5K3AA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/fluoroacetate - cocrystallized - both protomers reacted with ligand
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
295
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGNFLPEEAPDQTAEALVRFFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 113
structure length 295
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3aA00
2GYWA 3I2GA 3I6YA 1T2NA 3ZLTA 2OGTA 5DJ5A 3HJUA 5CT5A 4MQLA 3WZLA 3H2JA 5K3CA 4Y2VA 1UFOA 1BRTA 3I2KA 4DNOA 1EK2A 2WG2A 1NU8A 5EIAA 1ZD5A 2OQVA 3WK4A 4BP8A 4Q34A 3BJRA 1CPYA 3M82A 5FPQA 3C8HA 2G5PA 2WKWA 5IKXA 1VZ3A 1E89A 3PUIA 3ANTA 1WOMA 5AKXA 1VXOA 3R3ZA 3FBWA 2DFPA 4G4GA 4C01A 4XWGA 4BCDA 3NOXA 4C88A 1UK6A 1W4LA 3C70A 4BRZA 2VAXA 3H2GA 4OB7A 2ZYSA 4UFOA 4FLFA 4OB6A 4OD0A 2BCEA 1YS2X 3O4JA 3WK9A 3D2AA 2QVBA 3CN7A 2ZJFA 2FUKA 4ZXFA 2QT9A 3DL4A 4P08A 2EEPA 2BJHA 4WFKA 2CZQA 2HFJA 5AM4A 1PFQA 4B9AA 3F8SA 4EHBA 1BCSA 4FNGA 1EK1A 1MO2A 5EFZA 2VEOA 2OPHA 4XX1A 5ALXA 4GXNA 3C45A 1RYYA 4ZWNA 1FFBA 4MEBA 1EA5A 1VA4A 2Y6VA 3GZJA 4EY7A 4OU4A 2WFMA 4PF1A 5CXXA 1XZMA 3DS8A 3WQHA 1EB9A 4K2AA 1DQZA 5K3BA 3MVEA 3K2IA 1LPPA 5HFNA 5T4HA 3WK8A 4FKBA 3TEJA 1L7AA 1QONA 1E5TA 1W1IA 4G4IA 1QLWA 2GBCA 3AZOA 3DCNA 1WB6A 1MNQA 3OPMA 4F5ZA 1XZJA 3MGAA 4H7DA 1JU4A 3C43A 3WIBA 1XRRA 4PNZA 5AM5A 5HQ3A 1CUCA 2VJAA 3FWHA 2XI4A 3WKEA 2OCGA 3KOOA 4KAJA 4E11A 1CUDA 1QTRA 5CURA 3AIOA 1UK7A 1EVEA 1XQXA 4Y2TA 4WJLA 2BGRA 5AKKA 1XKTA 3I1YA 3I2JA 6YASA 3G0BA 4DNQA 4X85A 2VATA 5CH3A 2Y1KA 3KD2A 3H2HA 5AM2A 5SYNA 3LIPA 5AK5A 3E1GA 4Y2YA 2QOEA 4D9JA 4IH4A 4UFPA 3QPAA 5AKLA 5AI9A 1XZEA 3IUMA 1MX9A 4YPVA 1GQRA 3ZPXA 4H7JA 2Q0XA 4UBOA 3QVMA 4BDTA 4QZVA 2ACEA 2GBIA 5LP1A 3I2HA 4F60A 2QM0A 2OCLA 5DYYA 4J0GA 5D3ZA 4X95A 5CMLA 3LP5A 5K3AA 3M3DA 4EBBA 5LZ5A 3H17A 4IH1A 2C4HA 1ZJ4A 4JYPA 4IQ4A 1BROA 1JMKC 3GROA 5JZSA 3GUUA 3KSRA 3DD5A 2PSJA 1GQSA 1WB4A 5ALQA 4QWMA 5JATA 1MAHA 2X5XA 1CUIA 5LYYA 4FBMA 1D07A 4YX9A 5HF8A 5JALA 2VA9A 1GZ7A 1HPLA 1A8UA 4UBIA 3WKCA 4BAGA 4LYDA 1EDEA 4BAZA 1DU4A 1XZDA 2FJ0A 2C5GA 3GA7A 3I6ZA 5EHQA 4BATA 1QIGA 4WCVA 2JF0A 4TVKA 1XZGA 5AIBA 2YYSA 1XFDA 1U65A 4F21A 3C6ZA 2IX9A 3D7RA 2XUQA 3ILSA 5DWDA 2VF2A 3C6YA 5AI8A 4X6XA 1HQDA 4BAUA 1H2YA 5C8XA 3I2IA 3HC7A 5CW2A 1IUOA 1U2EA 3F97A 4X91A 1FFAA 2PSFA 4AQDA 3H2IA 1F0NA 2J3QA 1FFCA 4FFVA 1CQWA 4OYYA 4UFNA 3WIOA 4EB0A 2B9VA 3HEAA 3H1AA 4B9EA 1CUJA 1F6WA 4LXHA 2ROQA 4CCWA 3BIXA 2O2HA 1ORVA 1ZD4A 2XUGA 5DLPA 2WJ6A 3LLCA 3SC2A 1E3QA 2EDAA 2GYVA 4KYVA 1MNAA 5KBYA 5ISMA 5LKAA 4W9RA 5HF5A 1HL7A 4WDQA 3OURA 4BC0A 3WK5A 3DDUA 5KREA 2XUAA 4BCCA 2IITA 4UHBA 3M83A 3NUZA 1QOZA 3STYA 5C7YA 4EZIA 3PFBA 5HFAA 3VVMA 1THTA 2BKLA 4BTVA 2XB6A 3V1MA 5D6OA 1LPSA 1H2XA 3BDIA 1GGVA 1YASA 4Z49A 5FOQA 3W06A 4AO6A 4B6GA 1MU0A 1LLFA 1GPLA 4HXEB 1H2ZA 1XLUA 4CIBA 2AJLI 2OQIA 5HKBA 4QLOA 4YK7A 2Z8ZA 3WWDA 1Y37A 3IULA 1A7UA 3IIIA 1HDEA 4LYEA 1SFRA 1FFEA 3SX4A 5AKJA 5ESRA 3O95A 4H7IA 2GZSA 5JADA 5CH5A 4GHWA 4G1FA 4K6HA 5HQ3B 4AN0A 2HADA 2RI6A 1EXWA 4AO7A 2WUDA 5T4FA 3DYIA 3DNMA 4U2CA 1KEZA 1CVLA 3FAKA 3BIWA 1BE0A 4BE9A 2WTNA 4E14A 1UXOA 2HU8A 4N8EA 5CXUA 1ODSA 2NW6A 1GPNA 4DMKA 4DMFA 1LPNA 3FOBA 3C5WP 4QDTA 1XKLA 3RM3A 2XUIA 4N8DA 4AB1A 1UKBA 2W6CX 1MJ5A 5HKAA 3BXPA 4H0CA 1AZWA 3DL7A 3FSGA 1W52X 4INZA 5AIAA 1YB6A 2J4FA 3E0XA 4FLMA 3EQ9A 5DYTA 2XMGA 1YA8A 4H7KA 5ALRA 3VJMA 2RHTA 1LBTA 3STTA 1ZI6A 1MT3A 4DLNA 4DMHA 1TCAA 2QXUA 4H35A 5BWBA 1ORWA 5DNVA 1GPKA 2ZYRA 4U2FA 5ALZA 2V96A 4MJ3A 1H23A 3A70A 3H04A 2X8BA 5AKZA 3QMMA 4UPDA 4UHEA 1YS1X 3FYUB 2Y6UA 1XRPA 4Q3OA 1EX9A 3AZPA 3RARA 3JWEA 2GZRA 5C8ZA 3L1IA 4UHDA 7YASA 3STVA 3D5EA 4H77A 4H18A 4B82A 4AN1A 3STWA 1MN6A 2H7YA 1CUWA 3O9MA 1VXRA 4X6UA 4BYMA 1ZD2P 4W1SA 5ALJA 2CB9A 1WB5A 2B61A 2XUFA 3O4HA 2WQZA 1CUAA 2UZ0A 4EY6A 2DHEA 1EHYA 4G5XA 1K5PA 5JANA 1YCDA 2JGLA 4CG3A 2PBLA 4OYLA 5EHNA 4CI9A 1H2WA 5ALHA 1G4HA 3A6ZA 2QZPA 3BF8A 3VKFA 3HACA 5AP9A 5AK4A 2WG0A 4QE3A 1P0QA 1RWQA 1GKLA 3K6KA 4EY4A 1CFJA 4MXDA 5HZGA 1VZ2A 1XZLA 4C4YA 2I3DA 5AKIA 1EINA 3I6MA 5K3FB 5KWJA 2WUFA 1DX4A 2WUGA 5EHZA 2PU7A 2DHDA 4E46A 1ZGBA 1N1MA 1T4MA 2RIPA 1WHTA 3BWXA 2GYUA 4B84A 3DQZA 1LGYA 1IVYA 4HTAA 2X76A 3CCCA 1WHSA 5AICA 1IMJA 3PUHA 3QH4A 4F0JA 1YAHA 5FV4A 1LPOA 2ZJ7A 3FCXA 4MYDA 1R3DA 1DT5A 3HSSA 1QO7A 5K3DA 3KXPA 2YXPX 1QIJA 1CUGA 5JAHA 4AX4A 4FDMA 1J2EA 4OCZA 4QDXA 1CUYA 1LPAB 4P92A 3IBTA 2XUKA 4NZZA 2PKYX 1EVQA 2DSNA 2XUDA 1EB8A 4CFSA 5IVKA 4M0MA 4DSZA 3DOHA 5LZ9A 4PQEA 5ALDA 1K63A 2ZYIA 3WKBA 4IO0A 2HM7A 4KRXA 5A2GA 2JBWA 1QIEA 3FYUC 4FHZA 5AK6A 3L1HA 2JGIA 2AJBA 2Y2VA 4ZREA 2C58A 4HS9A 1Q0RA 5HK9A 1CUSA 4JUIA 3WI7A 2QS9A 4OSEA 4FOLA 4QDZA 1Q0ZA 3EQ8A 1GKKA 1XZKA 4M0EA 4UUQA 5JASA 3QBJA 2WHRA 2QKYA 2VT6A 4ZRDA 5IVHA 3QPCA 5AJHA 4DMCA 5JARA 5K5EA 1S8OA 5LLSA 4AMZA 5EIHA 5AKYA 1M33A 3ESCA 4FWBA 1JU3A 1JJIA 1FSSA 1MX5A 3EBLA 2B20A 3U1TA 4HAIA 3D59A 1XQWA 4BP9A 4I4CA 4X94A 3O4GA 3AIMA 5I7UA 4MYSA 5CT8A 2AJ8A 4KACA 2XMDA 2Y2UA 5ALWA 1ODTC 3S8YA 3W05A 3FLEA 4Y2PA 3IVMA 3WKDA 4KR0A 3BL8A 3WZMA 2R8BA 4XJVA 1KU6A 3R40A 2WIKA 1YSCA 1N5RA 4I19A 1BU8A 5JZ9A 4GECA 4V2IA 1E66A 3VISA 3ZV7A 3AZQA 2HFKA 3I28A 3FSGD 2WIDA 4BB0A 5ALMA 4B83A 1ZIYA 4Q3KA 2C5FA 2WHPA 1XZHA 2WIFA 3OM8A 1JFRA 2WLSA 3STXA 3BJMA 1EDDA 3WK7A 1DWQA 4W1RA 1GT6A 4KJXA 3KWJA 2WILA 2XUJA 2ZJ6A 2RONA 5JD6A 3WYNA 3ZLUA 3ZI7A 2HRQA 3G9ZA 3PICA 4PSCA 1DINA 2GBFA 2VTVA 2O2GA 2V98A 3O0DA 4FNMA 5AK3A 5ALIA 3WJ1A 3DKRA 4EY8A 1QFSA 5DTIA 1CUVA 3R3UA 4J0CA 4KE7A 1VE7A 2WFLB 5A71A 3A2NA 2CKMA 2HA6A 1SCIA 3ZWQA 3G9UA 2PSEA 1BEEA 4FMPA 5DYWA 3WL6A 5CBKA 3D3NA 1SCQA 1BEZA 1K4YA 3C5VA 3WKAA 3E4DA 4C87A 2HL6A 5JD5A 1IUPA 1H22A 1SCKA 1DWOA 5A7GA 4L72A 2PUHA 1WM1A 2RAUA 5FKJA 4BVKA 5A7HA 1OCEA 4G8BA 3IUQA 2J3DA 3RK4A 2OGZA 5AM0A 5JZBA 3E3AA 4UBLA 1BCRA 4J03A 1A8QA 3GBSA 3NGMA 1CUFA 1EDBA 1TKRA 1UOOA 2WTMA 1PJAA 2FX5A 4DNPA 2PSDA 2XUHA 1O6FA 2XMBA 4J0IA 4QDUA 3PFCA 1AMNA 5CT4A 4GWLA 4BE4A 5AOCA 3VXKA 4OB8A 4K6GA 1R50A 4Y9SA 3ZLVA 4K6KA 5LZ4A 2BUBA 4FLEA 1IUNA 5CTAA 5LZ2A 3W9BA 1ISPA 3QYJA 4TPKA 2Z3WA 4ZI5A 1LZLA 2DR0A 4RE5A 1KU0A 3LIIA 4E15A 5HK8A 4PW0A 4WFJA 3WJ2A 4PSDA 4QWWA 1K6EA 2PVSA 3A2LA 4MQMA 5CT6A 3WWPA 2XUPA 4FFWA 2XMQA 5ALTA 2QJRA 1P0MA 5LZ7A 4FTWA 2Z3ZA 4GW3A 4EA6A 4ZGBA 4B85A 4ZV7A 4J0KA 2YH2A 5YASA 5CT9A 2VJBA 4BBZA 2H1IA 3S2ZA 5ALPA 1L7QA 4HZGA 3QPDA 3W04A 3OG9A 2PUJA 3ED1A 4NMWA 3BF7A 4YASA 3W2TA 1W76A 1G5FA 5DNUA 2AXEA 4J0HA 1YR2A 4HXGA 5AHXA 3H18A 4WY8A 2WU3A 5FDFA 1CQZA 1CRLA 3T52A 3FYTA 3DEAA 1G66A 2PL5A 4W1PA 4DNFA 1ETHA 2C0QA 1A8SA 3RKSA 2WM2A 5ALLA 4QLAA 3WA7A 3IB3A 3V9AA 1ZGCA 4UBMA 4BZZA 3SWWA 1TIBA 1QGED 2CJPA 1JI3A 2PPLA 4X90A 3H19A 1UOQA 4BRSA 3QMVA 1CUXA 2OGSA 4X6YA 2CUTA 5HF6A 4RNCA 2IIVA 1XQYA 1W6RA 3DYVA 4KRYA 1XZIA 1J07A 4P93A 1UKAA 1I6WA 3EF3A 2OCKA 1JJBA 5A6VA 4EUSA 2QUAA 1MPXA 2XMSA 1F8UA 2XQIA 4LKOA 1QFMA 1CUUA 1CUZA 2WIGA 4PO3X 3G0DA 4IHAA 4X92A 5ALKA 5K3FA 4CG1A 2K2QB 3N2ZB 5FUMA 3D2CA 2ONCA 3FLBA 4UBJA 3OTQA 1SC9A 3P2MA 1QJ4A 1GXSA 1WPRA 2QXTA 2QJWA 2HA0A 5D3KA 3C8DA 4TGLA 1F0PA 4GI1A 3AINA 3H0CA 2DCMA 4RE6A 3QM1A 1QO9A 3M81A 4BTLA 1DWPA 3WA6A 5AOBA 4Y2RA 2HRRA 5EGNA 4BVLA 4DTCA 4CCYA 2OG1A 1QIFA 2QUBA 3D2BA 4ARBA 3AILA 3ESAA 1DT3A 2HU5A 4CIAA 1ACLA 1B6GA 1R88A 3GFFA 1CUBA 2VQ6A 1ZJ5A 2XMZA 1AURA 3HYSA 1XROA 3HLKA 1YB7A 5E2IA 1R4ZA 4KEAA 3VDXA 5ALSA 5BOVA 1K8QA 1Q84A 4DM7A 1VKHA 4N5IX 1CEXA 3STUA 1ZI8A 3KWFA 4LHEA 2VJCA 4ROTA 2WHQA 4JYMA 3DLTA 4LXIA 3R0VA 1LBSA 1TCCA 3R41A 4UBNA 5ALFA 2HA2A 1LNSA 1XRLA 5EIEA 3B12A 5FRDA 2WSLA 2WU4A 1AGYA 5LKRA 1L7RA 3G0GA 4Y2SA 2DQYA 4G8DA 3V1NA 4MWTA 2AJDA 5JIBA 4DIUA 1N8SA 3K9BA 3QMWA 1XQVA 2ZSIA 2ORYA 1QIDA 1TRHA 5SYMA 4NVRA 4B81A 3IUJA 5DNWA 3O9VA 5LIPA 4JNCA 5F4ZA 1UKCA 4H7HA 3G8YA 3WL5A 3TJMA 2HA3A 4GLBA 4EY5A 2OAGA 5AM1A 1X2EA 4W63A 2HHAA 2JEYA 4U2EA 2V97A 4LIPD 1UK9A 3G7NA 2XT0A 4KAAA 2QRUA 2RGUA 4AZ0A 3PI6A 4G9EA 4P9NA 2CMFA 1U4NA 2ZSHA 4NS4A 3UMJA 2BAGA 1CR6A 3LCRA 2QR5A 2W22A 3L1JA 4ETWA 5LZ8A 4UHFA 3IUNA 1AC5A 5C81A 4O08A 1TQHA 2XQGA 3C87A 2ES4A 1UT6A 1TCBA 2BFNA 3AFIA 4Q82A 3HXKA 1SOMA 2BUAA 3R3WA 2XUOA 4PV7A 1DX6A 1X70A 5JAPA 1MAAA 2WIJA 2G63A 1VLQA 1VA5A 4HRYA 1ZICA 1XRNA 1R9MA 2I78A 2G5TA 3V1LA 3WWCA 1HLGA 2Z8XA 4AO8A 4G4JA 2JGEA 4N5HX 2RHWA 1JMYA 3LS2A 2E3JA 5T4BA 1WPXA 2XMCA 5E4JA 4HVTA 1B41A 4C89A 2WFLA 4X93A 1Q83A 4B0PA 2GBGA 5FPPA 3UUFA 1PV1A 1XZCA 3U0VA 4XVCA 3HI4A 3G9XA 1R9NA 5ALEA 2VAVA 4U2DA 4GEGA 4LXGA 3WL8A 1XLWA 3IURA 3YASA 4S0XA 1USWA 3TRDA 2P8SA 5BV7A 1R1DA 2JEZA 5ALNA 4UBKA 1Y7HA 2XDWA 4WDRA 4H7EA 4A16A 3UUEA 4CG2A 2WJ3A 3CXUA 1O6GA 1LPBB 3JW8A 5HCUA 1CLEA 1XLVA 3F96A 4A23A 3R3VA 3D0KA 3HABA 2D5LA 5AKHA 1VJ5A 4G8CA 3OOSA 3G0CA 1YAJA 1BS9A 5JYCA 4HXFB 3AIKA 3EIOA 4JEIA 4RGYA 3V1KA 5FP0A 4X97A 1LZKA 5ALOA 2C0PA 3I2FA 4I3FA 4L9AA 1AUOA 1OXMA 2HA4A 3I1IA 2C7BA 5CH8A 3WL7A 2I3ZA 5AI4A 4A5SA 2XLBA 5FXMA 4QDOA 5AH0A 5AI6A 3FLAA 1QIMA 1VE6A 4X71A 1BN7A 1DTEA 5KWIA 1E8MA 2JGKA 1C7IA 2WHPB 3ICVA 5HF9A 2XMRA 5CRIA 2PM8A 5H3HA 4Q3LA 1TAHA 3DKKA 1MX1A 4G9GA 3QITA 2PSHA 2DQZA 2OLEA 1EH5A 5C8VA 3VVLA 4FBLA 1P0PA 5AKGA 3T4UA 2XQKA 1BN6A 5IH7A 2CBGA 4AMYA 3AUKA 3FNBA 5K3EA 3ICWA 1ZIXA 5ALGA 1UOPA 2QMQA 4OPMA 4C4ZA 2HDWA 3AJAA 5A7FA 3PE6A 4BC1A 3N0TA 1ZOIA 3HZOA 3OC0A 4UHHA 1ZD3A 2ZYHA 1FFDA 1AQLA 5E4TA 5JAOA 1UZAA 1N5MA 3WLAA 3PF9A 4GDMA 1J1IA 5ALYA 2J4CA 1RP1A 5D7BA 3B3QA 5I9IA 1G42A 2ECFA 2XE4A 5JD4A 4J7AA 4W1QA 4OUKX 3PDCA 1FJ2A 4OU5A 4X7BA 3BE8A 3WWOA 4DSAA 3SK0A 4C4XA 2BGNA 2JGFA 4Y2QA 4QNNA 4ZV9A 1VOTA 3FVRA 4WY5A 4M0FA 1P0IA 2ZVDA 1NX9A 3ANSA 4X00A 2FJPA 3R3YA 2O7RA 4DYHA 4JH0A 2VJDA 3WWEA 1CUHA 5JAUA 5AOAA 5AI0A 2H9YA 2CEKA 1IZ7A 1W75A 3MUNA 3C6BA 3ESDA 2AJCA 4L0CA 3FYUA 4X3CA 4B80A 2WJ4A 3KDAA 4Q05A 2B4KA 4PSUA 4ITVA 2H7CA 2DHCA 4L3WA 2ACKA 5ALUA 3A2MA 4U2GA 1HBJA 1ODCA 4B0OA 1THGA 3X3HA 1EI9A 1J06A 4BZWA 5IVDA 1AKNA 5AKEA 5BWCA 1CUEA 1WCYA 3GELA 2PX6A 5T4EA 1XRQA 1YA4A 2H7XA 4KE8A 1ACJA 4Y2XA 3FCYA 1XZBA 1MTZA 1Y7IA 4J0JA 1JKMA 1XZAA 4RPCA 3QZUA 2G4LA 4U2BA 4H7FA 1IZ8A 3Q0TA 1QTIA 2JGMA 1LPMA 1QE3A 3VJKA 5EHXA 1CV2A 1Z68A 1OILA 3W9UA 4AZ3A 1QIKA 3DJYA 2HA5A 2V9ZA 5E4YA 4GBGA 2WFZA 2OAEA 4CCYB 2D0DA 5AM3A 4QA9A 5I8PA 3C6XA 4BVJA 2JIDA 3H1BA 4C6HA 4K5QA 4Q1VA 1A88A 2EDCA 1X2BA 3IA2A 2XLCA 2XQFA 4B7ZA 3WMRA 2O7VA 3HRHA 1NU6A 4Y2JA 3Q8WA 2WG1A 4Y7DA 1CIJA 4DGQA 4KE9A 3WYDA 3DOIA 1ZI9A 3JYHA 1C7JA 3MUOA 3H2KA 2I03A 4Y2UA 2PU5A 1U8EA 3TGLA 4J0DA 4AXBA 4KAFA 2VSQA 3NWOA 1QIHA 5A62A 2R11A 1QIIA 5FLKA 3BDVA 4IH9A 1TK3A 3CN9A 2WUEA 2OXEA 5ALVA 2HIHA 1E8DA 4XIIA 4HRXA 4J3JA 2Z5GA 3F98A 2HU7A 3O4IA 1UWCA 3D4LA 3CCBA 3RLIA 3PF8A 2BUCA 1XZFA 3F9CA 3V48A 3R3XA 1DQYA 2O2IA 4KE6A 3G0IA 1XRMA 2LIPA 3G02A 5EI5A 2HA7A 1UK8A 5AI5A 4ARAA 2JGJA 5IVIA 5AO9A 4WFIA 1AX9A 1C4XA 4UHCA 2VT7A 1HKHA 5J3JA 1E8NA 2XQJA 1QZ3A 1JT2A 3FVTA 4N8SA 2QTBA 1JJFA 3IDAA 3G9TA 2OCIA 4BCBA 4MEAA 4MWSA 3F67A 5DTJA 3VJLA 4BDSA 3EQ7A 2YASA 3WK6A 3ESBA 4QEKA 3B5EA
chains in the Genus database with same CATH superfamily
4LCBA 1M0SA 3R09A 1Z3CA 2HXSA 3C48A 4G3XA 4WLFA 1G3IA 1JEEA 1OZ0A 3WY9A 2A8YA 3KJXA 4LWOA 2A9VA 1JEAA 3ONWA 2IBSA 1R6BX 5HBGA 1Y82A 1MO4A 3I61A 2N47A 4C4RA 1IAQA 1RI1A 1WMBA 1VRVA 1TMKA 2OHOA 2NO7A 2SECE 3BTSA 3DL0A 4Z3DA 3P0JA 1XXHB 1WETA 2DR3A 4JI7B 3FWNA 4A0GA 4JK3A 4UEKA 2XDQB 3RYFB 4ZK6A 4RMJA 4JITA 2QUZA 4LHWA 3TQHA 2O2ZA 4PYNA 1J90A 3WNVA 3H2JA 3WZLA 4YUWA 1LEHA 3FOFC 5K3CA 2IEGA 3HADA 4OIMA 3BA1A 4XWWA 4WLVA 3Q8MA 2PX0A 1EK2A 4PN3A 1QZTA 1ZM7A 5EYPB 3MRTA 4XFDA 2EKQA 2MR5A 1E4EA 3MLBA 2OYCA 1WD5A 821PA 5G1PA 2DBRA 4HH1A 4XRRA 2GD2A 1EVYA 3NHUA 5EXTA 1YZGA 3N5CA 2PZGA 2EJWA 3LUGA 3MZ0A 3DJFA 1RQPA 2CNWD 4Q34A 1GL3A 2IXAA 2R5FA 4O1HA 4PZZA 4RA6A 3C4VA 1YI0A 5D1HA 2Q6OA 4LFBB 5FUBA 4V0ME 2YV5A 3LT4A 1HZZA 1NZJA 1X13A 2IYRA 1H85A 1E89A 1MQAA 1W1UA 5BMVF 3HU2A 3O2SB 1PG0A 3ANTA 2QZJA 3FWYA 1DDGA 1WOMA 4PCLA 1G6OA 2IHNA 3K5HA 3FBWA 3MPUA 4UCWA 3GGOA 2ZRDA 5K8CA 3BWVA 5BW5A 4C01A 4PC7A 2YTZA 3GC6A 1PS0A 1VCNA 3RBVA 3ROKA 1SG6A 3E81A 3K71B 1G5PA 3NOXA 4JJGA 4ITUA 3WQSB 3FUCA 3UQZA 1XPOA 3ELUA 3FMIA 4KQWA 3GUVA 1QMGA 5HRCA 4YQYA 5K6RA 1Y3BE 4BRZA 2B4QA 4MWGA 3HP7A 1V95A 2HJWA 4E5UA 4GD3Q 2YWHA 1NLUA 1Q91A 1E98A 1R37A 1Y1LA 2XOEA 2NOAA 1OXUA 4OB6A 1C0IA 2ACWA 5COBA 5GJWC 1WVMA 4FYVA 5AVTA 1A4XA 3EEIA 1YS2X 1Y6JA 2YVUA 3MCAA 1C9EA 3UMFA 4EMSA 4YR9A 1DB3A 2RGEA 2ZYAA 4JC5A 3ZIAD 4Q7QA 3NU1A 3ZTTA 1JAIA 4HLQB 2F62A 5A3SA 2QQEA 1COZA 3OEED 3HZRA 2G88A 2LKCA 4ZXFA 3H8WA 2AOTA 3GEGA 2AR7A 5KSWB 3T7RA 1VCIA 2C42A 1CR1A 4PIMA 2SICE 4JC0A 2ZTUA 2BEVA 2W8BB 2O23A 3FFXA 4LSWA 3RVQA 4BEWA 1A1VA 3CWZA 3AF4A 3EC1A 4NCKA 4UZEA 1TPYA 4C7KA 3IHTA 1A4RA 1BH2A 1U0NA 1UDBA 1E18A 2QAGC 3NEPX 3QLUC 1UADA 4LNUB 4MS1B 1MGPA 5CB4F 2CZQA 2GARA 3CB2A 4GM4A 4JJ7A 3SNHA 1IE3A 2FJUA 2W2LD 1VE1A 3EVCA 3FBTA 2PFKA 1X94A 3LWZA 5CA1B 4MGZR 1OIWA 2RHRA 2Z8YM 3DD1A 3QI7A 2FSVA 3F8SA 2LCQA 4KQJA 4YV7A 3JD0A 1DBWA 4QRHA 8ATCA 1XP8A 2QE7D 3SZRA 1SXJB 4EVQA 4C0LA 2P2NA 1IN1A 4B35A 2YHSA 2W83A 3S70A 3K4HA 5JRDS 3HA7A 2GZAA 5DEOA 1MO2A 3PPXA 3ZHTA 2G28A 2OPHA 4XX1A 5EJFA 3TBHA 3NIBA 5FTJA 1WU8A 3ORYA 3Q7IA 5IC6A 1DLIA 1QWSA 3VPDA 3JCZA 1GZHB 2JI6A 2ZAYA 3L4BA 1EQ2A 1V1RA 3ETLA 1Z22A 1XYVA 3IEPA 2WLTA 1Y3IA 1A2OA 2UYQA 3D7KA 2E1PA 3OFVA 4RD1A 4DIBA 2AR0A 4B7AA 4OU4A 4QBKA 4YEDA 3PPVA 2OY0A 3KJIA 5CVCA 4PF1A 1VYTA 4DSNA 5BV8A 2I4NA 2PNJA 2BM0A 3KUCA 3TLBA 2B9EA 3V4PB 4S1PA 1TLFA 4B2PA 5LYJF 4B5KA 1G63A 1OZHA 3T4XA 3T95A 4PHGA 3PEUA 3MB5A 2EZTA 4F4CA 3VSEA 2XTZA 2FXVA 2O6HA 1L7AA 1QONA 2DXIA 1MJFA 1JR3A 4FFOA 1E5TA 3P2KA 3RH0A 1MOQA 1SBNE 1TMGE 1UMKA 4Z1MD 3JAKA 1P4HA 5IJ9A 1W1IA 5MHTA 1PRYA 2DZDA 3D8BA 1XVTA 3T12A 1HXHA 3LFTA 1W35A 3CX6A 1SD2A 1MNQA 1MENA 2GFQA 3DEHA 1EK5A 1IHYA 4QLBA 2VP2A 2FPKA 4BEVA 4CKEB 4EL5A 1JU4A 1IC6A 2XDQA 1KAHA 1HYBA 1E7YA 3MINB 3TEFA 3U3KA 1BE6A 2GCGA 2IP4A 2PX3A 5BQOA 5DRTA 1KOLA 1OVMA 1CY0A 4JZYA 3KZNA 4ND8B 1F4VA 4G0NA 5C31A 1BVYF 1ZVMA 3O38A 2A9FA 5TY0A 1N4AA 4KRFA 1CUCA 2ZYVX 2ZTMA 4RDIA 3DZBA 4K8RB 5FTKA 2XI4A 2OCGA 3QEJA 3VDNB 1MDFA 4PONA 4KAJA 2A9OA 2RHGB 4R8MA 3NT2A 5FJIA 1CUDA 4RWEA 3TZEA 3ZWOA 8LDHA 5K0ZA 5THXA 1D2AA 1EFKA 3BMOB 3AIOA 3NWJA 4M9SA 3DXYA 5A5DA 3ET5A 1AIPA 2R44A 3QVVA 2QG6A 3M6IA 1PG5A 4LQDA 4TSFD 4FYKA 4LWQA 1HE4A 4LUCA 4BFXA 2DM6A 3PFFA 2BI4A 3RBZA 3JR7A 4PSVA 5LYJA 2C5EA 1XQXA 1Y81A 3FRIA 4A2PA 3I83A 3V7UA 2VL7A 2SCUA 2ZRGA 4Y2TA 2ZRMA 1O8BA 2FLVA 2IXGA 3OD5A 1M2VB 1QR6A 1U1FA 3SQLA 1I94B 1XKTA 1DPFA 4Q4AA 4E5PA 4EELA 2E4YA 2ZT7A 2VP4A 4FINA 3LQ1A 4F72A 5TXGA 3KJHA 2QVXX 3IAM6 1WCIB 3F2VA 3KKLA 3CNNA 3SHVA 3H2HA 1GL6A 5AM2A 9LDTA 5SYNA 4OAQA 1P91A 4BVEA 2OECA 1DZ3A 1TF5A 2HDNB 1RI2A 1K3TA 2EEZA 1L7NA 3L84A 4HRVA 3ZDQA 2QOEA 5JSQA 4D9JA 3PNPA 1II0A 4IH4A 4JYBA 2BKXA 3KPVA 1ZBQA 2WIAA 4U1RA 1S3SA 5BR1A 5DYIA 2CXTA 2G6TA 4KDEA 1Z5VA 1XZEA 1A71A 3IUMA 2JVKA 3IERA 4L7QA 5TPWB 4DM4A 1AZSC 1VKJA 5HXAA 4R1NA 1Y3FE 4N7MA 1H3NA 2H7VA 3EGDB 5G3ZA 5J2TF 1DC6A 2IYYA 1N6NA 3TRIA 3IGFA 4BFCA 5JNTA 1OZFA 1P1IA 1ENYA 4QZVA 2V6JA 1KVUA 5HFJA 1NRXA 2FPMA 3EIEA 5T6BA 4CKBB 3F9RA 4Y18A 1FBTA 2F00A 4QUEA 4ZDIA 1EAMA 3FVVA 2VF4X 2RB5A 3ZLJA 1E5QA 3KHTA 3ONDA 2VCYA 3DZCA 1BFKA 3KU1A 4JWKA 4WA7A 2C4WA 3LP5A 2JLXA 1JHPA 1G1AA 2Q2WA 3R9WA 3EYAA 4OP1A 1C81A 5DULA 5LZ5A 5F7OA 4M1KA 1T91A 3L04A 3I4CA 1L5GB 4JYPA 4TWAA 1KC1A 2NXEA 2PKWA 4OHKA 4IQ4A 5ETJA 5EPOA 1VCMA 1JBKA 5TE9A 1XP5A 3OCJA 3DBVO 4P7JA 3IJEB 4IMIB 4BNVA 3ZZTA 4B6QA 2R5NA 1MIOA 4FOOA 3TNFA 4X0EA 2OO5A 3A8TA 4HYYA 1KJYA 4JIMA 3TM4A 3HUDA 2DWUA 1GQSA 3E3NA 3K6SB 1I4DD 1WB4A 4ND2A 5DTQA 1FX0B 1MR3F 2C7GA 2P6OA 3OIGA 4MW9A 5J1SB 2FKAA 5CLJA 3HXPA 5JATA 1JN0A 3HNOA 4AMGA 5BPHA 4FGLA 1RKBA 1RWOA 4W5HA 1SN7A 4LRYA 1Y3DE 4GOLD 3UXHA 1EWTA 2JGDA 2KB0A 3D31A 3RC3A 1N3BA 1GVHA 5CB4B 3WQRA 3ZWAA 4R1TA 2J3JA 2AW3A 4YDSA 4GPEA 1H66A 5FFNA 2RHJA 3WMGA 1AY0A 2EU8A 4GFDA 5CIWA 5B7QA 5HUQA 2VZ8A 1SQ6A 3N5KA 3KALA 1QQ6A 4H6VA 1K7FB 3DZ8A 1S96A 1NFFA 3E5NA 3FSJX 3QX8A 1U9YA 1IH8A 4LYDA 4RULA 1EDEA 1ULHA 2H8KA 2XCIA 4LJ7A 4ZAVA 1XJ5A 3N0VA 1H8HD 4BU0A 4PN7A 1XZDA 2VSOA 3I6ZA 1RBZA 2GH1A 1N2IA 3BERA 1H9AA 1QS0B 5EHQA 5DHFA 2FMKA 4I1VA 3QOWA 1PK9A 2O5VA 1TM5E 1RABA 2E4WA 3G1TA 1NI4B 4TLLB 4YMIA 3WRVA 5TEWA 1E6MA 3KR9A 1SKYE 2JGAA 4E15A 4EHLA 3LNCA 4L6AA 2VFAA 2FQYA 4FU0A 4MPJA 4PU0A 4CT5A 2AXPA 4YQZA 2Q5FA 3AUJB 1J0DA 3NBYC 1FUYB 2ZSEA 2J45A 3M6XA 3LBIA 5B55A 2DFVA 2XUQA 3HN2A 3ILSA 4C0BA 2HHCA 5DWDA 1WIWA 2P2GA 3U4QA 2WQ7A 1J9GA 3M70A 3AR3A 3AONB 7ABPA 1GKYA 4YAWA 4HLDA 3FCEA 1JQ3A 3OLZA 4JFRA 4XDYA 1HV8A 1DO0A 3KCQA 4QPNA 4Q16A 4BAUA 1NKSA 3H3JA 5F98A 3BH7A 3O6VA 4X54A 2FQXA 3BTVA 5CW2A 4R2LA 3PHJA 3ZJUA 3IVCA 3B48A 1QBGA 2F7SA 3PV0A 1FSFA 2R87A 4FZJA 4K88A 5HZMA 5ICEA 1WPQA 1FFAA 5IM4A 2IZOA 2P8JA 1WUTA 3G2LA 4AQDA 1E69A 3K7EA 2ZP1A 3AVOA 4HOYA 4EW2A 4F2WA 4KREA 3TTXA 4UAGA 2H4YA 4JI3B 3U62A 1UXGA 2GZHA 3TBFA 4XR4A 4BMVA 4NU8X 3X1XA 3OF2A 4X66B 2OM2A 2Q3HA 2HCTA 4EB0A 1DFHA 3JSAA 1QF9A 3HEAA 2R25B 5EY5B 4POOA 5LMNB 4XVRA 3ZBPA 3RSHA 4X3PA 4FN5A 2FWPA 1S89A 4NZPA 1H4SA 1CUJA 2Y27A 4LXHA 3UGQA 3LO5A 2ZSAA 1KI9A 2CNNA 1YCFA 4ZVUA 1FUEA 1ORVA 2XUGA 4BVBA 2XZOA 1SO8A 3HJAA 3I34X 4CM3A 1MD9A 2V6GA 4TT8A 2GPJA 1DEOA 4BWFB 2IQ5A 1PUIA 4OXQA 2HHLA 3KOYA 2HV8A 1QUFA 2JLWA 4NCJA 4QTUB 2K6GA 1IXRC 3HJGA 3T3MB 3VZPA 2EDAA 5JZMA 4JR1A 4D6XA 1XEFA 3ORQA 4TRRA 3HY6A 5ISMA 1VB3A 2IQIA 3JRWA 1OAKA 4RGBA 5HGJA 3R7SA 3SC6A 4I5IA 4NDZA 4LVNA 4C1NA 5L4LA 1QVVA 4W9RA 3OSZA 2XY4A 1ADBA 3PEEA 4OGWA 3RE1A 1M8GA 5F3WB 3SYLA 3LNTA 1HNWB 3QXGA 4ZKEA 3SJZA 3OT5A 3IP3A 1B8OA 3WK5A 4M9UA 2VBCA 2YRFA 1J97A 3HKDA 3Q5DA 3RDPA 2VCHA 4EKIA 1IRIA 2PYZA 3K15A 4BCCA 3IQHX 1U6JA 2IITA 3TPZA 4FYWA 3NUZA 1C3EA 5EP4A 3UGTA 4AS2A 3DXFA 4MW0A 4EGQA 1XXHE 2GZ2A 1YFKA 4NENB 1DEHA 2Q6VA 1EJ6A 3K70C 2C84A 2VSXA 5M7EA 1N2CA 2IK8A 3QY0A 3DF9A 3PRJA 1X92A 1VG0B 2BLLA 2DFKB 3PC8C 4XIJA 5JLAA 2BGLA 3VVMA 5EQFA 4MW5A 2BKLA 5EL0A 2XB6A 2E4XA 1LTKA 1TPZA 3I52A 3EK2A 3FNIA 5D6OA 3V1MA 2O19A 4KX5A 4FEAA 1WDKA 1GR1A 2HDHA 2PQ2A 4UD2A 3R76A 3RVBA 3G6KA 1XRJA 2DUWA 3WSTA 4EG5A 3MOGA 1E9RA 1XDWA 2D1RA 4MVJG 6GPBA 1ZCZA 1GGVA 1YASA 5JS1A 4S1TA 4QFMA 2IY9A 4LCJA 3MRSA 5G0WA 2C00A 2EW8A 3D0QA 4ABTA 4KK3A 4L02A 1LW6E 1GPLA 3AL2A 4HXEB 3BXHA 5E9JA 3TPFA 1E4EB 4P58A 2H8GA 4NYIQ 3LC0A 2YMMA 2Q3EA 3U4MA 4OXXA 2AE1A 1FXUA 3HCEA 4C4OA 2ZOSA 3EVGA 3AETB 4O4LB 2OMKA 1OA1A 1OWOA 2VQSA 4Y6QA 1Z6ZA 3JXEA 1OVGA 1CE8A 1I6MA 2XDYA 1R12A 2ZKIA 4RZIA 4YK7A 4I55F 4MVWA 1UFRA 4Q1CA 3QYPA 1N8NA 3WWDA 2VF7A 5TQ0B 3IULA 1SHZA 4O2AF 3RIYA 1FQOA 1HDEA 4PLGA 3J80A 2NPFA 3SFTA 5KCZA 2OQ2A 3H83A 4JXKA 5K6AA 1J99A 1K08A 4AP5A 3B3JA 4CMHA 3OMWA 4DXDA 1ECLA 3W6PA 4DIEA 2DKNA 4HDNA 3F7NA 1YBFA 4GHWA 1IHOA 1Z82A 4G1FA 4RPJA 1T8RA 4G0MA 4P31A 4AN0A 2BY4A 2HADA 4GBMA 4NP6A 3ND7A 3KU4A 2D4AA 2BOVA 1KGSA 2X41A 4QXPA 4JHXA 4AO7A 5T4FA 3WNBA 3QXXA 4ZZ3A 4U2CA 1RHMA 2M6SA 1Y33E 4PQRA 1KEZA 1M67A 3V8BA 1O94D 5A5VA 4N48A 3NYRA 5JROA 3PITA 5DTRA 2BTQA 3BIWA 1BE0A 3IEKA 3LVFO 1ULBA 1LLCA 1RJWA 1HEUA 1XQ9A 2EX0A 2LDBA 3G8BA 5HIKA 4RTKA 2OUKA 4L8LA 5HIIA 2VP5A 3COYA 2YYYA 5WRFA 3BULA 5TF4A 3ZGXA 3CX7A 5FF9A 4ZEOA 3TLZA 4DMKA 1SQ5A 3BSYA 1ZP6A 2VDMB 4MRMB 3USES 5L9AA 5KI6A 5D6NA 5AJYA 3CX4A 1T6XA 4NX2A 5GZ6A 1IY9A 2VAWA 4EYEA 4EMBA 1PEDA 2FY8A 1JIKA 4C30A 3F8TA 3JQAB 4GH5A 1IM2A 4BKPA 3RAPR 4RTSA 1PJ4A 2XUIA 5AJWA 1NMYA 3AP1A 4FP9A 1OOEA 4JLBA 4N8DA 3DLAA 1CZUA 1UKBA 1F48A 4MQ4A 2QPLA 3SZOA 4BX3A 4OX9Y 1JFSA 5HKAA 1V1JA 2DH6A 1ZX1A 1N1DA 3W6ZA 1U5BA 4FFBA 1ZM9A 2DC1A 3WHPA 1UWVA 3IEXA 3FSGA 1T2DA 5ILQA 2ZRJA 4H0NA 1W52X 4WXPA 3FD8A 2G09A 3L7IA 3ABOB 4GRAA 5AIAA 2IZ6A 3ZI0A 2GASA 3FDFA 3X1ZA 1HQYE 4LOKA 3DMTA 4RYDA 2QVGA 1EM6A 1NULA 2H54A 1X1QA 2ZTVA 3VPFA 4FYIA 5B2FA 4EHNA 3FSRA 1B0ZA 1CQXA 1HTBA 3FUUA 4HQ0A 3V8EA 5CDFE 1ABBA 4HEHA 3PRHA 1M1UA 4OJMX 5CB6A 2XRYA 4TOIA 1ODFA 3ZDDA 4F5DA 4PG6A 3P45A 3VJMA 2XVAA 1EUCB 3UWMA 4F6RB 1Z36A 1KQGA 2ZYUX 4HVAA 4OGFA 4EM6A 1IJEA 2OD2A 1ZI6A 3FZEA 1OBHA 4G24A 3M5WA 4XVQA 2AH5A 2JIOA 4RA9B 4FUTA 4NK4A 4OHPA 1SIBE 2X0NA 3HPRA 2JCGA 3H5WA 4H31A 4AKGA 5HOEA 5E7IA 4H17A 2WZQA 4Q3CA 4CM5A 2VDRB 4EQZA 1PIWA 2X1VA 3CF2A 4NR0A 4Q1FA 2DFLA 4F1JA 2PRKA 3SFZA 3NHMA 4L08A 4NY1A 3RJMA 4G0VA 3H9UA 1BOFA 2ZYRA 1G3QA 3V4LA 4EW6A 4DQUA 5HOQA 1GYRA 1OUMA 4P5PA 4ZCMA 3KO8A 2J9FB 3HKCB 2IPMA 3JRNA 3H1PA 4TV9A 4XGQA 4CL0A 1ONPA 2BMWA 4DA6A 1EXDA 3VAZA 5HDBB 4D8XA 1YS1X 5HKOA 1YRLA 5IX8A 3FYUB 2ID7A 5TDHA 3JD3A 2E82A 1P2UA 1NIJA 3VU9B 4BNGA 2ENWA 4XARA 1E3JA 1K86A 4W5QA 1EX6A 2Q07A 4ND1A 4XI9A 1ZMRA 2JLVA 4MAMA 4QHYA 1ZA2A 1NRIA 1NXOA 2H48A 3OE5A 1PNRA 2QZ9A 1IFXA 4NZ9A 2VKQA 4ISBA 4UHDA 3STVA 1ZJ6A 4ZYZA 1AKRA 1F1JA 2ST1A 3NC1C 3OCZA 2PY6A 5FWXB 1DUIA 1SUBA 3BB4A 1AS2A 3DAGA 4WEOA 2GHTA 2H7YA 5K20A 4MVJA 1QV7A 4RQTA 2XKKA 5JI3E 4YVFA 4A6DA 1VBFA 4L0DA 4W1SA 4K9RA 1YZHA 1OQAA 4FDUA 4BUZA 5CAEA 1RAHA 1TUBA 1KI4A 3PE4A 2B61A 3BRWD 4O63O 4UTVA 5KJCA 2OBYA 3T5PA 2WQZA 2ZRNA 3O3NB 1CUAA 4GX1A 4OSPA 3KAKA 2YJZA 5DT2A 3V4ZA 1Q92A 3S99A 1UM9A 4KPFC 1FEZA 4JVLA 4OUDA 3RC7A 4D8VA 2CD7A 4OHCA 5K0FA 2WBLC 3NV9A 2F4VB 3DEZA 3W4JA 2Q27A 3HZHA 1SXIA 2W6PA 1ISHA 1BMQA 1SBZA 2WZCA 3RTDA 2JGLA 2OVBA 4AJPA 4CG3A 5M34A 1GTMA 4TTAA 1ZSYA 3JARB 1BCRB 4QVIA 3RT9A 4CI9A 1H2WA 3P9ZA 1EGQA 5K09A 3A6ZA 4FK8A 3VKFA 2ZM6B 4HG2A 4IXMA 3KKMA 2AF4C 5DI3B 4QJBA 3UKOA 4TTSA 3BKXA 2OBLA 5AK4A 1TUGA 3EVTA 4XPZA 4L85A 2PH5A 5ECGC 4HWTA 2PT9A 3UTDA 1Z2AA 4P83A 2HQBA 1DWUA 3NHWA 1F60A 1WMEA 1CFJA 1XMVA 3UMRA 3AF2A 4Y3UA 4HL6A 4F5EA 5I7OA 1GILA 5HZGA 1SHTX 1VZ2A 5E3HA 2JLZA 1JIQA 2HB6A 4BZPA 1EINA 1X7DA 3I6MA 4I50B 4JLPA 1J23A 2Q5LA 2XGOA 4UUOA 2V0GA 2WUGA 4NULA 3K20A 2E89A 2VUHB 3NB0A 4KWTA 3GXBA 4AWAA 4MVJP 3LLSA 2P41A 2Y4NA 4OI4A 4MI1A 1UZUA 2VDWA 1T4MA 3SYKA 1GXSB 2BHRA 4G0ZA 4KMOA 2RIPA 2PLNA 2UYHA 2ZYGA 4NMXB 3TKAA 3HJTA 5DCLA 1G8MA 4ETIA 3W7BA 1WHSB 3R6WA 4M60A 5ABPA 3AUTA 2FP3A 3N70A 4HI0E 4X64B 1PR6A 2J0EA 4JL6A 4RV4A 9ATCA 4BLWA 2W48A 1IK6A 1VYHA 1IY0A 1JH8A 5FBWB 1NNSA 3K0AA 2X76A 3CCCA 1MCZA 1YB1A 2VHQA 1TB4A 3FUXA 1E2HA 3KKPA 3LPAA 4TKLA 4YS6A 3PUHA 1P6UA 4B8WA 3QH4A 4DWWA 1CF4A 1SKAA 5ES4B 4F0JA 1GZ3A 1DXOA 2JI4A 1YAHA 3QHPA 4DUPA 1RYBA 1LPOA 3OTIA 4B4OA 4MYDA 1R3DA 1XCGB 4BO9A 2X5KO 1P81A 3PJDA 5C80A 5K3DA 5THKA 2YN2A 1QPGA 1C80A 3LHIA 3N28A 4PFSA 4E5SA 5HGXA 4D4LA 3CZMA 3H7AA 3IKJA 4JKIA 3RQIA 4ZPJA 4FDMA 3NTVA 2PWBA 4HUJA 4DL9A 2NSDA 5G40A 5HUHA 2VHYA 2ISSD 2AS0A 4PLCA 3EHDA 2F6RA 3AH8A 1N2GA 3GOHA 3QLJA 4MUNA 4UPVA 4ZVKA 2OP0A 2ZB4A 5AW0A 4DV0B 2B7BA 3AJ9A 4I5EA 3U5TA 4NZZA 1LF5A 2BZ1A 3CLKA 2Q8PA 3EW9A 2DP4E 1A4IA 1EK0A 4YP1A 4FGUA 2C96A 1EVQA 2ONKA 3IC5A 1AB6A 1RQXA 2AZMA 5FNVF 3U7GA 4OVKA 2Q6KA 3ZDBA 3E82A 3I9V6 3Q40A 2B37A 3ULKA 1BHO1 2OXFA 4KV9A 4MEJA 4YAGA 4PQEA 3M1LA 2A94A 4KAXA 2WNIA 1NVEA 2PZFA 3ZDRA 3DKPA 3EODA 5C8DA 3GU3A 4CKWA 2EAUA 4IO0A 5A2GA 3TKYA 3PTLA 2ECQA 3NHZA 3KXLA 2G4VA 2DBVO 2TECE 3ON5A 3WB1A 3RSZA 3E7PA 3KETA 1N8TA 2GBPA 2RG7A 4JOCA 1YJAA 2EG5A 5ICSA 2AJTA 1EZ4A 1KEUA 1S2MA 2C3YA 4OA8A 1S2DA 4CKEA 3L7BA 4G5GA 3NFYA 2JGIA 2VDOB 3LQRA 2QX7A 1QOPB 4NYMQ 3ZDYB 4D42A 1XVAA 2IYPA 5K9ZA 2J7PA 4Y1RB 3ACBA 4HGPA 4AJJA 1P19A 4PG4A 4N6GA 3K8ZA 1C9MA 4FXOA 4I4NA 1E58A 4GSLA 4LWPA 1C7EA 4YRIA 4HPJB 5B30A 4JUIA 3OZFA 3H5TA 3K9CA 1I4LD 2QS9A 2FFRA 4OSEA 4KITB 4Y6SA 2QL6A 1PAUA 1W4CA 4NOLA 1JHRA 2Y1WA 4OHUA 4JLOA 4RK1A 4ZAGA 5HYVA 3BIJA 5JMWA 1SUDA 4QTXA 4QDZA 1P45A 4ZP1A 3R0ZA 2AHRA 1VMEA 3W5IA 5HNKA 5BWMA 3LOPA 1PQYA 1KKUA 2GB4A 4M0EA 1DIAA 2BMFA 2RJ3A 4BFSA 2WFAA 1K1EA 5IASA 1MKYA 2C83A 2HJVA 3H3FA 5C8YA 2H4XA 4C78A 5LU8A 2QKYA 1EG2A 3O4VA 4BVAA 3C5CA 1H9CA 2XODA 2IDMA 4LJ4A 4TMWA 1CNMA 5L3SB 5AJHA 1BMFA 3ANYB 1KI3A 1U31A 2ZIGA 4PE5B 2YC4C 3U2QA 2RGAA 4MQEA 4DMCA 2N9UA 3T5GA 1FJGB 2QM7A 4FHCA 1D1PA 4J16C 5LLSA 3I23A 2W2MA 5KHLB 4D81A 2MJLA 4GR9A 1MIHA 5AKYA 3OJLA 4ZI7F 5IJWA 1G64A 2HSJA 4O4HF 2WSSD 2GN9A 3W5CA 1VHWA 1JJIA 5KKAA 1ORTA 5HJ5A 3V4FA 4YCLA 1FSSA 3GLFB 4DV7B 2G8LA 1JPNA 3E2MA 3NJRA 1QB8A 5T6MA 4E7OA 3FB1A 4RTJA 3FPJA 3TH5A 2Z09A 3EBLA 3LRTA 2C94A 2NO9A 1HT1E 3I9LA 3H1TA 3PDIB 4G1MB 4JC8A 1NGSA 4X24A 3WJ7A 3D59A 1N57A 4RH0A 1QGZA 1ODJA 2OB1A 1XQWA 2PTHA 1M8KA 3C39A 3LXUX 4QVKA 4IP0A 3GVXA 4BP9A 2XBMA 3U4GA 3O4GA 3B36A 4IJQA 4BO1A 4NXMB 1KWKA 3LRXA 1JSRA 2G0AA 2X3FA 3JQ8A 3VR2A 4CHTA 5U1PA 3PTAA 1Z5ZA 2XMDA 2G9ZA 3D81A 4BNMA 1MB0A 4UVEA 3GRAA 1N3IA 4EYKA 4OXNA 3E5HA 3CV3A 4FSXA 1KH3A 3S8YA 4IVPA 4LI3X 2VJYA 4RJKA 5IMSA 1QBKC 3IVMA 2ZJYA 2E49A 3WLMA 4AMVA 3NXSA 1ZYUA 1QC5B 4EW1A 2M98A 3LZ6A 3A3PA 3RR2A 5CFPA 1C7QA 1MXFA 4KWIA 4AUEA 2BMEA 4TTPA 2VYFA 4GZLA 3D4PA 3T1TA 3COZA 3R40A 4TV8A 3ZE6A 1KY2A 1CJTC 1TZ2A 4EHAA 4IILA 1UJNA 1BU8A 3N2GA 3R74A 2V7EA 4QG7A 3VBCA 3VA7A 3CH4B 4GECA 2XB4A 1EXVA 1GFWA 5AW7A 1I2AA 2HLDA 2O0HA 5ERGB 3RK0A 3VISA 2M1XA 3QEOA 2GEVA 2QRLA 3NGXA 3ZV7A 4DEXA 2ZM5A 1JL3A 3CC8A 2BFMA 2DLNA 3R0JA 2HFKA 4YCBA 4YC7A 3VZCA 1OTHA 3QJ5A 1TQ2A 2W70A 3BTOA 4BLOA 1J00A 4P7BA 1AZTA 1C8KA 3VYSB 3RNOA 4BB0A 1OHHD 5LQNA 1NJ8A 4OH7A 4B83A 2EFHB 1RE0A 2WYVA 3DO8A 2B8WA 2I6UA 2C5FA 4CM4B 4J0FA 1JFTA 2WHPA 2Q29A 1NJSA 2GPBA 3DFUA 2JIQA 3L7YA 2V7WA 4G56A 3B9PA 5IBCA 5KWEA 3OM8A 2CDAA 2J3LA 1V41E 4Q4AB 1K4MA 1NPTO 3CINA 3STXA 3ZDEA 4J1TA 3KSUA 1KZGB 3WK7A 3PIRA 1YOVA 3HU3A 1N77A 2A9RA 3KVRA 3I5XA 4C4PA 2YC2C 4L3VA 3DFZA 2WILA 4ME6A 4B7CA 5B1YA 1FYEA 5HILA 5J2UF 4M6WB 5J4VA 4IR7A 4AJLA 3R3HA 2P2CA 5LFAA 2DUJA 3L1UA 3OA0A 4GLJA 1GA4A 1UUFA 2NO4A 3RJTA 2NXJA 1JMVA 3PC6A 4BN0A 3PEYA 2O8CA 2WM3A 4FYPA 4TVSA 1RM5A 2DH5A 5C7LO 2J9ZB 2JFQA 4NJEB 4JVMA 3HGMA 3U17A 1SC6A 4S04A 2XKAA 4A27A 2HPHA 1Z2NX 2HZ7A 3LECA 4OP2A 5I8ZA 5J58A 3O0DA 4FNMA 4ZK2A 4LX0A 2OKCA 2X22A 1RHUA 5DTIA 5DHRA 3PUXA 3EGXA 3OH8A 5TQ0A 4K0RA 1GQOA 1LBIA 2FSPA 3AHCA 1U2ZA 3DC7A 1SRRA 3SQWA 3ZNNA 3U6KA 5F2NA 2VEDA 2BM1A 4KE7A 3ZDCA 1O7JA 1N2JA 1AS3A 2ZTSA 2D2XA 4WTOA 2WTUA 4TTTS 3LSYA 1XTJA 1Z9BA 1QG6A 3PTZA 4Y0AA 5DWQA 1J2YA 1YULA 4RVOA 3CVOA 3RVRA 2W6NA 3EULA 4EENA 4DV5B 4G9BA 4HB4A 4MB2A 3FOEC 3ND6A 1XNGA 2P9EA 5EJ2A 2FMHA 2P3LA 4GKKB 2AN3A 2R2AA 3WIDA 3BD7A 3ZJ4A 2PSEA 2JLAA 5GIOE 3AY0A 1FX0A 5DYWA 2CMKA 2JAHA 1HFEL 2ZPTX 4HYTA 1MEJA 5FI5A 3D3NA 1SCQA 4L4UA 3M6UA 3L2OB 5DTMA 3SLKA 2AGVA 4PYQA 1K4YA 221PA 4RTOA 5CIQA 3L02A 4JJFA 2HHHB 1TZKA 1P3Y1 4DC9A 1IB0A 1ZC3A 3OOJA 2C59A 2CXXA 1JIXA 1U80A 4IPTA 3S81A 2C5HA 3MJCA 4H6WA 4MUJA 2DT8A 1ADYA 1FRZA 1WMSA 4E30A 4BKOA 1WUKS 1OBVA 2CVPA 4BHTA 4RTMA 1ISIA 2ONYA 2YMQA 1XI2A 1NATA 3QE3A 3LWNA 4R1UA 1RYFA 1YU9A 4F4DA 4L72A 4COKA 1VP9A 4B3CA 4YV0A 1I3NA 1RAFA 2GAJA 2Z5VA 1B3RA 8AT1A 2BGTA 3D6HA 1WM1A 2RAUA 3IR5A 2Z2JA 1TIKA 3PYLA 5FKJA 4N1AA 5IDWA 3DBHB 4IRMA 4LGYA 1GVNB 3THRA 4F2HA 2WWRA 2AFHA 3LQYA 1GA6A 2AV6A 4JWTA 3VOSA 4BVKA 4G1VA 3SIRA 1X1AA 4Z8YA 5FFMA 2FWMX 1JWLA 4COOA 1KAOA 1ZH0A 4QL3A 2ATCA 3B6IA 4Y6OA 3BHNA 3ROEA 4D56A 4OHMA 3NETA 4HLNA 4YRTA 5HR5A 2FN4A 1IEWA 1N9ZA 3Q9SA 4EFDA 2WV7A 3QU2A 2E0IA 1P4RA 3BYZA 4KO4S 5JCZA 2OGZA 3WGKA 1K7EB 2V45A 4UVGA 5CEEA 2E4ZA 5JZBA 2C3MA 2O0KA 2KYRA 5B36A 1RCFA 2YHAA 5BUCA 2VNAA 5L4NA 2IW1A 1X1EA 1UFVA 2ZDGA 4DPMA 4MUHA 4JLJA 3W34A 4EJFA 1CUFA 4TMYA 4MRAA 2O8BA 2A9PA 1TKRA 1UOOA 5B64A 2DBYA 4KDCA 2WTMA 4K81B 3NH9A 4U9IS 3GZNA 2FX5A 1GNSA 1YFZA 2ZIFA 1XYGA 2XUHA 3BMOA 4F11A 3RAGA 3VDMA 5NLLA 1N4DA 2WYHA 5H02A 4Q7EA 5JHGB 5GONF 3HBLA 3QOXA 4WAUA 4QDUA 3PFCA 1YBMA 4D97A 3I39X 5I7UA 1CRQA 4WFKA 3NEAA 5H9VA 2VSFA 2RSLA 2SCUB 4MRRA 1GRVA 3VXKA 3O8OA 1XQ6A 3GARA 5TT1A 4AT1A 4C4AA 4RACA 2X4IA 1FMCA 4JX9A 3ANNA 1Q0SA 3REGA 1OYWA 2ZAOA 4K6KA 2FK8A 4AN4A 4CQMA 4DMUB 1HA3A 2G9QA 4EAAA 1IUNA 4TV9F 3ECCA 1IAVA 1ST2A 3GJYA 1V0JA 3S5JA 3IP1A 1TNDA 1U7WA 1XMPA 3TLCA 5TGDA 2YIDA 3O03A 1IZ0A 4RLQA 4QDJA 4YJ3B 1FP4B 4YRDA 4CM4A 3UBTA 1H8HA 1G21E 3GVPA 4N0DA 4TPKA 5TS2A 3SSAA 4Q1BA 5CU7A 3SJBA 4G67A 3SR3A 3B7WA 3LIIA 4CT0A 1AUXA 1J7JA 1DPGA 1H4TA 3LUHA 3EMDA 4DG9A 5IXJA 4AY5A 2OPBA 4MSUA 5FLYA 4GKBA 1JKJA 1XMSA 4MUEA 4PSDA 4QWWA 4UBOA 3EG9B 1PTKA 1E9BA 3LT2A 3WGOA 4AD8A 1G8AA 4B71A 4RHEA 1U8CB 4TLAA 1ZG3A 4AULA 3VO1A 5I6DA 3D8SA 3ML1A 5KTYA 3ZXYA 2WWXA 3A9CA 2V5AA 4PS0A 5BN4B 3LK6A 2XUPA 3IPRA 4FFWA 3W5SA 2IYFA 5IBQA 5ALTA 2IV2X 1K06A 2O9JA 2Z3ZA 4QVGA 3SQNA 5DISB 3UMYA 4J07A 4MMXB 2O7SA 1TM3E 2FR8A 4B85A 1H69A 2QTFA 2ZAIA 1FPQA 3HWRA 3CONA 3H5RA 4H2DA 5CT9A 5D3MB 3WYCA 1P4AA 1O9BA 3ZQ4A 3IVXA 1QHYA 2Z6VA 2H1IA 3OT1A 1EFVB 3N74A 3L0IB 1GTJ1 5F35A 3NNDA 1C8BA 4M8SA 5A03A 1TTQB 4BTEA 5CNMA 3F5DA 3OQIB 3DDHA 3GOQA 2PFSA 3ZH2A 4W82A 5JNSA 2ZJAA 4LSZA 4JIGA 5GPBA 5AJVB 3ED1A 4NMWA 3ZQ6A 1KFJB 3AOEC 3SC3A 5B6IA 3HM2A 2D06A 2FZCA 1OFUA 1V26A 4TV9B 2AXEA 3VDQA 3VKVA 1ZL0A 1E3DA 3FETA 3ZHRA 3AGQA 3JQGB 5DHAA 4OHBA 1GPH1 1ZCAA 3H8VA 3HBFA 4PANA 2Y77A 5HSGA 4HXGA 1R66A 1W4RA 2M1ZA 2ZUVA 4AQYB 1KPGA 2UZ1A 4WY8A 1IOWA 1CQZA 2YRXA 3AHHA 1CRLA 3L6OO 4QFCA 4R9SA 3RUEA 2FEAA 3Q7TA 4MX8A 3T52A 4ZI3A 3G0HA 1G66A 4GM0A 4XVHA 5A2QA 1W46A 4JZKA 1WVGA 1JQKA 4G89A 4QNRA 3N2KA 1PGJA 4EUNA 2PIDA 2UXDB 2XZDA 1U0SY 2HRDA 3OLVA 4UM5A 3RKSA 3ZWBA 2WM2A 4E88A 2H65A 3ENVA 3MNFA 4L8YA 4QLAA 2XCSB 1WA5A 4U3JB 3HVKA 1L1FA 4DUZB 4WSOA 3ZHSA 1XRSB 4KN9S 3EPRA 1CY4A 4Q4HB 4CIWA 4IIYA 5JUWA 2OHHA 1KHHA 4WCFA 3NCTA 1D9ZA 3DO5A 3B89A 3OPQA 3BS4A 5B3LA 1G38A 1XT6A 3DCJA 1GARA 1NMQA 2CJPA 3G2IA 3DTYA 4M7RA 4X90A 4GNRA 1LCIA 5TMBA 5MGNA 4TTVA 3IA7A 2XPCA 1ZC4A 2QRNA 2B6HA 1J5EB 3H19A 3HXLA 3W2EA 3W6OA 4RL6A 1BE8A 3A9TA 2GK3A 2IX3A 3VSDA 3L07A 2PZ8A 1M8JA 2R65A 3QMVA 3RT1A 3TXXA 4C43A 1Y0BA 3V8NA 5HF6A 2O05A 2Q6LA 4RNCA 1QNLA 2RB4A 5BRNA 1LSSA 1K97A 2P5YA 4KO2S 4KRYA 4DCMA 1VSBA 1SZCA 1T43A 1XA3A 1XZIA 3HR4A 4M9ZA 2WM8A 1M1YA 3VHXA 2PCJA 2RDMA 4BFYA 5IDYA 3CNEA 2EKPA 1O57A 1Q1EA 2ALJA 2D0PB 5A9SA 4YBRA 1F8UA 1H4VB 1GPYA 4JY7A 5DLQC 4JQZA 1FBNA 4QOEA 1I7NA 4HLUA 4Z2AA 2RD2A 3PI7A 3ABIA 3EZ6A 3JRXA 4J91A 3VR6H 4FEGA 1UT8A 5K3FA 1LJ8A 1HRDA 4I6JA 2F8TA 4O2BA 1QRAA 3CNBA 3OKAA 2FEXA 3R5XA 2G3YA 2ONCA 2GXSA 1CETA 3AT1A 4XJSA 1VE3A 4GE3A 2J0SA 1C2YA 1NC1A 1KO4A 3S2GA 2WE7A 3QLEA 3OTQA 4M36A 2CSXA 4HGYA 2V5VA 2JAWA 1Z63A 2H11A 1QGYA 4M49A 3H8JA 3ORSA 1RPAA 4N0EA 2UZIR 4QU5A 2VWHA 4J4BA 5D3KA 5I3CA 4KFTA 3C8DA 4F71A 4XSHA 1IATA 1GPUA 1RXUA 1O6CA 2MIIA 4QASA 1DKQA 3KRTA 4JXJA 3JQFC 2JLQA 1JAXA 1KZ7B 1SQGA 1YDMA 5TF0A 3WVNA 5KYKA 3I9OA 1U5CA 2PR2A 4RE6A 3B1WA 3QM1A 2QYOA 1SXJC 5TQ2A 3VPCA 3Q0IA 1QX4A 3D7MA 3N7TA 1ML4A 2Z9BA 1N78A 1Y9DA 4O0LA 3BFPA 3KZMA 4KODA 4NENA 4F7WA 1HG1A 5FO1A 5E1MA 1KZHA 1HG0A 3EAGA 1PZGA 1JDNA 3QXHA 4BTLA 4DCVA 3JYNA 3G2KA 4B7XA 4BJ3A 2C5LA 3TAUA 5L3VA 4XYEA 1K3FA 5AOBA 1GCAA 2H06A 2J0QA 1CRWG 3HKDB 4TSKA 2HSDA 3N6XA 2YVAA 2ZANA 5E6SB 3NG1A 1W96A 1DQSA 4ZJYA 2QUKA 1RWNA 1VJDA 2VHEA 3G5AA 1H0HA 3LHDA 4G0PA 1AKTA 5EZ6B 1JW9B 4DTCA 2OG1A 3LC1O 5BSWA 5LWHA 1BEUB 5E8RA 2Q3MA 4DADA 2CNOA 4DSUA 5EIWA 1EZ1A 2QDKA 1H05A 1TO6A 3TQSA 4YONB 3B6ZA 3H11A 4DRXB 2J9YB 2RGRA 1DT3A 2HU5A 4TLBA 2GN6A 1T0UA 2LCIA 1ACLA 1EM8B 1JDZA 1VMAA 1R88A 3OQ1A 4G0OA 4GI7A 4Y8VA 1LD3A 1ZITA 1J2RA 4NJMA 1KZYC 3FGZA 1P7VA 4XUEA 1JHDA 1AURA 1DAPA 1MJNA 2I7TA 4EJSC 3OX1A 4ZU1X 3SDZA 1JXOA 1BHSA 5I47A 5EEGA 1YB7A 2PH1A 1MG0A 3SS7X 1DBQA 1E0JA 1RJ9A 4ZOLA 4DG5A 3HFJA 4TM8A 3VDXA 1JT9A 1W93A 3DKVA 3EEBA 4AJ2A 2REXB 1P1HA 4F84A 1TLTA 4XYBA 2W37A 3QEMB 2JFZA 4RPHA 2EZ8A 4IXNA 1CEXA 5BXQC 3QBTA 4FX5A 4PPGA 2NG1A 4WZBE 1CEEA 3KWFA 3KR2A 2NM0A 4LCEA 1KDYA 4AY6A 4ROTA 3WYEA 4DMGA 2X14A 3GRKA 1NJ2A 4Z86A 2OV3A 2XADA 3TL6A 1LRLA 4A0FA 1Z3IX 4AWXA 3GDFA 3JWHA 4OK5A 4TM7A 4LDJA 4XRGA 1AQUA 5BQXA 5ALFA 2CXOA 5I4CA 5JAQA 1V37A 1NW7A 1LNSA 4WKCA 2P90A 4WNYA 3UN1A 3V2GA 3IMFA 2ZIVB 4EYGA 2BBOA 2WWYA 2C3UA 5C1IA 5FRDA 1O95D 4XH9B 5LKRA 3SYMA 4Y2SA 4MKRA 3A1NA 3CY6A 1U0GA 1Q1BA 1UKVY 3L7JA 4FT2A 4G8DA 2JHCA 1Z17A 1YZVA 3LUJA 1KDOA 1RWKA 4M9CA 4QGHA 4YI3A 2I4RA 1TU3A 4CMCA 3PCXA 4MWTA 5JIBA 1T8TA 4DIUA 4WXRA 3V4RA 3K9BA 1TAUA 2ON6A 2R96A 2ORYA 1DV2A 2Q7OE 2BM9A 4MR7B 4FR0A 3ZUPA 3IUJA 4HP8A 5DNWA 1OWLA 4CLRA 1FW6A 1N3YA 4UHJA 3DDCA 3OY2A 5F4ZA 1W9HA 3S29A 1XCJA 1X0VA 3WL5A 2ERCA 2DJ5A 2ZE6A 3WLTA 4V0NA 3TJMA 2HPVA 4P98A 1ECCA 2HA3A 2XAAA 4Q6WA 4MVCA 2BV3A 4JT2A 2NTVA 1GV0A 2GKOA 2PVPA 3LCMA 3HKBB 4FE7A 5CX4A 4EY5A 4K6MA 5KSZA 4C2TA 3DGEC 1APBA 3DE4X 4W63A 1GDHA 4LQCA 1II8B 3UWSA 1QHXA 3FKJA 1ZW6A 1WZUA 2R97A 1A7JA 1U0BB 3AKEA 2LR0A 1JYEA 3NBUA 1KRWA 3MPOA 1BZYA 1RZUA 2NWQA 2Z2YA 1UK9A 4QAJA 3UB3A 1DCTA 1R15A 3TDMA 1QHHA 2QG4A 2XNDD 4XGNA 4BLTA 3W5DA 3L06A 4MHSA 1MQSA 1UMDA 1MQ9A 2DUNA 2I71A 4KWHA 4EW3A 3IBCA 4Q39A 2FF7A 2G0NA 3QTBA 1K8XB 1Y34E 2CK3D 1KEEB 2RGUA 4DRZA 3II6X 1W6UA 4P9NA 4O4IB 3LXMA 3FGOA 2PS3A 4ZQBA 4B2IA 1OYYA 9LDBA 3HVUA 2AZXA 4CRWB 2BAGA 2OORC 4I9FA 3VC7A 1A8HA 1CR6A 1P72A 2G8NA 2VJMA 2ZRHA 1OLXA 2W22A 3HFSA 3LCRA 2K5UA 3PQDA 4LGVA 2EL9A 5HM6A 5KINB 5KNCA 1ZSVA 4RHTA 1RRCA 1A76A 1IZYA 1BVRA 1KI6A 2HWXA 2X7JA 4ETWA 5DM2A 5LZ8A 2C8VA 1R6XA 3JWPA 3IUNA 4I8XA 4RPKA 1P17A 2GD6A 4DG8A 1GEEA 3FTDA 4OJKA 5KNCH 3SSNA 1T29A 1G0NA 1WP4A 2WT8A 3B1KA 3FTCA 1FNDA 1QDLB 4IDFA 1YQGA 4IHJB 4LY3A 3UK2A 4EF5A 1E1RD 3P9RA 1KAEA 5KDLA 2FSHA 2H1HA 1K5GA 4XYGA 4RA9A 5KYWB 1WOYA 3M6VA 4WHMA 4MVJE 5GADl 4FKZA 2WTAA 3SYRA 1OI2A 4M76B 3BFVA 3R3WA 3JQ7A 1NBME 2XUOA 4GOJA 3NWPA 3CSDA 4Z4EA 4URHA 3MHPA 4D5GA 2XWQA 2KQUA 3QA3E 1L4HA 3BA6A 5BUQA 4C14A 3P9NA 5JAPA 2G63A 3DOUA 3LLVA 3CJQA 1I0IA 3R0XA 3GW8A 2OT3B 1CYEA 1XRNA 2JK1A 1YT5A 4KUEA 5DTEA 5J47A 2UV8A 1S7GA 4RVGA 4P3YA 3V1LA 1T2AA 1ZVVA 4GEKA 4HRAA 1EGMB 4KO1S 4N0PA 1T15A 2VRNA 3K8OE 3KXDA 3STHA 4RUKA 4N5HX 4RM3A 1KE2A 2I29A 2OSBA 1OFTA 1G9SA 1ICEA 3C3DA 3ODGA 3LS2A 1O87A 5LOVA 1Y4AE 1EJ2A 3DMNA 2P77A 2PT5A 3K8QA 4MCJA 4U0JA 4I1IA 2PO5A 1KE1A 4D3ZA 4HNVA 5T4BA 1RJFA 1FS4A 1YZYA 4AL4A 4BMPB 1V6CA 5DDIP 4ZYTA 3V7WA 3ND5A 2OLJA 4D0RA 1KFKB 1RZVA 1Z62A 4WWHA 3CUTA 1UWKA 4MR9A 5ED0A 4C89A 5CIYA 1A3CA 2AC7A 3IHWA 4WK4B 5CM8B 5JDCC 2WFLA 1Q83A 3QF4A 4CEHA 3DBRA 5C5DA 2A86A 2G04A 3GNTA 1I7LA 3DMFA 3IHLA 2CVZA 3EXG2 1BHQ1 1LI4A 3B78A 4XVCA 4D4IA 4G09A 3HI4A 1Y7PA 4NATA 1OT3A 2YVQA 5AVXA 3L93A 4OF4A 5TB5A 2IBMA 4U2DA 3ZU2A 4WNCA 4JKOA 5BQFA 1ZUHA 1IVSA 1IBMB 4YCSA 3LTNC 1AU9A 4ALMA 4ZYVA 3FPFA 3GNLA 5JVDB 4MQBA 3YASA 1UKEA 1E2KA 4S0XA 3BZWA 3D1LA 4Q0MA 4YHBA 4OY3A 2V03A 4NCNA 3TRDA 1TW3A 4Q9DA 3EDCA 1CX9B 3LY9A 2PEYA 2W71A 4KKXB 1C9JA 5F77A 4JI2B 4GC9A 4HDRB 1QXSA 1Q12A 1SKUA 4BMYA 3PNKA 1K0UA 3ZX4A 2HR1A 4DA8A 4OHXA 1DC3A 3UB4A 4NEHB 3IKTA 1FNCA 1GP2A 2J3EA 3IPCA 4H7EA 1R8SA 3HJCA 2W2QA 4O2AA 2VR1A 4X7RA 2WJ3A 1IUKA 3M0EA 4MJ7A 3CLRD 2HWWA 2XEDA 4MW2A 2I2FA 3HFRA 5JFGA 3ZVKA 4RJIA 5GQSA 3JAKB 2J9RA 3T5MA 3TLGA 1RIIA 2VDQB 1B73A 2VHZA 1U94A 4AY4A 3F96A 5ECWA 1L7MA 1VHJA 4A23A 1BGVA 4HO1X 3WE7A 2J09A 3M9WA 5TS3A 2OXIA 2XQVA 2XMPA 3MJVA 4IZ6A 4UUBA 5FUQA 2C2BA 2R7NA 4GWKA 1I7QB 2V4UA 4Q4JB 1M8PA 1WNFA 3OOSA 2BMJA 4IDCA 4M55A 1VPEA 3LBNA 4Z3OA 3QVKA 3L40A 1XPRA 4L07A 3FVQA 2R6R1 4LYJA 1MFZA 1IN5A 2V3WA 4RGYA 1S8NA 1X7XA 3OLQA 3NUQA 3WIUA 2ODEA 2QL5A 1P5JA 1OX4A 1X38A 1XTUA 1B43A 2X0KA 1TOAA 4I3FA 5EXDA 4L9AA 2IU3A 1D9XA 1DP4A 2JD2A 2OHJA 2RGDA 2RIRA 5J5VA 1OXMA 3T9FA 1Z7WA 1RQGA 2HA4A 3F4BA 2C95A 3JD2A 4PSKA 4JVNA 4HR7A 1HE8B 4A5SA 4BXOB 2BR4A 4WNAA 2GXAA 2EJTA 2WRZA 4Q21A 4ZVOA 1OKKD 4FS8A 3HB9A 4Q4DA 1ZRHA 2QZ4A 4EPWA 2JAPA 2DYKA 1JBEA 3QWAA 3UH1A 3DVAA 1Q1QA 1S1CA 2G5CA 2GERA 3AM5A 4I36A 3VNVA 1EGVB 1ZWLA 4KWCA 5CFZA 1Q19A 2GM9A 2VLBA 4WI1A 4X71A 2W4QA 3ZEIA 1DTEA 1PD1A 1VLJA 1R0XA 3JQDA 4ZD6A 1MXHA 5KWIA 4OQPA 1C7IA 1V6AA 1GG9A 1ZZEA 3K9NA 3UANA 1P0CA 2ZI4A 5GM1A 1R5BA 1Y5RA 4A8PA 1L2TA 1L4MA 2WWFA 3TW6A 2ZRQA 3FJOA 3BC1A 1GCOA 2PM8A 3RFXA 1H6BA 2WHYA 1DDOA 3ID6C 3W8FA 1Z08A 3OT4A 1XD2A 4F8YA 1QRSA 1HY3A 3IEMA 1X1SA 3QITA 4QYMA 4FB5A 3CNQS 3D9QX 3QKRA 4UULA 4EJSB 1JBQA 3GCZA 4LVUA 3GQBA 2A4MA 3AKDA 3LWDA 3QW2A 3H5IA 1OLUB 2OLEA 2F1IA 4RZ2A 1IPHA 3DZJA 3GBPA 5DASA 1G8SA 4YAFA 3W7AA 4CFYA 2A0YA 1PK7A 1BMTA 1H65A 1U5BB 1UAGA 2QM8A 4FFBB 1XDZA 5H82A 2ODNA 5F5XA 3T4UA 3GP8A 2XQKA 1U2DC 3M4YA 4DILA 1P1RA 1Q5PA 4TMVA 3H8SA 1KY3A 1ZIXA 5DO9A 1RW4A 3ZHOA 3ZS8A 3VMFA 2GK7A 2XGMA 1RVV1 3FFBA 2V55B 1I2BA 4QEDA 5FULA 3LP8A 3UV7A 1NI3A 4P7FA 5CP8A 2Q1SA 3SEAA 4BC1A 5A7FA 5IU6A 3HZOA 4HNGA 1YVPA 5IT0A 2QLFA 2QTNA 3QYAA 1OTYA 5EZYA 3AESB 3VVBA 1N6IA 4MKGA 3IE0A 4EGCB 4L22A 2PQ6A 4Q9IA 4C6TA 4JUFA 3L01A 4B6SA 1JECA 3HDTA 2P4EA 2I54A 5IUJC 1NLMA 3WLAA 3IVAA 4RKQA 2ATXA 4W8HA 3WLIA 5E1OA 2HGZA 1RLJA 1A0OA 1GGMA 2Q4BA 3EVEA 2BKAA 2JHGA 3EZNA 4IDOA 4MV0A 1I1QB 2XE6A 2H18A 4ZO8A 2V3VA 2V7TA 2Y3IA 3ICPA 4ESEA 4EJ2A 5ALYA 5K2OA 1JH9A 4DC1A 4EA8A 2MYUA 2D7CA 3CEJA 3N3AC 5I9IA 4X1KA 3Q7RA 4LMRA 1RXCA 4MV9A 4RADA 2B78A 1SZPA 2NU9A 2PO7A 2RGBA 4RTLA 2X1MA 5EJ9A 5H0IA 2ECFA 3LPMA 3GUYA 4J7AA 5JD4A 4QQFA 3RVPA 4M83A 2OCXA 3U5ZB 5KC8A 3W9YA 3AWIA 7ADHA 2FUCA 2KWIA 1GTZA 1UDAA 1YIAA 3R75A 4HGRA 5IPFA 2ZWMA 3GEBA 4IGAA 1WF6A 1QCYA 1X0XA 1BE1A 3GRYA 3WLLA 3WWOA 4YT2A 3SK0A 2PMFA 5FR1A 2B1JA 1Y4UA 4L8WB 4PYMA 4QNNA 1E9DA 4Y2QA 3T4PA 1RRMA 4YCCA 4YUXA 2PUEA 2RHHA 4ZV9A 4DKJA 5IDVA 2VVTA 2AW5A 2C77A 3EMVA 3FOWA 5IUNC 3HO6A 2AG6A 3EGWA 2JZCA 1R4MA 3I8OA 1UPAA 3HYCA 2NN3C 4QQNA 4KVFA 3LKZA 5CNJA 1OGIA 1EUDA 3CLSC 3RRNA 2OLKA 3LK7A 4D3FA 1GQYA 4C0QC 4LZPA 8GPBA 4RELA 4ALKA 1XWIA 1K7XB 2GI4A 2NV0A 4C04A 3PC3A 3GR6A 2ADOA 2JNWA 2JAQA 3OOHA 5JBNA 2A4KA 3LHKA 1JEJA 4DCCA 1B23P 4X5OA 1GNTA 2AQ8A 2YXNA 5C4MA 4JLWA 1BIFA 1E0KA 1JQAA 4RTNA 4I55B 2X58A 4NLLA 1A5TA 1KAGA 1YBVA 3RRBA 3T7CA 1GZVA 4NYJR 3ZU5A 5LMCA 4MUBA 5HZHA 1DRJA 2ZBUA 4OOEA 2P91A 3AVQA 4WY2A 3U48A 4Z4CA 4PYIA 1UC9A 2A0KA 1IZ7A 1E96A 1W75A 1E3LA 1H2FA 3C6BA 4U8GA 3ESDA 2AJCA 4WOPA 1BG6A 4XDGA 4L0CA 1BS2A 4ZAWA 4X3CA 4CFZA 4B80A 1XF1A 4WK6A 3KDAA 3VTKA 3LV8A 4BQPA 5CEJA 3MD9A 4L8GA 2VDUE 2H7CA 3ZIUA 1Z6XA 3OX4A 3H86A 2C9CA 1FYXA 2ACKA 4UZSA 3ZYCA 4QOFA 3A2MA 1NBOA 1HNNA 2RGGA 1RC8A 5FTMA 3FF4A 2B1RA 2HU2A 5KX5F 1BQEA 4B0OA 2G77B 3LA8A 2AMFA 5B6JA 3L8DA 4CF7A 1I01A 2X1HA 5JWRA 1IBLB 2WWHA 3PVZA 3FHTA 4UQPA 3PVSA 2QRGA 4DV4B 4BZWA 1IYZA 4QU9A 2KBEA 1AKNA 1I3CA 1Z0AA 2HC9A 2OVFA 4P34A 4UARA 2C3OA 1Z6QA 3I9MA 4M9QA 1IWBB 1PNQA 1OPXA 3COSA 3U81A 4BNZA 4IDPA 4Z99A 4RXMA 2XITA 1WZEA 3CO0S 3ZE2B 2H7XA 1MRZA 4GF5A 5I7RA 4B47A 3Q5EA 2BDUA 3ZK9A 3FCYA 4HN4B 4BLSA 1U3VA 2VF5X 1SU8A 3DMHA 2XVYA 1QV9A 4GPBA 3LOUA 5DV9A 3F47A 1L4BA 4RPCA 4DR7B 5BPFA 1EEHA 2JJYA 1IZ8A 3K4PA 2C8LA 1R4MB 3FDZB 3Q0TA 4R05A 3QKSA 1QTIA 1H3EA 3CEMA 1DE0A 1BKSB 4KQ2A 5TGZA 3OM0A 4REMA 3RU9A 3EGXB 1YDHA 5H9WA 1RAIA 5K8VA 2O8EA 4PHCA 3IDSA 1NDQA 2DRIA 4DLPA 1PQ4A 3KXIA 4K40A 3KYCB 5T3UA 3U4QB 3RVNA 1CV2A 3F90A 1RRGA 5CD9A 2NAFA 2WT4A 2YHUA 1OILA 3PEVA 3PL5A 1SBHA 4LOHA 4A92A 4C6RA 4Z4GA 4BNKA 4R3WA 3OPYI 4B73A 1I30A 3EC7A 1Y6GA 2HA5A 4E5KA 2HK6A 3FCUB 1XB2A 3TXAA 3ZVMA 2V1UA 3ODPA 3OPXA 3DMYA 1Q95A 1TT7A 2IHUA 1YU6A 2WNSA 3HXMA 1OC2A 1QHSA 2O07A 2OORA 4K9KA 5H70A 1I2ZA 2LTAA 4AZWA 4RY2A 1ABEA 5I8PA 3C6XA 3WIEA 4BVJA 1JR2A 4KUHA 3H1BA 4C6HA 3Q1LA 2I6QA 5IEJA 1AUPA 4G1UC 1JFLA 1HL3A 3DT8A 4N03A 4Q1VA 3ZBQA 3G7SA 5DNEA 2EDCA 5DCWA 3IL2A 3D8TA 1QHHB 4HDCA 1X2BA 2PZKA 3IA2A 4JI8B 4KKVA 1VBNA 2P67A 2WD9A 4DCJA 4A10A 2CHVA 2A35A 2WAOA 1SVOA 1L4FA 3HRHA 3EZ9A 4XEHA 4Y2JA 1IG3A 2P27A 1UCFA 3QNUA 4C07A 1GPBA 1OZAA 2F43A 1VJRA 1XCBA 2XH8A 1CIJA 3Q6MA 5EE0A 3N8HA 4QUGA 3CEPB 1UIRA 4KE9A 4D74A 4DGQA 1XQ1A 3ILXA 3AIIA 3CF4G 5CHEA 1ZNQO 5KMGA 3CKYA 3AG5A 2BZ0A 1SXJE 4FDLA 1H2HA 2PU5A 4Y2UA 3IELA 1MX3A 4RS3A 1VFPA 3MYYA 4ZO9A 1Z28A 1CDDA 3I1JA 3IP6A 1RWWA 1ZIDA 3DOOA 3VSBA 3MAGA 3ZVRA 3AM1A 3K73O 1M0WA 5EXEA 2J85A 3F5SA 1I2DA 2B7LA 5DM60 1KERA 2C2YA 3A27A 3ZDFA 2V1XA 3WSVA 3DZIA 5DEIA 2R11A 5JH7F 3HN6A 4MRSA 1OAOA 3A4LA 4TN5A 2O3QA 2WUEA 5EKXA 2V7QD 4MV5A 3TJRA 4U7PB 2V4MA 2HIHA 3QVGB 1SURA 1NW4A 2I6SA 2JFUA 2VUIB 2WC1A 3QVXA 3Q3JB 5EKUA 5AWFC 3RSOA 1X8KA 4CM6A 4EB6B 5M29A 4XIIA 1HE2A 1HQKA 2AMLA 1QF7A 3IT3A 5JBIA 1KDPA 1E77A 4ZVVA 4DRXA 4RX1A 3F98A 1E9VA 3QX7A 4TUYA 1SB9A 1ZH6A 3NT4A 1P2SA 1UC5B 2YQ4A 4U7JA 5FR2A 4EVRA 1NTOA 5I51A 1FUKA 4F4UA 1JVNA 4C5AA 4TS1A 3DWFA 1U1CA 4YRRA 3TINA 2BGMA 3G2OA 4D1YA 3QSYA 2H29A 4R6XA 1BWSA 3K0KA 3V48A 1GFSA 4GL2A 4QFBA 4RZXA 1DQYA 3G1UA 2HZBA 5CK4A 1RRVA 2VHCA 3G0IA 1AQYA 1CZOA 1R10A 2CVOA 3C4JA 3TSAA 1MO6A 5KTOA 1IOVA 2D2IA 2WF9A 1O95A 5DGCA 1KI2A 4EQ6B 3IBYA 1UK8A 3UMBA 3RS0A 1T5BA 4TWZA 3NM5A 1PR1A 2HF9A 5HE8A 2D2VA 2PKRA 4KMSA 1SR8A 1TJPB 1R0LA 1J6UA 4R1SA 4XWKA 1T9DA 1WQ3A 3CEHA 3DXXA 1C4XA 4UHCA 2ZBPA 3ORRA 5JJLA 1O58A 1KRXA 3MGCA 2V6FA 3RPEA 1AUQA 4NG4A 3GNSA 5EPUA 4DR5B 2QSZA 1SQSA 1BXRB 3D3JA 3FVTA 3R5HA 1RXSA 4P4NA 4KQXA 3I1FA 1WCV1 3KEQA 1FMJA 2OHVA 1GTSA 3KVNA 4EG8A 3QLVC 3LQQA 1H5UA 3VR0A 4AU1A 2WIBA 1DAMA 2NSYA 3EUFA