5K3AA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/fluoroacetate - cocrystallized - both protomers reacted with ligand
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
295
Chain Sequence
b'LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGNFLPEEAPDQTAEALVRFFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
molecule tags Hydrolase
total genus 113
structure length 295
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3aA00
4K5QA 3I1IA 5AJHA 4H7KA 1UZAA 4IQ4A 2DCMA 5AKZA 2RIPA 2XUAA 7YASA 3EIOA 1PFQA 3OC0A 2ECFA 3C43A 5JZ9A 1U65A 5DJ5A 2G4LA 5CH8A 1YASA 5AI8A 4AMZA 5C7YA 3FAKA 2OGTA 4W1PA 4BTVA 2AJCA 4G5XA 4PSCA 5LZ2A 3G9ZA 3WL6A 1O6FA 4ZV7A 2HA3A 4K6HA 4QWMA 4GECA 4F21A 3STUA 3BDIA 5JALA 2AJBA 1GKLA 2HDWA 3WYNA 2HA7A 5FRDA 2H7XA 5SYNA 1LZLA 4EY5A 1W76A 2EDCA 2H9YA 5A6VA 5FOQA 1E89A 4JEIA 3AIMA 4DM7A 4TPKA 2XMDA 2JGIA 1EVQA 2OCIA 2XQJA 4TGLA 5CH3A 3Q8WA 2PKYX 2VF2A 1B6GA 4FLFA 3JWEA 2O2IA 2Z8XA 3FOBA 4U2EA 1CUIA 5ALUA 5AM1A 4X6XA 3STVA 5A71A 3G0BA 5AIBA 4BCDA 2GBIA 1GZ7A 3FLEA 5JD4A 1MAHA 1RYYA 1FFDA 4C4ZA 1H2WA 5AK3A 5AK5A 3ZI7A 3ANTA 2JIDA 1QLWA 3KOOA 1CR6A 4DIUA 3ZPXA 5ALRA 1E5TA 4P08A 5CT4A 2R11A 1ZICA 3D5EA 1U4NA 3QPDA 3A2NA 2XUHA 3IUNA 2R8BA 1MT3A 2HRQA 4DYHA 1VJ5A 2B61A 3R3XA 4DLNA 3W9BA 3DD5A 3K9BA 4PW0A 4B82A 1E66A 4J0IA 1XZGA 4UBNA 5IVHA 2WUFA 1XZKA 1Y7IA 5CT8A 3RARA 4A16A 5D7BA 1AKNA 4MWTA 5I9IA 5ALJA 5T4EA 1G4HA 3UUFA 5DNUA 4DGQA 4B0PA 4Y7DA 1GKKA 4G8BA 3D7RA 2ZVDA 3I2IA 5CTAA 3E4DA 1CUSA 2WHPB 2G5PA 3M3DA 4UFPA 4IHAA 2XUJA 1IMJA 3O9MA 5AKXA 1XROA 1L7QA 2W22A 2PU7A 3E3AA 1R88A 2XQFA 4EY4A 5AIAA 3WKAA 1K5PA 4OYYA 2JGJA 1ACLA 1C7JA 1P0MA 2XUPA 4KEAA 4Y2PA 2WJ4A 4L0CA 3HC7A 2VA9A 4UHFA 4W1SA 2J4FA 3MGAA 1JI3A 3FVTA 6YASA 4X85A 3LP5A 4Q05A 3G8YA 3I2HA 4DSAA 3PE6A 2QM0A 1XZMA 2G5TA 2BJHA 5HKBA 4A5SA 4F0JA 2JGLA 3UMJA 4GI1A 1LPSA 2VAVA 2W6CX 1UFOA 2Y2VA 5C8ZA 1CUBA 2BGRA 1AGYA 2WM2A 2DHDA 3HEAA 3F9CA 5AM4A 3WKBA 1GGVA 1JT2A 2ZYIA 1W52X 2CZQA 1K63A 1Y37A 4DMCA 2XUKA 1BROA 2YASA 4UBMA 1MPXA 5JYCA 5A62A 5IVDA 2VTVA 3N2ZB 4WDRA 4WY5A 1YA4A 3R3WA 2ACKA 1YS1X 5ALGA 2D0DA 4FBMA 3U1TA 2WKWA 5AKLA 1MX9A 4C89A 4BVLA 1MAAA 1TCCA 1FFEA 1EDEA 4B9EA 1UWCA 4A23A 4G4IA 4YX9A 2O2HA 5ALIA 3KSRA 4CIBA 1XRPA 3G9TA 3YASA 1YB7A 4N5HX 1KU0A 3G02A 1DT3A 2RHTA 3HYSA 5AI4A 1XKLA 4L9AA 1EXWA 4BAZA 1JU4A 1YAJA 1CUYA 5ALHA 1ACJA 1LPBB 2WJ6A 2PSEA 3LIPA 3EBLA 1SCQA 5EHQA 4HVTA 2Y6UA 4OU4A 1G5FA 1ZD5A 2I3DA 3DYIA 3GBSA 5JD5A 2LIPA 4Y9SA 5DYTA 2I03A 4ETWA 3WLAA 4U2GA 5EHXA 3B3QA 5AKYA 5HK9A 1UOQA 3E0XA 1LGYA 3CN9A 3F67A 1XQYA 3IUQA 3UUEA 3BE8A 2WG2A 4M0EA 3WA7A 1XZBA 4ARBA 5T4BA 4UFOA 1OILA 1BS9A 4FHZA 1A8SA 4FMPA 4P92A 5CT6A 5HF6A 2WU3A 5K3CA 2WIJA 2WHRA 1AQLA 1VE7A 2ZYHA 5D3KA 3KXPA 4J3JA 1DQYA 1EDBA 1XFDA 1EA5A 5C8XA 5AH0A 1VZ2A 2DSNA 2Y1KA 1WPXA 1N5MA 3H2IA 3WA6A 3HLKA 1WB5A 4JH0A 5KWJA 1E8NA 5FKJA 1XZHA 3E1GA 1TK3A 1SFRA 5LZ5A 4ARAA 1QTRA 5FXMA 5JARA 5AICA 2CKMA 1A7UA 4J03A 5F4ZA 2Z8ZA 3BF8A 1USWA 2CMFA 2HA5A 3D59A 4BRSA 3LIIA 4GEGA 4MWSA 2QJWA 2DHCA 4Y2SA 2XMSA 3AUKA 4H7HA 1SCKA 2OQVA 4QDOA 2BKLA 2JGEA 4NZZA 4UHCA 2BFNA 2Z5GA 4Q3KA 1HDEA 4PSDA 4K6KA 4OUKX 4E14A 5E4YA 3OG9A 1W6RA 1AC5A 5K3FA 3DS8A 3G0CA 4OSEA 4BYMA 4F5ZA 3DEAA 3WK7A 3D3NA 3D2CA 4HXGA 4Q82A 3DJYA 2Z3WA 1IUOA 1CQWA 3BXPA 3AZQA 5JAOA 2RONA 5AP9A 1MTZA 1S8OA 1VKHA 1H2XA 3PF8A 4LYDA 1CQZA 1SC9A 5DNVA 2XQKA 2NW6A 3D2BA 4QDXA 2VATA 3C45A 4B6GA 5I7UA 1R3DA 2ZYRA 3V1KA 2GZSA 4QNNA 5K3DA 2XB6A 3O0DA 4M0FA 2PBLA 4KRYA 4QLOA 5AM0A 2BUBA 2VSQA 1R9NA 3BWXA 5LP1A 4H7IA 4ITVA 3IUJA 1EH5A 2J4CA 5AKGA 1LBTA 2AJLI 4DSZA 3R41A 4UHEA 5ALFA 2V96A 2C0PA 2Y2UA 1EINA 1XQWA 1HLGA 3IDAA 3WK6A 3QMVA 5CT5A 5HKAA 3V9AA 3NGMA 5AKIA 3NOXA 1CUVA 5BOVA 3GZJA 1MU0A 2PU5A 4W63A 5HQ3A 1IZ8A 3BJRA 2AJ8A 1TCBA 3GELA 1QFMA 3PF9A 4WFIA 3HACA 1VA5A 1BEZA 4RE6A 1W4LA 4PNZA 4J0DA 4B85A 1PV1A 4B84A 4CG3A 1L7RA 2HIHA 3A6ZA 4BDSA 3SX4A 3FYUC 5SYMA 3F8SA 1B41A 1DWOA 4BCCA 3PUHA 4EA6A 1DU4A 5AK4A 3AINA 1QJ4A 2QT9A 5EGNA 3I6YA 5AO9A 4AMYA 2PM8A 5DYWA 4KYVA 3HRHA 3AILA 4DMFA 2PUHA 5K5EA 1K4YA 3O4GA 4IH1A 3FYUA 3FVRA 5ALZA 4BC1A 2V97A 4L3WA 2CB9A 3VXKA 5ALLA 4K6GA 1NX9A 2XE4A 1DWPA 2VT6A 4BVKA 2QTBA 3FSGA 4IH4A 3SC2A 3DCNA 4FLMA 1QONA 5CURA 2G63A 2DR0A 5K3EA 5D3ZA 3TRDA 3OPMA 4FFWA 3Q0TA 5JD6A 3L1HA 2WHQA 4QE3A 2OCLA 2GYVA 4LYEA 2OPHA 1W75A 1LLFA 4IH9A 3C5WP 3IA2A 3FBWA 5J3JA 1T2NA 3V1MA 3RLIA 1UT6A 4BCBA 1IZ7A 5ISMA 1QIEA 1XRQA 2C5GA 3BL8A 3ZWQA 1MO2A 2DQZA 2WUEA 4WJLA 1UXOA 4QZVA 3HJUA 3WIOA 1QZ3A 1WHSA 2ZSHA 5AI0A 1CFJA 3F98A 1XZAA 4UHBA 4U2FA 4U2CA 1XZDA 1QIFA 5ALVA 2C4HA 4KACA 4B0OA 1ZJ4A 2OGZA 5JANA 5IH7A 3H2HA 3G7NA 4Z49A 4HRXA 3ESCA 3K2IA 4UBOA 3O4HA 1MJ5A 4HXFB 4HRYA 5ALDA 2BUCA 4OU5A 4MQLA 4DMHA 4X71A 4UBLA 3W9UA 3I2KA 1C4XA 4MEAA 2HFKA 4X93A 3WK9A 4ZRDA 2QOEA 2UZ0A 1EHYA 5K3FB 3QMWA 5YASA 2WIKA 3D2AA 2EDAA 2GBFA 4KR0A 4J0KA 3KWJA 1LPAB 4XX1A 4OD0A 2VJAA 4J0JA 3DDUA 3IULA 4KE7A 2XMCA 2RHWA 2WQZA 1LPMA 4DNPA 5IVKA 4X91A 4KE8A 1FFCA 4GW3A 5JATA 4FTWA 2YXPX 4AN0A 2FUKA 2OCGA 1DT5A 4CG2A 3O4IA 3WK8A 1CUFA 1ODSA 4PO3X 4UFNA 3H17A 3ZLTA 5BWCA 1AUOA 4ZGBA 4E11A 2GBGA 5AM3A 2WIFA 4AXBA 5CH5A 1J1IA 2FX5A 1CVLA 4C4XA 2HADA 4CIAA 2HA6A 3RK4A 4UPDA 2H7YA 5CMLA 2QUBA 1WPRA 3PICA 5LKRA 2Y6VA 3AJAA 4F60A 5HFNA 2Q0XA 2DHEA 1XZEA 3WYDA 1BE0A 1EK1A 2WU4A 2WJ3A 1MN6A 4N5IX 3CCBA 1C7IA 3JYHA 3D4LA 4LXIA 3CN7A 3NUZA 2QXUA 4UHDA 4Y2QA 5HQ3B 4BE4A 1UOPA 1OCEA 3WKEA 4Y2UA 2QXTA 3G9XA 5LIPA 4GHWA 2OG1A 3I2GA 3H19A 1EI9A 1E8MA 5CT9A 1QIGA 5I8PA 1CUHA 1DX6A 1XZFA 2XUIA 3WL5A 2EEPA 5ALNA 4UUQA 1XRLA 2B20A 3QBJA 1ISPA 3WL8A 1T4MA 2PSJA 2XLBA 2C58A 2ZYSA 4BBZA 2AXEA 4KJXA 4MJ3A 3D0KA 3ICVA 2ZSIA 3AIOA 5JADA 3AIKA 1CUXA 3C70A 3FYUB 4AB1A 3MUNA 2GBCA 1MX5A 3KDAA 2WTMA 1QTIA 4WFKA 5LZ8A 4AN1A 2HRRA 1AMNA 4AZ0A 3VJKA 1UKAA 4LKOA 2JEZA 4PV7A 4XWGA 5ALWA 1UKBA 5DNWA 5BV7A 5T4HA 1HQDA 3DL4A 2DQYA 4FLEA 1Q0RA 3QH4A 4GWLA 1XRRA 5JAPA 2H1IA 2XUQA 4UHHA 2K2QB 4YK7A 5ALEA 1XLUA 3PFCA 4XIIA 4OCZA 5FP0A 4X7BA 5ESRA 1LNSA 1P0IA 3DYVA 3QPCA 1EVEA 3W06A 4FNGA 4X00A 3DKKA 2JEYA 3G0DA 3R3VA 4FOLA 1QIIA 3WWEA 1XZIA 5FPQA 1JJBA 2V98A 2PPLA 4PF1A 4KAFA 5A2GA 4QDUA 3QMMA 1VZ3A 5AKKA 4EB0A 1DQZA 2OCKA 3WWDA 4FKBA 5K3AA 1ZGBA 3H1AA 4KE9A 4UBKA 1OXMA 5KWIA 4WDQA 1QO9A 1UOOA 4LIPD 1CV2A 4EY8A 5EIEA 5AKHA 4DNQA 1BRTA 1CUCA 4EY6A 5LKAA 4H35A 1VOTA 1VLQA 1VXOA 4HS9A 2IIVA 1F0PA 2QUAA 4HXEB 2AJDA 3WL7A 1XRMA 5CXUA 1J06A 2C5FA 3DNMA 4G4GA 5IKXA 3AZOA 4E46A 2CJPA 1ZOIA 2IX9A 2X8BA 5D6OA 3NWOA 4OB8A 3I6MA 1TAHA 1VE6A 4G8CA 1YCDA 3ZLUA 5AKEA 1MX1A 1TIBA 4W9RA 4GBGA 5FLKA 1UK8A 1TRHA 1JMKC 3LS2A 1XQXA 4N8EA 1WOMA 1Y7HA 5CRIA 1J07A 1ETHA 2J3DA 1X2EA 1PJAA 2JBWA 2PSDA 1A8UA 5BWBA 4X6UA 2PSHA 4YPVA 3WQHA 2VJDA 5HZGA 4H7FA 4WFJA 3CCCA 5JIBA 2VAXA 4C87A 1CRLA 4JUIA 1QOZA 1ORWA 3QM1A 2OGSA 4MXDA 3LLCA 4BRZA 3PDCA 4X3CA 5JAUA 3W2TA 1UK9A 1CUGA 5AI9A 3ZLVA 3F97A 3PFBA 1KEZA 4M0MA 1QFSA 5ALPA 3H2GA 1LPNA 5HF9A 4ZI5A 3R3YA 4H7JA 2BGNA 3WIBA 3G9UA 3C8HA 1XLVA 1CUWA 1H23A 5HF5A 1ZIYA 1ZD2P 3H1BA 1EX9A 2B4KA 2O7VA 3O95A 1N5RA 4WY8A 2WIDA 3C6YA 1KU6A 4QDTA 1Q83A 4ZWNA 5EI5A 1DINA 4IO0A 3T4UA 5EHZA 4EBBA 3RKSA 4Q3OA 3L1JA 1O6GA 1YR2A 4GXNA 3S8YA 4KAJA 1A8QA 1YB6A 2XMRA 1XQVA 4AQDA 2WG1A 4G1FA 2XUGA 3ED1A 4FDMA 1K8QA 4U2DA 4Y2YA 2HU8A 5AOCA 1FFBA 2XUOA 5HF8A 2JGMA 2QVBA 3OTQA 4FNMA 2WG0A 4O08A 1Q84A 2ONCA 1JFRA 1QIHA 2ROQA 2O2GA 1F6WA 5AKJA 4LHEA 4N8DA 2YYSA 3GUUA 4Y2XA 3GROA 2WFZA 4Y2RA 4KE6A 1AX9A 5ALKA 3WI7A 5DWDA 5EHNA 3WWOA 2QS9A 2RGUA 1THGA 3GA7A 4QWWA 3I2JA 1E3QA 3R0VA 4X97A 4BATA 3HABA 1SOMA 2XQIA 2I3ZA 4K2AA 3WKCA 1Q0ZA 4X90A 4BZWA 1EDDA 3WMRA 2P8SA 4U2BA 1YS2X 5ALQA 3C6ZA 1CUJA 2PVSA 4TVKA 2BAGA 4BE9A 4JYMA 4RNCA 4LXGA 2XUFA 5AOBA 1WB4A 3RM3A 2QR5A 2HU7A 1A88A 3OURA 2OXEA 5DTJA 2ZJ7A 4B7ZA 1ZI6A 5JASA 1CUZA 3OM8A 4QDZA 1H22A 2WFMA 2WFLA 4P9NA 2XQGA 4ZXFA 4EY7A 3R40A 2H7CA 3DKRA 4BC0A 4V2IA 4RGYA 2JGKA 1GQRA 3LCRA 4BVJA 4H18A 4PQEA 3VJLA 5IVIA 2JGFA 1D07A 1JKMA 3G0IA 2OLEA 2XLCA 1K6EA 3H2JA 1UK7A 5AI5A 1VA4A 5LZ9A 1EB8A 4H0CA 2QJRA 2CEKA 3ICWA 2QRUA 5HK8A 1F0NA 3A2MA 3C6BA 3I28A 1IVYA 1RP1A 4S0XA 2OAGA 4EZIA 4B83A 2HA4A 4P93A 3VJMA 3R3UA 1AURA 4D9JA 3HXKA 1U2EA 3FNBA 2D5LA 3MUOA 4Y2JA 2GYWA 3ZV7A 3AZPA 1QE3A 1ZI8A 2X76A 2GYUA 3EQ9A 4J0HA 4DNFA 1CIJA 2XMBA 4X94A 1TQHA 1HBJA 4BP9A 4H7DA 4JNCA 3VDXA 4BTLA 2V9ZA 1CUUA 3DLTA 4LXHA 3FCXA 3STYA 3VVLA 3SWWA 1JMYA 2ORYA 1ODTC 4DNOA 4CG1A 3TGLA 4ZV9A 1R50A 2I78A 4RE5A 5E4TA 2XI4A 1ZIXA 1QIMA 4UBJA 1HPLA 4G8DA 3H04A 1NU6A 3MVEA 1DTEA 4X95A 1P0PA 2HA0A 5AOAA 2GZRA 2QMQA 5K3BA 2Z3ZA 3VKFA 2OQIA 3EF3A 1ZD3A 4Y2TA 3IVMA 3M83A 1JU3A 4BP8A 4UBIA 1P0QA 5HFAA 1BEEA 3V48A 4KAAA 5A7GA 4X92A 5FV4A 1LZKA 2X5XA 1BN7A 4MQMA 1DX4A 5A7FA 3O9VA 1YA8A 4AZ3A 2E3JA 1F8UA 4H7EA 4AX4A 3TJMA 1XKTA 4H77A 4CFSA 1QO7A 2XDWA 5JAHA 4B80A 1SCIA 5EIAA 4DMKA 3W04A 3B12A 4MYSA 4AO8A 5ALOA 1GXSA 3VVMA 2FJ0A 3WWCA 4Q34A 3HSSA 5CBKA 1BN6A 4C6HA 3C8DA 2VQ6A 1CUAA 2O7RA 4CCYA 3C5VA 1YAHA 2HU5A 4I19A 1GPKA 1WHTA 1LPOA 3WZLA 5EIHA 1H2ZA 5C8VA 5AK6A 2PX6A 2VEOA 1TCAA 5AI6A 1AZWA 3CXUA 3VISA 4OPMA 3H0CA 3A70A 2PSFA 3ILSA 3WWPA 3IUMA 3BJMA 1G42A 1HL7A 4C4YA 4YASA 3I1YA 3TEJA 3IB3A 3N0TA 5LZ7A 1FSSA 1GT6A 3BIWA 2WUGA 4HTAA 1IUPA 5E2IA 4WCVA 4GLBA 3STTA 3T52A 5AHXA 1XLWA 2BCEA 3QZUA 1LPPA 4I4CA 3OOSA 5ALXA 2ZJFA 3FSGD 4MYDA 4C88A 4ZREA 5CW2A 3A2LA 3ESBA 5EFZA 5HCUA 3FLBA 2VT7A 3GFFA 1I6WA 3I6ZA 1M33A 5E4JA 3I2FA 3FWHA 4NS4A 1L7AA 1R1DA 1QGED 4INZA 1H2YA 4JYPA 1XZJA 1R4ZA 1MNAA 2HL6A 1UK6A 3FYTA 4MEBA 3S2ZA 3C87A 1NU8A 3FCYA 5ALSA 4CCWA 3WZMA 3ESDA 3ESAA 4B9AA 1GPLA 4E15A 2HFJA 2FJPA 1VXRA 2WFLB 4J0CA 1Z68A 4FBLA 1YSCA 2YH2A 1TKRA 5ALTA 1CPYA 3C6XA 5AM5A 1BCSA 1XZLA 5LZ4A 2RI6A 2XMGA 4L72A 1MNQA 2OAEA 1FJ2A 2ACEA 4DTCA 3IURA 2WLSA 4I3FA 4OB7A 3BDVA 4BAGA 3G0GA 3QPAA 3F96A 4GDMA 2HM7A 3IIIA 2CUTA 4EUSA 4ROTA 1IUNA 4CI9A 4NMWA 1GPNA 3K6KA 4HZGA 2JF0A 4BZZA 3R3ZA 1CUDA 1ZGCA 3IBTA 3KD2A 3DQZA 5ALMA 4HAIA 1ZD4A 4OYLA 4Y2VA 3H2KA 1ZJ5A 2WUDA 2QZPA 1R9MA 1W1IA 1BU8A 1ORVA 1HKHA 3P2MA 5DLPA 5KREA 1ZI9A 5DYYA 3HI4A 5C81A 3BIXA 2ZJ6A 3B5EA 4EHBA 3M81A 4N8SA 1E8DA 3WJ1A 1N1MA 4AO7A 5JZSA 3HZOA 3BF7A 2WTNA 4J7AA 2WSLA 1CLEA 1QIJA 1XRNA 2VJCA 2PL5A 3ANSA 4PSUA 1FFAA 1UKCA 3STXA 4QLAA 3STWA 1RWQA 2DFPA 1CUEA 4B81A 4W1RA 1BCRA 1THTA 3AFIA 4QEKA 2CBGA 1EB9A 3V1LA 5FDFA 2IITA 1WB6A 4Q3LA 2XMQA 2WIGA 4OB6A 1XZCA 3WJ2A 2WHPA 3QITA 4X6YA 1JJIA 4FWBA 2PUJA 2J3QA 3W05A 5FUMA 3QYJA 5CXXA 3H18A 2QKYA 4G9GA 5A7HA 3V1NA 3M82A 3EQ8A 3U0VA 2RAUA 3WK4A 1GQSA 5JZBA 2C7BA 1WM1A 3KWFA 4RPCA 2B9VA 1QIKA 1CEXA 3DOHA 2XMZA 4XVCA 1G66A 2XT0A 4BB0A 2WILA 5LYYA 5KBYA 1X2BA 4CCYB 4NVRA 1X70A 2HA2A 1DWQA 2VJBA 1J2EA 5ALYA 3WKDA 1LBSA 2HHAA 4QA9A 4FFVA 5T4FA 3SK0A 1WCYA 3PUIA 1ODCA 3PI6A 4Q1VA 4KRXA 3JW8A 4BAUA 5DTIA 2ES4A 5H3HA 4G9EA 1JJFA 5AM2A 1QIDA 3FLAA 3X3HA 4XJVA 3DL7A 2C0QA 4W1QA 1EK2A 4AO6A 5LLSA 3EQ7A 4BDTA 2XUDA 4J0GA 3DOIA 3QVMA 3L1IA 5FPPA 1U8EA 1N8SA 3WK5A 3O4JA 4C01A 4G4JA 2BUAA
chains in the Genus database with same CATH superfamily
3GBPA 3CBGA 3G68A 3WMGA 2NGRA 1X80B 3UFBA 1HT3A 4LCEA 2YZGA 3OZ7A 5EQDA 4I4LA 1M1UA 2IHJA 2ZB4A 4K9RA 4U7DA 4H7KA 2P2GA 3FI0A 4NCNA 4GYJA 4JI2B 4OHZA 3AH8A 3MPUA 3WDKA 4XUEA 1A4IA 4Q39A 3N1UA 2IC5A 5KJ6A 4JI0B 3F47A 4EO9A 5A9SA 2CLKB 2VOJA 4E2YA 2Y67A 1D6JA 3AXSA 2Q50A 4RQTA 3VR4A 7YASA 4OP2A 3TOZA 1FDIA 2C9BA 2YX1A 3C3MA 1GCIA 3HP4A 1PFQA 5IEBA 2ARKA 2ECFA 2WHEA 3DD1A 4F5YA 5M5BA 1FFSA 3T61A 1NR5A 3SXUB 4D8YA 5DJ5A 1RAFA 5CH8A 5JEDA 1K68A 1VLZA 1WNFA 1YASA 4FKZA 2A0FA 2WJVA 4DR4B 3KPYA 1OIVA 3G2KA 3GJYA 3ADKA 1NULA 3AJ9A 4U5QA 4XLTA 4PC2A 3D0RA 4QUIA 4W1PA 3MC1A 4A10A 2QLBA 3H4IA 1C5KA 2BFAA 3WLJA 2AJCA 3DE0X 4WADA 4G5XA 3ROTA 4QO7A 1ORTA 1Q19A 2E5WA 2L19A 3TLXA 4L9WA 3SLRA 1MP0A 3A31A 4WZAE 1RXWA 4NBVA 1Q2UA 1PGNA 3PRYA 3VSAA 1FE8A 1O6FA 4ZV7A 3QTLA 4TS3A 4GMDA 1QZTA 3KKKA 3QPVA 2JDID 2BGTA 1DIAA 4RGVA 1AKRA 3E9MA 1DI0A 3GNQA 1MFPA 3FYCA 5FOWA 1JHAA 1ZA1A 3OX2A 5HUHA 3NHPA 2AJBA 4RVOA 1IPFA 4B7CA 2W8BB 3BTVA 2KX7A 2ORVA 3MWJA 4NENA 4P81A 5I6DA 4XGRA 2H7XA 1FDUA 3KCQA 3OQ6A 3PGJA 4ZP1A 1OI7A 5GOZA 5HQJA 3GT3A 3IPAA 4HHEA 4ZHQF 1LZLA 4S1PA 1JQAA 1ZL2A 3TW8A 4OMCA 4FXOA 4RELA 2H9YA 4P0QB 1KKMA 3ZG6A 1JH8A 4BNGA 1IB0A 1E89A 1FSFA 3AF5A 4JEIA 4POAA 5INTA 5J4YA 2ZWAA 2PUAA 2NPIA 3PKZA 1L5HA 1XJQA 3R0XA 5DYGA 1KJJA 3VMFA 2BBTA 1IDN1 3AGQA 3CTMA 3RI3A 3DDZX 2DPHA 2M9MA 4QO8A 1YUBA 1NW6A 2H59A 1HYHA 4I7EA 4Z3OA 4K1LA 5L3VA 1V43A 2GF2A 2PKYX 1GPWB 5EE1A 1R3UA 1KIFA 3EOBI 2POQX 3W5CA 2CL0X 2O2IA 3CX7A 4GVLA 2Z8XA 3DBHB 1GCGA 3FPCA 5F2EA 3I9NA 3FOBA 2A5GA 2WZQA 3EQ6A 5ALUA 4Q7QA 4KREA 4ER7A 3UJNA 3OQPA 3T3GA 3SQXA 2BDEA 3Q85A 4X6XA 1RQNA 3STVA 4KR9A 5AIBA 4DV7B 2X8LA 4AWBA 2GBIA 1EK5A 5G3ZA 1AB5A 4UQPA 4EW6A 2H85A 3LQFA 3UMBA 5JD4A 3TVYA 5I4BA 2ZRFA 4PAOA 3DFMA 2VOEA 3DW1X 5JJLA 1EBBA 3LPNA 3MMZA 4H16A 3AF0A 1K8RA 3PFGA 4MWGA 1BYUA 4OI1A 3BMXA 4CM7A 2VNSA 4BRUA 1UJCA 4MUMA 4YCBA 4ZEMA 3CF4A 1M0EA 4J4BA 4MYRA 5ALRA 3CZ5A 2O8EB 4PY2A 4CLXA 1UBKS 1F1JA 2ZJAA 1TUBB 2HQBA 3K0FB 4I55B 1G21E 3ZDCA 3AM4A 4YRSA 4J1QA 4M98A 4TTVA 3OZXA 4QPNA 4TMTA 2EZ8A 2P6MA 3A2NA 2E18A 5CM2Z 4YMSA 3ZJ4A 5CFLA 2V03A 2XUHA 3LXRA 4WOJA 4QAJA 1V7PC 1QHIA 1ZSVA 3KE8A 4FD2A 4QC2A 4KXNA 4W7SA 3CLSC 3LXUX 5A6SB 3VGPA 3T9DA 5JS8A 4F2WA 4LYHA 2DETA 2HRQA 5C46F 3KP1A 4DYHA 1W4RA 1VJ5A 1GZ4A 1NXXA 2GJ9A 4KIFA 5K6AA 4LSGA 4I36A 3WSWA 1NURA 2VPQA 2ZSAA 3K9BA 3U4CA 3G85A 3W5SA 5JQGB 4QPZA 3HWSA 3G2PA 3PPWA 4RESA 2JANA 2QLTA 3MTAA 1JHOA 3OLQA 2HF7A 4UBNA 1AZTA 3ZOZA 2WUFA 5IVHA 1Y7IA 3C7AA 4P31A 1L4KA 2ZYTX 3RARA 4A16A 1T9BA 3AETB 4W4TA 5IKOA 3Q7SA 4ES6A 2OVFA 5ICSA 5KKAA 1E6WA 1M2HA 5AUOB 2B99A 4MWTA 1N2CA 4OBBA 4YJFA 3THWA 2BGJA 4S2UA 4MI9A 3I3OA 4CL0A 1JBKA 1M0TA 5I9IA 5ALJA 1CSEE 1QQTA 1YQTA 2P6NA 3IPLA 5CNJA 3DL2A 3L6OO 1NNUA 4YH1A 3D3QA 1KPHA 4ZGWA 3GLTA 4LDNA 5IX8A 4O8CA 1Y6FA 2O2EA 5LNK6 3UUFA 3IV9A 5DNUA 2N47A 4DGQA 1R8JA 4N0PA 3FVWA 3QPWA 3RAGA 3U4MA 1P4GA 1VSVA 2VL7A 4G8BA 3HGMA 3T34A 2PS0A 4CKCA 3V4LA 4YRMA 5K8CA 2PNFA 4PPQA 2RGXA 2WHPB 1EVZA 4HADA 3TW0A 3M3DA 3L7YA 1UODA 4FDTA 4XH9B 1TGVA 3BIFA 1WU8A 3NOQA 5CM8B 2C7GA 4HVLA 4RVSA 1KIMA 2REQB 2W0SA 5AKXA 4DXAA 1J2RA 1W5SA 1U1EA 5I3ZA 3U62A 2J5BA 5LQJA 2PU7A 1T5LA 1VPEA 4CIDA 4EQ6B 5IJ0B 4OAQA 1F4PA 2MCFA 1E1KA 1A7JA 1K06A 1TECE 1IM5A 4FT4A 4EY4A 5AIAA 3WKAA 4Z7OB 3EXFA 3WGOA 3FCAA 2H4JA 4HNHA 3ZDXB 1NW7A 5G0UA 2JGJA 2X22A 5IASA 2QTRA 4L6CA 3LYLA 1I51A 2XUPA 4P7FA 2VHWA 2D8MA 2YWDA 1BKSB 2WJ4A 2XWBF 4BNWA 1YZ3A 1EE9A 3OPVA 4CEHB 3EY9A 3K6SA 2BLLA 3OFKA 3BBLA 3MWKA 4WA7A 3IBGA 4CQMD 4AQ7A 1PZEA 1SVUA 2JARA 1FFXA 1FJGB 5K0LA 4XDZA 6YASA 2AN9A 4UNIA 3VZRA 3WRXC 2XW6A 3E9ZA 3SSAA 4Q05A 3ES9A 5ECGC 4L9RA 5ADUS 1QHXA 2PZBA 3NHFA 3GEDA 2DLNA 1XZMA 1K9SA 2R1TB 4WJKB 5FYQA 1VLVA 4IFEA 2BJHA 5JDCA 5FWXB 1KDTA 4TYYA 1CJBA 1O96A 2UUAB 4O2AA 4RV4A 2JGLA 4RD2A 5DSTA 1C9NA 4LJ4A 4N82A 1IM2A 4GI1A 2Y1OA 2VAVA 2W6CX 2O05A 4OM8A 2Y2VA 2Y9MB 3P27A 3BIOA 3LOQA 5AJVB 4INJA 2O3TA 4J3FA 4PGAA 4UOEA 1ZRNA 1X0VA 3HDQA 1CUBA 2E4ZA 1U2GC 2Y0DA 4PTYA 1COWD 1H2FA 1E2UA 1QAOA 1AGYA 3WRXA 2V7WA 1L7XA 3B6IA 2QN6A 3MUEA 4REQA 1AMUA 3HEAA 3A6KA 4JFAA 4DA0A 1E6EA 3PIIA 1A1VA 1GGVA 2C5SA 3B48A 3FPLA 5KUTA 1I7LA 1XU7A 2JKYA 3AR5A 1ZKDA 1ONOA 4JWTA 5KHLB 1K63A 1WXIA 5TT1A 721PA 3BZWA 2F1HA 1UPXA 2XUKA 4PZ9A 2QAJA 2ZBVA 4QUDA 4A92A 3GLIA 4N7RA 1UZUA 1EFKA 1VCMA 2GAFA 4WUTA 5CK5A 4BB6A 1DKQA 1GPH1 5K03A 3DM9B 4ZCLA 4B74A 4DGSA 5JYCA 3U1BA 3GK3A 3I6IA 1RFLA 2YZKA 3ZD8A 4AROA 4DJEC 3EUEA 1Z4PX 2VTVA 3N2ZB 2ZJOA 3DAPA 4TRMA 1ESCA 1PI3A 3K1AB 1JHZA 2B5VA 2FX2A 4R51A 5FOTA 1NATA 4QUHA 1C8LA 1Z4LA 2PQ6A 4OM7A 2OXIA 2WKWA 5BW4A 3DCJA 3AERB 4HBGA 2RB5A 5BP7A 2OO7A 3CLKA 1MX9A 2ILVA 4FN4A 1MAAA 1EDEA 2A9QA 1MZVA 2YDYA 4PICA 3QIVA 1OJ7A 4U7PB 3UMFA 4A23A 4G4IA 4DNPA 1HE2A 2B7LA 4HNAB 3ZGZA 1AVTA 3GAFA 1RYMA 4H1UA 1SOAA 4U63A 2R68A 4V3BA 4UTPA 4C2BA 3G9TA 4D5GA 1JN0A 1PK8A 2FPOA 3OIVA 1XMOB 3NEPX 1V6AA 3ZDQA 4TLLB 1AO0A 2Y1LA 3FUVA 1G98A 3RS9A 4AY3A 4DV3B 5AI4A 4KVAA 1JG4A 1XKLA 3T9AA 1LK0A 1U90A 2QRLA 5I8ZA 5F77A 2B1RA 1KOGA 3O74A 4L9AA 4E6PA 1EXWA 4QOFA 1BMFA 3B2NA 3I53A 3K0EA 4DLUA 4FJ0A 1D2NA 4HY3A 1YAJA 2OZLA 3MT7A 5C9ZA 3LFHA 5KX5F 4X1KA 1W1UA 5B7PA 1PR4A 2RMKA 3HCAA 1LPBB 5J5AA 3LPCA 2ACWA 1Z4JA 1IJEA 1Y3HA 2XVYA 3DW3X 3CX4A 4C08A 5JAZA 5JNLA 4R2HA 3AKDA 2UYHA 5AJXA 5HRAA 1A72A 4YCDA 2B3TA 4ZDWA 2AR7A 4QU5A 1QVAA 3JX9A 4KPGA 2E5LB 4Q21A 2H2DA 2NV6A 1KI2A 5EPEA 1Z3IX 3H3JA 1UT5A 2B30A 4OU4A 4JIMA 3O26A 4Q4DA 3H3FA 4URVR 1G5FA 2OD9A 3I5UA 3QA3E 3EZXA 4Z0NA 1TQDA 2I3DA 3TR5A 1V4VA 3V7WA 4YP5A 1M5UA 4AUNA 4EF5A 3PJDA 2I03A 2N0SA 3DMGA 2YICA 4NBWA 3OCUA 4JL6A 1A9XB 4R1NA 3SC2B 2IEZA 1XWIA 5EHXA 4JZKA 4RZSA 1PYGA 2VKTA 1U81A 2I99A 4DA7A 2O14A 1UOQA 4HLQB 3E0XA 1Y6ZA 1F2DA 4ZI7B 2WWXA 3F67A 2B8TA 5GPBA 1XEXA 5EJ8A 3UUEA 5JE8A 4LY9A 3R2JA 4F4IA 1USUA 1JQDA 2E4YA 1WQ4A 4Q7JB 1G5TA 3HMKA 3Q0EA 5AHRA 1T2AA 1VIMA 3G2QA 2HI0A 4B75A 4F1KA 5LU8A 3QFTA 2Q3EA 3L4JA 1HX7A 3JRNA 5EESA 3WRYC 3VPCA 4M0EA 1JIQA 1XZBA 5DXFA 4F7WA 3T4EA 1J4AA 2Y0EA 3V4FA 3KS9A 4MPTA 4A91A 3TLBA 2ZYWX 4KXVA 5I3CA 5T4BA 4UFOA 1QXSA 2BFEB 2P2NA 1Q0PA 2YV5A 4LC1A 3CKLA 3IYLW 4HYEA 2CBZA 3GNSA 4X1OA 3J7AC 3WZ2A 3VR5D 1PD0A 4DWVA 5CT6A 1JG7A 1P1RA 1EDOA 4HZIA 3L3BA 2ST1A 2DT8A 1HDYA 5K0EA 3RYCB 2BBSA 1T2EA 1QTNA 4ALJA 3A05A 2ZYHA 2PGDA 1CJUC 2BLNA 1ISRA 4XW2A 3H7AA 3SJCA 4D44A 5CB4F 4YRLA 4F96A 5HXAA 2JDIA 3W7AA 3UC5A 4LJSA 1C1YA 1QK3A 1EA5A 1RWXA 4XQEA 4Q37A 2DSNA 1VZ2A 1XP8A 1V9CA 1YO6A 2B3DA 2Q2OA 3EULA 1WPXA 4FFNA 4UU1A 3ZX5A 4FSDA 3T7DA 1R66A 1X0XA 5U4XA 4NG4A 3OQHA 4MGHA 5M7EA 621PA 4B40A 3KVNA 3WBFA 3A9CA 4M0UA 4QYMA 2DLDA 4ISBA 1XQ6A 4NYMR 1YULA 3DXXA 3DGFC 5C4IA 1ABBA 3G23A 4KWCA 1KZYC 2O1SA 4EFDA 2JA2A 2UKDA 1K7EB 3CHYA 1O95D 5K9ZA 4DJJA 4JH0A 3EXAA 1U8FO 1W35A 2Q8QA 4ALNA 5BVGB 1JXQA 1W25A 5LJLA 1BHSA 1T6YA 5FNVB 2PRIA 1E8NA 3IQFA 5KWJA 3N28A 5L40A 3ML1A 2JJ2D 3CRZA 3B1YA 3LX4A 3E1GA 1VPDA 1P4SA 1TK3A 3K92A 1DDGA 4G2TA 1EP9A 1SFRA 2CXXA 3JQBA 3OZTA 2IXFA 4B7XA 5HS6A 2BEJA 1C9JA 1V5GA 3F7NA 3WWZA 1NYTA 5KTRA 1ECJA 3KZCA 3EIFA 1TGYA 2WWHA 4GLLA 4WEOA 1X7ZA 2CKMA 5FULA 4J03A 4KIWA 1EM8B 4QHSA 5F4ZA 4XM0A 5LQCA 3BF8A 4QFMA 3FI9A 1USWA 3UTCA 3GLHE 2CMFA 4LRUA 3OFND 1NW3A 4UUMA 1Y8QB 2ZBEA 4JBIA 2B78A 1L5SA 3DXFA 4BWFB 4UEJA 2EW1A 3FSEA 2DFVA 3O1LA 4RHEA 1W59A 4EDFA 1P0FA 3BQ9A 3P4YA 1OGYA 2VBCA 4JKIA 4KH0A 4MWSA 2DHCA 1MEJA 4LGVA 1MOPA 4A0GA 5B1SA 4B5LA 2YC2C 3IR7A 1NFRA 3ELWA 5JD3A 5ER9A 1SCKA 1F1BA 2PDAA 2FRDC 4PLTA 2Q28A 3FOZA 1KE1A 5EUBA 3RWOA 4HQLA 1BFKA 2J7PA 2VF5X 1AT1A 2QW1A 1LVHA 3AB8A 4NAUA 3QLVC 3TNDA 3WB9A 4A6PA 4C4TA 1I5EA 4Q3KA 1HDEA 1EKXA 1L3IA 2BEUB 4HNGA 2YZMA 1NRXA 3ANMA 1A2BA 4DMLA 3I5XA 3HKEA 4RIGA 2P30A 4TROA 4F86A 5DSZA 5E4YA 1IG3A 3C1UA 1J49A 1YDEA 3C0KA 1W6RA 3HCRA 2MMCA 3N05A 4JXKA 1AC5A 3QLUC 1B1AA 1G0NA 3H8VA 4UVHA 1R4NB 1PFGA 3TSOA 4BYMA 3AVWA 4RTOA 3WK7A 1R6AA 3D2CA 2BL4A 3CINA 2AMLA 1QYCA 2XMPA 3DLPX 3IIEA 4JBWA 5IC6A 3V8QA 3ZGOA 4F9FA 3EPHA 4MYHA 2FN8A 3DJYA 2JPDA 5CD9A 2F8LA 3GGSA 2AUNA 2IIQA 1IUOA 3AB3A 4BFUA 3CURA 3DAGA 5A5DA 4Q93A 1E18A 2C2WA 1NZDA 1CTQA 3WGYA 4RV9A 4TL8A 5HIKA 4FGKA 4BQOA 2R85A 4XARA 5F73A 2D1TA 3AZQA 3P5BA 4Y18A 3VO8A 5JAOA 3PIRA 3UM9A 1OROA 2RONA 1IB6A 1Q0SA 5FOSA 2H52A 3B78A 2R66A 4E12A 1LRJA 3QLUA 1NHWA 5AW3A 4PX9A 1S7GA 1VKHA 1Z07A 2IEBA 2ZVJA 2PE5A 1H2XA 4RK6A 5BMVB 1U04A 1XTVA 1Z2DA 1J56A 1YIAA 4EABA 1SC9A 1OXTA 1T6BY 2W8ZA 3MJTA 2CHQA 4JP1A 1QP0A 2Q3CA 1DP4A 1N0HA 4QDXA 2V3WA 3RSHA 4NMMA 3HYNA 3E8SA 2EHJA 4ALKA 4O59O 1UOEA 1R3DA 3H65A 1P77A 5CXSA 5I9LA 1BC5A 2GZSA 1YZTA 2QROA 2IELA 2MSDB 1E2MA 1R0CA 2P6PA 3PHIA 1TM7E 4G2NA 3HWX1 4Q9NA 2Y71A 4FE4A 1U0JA 3IGFA 4DQUA 2HPVA 3EWSA 4R5HA 2CSUA 3O8OA 2DHRA 5EIBD 1DJQA 1H69A 1SXJD 2VR1A 2BUBA 1FF9A 3MS2A 3K20A 3BTSA 1II0A 1VSQA 1BAPA 2Y4NA 3PQ8A 4PRKA 3B3JA 4CT0A 3BD8A 1YE8A 1PLKA 4RU1A 5LP1A 3BWXA 3LO8A 1W4ZA 2DZDA 4LOKA 3S1AA 4LV5B 4KR3A 4QAQA 5LQRA 1T36A 1YBFA 3L7JA 4II3A 4MKHA 2FPIA 2IEGA 3AM3A 4L0DA 3WDLA 5LOVF 2TMGA 4N3CA 5B57C 3RYHB 2QRVB 5FA6A 2AJLI 4B7AA 2D5BA 1PDOA 2E37A 1FUIA 2G4CA 3OOEA 1RKBA 2UXBB 1D4ZA 2VHCA 5EJIA 1BWRA 1E61A 1ICIA 1G7RA 2C0PA 2VHUA 4ZVRA 4HXYA 2Y2UA 4YIHA 4JHXA 1GL3A 4DLAA 2J09A 1ZH6A 1HNWB 1WZCA 5JZMA 2W2NA 5IK2D 4Z4FA 5EXEA 5THXA 1T4CA 1JKJA 3K9LA 2A5JA 3QMVA 1RI2A 1LS1A 2MR6A 1QU3A 1ZW6A 1T3TA 4C78A 5HKAA 4US0R 3AL0C 2O5EA 2DHQA 4DABA 2QB5A 5E7MA 3DWFA 4R1PA 4Q48A 3NGMA 3I0ZA 3P2OA 5AKIA 3K70D 1T5TA 1G8JA 1XD9A 1E2EA 4A0RA 1H2RS 2SECE 3KQWA 2OD2A 1WETA 2GLXA 3IT1A 4P3OA 1M1NA 4W63A 4AULA 1QH8A 2ICAA 2RH5A 3OAAD 3T5CA 3W7BA 4KQ2A 1Q91A 2GCPA 3IBSA 1PDWA 3OLVA 2HH9A 1VL6A 3PF9A 4JP3A 4WFIA 3U40A 3VM6A 1COWA 5JH7F 1YBHA 2YVKA 4MYCA 1Z17A 1LDNA 2CLDX 3BGOS 4MHSA 5BUSA 1VGVA 3SIWA 2VSNA 4CR7A 2DKFA 4AI6A 3RYIB 3DKPA 3LP8A 4GOLD 4N7MA 3RS8A 5J2TB 1OT3A 4UUBA 1UAGA 1JHXA 1KR2A 2V0CA 1CNMA 3NIBA 2NTEA 4L2IA 4A0QA 5HGXA 1ZXBA 1AQ6A 4GMFA 4HDMB 4E03A 2WV9A 4B84A 3GH1A 1QJCA 1R74A 2UDPA 1NE7A 1L7RA 5DNDA 1DX9A 1G6OA 1O6CA 1IXSB 1Y1KE 2FDRA 3QF4B 3KPJA 3IOMA 4RUKA 3UPUA 5C53B 5GOTA 4JOQA 2P75A 2BZ0A 3A4NA 2QTVB 1NN1A 3M2TA 4XEUA 1K5HA 1DWOA 2FQWA 4LE1A 4MV7A 4BCCA 3PUHA 4J9VA 4BFLA 2QPOA 4B3XA 4UQOA 1Z0DA 4AS2A 4BLUA 1H5QA 1DFIA 1FPMA 2RHBA 3FN4A 3KQPA 3V46A 1PEKE 2DT5A 2VA8A 2ZT5A 3CE6A 4AICA 2QT9A 1JTEA 1C41A 2XVZA 5MGNA 2PS9A 4QRIA 4U9IS 2PM8A 1UC9A 3KYJB 2G7ZA 1Q7RA 4F84A 3EQ2A 3HRHA 3KQLA 2QSZA 3RVKA 2O9JA 1K4YA 3PFNA 2D0OB 4E5DA 5K5EA 4K88A 2ETVA 4G24A 2Q1WA 3AF6A 3RHSA 2Y9PB 3UGJA 5ALZA 4V0NA 2IP2A 4DLLA 3E58A 4WN3A 1ZNZA 2CFIA 2V7EA 4OQPA 3UCXA 3JZDA 4KHPB 3H9GA 4HLUC 2Q4EA 2CF6A 4L3WA 1AGXA 3SF8B 3PP8A 3SZUA 4B3JA 3UVEA 4MARA 5GZ1A 4FFBA 1NX9A 4G0ZA 4QSHA 1YCFA 2XE4A 2X0FA 2QX7A 4GUAA 3S2GA 3QVWA 5DBOA 1P80A 1RLUA 2Q5HA 3RS0A 1EFUA 4INOA 4FGLA 3H2BA 2ZJ5A 1N9GA 3BE5A 1PJ3A 1QONA 2PT6A 2VKQA 3CXRA 3DCNA 3GEIA 2DFDA 2GK6A 1BXGB 2VBGA 3H84A 2DR0A 3EFOA 4JIGA 1NOKA 5D3ZA 1UANA 2OCBA 3BTUA 4GKBA 1P7ZA 2JFZA 2HZ7A 4CL8A 3E6AA 2CW5A 1D1SA 1JA1A 4AQYB 3ZXYA 3L8CA 1I4EB 3GPBA 4EHHA 3KTOA 2C7OA 3LHFA 3PD1A 1DHRA 4LCJA 4V0SA 3TPFA 4QE3A 1OHHA 2GYVA 3RU7A 1LWOA 5IABA 1UBGA 5EIWA 3KRTA 2GTPA 3WSTA 1D2RA 2GAIA 3LY7A 4Z6KA 3KZXA 2ZUSA 2BH2A 4M7WA 4RJIA 2EJBA 2GAJA 4KDFA 3S99A 2WR8A 3C5WP 3BCHA 4U00A 3IE1A 3VR1A 1GUDA 3I04A 4R2IA 2COEA 2H11A 3DGEC 2ZIUB 3FBWA 3QV2A 4KYTA 4PQYA 2HK8A 4QYSA 4UNSA 3CPHA 5BOSB 5BR4A 2J1LA 2R86A 3GJ7A 1JHUA 4ZZ0A 2EFCB 1V2GA 2JIMA 3P5SA 1YRBA 1PWXA 2Q2QA 3OJWA 4NQRA 5FOVA 3TD9A 1PZXA 2W70A 4A4DA 2CC2A 3KSDO 1S96A 1Y8ZA 2CY0A 1OBHA 4FILA 2ZJ3A 3K8OE 1D1QA 4MJ7A 4PFKA 5E1MA 4DBLE 4YUYA 4BPBA 3GV0A 4ARZB 3EYAA 4C2AA 3QEMB 5KDOA 3E9EA 1ZHFA 4MV4A 3P2IA 3GLVA 1WSBA 3RVBA 3VNVA 3PWKA 4R8SA 1R18A 2AUMA 5KVSA 2JLYA 3VVCA 2G25A 4OYHA 2AT1A 4YHBA 5BV1A 4HLCA 2G8LA 2Q5OA 5F98A 4H4DA 3L2OB 4M1KA 4WBNF 2DU8A 4BU0A 2BRUC 3VR5A 2O8BB 4OQLA 5BR8B 4LJRA 5FB3A 2CGEA 2EWVA 4DLXA 4GRAA 1ZONA 1TA0A 4QJ3A 4QZVA 3RK1A 2P6UA 2ZSHA 5AJTA 5COQA 4OBXA 2NO5A 5AI0A 5BV2P 2WVGA 1FNCA 1CP2A 1NR1A 1O95C 1LKZA 5JCOC 1DG1G 1L1EA 1XZAA 2DPMA 3V32A 1RVDA 5C1BA 1J5XA 2C54A 2QTGA 4DXDA 3RSZA 1TD1A 2MSKA 1BRMA 3EBPA 4YRAA 4UHBA 5BSVA 2GYYA 3CVUA 3OT1A 3H83A 4U2CA 3BXFA 5E6SA 3WC4A 5DM0A 4ZO8A 2RHMA 1I1HA 2VBFA 4IWXA 4B1FA 5DO9A 2JFWA 2KSQA 2WVJA 4OQNA 3IR5A 4XDYA 1ZQ9A 4KACA 1A5AB 2AA3A 1S4MA 2H9IA 3F0TA 4R1QA 5FTNA 1GFIA 3A6JA 3LBYA 4BASA 5ICGA 5JANA 4MOWA 1O6ZA 2HR1A 2GR9A 4QXAA 1HTTA 1E3IA 1UP6A 2YJ6A 3I3SR 3NLLA 4JI4B 2FSSA 4PGGA 3LVQE 5FUWA 3EVEA 4MPPA 3AO0B 2Y1XA 1KXJA 4CM4A 1FPQA 1I5OA 1YQWA 2XRFA 4HRYA 5B36A 3FFWA 3EGDB 4GL4A 2Z0MA 3GN1A 2JZCA 1QQ5A 3O7WA 3L7BA 1TZMA 2JJ2A 3RU9A 3OECA 3PNKA 3PZRA 4MQLA 5LQSA 3PU6A 4PAMA 3K5PA 3SDBA 1HM5A 5BUZA 4GUDA 1GKUB 4LSWA 1J70A 3IP8A 3VKVA 3W7VA 5KNCH 2ZRPA 3L9XA 2HNAA 3D4NA 3I2KA 1I8TA 3O4VA 2FR0A 1QAQA 2ZIWB 4I9FA 4MVJI 4N40A 4NULA 2O5RA 5IVPA 3Q15C 4EHJA 5HJ5A 4ZRDA 5LP6B 2QNIA 4YYEA 1TLFA 4PLGA 5K3FB 3GZ4A 3OFNA 3K32A 4IUYA 1N57A 2EKBA 4RDIA 3AQIA 5B2ZA 5YASA 3V1UA 5GIPE 1TLLA 3O21A 4PG8A 2WIKA 1P6XA 4D4MA 2EDAA 1K4KA 1A8PA 5TMPA 4O2BB 4YDRA 1X6VA 3RJTA 4IGEA 4L7QA 3ZWNA 5A4KA 3C97A 2OSBA 4HNTA 5LIRA 1QU2A 4M49A 3C1OA 3TE7A 1LPAB 1M2EA 1XJ5A 2WSBA 4NS1A 2CJWA 3ZKAA 1LS6A 2PA0A 3JQPA 2ZSDA 4ATNA 2J30A 1G3UA 2YINC 2BE9A 2Q5EA 4F85A 4J0JA 1Q6YA 2QP4A 3MYYA 2C2OA 1Z5NA 1AF7A 2NU7A 5BURA 3IULA 4KPEC 3QKSA 2Q2VA 1PNTA 2JIZA 4PLCA 3UIEA 4D9FA 3KFXA 1X9GA 1G3MA 4P83A 3ISJA 1FXWF 1IOLA 6LDHA 3DBIA 4WKOA 2OWEA 1LNQA 2XB4A 3CKYA 4I4TB 1XDSA 3B82A 1X14A 3IAS6 3ICCA 3K0BA 4J4HA 4K9OA 4TZ0A 2W58A 2B0CA 2WICA 4GW3A 5DEIA 1BJKA 4CMAA 1F6DA 3DE2X 1JA9A 1EK0A 5JNSA 1A4RA 2YJTD 4MV5A 4DT1A 1JB1A 2IIPA 2Y4OA 4D79A 1KZGB 5K4HA 4DAOA 2C57A 4DMRA 4HN9A 3FDZB 3GMSA 5AK0A 1SB8A 5T57A 1SCNE 4MP8A 3A9WA 5ER6A 3KYDA 4HDQB 1IHDA 2FLWA 3OZUA 3TLMA 5ADHA 1N7HA 1P2DA 3DHVA 3SVLA 3KEMA 4ETIA 4E5PA 5I4CA 4JSTA 4Z3DA 5BWCA 3FKSD 3CZ9A 2A92A 2ADOA 3ZHQA 4DJAA 1YFLA 4K3UA 1UQTA 2WJPA 3W8DA 5CTJA 1C3VA 2ASVA 4Z1OA 3ZDZB 3HXQA 4YMWA 3GLGB 3I01M 1HORA 2B2NA 1XNJA 1W30A 2WAAA 2R8PA 3EGXB 4WCFC 4CU5A 3I58A 4PZYA 5CH5A 1KDZA 4EPYA 5EIBC 1Z63A 1SXJC 2V6MA 4IXNA 1RXIA 4ZQFA 3CISA 4CL3A 3Q6NA 2VAWA 3TBKA 4BGUA 1HDOA 1TVEA 2HA6A 2F7SA 3L41A 2FWMX 1B3RA 2P35A 4X8LA 4HNVA 2A4MA 1WAMA 4LI3X 5CMLA 1ESDA 1W9MA 1UXGA 2D7JA 3NW9A 1C81A 9ABPA 3TSCA 1A5BB 1VSTA 3VC7A 5LKRA 5LPNA 1IJFA 1MAVA 1QYXA 2XCIA 4F7DA 1G8PA 3DT6A 5IBCA 1KK3A 2Y6VA 4FX5A 1SRQA 4N65A 4RK0A 5HFNA 4AL4A 4BAZA 1N5KA 5JSFA 4DQLA 1U3FA 3TF5A 3ZHSA 2JIPA 3AKCA 1ODKA 2V1XA 3NTOA 4AECA 4DILA 5IAOA 5JCJA 3ZDDA 4DARA 1IPHA 4Z5XA 4CMEC 4CEJA 2EIXA 4MDYA 3BBPA 5KYUB 5CYGA 2GHIA 4RTSA 4AY6A 3AUYA 3C4QA 4J7XA 5K2OA 1TJ4A 3CCBA 2IYLD 3E4CA 4EJ6A 3MRTA 2XGJA 4B3GA 4IQ0A 2H16A 4HL6A 4IXWA 4PFJA 4YNBA 3L1KA 3WHLA 4F5EA 4ZCSA 3TFOA 3QUAA 1Y3IA 3MWDA 2I2XB 5HZKA 2Z6UA 2ET6A 4Q03A 3PTLA 3R5FA 1NDHA 4JLVA 4JQZA 2CCJA 1T3ZA 4Y2UA 1KDVA 4KK4A 5U1PA 2AKAB 2E49A 1V71A 2QENA 3ZBUA 3HEMA 2XNHA 4CMEA 2DAPA 3BRQA 3NWEA 4DDHA 4GHWA 1RZRD 4A27A 2FRXA 1ULTA 3F3KA 1KAHA 2ODBA 2P67A 3SMVA 1K97A 1ODIA 4B3CA 1K2WA 1LK7A 4RO0A 1EI9A 3NCHA 2Q4OA 2ZRNA 3EVFA 1A9OA 1E8MA 3L7MA 2ONYA 4W5JA 5CW1A 3V6LA 3LFUA 2YY6A 3WFIA 5DI9A 4JK3A 2V7UA 2C95A 1PZNA 1YS7A 1P4RA 3QI7A 1QIGA 1W19A 4LPKA 1R8YA 1UPUA 4YCNA 1FX0B 3NM6B 1JEQB 1ZIOA 1XRLA 4C05A 1X1DA 1EJ6A 2CYCA 4KMRA 1WKVA 1SM4A 2Q46A 3H1TA 3OAAA 5ELXA 4ZEOA 5TXGA 4RY0A 4ZK6A 4MRNA 2P9EA 4GMGA 4CLOB 4C7XA 1B0UA 4DIEA 3K0CC 5KMGB 2ZBGA 1UZNA 5CA1B 3FCCA 3N3BC 1OFVA 3EYWA 2YXBA 5LXTB 2VLBA 3R23A 1KK1A 2VXOA 3KLOA 4L9SA 3L92A 1ML3A 3R6LA 1RPAA 1Y5RA 4OF4A 5F2OA 1Y1QA 1REQB 4A2WA 5CD1A 2C84A 3K1YA 1KMHB 2QRJA 3C70A 3FYUB 2O2SA 2P9JA 3CEAA 1JALA 1PAUA 3KLNA 3QELA 4P1ZA 4ZPXA 2MIIA 2A3NA 4L73A 3A1EA 4AKGA 4TZKA 4YBZA 1OBCA 1QQ6A 3RRYA 2R00C 4BLOA 4BQRA 2RGWA 1DKRA 5THQA 2G9QA 2HRRA 5CVTA 5FLYA 3TTVA 3DZFA 4EA7A 1AMNA 4ERNA 1P3Y1 2QV0A 2LZ0A 3F2IA 3K0CA 1WA5A 3RRFA 4D9BA 4FFDA 4RHUA 4DG8A 2QP3A 4RVCA 3K2EA 4HQRA 2B69A 2WA1A 3HFRA 3LQYA 5B3JC 4QYTA 1YF3A 2VZEA 1X7HA 2DWPA 3ZLJA 1GTG1 3DO8A 4JC4A 3G2NA 5KYYA 3EBOA 4OFXA 3ZHOA 5BV7A 3N75A 2P4SA 2AS0A 4DRXB 3E22B 2L42A 2GCGA 3C8ZA 1RBZA 5EJ9A 5KNBH 4ZOCA 2I1QA 4WXPA 4ZT3A 4TLDA 3B6JA 4D42A 2E55A 4FLEA 1EWYA 3DWEX 5HS4A 5TQJA 1Q0RA 2G08A 1I36A 2C00A 3U3DA 1CF2O 2WAXA 2ZR9A 3PTZA 1Q3HA 3R09A 4F11A 3V1TC 1NUSA 3LDFA 1VCHA 2H1IA 4Y1GA 5B3JA 2H1FA 5B7GA 1C3JA 3DB2A 5L4SA 3HR8A 4YK7A 1XPOA 3GEMA 1GT91 3IP5A 3LSTA 4MV1A 1VCNA 4M7PA 1Q5PA 1NA5A 4BGIA 1TVKA 4CV0A 3W8EA 1WRBA 4ESOA 1OLUA 2PLNA 5FADA 2ZE7A 4RLSA 1OYWA 5FP0A 2VH1A 2QTAA 1P0IA 3QPCA 3NVKI 4UKDA 5HMLA 2DFLA 1LLQA 5IF3A 3TTWA 2R4TA 3IHKA 2AOUA 1LBEA 5F7XA 1EQUA 3G0DA 4EYGA 3R3VA 4FOLA 5LLTA 4C03A 2FWAA 3WWEA 1XZIA 5FPQA 2HLDD 1VDMA 4KXQA 4X44A 1RMYA 5EEGA 5AQEA 3T0GA 3N8HA 3KJGA 4JLOA 5J4HA 5KNLA 3QK7A 1A9QA 2HIAA 4X64B 4N48A 5A2GA 3Q1LA 2QTMA 1JDBC 2XTJA 3ELBA 3DE4X 3K05A 1E5LA 1GGKA 1R0LA 1UZMA 4M89A 4Y9TA 1AQIA 2D0PB 3KZKA 4X20A 1JDNA 4N6OA 5F5LA 2DEUA 4MTLA 4DCPA 1KNQA 1IFXA 1L5KA 2H1WA 3S2YA 1HDXA 3NAQA 3F9IA 2HJWA 4V02A 1EUDB 5TX7A 1OFHA 3WWDA 2VHZA 4FKBA 5K3AA 2QPAA 2G88A 3AESB 3LT5A 4QNRA 3RIEA 2W48A 3E18A 4K6MA 4HB2A 5TQ0A 4BIIA 3J81k 1OXMA 2QZJA 1GA4A 3EG5A 5I4IA 5KWIA 1VKZA 1QO9A 4WDQA 3TLCA 3B52X 3F4KA 3KQTA 3AP3A 2PMDA 2PT5A 2ORWA 2F55A 4KPFC 4B3MB 2IZ5A 2O1XA 4IJWA 2FE4A 3ZZTA 2D7CA 2D3TA 2ZAMA 3F7MA 4EH1A 1H2AS 2IUFA 4U9HS 4MKRA 4PYRA 3OFJA 2IPLA 1NVVQ 4R41A 3OX4A 1CNEA 4ZQCB 1BX0A 2PMEA 1H5UA 1VLQA 2BI4A 3RASA 2W00A 2X77A 2WWYA 4RORA 5BN3B 3DMFA 3CX8A 4J0FA 5DTRA 4HXEB 2XBUA 3P0FA 1AF4A 1Z2EA 1JMVA 2ZT7A 5CXUA 2B9EA 1P7PA 2CLMB 2DLCX 4NV3A 1Q15A 4R2XA 3RC3A 2DUJA 421PA 5IKXA 3VOBA 4QODA 1N7GA 4N0QA 4NDNE 5DCYA 1W9HA 5BSGA 1BMQA 2YHSA 3AZOA 3BH7A 2B37A 3K53A 3F90A 2X9LA 4IKEA 3RT9A 3UQYS 2IH2A 1EFCA 1R6XA 3U4QA 4BNVA 3PQ7A 3NWOA 5EZSA 4Q1DA 3AEKB 2JJ8A 3K31A 1VE6A 3AEQA 2Z2KA 3AUTA 4G8CA 3VSEA 3IAHA 5BVHA 3GNTA 4QG7A 3MM4A 1DC4A 3GIWA 3AUFA 4KXLA 3L7NA 3PSAA 4JZYA 5DEOA 1E9RA 3DTTA 3CZPA 4GBGA 4MRSA 4CV1A 2IFTA 2WTEA 1BXZA 1KY2A 1QNFA 3FYSA 4JWKA 1JMKC 3LS2A 1QYRA 4FFPA 1GNQA 1XQXA 4K9NA 5EQFA 3T9CA 1YI0A 2Y27A 1SK9A 3F1LA 4HDRA 4EI7A 1IY0A 1X7GA 2CFCA 4FFOA 4JNKA 4MV9A 3FIJA 2J3DA 4Q1CA 4P58A 4XSVA 1MPTA 2HPAA 3PXCX 5EUCA 3VTFA 4BKQA 4BKUA 4HUQB 3F7TA 1PJAA 3I37X 3ZXUB 4X63A 1I3OA 3FW1A 4LZPA 2X40A 3R74A 3ZD9A 2HT1A 3OA2A 3PE4A 4D98A 2GJ8A 4DL9A 3T1TA 1YA6A 1Q1GA 3E0QA 1PW5A 1NW4A 2VZ0A 4H17A 2FP4B 4MVJP 2QTTA 5DM1A 2P40A 4HQ6A 5EMMA 5CXQA 4AJEA 3VHLB 1XVLA 1DMRA 4WLVA 4I14A 3SMQA 1WZEA 2FPPA 1RI1A 3R6GA 3ZCSA 1Z7EA 4MR9B 1G2IA 1JR3D 3CIFA 3M49A 4GU5A 3N53A 4BS9A 2NTYC 5G0SA 3AHJA 1AGNA 3DAHA 4HAXA 2XDAA 1YBMA 4IO1A 5TMDA 3WJ7A 5JIBA 4GOKA 1CRLA 2F00A 4QTXA 5M3BA 2M32A 7REQB 1NVKA 1ZQ1A 4FX2A 4HBZA 2F1JA 4RH0A 2OGSA 1C1DA 1J33A 1V41E 1P5HA 1QE0A 1G6HA 4WACA 4RACA 3A2KA 1QVRA 3MWLA 4X3CA 3VDQA 1BWSA 3AHIA 4PXSA 2BPOA 1SU7A 3W2TA 3G0OA 3LUDA 2WNHA 4DCVA 3QU7A 2FZ5A 5AI9A 5EN4A 5TNXA 2X9GA 3NHAA 2BF7A 3QFCA 3ZLVA 1SWWA 3OCZA 3ROPA 3LO5A 4G3XA 4IW3B 1Z88A 1JIVA 1P6QA 1U7UA 3DKIA 1SXQA 2LUOA 1L5LA 1WV1A 1SZDA 4F6RA 1RXVA 1LPNA 1RSZA 2W90A 3QVOA 3TW4A 4BNNA 3HVRA 4ZI5A 4BBJA 3P9KA 3KKEA 3L1VA 4PGFA 5EPUA 3R3YA 4D81A 5IULC 2PSSA 1AQNA 3ORHA 1BX3A 3KWMA 3F8TA 5K1ZA 1P8JA 3PGXA 3C8HA 4MJXA 2YYZA 3RUPA 1H3FA 1JFLA 2ZT8A 4RZQA 3JQ8A 3D4IA 5GMOA 1CZOA 4CKYA 4UDNA 1E1QA 1NPYA 2G9UA 3DMYA 2JW5A 3MTIA 5DH9A 4E21A 1UJBA 1U99A 3MCTA 3KEGA 4GQBA 4P98A 1BD4A 1R6UA 2QY9A 4DMMA 5T67A 2XRYA 5HF5A 4AJNA 4BRWA 3A1FA 4L4YA 2QQEA 3OT4A 4CI0B 4PYJA 2PZAA 3DBLB 4B76A 2DB3A 2EW8A 3CVYA 3R6TA 4W8HA 1U8CB 1Y1TA 2O7VA 1FCJA 5CNMA 1ZINA 3EGWA 5DV9A 1J1UA 1G20B 1XMXA 2PO5A 2CDCA 1DC3A 3B53X 3H4MA 5ESWA 4L5AA 2WIDA 1XZ8A 4IEIA 4MVCA 1NFFA 2X9NA 4OJYA 4TKUA 1Y7LA 4JJGA 1U2SA 4IQGA 1CR2A 4X5OA 2D2VA 3PC8C 1Y1RA 5FO1A 4LSZA 4Z3KA 2NZUG 1DG9A 2PWYA 1XXHE 2JFXA 4QX6A 2XD9A 3U7HB 5KPJA 3RWMB 3T4UA 1PX0A 2MJLA 1RYBA 4Y0VA 5IAGA 4HVAA 4ZHQA 2XKAA 1ATIA 2EJTA 3F6BX 3QVLA 4A8TA 4NWIA 3QEBZ 3AEXA 2OV4A 4KTTE 4J43A 2I80A 4YMTA 2YNMD 4ASUD 1KFEB 1RC1A 2FPMA 4Y3UA 4OQXA 1EVIA 1EE2A 1MIOB 1YR2A 1YQXA 3IDZA 4GXNA 4KAJA 1V1JA 1WVMA 3W6NA 5L53A 4BVAA 3N9IA 2AE1A 1FQJA 3PS9A 3O2SB 3LT2A 2ZAGA 1HRKA 3LCVB 1V3UA 2R7AA 3BFVA 2WG1A 2BEWA 2ZVPX 3MEQA 3KZMA 1AO3A 1E1RD 2D2EA 1I4DD 3PC8A 4G1FA 4LV8B 3LBAA 4L8LA 3VSCA 4RTJA 2PRKA 4NBLA 4AKEA 1Z74A 1JI0A 4FDMA 4FYPA 3CEMA 1K8QA 3FRJA 2XUOA 2ZGVA 2VPXA 4XQGA 5HF8A 3SYKA 2XOEA 5JXIA 3FNHA 2FP3A 1GUYA 3KXIA 1IC6A 1NTRA 4IJQA 4R1LA 3HKCA 3MGBA 3T94A 5IXJA 4BNIA 4Q16A 3I6BA 3KOUA 2IOQA 2Y1DA 3GP3A 2ROQA 4W6QA 1Z34A 3ELUA 1G59A 1EP3B 1RZRA 1EP1B 2J85A 5AKJA 2WJAA 4ZYZA 4IZHA 1ZUWA 3GCWA 1LJLA 2YRXA 3UJDA 1JH9A 3UHAA 2VWGA 2P65A 4J16C 5H80A 1E0AA 3CH5A 4OG2A 3V2IA 4ZVPA 1T1GA 1AX9A 4BO0A 3VYWA 5DWDA 2TMDA 5B1IA 5JISA 2PQ0A 4P4SA 4YDSA 2Q99A 1XN4A 3AL2A 2RGUA 1JG1A 3JZIA 3GA7A 4A03A 3I2JA 3TBHA 1A98A 2AC4A 1T1RA 3DHWC 3NS7A 4PCUA 3GUZA 3UF0A 4BUJA 1SUAA 1HV8A 3FB4A 1NKTA 2BFOA 4IGFA 4JI6B 5P8WA 3NYIA 1KYTA 4X8OA 2C3MA 3D2LA 1SOMA 3GFVA 3OEED 1QGUB 2XQIA 3GJXC 2Q9BA 3DT8A 3KOXA 1E9VA 2I3ZA 2JFQA 4H27A 4AJ1A 4J16A 2BH9A 1EWRA 4A26A 4L4ZA 3WKCA 2JBAB 1RLOA 1L5MA 4X90A 5EJGA 1TJNA 5B1YA 2VNIA 1W49A 5AJYA 4NTZA 1QV6A 3WY9A 5ABPA 1YC2A 1B73A 2ZWPA 3CM0A 4RPHA 3SJUA 1HLFA 3U3OA 3ICQB 2NXCA 1OUMA 2YTZA 3M3PA 4PX2A 4J3NA 3D1VA 2HMWA 2IYTA 3PC6A 4XJTA 4ZN6A 3P0RA 2H31A 4JT4A 3T1NA 1GTMA 3E5HA 2GH1A 1XXLA 1ESNA 2NAFA 3OJEA 4BE9A 1US8A 3DG9A 2VUTA 4RNCA 1PQUA 4LXGA 3RIYA 2VF4X 5AOBA 3X1KA 4EK9A 4OJMX 3RM3A 3VMMA 3GRAA 3IUBA 2BHLA 4C4AA 5DCUA 2CV1A 2E82A 1O3YA 2FUG6 4E51A 1A88A 4YN3A 1ZUNA 3EC7A 4XUCA 1DJLA 3UG6A 5ITZB 4B7ZA 3C5CA 1ZI6A 2GWRA 3MT0A 3UT6A 1VKJA 1KY5A 3IT2A 3H7IA 1T5BA 2XWQA 1CUZA 4R01A 1TK2A 2VUUA 2C9OA 2QY6A 4O4HF 4B3DA 4ENRA 3UAOA 1H22A 1TDJA 2WFLA 4OQEA 5SZIA 2G71A 2XQGA 1DRWA 2ALJA 2DJIA 1BCSB 4LDJA 5J4LA 3N6XA 4QM7A 4PS0A 5BWNA 3H5AA 3DH0A 3DKRA 4JJ4A 1ID8A 3HN2A 2JCGA 2HBRA 1G1MA 1OZHA 1PUXA 2ERXA 1CRWG 3GB9A 1WF3A 3HM2A 3SNHA 3UWSA 2O0JA 3GOHA 1ZZGA 5AVQA 1V39A 2RSLA 1H8HA 5AXDA 3PUJA 3CX3A 3VJLA 3UJAA 1N2HA 2PKEA 3PXGA 2CN1A 5JCJD 2FZCA 2QL5A 3O3NB 2CDNA 5E4FA 4UCXA 3QOXA 1U1DA 1XA3A 2CD7A 3DBRA 3H2JA 4OIMA 3NGLA 3NHUA 5ARBA 2X5JO 1PFVA 4JOCA 2BMEA 2HF8A 4MQUA 3W8RA 1UBLS 4MUGA 1M76A 3WIDA 1X3SA 4N3AA 3K0SA 1G4UR 1ZEJA 1LV8A 3CW2A 4IX9A 2GESA 4MVJF 5EWLA 3MYRA 3CNHA 4X1IA 5DWVA 3QKRB 2EFYA 4K87A 2XVAA 3FYDA 1SOWA 2HLDA 1FFWA 3MCVA 3THXB 4I8IA 3A2MA 3C6BA 3PI7A 3SQDA 3OOJA 1SCUA 5JMTA 1AXEA 2FEPA 4MO2A 4B83A 4YRNA 4QFBA 3X1WA 1XOIA 3VJMA 3OCVA 3PT9A 1U3DA 3LLSA 3R3UA 4NBRA 1CBUA 2FVXA 1AURA 2WJHA 4RHXA 3CX6A 2H5LA 1ISGA 4NEHB 3HXKA 4DCNA 2IYYA 4LOJA 5D1HA 4N39A 3VSDA 2XX3A 4G0VA 1UBOS 1QCDA 4XXHA 2D5LA 4GBJA 1PV2A 2MSEB 1LTKA 1YH3A 3NHWA 3GW8A 2C7QA 2I4OA 3E9RA 4IOMA 2O0KA 4IINA 1ZI8A 5C3UA 1QGAA 1KO8A 2J0UB 3BCSA 4EHKA 2VS1A 2E4XA 2XEXA 4RA6A 1UEXC 1H9BA 1NPDA 2VDVE 4K0RA 3OTGA 4J0HA 1SKBA 4XSHA 4X94A 2B94A 1L8XA 4IHJF 1LRKA 4PG5A 1ESZA 1PR5A 5HCNA 2HDNB 4JSYA 3EEBA 1QC5A 2HXSA 3EOZA 4H7DA 4JNCA 3VDXA 4BTLA 4EI9A 1VG8A 1EUQA 2EX1A 2H5JA 2WFAA 4KFUA 1U2DC 1TZJA 4WGFA 1PJLA 3D6JA 4IFIA 3GEHA 3I9MA 3TZ6A 1JMYA 3WP0A 1DQSA 4GOMD 1SXPA 2R5WA 4DNOA 3IKLA 1MB9A 3SHFA 1R50A 1ZCZA 2YRFA 3SSMA 4YCSA 4LOHA 5HG0A 1QIMA 4UBJA 2GMWA 4G8DA 4JD5A 1Q11A 3UO8B 2ECOA 4BWVA 2X58A 1Y9AA 3OTIA 4C0XA 2I8AA 4CQJA 4GDFA 4ZAGA 4C6TB 1X7XA 3CLHA 2GXAA 1N3BA 3SCZA 1RCUA 3EDYA 3DFZA 4QVGA 3JYNA 4U5XA 3PC4A 2QMQA 2DGDA 4HYTA 3G1WA 5HMMA 4K9KA 3EN0A 2NIPA 4B79A 3EF3A 1C8BA 1N5IA 2XNCA 4O4IF 1ZD3A 2G06A 4ENVA 5HSGA 4H6WA 2P9ZA 3M83A 3B1ZA 1TVMA 1VPLA 4PZPA 2Q7OE 3TTUA 1JVNA 2Z9BA 3VR3D 4BO9A 1E32A 4IPTA 3CONA 5FO0A 3E7XA 5IT5A 5JFGA 3ESRA 1N2BA 1RWPA 2A0UA 1A96A 1Z8FA 1N34B 2R5NA 3ADBA 1NUHA 5G0TA 2Y1WA 4KSCA 2PS3A 1MR3F 2PD4A 3TZCA 5BORA 5I9TA 1V3QE 2X9QA 1TT5A 4L4RA 3KKPA 4AAYA 1UDRA 2YUTA 1KVTA 4K0KB 3AEUA 2QHXA 2MSCB 3QY9A 1I7DA 1RPTA 2Z1DA 1J2JA 3VO1A 2K4MA 4N54A 4X92A 5ICCA 2Z09A 1HWYA 5KX5A 4ZZ1A 5BNFA 4R3WA 5H68A 1CDZA 2OHGA 1X1AA 2ZWOA 4GVPA 4MQMA 1RJEA 4MIOA 3O1JC 4UASA 4YR7A 4D45A 2FFJA 3L4BC 4O4JB 4JKOA 1N2GA 1QKJA 1K6XA 3O9VA 3R6WA 3WWYA 1N0VC 4LYYA 3PRKE 3P52A 2VJOA 4AZ3A 2ERYA 2J46A 1F8UA 2I7XA 3OIYA 3PQCA 3A3PA 4YQZA 4AX4A 4H77A 1NBIA 2RHRA 4ZQEA 3ZCPA 5JYDA 4C9BA 4GP6A 1GIAA 1Y4UA 3L6EA 5D85A 2EHDA 4AZWA 1IWBB 4B80A 3JYQA 1OSNA 3II6X 3W04A 4WIAA 1DG3A 3K8ZA 3RYFB 3M9LA 4NHOA 1EX1A 4MQ4A 2QQ5A 4QULA 2R7NA 3T12A 2RB4A 1CZHA 2DOKA 1V47A 4UDYX 3HSSA 4D82A 1X15A 2H1VA 3EIUA 3MUFA 4YUVA 3L4BA 1Q3KA 3BTOA 2UVPA 1BN6A 3PX7A 1BQ3A 4HLNA 1Z13A 2ZI5A 4C6HA 5KOYA 3G2MA 3LW8A 3BL6A 3DUFA 1Z33A 3WISA 3P9IA 2RK6A 1R0SA 1V7QA 3UAXA 3VU3A 2HU5A 3LUGA 1YHYA 3RHTA 1GPKA 3IKVA 1MB0A 1LPOA 2X0KA 2YXEA 3OPYA 1Q1BA 2CLEB 2C9MA 2XKJE 4IG4A 1ZJJA 4YRTA 5EIHA 4Y30A 5AVTA 1DKUA 2X9VA 4XYEA 3SYRA 2CXQA 3TRJA 2MR5A 2P0YA 2BWJA 2NUBA 3ODGA 1G3IA 1JYFA 2VEOA 4TTPA 2GLTA 2FSVC 3PHHA 5DWQA 5SYAA 3T7RA 3ZE0B 2AOTB 1QYDA 5AI6A 1V35A 1WKCA 1AZWA 1WOYA 2CL7X 5FA5A 3IUPA 3WRWA 1F60A 3FUUA 2GNPA 1X1QA 3H0CA 3MSXA 1W48A 3VTAA 3DOCA 4J0EA 1I7NA 2GKOA 3KV3O 4OXIA 4Z9FA 3COJA 3B13B 1RAAA 3AM5A 4K26A 4KXMA 4QBIA 3R9IA 4Z4GA 2GVDC 1AHIA 3ILSA 5FTMA 1OBFO 3WWPA 2I2BA 4Z99A 2OXRA 2CXTA 4JMPA 3SKVA 1FS4A 2YNMC 3AR8A 3CUYA 3F6EX 5EE5B 1AY0A 3COYA 4OQDA 2UYOA 1PNVA 1FIUA 1SBNE 4PIVA 3JVVA 3DPUA 5ANRB 4YASA 5CB4A 1OXKB 2GLUA 4BGDA 3TEJA 2F9LA 4Q5IA 4Q4JB 4X1YA 1N2IA 5TGZA 2JI6A 3P9QA 3SE0A 4IJ5A 4DC9A 1II8B 2FSVA 4QU0A 3SBEA 3BE4A 4E5YA 4UQLA 4Z7NB 4OI0A 2O8DA 1OPRA 3B6EA 1GT6A 2NNWB 3L05A 4JELA 3ONEA 2QTZA 1T35A 4YJGB 4Y6QA 5G53C 2QP9X 2JLSA 1FVOA 4OK6A 2P11A 1VIDA 4BZQA 1Y42X 2FX3A 1G2PA 1PUIA 1Z5UA 2EGGA 3LPLA 4X7RA 3COSA 3UMMA 1XVAA 3WGHA 2G9ZA 3NEYA 4EAQA 1TTQB 2YNMA 3FPEA 4ASUA 1YS6A 1FK8A 4B3RB 2ZP1A 5DBFA 3HMQA 3MWEB 4U39A 4Q9LA 2B8EA 5JBQA 3WNBA 1CYEA 2FPUA 2Q41A 2BCEA 1Q95A 3CSUA 3PLNA 4J6FA 4URZR 3AVYA 2O2CA 3NU1A 3OCXA 2RHLA 1X1SA 4H1TA 4NCJA 4TTJA 1G5HA 3A6LA 1BKDR 3T3IA 3EXIA 1GQOA 4XQ0A 3S2EA 1LPPA 3GD7A 4I4CA 5KYXB 5ALXA 2ZBDA 1E1RA 3CIOA 3MS4A 3M9XA 4LJLA 2ZJFA 3OZWA 2Q21A 3T7EA 4EEKA 4EHLA 2R8YA 2WE7A 3IB6A 1XHFA 3I23A 1X42A 5DHAA 5IBRA 4FONA 4DDMA 2FNAA 3ZBQA 1DRVA 2BGUA 1ILWA 1Q16A 2H5IA 2HLHA 5KI6A 5CW2A 3IKMB 2Q49A 2QPLA 1PCXA 2FW8A 1XQ9A 2XE8A 4OAOA 4OQMA 1X77A 4RHTA 5CHEA 1NVWQ 1YBVA 5H82A 3ESBA 5EFZA 1TW2A 1GLNA 4KGVA 1BHO1 3GFFA 1I6WA 3I6ZA 3P94A 3REQA 1LJ8A 2JIRA 4GM1A 4NRDA 4LJ7A 2AFHA 1F0KA 2GHRA 1P2TA 4G8JA 3TZHA 4CTOA 4QKQA 5IDXA 3FTEA 3Q8XB 4Y1FA 4UEWA 2XYRA 2VZLA 3I4FA 5DVZA 2P1RA 3AYZB 3WLPA 3FTFA 2IY7A 2R1VA 4INZA 3BD9A 1ZGAA 4WEQA 1YL5A 4F3NA 4IIBA 1UK6A 2Q3DA 4KBGA 4XPIB 5DRTA 5LUBA 3VI3B 1JSCA 4CF7A 3FHOA 3HPQA 1XKQA 1G2QA 1Z0JA 3DFFA 3F78A 4MQEA 4Q3CA 3BQNB 4JU9A 4DA9A 1ZIPA 3B9PA 4CCWA 3N7UA 2CNNA 4YFVA 4Y6PA 1GKYA 3ESAA 1GPLA 3E23A 3PUYA 3T1VA 1BIFA 1WPQA 1KAOA 2FJPA 3I64A 3MXTA 2GO1A 4O4LB 5JEEA 1J0EA 1B00A 1QLJA 4HOYA 4FBLA 4WRRA 2I76A 1TKRA 5EWJB 2JH3A 2PRSA 3BS4A 1EBUA 1CPYA 1TA4A 5FBVB 1FTGA 3C6XA 3PCTA 2DH6A 4EPRA 3W3ZB 4YJKA 1QG4A 2D2IA 1XZLA 2VP3A 1AQJA 1C4WA 5LZ4A 2FKAA 3C7KA 3DZCA 4FGUA 5HPYB 1SUIA 5IYZF 5T6BA 3VPXA 3JD0A 2XMGA 3M7IA 2G3YA 4MCIA 4P82A 2OAEA 3OQIB 2AN1A 1YK0A 1PT9A 1HG1A 4N5MA 4MGYR 3X2FA 1NUAA 4DTCA 3DBVO 3Q2KA 1EM6A 3KQOA 1CT9A 2NZYA 3CF0A 4G1CA 2DBRA 2B7CA 4GDMA 2M6RA 3UFXA 4AMBA 3PJFA 3HB9A 1ZX1A 4IJUA 4IVRA 4WK0B 1GDHA 4PN3A 4B71A 3UY4A 1Z0SA 4CI9A 3PLAE 4GWKA 2Z4RA 3W8FA 1OZGA 3EIHA 3IVGA 3NAGA 4IOJA 3IT3A 4G85A 3TLAA 1Y5IA 2JF0A 4XIJA 2MSWA 4TV8A 3ZEAA 1R9GA 4HAIA 3BB1A 1WXHA 4FW9A 4OYLA 3RVPA 2IHYA 3H2KA 3ORQA 1ZJ5A 3Q2IA 3ZY6A 4A6DA 1H8ED 5DHQA 3ZDEA 4BNMA 4A82A 4EUNA 2VUHB 1NW8A 2JKVA 1I6LA 3DMTC 4KQIA 1R9MA 1CY4A 3B6ZA 3EEOA 4AMGA 3ZD7A 1WMDA 4RCZA 2Q4TA 3ERCA 1MQAA 1IK6A 1HKHA 3P2MA 4TKVB 3IJPA 2X5OA 2XCUA 5LUAA 2KB0A 4O0MA 2E6KA 5A02A 1W5AA 5A1TA 5KREA 1ZI9A 1DUVG 3LUFA 4NICA 3NC4A 2AFIB 1JEJA 5PGMA 1PJQA 2OE2A 1J23A 1M73E 1GRCA 5LDHA 3OWHA 2V6GA 3WYBA 2N46A 3B5EA 3ZWOA 3KELA 2R87A 5GGXA 4EHBA 5E0KB 4CCSA 4X65B 1XD2B 4NBNA 2H08A 3DMTA 1AKTA 2IZ7A 5IANA 3PHCA 3GEEA 3NALA 1YUMA 3Q40A 4PHCA 1UJ6A 5JZSA 1DCFA 1QK5A 1U0TA 2WSLA 1CLEA 4MWCA 3SFZA 4QNMA 4TZTA 1GSAA 2FPXA 4EEZA 1XVVA 2DH5A 3VAYA 5FL7D 4JX9A 2O8FA 3BSFA 4WNAB 5DGTA 1IOVA 2PL5A 1M34B 4EJSB 2WAYA 3UMSA 1AUXA 1M0WA 2ZXEA 1UKCA 1JIUA 3L18A 5JI3E 3U60B 4OSPA 4G56A 3Q8MA 1OKKD 1QRDA 1RWQA 4N18A 4ZRMA 3X1MA 2I22A 4W1RA 1KEKA 5JH7A 1VMDA 4C21A 1BCRA 2N42A 4QEKA 4C2UA 1GZHB 4IS2A 4G97A 3NBQA 5HOQA 4FYIA 4QGAA 1BVYF 3GFRA 4QJBA 4BMVA 1PLLA 1ZRMA 2A0KA 4M9UA 5FDFA 3CLTD 5AW4A 1HL3A 1E4YA 1KF0A 3K0AA 1WB6A 4Q3LA 1LQUA 2JCBA 4WUVA 1DPGA 1G7TA 1RPNA 3QV1A 4MMYB 3A28A 5T3YA 4US2R 3HXOA 1MV8A 1HH4A 2NZVG 4P5PA 4QBHA 1P75A 3RS7A 3SBDA 2MT9A 2PVPA 2HF9A 1YTUA 1T3GA 1QH9A 5JNUA 1TAUA 1JBEA 1NOIA 2BM9A 3CNEA 3WJ2A 4S3MA 2GXQA 3UWPA 3X44A 4C0BA 1XDZA 2X0NA 3GC6A 4I1UA 2QJFA 8ADHA 3CT6A 2JASA 1VBFA 1AV6A 2IPAB 3LG2A 4YP0A 4LGCA 2Q62A 2V7BA 1KYIA 3W05A 4EKDA 3LRTA 2EJCA 2WSIA 1Z39A 2QKYA 3G5LA 4G9GA 3BFXA 4EGCB 1G1AA 2GPNA 2WWWA 1D2GA 1WP9A 1WS6A 2JJYA 1CJKC 3DP9A 1SBHA 3M82A 3TUZC 2VDUE 1MMFB 2AYXA 3LTEA 2IY9A 3DNFA 4C5AA 3HJFA 4WOKA 1ADJA 1E5XA 2CK3D 3ECSA 3NP9A 5AHWA 3TR6A 2RAUA 4TRRA 3VR3A 4D4LA 3HRKA 3KXLA 4M9XA 4YPFA 2QAGB 5JZBA 1XCMA 3CY6A 1WM1A 1GV1A 2XE6A 3KWFA 3ONWA 4J7UA 1QCZA 2UZ1A 2Y0PA 4J2TA 2OK8A 3TXYA 4M9QA 4C0LA 2IU0A 2V9CA 3NBYC 4JMLA 2JD2A 5CIQA 3THYA 4BEVA 1ECLA 3RCBA 4BZXA 2DWUA 2IU6A 2VYVA 3DOHA 3KL2A 3QOFA 3TNYA 2FZEA 3VX3A 4EQZA 1TZKA 1KYYA 2XT0A 3G2LA