5K3AA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/fluoroacetate - cocrystallized - both protomers reacted with ligand
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
295
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGNFLPEEAPDQTAEALVRFFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 113
structure length 295
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3aA00
3IUMA 5CXUA 1F0PA 5EGNA 2H7YA 3WI7A 3DS8A 1VZ3A 1SCQA 3K6KA 1TK3A 1DWQA 4A5SA 2RAUA 2WHQA 4OSEA 1HQDA 1YAJA 3DYVA 2ZVDA 3DKKA 4LKOA 1QZ3A 2VSQA 3R3ZA 4DMKA 5JD6A 4WDQA 4UHCA 3C6ZA 4ZXFA 3Q8WA 4FFVA 2XUOA 4UPDA 4X6XA 2QM0A 5K3FA 1YSCA 1YB7A 4FMPA 2XMQA 2VTVA 5HF5A 4MEBA 1IVYA 5EHZA 4N8EA 3IBTA 4EY8A 3DCNA 4Q3LA 5AI6A 1RP1A 1WCYA 2XUFA 3BIXA 5K3EA 4H7IA 4EY4A 3D3NA 1ZI8A 2VATA 2WHPA 4OB6A 1CR6A 5HCUA 5BWBA 4MQMA 3DQZA 5HK8A 1TAHA 3AINA 2PSFA 3QPCA 1CV2A 1XZBA 1QIIA 5DNWA 4BDTA 3H2HA 2ROQA 2QJWA 3D59A 2ECFA 5ALYA 4M0EA 2IX9A 4BCDA 3ESBA 4AMYA 2PX6A 3U0VA 5AIBA 3WL7A 4UBOA 3R3YA 1THGA 2OPHA 4BP8A 4WY8A 1L7RA 5CTAA 5JAOA 3A70A 4P9NA 3FSGD 2X5XA 3YASA 5AM4A 5IH7A 2DSNA 4B0OA 4CG2A 4UHFA 1KU6A 4G5XA 4K6KA 3LIPA 3STYA 3G8YA 3RLIA 3CCBA 1WM1A 2OCGA 5CT9A 2XLBA 1XLVA 3WKAA 5K3BA 1C7IA 1QTIA 4X90A 1XQVA 4X71A 2PSDA 5T4BA 1CUFA 3ANSA 2WTNA 4FLMA 5SYMA 1ZIXA 3FLBA 4BC1A 2WKWA 2DHDA 1K5PA 4B82A 1AGYA 4QDXA 4KRYA 4B80A 4AX4A 1JJBA 3S8YA 1GQSA 3G9ZA 4G4GA 4UFOA 1C4XA 4K5QA 4BTVA 4Y2XA 2QTBA 3R0VA 1CPYA 4QE3A 5C7YA 2Z5GA 1IMJA 4OD0A 1XZLA 5KBYA 5A7FA 2B9VA 4KE7A 2CMFA 5I7UA 3NWOA 3DOHA 4HXFB 1FSSA 1XKLA 5CT4A 5JALA 2J4CA 4OPMA 3F98A 5DYYA 5LKAA 4HXGA 5AKIA 1YS2X 3D2AA 2WIGA 3I2IA 2G4LA 4UBKA 2DCMA 1LZKA 1FFDA 4G1FA 5KWIA 4MEAA 3O4HA 3OC0A 1L7QA 4N5HX 5AM0A 2PU5A 3VKFA 3F97A 3DOIA 1EA5A 3PF8A 1GT6A 1LPOA 1H2XA 5AK4A 4P08A 3C5WP 4OB8A 4J0IA 1YS1X 4QDUA 5A7HA 3IULA 2C7BA 3QPDA 5ALKA 2JEYA 1EVQA 3DNMA 1XZKA 4YPVA 1W4LA 1TIBA 1WHTA 2GZRA 3CCCA 4W1SA 2EEPA 2ZJFA 1VLQA 1WPXA 4ZV9A 3KOOA 4Q05A 2FUKA 2HA5A 4Y2RA 5D7BA 2XUHA 1Q0ZA 1BEEA 2OG1A 2CKMA 2Z3WA 1GQRA 5JYCA 2WFZA 4H7HA 5FRDA 2VJBA 4BDSA 1L7AA 4J3JA 4AN1A 1XRPA 3O0DA 4AZ0A 1EB8A 3G0CA 4OUKX 1JI3A 3FAKA 4MJ3A 1RYYA 2W6CX 4AZ3A 4EY6A 2XQFA 3C8DA 5AKEA 5HFNA 1CQZA 4BTLA 1LPSA 4UBNA 5JAUA 4C89A 3D2CA 3G02A 3WMRA 3WK7A 1W1IA 2BKLA 3WIBA 1R3DA 3B3QA 4CIAA 4DMCA 5AI5A 3CN7A 4AMZA 5ALMA 2J3QA 1UK6A 3AUKA 4GBGA 5JARA 1A88A 5ALLA 4DTCA 3ILSA 3H0CA 4YASA 3H2KA 3QYJA 4I3FA 3V1LA 1MX5A 1Q0RA 2DHCA 3OOSA 1UT6A 4G9EA 3UUEA 1MAHA 1R9NA 4K2AA 3VISA 1XRNA 2B20A 3H1BA 4QEKA 3R3UA 1QIEA 1O6FA 1XROA 2CUTA 2H9YA 4MWSA 4CCYB 3H17A 4KEAA 5CURA 5LZ7A 5A62A 4FDMA 4X97A 2I03A 2UZ0A 5FKJA 5AOAA 3QMWA 3W05A 2OQIA 4ARBA 3U1TA 4BCBA 4H0CA 3FNBA 2HA3A 3WKEA 2DHEA 2V9ZA 4W1QA 4W9RA 1A8SA 3GUUA 4FNMA 1EDBA 3PFBA 5LIPA 4EY5A 1MAAA 3V1KA 2GYUA 5HKBA 2C58A 2GBGA 2WJ3A 3F96A 4LIPD 4WFKA 4L72A 4H7FA 2J4FA 3HYSA 3JYHA 1SC9A 1DINA 3CXUA 2Z3ZA 2GBFA 4ITVA 5FPQA 4DIUA 4G4JA 2GBCA 3STWA 1DT3A 4Q3KA 4DNPA 1CEXA 2XQJA 1CFJA 2XUJA 4CG1A 4CFSA 1XZMA 4PO3X 2AJCA 4RE5A 5J3JA 3WJ1A 2HIHA 3QPAA 5CH3A 5HF8A 5JZBA 1USWA 4X3CA 1LPAB 1CUBA 3DEAA 4XX1A 3I2KA 3N0TA 3SX4A 3W2TA 5ALXA 4K6HA 1CUAA 3E1GA 5E4YA 5AOCA 5D3ZA 4FWBA 3QZUA 3HLKA 5E4TA 2OLEA 2QRUA 4AO7A 4IH1A 3QH4A 2O7RA 1EX9A 1BROA 1UOOA 2VEOA 2XQIA 2VT7A 2WG1A 3O9VA 1ACJA 4IO0A 5EFZA 5IVDA 5KREA 5ALWA 1ETHA 3VDXA 2H7XA 4MYSA 1LZLA 5AKLA 1EB9A 4NVRA 2QOEA 3A2LA 1XRRA 4KAFA 1PFQA 1G42A 4IQ4A 5K3AA 2PSEA 2O2HA 3BJMA 1VXRA 5CRIA 1U2EA 3ZPXA 2XQKA 1SFRA 4J03A 2C4HA 3V9AA 3AIMA 1GZ7A 1E89A 4NMWA 3WK6A 4BZZA 1N5MA 5ISMA 1G5FA 4PSDA 5IVKA 3HZOA 3NOXA 4P92A 1P0PA 5I9IA 3FSGA 4F0JA 4Y2UA 4KACA 2LIPA 4B84A 1HBJA 3C45A 5CT8A 1CUEA 5CH8A 3ZLTA 2WM2A 3EQ7A 2HU7A 3DLTA 1EK1A 1Z68A 1H23A 1XRLA 2C0QA 2B4KA 1BN7A 4V2IA 2OCKA 5HKAA 3IB3A 3WYNA 1XZDA 2PPLA 4FTWA 2ZSHA 1TCAA 3WK4A 2V98A 2HA6A 1XRQA 4X95A 4DNQA 4ZWNA 4HVTA 3W9UA 3BE8A 2PM8A 4EA6A 1XQYA 2ZYIA 2WUDA 1J1IA 5KWJA 3VJKA 1DTEA 1ORVA 3KD2A 5DWDA 4C4XA 1EH5A 4GXNA 4LYEA 4FLFA 2VA9A 1CUIA 3PICA 2DQYA 4GW3A 1JMKC 3WKCA 4DSZA 4E14A 4U2BA 3IIIA 2BAGA 5AM5A 4KE8A 3DL4A 2ZSIA 3PUIA 1NU6A 3ZLUA 3I2JA 4BVKA 5HFAA 2Z8ZA 3HI4A 3KWFA 4J0CA 3KXPA 4GWLA 2WJ4A 3G9TA 4ZV7A 2R8BA 3D4LA 2XMZA 4BATA 4XWGA 1AKNA 4Q34A 2QZPA 2Z8XA 4UBLA 2ORYA 3FYUA 3A2NA 4B9AA 2C5FA 3EQ9A 2XMCA 2OGTA 3BXPA 4Y2TA 4N8SA 4E15A 3PI6A 1FJ2A 1LPPA 1GPNA 1K4YA 1DQYA 1P0IA 1DU4A 3PE6A 2DR0A 3RKSA 5E2IA 2EDAA 4H7EA 1CUXA 2PKYX 4WDRA 3FYUC 4C4ZA 1U4NA 4HXEB 1W75A 1GPKA 4HRYA 5DTJA 3V48A 1CRLA 3G7NA 3TRDA 3BIWA 1ZGBA 4U2FA 1X70A 2BCEA 5AK3A 1JT2A 1ZD4A 4X91A 1QE3A 4FFWA 3C70A 5T4FA 3X3HA 1BCRA 2B61A 3I1IA 5CT6A 3STTA 1B6GA 1KU0A 2XLCA 1HDEA 1MU0A 4K6GA 1KEZA 3I2FA 2JGKA 4F5ZA 5CH5A 4KAJA 3WL8A 1F6WA 3IUJA 5AIAA 3WKBA 4BYMA 4E46A 3FVTA 3MUNA 3NUZA 1XQXA 2WFMA 1CIJA 5HK9A 3OURA 3H2GA 3FWHA 4B85A 4CI9A 2HU8A 1U8EA 3RK4A 3BDIA 4N5IX 1E8NA 2DQZA 1LLFA 2HDWA 5AI9A 1VJ5A 2XUPA 3WKDA 3H19A 2PUHA 4EZIA 3WK5A 1FFBA 4UBMA 4OCZA 2XI4A 1QIFA 4Q82A 2BGNA 5LZ9A 3QMMA 1CUGA 1E5TA 1R1DA 2C5GA 3KSRA 3EIOA 4FLEA 1BE0A 3WK8A 3HJUA 3JWEA 4U2EA 4WFJA 1VE6A 5SYNA 2AJDA 3WK9A 4GLBA 5JAHA 1QIMA 2G5PA 2WILA 2WFLB 4UHEA 2GYVA 4EBBA 5AM2A 1R50A 3C43A 5FXMA 3R3WA 4EB0A 2RGUA 1DWPA 3IUNA 3WQHA 3UUFA 2J3DA 4BVLA 2Y6UA 1ZD5A 5CW2A 1CVLA 4LHEA 2JGLA 4I4CA 5ALQA 4W63A 1DQZA 3PDCA 3BF7A 4F21A 2AJBA 4KE9A 3GZJA 5D3KA 3WZMA 2QXUA 3EF3A 5AI0A 4UBIA 4RGYA 5T4EA 1LPBB 3QITA 1LBSA 2HFJA 3L1IA 3A6ZA 3WYDA 4ZI5A 5AO9A 1YCDA 5DTIA 3STXA 3N2ZB 2X76A 1XZAA 3G0BA 3VJLA 3V1NA 4JNCA 3K9BA 3DKRA 1HLGA 5JD4A 1EI9A 1E8MA 3EBLA 5ALGA 3ESDA 5AK6A 2VAVA 4GI1A 5AKKA 1AC5A 1J2EA 2FJ0A 3D0KA 4CG3A 2WUGA 1JKMA 1N1MA 1XZFA 1XLWA 1VKHA 4MXDA 1XKTA 2D0DA 1MO2A 5AKHA 1ZICA 3I6MA 4DSAA 2QT9A 4QDTA 1VZ2A 4B7ZA 2HM7A 2HRQA 1UK7A 2XUIA 5EIAA 1J06A 1QJ4A 5JASA 1NU8A 2WJ6A 5JAPA 4UHDA 5K3CA 4O08A 3VVMA 3WA6A 1EHYA 3H18A 1SOMA 2BFNA 3I2GA 4UUQA 3C8HA 4AB1A 5HQ3B 3B12A 4NZZA 1R88A 3AIKA 3H2JA 5JANA 4BP9A 1NX9A 1F8UA 1OXMA 3WWEA 1J07A 3LS2A 4L3WA 4F60A 3WWDA 1VA4A 2WSLA 2ZJ7A 4BE9A 5LZ4A 1ZI9A 1UOPA 2HHAA 1WB6A 1QO7A 1LGYA 3AILA 2PSJA 3TJMA 3ED1A 3NGMA 3DDUA 2YH2A 2R11A 4BE4A 4RNCA 5YASA 2WHRA 2JGMA 4UFNA 2PL5A 2WU4A 4HAIA 4Y2SA 2XMDA 2CJPA 3O4GA 1CUSA 2VAXA 3OM8A 5FLKA 3DJYA 4A16A 1PJAA 2G5TA 2Y2VA 4BVJA 2FX5A 2H7CA 4OYYA 1UK9A 4JYPA 5K3DA 3ICVA 1CUCA 4Y9SA 3WWCA 2DFPA 5JZ9A 4JYMA 1Y7IA 4AN0A 2ONCA 1R4ZA 3WLAA 1XZIA 5ALZA 1YASA 3WZLA 4G8CA 4FNGA 4NS4A 4TPKA 4M0FA 2O2IA 3WL5A 2JEZA 3FLAA 1A8UA 2ES4A 5LKRA 3F9CA 1XZCA 3JW8A 1N5RA 1MNQA 3EQ8A 3SC2A 3I6YA 1TKRA 3W04A 1QFSA 4G4IA 1W76A 1VOTA 3C87A 4MWTA 4HZGA 4KAAA 3FCYA 4J0JA 4EHBA 1F0NA 2JGIA 4H7DA 4J0GA 3M82A 5K3FB 4HTAA 5IKXA 1Q83A 5DLPA 1AURA 4HS9A 4GECA 4ZRDA 2H1IA 2XUGA 5FDFA 4MQLA 2XE4A 2HA7A 3M81A 5ALSA 4PSCA 3D5EA 5ALEA 2EDCA 4DNOA 2HA4A 2YXPX 5I8PA 1WB4A 2K2QB 4H77A 5A6VA 5JADA 3HXKA 4N8DA 1OCEA 1QIJA 1LNSA 5DNVA 3O9MA 3F8SA 1SCKA 1S8OA 4BAGA 3BWXA 4XVCA 1IUOA 4QLOA 4C4YA 4X6YA 2BJHA 5ALNA 2RIPA 1XZHA 2WHPB 3I2HA 3RARA 5DYWA 1UKCA 1WHSA 2FJPA 2W22A 1BN6A 1MPXA 4OU5A 4MYDA 3LIIA 2WG0A 4W1RA 4X6UA 4WCVA 3G9XA 2RHWA 5ESRA 4L9AA 2Y2UA 2CZQA 1MX9A 5F4ZA 1Y7HA 1FFCA 4KRXA 1JU4A 5K5EA 2OCIA 4QDOA 1K8QA 3ZI7A 5C8ZA 4J0DA 3QBJA 5D6OA 1YB6A 4FBMA 2QJRA 3D2BA 5AH0A 1R9MA 1CUWA 1UZAA 5CXXA 3STVA 5DYTA 3DD5A 4WJLA 1MT3A 3AFIA 3VVLA 3VJMA 3V1MA 1T2NA 4LXIA 4B9EA 3R41A 3FYUB 4BRZA 3ZLVA 5AKXA 1GKKA 3AIOA 4AQDA 1MJ5A 1LBTA 2PUJA 5LZ2A 4ZREA 3BF8A 2JF0A 1YAHA 4LXGA 1QIDA 4ETWA 3LP5A 4Q1VA 5ALUA 1OILA 5LP1A 5C8VA 1EDEA 1N8SA 2NW6A 1QGED 2QVBA 2OAGA 5AP9A 2ACEA 5HZGA 3KWJA 4H7KA 3R3VA 4PQEA 2JBWA 2VJDA 3BJRA 1E8DA 3QMVA 4QDZA 4QZVA 2I3ZA 2PBLA 1WPRA 2RHTA 2XMRA 2XB6A 2V96A 4DLNA 3R40A 1U65A 4EY7A 1AMNA 4YX9A 1A7UA 4QWWA 2ZYSA 4UHHA 2XUAA 5DJ5A 2XT0A 3P2MA 4DMHA 1E3QA 2VJAA 1QIHA 2V97A 1JJIA 3BDVA 2HL6A 2YYSA 5LZ5A 1QIGA 3GFFA 3IUQA 4DNFA 4BCCA 2XUDA 2WIKA 2I3DA 4FOLA 5EHXA 4X92A 4IH9A 4RPCA 4PV7A 5CT5A 1ODTC 4J0HA 4LYDA 1UXOA 2PSHA 2AXEA 5HQ3A 4H7JA 3WIOA 1CUHA 2JGFA 2WIJA 3AZQA 3C6XA 3HABA 2QUAA 1HKHA 1H2ZA 5LYYA 4KE6A 5JZSA 1ZGCA 5JATA 2HADA 1T4MA 2XMBA 1O6GA 2OAEA 2PU7A 1ISPA 4GEGA 4CCWA 5AM3A 4BAUA 1ZIYA 4IHAA 2QR5A 2BGRA 5AKZA 3HACA 1EXWA 2CEKA 2XDWA 5LLSA 5ALRA 1DT5A 1M33A 1Y37A 4JEIA 3C5VA 5EHQA 4RE6A 5IVHA 2VT6A 1LPNA 4JUIA 4C87A 1CUYA 1UKAA 1TQHA 2WUEA 3G0IA 2VQ6A 5JIBA 3H1AA 4X85A 4U2DA 1WOMA 4B0PA 3KDAA 3DL7A 2C0PA 2QKYA 2QUBA 4G8DA 1P0QA 1K63A 5ALIA 3I28A 1XZGA 3HSSA 1ODCA 4C88A 5ALOA 1HPLA 2WQZA 2YASA 1JFRA 4Y2VA 4UHBA 4Y2PA 4FHZA 4BB0A 1ZI6A 3QM1A 1UWCA 1AX9A 1P0MA 4INZA 5FOQA 1CLEA 3PF9A 3IDAA 1BEZA 3IA2A 2RONA 1CQWA 4QA9A 4Y2JA 3O4JA 4A23A 3O4IA 1CUJA 4TGLA 5EHNA 1UFOA 1CUDA 3IURA 1ZJ4A 2HRRA 5ALFA 3K2IA 3SWWA 4KJXA 3T52A 4B83A 4GDMA 2VF2A 3D7RA 4GHWA 1GKLA 2GZSA 5EI5A 3FBWA 1DWOA 3L1HA 2P8SA 3M83A 3HC7A 4H18A 4OU4A 4Y2YA 2GBIA 2Y1KA 3HRHA 2ZJ6A 4CIBA 4HRXA 1VA5A 4D9JA 1E66A 4M0MA 5C8XA 5ALDA 1QO9A 2D5LA 4PSUA 1CUZA 1FFAA 5FV4A 3OTQA 2XUQA 4WFIA 3AZOA 1ZOIA 3QVMA 4DYHA 1EINA 4B6GA 1QOZA 2Y6VA 3DYIA 3VXKA 1MNAA 4PW0A 5AKJA 5BWCA 5HF9A 1EVEA 3CN9A 2XUKA 3UMJA 4AO6A 4S0XA 1G66A 2BUCA 2WU3A 1CUUA 2JIDA 4BRSA 1QTRA 5A2GA 3C6BA 1AZWA 1XQWA 1YR2A 2ZYHA 1Q84A 2O7VA 5FP0A 3I1YA 4XIIA 3WWPA 6YASA 3M3DA 3S2ZA 1H2WA 4I19A 4AXBA 1QONA 4G8BA 3TEJA 5C81A 3E0XA 4XJVA 2AJ8A 3OG9A 2I78A 2QXTA 5ALJA 5AICA 3FOBA 3GBSA 1X2EA 1X2BA 1PV1A 3ESAA 3O95A 5AI4A 3STUA 3AZPA 4DM7A 5A71A 2XMSA 5AKYA 2WUFA 2AJLI 2OGSA 1IZ8A 2OGZA 4Q3OA 2OQVA 5A7GA 5ALHA 2ACKA 4FBLA 5LZ8A 3ICWA 4E11A 1DX6A 3Q0TA 4QWMA 4U2GA 1HL7A 1UKBA 1UOQA 1QIKA 1YA4A 1FFEA 2WG2A 4G9GA 2RI6A 4J7AA 1TCCA 4Y7DA 1XZJA 5T4HA 1XLUA 3T4UA 2WLSA 1IUNA 1GXSA 2HU5A 2QS9A 4C01A 1ZD2P 3GROA 3IVMA 1XRMA 3C6YA 2O2GA 1DX4A 5IVIA 5FUMA 5CMLA 2JGJA 4W1PA 2JGEA 5ALTA 3FVRA 1W52X 5AK5A 2BUAA 2CBGA 2CB9A 2BUBA 1MN6A 1RWQA 4C6HA 3PUHA 5BV7A 4X93A 4U2CA 2XMGA 5FPPA 2HA2A 4TVKA 1K6EA 1BCSA 1ZD3A 3ANTA 1AQLA 2XQGA 2QMQA 4PNZA 3L1JA 3A2MA 4BAZA 1TCBA 4FKBA 4L0CA 2IIVA 4DGQA 3ESCA 1H2YA 1AUOA 3H04A 3GELA 1EK2A 2WTMA 3MUOA 3HEAA 4J0KA 1THTA 5AOBA 3TGLA 4DMFA 3H2IA 4OYLA 1VXOA 2OCLA 1D07A 3F67A 2E3JA 2VJCA 5AHXA 3WJ2A 3WWOA 2IITA 4CCYA 1IZ7A 1MX1A 2GYWA 4KR0A 3G0DA 3FYTA 1G4HA 1TRHA 5EIEA 4UBJA 1BS9A 3R3XA 1A8QA 4P93A 3AJAA 1WB5A 3WA7A 3ZWQA 3MVEA 1ACLA 5HF6A 4QLAA 4ARAA 1LPMA 1W6RA 2ZYRA 1B41A 1XFDA 3B5EA 4BZWA 5CBKA 1BRTA 3W06A 2G63A 1IUPA 4B81A 3I6ZA 5BOVA 3MGAA 2X8BA 2WFLA 1YA8A 3OPMA 1VE7A 1JU3A 3WL6A 1H22A 2OXEA 5AM1A 3RM3A 1ODSA 4X00A 3G0GA 3BL8A 1CUVA 5DNUA 2WIDA 4UFPA 5JD5A 1ZJ5A 4QNNA 1MTZA 3GA7A 5AI8A 4WY5A 4LXHA 3G9UA 2HA0A 3FCXA 5EIHA 3LLCA 4ROTA 1C7JA 3ZV7A 4X94A 4X7BA 3LCRA 1JJFA 4ZGBA 1SCIA 1XZEA 4KYVA 4BC0A 4JH0A 1GPLA 4AO8A 1QFMA 7YASA 1QLWA 2Q0XA 5E4JA 4PF1A 3FLEA 4IH4A 4YK7A 1GGVA 3PFCA 4BBZA 5H3HA 3E3AA 5ALVA 1I6WA 4H35A 5AJHA 4EUSA 4Z49A 3SK0A 4Y2QA 1EDDA 2PVSA 4OB7A 1JMYA 3W9BA 1UK8A 1ORWA 2HFKA 3E4DA 1BU8A 2WIFA 5AKGA 5ALPA
chains in the Genus database with same CATH superfamily
5IH3A 1F0PA 2H7YA 3GEMA 1Z37A 2ZM6B 2PEZA 2J45A 3GJQA 2ODPA 1SCQA 3MBOA 1F51E 4EX6A 3N07A 4LY6A 3M4YA 1C5KA 3RHSA 1O6BA 4PZLA 4TVBA 1EXVA 3MLBA 3QLEA 2Y9PB 4EI9A 2QL6A 3OFJA 3OZBA 4LNAA 2HK9A 1YAJA 1ZC4A 3OLWA 3MCZA 4PRKA 1ZSNA 1PZMA 2CWWA 1GFWA 1BA2A 2I34A 3DYVA 3OF5A 4JP2A 4L08A 4OK5A 3U3ZA 1SVLA 3THWB 3IUYA 5BYBA 1TVKB 4R68A 3BL6A 3DOFA 5C5DA 4YLEA 2Y3IA 1YBHA 3GN2A 3ZBUA 2P9QA 5JD6A 1YZQA 4HI0E 1IHDA 2QP4A 4IX9A 4WDQA 3TAHA 1DIOB 3TQRA 4CR8A 3ZE7A 1M8PA 2ZUDA 1IQ0A 2GK4A 1I4LD 1V9LA 3WTCA 3GLUA 7GPBA 4ZXFA 3WLJA 1FDIA 3Q8WA 3ISTA 1TUIA 2PS9A 4HGRA 4UPDA 4WCFC 1T0JB 2E55A 1KY4A 2NADA 2AI1A 2QVLA 5G0VA 1RKUA 2FWPA 3AL2A 1Z5UA 2QM0A 5CU7A 5EE9A 5IT0A 1N32B 2PZEA 3L41A 4FYPA 5FOUA 5C35A 5K3FA 1YSCA 4YO7A 2BIFA 3LKZA 1QO0D 3RIYA 1YVPA 4NYIQ 1PHPA 2YWBA 4PZZA 3DZFA 1JECA 4NNOA 3LVRE 5KNBH 1A50B 1VL0A 3M34A 2BF4A 1D6NA 3GLGA 3PB3A 3AL0C 2WJWA 3NAZA 4YRDA 3JX9A 1QM5A 2PKXA 3SSMA 2CHUA 1M34E 4N48A 1EIWA 3NRCA 1Z62A 1JLRA 2DWPA 1JTFA 1RWXA 4JT2A 4Q3LA 4RV9A 3DBHB 5AI6A 3CRRA 2XUFA 2FQXA 3BIXA 1I3KA 2X77A 3PC6A 1G1AA 1HGXA 2A9FA 3I12A 4EVSA 1J24A 1JI0A 3MWFA 1U31A 1XGKA 3E9YA 1O95A 4KGDA 4LJ5A 4MW7A 3COWA 1EVYA 1M2VA 4UAGA 3WYAA 2ORED 2Z1DA 4K9SA 2XOKD 2QW0X 1Q0LA 1MB9A 5J2TF 5J5AA 4EK9A 4B3RB 4C0SA 1HNWB 3FTFA 2WHPA 4LOAA 2UVQA 1YONA 2CKDA 5HCUA 3FBGA 1JBKA 4R98A 3R7BA 3WV4A 4CM4A 4HT3B 2X1LA 4JLAA 4OOFA 3EVCA 3CUSA 2WU1A 5E8JA 5IPFA 3ER9A 1OLSB 1W44A 1EX1A 3KZKA 3SAJA 3OOEA 1T2AA 1HFWA 4Z0TA 3GWGA 3LX5A 1GAEO 4PLZA 3DV0A 2NTNA 4K9PA 3AHIA 2X42A 4EI7A 1J2TA 1LQ2A 1F1BA 1VLZA 4G67A 2QROA 2ECFA 3K9LA 4JA0A 1Z8NA 4Q15A 4R41A 1DRKA 2IX9A 4F91B 3ESBA 3V9PA 4C0BA 1TF7A 4KR9A 4P0QB 2V55B 3KAPA 3SSOA 2PX6A 1FX0B 3HUTA 4Y98A 4D6PA 3FHTA 5F78A 1W36D 3I8XA 2ZB7A 5FI3A 5AIBA 2BYTA 2PRIA 2QSZA 2XRFA 3QBTA 1N2CA 4RMNA 4CVNA 1TJ3A 4Z86A 3QVXA 5KOJA 4BQRA 3GLQA 1BOFA 4MK4A 4KMMA 4J0FA 2JLSA 2R7LA 4GICA 1ZRSA 1WDMA 3IEUA 5AUOB 1QG0A 3PQ6A 2UUAB 1SHLA 1KORA 1WU8A 3JTMA 5CTAA 5L95A 1OA1A 1AV7A 2GD6A 3THOA 2EFHB 1A2OA 2FP4A 4P9NA 1T3SA 2ZTLA 3UT0A 2UXDB 1BKDR 3S99A 5AM4A 3B38A 3CJTA 1EUZA 4L1KA 4R2IA 3UCEA 3AHDA 3VHRA 5IH7A 5L3QB 3NPMA 3QE2A 4O2AF 4J3FA 1MXFA 1FZQA 1K4MA 2CLIB 2HRCA 4RBNA 1Y3HA 3H11A 1PL6A 3H6GA 3R7LA 2ANBA 1MD9A 1OGJA 4C6TB 3E22A 8MHTA 2Y93A 3U9SA 2Q1SA 2AHRA 4YHHB 2DKOA 3RWBA 4C2TA 4DDVA 2EP5A 1KQ3A 4B4UA 5FAKA 4PHCA 4RM3A 2WYUA 1HL3A 1TYEB 3FW1A 3GNQA 2H1FA 4HN4B 2Q9AA 1CJMA 5EIFA 3AR5A 4MLCA 1X3LA 4L02A 4C0KA 5C7IO 3L1VA 3OFVA 3KLBA 4E4YA 1WM1A 5FI0B 2JVJA 3WHLA 1E20A 5JS1A 1WV0A 4PAQA 1X8XA 4DQUA 1X42A 2G07A 4XSVA 3SPXA 4UPEA 1W5EA 3DAGA 1P7YA 5MDHA 3UAOA 3UKDA 3VVBA 4F5EA 3CVXA 4Q02A 4O5AA 1MR3F 4FJ1A 2EWWA 1OI3A 4L22A 3P9PA 4YJFB 1P2VA 3V80A 4QUJA 3HVKA 1AGRA 2R44A 4EVQA 3TNFA 4I1UA 5DFAA 1CUFA 3ANSA 4WW0A 1L5QA 3WV5A 1RFLA 4FLMA 4C0WA 4D44A 3U6KA 3VOTA 2O8BB 1F3OA 4A03A 3VR2A 3VU9A 5BUCA 1TM3E 5M04A 3QX7A 3UFBA 1RJEA 2E4VA 1G2OA 4F2DA 5JXGA 4F4DA 2GBLC 2NSJA 4H31A 2IV3A 1R0XA 2JCBA 4P8RA 3SXUA 1OFUA 2QAGB 2SBTA 4MSUA 1KE2A 1A5TA 1FDRA 2B4AA 3U40A 3IEMA 2FG6C 4LRSB 5GJWC 2GNAA 2BFBA 1A5BB 3TIFA 3R5JA 1T5LA 2GXQA 4MRSA 1X8KA 2F55A 4RDHA 3QXCA 1UBOS 2R1TB 2WTAA 1G20E 3KDSE 3NRJA 3ORFA 4XB6B 3K72B 4AX4A 4HUTA 2ZR8A 4WE3A 3V4SA 1JJBA 2JDID 2Q1TA 3TTWA 4X24A 1K98A 4DDHA 1QWOA 4X3OA 1U2RA 3S8YA 3G9ZA 4G4GA 4GOLD 3OF3A 1IWBB 3FCOA 4I5GA 3F4BA 1MOSA 2LIVA 4I8IA 3T7JA 1R0YA 3A3YA 2DPXA 1L3IA 4E5DA 1TC2A 2QNIA 2C1ZA 1KYQA 1LV8A 4LFCB 1Z0KA 2NV0A 2VBGA 3M6AA 3OEEA 3U3DA 1EUQA 5C7YA 3BL5A 4IDBA 5SV2A 3BVPA 2Z5GA 2OSVA 2EGHA 1IRXA 1T5IA 2PKQP 1U7XA 2VA8A 3CH7A 3PA6A 2WZCA 1IMJA 2B5VA 4J6EA 3CVOA 1R6VA 2VWQA 3AR6A 4BN4A 1YRQA 4NICA 4MR8A 5KBYA 3L3BA 1K88A 3JARA 2SICE 4AZTA 2V6JA 1U0TA 2WABA 2V7WA 2O57A 4L5YA 4A10A 1ESNA 3K4QA 4M2LA 1DWUA 5EXXA 3I9KA 3NWOA 3DOHA 3BGWA 1KQFA 4U7DA 1G3MA 1QMGA 1RQXA 3PGXA 5TJ9A 1OB5A 3GNSA 2BBOA 2I4LA 1ESDA 1XOIA 2X6QA 2I0FA 3GAZA 2C3PA 2I65A 4GMGA 3L07A 2ZJ8A 1FFXA 3ZWCA 3ZXYA 1YZVA 1UBMS 3CBGA 4O1MA 4EGAA 4FI3F 1YS2X 4UOZA 3LU1A 1ZMBA 3D2AA 4I50B 1QWSA 1ZJYA 5DM4A 2PWAA 3ZEAA 5KU1A 1CHDA 4A8JA 4Y0NA 1EGMB 2C4MA 3VGPA 1GZDA 1MIOA 1RHUA 2GKSA 3Q4GA 4R3WA 2G4LA 2WSSD 2DCMA 4YRMA 3DHNA 4LDNA 1XTBA 2DPGA 4OQ4A 4JI3B 5JNLA 3ANMA 4GX1A 4L8LA 5LQUA 5HRAA 1N77A 2EIXA 1E2IA 5KWIA 1DJMA 3UJ8A 4ZCTA 2VRWA 5JMTA 5C0OE 4EZBA 1SPBS 1T25A 3OC0A 2R1ZA 2VXCA 4IUYA 4ND8A 4OI2A 3P9CA 2NUTA 1H0SA 4ALLA 1P6UA 4R9UC 2ZYTX 5L7WA 1UZNA 1TEHA 1XA4A 2YQ4A 4KDRA 4RJ2A 4RUKA 5J2TA 1WB9A 1LDBA 4ZK6A 3K92A 3KHTA 4ECEA 3DOIA 1EA5A 5LQMA 2MSEB 4FUQA 4X8HA 3PF8A 1GT6A 4R83A 3ZTWA 1LPOA 1EUYA 1IXKA 2A0KA 2ANCA 2JIMA 3HVHA 2WF7A 3NB0A 4B47A 2HY7A 1MO5A 3C5WP 1FS5A 1BQEA 3CX6A 3IHKA 4HFRA 1BH6A 4HPJB 3CUYA 1N4AA 3W1EA 4LZZA 4NV1A 5BN5A 3RHTA 5K0GA 2GJ4A 5EZYB 3LDGA 5DK6A 3H5AA 4QU9A 5TV2A 2H5IA 1CT9A 2EFCB 3CR7A 3I34X 3K9FC 3IULA 4ID3A 4BQSA 3S1SA 2C7BA 1IBSA 2Y1WA 5DBGA 2RD2A 2YKGA 3AF3A 3AWDA 3OX2A 1L4KA 2IW3A 3QPDA 2REBA 3SHFA 4BFLA 2QVZX 1N2CE 2GF2A 4B4KA 1N5KA 1TUBA 4DV3B 1G6KA 2IE8A 3OCWA 4N7BA 4WZAA 2PX0A 3A32A 5LVAA 4LY9A 3V6MA 1L5FA 2HNAA 4ZAWA 3V8QA 2V6GA 1VG9B 3KOOA 3PBKA 4FKMA 4IINA 4Q05A 5AVZA 4MUHA 3WLOA 2XUHA 3KUCA 2CKMA 2QSUA 2VOJA 4EG1A 5B4UA 1GQRA 5DYIA 5G4KA 1T4BA 3I73A 1GADO 1P6QA 1DAMA 2X0JA 2VK1A 4IJMA 3UMSA 1RJ9B 4EAQA 1RRVA 5BQOA 4E2XA 1ACMA 1Z3IX 4RVOA 5ITZB 2G5CA 5BSHA 2AKEA 4N39A 5F5NA 1IOVA 1KO8A 1XDZA 1FOEB 2I67A 4J8PA 2VCYA 4WOCA 3S40A 3E53A 2EHDA 2FYTA 2K87A 3AU8A 3CSSA 3D3QA 4XLZA 1M6WA 3EEOA 4PHGA 4OMFG 1ZL2A 4HWRA 1EB8A 3DBLA 3G0CA 2HQRA 1MA0A 2BISA 2FX2A 2VLBA 3OEWA 4LECA 5EP1A 1EFVB 5AT1A 2VJMA 4D8UA 4CLRB 3BK2A 3IDQA 3KZNA 2NZVG 3A4MA 1DE0A 4MP8A 3SR3A 2B0JA 4LZLA 1YFZA 2W6CX 1Q14A 4UM5A 5IJ0B 3OEHD 2XQFA 3C8DA 1PG0A 2YZGA 3GCGA 5AKEA 2PBRA 1I9CA 1JQBA 4HDNA 4FDAA 5HFNA 5CDYA 1YDEA 4O4LA 2OZEA 1Y8QB 3DDSA 1LPSA 1ZM4A 1DBRA 3HCNA 5EMKA 1CY4A 3PCXA 1PS8A 1RMYA 2VDNB 2QD1A 3B2QA 3TNJA 4C89A 3D2CA 3FPEA 1PGPA 1YMVA 2HCTA 1EKXA 3DPUA 3QSGA 5G1NA 2QRQA 3WMRA 4RXTA 2NM0A 5HQTA 1CBUA 5KVCA 5TRTA 1RZUA 4ZOAA 1W1IA 3EMBA 1I9GA 2TECE 4PZCA 5C4IA 1R3DA 1E5LA 1Q6ZA 1ZWKA 4RZIA 5U1PA 2NSHA 3DE3X 5LQDA 3GFPA 1TUGA 4YJKA 1O87A 4AMBA 2ST1A 4DZRA 4N0QA 4N6NA 3U7RA 5JARA 3B8EA 2OFXA 4P4GA 4DTCA 2PMEA 3I42A 4OXNA 2JJ2A 3ILSA 3RB8A 1THZA 2TMYA 2GCOB 3I5YA 2SCUB 2IOQA 2WT9A 3QEAZ 4BNYA 3L0ZA 3NYIA 3LSTA 3H0CA 2ZG6A 2J9FB 3H2KA 3KPVA 1NVMB 1KC3A 3QYJA 5C34B 1GU1A 1S02A 4OMUA 3DKIA 3PNPA 1C8LA 3A4VA 5JZMA 1Q0RA 3G6KA 2FPUA 3EISA 4P36A 3KKKA 2PXCA 2GFHA 4ISCA 2N0SA 5LFAA 1MAHA 4QTYA 1U6KA 2HJGA 1RI4A 4IO1A 5BXYA 2ZDGA 4G0PA 1XRNA 4MV1A 1Q22A 4O2LA 4ZO6A 4RTSA 2B20A 4ND4A 4QEKA 5HIAA 1ZM9A 2FZEA 1FFHA 3CLSC 4M3NA 1WW2A 1XROA 4CV1A 1W1WA 2CUTA 4I4TA 4MWSA 5H3LA 2AOVA 3QU7A 1JTEA 1T4CA 4KEAA 5CURA 2G04A 3GRRA 4NY1A 5LZ7A 4QKQA 3D3WB 2ZRDA 5CW1A 3ILHA 3W8EA 5BN4A 4Q7LA 4I1PA 1DXYA 4JS0A 2G0AA 3F78A 2YW2A 1EU1A 3HJTA 1T1IA 4X97A 2VHQA 4LKRA 3SIXA 2I03A 4WI1A 2E4YA 3PSHA 3OQHA 3G5AA 3FUXA 4Y1RA 2OQIA 2G06A 3D6JA 3VBEA 4ARBA 5BSGA 4BCBA 1Q1EA 1YZTA 2FZGA 3T0IA 3CVUA 3B7PA 1ZVQA 1SU4A 1SWVA 3FNBA 4G5FA 2HA3A 1EM8A 1NXTA 5J40A 3KRTA 2DHEA 4BP3A 2Q5EA 2W2QA 3BFKA 3D1JA 5E4FA 1O95C 3HDGA 3TTXA 1YUMA 1XDUA 2PJUA 1N0WA 1D4AA 1C14A 4AYTA 4DWOA 2WFAA 2JGAA 4EUKA 3V4RA 1TECE 1AQNA 1UC5B 2X4LA 4DV5B 1NQVA 1I0IA 2PA3A 4D4LA 3TRJA 1K75A 4O0LA 1NPTO 4EY5A 2XT6A 2CL6X 5L4SA 3T3MB 5HKBA 4W6QA 3I8OA 4HDRB 3KXDA 4ZYXA 3EUEA 4L3OA 3JTEA 1ONBA 3F96A 2AMFA 4PLYA 2A5LA 4WFKA 1E69A 4RLQA 1POXA 2J4FA 1KPIA 3A14A 1QHIA 3TGWA 4DQKA 1M2VB 1M5UA 1V3TA 3JYHA 3P20A 2AUMA 3KSUA 3PYMA 4X5OA 3MA0A 2PX4A 3LQYA 1Z34A 3O2SB 4PYRA 4OQQA 1XRSB 2JFWA 4GKAA 5A4FS 3CC8A 3ITDA 2GBFA 2C4NA 5JXHA 4DIUA 1KF0A 1NUHA 2VDKB 3A1TA 2GBCA 2QQEA 3ZTTA 4DW8A 1C0PA 3TD2A 1AO0A 2R60A 1RRFA 3RSQA 2YXLA 3Q2KA 1L5MA 2UUCB 5AW0A 2PGIA 1M2WA 3ZNOA 2PCLA 3NDBB 2EW1A 1RIIA 1WTAA 1S6YA 2IKSA 2XUJA 4NECA 3TB4A 3ZDQA 4CFSA 2HLDA 5BMVB 2ODWA 2PZGA 2BEVB 4V3CA 1W0JA 2HMUA 3I05A 1MA3A 2R25B 3BMQA 4IQ8A 4DB2A 4NU0A 4DA0A 5J3JA 1EX7A 1DEAA 4YJHB 1SCNE 2O0MA 2W2KB 3OECA 1TMGE 4X1YB 1SOWA 1T3ZA 1ENPA 3KUUA 5A9RA 5HOEA 2HIHA 2YZ2A 2E89A 3AR8A 5EGSA 4ZVSA 3OFKA 3R9KA 3ZDXB 1ZM2A 1BVYF 3B9BA 5DI3B 5HF8A 5JZBA 1XAIA 1ZWLA 3SIRA 4Z1MD 4IJ5A 1C8VB 1WP9A 3BB4A 3WYEA 4R1TA 1MVNA 2OR3A 4EMSA 1YJ5A 2OKGA 5CEFA 3DEAA 1NE7A 3I2KA 4PRYA 1U0LA 3KTAB 4HNSA 4RJLA 3F6YA 4XSHA 1L7PA 1QGAA 4NCIA 4ZANA 3SX4A 3HYRA 3QLUA 2P9TA 3GLVA 1YXMA 2IOHA 3OH8A 3OZDA 3AV0B 3OE7D 1PZXA 1RYBA 3JSXA 3RSOA 2YYYA 1L5ZA 4FGSA 4ETNA 5HJ5A 2HF7A 1TA0A 3AP3A 1CUAA 4QOSA 2W7TA 3QEOA 1OX4B 4NXNB 2C2HA 2X4DA 5IDYA 1BS1A 3VH4A 1WHSB 2W2LD 1SD2A 2XCUA 2HJVA 1OBOA 3C6KA 3IPCA 3T94A 3E22B 1SVKA 3K5IA 5C8DA 5KNCD 3FPJA 4DCPA 2NMVA 4E3WA 4FWBA 2G28A 2XSZA 3E1KA 3JZAA 4HEHA 3LXMA 1R6BX 2XF2A 3D7MA 3HLKA 5E4TA 2B9EA 2C20A 1MAWA 2OLEA 2QRUA 2Y99A 3DWIA 3F71A 3QH4A 4IH1A 5F33A 4G81A 4IV0A 2EXXA 1BE6A 3HUEA 3KALA 4YDHB 4ZYVA 2QTZA 1AXEA 3DWEX 1R6UA 1GYQA 2P5TB 1UBTS 2V3WA 1O7JA 1UANA 1PJLA 5KHOC 3KELA 1MOZA 3LFTA 3D02A 4IO0A 1ACJA 1DKQA 1RWBA 3MAGA 4H6PA 5IVDA 5JQGB 2AFIA 1E96A 1JDNA 4QD3A 1GD1O 1SNYA 3PQFA 1JHMA 2VTEA 4MGIR 1C9MA 5EY5B 2CXPA 2H7XA 3MUEA 4LJSA 5LXTF 4E5MA 2JLZA 4C7OA 3KG2A 3Q1KA 1EFDN 5F2OA 4B6FA 4NAVA 5K3OA 3HDYA 1JALA 3K70D 2BP7A 1KVTA 2HQBA 4BMZA 3JQAA 3G0HA 2Q7XA 2I9KA 2HGSA 2M1XA 1G2PA 4YFYA 4XQ0A 1MB4A 2FK7A 1NUAA 1ZMXA 1TEZA 1M8JA 4JYAB 1QGYA 4GSLA 1BC5A 4JEHA 1TOAA 1XRRA 3LRPA 3OIVA 4KAFA 4LRYA 1WQ1R 3W78A 2VSFA 1NWHA 1NRIA 3ZWXA 5E9QA 3E8MA 4IQ4A 3NC0C 4PRZA 2PSEA 3IEIA 4LMBA 3VNSA 1EZ1A 2O2HA 3BJMA 3AEQB 3MT8A 1G7RA 3UJCA 4AJOA 1W48A 3GLIA 3AHHA 3ZPXA 3AM4A 1LS1A 4BNDB 2XQKA 1SK9A 2C4HA 4CUJA 1LA2A 1P7VA 3GYGA 1TD9A 3BCSA 1QC5A 1QVRA 1PL7A 3NM5A 1TJ4A 3P26A 2WC1A 1TJ5A 3PU6A 5EE3A 3S68A 1TM2A 3T95A 3DHWC 4FT4A 4WRRA 1PO7A 3WK6A 4OXYA 1IL0A 3A9SA 3AF5A 2GJ8A 2VJLA 4KK4A 5A9SA 1Z29A 1KDTA 3NMUF 2P5YA 4MWGA 4EW6A 5DK4A 1XD2B 2UZ1A 4LF4B 2OK8A 2FZWA 3HZOA 5ADUS 2FEKA 3NNDA 1SXJE 4F71A 1UKYA 2RGXA 4IVRA 3TTTA 4EHKA 2ZZMA 1DZIA 5AUQA 4PC6A 2OCAA 1A8PA 3MS4A 4R9SA 4WEQA 1XFAA 2Q3DA 3JVIA 4V39A 7REQA 3A6GA 1CUEA 2Y0DA 3PJEA 3ISVA 3UMBA 2ERCA 4EDFA 3ZLTA 3IR7A 3REQA 3E8SA 5K3SA 5LUAA 4QQNA 3OLVA 1BHO1 1YZHA 3GYBA 1G5PA 4TRNA 5EEHA 3WDMA 5JBIA 1QFZA 4K9NA 3EXFA 1BMFD 1NP6A 1N8TA 3PPIA 4R3NA 1Z68A 4TXLA 4D5EA 2YJ5A 2NO6A 3HU1A 1V7ZA 1D9XA 2VG8A 4KOAA 4MAAA 3KWMA 1TU3A 2F8SA 3PIDA 2IZ6A 4ZEWA 3RS7A 3IIMA 2B4KA 4RF5A 3BCRA 3WMGA 1BN7A 3HE3A 3Q88A 4KQGA 1U81A 3Q7TA 1B6RA 1ZGAA 4RL4A 1AUVA 3R1IA 5HKAA 4MKXA 5JMOA 4YCDA 1XZDA 2XKJE 2B7LA 1N2OA 2XKKA 2WV7A 3MHPA 3QOYA 4F1WA 2I5PO 3PHCA 4HDCA 2HA6A 3FCSB 4FYJA 3KO8A 3PEVA 1EE9A 1Y6QA 4TKLA 1E6EA 5C31A 2P79A 4GX0A 4DNQA 4ZWNA 3ECCA 4LJKA 3H0KA 4ZCQA 3GT0A 3EAGA 2VWGA 3SVTA 1CB0A 5EZQA 2PGDA 1QYVA 3FHJA 1Z7BA 2ZTMA 1M6VB 2FWBA 3WJAA 3K7EA 2AJTA 4OF4A 4ZAFA 4WNAB 7AT1A 2IZOA 2IDZA 1AU9A 4HNHA 1SEVA 1TYBE 2PXXA 3HH8A 3QOFA 4G56A 3WRXA 4NLLA 3OAAD 4CKXA 2YMMA 5IAAA 2C9CA 2FG7C 1CW2B 2I4NA 4A6EA 5KWJA 1JEDA 5AW1A 1HEIA 3ID6C 4BO4A 5JFTA 1OJ7A 1Q0SA 3L7OA 2PX3A 1NGSA 3LC2O 3MTJA 5CBPB 1EH5A 4GGOA 3L7YA 3ZU5A 4IVQA 1RKVA 2ZAMA 3BWVA 3V4ZA 2D0PB 3PICA 2SNIE 5D1HA 3OZSA 4BWFB 4QPNA 3AB7A 4FGUA 4RULA 4DCOA 1M75A 4GW3A 3KD3A 1DGQA 4FQ7A 1M3SA 1JMKC 3CYFA 2CXQA 2JFUA 3AEKB 3I5XA 1VLJA 3UKJA 4FMDB 3C3MA 2B5OA 1ZSVA 2RBKA 2JGDA 3D54D 3KJIA 1Z5WA 3DFFA 4QULA 2K6GA 5LB2A 2JVIA 3ZE6A 1R00A 3V2UA 3LT4A 4XARA 2MYNA 5D5PA 1D1PA 1U98A 2ZSIA 4FGJA 2Q5OA 3PUIA 3RABA 2ZI5A 2WYWA 4RMJA 2D1FA 5EXSA 2V6BA 4TWAA 2AD5A 5BSFA 2MSLA 1RWMA 2YVKA 4OQMA 4QQRA 3ZH2A 4NMMA 3HJRA 1BMTA 1TMYA 2BMDA 1RFGE 2BGUA 4PS1A 3HI4A 3U44B 3KXPA 3L8ZA 5HZKA 2WJ4A 5A5FA 1AJEA 3ELYA 1WE2A 4RCVA 2Y66A 4NCAA 2QA5A 3LY8A 2VUIB 2PD6A 1E9AA 2FZLA 3OFND 1K9SA 2OCYC 3DHEA 3U4QB 3TAUA 4NIMA 1GPBA 1B0UA 1SRRA 4L74A 1P5JA 3ZBPA 1DKRA 1KMHB 2H4FA 2ZVPX 3VHLB 2PWYA 2Z8XA 3R3JA 4QIHA 1W96A 4ZO7A 2O5EA 2ORYA 3FYUA 3T38A 4AJKA 3A2NA 1E7WA 5AVTA 1R0CA 1VGQA 4NR0A 2P69A 1RAAA 2W6NA 3KU1A 3QYAA 3AESA 3UV7A 5BR7A 1MENA 1PS0A 3PI6A 3W4KA 1FJ2A 2FEOA 4P32A 1I6MA 4YJFA 1OLUA 4DE5A 1CZKA 1MP0A 1L5SA 1R0RE 3DCIA 3DONA 1DOHA 2I7VA 5DXAA 2AH5A 4D8VA 2O8CB 4FDUA 3R76A 2AW5A 3ZNQA 4R0MA 3EGXB 1V6AA 1VBMA 1IUKA 2XWJI 3PE6A 4LJAA 5E2IA 1KI9A 4AZWA 3RKRA 1M34B 1UXHA 1X9IA 1KYIA 3MMSA 1Y3BE 2IDKA 4L8WB 2H54A 3QFTA 2FSFA 2H63A 1Y3DE 1L9XA 4H16A 1QHEA 3HRKA 2PS0A 4HNQA 4C03A 4J16A 3BHIA 2FSHA 3DO5A 3REFA 1X1RA 2VPIA 1SU8A 2JKVA 4F3KA 4MKRA 3LW8A 4UTRA 4BU0A 1NJ5A 3CZMA 3MRSA 1IJFA 4FFWA 2BMVA 2I4OA 4RIEA 4XTRA 3WQBA 4ESOA 3UWSA 4A9AA 1GR1A 1XG5A 4MQFA 3TOCA 4GQIA 4IKOA 5CJJA 2C4VA 5FB3A 3STTA 1B6GA 4EJ2A 2VLIA 5FQNA 2JFXA 3AHFA 4RCYA 1A9SA 3AJ9A 3BHNA 2OTCA 3USZA 2K2WA 4EW3A 3CG0A 5H59A 1NJ8A 1L2TA 2O48X 1J49A 1KEZA 2DHQA 2O1WA 3I2FA 2P9ZA 3C1AA 3DKVA 1GRNA 1V26A 5J9FA 2JKYA 2ZRGA 4KP7A 2EL7A 1TW2A 2QRVB 1GZ4A 4Q7JB 1SQSA 1ZXBA 4KAJA 3KQPA 1F6WA 2YMPA 4FN5A 3WKBA 1JA9A 4UU0A 4E46A 4RTJA 4LQCA 4W5QA 1N92A 4MQBA 1XQXA 1QOQB 3R0ZA 4IBOA 1RHMA 2WFMA 2F1OA 3LW7A 5GOZA 2VJQA 5HK9A 1RXSA 3NH6A 3BJIC 1I3MA 4JLBA 4BXOA 5AXDA 4RTOA 4CKZA 5AW6A 2NQ2C 2JHFA 1NRXA 3E6AA 1U9ZA 2ZP1A 1CULC 3H2GA 3QF4A 4AZVA 1QR2A 2FSPA 2IH5A 1M1XB 3NI2A 2WF8A 2FXVA 3LWNA 2J59A 3V4OA 1BD3A 3ZUGA 2E9SA 1FUIA 4CI9A 3M8KA 1U8EA 3MNFA 1B2LA 2RGNA 1OXBB 3BMOB 3DOEA 2BHLA 4K9QA 4KQ1A 5GJVC 4QJ5A 4WFQA 3BDIA 4PG4A 3UF0A 4EHJA 1P33A 1XPOA 1A4UA 1RBZA 2FLWA 3EQ6A 1BDMA 3S1AA 4TQUS 2VRNA 5TT0A 4JP8A 2VKQA 5EJ9A 3OOWA 1HLPA 1JQ3A 1XA3A 1NDUA 2Z98A 1O9GA 1VJ5A 3QWFA 5ILQA 4PPFA 4A0FA 3H19A 4EJFA 2PUHA 3KXIA 4X60A 2XHZA 3V1YA 5BR4A 3AFMA 3KFXA 4D42A 4TWBA 1L6RA 1U1IA 1G8GA 1DZ3A 1T4DA 3KU4A 3RGWS 2HYDA 1UJ5A 2XI4A 3V55A 4HD8A 1XMPA 3C3YA 2Z1NA 3W6PA 5IABA 4AURA 5LZ9A 3P2KA 1CUGA 2D2EA 4BFCA 4YXWD 3MRXA 2UVPB 4KPFC 2DLNA 1C4OA 1NI4A 3BTUA 1E5TA 3QJGA 1R8XA 1A2QA 1K9VF 1JXOA 3AR2A 1TMKA 1P19A 2HSWA 2BI8A 2PWBA 3L7LA 1VJ1A 4NV3A 4YT4A 5MN4A 3ICEA 2R4TA 1IB0A 1IY8A 2H06A 2NU8A 3N05A 4E2WA 3FWPA 2C8JA 2H1RA 4NZNA 1S2GA 1F06A 1T9HA 3QU2A 4PGGA 1TZBA 2BMEA 3JWEA 2CLEB 2BFPA 3NIWA 1YDGA 2F7SA 4TRMA 2B4RO 1ZLXA 4JJZA 4ZQEA 5L53A 1D03A 2YMQA 5LSAA 2C07A 1ECBA 2AJDA 4TMWA 5SYNA 3CIFA 2ZJ3A 2P6MA 3EA4A 4HLUC 4K87A 4I0WB 3A31A 4QBTA 5KNDD 1XTUA 3MF4A 4HDSA 2G5PA 4ZT2A 3MRTA 3AHJA 3V8VA 3BZUA 2QZ4A 4CF5A 5IFLA 4RVUA 2GAFA 2WJAA 2AQHA 2AZXA 4EBBA 4C5CA 2OEPA 4JI5B 3C43A 1YC2A 2P4UA 2B8JA 3ASYA 3RWOA 4YAIA 1B14A 1IY1A 5H02A 2ZB2A 4A8PA 3G2NA 1ZGJA 2R6ZA 2Z04A 1ICIA 4F4HA 3WICA 3ZDBA 1QH1B 2DQ4A 4ZOLA 5KPDA 3G5UA 4I81A 5JSZB 4BVLA 1XMOB 1GPDG 4JL8A 1P5FA 1V6SA 2PBZA 3TE7A 1N6PA 5AJUA 5FADA 1ZD5A 1EWKA 2LD4A 4D9GA 1A95A 1S3IA 1VJDA 1WV1A 1CVLA 2C2OA 2HJSA 3IP7A 4LHEA 3MAAC 4OL0A 4UE2A 3TQSA 1C30B 2O0KA 2X0IA 3E03A 5CDSA 2RJ3A 5DN6D 4WT7A 1KEEA 3KT0A 1DQZA 4DGSA 2NSYA 1PLJA 2NVWA 4KX5A 3DTTA 4E5UA 1WETA 1F3LA 4KE9A 3GZJA 4XCXA 5K0BA 4GM0A 4M87A 4KN5A 3RC1A 3LTEA 3C97A 3UOGA 1F20A 3BH0A 4ZVRA 3ZDYB 3AERB 5FLEX 2BD0A 5AI0A 1L1EA 1S01A 5T3YA 4RGYA 2O2YA 4JJEA 1UPUA 2MINA 3DWFA 3LQKA 2P9BA 4O2BA 4D0LB 3AM1A 2XD9A 5ES3A 5HGJA 4NV0A 3RBZA 4R1LA 4PHFA 2W00A 1N2GA 1WUTA 1GPUA 2QQ5A 3CONA 3WYDA 3DBHA 2RGWA 4L4SA 3AWIA 1RRGA 1YCDA 1EQAA 4HEJA 3STXA 2XRYA 3PT5A 1NIPA 4LYGA 1RJFA 3MFQA 4UNNA 1EG7A 2X76A 5I7OA 1XZAA 3G0BA 4MCAA 1GU0A 2O2SA 1OR8A 3L4SO 2DWCA 2ZJ4A 5EJEA 3SHVA 4ONEA 2BHNA 3VX3A 5BUQA 2G6BA 1WABA 2NGRA 2Q29A 3F5DA 1P1IA 4R5MA 4HDOB 4W7SA 4B73A 3PUXA 4MVJM 1EI9A 2NO7A 4Z9BA 4J0QA 3EBLA 3H16A 1QSGA 2GD0A 3NTOA 4MIKA 4IJWA 4N5DA 4ON9A 2BLNA 1FPMA 2O3TA 2DWOA 4WIAA 2C5SA 3DZKA 3WNCA 3OX4A 2UZ4A 1ZDMA 3O8OB 5AK6A 5AKKA 3D43A 1JLLA 2YIMA 2FJ0A 3IOEA 1P62B 5D1NA 3VFDA 5H81A 4ZIRA 4CG3A 1XDDA 4P7JA 1E1QA 3KSMA 4UHJA 4IUBS 4WESB 1JKMA 4CHTA 1FS6A 2X9QA 4S35A 4DR6B 2YV4A 2Y92A 3QVSA 4EKIA 2JB9A 2J3HA 5M7EA 4FYKA 1LUAA 1WIWA 2F6RA 3H6HA 1N8KA 4BVFA 3WRYA 3I6MA 3OZXA 5CVJA 3M3HA 2CXNA 2C4TA 5FBHA 3U7QA 4JFRA 3C5EA 1EVKA 3QJ5A 1IZZA 2IZ5A 3L18A 2HM7A 2HRQA 3KV3O 2V9PA 1WMSA 3K6RA 2ZTVA 5EIAA 5CD1A 1JQKA 3CEPB 1XTVA 4LX0A 4C5BA 5BR1A 5KQMA 1QJ4A 2VYCA 1RJWA 2YN0A 4CN8A 5CFPA 3LQ2A 1UC9A 1JKJA 3PRYA 1QQ7A 1VGRA 4P1ZA 1KS9A 2WJ6A 2X5KO 4FYHA 1C1XA 1PP4A 4LK2A 5TPZA 3V6LA 4DMLA 5JAPA 4TL7A 1G8FA 1MOQA 1OXTA 3HJNA 4BHTA 1EHYA 3R44A 2MIIA 1VL6A 4RPGA 5C4GB 1KDVA 3JATA 3K2QA 4YEDA 2D5BA 4H1HA 2WE7A 3G2KA 3I2GA 4JLMA 3SC4A 3C8HA 4V2UA 4F9TA 2AEMA 3AR4A 1A9PA 5GQSA 3RR2A 4MEJA 3MCAA 1E9VA 2G4VA 3SN6A 3REQB 4UTOA 3V4VB 1RPTA 4KTTE 1M67A 1T3LA 1T2DA 2WAXA 4J7CA 1D0VA 1SGWA 4UHKA 4XOUA 4BP9A 3QHPA 1F8UA 3C98A 2BZGA 3WWEA 5HRUA 1S96A 1Q15A 3GEEA 3IKTA 2QRHA 4L3WA 3QPBA 4S2UA 1CB7A 4BNHA 5A0VA 1OFHA 3OM9A 4NHEA 3F73A 3WNBA 1X1CA 3DZIA 4CQLA 5KYXB 3IKMB 1S4MA 1A9XA 1CJKC 2WSLA 4HUQB 4BMXA 4WA7A 4EEKA 4Z4IA 1P0FA 4ARVA 4KQCA 2H2AA 4BFZA 2YV3A 1T2EA 1ZI9A 1JHRA 3VO1A 621PA 3EPJA 3UY4A 1O94D 3HL4A 1QO7A 2GLXA 1BXRA 1LGYA 1UBRS 1PFWA 2CDRA 3F0TA 1ESCA 3G0OA 3MPOA 1P75A 3FPBA 2DRIA 5L51A 1USUA 4PANA 4X1OA 4BBJA 1ZZEA 1Q91A 1UZLA 4QSMA 5DNCA 3NGMA 5FPKA 3GOHA 1SUCA 3FF1A 3TUJC 2R11A 5B12A 3BULA 4U6SA 4JI8B 4RD1A 4WECA 1XCMA 1HE1C 4ZICA 4CM8A 3OTOB 4ZIRB 4YP7A 3TLMA 2IL1A 1TO6A 2WU4A 4CQJA 3N2NA 3NHZA 4QUAA 2XMDA 1ST2A 2QTVA 2JK1A 1F17A 2YXEA 1QRDA 1XO1A 2GO1A 3C3KA 5FTJA 2BZ0A 3OM8A 2BONA 3AG6A 4HWGA 4KAXA 4R1OA 1TE2A 2G83A 4QU5A 2HZ7A 4P5DA 4PTZA 1IY9A 4NH0A 1Y8RA 1WF6A 3K5HA 1HZZA 4AWBA 4Z53A 1A7JA 2CNWD 2A35A 4BVJA 4URVR 1H0RA 3HBAA 2HQSA 2RI1A 2Q4EA 2YHSA 4Y1RB 2H7CA 1WXGA 1ZGGA 3O2QB 3ORQA 3R0IA 2X8WA 4OYYA 3W2GA 2H11A 2BFDB 4B34A 1NY6A 4JVNA 1MC4A 2OFWA 5K3DA 4RY0A 2BKVA 3P9IA 4RW0A 4Y9SA 1BNCA 3PKZA 5KYNA 4JKIA 4TQAA 5C1DA 3KSDO 1Y7IA 1L7VC 1C3EA 4AN0A 3TFOA 4HEA6 4DPLA 2ONCA 3A36A 5K0ZA 4WV3A 3BFXA 3QV2A 5FFFA 2HBQA 3FHCB 2UDPA 3IT0A 3OJFA 2DBVO 3K0EA 1E9EA 3D7LA 3MB8A 3FB4A 4ND1A 3WZLA 4FNGA 5DOVA 3EGIA 1G4UR 4M0FA 2W2VA 3UICA 3K0AB 4EYEA 5MFPA 4YJ2A 3WL5A 5A0TA 2YHUA 1CCWA 4R8KA 2C78A 2CMDA 3T99A 2C7QA 3GW8A 5BSTA 2GI4A 1UWVA 2QE7A 4V02A 1E63A 1EXNA 3SP1A 5JH7B 1JGTA 1M54A 3F9CA 2BGTA 2ADFA 2VH1A 3IPYA 3OE4A 2EOAA 3ZJTA 3DMHA 4QFMA 2AQKA 4OTZA 2EZ8A 1N5RA 1LWOA 3PTZA 2Q07A 1PI3A 2RHDA 1BG6A 1MNQA 2EYQA 3OPXA 5CX1B 5BW5A 1ZN8A 2ZIWB 5HOQA 1E2DA 1NW8A 2WVAA 3EBOA 1FUUA 1COZA 1M2EA 3C87A 3ES9A 3OZEA 4JU9A 3LY9A 1OYWA 4NK4A 1YCFA 1FTGA 3T6KA 4KAAA 3GVIA 3GV0A 1SVIA 5HIMA 1Z2OX 2DY1A 3ABQB 4KU4A 1T5BA 4P4SB 5KMGB 3JU3A 4L9WA 3F2VA 4J0JA 1XTKA 1QRAA 3FGOA 4C05A 4BZQA 5J2TB 4JLPA 2Q4DA 4EHBA 4EZEA 1O8BA 2JGIA 4J0GA 4J9VA 5AHKA 3ICQB 2HF2A 2J5KA 2H1CA 3PTLA 4N5LA 1EWRA 4FKZA 1RLIA 5K3FB 3QE0A 3CH6A 3TK1A 5FUWA 4I55B 2BGWA 4O4LB 3K70C 3UXHA 1UZMA 4K81B 3NHBA 4HZUB 2H57A 5BN5B 2YV1A 3GEBA 5A4DA 3M6XA 4GECA 3L6UA 1U2SA 3ETEA 2FKAA 4IMPA 5JISA 4MZXA 4JVOA 4YV7A 4BQQA 4FYXA 2V3CC 2VP5A 3PUKA 3EPHA 1PGOA 2WP8J 4MQLA 5LCXA 2PXHA 3ZUPA 4CL2A 5IU6A 1OV6A 4AM8A 2RHBA 2XE4A 4JT9A 2EZUA 1QRRA 1ORIA 1KZ7B 2VYND 3ZJ4A 2G9UA 3QXHA 3D5EA 1KY5A 4RVFA 2IXGA 2EDCA 5EXTA 3R0XA 5EUBA 2ZJAA 1WCWA 3PHGA 1MABB 4TS1A 3CJRA 5T5QA 4WERA 4YECA 2V6MA 4MUAA 1PJCA 2WLTA 3H9QA 1CR2A 4NONA 1E6UA 1IQRA 1ULZA 3BWDD 3IEPA 2K2QB 5DSZA 1RI5A 4Y0VA 2C4UA 4H77A 4B75A 1ULUA 2N47A 4DFDA 1WJGA 2WPDA 3VH1A 5A6VA 3HXKA 3WB1A 5L7YA 4MIEA 5JADA 2NXWA 1OCEA 2XZLA 2UKDA 3ORRA 2RH4A 1FYXA 4ZKEA 1DC6A 1XRJA 3E2PA 4Q7MB 5HFJA 1FQOA 3SDZA 2HXGA 2D2IA 4OVKA 1GG8A 1NZDA 3KEOA 5JWHA 4AUEA 4FOOA 1L7BA 1VFNA 4OGGA 2FNAA 4AUKA 1QP0A 1W93A 3PQ4A 4MRVA 1DOAA 5H1YA 5L7TA 1B74A 1YR7A 5DWVA 4AICA 1OXUA 1MC8A 1ZEJA 2M98A 4PC3A 4QGAA 4Z9FA 5HPYB 2I8CA 3P19A 2GAJA 1FUEA 4Q12A 2OD9A 4X6YA 3I0NA 1MVOA 3T0FA 4E94A 4AP5A 1PRYA 1ZH2A 2GLTA 4JGBA 1WG8A 3BB3A 4DJ5X 1VHWA 1XZHA 4YWJA 3WXMA 2GZMA 3R8FA 1OLOA 1PUJA 1UOEA 4L8FA 3D5TA 1RZRD 1V4NA 1Y6ZA 2Q3FA 2OK7A 3NGXA 3D3WA 4OGFA 2HSZA 1J21A 1FVHA 2DBQA 1M1NA 1PR6A 3IJEB 1NQAO 2FJPA 2YBDA 5JDIC 3L6RA 4RC9A 4X62B 1GO2A 3F5MA 4MYDA 4OXRA 1C4KA 1K7YA 2CBXA 4EOGA 4FNAA 2RGBA 4QQKA 4JUAA 1A3CA 721PA 5DYGA 4WCVA 1C9EA 3HGQA 3L4BA 3TDNA 1N2CB 5B3JC 2XCRB 4RAQA 2JCYA 3DSRA 2LDXA 2ZXUA 1I7DA 1MX9A 4RCZA 4RQUA 3MWDA 1SCAA 5HE8A 4YRCA 4WSOA 1JVBA 1C41A 4OK6A 1QB8A 1DV2A 1DAFA 1PJ8A 4HZUA 5KJ1A 2RCNA 2OCIA 3PFWO 2DGDA 1FNNA 4J0DA 4F45A 1CY8A 4Q21A 1WD7A 5B1EA 1ZK1A 3QBJA 5F9MA 3WVNA 4K9RA 1JEAA 4F4UA 9LDBA 4Q93A 5I4IA 2GD1O 4PFKA 4TRRA 1SC4A 2VTKA 4XD2A 5HTOA 1BE8A 3KWLA 5AH0A 3Q7RA 2ZRCA 5HQJA 2Y68A 1O96A 2WHYA 4YQZA 1CUWA 3I0ZA 3NHLA 1QDUA 1LS6A 3PT9A 4QVGA 3QVUA 4KMOA 2X1HA 1IHYA 5DYTA 3MGKA 4PXAA 1JEYA 1NW9B 1M0WA 4WJLA 3IIJA 4CEIB 1P7PA 2X9LA 1LNZA 2F48A 1Z88A 4M9XA 4WBNA 2GJSA 1ATIA 1E5DA 4CGYA 2O3QA 4ETIA 1YBFA 3GO4A 5C5CA 5A3SA 2GA9A 2DQKA 1PNQA 1UQRA 3KR1A 4TT3D 1ULBA 1CS4C 1D2MA 1W0CA 4ITUA 1BTOA 1VB5A 2C5AA 4GKBA 4PFJA 4YJGB 3VJMA 3VNBA 4DR1B 5KCMA 5IMSA 3V1MA 1IRIA 2EQ5A 2P41A 3ZIAD 3FRIA 2PUAA 4YS6A 3QKRA 2Q49A 3WDKA 3OT4A 5GGYA 3E23A 3UGKA 1TA4A 1YJAA 2Z3VA 4G84A 4MTLA 2QTMA 1IBMB 5FOXA 4HX9A 1EWVA 3FYUB 1M1YE 3IXQA 2O2JA 1UBEA 4RANA 1C9NA 3GFQA 5AKXA 4OLHA 5EPUA 4CKWA 1GKKA 1U7HA 5LD2C 5JAQA 1LVHA 3PEFA 4WD3A 3Q3VA 4AQDA 4GVLA 2YCLA 3GLFB 2GCNA 2Y1EA 1WOYA 1V3VA 5FNVA 5EJ6A 3THYB 3T9BA 3IP1A 3FDFA 3GK3A 4O4HF 4LTNA 5BNZA 2Q45A 4FEYA 4PS0A 5F7JA 3N8NA 3QWBA 5COQA 2JH8A 1SUPA 3WAGA 2V7VA 4QPZA 3DLPX 5EE0A 2IIQA 2VT2A 1O89A 1CQXA 2BMAA 3PK0A 2P6PA 2XSZD 3VU3A 2F17A 4ETWA 3ETNA 4R4JA 4BWGA 3ESZA 2CXUA 1OILA 2IPNA 4EB6B 1N8SA 3BEOA 4LSMA 3U7GA 3PWSA 2G9NA 2HMYB 1A98A 1PK7A 4Q1FA 1O9HA 5ABPA 1UXKA 2QB5A 2OAGA 1YC5A 2FN3A 3FR7A 3DEYX 5AP9A 3TW6A 1RQPA 4M1KA 4H08A 1H4QA 2ACEA 4JVMA 3K8ZA 4HX5A 2AE1A 2ZUVA 2WE8A 4D9EA 5GP1A 3AT1A 4KGZA 4QU0A 3NIFB 3KKLA 3LY5A 3SSAA 1VJGA 1NUUA 5F2EA 1BMFA 1Y9AA 2A5DA 2VJDA 2ZKIA 4JC0A 3DE4X 2YUTA 2DG2A 1Q16A 1RACA 1X7ZB 2HNBA 2QU8A 4P98A 5EJGA 1L3CA 1P7CA 2JAHA 3BJRA 1OWMA 4MPRA 4WGFA 3W4IA 3QMVA 4DQLA 1KP3A 3TL6A 5BV1A 3EEFA 3IP3A 3NHJA 1PQYA 3U3KA 3K1JA 2QR3A 5I3ZA 1L5HB 5K45A 1OAOA 1AHNA 2PBLA 1X1EA 1WPRA 3AX6A 3KXKA 4DABA 2XMRA 4KSCA 1KZYC 2HIAA 4XPZA 4DLNA 4K86A 4O1HA 5DZSA 5EERA 3UIEA 3EB9A 5T57A 5KEIA 1ZU4A 1NVAA 2Q8PA 1N1DA 2YWCA 3DG9A 3C5CA 4Q3NA 1NVVR 4EQ6B 1XMXA 3EZGA 2VYVA 3V2IA 1GTVA 4QHSA 3IFSA 4BLUA 2DUMA 1RWVA 1A7UA 5AQ1A 5BV0A 1H85A 2B37A 2OVFA 4IXNA 4U8GA 1U5AA 4R1MA 4MKFA 2ATEA 4OH1A 3BH6A 4V0RA 4RYDA 3ZBTA 2PUGA 3H5VA 3AUAA 4I08A 1ISSA 1NI3A 2P91A 3P2MA 2B1QA 2P30A 1ZO8A 2VJAA 4RIFA 5HNKA 3EJ6A 2QAJA 3LP8A 1XQ1A 3BDVA 1SO8A 1YHNA 4HYEA 4RD6A 4AW9A 2YYSA 3MT7A 1AIPA 2WUVA 3AESB 4JUDX 3K16A 1XEAA 1JDSA 2XUDA 2ZWPA 1SIUA 2ZUSA 1BD4A 5ECWA 1CQIA 1U6IA 2I3DA 3IQEA 5LU9A 4JYBA 1FYFA 1KIAA 1JHPA 4BLOA 3HKBB 4PV7A 5CT5A 3ER8A 1W73A 3UUGA 3EN0A 3I3SR 4BNFA 1CETA 1H9AA 4QEZA 2DUNA 2DPLA 4O4IA 4TKZA 1CYEA 2HREA 3K0FA 3VNUA 4BFWA 3AVPA 4LBZA 4Q18A 3EWAA 3VOBA 4DWVA 3K3PA 1B8OA 1J09A 2JGFA 3RVDA 1GCAA 2HT6A 2PJDA 2W4MA 1C7FA 4FYYA 4GPTA 1QHYA 3GJ5A 5ICCA 2E4ZA 2BWJA 1F9AA 3R7AA 2PN1A 2RBEA 3R24A 4MLDA 2E1RA 2A2ZA 4FYMA 4H3KB 1AKRA 3R7SA 1XWWA 2Z2ZA 4AG5A 2JI6A 2R6DA 2P0AA 2OYCA 1HKHA 3G8BA 2DP4E 4KE6A 2JIRA 1BVUA 1CZOA 2WWXA 3EIUA 2AS0A 5JATA 4XWWA 2RHHA 1L1QA 1YHYA 3T3NA 1DRJA 2ZGVA 1UF9A 2WQ7A 3RI3A 1T4MA 3IMEA 1O6GA 3G2JA 3TINA 1BQ4A 5GM1A 3ZDRA 4CQMB 3LT2A 2IF2A 3B13B 4GEGA 3PQ7A 4X84A 1NSFA 2LBPA 1UMCA 4KI7A 1SZPA 5CAEB 4MB2A 2C2BA 2BGRA 3FOEC 1NW3A 3DV0B 2Y1LA 4WCFA 4NSNA 3HACA 1LBQA 5KTPA 2DH6A 2HT1A 1EFVA 3C4JA 3W1WA 1EXWA 5LLSA 1LK5A 1TPZA 2OHIA 2VF8A 5C4MA 2CGEA 3N2GB 3Q8KA 2ZUUA 2RAVA 3DC7A 1VG0B 3ZGXA 4M0LA 4MV8A 3L8MA 1WMAA 2FOXA 3CURA 3RVKA 1COWD 2H1SA 4HDNB 4KFTA 4JUIA 3L0IB 4IWXA 1E3TA 3K1TA 2J5QA 3PUJA 4FHEA 1CUYA 3VYTB 4A82A 1UBCA 1KRHA 2J7KA 2V5AA 3ONDA 4LA4A 5H3CA 5FFNA 4MGKR 5ED4A 2PFGA 2ONZA 1NI5A 3IUPA 4H17A 4P6VF 1IM5A 2QD5A 4LDQA 4U7PB 5JDCC 1XMSA 1UP7A 1ZEMA 1E60A 2C04A 3KHUA 1JR3D 3H1AA 4KQFA 3VYRB 4B0PA 2FW0A 4JELA 3WFZA 4AC9A 4FFNA 1RXWA 3RT9A 1ULAA 3GJXC 4AIRA 1MEEA 4FWTA 4IJ6A 1DDGA 2QKYA 1OX4A 1ZLYA 4I46A 4WA8A 4ACBA 1A77A 3CGGA 1IYZA 1Q44A 2EFDB 2XBUA 2ZDHA 4E2FA 3BFJA 3IQWA 4MI9A 4PYJA 3RU3A 5ALIA 1TD1A 1KH1A 3V1UA 5BQ3A 1NBIA 3MINA 4EW1A 5G3ZA 2H2DA 1RYNA 3L93A 1MRNA 2PRKA 3HKDA 3QTBA 4O5OA 4WKBA 4AWAA 5BV2P 1QTQA 2QLMA 4QGHA 1HPLA 3RYCB 4CFZA 1JFRA 1E3LA 2COUA 3AGQA 4P3NA 3H2ZA 1GUBA 4RJTA 1K3TA 3MPUA 4IUCS 4FHZA 5KYGA 1RYHA 5F77A 1ZI6A 3T7KA 4ZZ1A 3HCPA 3ZDCA 3HZZA 1P0MA 5LR6A 2B83A 3FOZA 5K03A 4DR2B 5E0OA 3AEXA 4INZA 3GGSA 3S55A 5JH7A 2FQWA 4GOMD 4MPDA 3IV9A 3WYCA 5HZMA 1U3DA 1YOVA 2GCOA 3LXXA 4GVXA 2W2TA 1U2GA 5TX7A 3UMVA 3Q8XB 4IJUA 2R8ZA 1CLEA 5JCXA 1MFZA 1V7CA 4B7UA 1EUDB 3CNOA 3IP9A 4H6VA 4PWYA 2GEVA 1DADA 2OXTA 1TAGA 1D6JA 2YQZA 3OU2A 2G9QA 1GGFA 4NZ9A 4PAWA 4AG6A 2E85A 1CQWA 4QA9A 3ZE8A 4Y2JA 5TQ0B 3O4IA 1CUJA 1AGXA 1SG6A 3ZHSA 4EB0A 3O8OA 3O38A 1CEYA 1KZHA 3E48A 3GX1A 1V5GA 5LDDC 1UFOA 4FJ0A 3F6BX 4IEIA 1KWGA 1CUDA 5COBA 1H94A 4DBZA 2D0IA 2QTLA 3HXQA 2HRRA 3DOCA 2XCOA 4TN5A 1YR8A 4REQA 5LLDA 2OZLA 2WBLC 3JASB 1XX6A 4LDJA 5HUJA 4GDMA 1Q3TA 4B3GA 2FPIB 1KSHA 5FTMA 3S1LA 4PPYA 4OFXA 2IGTA 3P27A 4GHWA 5KYUB 4ZQFA 2GZSA 1KK2A 5EI5A 4AKEA 2P40A 1TT5A 1VTKA 3JYQA 2FSVA 3ECSA 3L1HA 3LQRA 2Z5VA 3C85A 3M83A 4G5RA 1Q3KA 4Y6RA 2QRKA 2ECOA 2GBIA 2Y1KA 3WS7A 1JDTA 1T35A 4DIEA 1ZBQA 1WX1A 3KKEA 1NJ2A 3SJ7A 1R37A 3PZRA 5CA1A 2ZJ6A 4CIBA 1M5TA 2JH9A 1NF8A 1SKYE 4EMUA 4F4IA 1Y4ZA 2EAUA 3MWLA 2C42A 1NNEA 2IOFK 3MIZA 3U3XA 4F2HA 7REQB 2FE1A 1XBTA 1PFYA 2D13A 3GCDA 2XRMA 1IG3A 3VR2D 1ND6A 5K0FA 1CUZA 1FFAA 1JA0A 1EM6A 3FPFA 3M9LA 1NULA 5IANA 2IBSA 4P3KA 3AZOA 1E59A 2WWRA 3PHHA 1UKEA 3B6MA 4BMVA 2XRZA 4URYR 4V3BA 2C77A 3M1YA 4QT0A 4B6GA 3SHWA 4EQZA 2W37A 4NG4A 2P3LA 3ON5A 1HORA 2Q5HA 2A58A 4GMFA 5AHOA 1MNAA 2E5FA 2BT4A 2DC1A 1N3YA 4K0RA 4JLVA 2JLYA 10MHA 4D43A 2O14A 1KEVA 3QEMB 1GN8A 4YRGA 3Q7PA 4S0XA 3FFXA 2EJTA 4B6RA 1H2AS 1G66A 1SUFA 3PNYA 3I4CA 4ZHQB 1CUUA 2JIDA 4YJHA 5D84A 3U37A 2A9JA 4RF4A 4A3SA 4D45A 3TQFA 1Z8DA 1HE8B 2O2CA 2CZGA 4I50A 2RGAA 5A2GA 1P4JA 3C6BA 4ZEXA 3KYDB 2YY5A 5JSYA 1KYXA 3HM9A 2VDPB 3ZZTA 2BZSA 1HDOA 4RQTA 4PSAA 1P9OA 3OQ1A 1LW7A 1AO3A 1SVNA 2QAGA 3DNPA 3N6VA 1SZCA 4IXDA 1UEIA 5TQJA 3ED5A 3ICCA 3W3AA 3K9QO 2BFAA 3PC3A 4GQBA 4CE6A 5BSVA 4DSTA 6YASA 1H2WA 2C98A 2LKDA 3A11A 2ZBGA 3HKEA 3NHPA 3QLVC 4M0DA 2GM9A 1O6CA 5FL7D 1MVLA 5IK2A 4AXBA 4KSYA 3EVDA 3ZQKA 2W6OA 1LLCA 1OXSC 4QTXA 3VI3B 5J4HA 3NEAA 4XJVA 5T3UA 3K09A 3HLTA 2I78A 4E22A 1G19A 3LZ6A 3VO2A 4MRPA 4LOKA 1EP2B 3NOVA 4LNHA 1PEYA 1PJBA 3U9LA 4Z5XA 3HBMA 4JV5B 4OHWA 2P62A 2C3MA 4IGEA 5HMLA 4B6QA 3GBSA 4PQRA 4R8RA 1F14A 1AQYA 2CJXA 2I66A 3V7NA 4CIYA 1X39A 1RYEA 4NDNE 3O95A 1DC3A 4QUGA 5AI4A 3LL7A 1LY1A 1RVV1 2R8PA 5G40A 3K4PA 5JLJA 2H0RA 3SR0A 4QUIA 3NWJA 4A73A 1Z0JA 1R8JA 2VDJA 2BTOA 4OV6B 2KS6A 3ZI0A 2OQVA 3OEED 5J43A 4D26A 1Z12A 1O8CA 2NUPB 3ICWA 1QGDA 5LZ8A 4E11A 1H3EA 5LMNB 3OETA 3I39X 1P4GA 1DKUA 4U7JA 3WSTA 1KJQA 1H1LB 4ODIA 3V33A 4PQFA 4U2GA 5EZ5A 3F46A 1VCOA 3T7CA 4BB6A 1UOQA 5KVQA 4EI2A 3PC2A 2QBYA 3ONNA 4DWWA 4ERXA 4JMLA 1QIKA 3OA0A 3T3EA 3B9PA 4IHQA 5IXSA 5JTUA 3OZFA 1HQYE 2RI6A 2QAIA 2E6KA 3F8WA 3MTAA 4J7AA 4BJ5A 1RWOA 1PT5A 1K0UA 2BMWA 4G86A 3T4UA 3TBKA 1IUNA 1GXSA 2HU5A 4MCJA 1DKNA 4J7UA 2BEJA 4CIWA 1KQGA 1SIWA 1ZJ6A 2RHOA 3GC6A 1ZD2P 3TW4A 3LLMA 1R0ZA 3VPCA 1B23P 2J4DA 4HAUA 5EZYF 1QH0A 1RHJA 1JZSA 4FGWA 3MWJA 5IVIA 1JDBC 3A3KA 5CMLA 1C7EA 3WNDA 3V4FA 3ZH9B 4KR3A 3TJZA 5IYZA 2JFOA 3WHKA 4F1JA 1YQXA 1W52X 4MRRA 4BTEA 1KEKA 2IQIA 2FPGB 1VG8A 1YFJA 4TV8F 5MF6A 5DO9A 1SHKA 4IIJF 2MR6A 4U9UA 5HBRA 1U80A 4R9NA 1KEEB 5FPPA 2AOWA 1KOFA 4JJ8A 1R6XA 1U90A 2XVAA 3EYWA 4EGSA 5CD9A 3LO8A 4MS3A 4YMGA 4OJYA 5IKPA 1K6EA 1CRQA 2CLLB 3AJDA 2QZ9A 3VH3A 4QG3A 2AVNA 3W5AA 4RS4A 1P1JA 3LE8A 3T1QA 5JEEA 3N8IA 2NUBA 2W11A 5IWAB 1BAPA 1FDWA 4RHYA 4FB5A 4FKBA 2WVGA 1WCIB 4GZ3A 4G97A 2RC5A 4MLPA 1KNXA 4DA8A 1D5CA 4UARA 3SZ3A 1GDHA 2AB0A 3NBUA 4F1KA 4UTXA 1YZLA 4MUFA 1JLMA 2HLPA 3E2IA 5CLQA 1AE1A 2KSQA 3DXXA 1R0SA 3VTZA 1ADCA 2X0KA 4KDEA 3RS3A 2VHVA 3LYAA 3PR3A 1DV1A 4UVIA 1EDOA 1JIXA 2IXAA 3W6NA 3S2IA 1ID8A 4XX0B 4XD7A 1ZGZA 3JQ6A 1FSZA 2BFEA 4GUDA 1IEWA 4PCVA 2X5NA 2XGGA 2P67A 3O83A 2A0WA 4KH1A 4XOIA 1TUEA 5GPBA 3EG9B 4ZZ0A 5I9LA 1R7RA 1II0A 1NNI1 3JAWA 2WTMA 4F97A 1K89A 1YJQA 2OBXA 3MUOA 4TQGA 4CKYA 1TM7E 5L9AA 3RADC 1GTJ1 1JQDA 2D4AA 1WDKA 1JSCA 1LTKA 1RMQA 3Q0EA 4H3HB 4KXFB 5AOBA 5LA6F 3VU1A 3SQMA 2BEUB 5AVOA 4IG4A 2Z5FA 2F8MA 1SEPA 2OM6A 3HBNA 4EB8A 3L01A 5EESA 1LRJA 3TXAA 4PTYA 4XFKA 3CUVA 1TZCA 1O77A 2H7VA 3E3LA 2IXEA 3O84A 3OIUA 4QOJA 3SHQA 2O59A 3UA3A 5K2MA 1U7WA 5E1OA 4ZOQI 1ZN9A 4RDIA 3WWOA 5AFSA 4OHCA 1XNGA 1VG1A 4V0ME 5DIZA 3O03A 4XIYA 1ORDA 3UNXA 5K99A 1G63A 3K0CC 2RAPA 3AUUA 1EXMA 3FPAA 1GA6A 3IJRA 4KR0A 5T41A 3FYTA 3K0BA 5I01A 2OXIA 1FX1A 4UBJA 1P1BA 3ICOA 4KYTA 1BS9A 4N18A 4XVHA 2E5LB 2WNHA 3R3XA 3ZY4A 3ZGVA 2FN4A 4QTUB 4EW2A 4WBSA 4LV6A 3ZOZA 1A96A 1OKKA 1M7GA 3DUFA 4I4LA 3BICA 5MFZA 4BQPA 2GETA 4UU7A 5KQSA 1KERA 2FMFA 3CTPA 2SHKA 3CIOA 1QHFA 2X9NA 3ZWQA 1JP7A 1L4HA 3UMRA 1XPUA 1TTHA 1ESMA 5CJ2A 3U3RA 1E4YA 3E5MA 1G9XA 2OV3A 1IHXA 1FFWA 4YH1A 4DADA 1UINA 1KA9H 2LUOA 4ARAA 4DCNA 1W6RA 3UKOA 3ZS8A 1YJBA 3LGAA 5FOVA 1WXHA 2CSXA 4DIDA 1MKYA 1SUAA 4GXTA 1TADA 4MMXB 3RS0A 1TL7C 3B5EA 1HG0A 3QY9A 4PO9A 4BZWA 3VDQA 3T7IA 1PX0A 4AFNA 1N2SA 1ZJWA 2REXB 2ZYVX 1STOA 2WICA 1YRBA 3L82B 4LCJA 3RRZA 3VDMA 5IG2A 5BVGA 3ZWOA 4B81A 4ZJYA 2QYTA 3H9JA 3I6ZA 4LQ4A 5KSOA 3J7TA 3ML1A 3OJLA 1IULA 2DTDA 3O1JC 2X8BA 1ODIA 1GQ2A 3BTSA 3KKPA 3KK0A 2DBYA 4KVZA 4RK1A 3S2YA 3E5NA 1VE7A 3EZ2A 1TQDA 5TF4A 4YB8A 1DPGA 2FW8A 3FG9A 3M7IA 1GCIA 1H22A 1NKSA 2X23A 3HN7A 3K05A 3NALA 2QD3A 4J7XA 5DHPA 2OXEA 3ZU3A