5K3AA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/fluoroacetate - cocrystallized - both protomers reacted with ligand
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
295
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGNFLPEEAPDQTAEALVRFFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
total genus 113
structure length 295
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3aA00
4WFIA 4Y2PA 4G5XA 1UKBA 4ZV7A 4JEIA 4CIBA 4HVTA 1NU6A 2GBCA 3H19A 5AK5A 2C0PA 3STUA 5JATA 5F4ZA 2PSEA 3JYHA 2XQFA 3MGAA 4YK7A 4U2DA 1ZI9A 4E14A 1J2EA 3O9MA 3C87A 2PKYX 3F96A 2PSFA 3V9AA 4CG1A 3WQHA 4JYMA 4DMFA 5JADA 4N8DA 3NOXA 4KE6A 2GZRA 3M81A 2CBGA 4E11A 1EB9A 2XMRA 3AIMA 5CW2A 1HQDA 4BCBA 1A8SA 1W76A 2XMBA 4B81A 2J4FA 4AO8A 1E89A 2B4KA 3DS8A 1ZIXA 5LZ5A 1I6WA 2G5PA 1BRTA 3IVMA 4OYLA 4J0GA 3PUIA 5DYWA 1GKLA 1FFAA 1O6GA 2GBIA 1CRLA 5FUMA 3FVRA 4BATA 3RARA 4PW0A 5AM2A 3RK4A 2OQIA 4E46A 1IZ8A 4BE9A 4LXHA 3VVMA 4DIUA 3G0CA 3BIXA 2XUPA 5C8VA 3PDCA 5DLPA 2C5FA 3FCXA 1W1IA 2YASA 3F98A 3GZJA 2VT7A 2XQIA 2WG0A 3PFBA 4Y7DA 4FMPA 3BDIA 4CIAA 4QWWA 3PI6A 2WLSA 4BRSA 1LPSA 3FSGA 3ZV7A 1PV1A 5ALSA 3HJUA 1MAHA 3A70A 4UFNA 1WOMA 3H17A 3HABA 1ODTC 2P8SA 5AK3A 1JJBA 2EEPA 4KYVA 5JZSA 4BE4A 3V48A 1EA5A 3WJ1A 2AJLI 4QDTA 1J1IA 1MU0A 5EIEA 4INZA 2QZPA 1E8DA 1B41A 1AGYA 2CZQA 4TVKA 2QXUA 4W1SA 2I3ZA 2XUKA 4BRZA 1YR2A 2LIPA 1DU4A 1X2BA 4QA9A 1CUVA 2ZYHA 1DINA 4QLAA 2ZJFA 3STYA 3DKRA 4X71A 1EHYA 3ANTA 3QYJA 4ZV9A 1BCRA 1K63A 4GECA 5JZBA 1XRRA 4GBGA 4MYSA 4B80A 4Y2UA 4GXNA 3DDUA 1X70A 1EVEA 1LPMA 4UBJA 1LNSA 1THTA 5ALVA 3C5VA 4O08A 3WYDA 4IH1A 2HRRA 1LBSA 5AKKA 4F21A 3HACA 5LKRA 2OCGA 2XQKA 5JAUA 1DWOA 5JAPA 2DQYA 1XZJA 1JMYA 5EI5A 1TRHA 1QZ3A 4MJ3A 5BWCA 1C7JA 5K5EA 3U1TA 2AJ8A 4CI9A 5JAOA 1GQRA 2WHQA 3FYUA 2B61A 4OPMA 2ACKA 5C8ZA 2WUFA 2XMSA 4FBMA 3F97A 3OG9A 5HKAA 3OC0A 5EGNA 2OQVA 4G4IA 3NUZA 1CUBA 1YB7A 2JF0A 2PUHA 3WL6A 1QOZA 4W1PA 1UWCA 2PU7A 5HF5A 5ALOA 5JAHA 5CT4A 4UHDA 5LZ8A 2HU5A 5LZ4A 4Q3LA 2VF2A 1CUYA 3IUMA 2CB9A 2WHPA 4ZWNA 3BWXA 5EIAA 4EUSA 3ESCA 1CR6A 1R88A 1UOOA 1Y7HA 3W2TA 1WCYA 3CN7A 2VEOA 5AIAA 4A23A 1LPBB 4DNFA 2XLCA 1MNQA 5AOBA 4EY5A 3V1NA 3FYUC 1GZ7A 3CXUA 1ZGCA 3SK0A 3WWEA 3N0TA 1TCCA 3N2ZB 5AK6A 3STWA 1Q83A 4A5SA 3QVMA 4Y2JA 1SCIA 4FNMA 1XQXA 4DNPA 3I6YA 4MXDA 2RGUA 4JH0A 5ALRA 3M3DA 1CUCA 5IVIA 4LXIA 1U4NA 1JMKC 1VXRA 3C6YA 4ZI5A 1CUDA 3WL7A 4RE6A 2E3JA 3GUUA 3FNBA 1R9NA 2FJ0A 4LXGA 4J0HA 3G8YA 1YA4A 2Y6UA 1R50A 1ZI8A 1U8EA 1CUGA 3G9UA 1G66A 5IKXA 3PF8A 3C8HA 4U2GA 4FFWA 2O7RA 1H2YA 4GI1A 3DYVA 1L7AA 4M0FA 1R4ZA 5AI9A 2RAUA 1EX9A 1A8UA 1USWA 4UHCA 4J0DA 3B12A 5CXXA 5ESRA 3H2KA 2WTNA 1CFJA 1WPXA 4V2IA 3HZOA 2PSHA 3V1LA 2H7YA 3C70A 4X7BA 1ORVA 4UPDA 3E1GA 2ZYSA 4BVKA 1EB8A 2B9VA 3H18A 3R3VA 4ETWA 4BP8A 3AZQA 1RWQA 4ROTA 3U0VA 1GPLA 3I1YA 4RGYA 2XMZA 1YCDA 1ZD2P 3GBSA 2ACEA 3LS2A 1DT5A 3CCBA 3RM3A 3TJMA 3ESAA 2XT0A 3L1HA 3QH4A 4D9JA 3DLTA 4EY4A 1UZAA 1THGA 1B6GA 4G8CA 2VJCA 4KE9A 3DD5A 4UHBA 3DOHA 1WB4A 3YASA 1FSSA 1XFDA 3IUNA 5JD4A 2YH2A 3K2IA 4N5HX 1CQZA 1MX5A 4PF1A 2WUGA 4TPKA 2C0QA 3R3UA 2OPHA 2HA0A 5CH3A 1XZAA 3HYSA 1AUOA 2PVSA 5AKHA 5ALTA 5HKBA 1ODCA 1OILA 1VJ5A 3AINA 1JU3A 4U2CA 3BF7A 3I2KA 1AX9A 3Q0TA 1MAAA 5ALWA 2GYUA 2DFPA 2O2IA 1ZGBA 4YX9A 4FWBA 3FLAA 3AZOA 5ALGA 5AICA 1WHSA 5IVKA 2R11A 2VTVA 3G9ZA 4Y2RA 2Z3WA 4EY8A 1KU0A 1WM1A 3KSRA 4BC0A 3D4LA 1A88A 2BAGA 1G5FA 2CMFA 3WK9A 2VSQA 4BAUA 2Y2VA 2WU3A 5K3EA 4X97A 2OXEA 5K3BA 1S8OA 4QDUA 2XI4A 3ED1A 1C4XA 1DWPA 1H2ZA 4KE7A 4X6XA 3FCYA 5I9IA 1VZ2A 2WG2A 5T4FA 2XMCA 1CEXA 1FFCA 3D59A 2G63A 2OGTA 2D5LA 5BWBA 4QEKA 1LPAB 3H1AA 5FKJA 3EF3A 5ALZA 1GQSA 5EHQA 2OCIA 4FLMA 1QIKA 3EQ8A 3DL4A 3H0CA 4H7FA 4N5IX 2WHRA 1QIIA 4JNCA 4L0CA 1W75A 5AOAA 4B84A 2IIVA 3DKKA 5AI4A 4UHHA 3FAKA 1YB6A 4NVRA 3IUJA 4KE8A 2UZ0A 2V97A 3G9TA 2HU7A 4P93A 3I2GA 5AH0A 3R3ZA 1JJFA 1F8UA 3L1IA 1AZWA 2XQJA 1M33A 3FSGD 4G9GA 4AO7A 1DT3A 1BROA 1XKLA 2Y1KA 3E4DA 5FPQA 1XRQA 2BGRA 1BN6A 4YASA 3D2BA 4KRYA 1XLUA 2QOEA 4B82A 1F6WA 1TK3A 4PNZA 2HRQA 4Q3KA 2WG1A 5CT5A 3HEAA 5AI6A 3D5EA 3C8DA 3M83A 4X94A 4BTVA 3JW8A 5FPPA 1HLGA 4C87A 1KU6A 1YAHA 2OLEA 4JUIA 1QLWA 4EZIA 3WI7A 3B3QA 3G02A 3I1IA 2ZYIA 4DYHA 3C6XA 2VT6A 1XRMA 5HQ3B 4F0JA 4UBNA 2WJ6A 3G0DA 4J0KA 3AUKA 4X95A 1XZGA 1DTEA 3F8SA 4MWTA 2QKYA 4M0MA 2VJBA 2CEKA 4KRXA 3H2HA 2WKWA 1EDBA 1QIGA 5DTJA 5IVDA 1JFRA 4S0XA 4J3JA 1CUIA 6YASA 4BP9A 1UK6A 2RONA 5I8PA 1VE6A 3O4HA 4MEAA 2PM8A 2RI6A 2WIGA 4UBKA 2AJCA 5EIHA 4AZ3A 4UBIA 3K9BA 4HXGA 1WHTA 3F9CA 3W06A 3D7RA 1TIBA 5YASA 5JIBA 2Z3ZA 4G8DA 4C6HA 2XE4A 4RE5A 1QONA 4OYYA 2BFNA 4FLFA 4BYMA 4BZWA 1E5TA 4HRYA 5FDFA 3BDVA 1QIMA 1R1DA 4N8EA 2VJDA 1J07A 3I28A 3QITA 1F0PA 3JWEA 5A7HA 5LYYA 1HDEA 4Q3OA 1LZLA 5AM5A 4DSZA 4PV7A 4E15A 1UOQA 4LIPD 3W9BA 2JEYA 1QIFA 3FYUB 2QUBA 1ZD5A 2JGKA 5IVHA 1Y37A 3V1KA 1RYYA 4GDMA 1BN7A 4DGQA 2DHEA 2ZJ6A 1T2NA 2Z8ZA 3HRHA 3KWFA 4PQEA 1G42A 4K5QA 2HA2A 3WK8A 3CN9A 2J3DA 1A7UA 1ZD3A 3WK7A 3VJLA 2JGMA 5FXMA 3BF8A 2C5GA 1QE3A 5D3ZA 3TRDA 1CQWA 4HXEB 4J0JA 4DLNA 3EQ9A 1TQHA 4UBLA 4C4ZA 3KD2A 1TAHA 4X00A 3IDAA 4KAFA 5JASA 1DX4A 1QJ4A 2QM0A 4C88A 2VQ6A 4N8SA 2HFKA 3M82A 3UMJA 1ZI6A 2RHTA 5LZ7A 2EDAA 5CXUA 1N5MA 4FOLA 2WU4A 1OCEA 1XZEA 5A7GA 3H2GA 3BE8A 5T4EA 2X8BA 5JD5A 1XLWA 2VAXA 1IVYA 4XWGA 5DYYA 1W6RA 4M0EA 1MJ5A 5ISMA 2H7CA 3WKAA 5ALDA 1CIJA 2OCLA 3ZLUA 1QFSA 2AJBA 3EIOA 3QPAA 3QMVA 4B9AA 2BUBA 4ITVA 4HAIA 3FWHA 5CMLA 3O4GA 1C7IA 4OU4A 1NU8A 2AXEA 1SFRA 3IIIA 3IUQA 4ZRDA 3T4UA 4Q05A 1UK7A 3LIIA 1LGYA 2HDWA 3MVEA 1CUHA 3ESDA 5SYNA 4DNQA 4XJVA 3LIPA 2V98A 3GA7A 1GGVA 1ODSA 1EVQA 3O4IA 1VA4A 2GBFA 3QM1A 4H7KA 4EY7A 3H2IA 2XUDA 1LPOA 4L9AA 4AMZA 1Y7IA 2WJ4A 5E4JA 2D0DA 4EHBA 2HA3A 4W9RA 1YS1X 3NGMA 3WMRA 1SC9A 2BGNA 1DX6A 2FUKA 2PSDA 1CUUA 4Z49A 3A6ZA 3G7NA 5DWDA 4X90A 3WA7A 3VXKA 3ZPXA 1QIJA 4MWSA 3EQ7A 3WIBA 3AJAA 3OPMA 3IBTA 2HHAA 4MEBA 4CFSA 4F60A 5EHXA 2ZYRA 1YA8A 1IMJA 7YASA 4OD0A 5T4BA 1F0NA 4H18A 4IH4A 3ICWA 5C8XA 2BJHA 5K3AA 3FOBA 2RIPA 4FBLA 1TCAA 3MUNA 5AM1A 1SCKA 3H1BA 1VLQA 1W4LA 5A6VA 4AZ0A 2NW6A 5JYCA 3ILSA 2DHDA 2QMQA 2PL5A 3SC2A 4K2AA 4OU5A 3F67A 2JIDA 2J3QA 5FV4A 3KDAA 3G0GA 3AFIA 3GELA 4HZGA 3VJKA 4PSUA 3V1MA 2B20A 5CTAA 2ZSHA 5E2IA 4PO3X 4NS4A 4FNGA 1ETHA 1XKTA 3ZLVA 3WIOA 2DCMA 2JGFA 2O2HA 2HA6A 4XVCA 3ICVA 5AHXA 3UUFA 5T4HA 1E3QA 1GPKA 3AILA 2V9ZA 3Q8WA 1XZCA 1JT2A 3SWWA 1VA5A 3T52A 2ES4A 1HBJA 4CCYA 1EI9A 1BS9A 3WKEA 1LZKA 4BC1A 2FJPA 2PSJA 5CH8A 1XRPA 4Q34A 5AKGA 5AM4A 5BV7A 3VKFA 1UT6A 3WZLA 4NMWA 1NX9A 5ALKA 1ZOIA 3UUEA 1PJAA 3DJYA 3DOIA 1CLEA 3VVLA 5KWIA 4TGLA 4DMHA 4H7HA 3IA2A 4GW3A 2K2QB 1K4YA 5ALNA 2WFLA 2C7BA 3LCRA 1FJ2A 3QMMA 4I3FA 4H7DA 4B85A 1EK2A 4BVLA 2CJPA 3IB3A 4I4CA 4C4XA 4AN1A 1DQYA 1XQYA 2WIKA 2Y6VA 4HRXA 3STTA 4WY8A 4X3CA 1XZDA 5AKLA 2QTBA 1FFDA 1EINA 5HF6A 1FFEA 3ESBA 1YSCA 4X92A 4CG3A 2HADA 3C43A 4UBOA 4KJXA 1JJIA 3A2NA 4OSEA 2IITA 3MUOA 5CBKA 2ORYA 5AI5A 5AKYA 4NZZA 5ALIA 1QO9A 4FFVA 3ZI7A 5A62A 1EXWA 1CVLA 3BJRA 3QPCA 4HXFB 4BAGA 5I7UA 4QWMA 1XZMA 4QNNA 2GYVA 3A2LA 1QGED 2DR0A 1CV2A 4KAJA 3W05A 5BOVA 4GLBA 5HF9A 3WK4A 1CPYA 4ZXFA 4EA6A 4RPCA 3OM8A 4KACA 2HFJA 3O0DA 3C45A 2HA7A 1L7RA 2OGSA 3AIKA 4C01A 4P08A 2PUJA 1GKKA 1QIHA 5EFZA 3B5EA 4BZZA 5K3FA 4OB8A 1N1MA 1W52X 4Q82A 3C6BA 4OCZA 5DTIA 2QVBA 5HCUA 4H7EA 4P92A 2CKMA 4J0IA 5CT9A 2I03A 5LZ9A 2BUCA 3E0XA 4CG2A 3HSSA 5AIBA 3H2JA 1HKHA 3LLCA 2WIJA 5E4YA 5ALLA 1EH5A 5EHNA 5AM3A 1ACJA 1JKMA 1TCBA 1LPPA 3HLKA 1H22A 1H2WA 3AZPA 1J06A 1XZIA 5ALJA 5FP0A 2XLBA 5J3JA 1U2EA 2OAEA 2XDWA 3I2HA 4C4YA 2O2GA 3WK5A 3DCNA 1UKCA 2XUOA 5SYMA 1XZLA 2WFMA 5ALPA 1P0QA 3PUHA 3D2CA 4J7AA 5KBYA 2JGLA 5HK8A 1QTIA 4B7ZA 3QPDA 1OXMA 2G4LA 4BCDA 3KWJA 3WKDA 2C4HA 4IHAA 1P0MA 3G0BA 1IUOA 3R0VA 4UBMA 5K3CA 4I19A 4AMYA 1Z68A 3FVTA 2I3DA 4H0CA 3TEJA 1QFMA 2JBWA 2XUAA 3S8YA 3D2AA 5ALUA 1LBTA 2ZVDA 2XB6A 3C5WP 2YYSA 1JI3A 4XX1A 4GWLA 3I6MA 5LZ2A 3D3NA 4X6UA 4J0CA 3G0IA 4QDZA 2QT9A 1K5PA 1Q84A 5C81A 4DNOA 1R9MA 4QE3A 4WFJA 1X2EA 4BAZA 4G4GA 2BUAA 1QIEA 4P9NA 1XROA 4H77A 5AKJA 1AURA 1T4MA 4ZREA 4FTWA 2G5TA 4H7IA 4WDRA 5CURA 4B83A 1MT3A 4UHFA 1ZD4A 1WB5A 3PE6A 4Y2VA 5ALFA 5DJ5A 5ALHA 4X85A 2X76A 1SCQA 2XUQA 4WDQA 1UK8A 2GBGA 3I2JA 3GFFA 4W1RA 2HIHA 2CUTA 3BJMA 4AN0A 3DL7A 1MX1A 3O4JA 1QO7A 1L7QA 3GROA 2HL6A 5FLKA 1AMNA 3HC7A 3X3HA 1JU4A 2PU5A 4IH9A 5C7YA 2OG1A 5HQ3A 4U2BA 1KEZA 1U65A 4L3WA 1N5RA 3FLBA 2QJWA 2PBLA 4EY6A 5AP9A 3P2MA 4MQLA 4B6GA 4UUQA 1WB6A 2J4CA 4OB6A 3O9VA 3IURA 4EBBA 3TGLA 4WFKA 4BB0A 4A16A 2HU8A 4Y9SA 4G1FA 5JARA 2WHPB 3DQZA 3CCCA 3L1JA 4G9EA 3STXA 4IQ4A 3PF9A 4DMKA 2ZSIA 4FKBA 1UFOA 2W22A 4BDSA 5AO9A 3VJMA 4J03A 1GT6A 5ALEA 1XRLA 1YS2X 1TKRA 1MTZA 4B9EA 5HZGA 4K6GA 1ZICA 3QBJA 1CUXA 1A8QA 4PSDA 2PX6A 1CUSA 4EB0A 4UFPA 5HF8A 3RKSA 5LP1A 1WPRA 4H35A 2WILA 3R3WA 4W1QA 5AKXA 3WZMA 3WJ2A 5DNUA 5AKEA 2XQGA 3KXPA 4BBZA 3S2ZA 2HA5A 2Y2UA 1CUWA 3PICA 3WL8A 1IUNA 3SX4A 4FHZA 5IH7A 2OCKA 2QUAA 1XQWA 3R3YA 5JANA 4Y2YA 1EK1A 4CCWA 3G9XA 3STVA 1CUFA 2H9YA 5KWJA 5AI0A 4MYDA 3O95A 3WL5A 5D7BA 1UK9A 1CUAA 2VJAA 5HK9A 3QZUA 1XQVA 3W04A 4QDXA 4G4JA 5CH5A 3WK6A 4XIIA 4ARAA 4OB7A 4QDOA 2VA9A 5D3KA 4ARBA 1ACLA 4Y2XA 2JEZA 2VAVA 4RNCA 3H04A 1FFBA 4AQDA 4H7JA 3WWPA 5CT8A 5DNWA 2Q0XA 2XMQA 2Z5GA 4Y2SA 1RP1A 5A71A 1E8NA 4UFOA 2RHWA 1AKNA 3AIOA 5HFAA 1MX9A 5JD6A 5CRIA 2PPLA 2R8BA 3BXPA 4QZVA 3WWOA 4AO6A 1DWQA 1Q0RA 1HPLA 4KEAA 3VDXA 4X6YA 3WKBA 3RLIA 1EDDA 5CT6A 2XUIA 2JGIA 3I6ZA 4HTAA 4KR0A 4HS9A 1VOTA 4F5ZA 4OUKX 2BKLA 1IUPA 2W6CX 4U2FA 4Y2QA 5AOCA 4UHEA 4BVJA 2QS9A 3BIWA 2WQZA 1K6EA 3KOOA 4CCYB 1UKAA 2FX5A 1AC5A 2BCEA 5LLSA 1VE7A 4GHWA 5A7FA 4WY5A 2GYWA 3WA6A 5K3DA 1UXOA 5ALQA 4FLEA 4AXBA 4U2EA 1MO2A 4K6KA 2XMGA 4MQMA 1XRNA 1MNAA 3QMWA 3K6KA 2JGEA 2WIFA 2WM2A 4WJLA 5JALA 3OOSA 2XUFA 1G4HA 5DYTA 1VXOA 2C58A 4IO0A 1MN6A 2WFLB 1XZHA 4C89A 1H23A 1P0IA 3R3XA 1XZBA 1ZJ5A 3PFCA 3DNMA 5AKZA 5FRDA 4Y2TA 2O7VA 2OAGA 2YXPX 5ALMA 2OGZA 5AM0A 5FOQA 4BCCA 5JZ9A 4DMCA 3WLAA 4AB1A 3HI4A 2GZSA 5E4TA 3I2FA 3OTQA 4LYEA 2DQZA 1P0PA 1ZIYA 1O6FA 2JGJA 1HL7A 5H3HA 2VATA 3LP5A 3FYTA 4B0PA 2WSLA 4W63A 2H7XA 1MPXA 1D07A 4JYPA 3WKCA 3HXKA 2Z8XA 4G8BA 4KAAA 4WCVA 1ZJ4A 1DQZA 4AX4A 4DTCA 1UOPA 3EBLA 1CUEA 2DSNA 3FBWA 1H2XA 2ZJ7A 2ROQA 3WYNA 5AK4A 1SOMA 5DNVA 2ECFA 4YPVA 2WIDA 3E3AA 4LYDA 1LPNA 2WTMA 2XUHA 4K6HA 3VISA 2QRUA 1CUZA 1VKHA 3DYIA 1CUJA 3OURA 4X91A 3W9UA 2X5XA 1ORWA 2WJ3A 4Q1VA 5KREA 3FLEA 5K3FB 5D6OA 1XZKA 2XUGA 5AKIA 4DSAA 1IZ7A 3C6ZA 5HFNA 1QIDA 1K8QA 1ISPA 1XZFA 4BTLA 2XMDA 1BCSA 3IULA 1XLVA 3D0KA 3ZWQA 1PFQA 4B0OA 5LIPA 2V96A 4BDTA 4FDMA 2WUDA 3ANSA 1EDEA 4LHEA 4DM7A 1BEZA 5ALXA 2HA4A 2IX9A 5LKAA 2QXTA 1R3DA 1E66A 1VZ3A 4ZGBA 1YASA 1YAJA 2DHCA 3R40A 2WUEA 1QTRA 5EHZA 4LKOA 3WWCA 1GXSA 1LLFA 3WWDA 3I2IA 1E8MA 2AJDA 2ONCA 1N8SA 3NWOA 2H1IA 3R41A 2WFZA 1BU8A 4GEGA 3BL8A 4QLOA 2XUJA 1Q0ZA 1BEEA 4L72A 1GPNA 2HM7A 2QJRA 5A2GA 3DEAA 1BE0A 1AQLA 3A2MA 4PSCA 2QR5A 5AJHA 3ZLTA 5AI8A 2I78A 5ALYA 2EDCA 4X93A
chains in the Genus database with same CATH superfamily
4Q1FA 1P9RA 3JVIA 3EDQA 3EPPA 3HB4X 4NEGA 2VEDA 2NG1A 4QJ4A 5BN4B 3NCTA 3I72A 4HDKB 2VHTA 3DW3X 5KNDA 2MSCB 3TCNA 1NSTA 4Y2PA 3EVDA 1UKBA 5CA1F 3IMEA 1G2QA 2FN9A 2PS3A 2Q5LA 1PJSA 1DTWA 1NU6A 2EVWX 4QT4A 2ZRIA 2YYYA 2IYFA 5EIOA 4E08A 3F5DA 4KHPB 4V2UA 1PFUA 1U3FA 3N8IA 1HEYA 1X9HA 4P3OA 2I71A 1ABBA 5JATA 5F4ZA 2PSEA 1M1NB 3GGCA 2E7ZA 3PDWA 3CNLA 2EX4A 2VNAA 1QPGA 5D00A 1ZI9A 2VDQB 1UC8A 4U7GA 4YXWD 1N36B 5TT0A 2GK4A 3VTZA 3O9MA 1IRIA 1KZHA 3FIUA 1LF5A 1R8YA 3F96A 3U4HA 2TYSB 3TL3A 3ZOZA 1JQBA 1U7WA 4J6FA 2IPOA 3FWNA 1QZXA 3MCVA 5T8KA 5CA0F 5B1SA 3B85A 3SQOA 1SCUA 2YCBA 1J09A 3WQHA 4DMFA 4G5QA 1KJNA 2EZ9A 3MGKA 4NDAA 3U6BA 3CBGA 5CFPA 1P7VA 1U8XX 2RGWA 4N8DA 2ZKIA 1TUIA 1UJNA 1M34B 2J3HA 3DDHA 4YACA 4RMHA 1D6JA 2CBGA 4F1WA 3KFXA 1QDUA 4FIZA 4H6WA 4TMTA 4MH0R 1PSWA 1FK8A 4E11A 3DOUA 3AHDA 2JCYA 1EB9A 5F78A 2PX2A 1H66A 2D7DA 4PXSA 3PHGA 1FTNA 2LKCA 1NE2A 2H85A 5CW2A 3GEDA 1I4DD 2A88A 3DZCA 4ZAZA 2JAWA 4JQSA 1AK2A 1EBBA 2X22A 3EFBA 3PX3A 2E5LB 3EZ6A 1NZFA 4ZZ3A 1YH3A 3LOUA 7MDHA 4I1PA 5EZ6B 1IHYA 4QXQA 5HS6A 3K9GA 3TKAA 3KUXA 4QQNA 4KLRA 2O20A 2HV9A 2RSLA 4EFMA 3L01A 2ICAA 3QK7A 1EAMA 5I7OA 4YIHA 1DBWA 5KNBA 5G4KB 1CLUA 1E9EA 3U13A 3KETA 3E8XA 3AVTA 5JSKA 3ZEIA 2CXNA 1BRTA 2DJIA 1V4BA 2P65A 4X63A 4HDSB 5CCBA 2B98A 1YJAA 5KVAA 4CN8A 1TAQA 4Z8XA 2TMGA 1Y3AA 3PUIA 4LK3A 4XRRA 3FDZA 3GH1A 5FNVF 3KQLA 5DYWA 1XK7A 1X0XA 2BTOA 1PS8A 2NUAA 3N7TA 5DHPA 4MWEA 4HDMA 5KU7A 2GBIA 5L9AA 3L7IA 1R0LA 5FUMA 3FVRA 1S2DA 1SC1A 3HBFA 4MUEA 5AESA 4XUCA 1KI6B 2IYRA 2AL7A 3C3JA 4Z9BA 6AT1A 4LF6B 2WJHA 2CVQA 5DNDA 1U7PA 1QQ7A 3U37A 1YB5A 3VBEA 1JHDA 2J9FB 3FKSD 3GP5A 1KE1A 3KLMX 4K9SA 3CB4A 3U60B 3HCFA 2GEUA 2DKFA 4GQBA 3VVMA 3W2EA 1LDEA 1YA6A 2QRVB 4ZYTA 3G2MA 5AVVA 4WERA 4JGBA 3FWZA 3K35A 2BHLA 5FOSA 3FOWA 2D4AA 3PQ8A 2XYQA 3KUKA 5DN6D 1G41A 3Q3EA 1DFGA 2C5FA 3OU2A 5FJJA 1RM3A 1W1IA 1ZRNA 4S1NA 5F7OA 4CL3A 3P0EA 1E5DA 3DBLA 1US8A 1GKUB 3K0AB 3GZJA 3Q1LA 3JWHA 4XYBA 2I87A 4A2QA 2J6IA 2Y3IA 3DE2X 3ZJYA 3AL2A 1ZJZA 4PLTA 4ZOLF 2JGAA 5JMTA 3KKLA 2OE2A 4N1AA 5FPHA 3BXOA 3L0IB 5DXFA 5F1YA 5DM4A 3PCXA 1YBMA 1I9CA 2P9TA 2VJKA 2WLSA 1RT9A 3A6FA 3L7LA 5BQFA 5BUZA 1KWKA 1M1UA 2XTMA 1G8MA 1NC1A 1S5PA 2Y1DA 3H9QA 3HBMA 3UBTA 1W7AA 4C4TA 1ULBA 1U9ZA 3ZJVA 1GUAA 1OPXA 4XCVA 1AMUA 1ODLA 3M70A 3I0MA 2NAFA 1QZTA 1Y63A 1CS4C 1H0SA 2YCLA 3BFVA 4YJKA 1S02A 3D3KA 3LG2A 4JYCA 4LJ4A 5M2QA 2EWVA 4INPA 3RAJA 4OEHA 4ZVNA 1V35A 4A3SA 5BOSB 1MAHA 3HUFA 2C31A 1P0CA 3A70A 4F5YA 5I7RA 3P32A 3PEFA 4O2RA 4PX2A 3ABSB 5JRDS 4FT2A 3B36A 3L4KA 3UWMA 2VJYA 1SUPA 2FP3A 1H2HA 4J76A 5IZ4A 1JJAA 2EEPA 3EB9A 4IILA 3FPCA 3AL3A 3U3KA 1EKXA 2JGDA 3PKIA 4ER7A 1I6LA 4Z7OB 2OB1A 4MI6A 4TUYF 5LIRA 1RHUA 3ONWA 2J31A 4GGOA 5BPHA 4FDUA 4JP3A 4MVWA 4DSTA 5DPMA 1HDYA 2AJLI 4MUXA 1HEIA 2ABWA 5CLQA 3CUUA 1U6KA 2CDBA 3E82A 2ZWVA 5C8YB 5EIEA 2JIPA 1TYZA 3QJGA 4A15A 2OYRA 1F2UA 1J2TA 1TEXA 1E2HA 3PUWA 2UV8A 3P9ZA 1P5HA 2P6UA 3EXAA 4TVKA 4RFSA 3DDSA 3CVJA 1OA0A 3CA8A 1PUXA 4K6MA 2Z57A 3J7AC 4JXZA 3MCWA 3VYTB 4PZDA 2XRZA 4I5GA 3O2JA 1S4MA 1RZUA 2OT3B 1A9OA 5CDSA 4GKJB 4CLRB 1DJLA 1JR3A 2R8YA 3RV3A 1YR2A 4M0LA 3X1DA 4ENTA 2RJ3A 5TS2A 4TZ0A 3K2BA 1CP3A 4NC9A 4Y9RA 1B8PA 4EHIA 4M1QA 1DEXA 2I62A 4XCQA 1EVZA 5AW8A 1TTTA 1OWLA 2VK1A 1P17A 2JAXA 4IIUA 4Q5IA 4ARSA 3FSEA 4YJ2F 4ZV9A 5DHSA 1I94B 3K5IA 4A03A 3LT5A 1DAMA 3O0TA 5JZBA 2QTAA 3LZ6A 2ZVJA 4GBGA 3E7PA 4GBJA 5DSXA 2RJOA 1XWIA 3GY0A 2D2EA 4WZAB 4A92A 4NCBA 1RQ2A 1X70A 2BN4A 1W19A 2K87A 2HQRA 3E58A 2GXSA 2PX3A 3K0BA 4AU1A 1O5IA 2MSKA 2QPOA 3G2KA 2EKQA 5G1OA 5JNSA 1ONPA 5L4LA 2PDAA 1VE9A 5AVUA 1ZSYA 1D03A 3R24A 3BXGA 1VCOA 5FR1A 5A5GA 1FSPA 1BD3A 1P1KA 4MINA 1THTA 2B8NA 3L6OO 4ALJA 2ZJ3A 1C9KA 1EWYA 4EHFA 4CMKA 3FTDA 3KHKA 1NXQA 3LECA 2ATCA 3CB2A 2X6QA 4MYUA 4P82A 4M9SA 5AKKA 3RNOA 2BZGA 1NN3A 1EP1B 2BKAA 2YFKA 4WW0A 4F21A 1MAWA 1ZSNA 2D5CA 4KYUA 3H99A 2HMSA 3H9UA 4O25A 1OFUA 2OCGA 3TDMA 3HY4A 2XQKA 3GRFA 4P2BA 4BNTA 3HB7A 4BE7B 3NOQA 4BFYA 1PQYA 5JAUA 3RUEA 2ZR0A 1BH2A 1M2GA 4R69A 1IG3A 5ER9A 3PE4A 3RFFA 1AB6A 5IMBA 1XZJA 5BN3B 3DL2A 4CN9A 2IL1A 3U3ZA 1S2LA 3UNXA 3DF9A 3ZWPA 3UTDA 1I9GA 1JSRA 1TRHA 1XJ5A 3OLCX 5EL0A 3TXYA 1DMRA 2I4RA 4QBKA 5A3RA 2C7VA 3ICOA 4WT7A 3R7WA 3WLRA 5BSEA 4C7MA 4A36A 2JCVA 1K92A 1E2BA 5K5EA 2A7XA 3LK6A 4M9RA 4ISBA 2IYLD 4UZFA 1Z25A 2B5WA 2QAJA 2W8BB 3GH3A 1O5OA 3QLUA 3PXGA 3CSDA 4R8SA 5JRZA 3UOWA 3IDZA 2E6UX 1TZCA 2IYXA 4JWKA 1F5SA 2IE8A 2H92A 4YJGA 1G38A 1H5UA 2ACKA 5C8ZA 1RPAA 3UHPA 4YONB 2OZLB 2XMSA 2F64A 4K03A 4QQFA 4C6TB 3OG9A 3V4PB 2VNSA 3OC0A 5EGNA 1V96A 1ECGA 2C84A 3KDPA 1SXQA 3HN7A 3GNTA 4JP8A 3R23A 2GHRA 3R6DA 4TL7A 1MA3A 1P1JA 5ICCA 1CUBA 3BXEA 3CVXA 2XTNA 3GQBB 2J0UA 4GZ5A 1UJ5A 4K81B 4KUEA 5AD1A 1QOZA 2Q1WA 3RSZA 5HF5A 1BGXT 2PU7A 4EZBA 1BQ4A 5CGZA 4BNFA 5L6MB 1GVNB 1L8QA 3H65A 4UHDA 2X0KA 5LZ8A 2P9QA 5C5IA 4QHYA 2VP5A 2OM6A 3H2ZA 3MJ4A 3OHPA 2CLLB 1JHOA 4Q4LA 3INNA 2NO4A 4JBWA 3NJRA 3BWXA 2ZJ0A 2WWXA 3H05A 4NY1A 2JLBA 4EUSA 1WS6A 5CB4F 3NJ8A 3ESCA 5K6RA 4QBIA 1HM5A 1TKBA 3KLNA 4YRNA 2ZW9A 1T24A 3OOWA 4LF8B 1MDFA 5FBKA 3B82A 1NRWA 3DWEX 1Y7HA 3JQGB 2YVLA 1ZK0A 1QNLA 4HX9A 1IBLB 3AUSA 3PZRA 2F1OA 5BVHB 4FE7A 2GH1A 1B8NA 1JG4A 4PPFA 1YIDA 1Z0FA 1KPHA 2JFOA 3FNQA 4OLJA 4Q9KA 5BRAA 1OJLA 4MR9B 1KAEA 1Q19A 3KQUA 3WBKA 5JO0A 1B15A 1A8IA 2HMWA 1GCUA 3HO8A 2Q7DA 1C8VB 4RH0A 3QVWA 4IIHA 2PO7A 1OE0A 1MO6A 4E2FA 3IELA 5JHHB 1UZMA 4NAVA 2IEIA 1GFZA 4KN9S 3OY2A 4TZKA 3ZYZA 1ZQ1A 1R2QA 2WPDA 1ZGHA 2GPTA 1DJPA 1SXHA 4F11A 1ND6A 5JSQA 1HR0B 1Z2AA 2VKQA 2QX7A 5E38A 1VKRA 1TCCA 4JJ8A 3AHCA 3KD3A 3N2ZB 4TVSA 2LR0A 1PL6A 2FB9A 2OY0A 1S8FA 5BV8A 2A1TS 3OZCA 5AHOA 3OLYA 1SM4A 4EKYA 4HN2A 4N5DA 1UBUS 2JCGA 2VHQA 3PPVA 4G09A 4ZVRA 2Y1CA 3VKUA 1E4VA 3LDGA 4L9WA 1J21A 1JKFA 2G1PA 1KQNA 4DTIA 3WGUA 3FE2A 1I7NA 3HADA 5K8VA 3JD1A 1VIAA 3KOZA 1SUIA 2BKEA 4RFVA 2RGUA 1JDJA 3GOHA 1VDMA 4EVRA 4IJUA 3ZTWA 3W3AH 1Y89A 5ALRA 4GP9A 2B5OA 4HVAA 2GKSA 2IIPA 4Q16A 1CUCA 4PLHA 3LFTA 3MAJA 3RRJA 4OKSA 3UENA 3VZSA 3JX9A 4TV8A 1YJ8A 3DMPA 1BFDA 4C6SA 1U4NA 3HPRA 1JMKC 3T12A 4B7CA 2H2AA 1VXRA 3EN0A 3FGOA 1YR6A 3TLAA 4EJSA 3LTNC 3RVPA 3WL7A 4XXHA 4RE6A 2E3JA 5DX1A 3GUUA 5J2UA 3FNBA 3NHUA 3EW7A 1GZUA 1R9NA 2HLDD 4BNLA 2FQ1A 1ZN7A 3F73A 1JSLA 3ISTA 2FJ0A 1XTVA 2DPLA 2P3LA 3OVMA 3OECA 2GRJA 3HHEA 3M4XA 4OYHA 4RESA 5LA6F 1L7NA 3FZEA 2MU1A 3GJTA 4F04A 2WHEA 3E1KA 4RK0A 4ZQBA 3E5HA 1G66A 5TC4A 3KQHA 2B5VA 4G1VA 3H6KA 4DUZB 1NN1A 1AF4A 3BD6A 4D8VA 3TDKA 3OFNA 3VM6A 2PCJA 3WRYA 3WWZA 1MFPA 5D3MB 3JQRA 4O4IF 2JFZA 4ZEVA 5IXJA 3OJWA 3NI2A 4MCJA 5K4HA 2O7RA 1EWKA 3NAMA 4TL6A 4IFBA 2PKQO 4GI1A 3AEYA 3DYVA 1R0SA 3NYWA 1GZ4A 2OMEA 4ZD6A 1T4GA 1VSQA 1IN8A 4M0FA 4AKEA 4WKBA 4Y6QA 5EZYF 3OTOB 4MW2A 3AUYA 2PAFA 1ZIOA 3TH5A 3KQWA 1T6BY 2ARKA 3S99A 3IMFA 1TC1A 4IJVA 3VV2A 3ZCSA 2GJKA 4RK7A 4IP0A 5CXXA 2FPGA 2DPGA 3HXMA 1N0WA 2CDAA 1BU5A 1G16A 2IUEA 3HH8A 3NYQA 3U7HB 4UAJA 5FNZA 5B3KA 2QX4A 3EFEA 4MV7A 1WPXA 2QTZA 3KQTA 3LU1A 4FGKA 4OQDA 3VNBA 3R6TA 3SR4A 2Z5VA 1M66A 2DRIA 1QZUA 5CD1A 1R6VA 5IDQA 3A11A 1BCSB 5C7IO 2EJBA 1DUVG 2ILTA 5HGJA 4EJSC 1HQCA 4M99A 4KIGA 1XTQA 5KYKA 2QUJA 4GEKA 3TLGB 6PFKA 2O8VA 1EB8A 1V9LA 2GPJA 3WRXA 2OR3A 2B9VA 2OENG 4ZTZB 4QBHA 3DO5A 3H7IA 3OX3A 4DG8A 2JJ2D 1ZK1A 3BGDA 4O29A 4YO8A 3QNWA 3ZHUA 5F2EA 3T4XA 2C59A 4ROTA 3WK5A 1FSZA 1RP7A 1ZKMA 2EKBA 3TVTA 1ZVJA 2Q4DA 3G2OA 4RGYA 4W5QA 1TPYA 1FFGA 3F8TA 3JRNA 2X4LA 1HK7A 3TBKA 1YCDA 3NNDA 3UWDA 8AT1A 2VDUE 1N2JA 2R1TB 3GBSA 2YIMA 4BIMA 5KZMB 1Y6QA 4DQKA 4BLQA 3T1HB 3BBPA 4N40A 3RM3A 3TZLA 1RLIA 1E7QA 2A9KA 2FRDA 2WDPA 4NOKA 1J7JA 4D9JA 4CKCA 2QVLA 4N3CA 4B3IA 4EHJA 5LOVA 3V2IA 2OHFA 4NPCA 4F3TA 4N7JA 1VMDA 1THGA 2NSDA 2YZ7A 3NC0C 4QU5A 1M5UA 1SB9A 2HDHA 2XJ4A 4Z1MA 3K6SA 1QQAA 2X5NA 4OHBA 1R8XA 1HE2A 4G8CA 1KIAA 5LCXA 4DT1B 1B74A 3SXUB 3SZUA 4JT2A 1C9EA 3TD9A 2RB4A 3ZZ0A 2AS0A 2PRIA 4BNYA 1CVIA 2AG1A 3WGZA 1NW4A 5D2CA 3ORYA 1WB4A 2C8VA 3KPVA 4ZVQA 3MNFA 1TQ2A 3AR6A 4JUBA 1CJMA 2W6ZA 3OU7A 1ZVKA 4I4TB 4IIJB 2RGEA 3ZGYA 4EG1A 4YECA 4FVTA 1BVHA 5ENVA 3V80A 4I4NA 1SVOA 3KZMA 1QR6A 2QD4A 1D5WA 1KFJB 5DNAA 4YAUA 2DLCX 4YP5A 3K2IA 1NW9B 4NU0A 3UGQA 5EGSA 1RRMA 2I2AA 2NZXA 2Q49A 2X5OA 2P9JA 4CMCA 2EKZA 3DBHB 4HTFB 4JYAB 2WQ6A 1QG4A 1XUOA 4WY8A 3O73A 1AQ6A 4IRXA 2AZTA 3PXEA 2WFAA 3M6WA 2C0QA 3G5LA 1IATA 3P97A 3R3UA 2JFWA 3DE4X 3HJFA 3T38A 4AJ2A 3TI9A 4BMVA 1JQDA 1MG5A 1PQPA 2A14A 2AW3A 3HS3A 2CB0A 3IBGA 3IMGA 5EKSA 2BPOA 4QTUB 3SX2A 1G19A 1ZLYA 4RPHA 4B3DA 1X19A 2VH5R 4QU9A 2WOJA 1HFJA 5AKHA 3ZHTA 2QE7A 1RDFA 2FP4B 3GCXA 1UKYA 1Z5OA 2GAIA 4Y1RA 3H11B 4F6LA 3SIXA 4U2CA 4YVFA 2UYHA 3BF7A 1AX9A 2IXAA 4MA5A 4Z9YA 3Q0TA 1UMBA 4JQOA 5ALWA 3QEBZ 4D3ZA 4RVGA 2RFLA 1R5BA 2LVBA 1NBAA 4OGGA 1YMQA 4YX9A 2VQSA 4MIOA 2IUSA 1QO0D 3FLAA 4B4UA 3GGJA 1SUEA 2OZEA 4G6ZA 2IHYA 5ALGA 3TKLA 3PXAA 2VZLA 4LC0A 2C82A 2KM1A 5G1NA 4C6RA 2FHPA 1FZTA 2O07A 5SY6A 4GR5A 4DV3B 3IO3A 1IMOA 1K06A 5LQSA 4FDVA 4EKNB 2BRUA 2EFEB 4QGBA 4YFVA 1D1TA 2VBGA 3D7MA 2PUGA 1ZXLA 1PGNA 2QV7A 5JJLA 2X9QA 2NSHA 2Y0BA 1LDMA 2IV2X 1W47A 2V58A 1GPMA 3CRW1 4JIMA 1Q0UA 1JSXA 3O3OB 5IUKC 5L3VA 4LYJA 1WM1A 3V8BA 2XYPA 3N2KB 4D4JA 1SCBA 1A88A 2JVIA 4FEAA 1KYQA 3SIPA 3M5PA 3RRMA 1G5FA 1BVUA 1T1IA 1TVKA 3FNEA 3L6EA 2X0EA 3WISA 4AUEA 2YJZA 3ER9A 3WK9A 16PKA 3T3EA 5DNYB 4X45A 1C9MA 2VSQA 2CUNA 2ODEA 2YQZA 2YJ6A 1WDTA 1J42A 3IP6A 1Z22A 1ZK4A 4N01A 5EZ5A 4BAUA 2FUEA 5I45A 5ELXA 4AI6A 2W6IA 4HH1A 3VGPA 1OLSA 1SOAA 2BV3A 2OXEA 2AOUB 2Y1OA 2YHUA 1Q1QA 4LCEA 2XA9A 3DWFA 1I1NA 5K3BA 2Q5EA 2NUTA 3WXMA 3IFSA 3HXPA 2XI4A 3MMSA 2NU7B 3UJBA 2FN3A 1ZISA 5IJ0B 3FOAA 1YOBA 4PG4A 5C2JB 3NUQA 4Z4IA 1DEOA 2AVNA 2ZREA 3B1VA 3HCCA 3HU1A 1QQ5A 3E03A 3T6KA 3TCKA 3UK6A 5I9IA 1GL3A 1NP6A 4XQ0A 2BLLA 5T4FA 3EG9B 3LE8A 2FF7A 1ZG3A 5COAA 5IYZB 1FOEB 4RVSA 5ED0A 1Z6ZA 5DWQA 1IY1A 1W5AA 3BH6A 3ZQJA 4E6PA 3L07A 5FUYA 1AK9A 4RLFA 3ZDQA 1DOAA 5ALZA 1N2IA 2XVAA 1Z08A 1Z6GA 2R6AA 5EHQA 3VA7A 2GZMA 121PA 4CM6A 4S2UA 3KQNA 2PKRA 3EQ8A 4Z54A 5REQB 4J2HA 4ZV4A 2YWBA 1Q3HA 1A71A 3HK2A 5L3SA 3N58A 2PMWB 2TMYA 5HUQA 3HZHA 3GGPA 4H7FA 5C1IA 3SJ7A 1AG9A 3TZHA 1OD6A 3KEQA 1W75A 1WW2A 5AOAA 3IE0A 4DN6A 5PNTA 2GBPA 3HXOA 2O8BA 1J0XO 1JYFA 2AFVA 2AUTA 4F4CA 3N0VA 5B55A 1A96A 1EXDA 4OSPA 4H1TA 1IOWA 2PZFA 3INTA 1UJCA 3BH7A 2HXSA 3IQFA 3RU3A 4QRIA 2O2ZA 1RABA 4A7PA 4NVRA 1JHRA 4CM4B 5K0CA 3AWDA 5C31A 3DOFA 1X80A 4WV3A 4P3KA 1Z0IA 1O94D 1AQUA 4RGQA 5TQJA 1Y98A 4EENA 1QFYA 4KDEA 4FYHA 2IHZA 2DF8A 3RRZA 3LGXA 1GTG1 2O2SA 3BL5A 3ZY3A 1JJFA 3K15A 1P9NA 2YRWA 1Q0QA 3NU1A 3PC3A 2QGFA 3DP7A 3OAAD 4HLUA 3W2FA 3QVKA 1TNDA 3SICE 1W2GA 4LWZA 5KQGA 1D3AA 2CWDA 4BO3A 2JATA 5H02A 2MR5A 4PGHA 1NJ1A 4D8WA 4BJ1A 3O26A 1S8AA 3HJBA 1ZO8A 5TMDA 6Q21A 1BROA 3P9XA 3DGEC 4FUQA 3JQBA 1WZUA 2RIRA 4TLEA 4BPBA 5J2UF 2AR9A 5C5CA 4Q00A 2BGRA 2GMWA 3NHPA 3I4FA 4J7UA 2ZRMA 3KP1A 4UNQA 4B8ZA 3D2BA 4KRYA 4QKQA 2V6JA 1F6WA 1FJHA 1TK3A 2HRQA 1GGHA 1VHJA 2B8JA 1A1SA 1PJ8A 4PLPA 2ZIZA 4HAWA 5TPZD 2PZEA 3O4RA 3C8DA 1QAQA 2W2KA 3FPAA 3UXYA 3AR5A 3GRRA 1SQFA 1HYGA 2BMVA 5IT0A 2ZUCA 1P5RA 3FPBA 2WWGA 1VPTA 4GSLA 2CUKA 3KRTA 4E1VA 4C87A 2IVZA 3HZZA 3UJHA 4RJLA 3GJZA 3ASYA 1NUTA 3N3AC 1QHXA 4EZIA 3FOZA 4FXPA 2Y05A 4XPZA 2IEGA 3B3QA 3HY6A 5CG2A 1W0JA 1EFCA 3H1EA 4ZMSA 1OFTA 2GM3A 3FPHA 3PNMA 3SBOA 1F8YA 4PXYA 5C32A 5HQ3B 4F0JA 1TADA 2QL9A 2YQ5A 4JKOA 4O63O 3D4OA 5J1TB 2NU9B 1R8SA 3DO8A 1T2EA 5HXAA 3A1EA 3WQQA 4Q9NA 1X7XB 4I81A 3AUKA 4HDCA 1XZGA 1T5TA 2XADA 5D84A 1HLPA 1WXXA 2HO5A 4BFZA 2PVCA 2WZDA 4CQNA 3MILA 1JLRA 3GEEA 1JKXA 3K09C 1K8RA 2VJBA 3QYFA 5IDXA 1JHZA 4CEJB 2XB4A 3LO8A 1OKKA 4OO3A 4ZZIA 1OXKB 4LF4B 4EFDA 4HLUC 1ML4A 4KRXA 1HQYE 5LP6C 3RC2A 2X14A 1QIGA 2F1RA 3DV9A 3QE9Y 3DDCA 1ORRA 1HZJA 2HWWA 4GLJA 4J3JA 4BFVA 2DPXA 3KEMA 1CUIA 4O1MA 2VH1A 3AUAA 4XDGA 4WLOA 3E7FA 4BKMA 2HQOA 4F2WA 1G3MA 9LDTA 1VI5A 5I8PA 2VP6A 2I6FA 1KZ1A 2PUTA 4MPTA 3SE7A 4IQ0A 2FPMA 3QLEA 1GFSA 1OAKA 2ZI7A 2PE5A 1ILEA 2PM8A 3JQBC 3BZWA 4I1SA 4BVHA 3ABRB 3GFSA 2GD6A 4IRMA 4MW6A 5BW6B 4D4KA 2AJCA 5EIHA 2XXAA 4B6RA 1LQTA 3OT1B 1Q1GA 3RVQA 2PWZA 3W06A 1BYIA 2HTEA 3R8CA 3D7RA 1M2EA 3I6QA 4YCMA 5IPFA 1I5OA 2H4XA 4G1BA 2VHUA 3QTLA 5GY7A 5JIBA 2V4UA 3E61A 3KSBC 3QXCA 1UBOS 3RQIA 1F1JA 5JZVA 3LQKA 1ZCJA 2VK8A 1RJ9B 4M76B 1O57A 2VYND 1ZOOA 4ZVVA 3AU9A 4RGVA 3PJRA 1QONA 1QHGA 2FSFA 5ITWA 1X1CA 1N75A 2CF6A 2WWTA 3OQJA 4OYYA 5ERYA 2WZCA 5BYBA 1W4ZA 3VO9A 1E7RA 1H2EA 2JLZA 3HVUA 3NHWA 4MUGA 1JFTA 1H5NA 2F3QA 4CMEC 3L0BA 4NQZA 3NBFA 1QIMA 5FUQA 1TK2A 2J0QA 3C74A 4H1HA 4R31A 2CHQA 2E37A 3QE2A 1V2GA 2XNCA 3PR3A 3A9TA 4G0XA 2G1JA 6REQB 2E5FA 5EP1A 4D26A 1XTSA 3MT0A 3VSDA 1ZM9A 3I28A 4DV2B 4F3KA 4JLKA 1DX9A 3PEWA 1FJXA 3KM0A 1YFJA 1UZUA 3ZH9B 3OZSA 4RHTA 1KSFX 1KYTA 2O14A 3EJWA 5IU6A 3IERA 3ND5A 1R0ZA 5A3QA 3UPDA 1Q14A 3NC1C 1P2VA 1RKBA 1LZLA 3L4SO 1SBIA 3DBIA 2GB4A 3O8BA 4EAQA 5IJWA 1TGVA 2X19A 1PTJC 3EGWA 3ELBA 3NEPX 4GXTA 4NYJQ 3V1TC 4DSZA 5EUMA 4CM8A 2P5YA 1IN1A 2GM5A 2BBWA 1UOQA 2TSYB 1XDSA 4PR0A 3T5AA 1VKZA 2B1GA 1SBQA 3AERB 3B6ZA 4HBGA 5TF0A 3DE7X 2QLBA 4C7OB 4D97A 2ECQA 1MZVA 4NE7A 2JEYA 3HVRA 4NXNB 2O1EA 1VFNA 3FYUB 1HI9A 2BVNA 2E49A 3LBFA 4ON9A 3VR0A 2P4EA 1Y37A 3KIPA 4QELA 3K1AB 3PC8A 3ICCA 1WUJS 1B3RA 3ABQB 4RQUA 1BN7A 3OJEA 1LD3A 2PYDA 1DHRA 2Z8ZA 2FDCA 1YVPA 3ES9A 4I3HA 2YXEA 1H4VB 4PQEA 4DM4A 3RAGA 4OI4A 3VAZA 5BMVF 1I4EB 3UJAA 3DNPA 4WBNF 5KO2A 4RHUA 4RENA 2HA2A 3QWBA 3QXHA 3MJDA 3VH3A 3WK8A 1L9XA 3WBJA 2UU9B 1W35A 2JKVA 4DYVA 2NXJA 5LDGA 4LCJA 1WBJB 3ASUA 4QL3A 2EYUA 5DYIA 2ZRKA 5BV0A 1MB3A 1NDQA 3CS3A 3DOCA 1G2OA 1X9IA 1TT5A 3MCUA 4XD7D 5P21A 1HYQA 5B1YA 2CYCA 4F2DA 5DI3B 4WLVA 1DO8A 1DLIA 4CFYA 2HPVA 4JGIA 5CJJA 2AR0A 3TVDA 4OBXA 1YR7A 5HHTA 2R751 2FF5A 2Q9AA 5BR4A 1LH0A 1T9ZA 3QG5A 4NEHB 1FQKA 1LBHA 4AYXA 4C4ZA 3HFGA 1SG6A 1BC5A 4KI0A 4NQRA 4O8CA 1C30B 3UQYS 1JI0A 1JB9A 2R7NA 2Q62A 3AK4A 3DEKA 2AI2A 2CNWA 4E5DA 1NJ5A 1XT6A 1XAHA 2GZ3A 3GJ0A 4TS1A 5GGXA 4LQCA 2B92A 3TK1A 1WKCA 2IHTA 4RHYA 2A5LA 1QJ4A 3LUFA 1B8UA 2EKPA 3IBCA 5AYVA 2DP4E 1DQSA 1KY2A 5F3RA 1Y8QB 3H3XA 3VR1A 3ZDFA 4COOA 1KWGA 3MYRA 4C88A 2PUVA 3B6MA 5CFLA 2Q6KA 2IXGA 4G5HA 2A0KA 3PEYA 4BNDA 1DBVO 2C92A 2OAP1 2FEKA 2OUIA 2UKDA 2YVAA 3IC5A 5AQEA 3EIFA 3WTCA 2WWYA 1VGVA 2RHTA 4ZGGA 2A86A 1YDHA 2EJUA 3O82A 5H9WA 3HDTA 4ESVA 4QHTA 4TMKA 4I2NA 4FOLA 4Q6BA 1U3UA 2O8FB 3PC8C 5CAEA 1QQBA 4KI7A 5CITA 3L8FA 4PIMA 5BXYA 4DA9A 4P6VF 5A7GA 1COWA 3R44A 4MKRA 2PA0A 4FDLA 4A6XA 2ZATA 1PG2A 1MQ8B 3T1TA 4FQ8A 5TY0A 3IKTA 4G0NA 5DMXA 4XGNA 3SF8B 4AKSA 1E7YA 4MQ6A 4Y18A 2W2OA 1RWPA 3E48A 3PFKA 2XZLA 3WGYA 4HHEA 4XWGA 3HU5A 5KSPA 4D42A 3EOAI 5TX7A 1W0KA 1MJ5A 3BGWA 2V5VA 1YUMA 3UK1A 1EUDA 4GU5A 1EGAA 5TGZA 4EK9A 4J43A 2VFAA 4DA0A 1RKQA 4CLDA 3W4KA 5ISMA 1NUPA 5FO1A 5IBPA 2VDJA 1CIJA 2AEEA 2OCLA 3GLGA 4E33A 4ER6A 2DUJA 4JXKA 1O9HA 3CF4A 3ZLUA 3UC9A 5DTMA 4GMFA 2I66A 4WCFA 3PDUA 2YFHA 2W4MA 3EIOA 1LS6A 2QMHA 1DOHA 4GFDA 2PIDA 2JAHA 3QMVA 3IE1A 2YC4C 2NPIA 3AU8A 2BUBA 5CB4B 2ZEJA 4RZIA 4ITVA 1JDUA 1SURA 2P3QA 5ESXA 5SZJA 3DV0B 3EULA 4F4UA 3D4BA 2JHCA 3N39C 5B1DA 2AG0A 3FWHA 3FCAA 5LJIA 1A98A 1NW7A 3GJ5A 4KBYA 1Z8HA 1NU8A 2YDXA 5FBRB 4RAOA 4MRRA 1QWOA 2JAOA 4DE5A 5L8VA 1PVDA 2OQ2A 1NR1A 2OORA 3K0CA 1SFRA 3FKJA 3LUPA 3N53A 4R83A 3T0GA 5KNCD 2A57A 5HNKA 1OC4A 2JJQA 3IIIA 3IUQA 3QPUA 2E6KA 3RTEA 1S3GA 3EGIA 4NMLA 1R5OA 3TRHA 3W5VA 1CDOA 2HDWA 3DG9A 3NWPA 1N7GA 2LNDA 1VE1A 3KJNA 3WQSB 5E6UA 3EY4A 4XQGA 3ZWMA 1AKVA 2Y1GA 5SYNA 4DNXA 4E4RA 2R2AA 2C4UA 3TR6A 3EGCA 3GA7A 2AN4A 3GEGA 4HEA6 2UYQA 5IT4A 1EFAA 3P5SA 1P2FA 2BEJA 1VA4A 2JHFA 2XGOA 2PGIA 4JLOA 2QD1A 1Y9AA 2X42A 2H5EA 2QL5A 3LUBA 3ZGVA 3EIWA 4DUPA 5CDTA 2P79A 5IDVA 3A14A 4U6SA 2HDOA 3CBQA 1T5SA 4BOYA 3FTEA 2IS1A 4TTIA 1U7HA 3UJDA 5M7EA 4ABTA 3E2IA 2AOTA 4L9AA 4QHSA 4BGDA 4YP9A 1W4RA 1A4IA 2JD1A 3MWEB 4NBKA 3UWOA 3L41A 4MYRA 1YBHA 4WA8A 1O97D 1V9CA 2GJAA 2QNIA 2ZR8A 4WNIA 3HGQA 3HLTA 3C1AA 1D09A 5B36A 1M34E 1SC9A 3OEYA 1ICEA 3V8QA 1DX6A 4Q21A 1RYMA 2FE4A 4WADA 3WSVA 1U5BA 3JQ6A 3O75A 1TJ5A 4RC9A 4RHCA 2HMTA 3ZHXA 3OICA 1CUUA 3DP9A 2GF0A 2Y1FA 4WE3A 2EF0A 2PWAA 3A6ZA 4RO0A 3H6HA 1T0IA 2ZS8A 2WINI 1V1RB 3OJCA 2J6BA 3T1YB 3GP8A 2MR6A 3KYBA 3IKJA 1YC5A 3MF4A 2EFGA 5CEJA 2IEDA 2PZ8A 2Z95A 3VXKA 3QUCA 5AVJA 4MWSA 4YCBA 4LFCB 4WECA 1J8DA 1I24A 3EHDA 4ND2A 4R8MA 1A3CA 2XODA 4LXQA 5FYQA 3G8CA 2PVPA 3EVCA 3JR3A 3KV1A 4H08A 3EY9A 4MEBA 4Q0MA 2M6LA 1FDOA 4DY4A 1QP8A 2F8SA 2G9QA 2HJHA 3K0CC 4RA9B 1KSHA 3T3DA 1H4SA 2ZYRA 4N39A 3BPSA 2G4VA 1M6VB 2B2NA 5EJFA 3CEHA 3I09A 3WVNA 4BLSA 2ZRGA 2RKOA 2VDWB 4HX5A 4FYPA 3UAYA 1BWQA 3CZPA 4OJNA 4EFKA 4P0PB 2MSDB 4H18A 5FEMA 2IWRA 4AG6A 5I8ZA 2H5JA 4B3FX 4EG0A 4QASA 3WYAA 4LGMA 1OX5A 9ABPA 3DLIA 1GNRA 1A9XA 5AM1A 2GA8A 3OJXA 4ZOCA 5FYDA 5F98A 1L8XA 3IP5A 1U8CB 1G7CA 2HHCA 4YDSA 4R01A 4DJJA 1YBVA 1A9YA 1XEFA 1QG6A 2FZ4A 4NNOA 3UJPA 2O50A 2EJWA 3QFCA 1K5GA 4ONEA 4HV4A 3PB3A 5JYCA 2OHVA 1N0IA 3NBMA 3REOA 3C7KA 3LUGA 4U3JA 2B1QA 1N0UA 1VFPA 1H1LA 3OD5A 1Y8RA 4ZAYA 2IFTA 2Y76A 4RZ2A 3F67A 1ES9A 2AF4C 4QATA 1NNUA 3PRYA 5FV4A 3Q7QA 3G0GA 2PS9A 2CLDX 2FMIA 2QT1A 3JRXA 4OXKA 4HZGA 1QAOA 5B37A 4ARVA 4JELA 5DGCA 2MWMA 3ZDRA 4KFCA 1TKAA 2O4CA 4RZSA 1K0UA 2IZZA 4Y0VA 4NS4A 1Y8AA 1TQDA 1PT9A 2EP5A 5FUWA 3UM9A 1ETHA 1W48A 3NVMB 3COSA 3R5JA 1KP2A 2DCMA 2XBMA 4N48A 3DHEA 1FYXA 1N9GB 4KWEA 4XVCA 1STOA 4D25A 4TLMB 4L57A 4OQXA 2M6RA 5EQFA 4LW8A 1ZD9A 3A1SA 1CVRA 3EBPA 4L5CA 2JARA 4I1RA 5B7NA 1MEEA 3UUFA 1LBQA 1PRYA 2ZFUA 3BMXA 4OHCA 4U39A 1LQUA 4X7RA 4PN3A 1RTKA 2N75A 1WO8A 3U31A 4DANA 2DKOA 3P2EA 2V9ZA 4UAVA 3NWJA 1XZCA 1JJVA 1G3IA 3O03A 4OVKA 4YMHA 2FLKA 2F9FA 2P9GA 1X7WA 3A4VA 3C15C 3CF6R 3JYQA 2CXXA 3MOSA 3ZBPA 4TVBA 4CCYA 4CMBA 1MRNA 4XA8A 1XXLA 4NAHA 5IXYA 3VR4H 3HJHA 3VO8A 4Q9DA 3WKEA 1TZBA 3OOEA 1V8ZA 2BGWA 4M1EA 4IJMA 1E3LA 5LKAA 1RKVA 2QX9A 4BC1A 3X43A 5KX5F 3J80A 2FJPA 2C4MA 2V74B 4RD0A 1EUCB 2AEMA 3QF4A 1XNHA 5CH8A 1XRPA 1WHSB 2IYSA 3WMWA 2QMEA 2O5CA 2JI8A 4FJ1A 4REMA 5CTJA 4YRIA 5BUSA 5AKGA 2O48X 4MLDA 3ZU6A 2CJFA 4GPEA 4YJ3A 4OK6A 1KC1A 4EB6B 4NMWA 2ETXA 4PLGA 1P1BA 3CEJA 2XNDA 4WMLA 1C1DA 1J20A 2R6DA 4IXNA 3HWSA 5T6BA 3ZUGA 4B2PA 1PU2A 2D2IA 3UJ8A 1PLJA 4DUGA 3SQNA 1U2DC 1T3HA 1QRAA 1V43A 3UUEA 3AJ8A 2QQFA 1ZA2A 2FW6A 3EA5A 4KYTA 3L7AA 2IYTA 2J46A 3DJYA 2C8LA 4I6JA 4HZUB 4IDHA 3DM5A 4PPQA 3WIEA 3ESYA 4P5DA 3UMRA 5JCPA 2Y66A 5JBQA 1A95A 5KWIA 1YTUA 2QEQA 4H7HA 4DA4A 2VH2A 1N2GA 5BSUA 5HBRA 5JFGA 2JHGA 2K2QB 4JP2A 5ALNA 1U1CA 3DR5A 4KN6A 1S1MA 1WW8A 4U7HA 2B36A 4TZ6A 2WFLA 1UBCA 1PZMA 2O3JA 2B0CA 2Q2VA 3L9WA 4OUDB 3TD2A 3HM9A 2JAPA 2Q27A 2C7BA 3F3KA 4G8JA 3TZQA 3IV7A 3UOGA 4ETIA 1LLCA 2PKCA 3HRKA 4HG2A 5FCDA 3U4GA 3UCFA 4CLEA 1WRBA 5KHLB 2PYZA 3LDHA 1J4AA 4H7DA 1L5OA 4RADA 1E9SA 4TQGA 1WA5A 3REFA 4B85A 1KYZA 2CJPA 2H4FA 2XITA 1SC6A 2AKEA 3HPQA 1ADBA 4OXNA 4C4XA 3AVOA 3N8HA 1DQYA 4H3VA 1FDVA 3CLUD 1RXSA 2FW1A 4FFRA 3RTCA 2R6R1 2Y6VA 1OREA 3CCFA 4WZAE 1I7QB 3O4VA 4HRXA 3LC1O 2PAAA 4NBNA 2NUPA 5J3JA 1F2TA 3PK0A 1J8VA 2K4MA 1ISSA 3GQVA 3NGLA 2ZPUA 5I7EA 1NOKA 1PQUA 1T5LA 3OE7D 3AY3A 4DVJA 4OXRA 3ORFA 4P7KA 3AV3A 3CW2A 1KVRA 1OSNA 2CJWB 4AICA 1Y5RA 3LT1A 4X92A 1OLOA 2AW5A 4P38A 5L7WA 1ARZA 1Z2OX 2C4NA 4ID3A 1RWKA 2D4HA 3BCRA 4TSFD 3JS5A 1MMFB 1QC5B 5C51B 2Q0SA 2GXAA 5IKOA 4UBOA 5F1OA 3S2SA 3RHTA 1XYYA 1PT8A 2JAQA 4A8TA 1DAGA 3QHPA 4NJEB 2RGNC 4JQZA 4IMJB 3BICA 3N87A 3COVA 4JV5B 1RLJA 1Z4NA 3K4QA 3RT7A 3TLYA 1P6UA 1LDBA 1O58A 4NE2A 2ZBGA 3GJ8A 2Q4EA 5KYWB 1GPH1 3IMCA 3QLTA 5AI5A 2YXLA 1Z5UA 5A3SA 4OQYA 3S2EA 3W3ZB 5JASA 3DONA 2C2HA 1TF2A 3JQFA 1N25A 3RJTA 1T43A 4P33A 5CLLA 3HG7A 3MJVA 4TXMA 3QPCA 1SK8A 3SEAA 3HI6A 4HXFB 3TLCA 5FT9A 1L6IA 1YRWA 3NTVA 4QWMA 5BW5A 1XZMA 2IEYA 2GYVA 3O92A 3WRVA 4CEHB 2HRDA 4LGVA 1E4EB 2D00A 1Z26A 2IIQA 3V4SA 2N42A 5B3JC 1WTAA 5JTTA 3KZXA 1TA4A 5BW4A 4DKJA 1XTBA 2R8OA 1EG2A 3AVPA 4QM7A 3KHSA 1KKLA 1LV8A 2DR0A 1P9WA 1HH4A 1NFFA 3W78A 3I1FA 4KAJA 5EP2A 1NM5C 3W05A 2RAFA 5BOVA 2CXQA 4Q4AB 4MKZA 3SC6A 2UUAB 1X87A 3WLIA 3I23A 3HCBA 4GICA 1V8DA 1UP6A 5JXJA 4I50B 3CM0A 2Q6LA 4AKHA 2ZUVA 4A10A 4UNSA 5KQLA 1UBEA 4LISA 5AW9A 4DJAA 3KELA 4LNUB 2FEAA 2IHVA 2P35A 3AR2A 4TYYA 2IS2A 3HA5A 3O0DA 1M8PA 1UINA 5EKTA 1XNGA 1UR5A 1N2EA 4YT8A 3DR3A 2WV7A 2YYZA 1XN4A 4IDGA 5TVKA 4LF5B 1ISFA 2DPMA 4PCAA 2LTAA 3AIKA 3LKDA 4C01A 4D3SA 2X6TA 2FPIB 4AJHA 2W90A 3OZBA 3WIDA 3GFPA 4P8RA 5FA8A 2X2FA 2AN5A 2J09A 3TQTA 2V4ZA 4DGSA 2MSEB 1QNFA 4BZZA 4CV2A 4S04A 5JMWA 1M73E 1RIFA 3LP6A 4X8HA 2FZGA 3BD9A 4H27A 1N1MA 2GWRA 3TZ6A 1W52X 3MS4A 1WVMA 1RS0A 3OM0A 1ADJA 4JVOA 4ZZ0A 3T9EA 4R68A 3ZY6A 3MGBA 1WMFA 1E18A 4P92A 5E6SA 1DKQA 2MSLA 3MWYW 2DWPA 4H0FA 4MP6A 5A04A 5LQCA 4MW0A 1VLLA 4Q3NA 4L08A 4UC0A 5J2TA 3F5MA 3ZWYA 3G7UA 1SHTX 1TI7A 5EMKA 1Z6YA 1WR8A 3PVCA 3LCCA 4M9QA 4P58A 4YJHB 2BMEA 3SLGA 2OO5C 3WDKA 3IAEA 5CDUA 1RAAA 4H3HB 2WKQA 3RC3A 5L3QA 3KX2A 1HKHA 2IZ5A 5EP4A 4I8XA 3SG0A 1MC1A 5ALLA 4MUHA 4AT1A 1BJRE 1D7AA 4AZ3B 1EH5A 2FYTA 4UVIA 4ZALA 4NFSA 5ILOA 1TAUA 1IY0A 1VYHA 1WHTB 3D81A 5J5CA 2BFEA 3DHYA 5IDWA 1P45A 4U5XA 3CC8A 3HLKA 3QBVA 4KPEC 1B14A 2A9JA 2X3FA 1GCAA 1QH1A 3K5PA 3EVAA 3MCAA 3QELB 1SZCA 2LXNA 3WG9A 1GGEA 3T3MB 1J06A 4ZHSA 4JI8B 4P0QB 1RHMA 1G3QA 4REQB 5CM2Z 1N4AA 3DEIA 2CNKA 3OUUA 4EECA 5KQSA 1L8LA 1YHYA 1P44A 721PA 2DH6A 3AUFA 3JYPA 4JYBA 1U2EA 3OIWA 4PPGA 4C4YA 1Y34E 2XE7A 5HKKA 1IDOA 3G2NA 4KK4A 4EUNA 2XUOA 3QFTA 2IPLA 1XZLA 5SYMA 3TSAA 3EXG1 1XP8A 3FJ1A 3F6PA 1NPYA 3A27A 2PH3A 4FWIB 4RMNA 5ALPA 3ANNA 2FK8A 3KKEA 4N7MA 4D9MA 4U9HS 4DDHA 2NO6A 4INAA 3FB4A 2VBFA 1V4NA 2GNPA 3ZHRA 4B75A 2BP7B 1XQ6A 3JQAB 4E7PA 3L7JA 4O8ZA 2F1KA 4XI9A 3TZCA 4A2WA 3QPDA 4BMXA 4I9NA 2O8EB 1LSJA 5B6JA 2Q7XA 4GX0A 1PNVA 4IIFA 1H9CA 1ESDA 2JH8A 3ZW9A 5K4AA 5KYUB 2WVGA 4D0NA 1VECA 2HF2A 1DPGA 2GHTA 3L06A 1ZCAA 2C4HA 1XWFA 4Q7QA 4IHAA 3PDIA 2I6UA 1P0MA 3PFNA 4MA0A 4UMDA 3OJFA 1PZGA 4UBMA 1ZYUA 4I19A 1EFUA 4MWGA 1Z68A 3LWBA 4L73A 3VR5D 4N0EA 4C4OA 4RKEA 3UJ9A 2NGRA 4RZHA 1WZEA 2I3DA 1JKIA 1JEDA 2F62A 3R9KA 1SOVA 2W5UA 1WY7A 4H0CA 2Z08A 3I42A 4FN5A 3TEJA 3U4QA 3QQPA 2C95A 2JBWA 3A25A 4EYSA 1YS7A 1NLZA 2ZBPA 1LBTA 2PHZA 2HYDA 3CF2A 4L3VA 4E70A 3F3SA 5FBHA 2JD2A 2W6JD 1V7QA 3KJFA 4QC2A 1OTYA 3L8MA 1JI3A 2PFGA 1RCFA 3DFFA 3HFJA 3FNFA 4LVUA 4MRVA 3T3HA 5I9NA 3ZQUA 2EC5A 2GVNA 4KQHA 3W6ZA 1YS4A 4XW2A 3UAWA 1FMLA 2YUIA 5BN4A 2ECOA 4H9GA 2NNWB 1HG1A 3D3NA 4HDKA 4MS3B 4DLVA 2Q3CA 4X6UA 4F56A 2EG5A 4YV1A 5ESDA 4H3SA 4IINA 2MINA 1GARA 1F0KA 4UNRA 1O6ZA 1KXJA 3BRWA 4BB9A 1DIGA 4UDXX 4D41A 4JFAA 3ESQA 3ZWBA 3K0FB 4ZO6A 4HAVA 3C97A 3CUVA 5DCUA 1PSDA 1CJCA 4PAQA 4MPRA 2O8DB 4BN0A 2FSHA 2YRXA 1M1NA 2QIOA 3EARA 1DAFA 3ET4A 3GXBA 1DDIA 1JILA 1QIEA 1YUNA 2BUAA 1H8EA 4IZOA 4R2KA 4UOQA 4XLTA 4URXR 5A4MS 1XROA 3OPNA 1KEEA 4Z3DA 4M1SA 1U9JA 4NU8X 5IBRA 3WGIA 1DIAA 2AE2A 3DVRX 5TB5A 1UC9A 3CX3A 4CGYA 1CY8A 3WNVA 4RV4A 3MGGA 1J0CA 1NBME 2GN2A 4YJ3F 4FTWA 3IBSA 3R20A 4H7IA 4LBZA 4EI2A 1Z3CA 4RZUA 5CURA 2CD9A 4ODIA 4YP0A 5HM8A 2VDKB 1M34A 2CXUA 4UHFA 2YUTA 4Y2VA 4CV1A 5DHQA 1ZGGA 6ADHA 3D9QX 1AKRA 1WLSA 2X76A 4JIGA 3TRFA 3QE4A 5KYYB 2N46A 4L9RA 3GFBA 2XUQA 2C96A 3AM1A 2H08A 2FHSA 5ICMA 1OB5A 1ECFA 1UK8A 2NO5A 1FS4A 1XPJA 4WK4B 4MLCA 3RRYA 5FAXA 2CF5A 4QECA 4O3MA 2GX6A 5CVJA 5FFNA 2IQIA 3F2VA 4BWVA 1ZITA 3PVZA 5DW3A 5LWHA 4YXWA 3C3YA 1QO7A 1UUFA 1D4FA 1HZZC 1NRXA 1L7QA 1TM4E 3D1JA 3LWNA 3NRCA 4PGGA 4GI5A 3ZHQA 5JFOA 3UT0A 1H4QA 4MW4A 1G60A 4PINA 1JLLB 1A2OA 3GZNB 3A28A 1CDEA 4MMYB 2H1FA 1VJRA 2OV2A 2VAPA 1JXOA 2ZSDA 3P8ZA 2PU5A 4W6ZA 3RBZA 3ZX4A 4ALLA 4EMSA 1JG1A 4A1FA 5JFTA 3QFFA 4IH9A 4RMJA 2ZPTX 1EHIA 2BDTA 2PKXA 3EDYA 3JR7A 2C78A 3SY8A 3ZQ6A 3KR1A 4YR7A 2ZYDA 3F2IA 4YWHA 1M3SA 2JS7A 2OG1A 4HDSA 2I7CA 3RAFC 2NTJA 2X5JO 4M1ZA 1U65A 1P62B 1I01A 4CVNA 5JY6A 3PFIA 4AY5A 4ND5A 1ZQ9A 2OBBA 2PGNA 2QT0A 3JD0A 3JU3A 4URZR 2PBLA 3UB2A 4YIKA 1R4NB 4EY6A 2D2FA 1YZLA 3HBNA 1UBKS 3QU2A 3P2MA 4MQLA 1S1CA 1U5CA 3KPWA 3RYHA 3TQIA 2QYSA 1N8KA 1PP4A 1EK0A 1JFLA 3NPMA 4MITA 4UUQA 1WB6A 2B35A 2GXUA 4GPAA 4JJIA 3VR3A 2ZB4A 4IDNA 4LZOA 3WV5A 4RAQA 3O9VA 3IURA 2J9FA 4EBBA 4YTEA 2QX6A 2YYAA 3C1TA 4A16A 5TPWB 2B4AA 3BJIC 4G1FA 3TWOA 2DC1A 3TO5A 3VDRA 4DLLA 5CVTA 3A10A 1MHTA 1SBYA 2QRVA 3D31A 5IJ9B 4AKIA 1K5HA 2WHPB 3DQZA 4GDFA 3CCCA 4FC7A 5U4QA 3BRSA 2CDCA 3R3HA 2KMLA 4NV3A 1B7GO 1CR4A 2E4VA 4KL8S 4JKIA 1YULA 1FXSA 2RAPA 2CHGA 1E3TA 3O38A 3DZHA 4U8HA 3UAZA 3AVQA 4GWKA 1PDVA 3M34A 3K0AA 1KZGB 1T8RA 2ZIFA 3Q9UA 4J03A 3OQHA 1P2UA 4GYWA 4RD6A 5ALEA 5IWCA 1YS2X 2J41A 4O4JB 4Q18A 4XVUA 3K96A 1RBZA 2HMAA 5H4HA 3BHNA 4FDTA 4EB0A 1T2DA 4PSDA 1CUSA 1QAMA 3RC8A 4Q03A 1KI2A 3KZ1E 4XFDA 2Q6OA 4HOYA 3B38A 3QOXA 1WPRA 4LN1A 4WUVA 5DTQA 5LBUA 2GN1A 3SBDA 2C9ZA 2ZXEA 2ZJBA 4KODA 5KINB 2WILA 2BWJA 2Z58A 4CPDA 3WZMA 4MP8A 1SCAA 2Z1NA 2V6MA 4Y1GA 5DNUA 1PO7A 2P0YA 2PCLA 5CM9C 2HGZA 1IEVA 5BOSA 3B6KA 1Z06A 2VJOA 3DAYA 7REQB 3EH1A 4JODA 2RKWA 4Y1FA 1LY1A 1V45E 3UCXA 1SKAA 2ZG6A 5EWLB 1IUNA 4ESHA 4F85A 3QSYA 2ZWOA 2PX4A 3SX4A 5CYOA 3BM5A 5LUBA 2ZUEA 1D4ZA 4WOBA 1JRLA 1MIOB 2AFHE 4H6PA 2H3HA 4X8LA 3DVQX 4BQNA 1D2GA 1XQWA 1YQQA 4IS2A 5JANA 5JS6A 5LU9A 3NPAA 2NAPA 2EERA 1DLJA 4JVSB 4Y2YA 2YWCA 3D6AA 2G0TA 2CLFB 2REQB 4CKWB 2GRAA 5FORA 5LD2B 4ND8A 3STVA 4GYJA 4RIFA 5KCMA 3MXOA 3O95A 1RWWA 2QD5A 4LY3A 2IIBA 3WL5A 1ZEJA 3FMVA 4ND7A 2HBYA 4EG6A 4CMHA 4EHHA 1F20A 1NVTA 4P4UA 1KRXA 4DV5B 1B3BA 3KJEA 4XYGA 5HK9A 2Y1EA 3DV2A 3T1NA 4XM0A 1MH9A 1KI4A 2F3TA 1U2GA 3PGLA 5FWXB 4FR0A 1M67A 1PF7E 4CIDA 4EO7A 3LLUA 1ZM4A 3SSNA 4JQCA 1USVA 4RY2A 4QTXA 4L5AA 4CLRA 3QWHA 3WK6A 4ARAA 4R41A 3HJTA 4DRZA 2G77B 4J90A 4WGFA 5EJIA 3CHYA 2O3TA 3NH9A 4YCAA 1V16B 2F43B 5HILA 4C05A 1WUKS 1WD7A 4DSNA 3ETEA 1VCNA 3EXHB 3J7TA 4P7BA 5J2TF 3T7CA 5CA0B 2VA9A 2WF5A 3OZWA 3R7BA 3PUVA 2BFBA 3UWPA 3W8DA 5B2ZA 4US2R 5HZKA 3GCDA 3H04A 4QD3A 5JVDF 1DAEA 2QN7A 1K1EA 3A8TA 3IIJA 4YGYA 2PNJA 1A0OA 5IS2A 1W2WB 4CCSA 2D2XA 5KSZA 2BEWB 1QKKA 1A76A 3QYAA 4WK2B 4CF4A 2P69A 5K20A 1NONA 3AFNA 1EP9A 3O1HB 4I08A 4D92A 4E2ZA 3E5MA 5F9MA 1Y6FA 2DWCA 4YRCA 5HCIA 1U8FO 4LGCA 4WK0B 4WZAA 3FOEC 1USGA 2B4QA 1KS9A 3UFBA 1TXGA 5B1EA 1CDZA 4J0EA 2XMQA 1OT3A 2Z5GA 5KYTA 1KDRA 3MBIA 5HPYB 2VCHA 5A71A 3WMEA 1E8NA 4AG3A 4UFOA 2JHAA 1PYGA 3ADCA 1E1CB 1XA4A 4KNWA 4XFJA 2IX3A 3K5WA 3LSYA 1HNNA 4JNKA 4ZVKA 3X1ZA 5CDHA 3F7OA 2BIFA 3ZLJA 5CRIA 2PPLA 2R8BA 3CRRA 1HRDA 3KSDO 4N0PA 4LE1A 1WF6A 4OI2A 3MWDA 3B1XA 4K8RB 1FRFS 3BXPA 5EMHA 5EYPB 5HIJA 3THYA 1B4DA 4TMWA 5FA6A 3BWCA 3TTWA 1DWQA 1FS5A 2B69A 1Q0RA 3BTOA 4G5SA 3TW4A 4AD8A 4D9FA 1D4AA 3KQPA 4UM9D 4FDAA 1CULC 1T26A 3IESA 4Q4JA 4A6DA 4IDFA 1DAKA 3WKBA 1P75A 1UBRS 1V39A 2G70A 2WVHA 4D4GA 2G80A 4PM4A 4L0DA 1ODIA 4RTSA 3RADC 3W5AA 3EWSA 5DHAA 5BN3A 4EFNA 4RV9A 3SR0A 1SC4A 1FNNA 2RH9B 1X3LA 4RA6B 3VQTA 3SSOA 1JWLA 4QOJA 1IUPA 1GOTA 2ZRNA 3C7DB 1XTPA 3KUDA 5JY1A 2V7QD 2XZDA 1GLGA 3MAGA 4KIWA 5AOCA 4Q9IA 3W7VA 1YRBA 4AJIA 3KSAC 2GPWA 3FD8A 4C4PA 2P7IA 4FMCF 3M0EA 2Z2KA 4WLFA 1LBIA 1YZFA 2QP3A 2YY6A 4WKOA 1U2TA 5DCLA 1ZR4A 3ZZNA 4JBIA 3RYTC 4OMDA 1B73A 1EQAA 2IU6A 3GCGA 1YOVB 3K20A 5CG1A 2A0YA 4XZ3A 2G9VA 1JAZA 2OZLA 3CURA 1BDJA 2F1JA 4NDNE 2BCEA 4UQPA 1FDUA 1L5ZA 1USKA 4IDQA 3U26A 4C6TA 2JDIA 2R87A 2Z56A 1PR2A 3OZRA 1H9BA 1TQ6A 2XCQA 4QUEA 3T06B 4TXLA 2C2BA 3ADPA 4KR7A 3OCYA 2HNAA 3KL4A 1JHPA 4ND4A 3VYUB 4MCAA 1EFPB 2FFAA 2VOJA 3QBTA 4EATA 4ZCRA 1OH8A 4ZOLB 4ZIRA 1FEZA 1V9SA 4ETMA 5FLEX 3IHLA 4CZ2A 2H11A 3CH5A 4K6KA 3ZBTA 1NBHA 4EQZA 1JFSA 4CL2A 4MQMA 1E20A 3QMWA 4OKIA 5JCOA 3FOFC 2DXIA 3KKPA 5BY2A 9GPBA 2B7BA 3NOVA 4GX1A 5DGIA 5JRJA 4JDPA 1ZNYA 2XUFA 4J7CA 4WNAB 2OXFA 4E22A 5MN6A 2PPVA 3E8MA 1VXOA 4FLFA 4MV1A 5AVYA 2C58A 1V6CA 1W9MA 3HUUA 4YBZA 4HYEA 1P18A 2XYGA 3MERA 1MN6A 4E1BA 2FCRA 4MRNA 1H23A 3JQGA 1IE3A 1UMCA 4LSWA 1KMHB 2QM8A 1HT1E 1W73A 1W8IA 2LW7A 3EZGA 5AKZA 5BVHA 4BNXA 2P7HA 1GTVA 3TOCA 1P8AA 5FRDA 3NNSA 1FYVA 4Y2TA 3BQNB 2FPWA 4XE5A 4NOLA 3CSUA 4MR9A 4QFBA 2ZYWX 1N3BA 2X8WA 2AF3C 1P29A 3DQQA 3PHCA 1QHSA 1CD5A 1UL1X 5JZ9A 4UUMA 3U61B 1W36B 3HI4A 3N5KA 2FAXA 1N3LA 1T2VA 4UUPA 5IN4A 2J0EA 1ODKA 2JFYA 4R1PA 2WAXA 5E4TA 4POOA 3HBJA 4EMTA 3NT4A 5CPFA 5U9CA 2O2XA 4LYEA 4Y2GA 4WJKB 5KUTA 3BS4A 1ATIA 1T2FA 3MWFA 4HQ0A 3ZD9A 2ORWA 1O6FA 2W83A 4GR9A 2V03A 4KW7A 3HA3A 4QXRA 3F5FA 4F4FA 5EHGA 2F00A 1ULAA 5H3HA 5KWVA 3U4IA 3CZMA 5CXQA 2ODBA 3CIOA 3A4NA 1L7OA 4ML3A 3AGQA 3F6RA 1ZNZA 3FWKA 1TFRA 5F73A 1WOYA 2IOHA 5FTKA 1SK9A 3SXPA 2PMBA 3Q4GA 3E2PA 4A9AA 5JCOC 2O3UA 2TS1A 1MPXA 3NXKA 3WSTA 1PR4A 4IGFA 5DGXA 5HIMA 2FXIA 2QG6A 3OFVA 5LMZA 2W4QA 3FBGA 3SHOA 2YIVX 3C6KA 3RODA 3CNEA 1N7IA 4JYPA 3WKCA 5I8WA 2OLJA 1XJ0A 3N59A 3T7JA 1DKOA 3UBMA 2G08A 5KTRA 4KAAA 1NPTO 3T3NA 1IHUA 2RHGB 4WNCA 1Q50A 3VZDA 4B4DA 1FMCA 2ADMA 4AX4A 4DTCA 1UIMA 1E1QD 2G36A 1UOPA 4EPRA 3GAFA 4LHXA 2O0HA 3UKOA 2DSNA 1Y42X 4B6FA 3QKSB 1TECE 3MOGA 2HPZA 3EK2A 1IOZA 2BZSA 2ROQA 5KPDA 3EDMA 4TROA 5HKLA 3DSRA 3L84A 3ZZTA 5AK4A 1WDLA 3ZHCA 5B5SA 2VDLB 4TV9B 3GUHA 3NP7A 3NEJA 1RZRD 1O7JA 1Z6AA 2OBYA 3IPCA 5DNVA 4BMPB 1FVHA 3A7DA 5IBQA 2GF9A 3LXMA 1XHLA 1PTKA 3AW8A 3RUCA 5D3MA 4BVGA 1TPZA 4V0ME 1JGTA 4ZVTA 3ZK7A 5C1PA 2ID9A 2WIDA 3ZNQA 5FR2A 1JBKA 5IG2A 4G0UA 2FZWA 1TM1E 1LKZA 4PG8A 2ENUA 2XUHA 4I1YA 1Q44A 1SHUX 4IGAA 4QUKA 1X38A 2CFRA 1DV1A 1OLUB 4J8PA 1L4LA 4M37A 2QRUA 4L8YA 2HZBA 1VKHA 3AKEA 1LK5A 4L4XA 5C4MA 5G0UA 4GP7A 1BH6A 2X5XA 4DCNA 5A03A 4HEQA 1G20B 3OPYB 1LA2A 5KREA 1EXMA 3CYFA 4IEFB 3CW9A 2HQBA 4RTJA 4DMUB 5D6OA 3H8JA 3JQ8B 3L9XA 3FTCA 3A6GA 3B2NA 4Y9DA 4BU0A 2HH9A 3R2JA 4OHKA 5DXJA 2J33A 1HEUA 2R7MA 4HFNA 5EESA 5KJ6A 4W5TA 1ISPA 1XZFA 1XTUA 2XMDA 3ZI4A 5FTNA 3SNHA 1T8TA 1BCSA 2TMKA 4CDRA 5BMOA 2O57A 1CY2A 1T6XA 4P7GA 3UHFA 1ZX1A 2C4WA 2QJFA 2WJGA 3PE3A 2PTGA