPA 4IDEA 1GGMA 4N9WA 1SHZA 1VKOA 3EH2A 4IFIA 4RWEA 1O4WA 3W9UA 4D9CA 5C8VA 4KRFA 1M66A 5JS2A 5CYOA 4BGDA 1UMBA 5ES3A 1PQYA 1O94D 3L7KA 1FW6A 3EQ2A 2QN2A 2QTTA 1OZFA 3N5KA 4KO4S 4MYRA 2B8TA 4CEHA 4RJJA 1E32A 5COAA 3IP9A 4ENSA 3KCNA 2C3YA 1IHUA 1CQIB 1UMCA 3QF4A 4OEHA 1GKLA 5E6RB 2ZRJA 3LIPA 1R88A 3K0CC 4NLLA 4QU0A 2GK7A 2JCSA 2ZPAA 4G0OA 2AL7A 5CNMA 3GEGA 1RR6A 1DKOA 3P94A 4HQ0A 1XDBA 2ZGVA 1RSZA 3WBBA 3AJ8A 5ARCA 4QZVA 4OGKA 4U6QA 4B3FX 2WMDA 3JD0A 8GPBA 2EIXA 5JISA 4R1LA 2EATA 3O8OB 1XU7A 2ZJYA 1AO0A 2DYKA 1GTMA 2QZZA 5A2GA 4D8XA 4LBVA 4KDFA 4I4TA 4KK4A 3WWDA 4NG4A 3N07A 3N1UA 1RMYA 1RYBA 3EXHB 1M7GA 5DM0A 3TBFA 3DUFB 4EYKA 3QXJA 4UBLA 3U5TA 4DR1B 3B52X 1OVGA 3PFHA 2JC3A 4Q93A 3IBTA 4KTTE 1PO7A 1ZJ6A 4UU0A 1U7HA 5TPWA 4JZKA 2QROA 1EXDA 4O59O 3MTEA 4KFUA 1YRLA 1F6WA 4HN2A 2WJPA 1QHNA 4PCAA 4IP0A 3E9MA 4ZJUA 1P2BA 4CM8A 3RWBA 1SHTX 9LDTA 3WL4A 1UXJA 3M9WA 3BWVA 2VIIA 2QN8A 2HDHA 5DN9A 4HNSA 3HUDA 1I5RA 4R2WA 4RK6A 4N5MA 4GBJA 3SZLA 1YVUA 1J8VA 1IAQA 3IKJA 4H3KB 1N3BA 1U7PA 4RJIA 1VBFA 1TYAE 1THGA 2PUTA 3AX6A 3MJDA 4XPIB 1L8AA 3I9FA 1PG5A 2C84A 5C51B 4GECA 5E8JA 2JGLA 4D82A 2Q1WA 1P2UA 3NHBA 3Q41A 3QE2A 2FSHA 4FYVA 2V54A 1O1YA 2XUDA 4JLJA 5CA0A 1DIAA 1WCYA 3R24A 3GQBB 4FE4A 3LPLA 4FEAA 4AUMA 2ZITA 3AMVA 3GG2A 1M2VA 1E9CA 1TCCA 2G28A 2WKWA 3IILA 2GS9A 4LYGA 3GJXC 3TPZA 4E2ZA 5LWHA 3SR3A 3I9MA 2PUAA 3NHWA 3EZNA 4G8BA 5CFMA 2ZUFA 5IVHA 3QMPA 2CXNA 4MYDA 2O57A 2QNBA 3HY6A 3U61B 3ESQA 3G23A 1R0XA 3ESDA 3LK7A 4A8JA 2MSNA 3W6NA 4NAVA 1KMCA 4GOOD 4YV7A 3H86A 1JVNA 2QRMA 3C5VA 4ZEWA 3U3XA 1NI5A 3OU6A 2CJPA 1EFTA 1OX4A 3UW3A 4F8YA 4FI3C 1ZCBA 4MINA 3SFZA 1KJZA 4DSNA 3EJWA 3TB6A 4AIIA 3CZMA 1PR2A 4A1FA 4GOMD 2WIBA 4IDHA 1PGOA 1TM1E 5I4CA 2B9EA 3TXYA 721PA 2QTFA 4GT1A 1V37A 1PCXA 3HVUA 4PSAA 1VG8A 1RQPA 4WZAB 2W2LD 3PA6A 2R96A 1YS7A 4LOIA 4LJSA 4S35A 2WSSA 2XQIA 5ENDA 1FA9A 1EFVA 1V1MA 3BTSA 4L74A 2AQKA 1IHXA 3LPAA 4JITA 5KOJA 3F4LA 4FFNA 2J46A 4A03A 1QH8A 3K6SA 3WSTA 1E62A 1QU2A 1E9AA 1KEPA 4IF4A 1NLFA 4RD1A 3TNLA 4D8VA 4B75A 5BYAA 3MTGA 1BMDA 2ZDGA 1PK7A 4ED9A 2GMWA 4F92B 1HDXA 2MMCA 2DUUA 3EB9A 1F6BA 3VYTB 1LNZA 3AWDA 3OC6A 3FOAA 4YRTA 1VLQA 3NVMB 4ATNA 4S1PA 1WXWA 4EENA 1NGSA 2GF9A 3GRVA 1XZEA 5AVOA 3TLEA 4C7JA 1EFRD 3Q0EA 4AYTA 3QKWA 1R7RA 4IHJB 2PR7A 3KVYA 3L6BA 4OQQA 4EYEA 1QE3A 4PX9A 4D92A 1PWEA 1RVV1 1XDGA 1YRBA 5TF0A 1T9ZA 2MR5A 3MPOA 5LBIA 3Q2KA 1CR0A 1ZWKA 1K86A 3AXSA 3LOQA 1M73E 4QT0A 3O4RA 1PQWA 2XZLA 2DSTA 4Q34A 4YRLA 2VLBA 1JZQA 5EGSA 4DY6A 1I0LA 5KYWA 1B43A 2BFFA 3KS9A 3OEEA 3FRIA 3JYPA 4FE7A 4JCCA 4NJEB 4CUJA 5I7UA 1EUZA 2CL6X 2OFXA 1BJRE 1KI7A 1F3LA 2B78A 2IYXA 3Q7IA 2BGLA 2V3VA 3DE4X 5CNIA 4KJZA 3S55A 1NBWB 1UBTS 3ASUA 5SY9A 3Q9LA 3K9FC 2C4TA 2P9GA 1DE0A 1AGXA 2B21A 1YHNA 4N4AA 1W8IA 3FKQA 2A5DA 4IH4A 1W5BA 3VHQA 4ZXPA 3T3GA 4C0HA 4DNOA 4YMLA 1JDUA 5BORA 2PJRA 3H5WA 2EJTA 2XZOA 4B6OA 1NV8A 1RMQA 5HF9A 2GAOA 1I3OA 3VR2A 1Y8RB 1Y4DE 3FRJA 1NX9A 4V0MA 1ZD2P 1DEAA 2PO7A 2KHZA 2ECOA 2DWQA 4EAQA 3ILYA 3HR7A 5TF4A 2ECFA 3U1TA 3O8CA 2ABWA 5JMOA 4ECEA 1NZDA 4GWLA 1TMKA 3HXPA 3R9WA 1KL7A 2VH2A 3HKCA 1EEHA 5BO5A 1TGVA 2WOJA 1E1CA 4YO7A 3I76A 3WGLA 4ROSA 1H0HA 1YKFA 3D8UA 1V71A 4JXZA 1RYDA 5JPIA 4IUYA 2FQWA 2VA9A 3ROZA 3VBEA 4CN8A 3GV0A 5L6MB 3A04A 4FGJA 4B87A 2QRPA 3WR5A 1R6AA 4K87A 4RL6A 1KARA 3ETGA 3ZIDA 2XNDD 1DB3A 1B1AA 2P68A 5JCJD 2RBKA 2FRVA 1OY1A 1USIA 2DHDA 4YH1A 1Q0LA 5JXGA 4NESA 3OZ7A 3TRHA 3B6IA 4DT1B 2QU8A 3BKXA 4GUDA 3DQQA 1KEUA 1QIFA 1P9RA 3CH5A 5FQNA 3HRKA 4LXUA 2RARA 2ZBDA 4QGFA 1M5RA 1EUYA 4KR2A 1Z0KA 1KOJA 3LFHA 2X58A 3PE6A 4UXHA 1W5FA 1XYYA 5C8DA 5CA1F 3PC2A 1SR8A 4P3OA 1KKLA 2BTQB 1URPA 4UZEA 3TKAA 2NTYC 2ZJ7A 3CIFA 1NN5A 3D2BA 1LTQA 4IHKA 2DPYA 1QFZA 3FOWA 3OO1A 2JLWA 4BZZA 3UAZA 5C5CA 3HGMA 1OAAA 4XM2A 2P1ZA 2ZYWX 4CIYA 5FO0A 5FFNA 4K88A 1UMDA 1OIWA 4HQNA 4QOEA 2D1YA 4HAWA 3ONNA 5KREA 5LLDA 1P7YA 3DONA 2WMOB 1GGNA 3IMCA 4DMGA 1G7CA 3REQB 4PC7A 4IG4A 3B8EA 1W0KA 4J29A 3CR8A 4WMLA 3LVBA 5BT8A 1YMVA 2DFNA 5IFKA 1IJBA 3R9XB 2Y77A 3U16A 4A2QA 1AQUA 1T2FA 1XBTA 3NYIA 5JFGA 2ZAYA 4HG2A 1Q95A 3V4ZA 3I42A 2AMVA 2RAUA 4HRXA 3D0KA 5B4TA 2ODPA 4DEYA 4OSOA 1KR2A 1G98A 2C4NA 2PUVA 3D6TB 3F46A 4HDRA 1Z9BA 2GJ8A 2D1QA 3BIFA 1O94C 2C5EA 2DY0A 2P27A 3V00A 5JLJA 2C95A 3K30A 4M1ZA 4OXNA 3ACCA 3RKUA 4CPDA 2HK9A 1GQFA 1JR4A 2JI4A 5JSUA 3ZPXA 4WW0A 4XM0A 3FTCA 3S29A 2R6FA 4YECA 3UH0A 3D8TA 1E2QA 1Y1SA 1HNNA 3L9XA 1EDEA 2BDTA 2CHQA 1AS2A 1L7EA 1RRPA 3RFUA 4QT4A 3G5AA 3DV0B 1NAHA 4QLAA 2D59A 4E15A 3HJAA 3KQHA 3TLGB 2QSZA 2C2KA 3KZKA 4UM8B 1D04A 1JQJC 3I2HA 3QJYA 4FFOA 2D2VA 4IBOA 1V16B 3MTBA 4B81A 3OTIA 4UMVA 2YC4C 1MJGM 3HUUA 3L7BA 3U7QB 3LY9A 4NBSA 4QNMA 4F9TA 3UM9A 2GBIA 2V7EA 3R5HA 3B6KA 2HX1A 5BOSA 2YFHA 3MINA 2WF9A 1YDFA 4UCXA 5DLEA 3W3AD 4Y2GA 4AMBA 1N8SA 2IPNA 1BGWA 2A94A 2CXSA 2PZFA 3K3PA 4Q6BA 1N5IA 2JHFA 1EHCA 2G76A 2VTVA 1UFQA 2ZSJA 1YZGA 2AMFA 3K0EA 4FLFA 3GJQA 5BQ5A 3WLMA 2O8DA 4R2KA 4BLWA 2WE7A 2XQJA 3EWSA 4LXXA 3NKFA 4WINA 4BB5A 1XNRB 3OM1A 1E2HA 1QUEA 4IO1A 1A4IA 4KE6A 3W2TA 1RI4A 3R7WA 1UFRA 3A2LA 2WSIA 3DTVB 3E9EA 4HDCA 5SY4A 3C4JA 2RGNC 3SJUA 2V3WA 2QPOA 4XB1A 5FI5A 4ARIA 1WQ3A 3K09A 1C9NA 1G6Q1 2CD7A 2IP1A 2J9FB 2QL7A 2XVMA 3DAOA 3M70A 4IIEA 3OT1A 3C3XA 4EHJA 4M3NA 4MVJP 1OBHA 1P8JA 1TU4A 2QTMA 4LC1A 1BSVA 1NMZA 1HXHA 2WU8A 3IBCA 3M7IA 2GN1A 4E5YA 1CUUA 3JQCA 4Q15A 1L7BA 1GZSA 3LX5A 3G13A 1SBNE 3NZEA 4ZGWA 2I62A 1ODLA 2DP4E 3GZ4A 1FFXA 3JATA 3K9GA 1W75A 4GM1A 4MEBA 4MVJD 2JIZA 4N40A 3IJEB 5JR3A 2ZRIA 3ZWBA 1VDZA 3S5UA 4C76A 4YAOA 2F55A 1JA1A 2V97A 3H2GA 1A8QA 2P9EA 5TRTA 1CLUA 5HQ3B 4YHBA 4WCFC 4W5TA 5ADWA 1YS2X 3WIVA 4PO3X 2G5PA 4ZTBA 1LVHA 2NPIA 4LYJA 2QRVB 4F2WA 3L8HA 4MWSA 3PZRA 2O4UX 5G3YA 3MWGA 2CDRA 2E37A 4LZNA 3R2JA 1QSGA 5HCIA 3BB1A 5LP6C 2JIQA 4TXMA 4ZCTA 4JP2A 2DH5A 4EA6A 2B5WA 4YMTA 4LV6A 5JBIA 4Q3EA 1OC4A 2EFYA 3KKKA 2PVCA 2AXQA 2PKQP 2ZSEA 3FM9A 4LRYA 4X8OA 3RW9A 1RPJA 2YNMA 2GYUA 3ZUGA 2YJ5A 4YR7A 5BMVA 5IVKA 1U9JA 2VVTA 4J1QA 1U0BB 1WG8A 3Q3CA 2YVLA 1F8GA 5ITWA 3FROA 1EKXA 3DP9A 1QMPA 4TMXA 2JGJA 3TL6A 5B7QA 5BY2A 2Z83A 1B6GA 1NXSA 1ZGJA 2HU8A 3B3JA 3AR9A 4DA0A 3PDCA 4NMMA 1EEXB 1KK1A 1TMYA 1QFJA 2O8BA 2AQ8A 2JFFA 2LIVA 2W6IA 3C7AA 3DPSA 3ETJA 1CCWA 5ULLA 3T54A 1HDZA 2IOFA 4BV9A 2I3GA 1I10A 3KTAB 4N5HX 5BSEA 2VHZA 4LC0A 4B6PA 2HM7A 4NE9A 3NVDA 4AJNA 2F67A 1OLSB 1DJPA 3HB1A 4FFBA 1UKBA 1JDTA 3TE7A 1VIDA 3UG7A 1XZAA 3CEJA 4YK7A 3HJTA 2PMDA 4EW1A 5CTAA 4WNAA 4OHYA 4E21A 2O8EB 3E5RA 4BNUA 1KI9A 5JU6A 3NPAA 3U37A 2X0IA 2DM6A 2ORYA 4YJHB 3A9RA 3CZAA 4JX8A 4WZBA 4I0WB 5CVCA 2PUGA 3E5HA 2A88A 3M82A 1MX1A 1G5PA 2UZ0A 4LS3A 4N5IX 4RK0A 3FWZA 4ZCLA 3RVDA 1ZEMA 1DKLA 1F0KA 1Z0SA 3LG2A 3QG5A 1L5GB 2O1EA 4EHFA 3WGIA 1WXGA 2RGDA 3DOHA 3PITA 5SY6A 3ZZNA 4GU5A 1OI3A 4IO0A 1K6MA 4OLHA 4XPZA 1WR8A 3G0GA 4KGZA 4KQ2A 5KNCA 2GFHA 2VUTA 4BFLA 1H6DA 1RI3A 2AKYA 3FDFA 4JH0A 2NO5A 4YAJA 2NXCA 1EFHA 3Q0IA 4EELA 1TK3A 3QY9A 1P61B 2X77A 2KW5A 4JX9A 5E6RA 1GGVA 1NU6A 1U0HC 3A6KA 3FZEA 1A27A 2H8GA 3GJ3A 3HKEB 4K9RA 5K1ZA 3TLXA 2BFEA 2E4YA 2EFEB 3KXIA 1H9AA 4LY6A 4UFPA 1RXVA 3VYWA 4D26A 4D3DA 5P8WA 4U2BA 5HIMA 2JD2A 4O8CA 1OU4A 1W49A 3EG9A 4IGIA 4E5UA 2D3TA 2V7WA 4QBTA 4R8LA 5AK0A 1XK7A 2GNPA 3E0XA 2O2YA 4H4CA 3KLNA 1Q0QA 1J1UA 1KQOA 2PS3A 2R62A 2RKWA 2CL5A 2B82A 3ZXUB 1CSEE 2WICA 4L3WA 1MIOB 1AG9A 3EZ7A 3NOXA 1LA2A 3OTGA 2J5RA 3QMWA 3TJZA 3L8GA 3H8VA 3U31A 4A3SA 4MS4B 2VSYA 4BNVA 3FCAA 4GL4A 3WIOA 1AGYA 1NDUA 3O5AA 1I5EA 2XZDA 3OPQA 1EJBA 2J87A 2NSLA 4I8IA 1WO8A 4BKOA 4KYIB 2HMYB 2W6OA 4YXWA 1JG4A 2VUIB 2XYGA 1LKZA 4I3HA 3IMFA 2J3QA 2J3IA 2PGDA 1SXIA 4X1YB 5AHWA 3M5WA 3RHZA 2Q9CA 3IVRA 3DBHB 1TJ4A 2JD1A 4G0QA 5E9WA 5B3AA 1G8FA 4XPIA 4GYJA 4A9AA 4B3XA 3VYRB 2FSFA 3KL4A 3H11A 1NR1A 3T15A 5DWVA 4IHAA 1O89A 4PE5B 4BVAA 1JAIA 4TRJA 1M6WA 5ALRA 5K8CA 4FKMA 2HPZA 4XJVA 2GPBA 3U40A 1GV1A 5E6UA 4ZJPA 1N77A 2CLHB 2W7TA 4RQUA 1XZCA 2QT9A 4O2BF 5CBPB 3WBKA 2WWWA 4D5GA 3EXG1 1N57A 2HPHA 4KVAA 2QTNA 1ADCA 1PWHA 4LRQA 2FKAA 3RODA 2X8LA 4H7HA 1H5QA 3BORA 2ZK7A 3C1OA 2LBPA 5LPNA 1BKDR 1GGKA 1TZBA 1U2GC 2UU9B 1DAHA 2PPLA 2X3FA 4PO8A 4CQNA 3OECA 2OV6A 5A0TA 4GE3A 4NWIA 4JMLA 4CT0A 1U2RA 2R7LA 5GM2A 1ORTA 4C7MA 4YUXA 1A9YA 1ZJ5A 1UBHS 2QI9C 2JHAA 2Z98A 4Q05A 3TDKA 5FV4A 2OG2A 1P7PA 3ZBPA 2C3OA 3G7SA 2CV2A 3EDMA 1RLUA 2VJLA 4XE5A 2A2ZA 3FJYA 5ITZB 2ODNA 4P82A 1MX9A 3NIDB 3M3HA 4B5LA 4LWZA 3OFVA 2PJUA 3KOMA 3WE7A 4OOEA 4IRUB 4WESA 3NTLA 3GXBA 3RIXA 1X42A 4OYYA 3H6GA 4LOAA 3QPUA 4M46A 1JE1A 3OLCX 2YHBA 1CUIA 2OHXA 2DUWA 3GN1A 4RW0A 4JB8A 1S3GA 5T4EA 1FSFA 1M8FA 1VE9A 4MGEA 1JU4A 2F7SA 2IYQA 3ANYB 4FDAA 4NCIA 1FFEA 4Q82A 4BU1A 1JECA 1MAVA 4INAA 4U7WA 2Q7OE 3DVQX 4KGVA 3RSGA 1IHDA 3QQ5A 4QOSA 1LVUA 4QDJA 3LX4A 1K5DA 5H81A 4EPYA 1BCSA 3KOWA 3IPAA 4HD8A 4I5IA 5TR9A 2FLKA 4IHJA 3D54D 3E35A 3USZA 5JYBA 4LHEA 3T3PB 3CF0A 3SZMA 1NIJA 2WKRA 2NAPA 4J0GA 2Y76A 1JMVA 1G21A 1C30B 2XECA 2DBRA 4G9EA 2EZ8A 1ZS9A 2OV4A 2Q2OA 4FYYA 1BQEA 3F3MA 2VDKB 3QGMA 3R0VA 1VJTA 3LHIA 5E7MA 4DLLA 5ITSA 5JZ9A 3KQNA 4M4SA 2DE0X 1N1EA 1DVRA 2JLZA 4C87A 3F78A 4MVYA 5KTSA 1E3EA 2G5GX 4I9HA 4DRZA 1S96A 1Z6XA 1C2YA 1GD1O 2K7ZA 3CRVA 4V3BA 3SQLA 1SQ6A 1JKJB 1J1IA 1Z6PA 3FKSD 4OXXA 1MC1A 2F1KA 4MS1B 3MMNA 4EITA 1PJRA 4H7EA 1PV2A 4JLSA 1B23P 1YA8A 2AJDA 4IVRA 4I9UA 3N6RA 1VB3A 1KEZA 2YWFA 5CVJA 2NXWA 1QQBA 3LVRE 2CXXA 3BXGA 3CS3A 4G41A 3FI0A 2PPVA 2PJZA 4B31A 4YUWA 2VJQA 1RT9A 1XROA 1YQXA 3AHDA 4K8OA 4QQFA 5EMKA 2Q6LA 3OURA 3TQCA 1FFBA 4C0WA 4IJ5A 1YRAA 2EQ5A 3MJRA 3PGKA 4XVUA 3WIDA 3ROMA 2AW5A 3AEUA 3H65A 4YJ2B 2ZBUA 3B38A 1H69A 3H5LA 5TS2A 1KP9A 5A9SB 1GRVA 5BVHB 1BEEA 1OASA 2PYZA 3NIFB 2FEAA 3OY2A 4R1QA 1QTIA 1DC7A 3GGOA 3GUVA 3INYA 1X77A 2WFLA 1W44A 3UK1A 4LF9B 2M32A 3UUFA 3TR5A 4X65B 3DE7X 2FFBA 2C7QA 4Q3DA 3MOIA 1T8YA 4CN9A 2G9RA 4KPUB 4ZPXA 5C4IA 4TS3A 5EYPA 3IT2A 1L4BA 1OI2A 1PR0A 1C4XA 3DT6A 4LDPA 4ON9A 4FDTA 3V4SA 3RYCA 4B4UA 2YYSA 5EXPA 3DWIA 1BTOA 1DL5A 1G291 4C78A 1CY7A 1I1HA 4UVGA 2L0XA 3ASVA 2FUEA 3H8SA 4GOND 4Q9IA 4ZGGA 1M83A 4QHYA 1YFZA 2AH5A 1UPXA 1Y3BE 1Q7EA 2HEIA 3FBWA 1J49A 1N1MA 2NP6A 4NAHA 2HSGA 1CY6A 4FJ0A 3PUVA 1ZQ1A 5KQMA 1QBKC 2IS4A 3ZVNA 1XJ5A 3M6WA 4PYNA 4HGZA 4NPHA 2YN4A 4HWGA 1ETUA 2YXNA 2C2BA 3IC5A 3W4KA 1ECJA 3TVTA 4F5ZA 4QRHA 1EQ2A 1RJFA 2W2KA 3K9WA 3L01A 2BGRA 4C1BA 2GBFA 2OHGA 3I92A 4MQFB 1GNPA 4YDQA 4UHJA 5CAEA 1F4VA 1GYRA 2JGIA 3QA9A 3IP6A 4UQOA 2X0NA 4XRRA 3FCOA 1IOZA 2ZAMA 1GRCA 1DMSA 2I1QA 3PL1A 1GADO 3Q15C 5LQDA 5I4KA 1OQAA 2A9JA 4R8MA 2AV6A 1F4LA 2J09A 3LX8A 4XUEA 5TQVA 2P11A 3T1YB 5HRCA 3A4NA 1YB4A 3GAZA 5F23A 1EZ4A 1ADJA 3BK1A 4PGMA 3ROQA 1NVMB 4CFSA 4NFHA 5DE3A 4QUJA 2JLRA 3BTUA 2HO5A 4NE7A 4OM8A 1OXTA 4NYJQ 5FBQB 3A3OA 3MVEA 2IZZA 3A06A 4OJYA 3ZU3A 4G0PA 2N46A 3OE7D 4IR7A 1O5TA 4Z0PA 4KQIA 4HPXB 2H2DA 1BYUA 4F84A 5LXTB 2JK1A 4XZ3A 3H3XA 4DUGD 2X40A 3SHVA 4AUEA 1IY0A 5M5BA 3RUEA 4KPEC 4FMCB 3ILXA 1LY1A 2ODEA 2QAJA 1CWUA 3DZCA 1UJ5A 5K2MA 3WK9A 1TQDA 4D96A 1ZG3A 1JB1A 1XLWA 3TBKA 3TKYA 4CLOB 2XUKA 4N12A 2DQZA 3IKTA 2OC4A 2BKEA 4RS4A 4HO1X 3WL6A 2P9TA 4LRXA 5KKAA 4BUZA 4RPJA 1MTOA 1UBGA 3KV3O 3EHDA 3VPDA 1V25A 4EQ6B 3DKIA 4QFBA 4LSZA 1I0ZA 2W4QA 4PLZA 1E5VA 4LDZA 4V3CA 2QK4A 4LXGA 1GG9A 2VT2A 1GA4A 2AXEA 1FMTA 2SICE 1E7SA 5HKBA 2EKLA 1KA9H 1S7GA 1KDPA 2CUNA 3L8MA 1SVIA 1QLJA 1WX1A 1XMVA 3U13A 2IK8A 2WF6A 3EXFB 3W5UA 2FQYA 4EKGA 1SC3A 2BZ0A 3W8RA 1KGDA 3ILHA 4AKIA 2QD5A 2FX2A 4ZRDA 1RZ3A 5JD4A 4KAFA 3HB4X 3A6DA 3OFSA 5EJMA 5JEEA 3HWX1 3G79A 2R86A 3QFTA 2ERYA 2P65A 4RO0A 4Y9SA 1I3LA 4AWXA 4XIJA 4HVCA 2OENG 4RMHA 4BO8A 3SIWA 1O77A 2SECE 3N75A 4NZYA 4H1VA 4HY3A 1CUHA 2EEPA 3RKSA 1UINA 3WZLA 2P78A 1QZUA 4BZXA 5K51A 4EY4A 3ZIAD 2DEUA 4JEHA 2XOKA 4MLCA 4O3MA 5HEKA 3A1DA 2IITA 5EKXA 5DZSA 3F6CA 1W73A 1EBBA 3U9TA 2FFQA 4MIEA 5DH9A 1H65A 1UBRS 3IMGA 1EX1A 2YQ4A 4EYSA 3DTVD 5IF3A 4NH0A 4RLSA 3A4VA 2HXSA 5B7GA 2OZLA 4TLLB 1EIWA 2CDAA 3HYNA 2FPMA 2EGUA 1K3TA 5AKLA 2PMBA 1DXOA 5IM5A 2I5PO 1P62B 3WGKA 3OKCA 3L92A 1NOIA 2QL5A 5B58C 3RT1A 4ZANA 2WZCA 3RFTA 4CG0A 2WWRA 4QYMA 3BJMA 3DL4A 3JX9A 2F9LA 1HZZA 2J3HA 3LLUA 1PGQA 4HLUC 4PZAA 4CG2A 3HO6A 3GT4A 5MHTA 1Y8QA 1GGHA 1I7QB 2W6QA 2FCRA 4Z4EA 2ZT6A 4OYLA 3WIEA 2H59A 3DLHA 3RRYA 2F2TA 3N2LA 1NFQA 1ZI6A 1HY3A 2G9ZA 3NTUA 5HIJA 2GJ9A 5BVGB 3BSWA 2FR8C 3LLMA 2LW7A 3KQSA 4KG7A 4IKPA 2DBVO 1NVWQ 2G6TA 3T1TA 3BBLA 4IV8A 4BFXA 5C7YA 3ZGYA 1ESEA 4ZT7A 2VTBA 4I9GA 5A0VA 4KI7A 4A2CA 3D3WA 1PFVA 4EH1A 4KIFA 1NM5C 2H16A 1E7MA 3KTOA 4ISBA 1ODTC 2OXEA 5SYNA 2IYRA 2NO1A 4J4HA 4A27A 3D59A 1FQWA 4JLNA 5FAXA 4GR5A 2AW3A 4IQ8A 2RGCA 1EWQA 3WLOA 4EFDA 4HWKA 1MCZA 3ESZA 1HYGA 3AUAA 1VJ5A 3T06B 5KKCA 3MT9A 4QU5A 3A9SA 4RX1A 1MF7A 3AEKB 3HZRA 2GJ4A 1BDMA 2UUBB 5B6JA 1MB4A 1P1FA 2FZVA 2H1VA 4WFQA 1KK0A 3BMOA 3MTDA 4PSDA 3LP6A 1YWGO 5LBTA 3ZU4A 1C3OA 1ULBA 4HS4A 2O8EA 5JAPA 1IXZA 2Z2XA 5JALA 3JYLA 3FJ1A 4MV8A 4YJHA 4JUAA 1PJTA 3M6IA 1SBYA 3CNEA 3VSCA 3PA8A 4EB8A 4P4GA 4JLUA 5BWCA 3EGVA 1PZEA 1S8AA 3SFVA 1EFPB 3TLCA 3A8TA 1CF9A 4BX3A 1GPYA 4F4IA 4YQEA 2J0UA 4CTMA 3K9CA 3B1KA 4K6KA 3RRBA 2X23A 4EW6A 4HAYA 1WY5A 4CIBA 4C4RA 4EK9A 2EFDB 1N5MA 3O4IA 4NFLA 1M6VB 3G9TA 3L6OO 4GPEA 3E03A 1GA1A 4I46A 4AI6A 2VA8A 3M6VA 1G7SA 2VOEA 1Z6TA 3MT0A 1R6DA 3L82B 1YQGA 1Y4ZA 3T35A 3U4QB 2H2HA 3BD9A 1W76A 5E4TA 1T9KA 4M9SA 4J8PA 4NYIQ 3PR1A 4BGVA 3O2NA 4WBNF 1A9XA 4MVJE 4RKQA 1J97A 5NULA 3ENQA 1TZJA 2ZJ3A 3RASA 5FAKA 1E3QA 3NYRA 4DANA 1Q2UA 2C7GA 1VPLA 4ZDIA 1XZIA 1YZHA 4GRDA 1OGYA 1FLAA 1CIVA 1T3SA 2E4XA 4JJGA 4M9RA 3BCUA 5LLTA 1U2EA 2GM4A 5ALKA 5EIOA 3WO1A 2KX7A 1G3IA 2HRDA 3HQ4O 4WA8A 3EY9A 2AHOA 2JLCA 3DTNA 4HEJA 4EI7A 5JS1A 4WECA 1W6RA 2BF7A 5BXYA 2XDQA 1H5UA 3INGA 4CLXA 1IRIA 2NADA 5JJKA 3LY5A 3NATA 2FVXA 2DTEA 3NFYA 3MNFA 4QXOA 1MFZA 1P2GA 3S8MA 4H7DA 3PJRA 3HEAA 1D2NA 4L08A 4H4EA 4F04A 5JNVA 3L4BC 1YC2A 3SXJA 4BB9A 1E2NA 1TTPB 1XZNA 1TJYA 3QPCA 4W5HA 1BE0A 5E7JA 3VR5D 2YVAA 2EIHA 1E99A 5HJ5A 1O03A 1Y1TA 3ZWWA 3LS2A 4DJTA 2HL6A 3U4IA 3SHOA 3SSAA 1NYTA 1V5IA 5BSTA 2ID4A 2JIPA 3ABQB 4IVNA 5FF9A 4TLMB 4DNPA 1XL1A 5AUNB 4LF7B 1FFAA 3E7FA 2GM3A 2YWGA 3HPQA 4QM7A 3K0AB 4N5DA 1AQJA 4L1KA 2IH2A 1ISHA 1FY2A 1HNXB 2EFCB 1NMQA 5DNEA 2R5FA 2HCJB 3PXBA 2ZSKA 3C7CB 3A28A 3UA4A 1NOJA 2A1IA 3NHSA 4KGDA 4ND8B 3U26A 4GZ5A 4KV7A 2RAPA 1F2TB 3ER9A 2P79A 2ZRCA 2ZRFA 2WAMA 3DBLB 1WSWA 4EG5A 4DLSA 1UJ6A 2PX2A 2CNWA 3CE6A 3EZXA 2R65A 1AQNA 1Z2OX 2OMEA 3BIJA 1L0BA 5BQXA 3NVKI 2P9HA 2RI1A 3PQ2A 3VR6D 1Y6RA 3ECCA 3N2ZB 5EXSA 1YBFA 3R3UA 4MO2A 3WFZA 4QG7A 4WFJA 1WUJS 2EFJA 3S0JA 5I7EA 5LP6F 1ZH8A 1P4HA 2G4LA 2OHVA 3N7TA 4ME6A 5D86A 5LP1A 4W8HA 4BWVA 1KVSA 4C4OA 1RC1A 3UXHA 1H2RS 3TCKA 3CNLA 4KRYA 4WGGA 5JECA 2H65A 4I50B 3QOXA 3LFUA 3VO2A 4UE2A 4NMHA 4DDKA 3K16A 3DZHA 2IHZA 1A9PA 1R9JA 4I08A 4MUAA 1BWSA 4TTAA 1CP3A 5AI4A 5THXA 1IK4A 3P4YA 1TVKB 2Q3CA 2XJ4A 2Q5CA 5G0TA 4IWYA 3EDCA 3VZSA 4QJ4A 4CKEA 1FQKA 5JJIA 2RGUA 1KIAA 3RSFA 5JJ5A 1A9ZA 1LWOA 3GEMA 4YGYA 4B6SA 5E95A 3BL8A 2JEOA 3L0PA 1M33A 5KAMA 3U7EB 1H3EA 1CULC 1SZPA 3ZW9A 1P80A 1FOEB 4I1YA 1ZHFA 4MW0A 3BUSA 4TX1A 1TIPA 1MQSA 1HOXA 4WOBA 3SX0A 1PW5A 1JR6A 3AB7A 4RV5A 5DN6D 4B2IA 2XBUA 1CUJA 4ZI7B 1ZGAA 5J43A 1J7KA 4PAQA 2XNHA 3FUTA 1KAQA 3SGLA 2OBXA 2QGZA 2YV5A 3BCHA 3HB9A 1EK1A 4I8XA 4UEWA 3TECE 4UULA 1JB9A 4D3XA 4URUR 4J0IA 2YW2A 4MYTA 2HRZA 5I8WA 3NTQA 4JS0A 2ZREA 3NDRA 4JT2A 2GLXA 5AUPB 3REOA 2C1XA 2DHCA 1GRNA 2HB6A 4O4IF 3WRXA 4AZ3A 4EOGA 5K0FA 1BS2A 3BH0A 1NC1A 1SXJA 3VC7A 4ZOQI 1D2EA 2PLAA 1DELA 1JMYA 2O3TA 3B82A 4S1OA 1SOVA 4EYQA 1FMCA 4BWYA 4PNEA 4TXJA 5C1BA 3LPDA 4OUKX 3NLLA 3ZDQA 3LDGA 2X9LA 3HDQA 3ND8A 1L5WA 1MZVA 4FEEA 4P34A 1FNCA 2N0SA 2D5LA 4DC1A 1M2WA 4QDKA 2ATCA 2O5EA 4MS1A 2JGAA 1SCJA 3H1FA 3P97A 4OL9A 3DOEA 1SWWA 4YMUA 1TGYA 5AIAA 3W7AA 3EXIA 2FZKA 3JARB 2BP7B 3GLKA 5C0OE 5AO9A 4C3OB 1FPMA 2CCJA 3RTGA 3IA2A 1KEEA 2W0MA 1QV7A 2YR0A 4ZOLB 2TSYB 1BRMA 1LBHA 2OV1A 2X1HA 4P31A 2FW9A 1JKFA 3BHJA 4IJ6A 4DQUA 3CVWA 4OLBA 5LQJA 2BFCA 2NYRA 1ZESA 3HA5A 4RLQA 2CLDX 2HYDA 1B6TA 3PC4A 3WHIA 2ZROA 2EHDA 4B0OA 5BVHA 5L3VA 3OPYB 1FDVA 5KYVA 3V6LA 1IB0A 2WJ3A 2O8FA 2YCBA 1Z06A 1ZJZA 1V3QE 3ZZMA 3D3NA 3DTTA 4IRXA 3KDPA 2ISCA 4NATA 3BWBA 3QIAA 1CFZA 1JG6A 3ZVRA 1L7XA 5AFSA 3OQOA 2VBFA 3H99A 3UOGA 2Q5EA 2O5RA 5HX7A 2C96A 4KPUA 3MCVA 3IQHX 4WWHA 3THOA 4D4HA 2VHTA 3IAFA 4ENRA 3DHEA 4NFYA 7REQB 2GCGA 2I4MA 2ZB3A 1Y63A 4YUYA 2Y99A 3BJZA 4MI9A 2NP7A 3QY0A 1DJLA 1E7RA 1ENPA 2QTAA 4K9PA 3S68A 1D7OA 3VR3D 4G8CA 2YW9A 3AKCA 5FWNA 2QZJA 3QEJA 5T8KC 1N32B 2EBWA 3L8YA 3OZIA 4CL3A 1NNI1 2Q45A 1BMFD 2AG6A 1QO9A 3W78A 2GF2A 2D1RA 2NQ8A 3BE4A 1YE8A 3STVA 3F7MA 4CUZA 3QFCA 1P5JA 5CR9A 3OZXA 1EHIA 4E94A 3EC7A 4XR9A 2TMGA 2I6UA 3O21A 2FSGA 2QUBA 2GPJA 3L7JA 1FDSA 2O0LA 4I36A 4C7KA 1MP0A 4COOA 1JXAA 4X91A 4MWCA 4EEZA 3BWXA 2QP4A 4JSTA 1KYVA 3TX2A 2VNAA 3FLMA 4CYMA 1F2UA 5CK5A 2XLBA 4K6CA 3FUXA 2B5VA 2VWQA 1EVKA 5TQ2A 3ZNQA 6LDHA 4FKZA 4O4LB 4E5SA 1KOGA 2LUOA 4RTJA 3COSA 1ISGA 1W2WB 3ZDXB 1FU7A 1N8KA 2PWYA 3QVLA 4FD2A 4JT8A 3UXEA 4B3MB 1BQ3A 1KJQA 1ACMA 2J85A 3GC6A 4FCTA 1FLDA 4GSYA 3Q9UA 5ALMA 5EZYF 3SEZA 2GN2A 2OK8A 1ULHA 2PTGA 4YMHA 2HBQA 2KBEA 3E7PA 3M6AA 4JJEA 4Y1RB 4N8SA 5A03A 5EJ9A 1JHPA 2BH2A 4TWIA 3W06A 2W2OA 1K8XB 2P9QA 1L4LA 3GNSA 5EP3A 2YY5A 3RNOA 3X1JA 3MIIA 3THXA 4BPBA 1E1MA 2C3UA 1WZIA 3LKZA 4ZAZA 3I6BA 1P3JA 2IW3A 3BZBA 1ZZGA 4FDMA 4D0NA 4DDMA 5EIEA 4C1NA 1I7SB 2ZLBA 3HDVA 4ZHQA 1H4QA 1DZ3A 2W2XA 3THWB 2QW0X 3IUJA 1EG7A 4J16A 5FFMA 3VNVA 3G5UA 4RTMA 3SEAA 4BLPA 4QJIA 3NUGA 5FKJA 1OGJA 3QUCA 2JK0A 5K8TA 1X7DA 3BG5A 4L2IB 1GUFA 4JQSA 4EKNB 5KWSA 2WB2A 3KYDB 4NBKA 2GHRA 3L1IA 4MITA 4TRRA 4G5RA 1OXXK 4TV8B 5LZ9A 4UAVA 2GVNA 2XYHA 4EPRA 4UUPA 2JBAB 4LBWA 3CUEF 1RHJA 1AD2A 5DYYA 1KU0A 2PGOA 2FXVA 3QYPA 4OHPA 4BJ5A 2WWYA 3CQ9A 2RSLA 2CDNA 1WXHA 2CVPA 2D1SA 2HK7A 2P0AA 4FOLA 1S3SA 4HLQB 1CXZA 3N0VA 1MXFA 4CF6A 2SCUB 3AWIA 6PFKA 1P29A 3A32A 2AS0A 2ZKLA 1K0FA 2KSQA 2PS9A 3GFGA 2C3MA 3DAGA 3PF8A 4PCVA 4NZMA 4XX1A 1T5OA 1RXWA 4D43A 3LWNA 2AG5A 2WLTA 4QRIA 4E33A 4H4DA 2FI1A 1QXSA 3G49A 5ESWA 5SV2A 3RARA 1RYZA 3P0EA 3V42A 2Q2WA 5M7EA 1R12A 4PGFA 4XD7A 1L3IA 1NBHA 1I4TD 4I1OA 3I9KA 3WLPA 1YOVB 3ZXSA 3OQHA 1SCQA 1HTBA 2V4UA 5FR2A 1Z0UA 3EXFA 5DX0A 3DC2A 3E1KA 3WWOA 4CKYA 1HDIA 3KBOA 5D84A 1T34A 3M81A 1P1RA 3HBJA 3OZDA 2D5CA 3UVEA 3HMQA 4XYBA 1Z88A 1NNEA 1U6JA 2OKCA 4C88A 1EUDB 4IIUA 1DEKA 1TRHA 1FDUA 1LDEA 2HLDA 3NHYA 5FL3A 1XZPA 2OFFA 1GRQA 2QRHA 3AC0A 4LHZA 3KOUA 2AEJA 1QMGA 5FYQA 3UJBA 3WRYC 1I2DA 5JSKA 3KXLA 3U62A 2CMHA 3COJA 2PN1A 1D07A 4DSZA 5FI1B 2LXNA 1OFIA 2FU5C 2QJRA 2GWHA 4DMFA 5TPZA 5F1YA 4N6NA 3HCBA 1EJ2A 3MTQA 1Y0BA 2I65A 1L2TA 2P1DA 3KETA 3G59A 4CEIB 1I4WA 3GLIB 5C5DA 5KS2A 1C14A 3FAKA 2C5BA 5LZ5A 5FOSA 4BJHB 1B26A 4QUHA 2V96A 4WIAA 1WWKA 1XJWA 4NNOA 5CVTA 4J07A 2BI8A 4A8HA 4ZYVA 4F86A 5ALPA 4OPMA 5ER6A 4FR0A 2HK8A 2FN7A 3DE0X 4K40A 3T6KA 1E9DA 2PEZA 1ODCA 4L73A 3VHXA 5A5VA 1L7RA 2D7JA 3C3EA 1FVOA 1FSGA 4RYDA 3T5GA 5C2JB 5IX8A 2GEFA 1PJ8A 1H1DA 2HHLA 4JA2A 4CL0A 2WA2A 1PR6A 4MW5A 3MGKA 5BSKA 2IPOA 1NR7A 1YDWA 1GFSA 1RE1A 4PG4A 3JQAB 2G1UA 5M2QA 1Y89A 1EXVA 2QXUA 4QPPA 4DZRA 2Q3LA 1RVDA 3B12A 2ZEJA 3KU4A 3F74A 3NTOA 5TMDA 3TNYA 5F35A 1QNLA 2BM9A 3AEQB 1NN3A 1BNCA 3P8ZA 1Y48E 3U49A 4U7GA 3LX6A 1GXSA 1UDWA 4EEXA 1Z47A 3T3IA 3CW2A 3IYLW 2B34A 1JKXA 3OQIB 2BBWA 2RHGB 3CWQA 1XQ9A 3BFKA 2FP4B 1QIIA 5ALWA 5K0CA 2YICA 3E7XA 3IOEA 3JQDA 1GEEA 1QU3A 1G0NA 121PA 3AF4A 3M9LA 4B8WA 1BWQA 3DDUA 1PR9A 1KAOA 4LKOA 4YP7A 1NXOA 1TZKA 4JI0B 4NCKA 5E3HA 2KB0A 3ZDZB 4UUNA 2Z3ZA 5MF6A 1X1RA 4D42A 1CRZA 3PCTA 1YB7A 3JQFC 1N9GA 4MIOA 3K73O 4RPGA 3OPYI 1HQCA 5CX1B 3KKQA 4BVBA 4QVGA 4TKZA 3JQ9A 4PZDA 4EJSB 3P96A 3E58A 3WLSA 1TUBA 3N5CA 1XNGA 3MYYA 1JWAB 2AYYA 4YAWA 5IJ0B 5J4YA 1Y9JA 2EWVA 4Q3KA 5JPCA 2E0IA 4KXLA 4ML3A 3FPJA 2ZXEA 4KBFA 5AVWA 4EB0A 2A9RA 2GX6A 4EB6B 5MFPA 1B6RA 1SXPA 1WMFA 2ZVDA 2BGGA 1TA0A 1NDQA 1LS1A 1T5LA 4RXTA 2E4UA 5J63A 2NPOA 4PS0A 3FHJA 5CFLA 1YC5A 4F4CA 1RQRA 1GZ5A 1IEVA 3GCDA 1R0KA 5H9WA 1U2DC 1UT8A 4QUIA 5GOTA 2G70A 3EAQA 2PRSA 2DXIA 3HNOA 3PE4A 5CB4F 1G42A 4F5DA 3P4XA 5FO1A 1GL7A 3DDCA 2BUBA 2O2SA 3U4QA 4ICIA 3RTCA 5IJXA 3ANXA 2O54A 2OCIA 4Y1GA 5K8JB 2QQEA 1K5PA 5HDQA 4L51A 4CFYA 1HQYE 5JH7B 3TG2A 1C8LA 1KQPA 3O4HA 1DLJA 1GAWA 4JMPA 3BT7A 1YJBA 3P27A 1MNQA 5HF8A 3NAGA 3V6MA 4Q48A 3HVRA 2J3LA 4RYLA 4DMUB 4MDHA 3I2GA 1SCAA 4ZOAA 3RVLA 1C80A 2IIPA 1YUMA 1ZH2A 5K5EA 4G0YA 3W8NA 3WJ7A 4N76A 2NO7A 5GPBA 2QVGA 2WKQA 4GPBA 2NV2B 2NSYA 3DD5A 4AY3A 2BGMA 5MN5A 4QFDA 1I36A 2P41A 4KLRA 1TYEB 6NULA 1K4YA 3AOEA 5KZMB 4J1NA 1OXKB 2SNIE 1IPFA 4BNYA 1SRRA 3BDVA 4GI2A 3C8UA 3KT3A 5FTJA 1YIOA 1XB2A 3PQ7A 4BCBA 1YFLA 7YASA 3GGJA 3MD0A 4DMCA 4YJFB 4C0LA 1FSSA 1VC2A 1U9ZA 2AGVA 3BWEA 4DL9A 5JBNA 2ZVQX 4NTZA 5FHRA 1XD2B 2HEGA 4MRPA 4F6LA 2Q4OA 3LI2A 5FB3A 5AVJA 3VDNB 2A5GA 1MVOA 2WZDA 3EVTA 1BDIA 1PWYE 1VJRA 2C7VA 2QM0A 4IXMA 4MSUA 4UXIA 2QMUA 3FGOA 5AXBA 2AVDA 2B4AA 3ZC3A 1GPAA 2CGEA 3CZ9A 1MR3F 3EVEA 1YQWA 1EE2A 1R8YA 2OO5C 3GFSA 2YJTD 4PPQA 1HPLA 2JCBA 3JZIA 4WY8A 1FX1A 2Q0HA 4IQGA 1XFAA 2YJ6A 1O95D 3WDLA 4FKBA 3CE9A 1QRRA 3HTXA 3EIWA 2IBMA 2I87A 2Z9BA 4LUCA 4K2AA 4Z9FA 2VC2B 2PSJA 4KU4A 5FRDA 1ESNA 3L0BA 1QK4A 2FZEA 1FP4A 1KR5A 1E1DA 4RXMA 3E4CA 3E8MA 3B8HA 1WVIA 3G68A 3MIZA 4TSKA 3UB2A 2QM7A 4F4HA 1L8OA 4G1FA 1NR5A 4K9QA 1NNLA 1JDBB 4P84A 4INOA 3NHZA 3AUTA 2GPWA 1T8SA 5IS2A 3RYFB 4FHEA 3GZNA 2H4ZA 4ND3A 4U2EA 2E85A 4TLDA 3N9IA 4KIGA 2H51A 4I5FA 4NEHB 1UEJA 2HMTA 1ESMA 4OHWA 5FD8A 1VKZA 2B99A 4ETIA 1PJZA 4G1BA 4WRRA 3F1KA 3IHLA 3TOCA 5AVQA 2X1VA 3DV9A 5KIAA 1MZPA 1SQGA 2BR4A 2IXFA 3E18A 4MKGA 1KU6A 4M1YA 3CLSD 4QBHA 1SIUA 1S5PA 3IBYA 4Z54A 1MB9A 5AW7A 4B5KA 5DP2A 4UREA 5F7XA 5I3ZA 3H04A 3HADA 4YASA 1W4BA 2A5LA 1YONA 3GJTA 2NUTA 2NXNA 3V2HA 1DX9A 2O3UA 1T43A 1KMIY 4ZI7A 5BR8B 1XA0A 4TTRA 4P0PB 2F1HA 2PFSA 2NPFA 1UC8A 5A3RA 1YZTA 1C9JA 2XF8A 4KX3A 1RJ9A 4GMHA 4UC0A 2G9NA 4CDMA 1ZUHA 3I1YA 4UTPA 5HF5A 2PUWA 3KAJA 1SHJA 4JJ7A 1LK5A 4MB6A 4NS4A 3T5CA 4CF7A 1YJ8A 4L8WB 2ZWPA 3SN6A 3UTCA 3EVBA 1BE8A 2YV1A 3RV3A 5I5EA 1QM5A 1XDDA 1Y8CA 4Z8XA 1PR3A 1YAHA 1ZINA 1TZ2A 4H0NA 4EDFA 5BWMA 3GFOA 4M8KA 2XGMA 1BVUA 1LBIA 2YWBA 4HI0E 4FZVA 2HJGA 1CUVA 2JAWA 1J2YA 2Q28A 4NDAA 4P38A 1SQFA 2BFAA 1ZCZA 4RHFA 4JWKA 5HIKA 4KHPB 4TVKA 1E2IA 5EJ4A 4NPCA 4V2UA 4ER7A 1OV6A 1NE7A 4LY0A 4AZ0B 2O6LA 2OP0A 5JI2E 2NMVA 1A76A 3E0QA 1LDYA 3ORHA 5MGNA 1L5YA 2WSSD 1Z29A 2V8OA 2H5IA 2RI6A 4Y30A 3KJGA 1PGNA 3IHTA 2IDZA 5AW3A 1SBQA 5D1NA 4BY9E 2WWXA 4C7VA 1XAJA 1FTQA 3PL5A 4ZOLA 3MF4A 5FPQA 1NY5A 2O07A 2UZ4A 1Z0JA 2O14A 3ECAA 3O31A 3RUPA 2I2WA 4R71A 1H0KA 3K1ZA 4Y6LA 5TIIA 4I4IA 1UOPA 3OJCA 2G67A 1UDRA 1C0PA 1G2IA 2G09A 5FA5A 2DERA 3CO5A 2BFWA 2O7QA 4BO9A 1UK7A 1FFCA 1T0PA 2NX2A 4FBLA 3VSBA 1PSZA 3QA3E 5F73A 3WGUA 3JWJA 1QCCA 1Y9ZA 4N47A 2VK2A 4ZZIA 2CNDA 2G0NA 2QYTA 4OP1A 3UOAB 5LD2C 1NMYA 1SN7A 3JAKB 2PMEA 3WXMA 1B41A 4P5EA 5AJUA 4Z4CA 2FPSA 5B7PA 3MJVA 3O7MA 1U9YA 2GZAA 5G40A 1FFHA 1OAOA 2Q3MA 5CFQA 5DNAA 4CM7A 3ZWDA 3LCVB 3AG6A 2GYYA 3GPBA 4JHLA 1S8NA 2ZP1A 3JQ8B 3R3HA 3C39A 1N0UA 2XVAA 5AK4A 1GFZA 2UV8A 3RD5A 3LA6A 4NAUA 2AR0A 2EX4A 1NZFA 1GZHB 1U11A 3AUUA 3HI6A 3KUUA 4M8IA 4YCBA 3TINA 4TWZA 3WK8A 2I3AA 4BTVA 3V7FA 1IPHA 4D4MA 3K6SB 4J3NA 3A4LA 3M2TA 4BO6A 2BZ1A 3HRHA 1QDUA 5F7OA 4GKJB 2WW8A 4K7JA 5EHQA 3O9MA 4F3KA 3VYVA 1U2QA 3G2IA 4ZZ1A 1B76A 1EWTA 4FD3A 4M2LA 3IXQA 4R9UC 5ESDA 4GS5A 4LFBB 1Y3DE 3MLEA 1N2JA 1J7JA 4PLWA 3WZ2A 5K05A 4UM5A 1GR1A 2X6TA 2X15A 1QZ3A 1TJ3A 1KHTA 2C92A 2PWPA 4O4LA 4RTSA 1HA3A 3LIIA 4CGYA 1DRVA 3IMKA 3PRKE 5BQOA 2GDJA 2ZYIA 3Q8XB 4TVBA 4Q0MA 3FZQA 3CCBA 1D2RA 1T2CA 2EZ4A 3QKRB 4Y1RA 3UT5B 5IJZA 2I34A 2JIMA 2DB3A 3LW8A 2P4HX 5DV9A 4ARZA 1ZM9A 2QRZA 1NA5A 4TT3A 5L7TA 4QPCA 2BTEA 1V8ZA 4YUVA 3JD3A 3HY4A 3MLAA 4N65A 3RIHA 4BE7B 1GM5A 3ZWMA 5KPDA 2J0VA 5CDFA 5D51S 2ZI9A 3BXHA 5LJLA 4WY5A 5M29A 2FX5A 1PL0A 3GVHA 4O25A 4K9KA 1YE3A 1ZXXA 2VK4A 5KINB 3SSNA 5AW8A 3OM0A 4WUVA 2QLTA 2WMNB 3D4LA 4IYJA 3UN1A 1K8QA 3VNSA 1OBVA 4BNJA 4XVHA 5IASA 3W7VA 4ITVA 5FBZA 4GYKA 1KKUA 2PMKA 2VQ3A 3EWNA 4HN4B 4QBFA 4W5JA 1GPMA 3RIGA 4NZNA 2Y0BA 5AK3A 1GL9B 1JHUA 3HWSA 1TF2A 4FFPA 4EM6A 1TI7A 2CB0A 2V5VA 3WB9A 1FQOA 4NABA 4IJVA 2NQ2C 4XDZA 5IKMA 1NW9B 3FYUA 3DVRX 4Q4HB 1NMXA 5DHPA 3C5CA 3E9YA 3MJTA 3EOBI 4AMUA 1XQVA 1XKTA 3WIUA 1QYXA 2FZ5A 1QGUA 3ABSB 2XQVA 1P6XA 3GB9A 4LE2A 2ZBGA 1L8QA 1U2SA 4Z7QB 1JEAA 4ENQA 3B6ZA 2R8RA 1DC5A 4J0CA 3WLFA 3W5DA 5E1OA 2QTVA 5J59A 4M37A 2X3YA 5EFZA 1W0KD 3L7YA 5L3SB 4KWHA 3NAQA 1ZFNA 4Q9HA 1K88A 1UQUA 1IVSA 4MPRA 4J6EA 2X76A 3G2NA 2YUTA 5I9TA 4XCQA 3LXUX 5CM2Z 1IN6A 1EK2A 2Q4DA 1OXUA 3KUDA 3P71T 4GR4A 1SKYE 2X2FA 4MNTA 4PRLA 2FH5B 3PPWA 1N0HA 2E5WA 4II2A 1QPBA 1T2DA 2HRQA 2POCA 4PC6A 3BPSA 3M1LA 1Q57A 4GM4A 4J90A 5CLLA 1K97A 3II6X 2BI4A 4IRMA 5GINE 3ZE6A 1M0EA 1JQLB 1TIKA 3GT0A 2B4TO 5J5AA 3UATA 4S12A 5WRFA 4G85A 2QMEA 1T8WA 5ICFA 5T67A 4I7EA 2H9AA 1K7EB 4KMRA 3QENA 3M89A 2ZUTA 3OQVA 4IIVA