5K3AA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/fluoroacetate - cocrystallized - both protomers reacted with ligand
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
295
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGNFLPEEAPDQTAEALVRFFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
molecule tags Hydrolase
total genus 113
structure length 295
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3aA00
3AIMA 1EDEA 4NS4A 3F8SA 4L3WA 1CUDA 3DNMA 3O4IA 4OB8A 3NOXA 2VF2A 1USWA 5K5EA 1BN7A 3O9VA 2HU7A 4ZRDA 4DM7A 1T4MA 3D5EA 4Y2VA 3KWFA 3VJMA 3IUJA 3DS8A 4N5HX 4UFOA 1J06A 2FX5A 5CH8A 2JGJA 4J7AA 2Z5GA 5E4YA 1TCCA 1ZD3A 2OCKA 3ZLVA 5A71A 1O6GA 1AUOA 1ZICA 4JYPA 1VJ5A 1ZI9A 2XMSA 1QGED 5AKLA 3FYUC 4Y2PA 4JUIA 3GA7A 3DD5A 3H19A 3B5EA 1EK2A 1DWQA 1Y7HA 4IO0A 3WL6A 4LXIA 4F5ZA 2XMZA 5HKBA 3O0DA 4OB7A 5HQ3A 3H04A 2OPHA 5LZ2A 1LLFA 1R3DA 4G5XA 5ALLA 5E2IA 2J3DA 2ZJ6A 3FLBA 3WZMA 1LPSA 2WHPA 4E46A 2ACEA 3T4UA 4FLMA 3WA6A 2I3ZA 5JAPA 5HZGA 2HM7A 5CT4A 5DTJA 1QOZA 3CCBA 4KRYA 1MO2A 2XQGA 4Y2SA 4H35A 4JH0A 4B85A 4RNCA 1WCYA 4H0CA 4HXGA 2GBCA 2YYSA 3A2MA 4B80A 4G9EA 2HIHA 2OAGA 3LLCA 1XROA 2G4LA 3IURA 1LNSA 4NMWA 3Q8WA 2X5XA 3VDXA 1R9NA 4U2CA 4A23A 5FUMA 4E11A 3MGAA 4LYDA 4HRYA 3C43A 3G9ZA 4MXDA 1AGYA 3G0CA 1M33A 1K8QA 3WKBA 2HU8A 1KU0A 5CMLA 1TAHA 5LZ9A 3ESAA 4X93A 1AMNA 1B41A 4N8SA 2I03A 5K3CA 2XUDA 1IUNA 1DTEA 2HU5A 3C8DA 4CCYA 2WUFA 1EXWA 4Y7DA 1XZJA 4TGLA 4F0JA 5SYNA 3CN9A 1A8QA 3FVRA 3WA7A 3H2GA 2XMCA 3H2IA 4UBMA 1ZGBA 1YB7A 3C5WP 3G0IA 2OAEA 1CFJA 1BE0A 5ALWA 3SWWA 1H22A 1EA5A 4CIAA 3ZWQA 1HKHA 4J0CA 3H2KA 2QS9A 3WIOA 2CEKA 2PSJA 1ZOIA 1GKKA 3DCNA 2XUQA 3EBLA 4CCWA 4C4ZA 2WJ6A 4JNCA 4QLAA 4ARBA 2Y6VA 3ANSA 3EQ7A 2VAXA 2H7XA 4H7IA 5AI0A 4QDOA 2C5GA 2OG1A 3CCCA 1DINA 4MYSA 5JALA 1R9MA 1LBTA 4X71A 4HZGA 4J0HA 5LP1A 1G5FA 4ZREA 3H0CA 3C6XA 1HPLA 3H17A 3STTA 2HA3A 4NZZA 5HKAA 2O2GA 1QIIA 2VEOA 4K6KA 1W52X 5DLPA 1JT2A 4X85A 2XLBA 3R3UA 1UZAA 4EY6A 4G1FA 2WIGA 2VTVA 3DLTA 4FFWA 1LPAB 7YASA 2DHCA 3F9CA 4HXFB 4J0JA 3RLIA 5HFNA 4B9AA 4KAAA 3FWHA 2PVSA 2ZYIA 5AKJA 2HHAA 4OYYA 4UHBA 1EX9A 2I78A 1QIEA 1A8UA 5ALIA 1W4LA 4J0GA 2BUAA 4UBNA 1Q0RA 1A88A 2WG0A 4J0KA 4FLEA 4X92A 3QMMA 4BRZA 1P0PA 4AO6A 4I19A 3ICWA 2Y6UA 1SOMA 3IA2A 1QIHA 4XWGA 4Q82A 4K5QA 4LKOA 3HACA 5FRDA 2QXUA 2JGLA 4HXEB 4O08A 5FDFA 3MVEA 3H2HA 2JEYA 1ORWA 4BBZA 4U2EA 3BE8A 4DMHA 1MNQA 2O7RA 2XUKA 3EQ8A 4X00A 4W1PA 3KXPA 3I6MA 4KE7A 5AM3A 1VE7A 4QWWA 4AMYA 3FCXA 3O9MA 3AIOA 5JAHA 1EVEA 1HL7A 5AM1A 4Y2YA 1UXOA 3Q0TA 2ZYHA 2XQIA 4Q05A 4X6UA 2OQIA 3O4GA 1JMKC 4AZ3A 2HA2A 4LIPD 2VQ6A 5EHXA 2JBWA 4HS9A 5AK3A 1GXSA 3DOHA 3GELA 3BIWA 4MQLA 5T4EA 2BKLA 5IKXA 3C5VA 2OQVA 3W2TA 3WJ1A 2HFJA 1UOQA 4Y2RA 1NX9A 5AO9A 1WHTA 5AHXA 3IUNA 1MX1A 1CUEA 2XUIA 3FSGA 4PSUA 1YA4A 2QUBA 4DLNA 2WFZA 5AM5A 4X7BA 3F67A 4KJXA 3FNBA 3BJRA 1IZ8A 2CKMA 1EDBA 3O95A 2QRUA 1JU3A 1QE3A 3I6ZA 4F60A 5KBYA 2ES4A 4BVLA 1SCIA 2WHRA 2GYWA 1X2EA 5ALPA 3B12A 2HA5A 5AM2A 4DTCA 3WWEA 1QZ3A 4C6HA 1YB6A 2R8BA 1X70A 5EHQA 4BC1A 1W75A 1EH5A 4N8DA 3WWPA 3DKKA 5J3JA 2EDCA 3K2IA 4N8EA 4ZI5A 2XQJA 3GFFA 5ALJA 3WJ2A 5AOBA 2DHDA 3FYUB 3AFIA 4UBIA 2JGKA 1CUIA 4DSAA 5ALNA 2WIKA 5ALTA 4YX9A 4X95A 3EIOA 4KYVA 3CN7A 4DYHA 3AUKA 1K4YA 1H2ZA 2FJ0A 2B61A 2RONA 3PFCA 4GECA 1EK1A 4AN1A 2WIFA 3E1GA 5DWDA 3H18A 3STXA 5JANA 1XZMA 1YAHA 4Y9SA 1F8UA 1W6RA 1K63A 4KR0A 1QFSA 1VXRA 4H7EA 4EBBA 3STVA 5AK5A 5I8PA 4UBLA 3EF3A 1XRMA 1CR6A 2GBFA 4UBJA 1VKHA 4Q34A 1EVQA 1GGVA 2PUHA 3VJKA 1H2YA 4DNOA 2WQZA 3JWEA 1LPOA 3WK4A 4N5IX 4OYLA 2HA4A 2PU7A 2AJCA 1BEEA 1XZAA 2CMFA 5IVHA 1CUSA 5A2GA 1YS1X 2H1IA 3LS2A 1WPRA 3I6YA 4CG2A 2XMGA 2DHEA 5IVKA 2YXPX 3OTQA 2PSFA 1NU8A 1XZLA 3PI6A 3WZLA 1BRTA 1N8SA 2WHQA 3HLKA 4HAIA 1YR2A 3TGLA 5CXUA 3G9XA 3D2CA 4BZZA 2ZSHA 5KWJA 3W9BA 1GT6A 3FSGD 4BVJA 2WIDA 4X91A 1U65A 5LKRA 4UHFA 4OU4A 3HJUA 1THGA 5HF5A 3UMJA 2HFKA 2HADA 3VISA 1XRNA 3BJMA 4BDSA 1CQZA 5AKYA 2AJ8A 4GXNA 2G5PA 4H7DA 1CUBA 1I6WA 4EUSA 2V97A 1BCSA 1CUYA 3WKCA 5K3FB 4Y2TA 4BDTA 1XFDA 4JEIA 4UHHA 3IVMA 4W1RA 3V1NA 4QNNA 4FOLA 1J07A 5ALQA 1QO7A 3A2NA 5EHZA 3SK0A 3I2FA 2J3QA 4FMPA 2Y1KA 1ZGCA 3K9BA 2WG1A 4V2IA 2WU3A 4CI9A 3ESBA 1N1MA 5ALVA 4DNPA 5A62A 1DX4A 5EI5A 1ZD5A 3X3HA 1XZFA 1YASA 3V9AA 1BS9A 1XZEA 2EEPA 1GQRA 3WWCA 5D7BA 4RPCA 3LIPA 4OU5A 4M0EA 4MWSA 3R0VA 1WOMA 3IDAA 4BCCA 4NVRA 4FNMA 3W06A 3I28A 3V1KA 1QIGA 1K5PA 2BUBA 1P0IA 1DX6A 4J0IA 4CG3A 4UFNA 4H18A 4KAJA 4CG1A 3UUEA 1AC5A 1JKMA 2WTMA 3D3NA 2VT7A 1CUWA 1XZHA 2DQZA 2CUTA 3DYVA 4AMZA 4G8CA 5AM0A 3WKAA 1ZD4A 2VJDA 4M0FA 4B6GA 3V48A 5IH7A 3G9UA 2QM0A 2BUCA 1JI3A 4INZA 1E66A 3RARA 4J03A 1XZIA 1D07A 1QTRA 3JYHA 1NU6A 2QJWA 4G8DA 1QTIA 3QZUA 1XLUA 5CT9A 2AJLI 4RE5A 4UFPA 2PSDA 1C7JA 3R3XA 4B7ZA 1CUZA 2YH2A 4QDUA 1LPPA 5LZ4A 2QMQA 5CT5A 1DWOA 1W76A 3O4JA 4TVKA 4QDTA 2Q0XA 4G8BA 1C7IA 2VATA 1UK7A 2Z3WA 4C4YA 4WY5A 1QIMA 4OSEA 3D4LA 5ALGA 2C7BA 1JFRA 2JEZA 2HRQA 5AIBA 3BDVA 3K6KA 3FYTA 2IIVA 3C45A 4ETWA 1ODCA 1AQLA 5ESRA 5AKIA 1MN6A 3LCRA 4UBKA 5EFZA 4B81A 1HDEA 3IUMA 4LHEA 3QITA 1VA4A 5EIHA 5AICA 1C4XA 1P0MA 5ALYA 1YCDA 4FWBA 5T4FA 2QT9A 1SCKA 2PU5A 2XLCA 4OCZA 3PFBA 3PUHA 4I4CA 3ZLUA 3F98A 5YASA 2H7CA 1YS2X 1CUXA 3FYUA 4H7FA 2Z8ZA 4Y2QA 5CT6A 4FKBA 4ZV7A 1QIKA 4ZXFA 1OCEA 5CURA 3DDUA 4MYDA 1JMYA 2PSEA 2O7VA 1ZIXA 3IUQA 1AKNA 1VE6A 5FPQA 5DYTA 1GPNA 4B84A 1IUPA 2OGZA 1G66A 4I3FA 1ACLA 4AQDA 3MUOA 3QVMA 3HC7A 2GYVA 4HVTA 5AKZA 1R50A 3S8YA 1DT3A 4WFKA 4WY8A 3I1IA 1ORVA 3ED1A 1BROA 3H2JA 3OM8A 1Y37A 1XRLA 3WL8A 3D2AA 2HA0A 4FLFA 1EB8A 3OG9A 5IVDA 2HA6A 1SFRA 5JATA 3NGMA 1TCAA 1UT6A 5JADA 5JARA 4WFJA 1MX9A 4LXHA 1CQWA 1WM1A 4FDMA 4KE9A 1KU6A 1VZ2A 3I1YA 3R41A 4P93A 4QWMA 4L0CA 4X90A 4X94A 2B20A 3FCYA 3W9UA 2XQKA 4BAUA 4DNQA 1XQVA 4PSDA 4IH4A 4U2DA 5AIAA 4G4JA 1MT3A 4C89A 4OPMA 3RKSA 5IVIA 2H9YA 1AURA 4EHBA 5F4ZA 4BC0A 5JAOA 5DJ5A 4ZWNA 3HSSA 4PQEA 3FLEA 5JD4A 2XI4A 3WL5A 4P9NA 4ZGBA 3DOIA 3O4HA 4FBLA 2X8BA 2XMQA 5JD5A 2XE4A 4MJ3A 5ALEA 1XZBA 1SC9A 5AKHA 5K3FA 3WYDA 4DMCA 5JZSA 4IHAA 1BU8A 5HCUA 1LZKA 4EA6A 3DQZA 3ILSA 4FTWA 2WUEA 2XUFA 1ODTC 4B82A 2PKYX 3PUIA 5FP0A 3L1IA 5AKKA 5HK8A 5KWIA 1UK6A 1CIJA 3FBWA 3WYNA 1G4HA 3L1HA 1EDDA 1MAHA 4DMFA 5DNUA 2YASA 3SC2A 3GZJA 4XIIA 1IUOA 1DQZA 1VXOA 3AINA 3W04A 4BZWA 4GBGA 5JZ9A 1CUCA 1XZDA 1DQYA 2ROQA 1GZ7A 4U2FA 5CRIA 3PF8A 4K2AA 2WU4A 4HTAA 2O2IA 1QO9A 2XUJA 3I2JA 2V9ZA 3I2IA 2QJRA 4KE6A 5EHNA 5BV7A 3NUZA 3LP5A 5ALXA 2RGUA 3ANTA 3GUUA 2W22A 2C5FA 2RIPA 3I2KA 3I2GA 2XUHA 1VLQA 5I7UA 5AK4A 1QIDA 3ZI7A 1CV2A 1E8NA 3V1LA 2BGRA 3AILA 4AO8A 3U1TA 3HABA 4MQMA 2QR5A 3HI4A 1CUVA 1Y7IA 4KEAA 2WKWA 1UKAA 1W1IA 2QKYA 3I2HA 4MEAA 3R3WA 2XB6A 1U8EA 3R3YA 2C0PA 4OUKX 5CBKA 1UOOA 1EB9A 5AH0A 4YPVA 5EGNA 5LZ8A 1VOTA 1IVYA 2K2QB 1THTA 4X3CA 2GBGA 1IMJA 2OLEA 1MAAA 4W1SA 1X2BA 3VXKA 1ZJ5A 3D0KA 4FBMA 1CUFA 1XQXA 2WFMA 1AZWA 1U2EA 1SCQA 5HF9A 3WK9A 1HLGA 4GW3A 2WG2A 4BRSA 2CZQA 4EY7A 4KE8A 4MEBA 4QLOA 2PL5A 4DMKA 2OCIA 3WK6A 5D3ZA 4BE4A 4GI1A 2RHWA 4Y2JA 5A7GA 2WJ3A 2OCGA 4YASA 2XT0A 3FAKA 3VJLA 3ESDA 1CUUA 3G02A 5FKJA 5AOCA 2J4CA 1XLWA 1UOPA 3QPDA 3G9TA 4YK7A 1J1IA 2OXEA 5K3AA 5FOQA 2UZ0A 5I9IA 2Z3ZA 4Y2UA 4GWLA 4BP9A 4ARAA 2QOEA 5ALUA 4ITVA 4U2BA 1JU4A 4U2GA 3D2BA 2IITA 3WKEA 4BTLA 3D7RA 5ALHA 5AK6A 2G5TA 3KOOA 4AZ0A 5JZBA 4WDRA 1QFMA 3STWA 2WFLB 3QPAA 2ZSIA 5ALFA 1MU0A 2XMBA 3QM1A 3U0VA 1HQDA 3C6YA 1BEZA 6YASA 1L7RA 1GPKA 1CUJA 3STYA 3KD2A 1VA5A 5AI4A 3BDIA 3BL8A 3DYIA 3OC0A 5K3DA 1N5RA 4BYMA 4BTVA 2V96A 5ALRA 4E15A 1A8SA 2OGSA 1G42A 5BWCA 3TRDA 2I3DA 1XRRA 1XKTA 3FOBA 4IQ4A 3VKFA 3M81A 2PPLA 3PE6A 5A7FA 4CIBA 3R3ZA 1LPBB 3UUFA 4GLBA 5K3BA 3C87A 4DIUA 1ZIYA 2XQFA 4A16A 1R1DA 1CVLA 3T52A 2AJDA 1L7QA 1CLEA 5AI5A 3AZOA 3GBSA 5ALSA 1FJ2A 2D0DA 3HRHA 1MJ5A 1UFOA 1ZI6A 3AZQA 3D59A 4Q3KA 1CEXA 3EQ9A 3BF8A 1MNAA 4S0XA 5HF6A 2O2HA 2BCEA 4J3JA 1QLWA 1K6EA 4UBOA 3QMWA 1IZ7A 2PM8A 4KAFA 1UWCA 3E4DA 1CPYA 2JGIA 4EZIA 5AJHA 4UHCA 2Y2VA 5HK9A 1TIBA 3OURA 5EIAA 1QIFA 3AIKA 4WCVA 4CFSA 3H1BA 4XVCA 4QDZA 5CT8A 1A7UA 4W1QA 1WHSA 4LXGA 3KSRA 2W6CX 1OILA 2WLSA 3WK8A 3WK7A 3BIXA 4JYMA 1E3QA 2IX9A 4L9AA 5C8ZA 1XRPA 3WQHA 3S2ZA 2VJCA 1TCBA 2R11A 1XQYA 5CW2A 1TKRA 5C7YA 4P08A 1BCRA 1XZKA 3H1AA 3AZPA 5LKAA 5AI9A 4X6YA 4WDQA 1DWPA 1B6GA 2ORYA 3HEAA 3R3VA 4D9JA 2VSQA 1YA8A 2QZPA 5T4BA 3N0TA 3JW8A 3A6ZA 5CH3A 2ZJ7A 1CUHA 2PSHA 3E0XA 3KDAA 3OOSA 5JD6A 4BE9A 1QIJA 3P2MA 1LGYA 3WIBA 4B0OA 3SX4A 5CXXA 2WM2A 2JGEA 1XKLA 5BOVA 2WUDA 4Y2XA 3WK5A 2J4FA 2E3JA 3G0DA 4Q3OA 3WWOA 4GHWA 4BB0A 3A70A 5DTIA 3KWJA 2WJ4A 2WIJA 4F21A 1LPMA 5HFAA 4DGQA 5DNVA 3E3AA 2CB9A 1E5TA 4G4GA 4L72A 2XUPA 4Q1VA 4PW0A 3OPMA 4HRXA 4UHDA 1AX9A 1Q83A 2QUAA 2QXTA 1CUGA 5JYCA 1ETHA 2WSLA 4QDXA 1MPXA 4W9RA 1PJAA 1XLVA 3F96A 3ZLTA 1PFQA 3QBJA 3A2LA 2V98A 4X97A 4EB0A 1JJIA 4PO3X 1CUAA 2Y2UA 2OGTA 2B9VA 1R88A 1FFEA 5D6OA 3HZOA 1ISPA 1XZCA 2BJHA 4RE6A 1KEZA 2DSNA 5ALOA 5ALMA 2VJBA 5AP9A 1CRLA 3IULA 5KREA 5LZ7A 1Q0ZA 2OCLA 5DYWA 5EIEA 1TK3A 3AJAA 4BATA 4KACA 1E8DA 4UPDA 4H7HA 2C4HA 4PSCA 3B3QA 5FXMA 1GKLA 1WB6A 5LIPA 5ALKA 2DFPA 4DSZA 3VVLA 1JJFA 1F0PA 5AI8A 4QE3A 3YASA 4MWTA 4DNFA 3G7NA 2WFLA 1WPXA 1LZLA 1RP1A 5SYMA 3IBTA 2VT6A 4E14A 4J0DA 4BP8A 2HRRA 5A6VA 3G8YA 3QYJA 1PV1A 2PX6A 3L1JA 1VZ3A 1S8OA 3HYSA 2G63A 3FLAA 4C88A 4G4IA 1Q84A 2LIPA 2CBGA 1DT5A 3WKDA 5AOAA 2XMDA 1N5MA 2ACKA 4H7KA 5FLKA 3C70A 2GZRA 4WFIA 2ZYSA 3ESCA 1J2EA 1RYYA 4ROTA 1GQSA 5ALDA 1ODSA 2FUKA 4PV7A 5JIBA 3ZPXA 2BGNA 3BWXA 3G0BA 5HQ3B 1ZJ4A 1UKBA 1LBSA 3WI7A 5H3HA 4C4XA 5DNWA 5JAUA 4P92A 1FFAA 1UK8A 1ZD2P 4H7JA 2WHPB 4LYEA 2GBIA 5E4JA 2JIDA 1XQWA 4GDMA 1BN6A 4K6GA 4GEGA 4IH1A 4Q3LA 4EY5A 4W63A 5C81A 2RAUA 4XX1A 3DEAA 5ALZA 1FFBA 4WJLA 2VA9A 3ICVA 1HBJA 2NW6A 5AI6A 4EY4A 3WWDA 5AKXA 1H2WA 2DQYA 5LYYA 3HXKA 1EINA 1ACJA 5D3KA 4FFVA 4OD0A 1T2NA 4AXBA 2HA7A 1TQHA 2DR0A 5ISMA 1H2XA 2XUGA 3MUNA 1FFDA 3IB3A 3V1MA 2PBLA 5C8XA 1FSSA 4KRXA 2CJPA 1TRHA 3DL4A 3DJYA 1WB5A 4AN0A 1GPLA 2ZVDA 3M83A 4BCDA 4EY8A 3IIIA 4QEKA 4C87A 4Z49A 4AO7A 3WL7A 5C8VA 1H23A 1QONA 2X76A 3N2ZB 5CH5A 5A7HA 3DL7A 3C8HA 1XZGA 4CCYB 1UK9A 5BWBA 1UKCA 3M82A 4G9GA 5AM4A 3PDCA 4BCBA 5E4TA 2RI6A 4K6HA 1E8MA 2B4KA 4BAZA 3DKRA 2H7YA 2EDAA 4RGYA 3STUA 1FFCA 1WB4A 3FVTA 2BFNA 2C58A 5LZ5A 1EI9A 4B0PA 3LIIA 5HF8A 2WILA 2GYUA 3C6ZA 2XMRA 2C0QA 2WTNA 4B9EA 2HL6A 1JJBA 4XJVA 2Z8XA 5DYYA 1E89A 3WLAA 1EHYA 2PUJA 5LLSA 2ECFA 3R40A 1YAJA 3WMRA 1QJ4A 1MX5A 3PF9A 3RM3A 1OXMA 4BVKA 2FJPA 3QPCA 3CXUA 4TPKA 3VVMA 4OB6A 4H77A 4UHEA 2AJBA 3GROA 5AKEA 2QVBA 4B83A 1MTZA 3PICA 1XRQA 3QMVA 3BXPA 1R4ZA 1P0QA 2ONCA 4AB1A 2JGMA 1U4NA 3G0GA 2ZYRA 2JGFA 2XUOA 4PF1A 3ZV7A 2JF0A 5K3EA 4FHZA 2GZSA 2XDWA 3NWOA 4FNGA 5CTAA 3QH4A 1LPNA 1F0NA 2RHTA 5FPPA 3TJMA 4ZV9A 3TEJA 5T4HA 2P8SA 2QTBA 4C01A 4AX4A 3RK4A 2XUAA 4A5SA 4M0MA 1YSCA 2DCMA 1DU4A 2AXEA 2WUGA 1ZI8A 4PNZA 2VJAA 4QA9A 4IH9A 2D5LA 3C6BA 1Z68A 2ZJFA 2VAVA 1L7AA 5JASA 4X6XA 3F97A 4BAGA 1F6WA 3W05A 2BAGA 4UUQA 4QZVA 3BF7A 3M3DA 5AKGA 2HDWA 1O6FA 1RWQA 5FV4A
chains in the Genus database with same CATH superfamily
2H65A 3AIMA 4PZPA 4AICA 3TQRA 1YNSA 4KIWA 3DNMA 3O4IA 1Q1GA 4NBLA 2I4OA 1ZSVA 1J4AA 1DO8A 1NUUA 1USWA 3LFUA 2CWWA 2UZAA 4OHVA 1PBNA 2F2TA 5EUMA 1CE8A 3L6EA 4GMFA 3BFPA 1DCMA 3NTXA 1DAOA 4UE2A 5SZKB 2BFBA 4A91A 2HT1A 2V7TA 4JC8A 4FYWA 1Z6GA 4BZPA 2HF2A 5FPTA 1NE7A 3AWIA 3KWFA 3UFBA 5DHQA 3VJMA 2QRGA 4MA0A 2X14A 5ARBA 4O8CA 4EUHA 3BRWD 4GNRA 5K8JB 1BGXT 3S3TA 3O7MA 3VPAA 1VYUA 4X1KA 2O5RA 3OBBA 1NMYA 3CR7A 1J06A 1KHHA 3E15A 3PP8A 2AOVA 5EEHA 4EBFA 5CH8A 3HB9A 5LMZA 1IJKA 4MIKA 1JB9A 1A76A 3KPVA 3QE0A 5E4YA 1EDZA 1SU4A 1Y3IA 3C2QA 2IYZA 1W87A 1ZD3A 2OCKA 4PX9A 5J2TB 3W4KA 4PICA 4I5EA 2Q2VA 5JJCA 3M34A 2WYIA 3ZLVA 1CQJB 1XB2A 1GQFA 1U3WA 3AVTA 3AMVA 3BJEA 1E4EB 2A0FA 1T6YA 2HQBA 1C4KA 2JRLA 1PVDA 2NO5A 4HSEA 5DHSA 3T4EA 1AUOA 3OX1A 1ZICA 1P2DA 2FGKA 4JYPA 3NVMB 4R1MA 4QNRA 7REQB 1HWYA 1TPYA 4FYIA 1PN3A 2X5JO 5SZJA 2BTOA 3FYUC 3O8QA 4KXLA 3IEUA 4FR2A 1IZ0A 2MJLA 2KLHA 1Z15A 1KE1A 2SKCA 2GPSA 1FP1D 4KIGA 3H19A 3D6FA 3Q0IA 4HOYA 4R2KA 3B5EA 1M2EA 1OX4B 1Y7HA 1N7HA 3L7CA 1OY1A 1QR6A 4IO0A 4FDUA 4LJLA 3SX0A 4D42A 5J47A 3EXIA 2XMZA 4MCHA 3O0DA 5LUBA 2PH3A 2HJHA 2WDZA 2GQ0A 3F74A 1VYHA 1PKXA 3TL6A 4BLUA 3RTBA 5LZ2A 4G09A 3E9DA 4M2LA 1RR6A 4QULA 3C5CA 3DZHA 5GJVC 3V8EA 3A4IA 4RF5A 4E3ZA 2BYTA 2Y3IA 2PMKA 1QE5A 3W90A 2NXJA 2JPDA 2EG5A 4YROA 1UKZA 1UBCA 4QGGA 3SBXA 4YRNA 1SBZA 2D59A 2O2DA 3DG9A 4LN1A 1OFUA 3FFTA 1DOHA 4FFBA 2E18A 5JXJA 4E46A 2ACEA 3DBRB 3T4UA 1O1YA 3NBAA 3I58A 4ZARA 2P69A 1W36C 4NFLA 2YMPA 3ND8A 4FVTA 4GUDA 1B3RA 2VNSA 3C3BA 4TX1A 5CX1B 3ZOZA 3D4IA 3IR5A 1C0EA 3NTUA 4FOTA 4LYHA 3H65A 4GF5A 4NYJR 4PO9A 2WWVD 2C4MA 3VR6H 3ZLJA 2HM7A 3F9IA 4MTCA 2OXIA 4KTTE 5KSOA 1CR0A 1T36B 5K0EA 5JNTA 4DJ5X 5EMKA 1A69A 3HLTA 4L50A 2XCRB 1MO2A 4GRIA 4B5KA 4UDYX 3VKVA 4EMTA 4L6CA 4B85A 5CLJA 3SZRA 1CBUA 4KWCA 5L6MB 2B8WA 1WW8A 2JI9A 2M1XA 3D31A 5DN6D 3K0HA 3WBKA 4XUDA 5IANA 2OM2A 4JGIA 2FPOA 3B2NA 3BVPA 4YQFA 3U9SA 4J76A 1F9EA 5ECWA 2I0FA 3HBFA 3IHKA 1EK0A 3CZAA 1TNDA 3QFSA 5ADWA 1P31A 3QVSA 3A2MA 4OM8A 2GUWA 4G24A 2PMCA 5CLIA 4B80A 4ZV4A 3KR2A 4Q02A 3L7YA 2JJ2A 1FFXB 1CJKC 4JU9A 1SUCA 2PMEA 1A9RA 2D1YA 3SHVA 4JI7B 2JHAA 1NI4A 2QP4A 2O2EA 3RS4A 4DC9A 5EPOA 3R1IA 2XA9A 1NJ8A 3NAZA 3GFOA 1H1TA 5I9TA 1M2FA 4GI3A 1FY2A 3IVGA 4IOLA 5EL0A 5HUJA 2G1KA 2FPRA 4C7XA 3I62A 3KVVA 4U2CA 3E53A 3RASA 1X8JA 4E11A 2AMJA 1AHNA 1SBTA 1SCDA 2CNWA 1XEXB 4HRYA 1PTJC 4U7GA 5KIAA 13PKA 2B25A 8OHMA 1Y8ZA 1JPVA 3UOWA 4C14A 1Y9EA 4JP8A 1B0PA 4JQYA 1BA3A 5FBHA 1WVMA 2LP4Y 4MXDA 5J59A 1AGYA 3I32A 2PBFA 2ZXEA 1I80A 3WKBA 2OQ2A 3Q3VA 4G5OA 2HU8A 3GFQA 2EFJA 2IZ6A 1E1RA 2WSIA 4X93A 2EQBA 3WRWA 4C3VA 1U1GA 1UR5A 4MW2A 2GILA 1A98A 1ISMA 2QP9X 1U94A 3IAM1 1XIVA 16PKA 4ND7A 1FE8A 3C8DA 3EQ2A 1I3NA 1TDJA 1UANA 2W6OA 5HM6A 1OWNA 2QMUA 2FPWA 3JARA 5DTRA 1VPWA 2FPXA 4WZAE 1I10A 3NVKI 3R7DA 3ECCA 1G9XA 1CG6A 1V8BA 2W2PA 1PFGA 3IP3A 3ICOA 3OEEA 5SYNA 3ETCA 3CN9A 4D4LA 1EFPB 1K88A 2C92A 3N6RA 3ZWKA 5DNYB 2Q3EA 4MHTA 2FMUA 4I7EA 3WA7A 3ZN2A 3UWPA 2SECE 1CZNA 1IWOA 5F78A 3GZNA 1MJGM 3W5DA 2C2KA 1CIPA 2NV6A 3P0HA 4UBMA 4IGKA 2J31A 3IQWA 1ZGBA 2F62A 3RIGA 1DL5A 1RPAA 4WIAA 4X1YB 4HDKB 3PUJA 1JV2B 4L5AA 2IDMA 4IHJB 1QBGA 3EFOA 4GR5A 5BSFA 5K3OA 4OJTA 3EOBI 3L84A 5ALWA 1KO7A 1ZGGA 3SWWA 1Y4ZA 3GNSA 1NMSA 2DY0A 4F5DA 4M3NA 3N8NA 3IP9A 2MSKA 4O4IF 4XX0A 4F04A 1FQWA 4DDWA 2VTBA 4BMCA 3DBVO 4MPJA 3QVGA 3WGYA 2G08A 3H2KA 4IW3B 4QPDA 3L7KA 3E7FA 3A3OA 5LYJF 4CCWA 1LDNA 1JG2A 1OZFA 3EBLA 4G9BA 3REFA 3QUAA 1U3UA 4D0NA 2ODWA 2WJ6A 3LCVB 4NE7A 4CE6A 4QLAA 4WNCA 1HNZB 1TIPA 1DOZA 2PY6A 1EESA 5B57C 2Q2NA 2R5FA 3F3KA 1E5DA 3V8RA 3EQ7A 3I3SR 1ORIA 2NZ2A 1RFLA 5ERYA 1SVLA 3MOIA 4CR7A 1RQ7A 4WUTA 1YBMA 3IDOA 4Q01A 4FIDA 4ZVMA 1RT9A 5LQUA 3Q1KA 3TTVA 3PC3A 3JR3A 2WICA 4F1WA 1H9CA 4X45A 3P9XA 1RPTA 4R84A 1KWKA 2P40A 1P1FA 1LI5A 4J6FA 2C5AA 4PPFA 3UCEA 5I45A 4C5AA 4CBVA 3OLVA 2ST1A 3RBVA 4F92B 1NXQA 2X86A 2EFHB 3IMGA 3NHRA 3NKFA 2C96A 4XQGA 1LBTA 3SEQA 4NNPA 4J0HA 3L07A 3SYLA 3N2IA 3TWOA 4CKXA 1V16B 1ONPA 4G0PA 2GHIA 1MV5A 1G5FA 2D2FA 2JBHA 1G60A 1YE3A 2V5VA 4RVHA 4HLCA 4ZREA 4D92A 1Z6TA 1EU1A 4EI9A 5BW6B 3M0EA 5C53B 3C6XA 4MDFA 1KFKB 1WY5A 2Q9AA 4RD2A 1J9EA 1DBVO 5IT0A 3QKWA 1S3SA 3WWZA 2PZGA 1BEUB 4LSWA 1E5XA 3DPIA 4PG6A 2CC2A 3GRKA 1E6KA 2D7CA 4BNMA 3KQMA 2JFBA 2O6LA 4K6KA 2FTKE 3QE2A 4NU6A 4A2QA 4NQRA 5MDHA 3KT6A 3KOWA 4DG5A 2XLBA 3IP8A 2IPLA 3KKOA 3WNCA 4C2AA 2O7SA 3N05A 3BC1A 3FFBA 4P32A 1AUPA 5B2FA 4HGYA 1QLJA 1BOFA 3E7XA 4EY6A 2UYOA 3FR8A 1MIHA 1DUVG 1WKVA 2X9LA 2XCLA 3KSMA 1EX7A 1DP4A 4RJJA 4WTOA 2IX3A 2VP4A 4IVRA 2V8BA 2RC6A 3HVKA 2JJ2D 1VRWA 1UBGA 2A9KA 2Q2QA 4PHGA 3C24A 3OM9A 4FGJA 2DHCA 7YASA 1OB5A 4J0JA 4YJ3A 2C4NA 3K1AB 5I7EA 5BV1A 4M1SA 4ARSA 4AXXA 1ZXLA 2OXFA 4W5OA 1ONNA 4TT3A 1DZ3A 3UJBA 3QFCA 4KB5A 2W71A 3AR2A 1H5QA 1K06A 4OI4A 5AKJA 2O6HA 3NS7A 4CVNA 4OYYA 3KL2A 4DV0B 2VEDA 4B7CA 4H0NA 1IOVA 1MPTA 2QUHA 5F98A 3DDCA 4EHKA 1KGSA 1Q50A 1W6UA 2I78A 1KI2A 4UVIA 2CDAA 4QQFA 4ARZB 2Q3FA 3L4SO 3VI4B 1ZK3A 1TT5A 3AHCA 1EWRA 4PXYA 4RA6B 1TLFA 2E89A 3EDOA 3NWJA 4W5WA 2V6FA 2QQGA 4UCWA 4LFAB 3SYRA 2BE9A 1DEHA 2WG0A 3CYFA 3NI2A 4NAVA 3K5HA 3O3NB 1H9AA 1Y5MA 4MI6A 4TLCA 2E49A 3AB7A 2F43B 3BEOA 1E1RD 3N5CA 3VO9A 1U7TA 1P0PA 3L06A 1VSQA 4TLEA 4BL5A 1W4CA 3H6GA 4DA7A 2Y6UA 4O2BB 2REQA 1BDMA 5A3QA 1IM5A 4MIYA 4V1CB 3KLBA 4JL5A 5KOJB 4C4OA 5KPJA 3TFOA 1SU6A 4HBZA 1L5MA 1K2VN 3DSRA 4HDRA 2I7XA 3MVEA 4W7HA 5FDFA 1KR2A 1YRYE 3H2HA 1T9ZA 1YDHA 2O1EA 3H7AA 4IWNA 4QGBA 2BDTA 1C50A 3PS9A 3I64A 3OEED 2I6XA 3GLHE 3NXKA 2VDLB 4UVGA 1OVMA 5ANRB 3T5MA 5JCOC 1H1LB 1MZPA 2P9GA 1PT6A 4CT5A 1QAOA 1E3DA 2EGHA 4MYTA 4W1PA 4AJHA 3GG9A 4NBVA 4KE7A 4BNWA 3G59A 4DUGA 5JC8A 3OAAD 4I1PA 1NFQA 1YI8A 2BFWA 2V65A 3AJEA 2HWWA 3D8BA 4K9NA 1GG9A 2DULA 1OLSA 3QOWA 1EK6A 3N0RA 1HG1A 3R5KA 4Q48A 4D6PA 3P9ZA 1TZMA 1KZ9A 4I36A 4DLBA 1JDTA 4J0FA 3SXUB 2FSGA 2V3VA 4KH1A 1HL7A 2V9CA 3LYHA 1PT7A 1AKEA 3N2GB 2EWMA 5AM1A 2YWXA 3HEBA 3NV7A 2AQ8A 3KSUA 4HYYA 4IGEA 4KVAA 2W4IA 3Q0TA 1N2IA 2KBFA 1IC6A 1FDWA 1ULAA 2VP5A 2XQIA 4B8WA 3DFUA 1GTZA 2CJXA 3F49S 1OYWA 1GZ5A 1EHIA 3OPYA 3PWZA 1JMKC 1LI7A 1FP4B 4EEZA 3RAEC 2WJVA 2D6FA 1A8IA 2WUVA 3M6FA 1FSGA 2QNRA 1N3LA 2ODAA 1OI3A 4PEVA 4C0QC 1SK8A 5JSFA 2C5BA 4R9UC 1J2YA 1J0CA 5EHXA 3RVKA 4F6LA 2JBWA 2CB0A 4WLOA 2GHRA 4OJNA 3THWA 3NFRA 3FTPA 3PC7A 3CZPA 4RIEA 2IEAA 3CPSA 5DW3A 2E5WA 3QSGA 2YKGA 5EPEA 1A0OA 1A9OA 4R4JA 1T0UA 3EZGA 2XOKA 1IN1A 3OU2A 4OK5A 3EZNA 5JXIA 5AESA 3TUIC 1K0FA 3RUPA 2C84A 1M8PA 2XDQA 1ST2A 2PMDA 1KO5A 3W2TA 1WVIA 1X0XA 3I0MA 10MHA 5TQ2A 5BRNA 5JE8A 5CPBA 5AO9A 4DA0A 2IV7A 2EZ8A 1D6SA 2O3UA 1KQFA 1E7MA 5CDFA 3JVEA 2OWEA 3LX8A 5IAAA 3CW8X 1WHTA 2JH9A 4QAJA 4CM4A 2EFGA 1YF3A 4TYPA 2CNBA 3D6JA 1MX1A 2A5GA 3IUNA 5E1OA 2FN7A 1KYVA 2XUIA 3HXTA 3JYOA 3TM4A 3GOHA 2XKKA 2CF6A 2OORA 1J0BA 4F3RA 4MUHA 1ILWA 3ZHRA 4CPDA 3EN0A 2PE5A 4X7BA 4RKEA 1TZKA 3PPIA 1V8ZA 2GKOA 4JLKA 3TZBA 1KFEB 2HSEA 2J8ZA 4KPGA 1XA4A 5D00A 4E7OA 4QG7A 4GKVA 4KWEA 5DOVA 3A05A 1BDIA 4EGSA 2C9YA 3H5IA 3RG2A 4F60A 1IBMB 5AVTA 5HKKD 1SCIA 1W5AA 4AKIA 3F6BX 2C9OA 3QIAA 2IYXA 4UATA 4D43A 4D9MA 1WE2A 1ZVQA 2C5EA 3RBXA 3ND5A 3A4LA 4RAOA 4QG3A 3VVBA 3C7TA 3KCNA 5CEJA 5AM2A 4JVMA 3G85A 1FS6A 4XB1A 1TU0A 1Q0QA 3QYFA 5TQ0B 4KAXA 2R8BA 1G8GA 3U62A 1WQ3A 4BRWA 1AMUA 1X70A 1XJ0A 3DCIA 3F6PA 3PQCA 1TF5A 3B52X 1V3TA 4IIVA 5K09A 4ER5A 2BGTA 2CCJA 3N7UA 1YR9A 3AOGA 3ZWDA 4I6GA 2FPPB 4BC1A 2O5EA 3EPLA 5FFNA 4HVAA 3LGAA 3NKVA 5J3JA 1DBRA 5AXDA 4K6OA 1I4LD 2EDCA 3JWPA 3MMNA 1U3GA 3DEYX 2O0JA 3RYFB 4CLRA 4ZI5A 1N3IA 3KPJA 1AG9A 2XQJA 3GFFA 3ZZNA 3KX2A 1RRFA 3WGOA 3H4MA 5ALJA 4QUJA 2Z95A 4AY4A 2NP6A 5AOBA 2DHDA 2IV2X 3AFIA 3H8VA 4CGYA 1GOTA 2IK8A 5TF0A 4EYGA 3MCWA 1GGFA 3KM0A 3GRZA 1U5BA 2JGKA 4OFZA 2ZYGA 4XX0B 3FSRA 2GA8A 5K0JA 1E3LA 3DFMA 2C94A 1LRLA 1CUIA 3MT8A 4J7UA 3NTRA 5ALNA 4DT1A 5AVQA 4CI0B 2ZBDA 5CFRA 2O7NA 4MVJA 2GTHA 5ALTA 3SCZA 3V8PA 4QBHA 3GH3A 1A8PA 1E4VA 2BY4A 2H2IA 2C4TA 4TS9A 3UJ7A 4CMEA 5IKEA 1YRWA 2QRPA 4JIMA 3ZU3A 1VPVA 4DYHA 4PLVA 4BKMA 2VH2A 4OKSA 1H2ZA 2DUUA 2FJ0A 2P6NA 2FOIA 3AY7A 1M72A 1VIDA 4O2AA 4OIFA 4DLWA 1U9ZA 2R6JA 3KUUA 3QNMA 3SD7A 4DUGD 5JH7F 4HNAA 5KNDH 1ZRSA 2YX1A 4TMVA 4M0LA 4DY6A 4OIMA 3I73A 4EA7A 2ZANA 1Z13A 2PGAA 3P5BA 4ZPJA 3HO6A 3FBGA 3O91A 4XWWA 1VE1A 1H42A 5JANA 1QU2A 1XZMA 1Q0LA 3DTNA 2F4VB 5A2QA 2VXCA 4H0FA 4Q3BA 4U02A 3TZEA 2FOXA 3V97A 5KTNA 4EBBA 3T9EA 3G1UA 3EVGA 4UBLA 3CF4A 3SEFA 1XRMA 3HCEA 3G1TA 4F3TA 1PRYA 2GBFA 4G1MB 5JFOA 1Q6ZA 2WQ7A 3OH8A 4U4AA 4Q34A 3VJKA 3RS8A 2A33A 4NENB 2MINA 3D8NA 5JZVA 2WQZA 2W4MA 3ENNA 4LY6A 1FMJA 3BIFA 1Y8RA 3PXXA 1CEQA 3MYRA 3RF6A 3WK4A 4N5IX 2V4UA 1SXJC 1YH3A 2ERCA 4B3XA 4OX9B 5LDDC 5F9MA 2XT6A 2GKGA 2HA4A 1IQPA 3SQLA 2BMFA 3ONWA 3PJFA 4PBTA 3IMFA 4RO0A 5EHIA 5TMDA 2IH4A 3KFXA 4HQFA 5ULLA 1BEEA 1XZAA 4EVIA 5G0SA 2CMFA 1T9HA 3PENA 3QI7A 4OMCA 4S1WA 3MIIA 5IVHA 4CKCA 1ISRA 3GJ6A 2H18A 3IP1A 4BLVA 5K0TA 2XOKD 2YWCA 4BEWA 1MW8X 4F5YA 4D41A 4U0JA 2EFEB 2ODNA 3E03A 2AR7A 4P84A 1KA9H 1TUIA 1DLIA 2DHEA 2VZEA 3ETLA 3RIYA 5TXGA 3OIWA 1F12A 2HPZA 3Q88A 3UKJA 1KYYA 1KDTA 3WZLA 4WE3A 3ZXYA 1GD1O 1X92A 3TGLA 3MS4A 2M6RA 4JEHA 4YUWA 3RBAA 5CXUA 2ZSHA 3GDOA 3PNQA 2CVHA 4HT3B 4OQLA 1MT0A 1N25A 1GT6A 3P4XA 1XL0A 2VA8A 2XITA 3LBIA 1H85A 1UC4B 4BMSA 4BVJA 2AK3A 5B4UA 1VIAA 3ND6A 3I4CA 1Z4IA 4X91A 4I9HA 1TYDE 3WLRA 4HWSA 4QYSA 1L4FA 4B48A 2VDKB 3HJUA 1FNSA 1O95C 4G5YA 5HF5A 4AYTA 1E3WA 4C43A 3D0OA 4ZYZA 4JBIA 4Z5XA 5JDIC 2WSYB 2R9VA 4FZ3A 5SZHB 4BDSA 4KBYA 1SQGA 2I3GA 4Q1AA 3V00A 1TZJA 3PRHA 3ZVRA 2AJ8A 2ORWA 5EWJB 1M76A 2DECA 3EVNA 3OKPA 3UK0A 5DEIA 4ZYXA 5KO2A 1SCAA 2CFRA 2NIPA 3HGMA 1J8DA 1D7AA 4HC4A 4OBXA 5I4CA 4H7DA 4YB8A 1DC6A 3KL4A 4KSBA 4OAOA 1DB3A 4LDZA 5HPYB 2WB2A 4D9IA 3X2FA 2V97A 4TUYB 3THXA 5JSZB 2JFXA 5K03A 1GYPA 5C4IA 3Q12A 4WBNF 1OX6A 1C9YA 2JAPA 4LV5B 3DM5A 1Q12A 4O3MA 1NNI1 1JKJA 4E94A 1XMVA 2QK4A 3TR6A 3VYSB 2QRVB 3Q87B 4PLWA 3JQGA 2C29D 4JEIA 5KCMA 4G0MA 4ROSA 4BX2A 4Z7OB 1TKBA 4D5EA 3WLHA 3ZX4A 3TECE 4W1RA 1ISIA 2QJOA 3M49A 4U6NA 1FTSA 3REQB 3S7ZA 3V1NA 3ZZ0A 1P62B 3TPCA 1R3UA 4ZVOA 1RLTA 1F48A 1QHEA 1TUBB 4K9OA 3FTEA 4LHWA 1GWNA 1QO7A 4TOIA 1FJXA 3OTOB 3FWKA 4QUEA 5I9NA 2AWNA 4G26A 3T3MB 3P45A 2BISA 2J3QA 4IYJA 4D4HA 2X1LA 1IDN1 2VRCA 3OJLA 5LOVA 3L6DA 3R09A 3LQ1A 4PLCA 1D6JA 1ES9A 1CNEA 3LPMA 5EVCA 3WSVA 2X4GA 2BHSA 4ZQBA 4LOLA 4DR1B 1TIKA 2QTHA 3C4VA 5ADVA 4UOEA 2AK2A 1RMTA 4HF7A 4Y1RA 4U8GA 4V2IA 4COKA 4YJHA 1QWSA 3WFZA 3N53A 4CI9A 4QATA 3LO5A 2E85A 3G8AA 1E6UA 5ALVA 4MVJD 1TTQB 2XRFA 3BFXA 3QF4B 1HT0A 2QPAA 2QPLA 4UM9D 4AYXA 3VTZA 1YASA 1US8B 4DMMA 4EG6A 1MC1A 1GQRA 4PSVA 3LIPA 3T4PA 3UKOA 4OU5A 4M0EA 4K28A 4ZHQB 3P2YA 1WOMA 5CGZA 3WYAA 4EUKA 3LBFA 2IIBA 3TQOA 1IIRA 3HN2A 4QTYA 1DEKA 4R68A 3VAZA 1T8PA 5ILGA 1RP7A 1T8UA 2PAFA 3I28A 1SIWA 3BMCA 1U0TA 4J3FA 3RYTC 4ENWA 1NULA 2NP7A 2ANBA 1CS4C 4BO2A 2OBLA 1K5PA 2GK6A 1P0IA 1V1RB 3FGOA 4IDNA 5TY0A 4UFNA 1U3TA 3CISA 1Z88A 3S68A 4KAJA 1P72A 2WZQA 1R0KA 1O96A 3SDBA 1NJFA 1AC5A 3UUEA 3E7DA 3P0IA 1IM2A 3MNFA 4FUTA 3WGGA 2IHBA 3BK2A 3BGVA 3D7KA 2OCDA 3IRVA 3ZBQA 4RAQA 1ZMOA 1RAGA 1E9BA 3RF7A 1ODIA 3GRVA 4B3CA 4AZTA 2CSUA 2VH1A 3DYVA 4MJ7A 2COKA 3EXEB 4AMZA 5AM0A 5K0GA 1MDFA 5IP5A 1ZD4A 2AYYA 2W2MA 3VNAA 1E3MA 1QU3A 1H94A 2I4NA 4IIBA 2CL0X 3QVJA 3H5VA 1IHPA 2DPYA 2Q4BA 4PLGA 3THRA 3V48A 3BN3A 1RWOA 2KE5A 5A1TA 3ZD6A 4R8RA 4YA6A 3CUWA 3SJAA 4CU5A 1JSLA 3JAWA 1RBZA 4ZC1A 1JI3A 1MQSA 1F6DA 1E66A 2C5SA 2ONYA 3QJYA 1E0AA 4HLUA 4J03A 3MJDA 5CVVA 2QSZA 1G7CA 3NT5A 1PQPA 5GM2A 1D07A 2B8TA 3JYHA 5ENDA 3RS2A 3RREA 2BFAA 2Q6KA 3BWYA 4QSHA 2IYVA 4YONB 4YRQA 3U3KA 5BWMA 1KMCA 3ITDA 1U8UA 4MV5A 3OQ1A 1JHMA 1U8CB 4C4SA 2J48A 1OW3B 5B53A 3QZUA 2WD8A 2I2XB 3AL2A 3PHGA 1HDIA 1YR3A 4XD7A 1RCTE 5BOSA 3DGEC 3QHPA 5JRZA 4QXAA 5IAKA 4CTMA 3OIVA 3CEPB 1C7JA 4B7ZA 1IBRA 1J09A 4MRAA 1CUZA 5G1PA 2XVZA 1ZN8A 2FX3A 4HK4A 2YH2A 2ZCVA 5FOUA 1NONA 4RKYA 1C3OA 3RUEA 1ZN2A 5L45A 4KNVA 1LPPA 3DBOB 3E6AA 4HCJA 3N8HA 1OF1A 2GERA 3QG5A 4WKOA 5H0IA 2B4RO 4ALNA 1DWOA 1SWWA 4COOA 4TYYA 4INAA 4XDGA 5K0BA 3WV4A 2V3CC 4QDTA 2G83A 3ONDA 5L9AA 1K89A 4G8BA 4UUBA 1YQTA 3KYBA 2BGMA 1OD6A 4C3UA 3LUDA 1YIAA 2NUTB 3GRYA 5I5GA 2AMVA 4EYKA 1CC1S 1UK7A 1TXGA 2CXRA 2IIPA 1ZOSA 2X6QA 1O8CA 5EQDA 5ESXA 2Z3WA 4FZRA 1QIMA 1N5KA 4PGAA 1OROA 3UPTA 2I7DA 1E6EA 2ZI4A 1XN4A 2ODQA 1QCYA 3PPVA 2OPBA 4IJVA 3D0QA 3AYZB 1U1FA 2J6CA 1JWBB 2WD9A 2PFSA 3I42A 3ETNA 3KYCA 3THOA 5CJJA 4QRDA 3AKEA 3BWCA 3TW8B 4IIFA 2JNWA 2IYLD 1RJ9B 2E4ZA 3DHNA 1O2DA 2X9QA 3M6LA 4E4YA 4ETWA 4HNAB 4Q4JB 1HFKA 4KV9A 4M53A 2A86A 4DLLA 5I01A 3DLBA 4N0PA 2J0EA 2P5UA 3VPCA 3WOVA 3MD9A 4WZBA 1F1JA 5T67A 2E7ZA 4ZYWA 3Q2IA 3LK7A 2A9QA 3IUMA 2QGZA 5TIIA 3AP2A 3PT9A 3U81A 3TX2A 3B3JA 2VRCD 3DCJA 4KW7A 3FDXA 1FTNA 3MZ0A 4GR4A 5EIHA 3W78A 1PWEA 2N9UA 2PS1A 3NKLA 4JGBA 1FLNA 3RR2A 3E58A 3RIHA 2AFVA 1ZK0A 3WY9A 5J2UA 3P2KA 1U0EA 4QHSA 2VVTA 3W6UA 1ZGJA 1R5NA 1A4XA 2ENUA 2QT9A 3H0EA 1GSOA 3PFBA 3FFAA 4D44A 4TMZA 4WNAB 4I4CA 1FUYB 3KOZA 3F98A 3G49A 4TL9A 4K8OA 5DNCA 1ORHA 2NO4A 3TFWA 2IU6A 5JSKA 2PGLA 4CF6A 2X0RA 5SY4A 3TN7A 1X1DA 3N59A 3BS4A 2XZPA 4FGUA 5B30A 4WXMA 1I36A 1S2OA 2EQ5A 2Z04A 3I0ZA 4WECA 4ZV7A 1T10A 2H63A 1G5PA 3E48A 2DVMA 2EZ4A 1GNTA 3SZLA 1QLHA 2C1ZA 3TQSA 2C3UA 3CLTC 4R7ZA 1E0KA 1PQ4A 4UUPA 3TK1A 2PZEA 2O8CA 1N0WA 1L4GA 3U31A 2ZIEA 1PYOA 3OZVA 3Q8LA 2XX3A 2Q1SA 4D45A 4B6OA 3OFJA 4L08A 4KR7A 4XOUA 3TNFA 1ZIXA 2VOJA 3T95A 1UBMS 1NYLA 3AUTA 3N8GA 5DYTA 4R40A 1ECPA 3GGOA 3LY7A 1N2JA 1EUQA 2H54A 4HDOB 1N3YA 4RQTA 5BO5A 3MW8A 1PQWA 4ZCIA 4CLOA 5IYZB 4NHOA 1XXHB 4MKXA 4AKTA 1ACLA 4KLZA 4AQDA 3AETA 2RGAA 3H2BA 4ZT4A 2VNAA 3HC7A 4J49A 3SLGA 3TNJA 4ASUD 5CB4B 1AN9A 2YCLA 1LQ2A 1WETA 1GRQA 3H1FA 3LZ6A 2AEFA 3IQIX 3GL9A 1GQOA 1V9CA 1Z45A 3OEYA 1UJNA 1UWVA 4EAAA 4OLAA 1W2HA 3ETEA 4WY8A 1IQ0A 2G76A 2PBRA 2A67A 5CVTA 5DK6A 1KOGA 1ZO8A 3V7YA 4B35A 1QWOA 3P4YA 3QHAA 4P36A 5T6MA 2W0MA 2R7MA 4OLJA 3BFJA 1OTXA 1CJMA 1Z22A 5KYTA 3H42B 1DUIA 1UBSB 4BO4A 5IBCA 1Z8DA 1Y37A 1XRLA 3FYCA 3OM8A 3PQ5A 2XE6A 4RLFA 4AJ1A 1JXMA 3RHSA 3D2AA 3ZV6A 4FLFA 1EB8A 4PE5B 1AMOA 3OG9A 1Q0PA 4G5QA 4QL3A 4P38A 2X40A 2HA6A 4ND5A 2FZGA 4RGQA 3Q11A 2ZSDA 1XN1A 2OESA 4BMXA 5TPZA 1UT6A 4QGAA 4Y0NA 5JADA 4DLYA 4XD7D 2VK1A 4WFJA 1N9GA 1XA0A 2HC9A 1NNLA 1T5IA 4S2UA 2GH1A 1T4CB 2GNOA 4XH9B 4ETMA 1QVRA 4EG5A 2D1QA 1MX9A 1GO2A 1QO0D 2H06A 3WMGA 1QHHA 3JD4A 2Z1NA 4JYBA 1EFRA 3GFRA 4M1ZA 4PANA 5SICE 1BMDA 5CB8A 2QX4A 4NESA 1Q1AA 4AT1A 5AW1A 3ZHCA 3AB3A 3RTAA 2CZGA 2FWBA 2Z5VA 4V2UA 5BPFA 2NOAA 3OUTA 1ZCJA 1ZJZA 4IV5A 3W9UA 3CSSA 4QYMA 4DNQA 1B6SA 2WTXA 4EMUA 4ZI3A 5A5VA 3M1LA 4U2KA 4YMGA 4BNHA 3A1CA 1XQVA 2ZYAA 2NV2B 1R0BA 4G1BA 4LWQA 1WX1A 2C83A 4U8HA 1S3IA 1JFLA 1PFWA 1ZM3A 3R8FA 2R1UA 3EXG1 1PJ4A 3H99A 3GLUA 1XL1A 5JT1A 1OXKB 4DUYB 4X7PA 3KQYA 2XGSA 4QBIA 3M2PA 8ADHA 4L16A 3E22B 1M10A 2EC5A 3O8BA 3TNDA 1PGNA 4PONA 4UKDA 4BQNA 3UK1A 3U60B 4TV9B 2IPMA 4HMOA 4UD2A 3MD0A 5JAOA 2WF7A 3V5NA 4ZWNA 4GXTA 1WTCA 2YUTA 2P2NA 5CXSA 1KFJB 1BVHA 5CA1F 4QYXA 4RPKA 2RHHA 2C2OA 1ZH2A 3DE0X 3UCFA 1AKYA 1KI8A 1KOLA 4N47A 4P9NA 1YS6A 2PHZA 2I29A 4KSYA 4L0QA 2FQXA 5K8UA 1U8XX 3OLCX 2O8DA 2A4MA 1E9EA 1RKBA 2X8BA 3S2IA 2CVPA 2SBTA 3I1FA 4V38A 3IMCA 4C1NA 4CQJA 5JD5A 1PSWA 5ALEA 3S40A 2ZSBA 5G1NA 4WBSA 1QHXA 1SC9A 3AP1A 3C4JA 3F90A 3OWXA 3OZIA 2R8RA 4DMCA 1L8XA 4UOZA 4IHAA 3ICPA 3KQLA 4INJA 2Q4DA 2COEA 3SVLA 1ZUWA 2P8JA 1E1QD 2R6GA 1BU8A 3EIXA 2V6GA 2AMLA 3Q3IA 1V43A 3OZWA 4TTJA 1P2UA 4L22A 2IUUA 4FMDF 5C32A 5EJ5A 3LF1A 4RX1A 4BPRA 4XJXA 2FUG1 2I76A 1D8AA 5KKCA 1I3CA 2LDBA 1FTWA 5LWHA 2QRJA 2ZTLA 3K70B 4GL4A 1PCXA 1KEEB 4IO1A 5AT1A 3PD7A 1DIOB 4B6FA 3VM6A 1GRVA 2ZU0C 5EZ5A 1XD9A 2PKYX 2J3KA 1T2VA 4HAVA 1V71A 2GESA 1UK6A 3RVMA 1OWMA 4HQ6A 5FAXA 3ENQA 1AHPA 2F1HA 2IXFA 2NYVA 3PFFA 1G4HA 3HJGA 1DS6A 5CJ2A 1KQNA 1CY0A 1EUCB 2R8EA 1MC5A 2I2CA 3NB0A 2YASA 5DNUA 1PD1A 4UOQA 3KEGA 4O4HF 2BSAA 4N3GA 1WUKS 3IE2A 3UGTA 4AS2A 1G4UR 1VI6A 2J0VA 1X39A 2VZLA 3AINA 2IWRA 3W04A 2OCYC 2WMYA 1EG2A 4M38A 4GBGA 3WB0A 1YRAA 5JWRA 4Q4HA 2AFIA 3F46A 1J42A 3DO6A 3G7UA 5BVHA 1KKLA 4WESA 3ESRA 3LSYA 3RRZA 1W2GA 1ADJA 1E32A 1H4VB 1UJ5A 2E4WA 2LE0A 1DNPA 4D4IA 1O97C 2PVPA 1KY3A 3TRKA 2CK3D 2P2YA 3QV2A 1NPDA 4HX2A 4PHTA 3WC4A 4UU8A 1QP7A 1BCRB 1MFZA 1L5RA 3BRQA 3PX2A 1G5QA 5ITZA 3BUSA 4JLJA 3ILYA 3UYLA 3VSAA 2XUJA 3I2JA 1L7OA 4LZZA 3HNRA 3OEHA 1UKVY 4MROA 5KNDA 5MFPA 4R0VA 2REOA 3DAFA 3LVBA 3T5TA 3SIXA 4E3WA 2VQEB 4F91B 721PA 5BV7A 2HMYB 4Q1EA 5EXSA 1X7XA 5JNSA 3ENWA 4M21A 4A2CA 4CYMA 3KKPA 1T5TA 4CEJB 1QYRA 3D6AA 1F8FA 5D86A 4O2RA 3JSXA 3GRCA 4JA0A 4QPZA 4RY8A 1B6RA 2NNLD 1WLSA 2V6BA 2QTRA 4D9BA 1YA6A 4O8ZA 1NAHA 2RHGB 3FSJX 5IUKC 5TPZD 2WF9A 2JFGA 4W9NC 4FZJA 2DERA 3EAGA 2NZUG 3DHVA 4QBKA 2P3SA 1RIIA 1L5LA 4Q5IA 4PRYA 1HE4A 2QLTA 4HGRA 5FH9A 1VLQA 4KC0A 5T3YA 2B34A 5KMGB 4RULA 3KELA 3WISA 2JASA 3U40A 1EFRD 3CH7A 3EVTA 4OQEA 4QQRA 5HQTA 5CNKA 4Z4FA 3A1NA 3UFXA 3V1LA 2G07A 4ZEOA 2GN2A 3R6DA 3HYTA 4E4TA 4OA5A 3PEYA 2FOLA 3U1TA 2FEOA 4FDVA 4AMUA 2K5UA 2ZSFA 1U2PA 3U56A 1LBIA 2M1ZA 4AKSA 3AV3A 1FMTA 3HI4A 2E4XA 2GX6A 2BLLA 4R1SA 1I4OA 3GP3A 1CUVA 1Y7IA 3HBMA 5FTMA 2WKWA 2H4JA 4IHKA 5JAMA 1LBQA 4R71A 3BEDA 4E0BA 3U4AA 1Z0DA 2WTBA 3BERA 3CTPA 3ZTTA 2HIAA 2ZJ0A 4OLHA 3MMZA 3G6KA 1R64A 1P74A 3ZWCA 4ZI7B 5JPDA 4C7OA 5LP6B 1NMXA 1G2QA 5LUAA 3UB4A 2FK8A 3AM5A 3SIWA 2LVBA 4JP3A 4KMOA 2JG3A 3H4IA 3R3YA 3TKAA 1TM2A 3WRVA 4KFRA 5K05A 4A36A 1YB1A 2Q07A 3UQZA 1NW5A 1QGZA 4TLAA 5COQA 4FYXA 1EE2A 3ZE2B 2WU1A 1KMMA 1QAQA 4GOJA 3X1XA 2RBEA 3WGQA 3ACCA 5LZ8A 1VOTA 2R1TA 3EPPA 1IVYA 1SIOA 2REBA 5IVPA 1WD7A 2GBGA 2QN1A 1MKYA 1WEKA 3W9SA 3ZEIA 1IMJA 4W1SA 1X2BA 3ZJ5A 1P6QA 1PL6A 1SXGA 1ADBA 4QRIA 2GZHA 2DPGA 2ZJ1A 3LPNA 1PEYA 4G1UC 1RQGA 5DMXA 3V55A 3CZ4A 4B4KA 2QG4A 5CHYA 5JS6A 3CUEF 1KGDA 2WFMA 5F1PA 1D5WA 3ELBA 2GXUA 3DT6A 5ESWA 4DWJA 1Z38A 4F2DA 1WQ1R 3W7BA 1WP9A 3EZXA 2GHQA 3IOMA 4NG4A 4ZKEA 1ADGA 2VWPA 1TA4A 4N0DA 1OT5A 4V1CI 2C82A 3IEMA 2W2LA 3LL4A 3PKJA 4GW3A 4YN3A 1V4VA 1VE5A 3U3DA 1LC0A 3NQ41 2HDOA 1H3FA 3GRRA 2H6EA 2EW2A 4PYLA 4NJMA 5DV9A 1WBBA 1T35A 3WB9A 3PXUA 2YOGA 3RRJA 4Z4IA 1RJEA 2PL5A 1C0IA 2BGJA 2GD1O 1B8PA 5BSVA 1QQBA 4V0OA 1PR5A 1QHSA 2OCIA 1R5BA 4PAOA 3SF8B 3WK6A 4KXFB 5FAKA 3GGJA 1DOAA 2PZAA 3MN1A 2DWOA 4HEQA 4CJXA 1U8YA 3PHHA 1MAUA 4KQHA 1GGMA 1PGPA 4M9XA 5CDFE 4DMUB 1PK8A 1NWCA 2IE0A 4YASA 2G9NA 1DXYA 4H3HB 1CUUA 1Q14A 1RHQA 5FKJA 2V9PA 5J40A 1E1CA 2ZUWA 3F3SA 5CW1A 3B70A 1KXZA 2I6FA 3ISJA 1RYEA 3ZUGA 4ZAZA 4IUDS 4D9NA 2O4CA 4C0BA 4KREA 2SNIE 5TQJA 2UZ0A 4DJEC 2J41A 2NADA 3GJ4A 3GOQA 4GWLA 1ZBDA 4FI3C 3QUSA 4AF7A 3KAKA 4LZWA 4DMLA 1U9IC 3Q6MA 2ZSEA 3RT1A 1XVUA 4MRPA 4ARAA 2YNMA 3FTQA 3Q5DA 2WV9A 3N3AC 2LCIA 4GNKA 3UANA 3JAKB 4YRPA 2X0FA 2JFFA 3G2LA 3B6ZA 2F59A 4MV3A 1MB0A 2Q27A 2XDAA 3ZWVA 5IJAA 4MS1A 4DUZB 3LT0A 1N2CA 4D26A 1FTYA 2OK8A 3DXXA 4G1EB 1HQYE 4NBNA 4WCDA 3D6HA 4WK4B 5ALHA 1E2PA 5AK6A 2Y8EA 3T5AA 4BNUA 3OZCA 2HKIA 4M49A 5DT9A 1GCGA 4ZXPA 1ENZA 3WQSB 1UC5B 1QKKA 4KQ9A 2JW5A 3HJBA 4DIOA 2VIIA 3RDPA 5JZBA 2HMSA 4K9DA 3SNHA 3EBOA 1YUMA 1ZM7A 2WINI 3W4JA 4REQA 3FX2A 3DPUA 3IKVA 3STWA 1C0PA 2NQ8A 2WFLB 1RJDA 5KC8A 3EG9B 3WB1A 3G5UA 2CE7A 4AJPA 2ZJ3A 4P4LA 4RSGA 3KJFA 2OAQ1 3VKGA 1H0RA 1ZLXA 4L27A 2YVKA 5HS6A 1MU0A 4F3KA 1DIRA 3ADKA 4G5FA 4Q00A 4UDOA 5BXYA 1E2BA 1GRRA 2W2VA 5J9FA 1AM4D 5JLAA 3M33A 3T5BA 3UW3A 2H31A 3QM1A 1A71A 3ROEA 4F9FA 1UF9A 2I4LA 3C39A 1LI4A 5EKXA 3RFVA 1XPOA 4F4UA 3U0VA 1YR8A 5ERXA 3D43A 1HQDA 2XGMA 3NO4A 1XCBA 4YT8A 2NO0A 3H11A 4Y6QA 5I6DA 1L7RA 1CUJA 1OI4A 2QWXA 1KC3A 1JNYA 4TZ0A 3T3IA 2JK0A 1ANKA 3GFTA 4XUGB 1Q57A 1GSIA 3JXEA 3GBPA 3NBUA 2HPHA 1P9OA 2ECOA 3KZKA 1M1UA 3TQQA 4Q1FA 2CXOA 4QAQA 2F3PA 4V0KA 1ZY2A 1RQLA 1PSDA 4M98A 4X1IB 4URHA 2W6ZA 4CM9D 3DYIA 5HM8A 3FPGA 1OWPA 4MVJE 3TE7A 3DR5A 3OC0A 3PLAE 3H6HA 1N5RA 1A9PA 2FV8A 2QTGA 2YVAA 3M9LA 3VGPA 2NAPA 3C6QA 3OE7A 1ZZGA 2Z2JA 4N39A 3FRIA 2PNJA 2R7NA 4RMGA 2PL9A 3FPJA 4ZVVA 3HK2A 1T6NA 3WP1B 4B3RB 2DAPA 3T0IA 4E15A 1A8SA 4ATNA 1USUA 2VDPB 1JDZA 1QGOA 3G2PA 5BW8A 2V1XA 1VKJA 1GUZA 4LJ9A 3VU9B 2IZOA 5BWCA 4AS3A 2HJVA 3N5KA 2I3DA 4IQ4A 3FPHA 3S7TA 3VC7A 1XDUA 1QFYA 3ZQ6A 2CLEB 3M81A 1CHNA 3OLYA 4J1TA 3V8MA 4E7PA 1NI5A 3IBYA 4X64B 4RIFA 3UUFA 4GLBA 1TQ6A 3T5DA 4DIUA 2IYSA 2V7UA 2NMVA 1ZIYA 5DRYA 4X41A 4A8PA 2EBWA 2FWRA 2PKQO 1RWVA 4A16A 4CUZA 1YOBA 3FVVA 3PEUA 4KP7A 9GPBA 5JBNA 3GZ4A 1FPQA 3AZOA 1Z2EA 3K09A 2WM9B 1NNUA 3GBSA 3JQBC 3L77A 3PC8A 1QUFA 2FMFA 1V96A 1FJ2A 3MB8A 2D0DA 4CG2A 1XXLA 1UFOA 3EFBA 3Q98A 1ZI6A 4FFSA 2XYPA 1YRQA 1H4QA 3KQOA 4ZFNA 1N1EA 2C2ZA 1CEXA 2JGAA 3BF8A 4L6AA 2HT6A 4W9MC 1VSTA 2PV0A 4ZVSA 2CNOA 1MNAA 4F06A 4G2TA 3IAM6 2DWQA 3T9DA 2ACWA 4WL0A 2IHYA 2O2HA 2XCOA 2ZDQA 3USES 3WNZA 5ITZB 3CNHA 1L8AA 4M8NE 3VC1A 4GOOD 2HEIA 3WGTA 3FDZA 1YR1A 4WWHA 3ANYB 3TD2A 4DCSA 2G8NA 1L4KA 2O8VA 2ZTMA 4I2NA 5KKNB 4K9MA 2VYFA 1NN3A 3CX3A 3RVPA 1GZHB 3OPQA 5C7IO 3KRTA 3E4DA 4G65A 2QMHA 3LWZA 3UY4A 5DEOA 3FUWA 3FZGA 2D8AA 6Q21A 3SPXA 1CPYA 2ORIA 3O03A 4UAUA 4EZIA 3IJPA 2B8EA 3DO8A 5L4NA 1LSUA 2ALJA 2ODPA 3GRPA 2BKUA 5HK9A 1TIBA 3HEMA 3S99A 1LK7A 1P19A 4WOCA 3JS5A 2YHSA 1I2MA 5DH9A 3BICA 1J22A 3BDAA 3I5AA 4NABA 4WCVA 2ZJ4A 3UG7A 2FPMA 2WYHA 4K26A 4BNKA 4XVCA 7MDHA 4ZN6A 3MGGA 2NSHA 4W1QA 1VMAA 1SB9A 3MPUA 4L75A 4IMPA 4KUGA 4A0FA 2YNMD 1DO2A 4XFDA 3UJ9A 4A10A 3TBHA 3KSRA 1MJHA 4OJQA 1B7GO 1OILA 5I4BA 1JPNA 4RFSA 3Q6IA 2O19A 1M6WA 3WIDA 5KHOC 3WK7A 4R2LA 4TV8A 3GQVA 2NTJA 1WSAA 2YHUA 4L9AA 4I1UA 3FNQA 4YO8A 4R7GA 3CQ9A 4HVLA 2FEXA 3AG6A 2C97A 4D9CA 5C8ZA 1V4NA 2XGJA 1LXCA 1WXDA 1XRPA 2CXNA 2ZT7A 1RQRA 4MKFA 2VDRB 4UNSA 5B3AA 3EJWA 3S2ZA 4QYIA 5IZ4A 4JEMA 1Q6YA 1ZAKA 4RJIA 4WGGA 3GLGB 3WJ7A 2RE8A 1EGMB 3HGQA 2YXNA 5C7YA 2OHOA 1EXVA 1V6AA 5AVKA 1DJQA 1PJZA 2FP3A 2TRSB 2VLBA 1AK2A 3LZCA 4FCCA 4GMGA 1NBAA 1UMBB 4CM8B 2VJQA 5BRJA 4HGPA 5BW5A 4A27A 2H07A 4DKXA 4RA9B 1J99A 5LKAA 1R4NB 5GZ3A 5B7PA 1RXIA 4X9XA 2Z6VA 2IS2A 3LTNC 4OUDB 2W6PA 3GLVA 3MTIA 1PVOA 3GC6A 2DFNA 1Z35A 1IY1A 1B6GA 1DWPA 1QZTA 2I4RA 1Y4DE 1K5GA 3OZTA 4I1IA 4KDRA 2ORYA 2BGWA 1N77A 2Q3BA 1PJ8A 1JG3A 1KE2A 4D9JA 3PJRA 1YL6A 2R87A 3FXAA 2B0CA 2R00C 5DX1A 4CKBB 5KYNA 5T4BA 2ZVPX 5LJIA 3OQ6A 1L5NA 1N75A 3HA5A 4OXYA 1O6CA 3ZHXA 2YZ7A 3UF0A 3G8CA 1J0EA 2ZJ7A 3CLSC 2VJNA 3OIUA 5CH3A 5JECA 1IIBA 1PUXA 1WW2A 1KOJA 3AOEA 3L7AA 4FU0A 4O4JA 4XQEA 1RJFA 3AH8A 2AXPA 4IXWA 1Q2UA 1RI3A 3CX8A 3OOSA 4E2FA 1BG6A 3OZSA 5FWDA 3Q9LA 1HX7A 3EIUA 4LDRA 4M6WB 4EYEA 1IATA 3IS3A 4GOND 4DXHA 2PZJA 4ZK2A 1J5PA 1VHWA 1R6DA 3LQKA 4F11A 4TTPA 2XW6A 1SIUA 3OE7D 3TRHA 5JCPA 3CRNA 4DV6B 3W5BA 4PTZA 1M1YB 3SQNA 1XKLA 3O7WA 3MELA 4RS3A 2JGRA 3S6JA 2PZ8A 1JJVA 3D81A 1J0AA 2JJYA 3OZAA 4G5SA 1FRFS 3E8MA 1RPZA 1R0RE 2FQWA 1ZKMA 2GEUA 2XOXA 4Y2XA 5CCEA 3KUXA 1A2KC 4RHCA 1D8TA 1RCFA 3GCWA 2BV3A 3GT4A 4MB0A 3UCXA 1TTTA 1HYHA 3KFVA 4DEVA 3L82B 2PX5A 2G9ZA 2ATCA 4IDPA 2J4FA 1M2VB 3G0DA 3HKEB 4DA8A 2WM3A 4BB0A 1JIXA 1JLHA 3W5AA 3ZQUA 1SBNE 1A7KA 3QBDA 2C78A 3PUXA 1J0DA 2F9FA 1E6LA 4FFRA 1XCJA 2CHVA 2X23A 1PLJA 2YJNA 5HFAA 1THMA 3RH0A 3SX2A 2CB9A 4GICA 2NX2A 4JLMA 3OP1A 4L5IA 2V4ZA 5FNVA 2RHBA 3LYLA 2C98A 2FEMA 2Q1UA 3LW7A 4YV0A 1PWHA 1W2WB 4Q1VA 1DKLA 4MVJM 4PW0A 1SCUB 3RVSA 3NRCA 3OPYI 5D3MB 3GEMA 2EFDB 3J7AC 1AX9A 1Q83A 3K72B 4RFVA 2ZDGA 2FZ5A 3C85A 3VPSA 2C1XA 4TKUB 3HGTA 3CX7A 3N0XA 2POCA 1G6KA 1ETHA 3RADC 5JAZA 3RSLA 3H9EO 1YE5A 1ACMA 3CKKA 4CV1A 4W9RA 3MPOA 1U1IA 3G0OA 4E2WA 3FOFC 5EP4A 2QUJA 4KFUA 1ZQ1A 4GZ3A 5DTQA 2P75A 1D0SA 2WT8A 2BEUA 3R7FA 5HCUA 2C7RA 1KERA 1KH1A 3QBJA 4CIDA 4LJYA 3TLYA 5B1EA 1ISGA 1RIFA 4WKPA 4PO3X 1I4DD 4ACAA 1NBMA 2WD7B 3HNOA 1ISSA 1CUAA 1G8PA 2FZVA 3EGEA 4IZHA 5LB2A 4L9SA 4E5UA 2C3YA 1P77A 8GPBA 1WUYA 2HPAA 5GONB 3H6KA 1TM1E 1F2TA 3WXMA 3ZE1B 1XLTC 3TXAA 2VKQA 1G0OA 2D2VA 2VP6A 4UDXX 2KM1A 4XRRA 5LQCA 2ZITA 3P1JA 2AN9A 1MTOA 3OHPA 4I14A 4AAYA 4IJ6A 4YRMA 1I14A 1KFCB 1U98A 1WXHA 2Z4SA 3I4FA 3QBVA 4YBRA 4YRDA 5IHPA 2CFCA 1SZJG 3KPWA 5C80A 2Y1XA 2VJBA 5KAMA 1T34A 4FSHA 1E6CA 2R6R1 2IIQA 3EVEA 4M0UA 1NLMA 3CURA 1ULSA 4JT2A 4RANA 3T7CA 4QJ3A 4YR7A 2HR1A 3SR0A 1GL6A 5EPUA 1G2OA 1P8JA 1VKZA 1IE3A 5EYPA 4YV2A 1GFIA 4ALKA 1ZCFA 4Q9LA 5BNWA 2ZFUA 1VSBA 2JBAB 2SCUB 4JAVC 2WU8A 5KVAA 2OCLA 1G1AA 4DAOA 5TEWA 2P3QA 5IULC 1AB5A 2Q1YA 1TK3A 3AJAA 3H2SA 2Z09A 3IDZA 4KACA 2POQX 4TM8A 3NIFB 4EB6B 3LQRA 1G38A 3W7VA 4GQIA 1PDOA 2D74A 2FQ1A 2F7SA 1MH9A 1EZ4A 4YHBA 4P4GA 4AJKA 4LJ4A 3F5MA 2GFIA 1R6BX 4RETA 5LIPA 3IO3A 1CVIA 4DDHA 1F1BA 2DFPA 3L43A 4QGHA 5TB5A 3VVLA 1JJFA 4DSZA 1F0PA 4WZBE 1RLIA 1MA3A 2OCXA 5LLDA 3YASA 1TD1A 3HP4A 2WJAA 3OZUA 4IIJB 4O29A 5E8JA 4BGEA 2GFHA 1K7XB 2BM8A 1LRJA 3KOMA 1EBBA 1W73A 3BZBA 4NI5A 1BYIA 4TXNA 1RI2A 4EHIA 1JILA 3L1UA 3GLFA 3ZS9A 1C8KA 2VPPA 3B3FA 4X61A 4RCYA 4RS4A 3D1JA 4Z8YA 1WZ2A 3LZDA 2HCJB 3ROMA 3FM9A 1Z5GA 4E14A 4J0DA 2FHSA 1AZTA 4L2IA 4N40A 2B8NA 3DO5A 3WRYA 4V3CA 3G8YA 2Y99A 4JS0A 5IXJA 2AMFA 2ZR0A 3OTIA 2J7KA 4WRRA 3QYJA 4FS3A 1TQ2A 2B1GA 2F1RA 4EPWA 2FSSA 3N87A 3WDKA 3FSEA 2H5JA 3NHWA 2KX7A 4MAFA 4PSKA 5TRTA 1SZCA 1TK2A 3DDSA 1G41A 4YYZA 3CWCA 4BECA 1B8UA 1ZSNA 3EX7C 1U28A 1W96A 1HH4A 4O1MA 5CVJA 2WYOA 4F3CA 3L0DA 2Y1WA 4MVJI 4C88A 4BKRA 3GUCA 4G4IA 4GZMA 1XNQB 1T1EA 2XWQA 3WLMA 1WOYA 1RLOA 1DT5A 3NBZC 1U0FA 4RD4A 5AOAA 3WKDA 2CFSA 3LI2A 3AEQA 2ACKA 4MR9A 5LD2B 4J6EA 2H17A 1V95A 2J0UA 2RH5A 3PBKA 4ZCRA 4JQOA 2UVDA 1V7CA 4UE3S 5JS1A 2J46A 3WQRA 1B14A 4PX5A 3RVOA 4F97A 1YJ5A 2P2LA 3NHLA 1RYYA 2DFLA 4K9KA 2QM3A 1KZ7B 2DFKB 1RQXA 2HNAA 2ZWPA 2AF3C 3QEKA 1QF6A 4CKWA 4J07A 2P9FA 2BFOA 2X1MA 2C8LA 1ZGZA 4YMHA 1U11A 4MGZR 1EFHA 3WLSA 3X1DA 2PRKA 3QV1A 4HZUA 4AD8A 1DAGA 2IBSA 1QH1A 5KYWB 4HWRA 1OT3A 1RE0A 3AF5A 1D0IA 3IVXA 4X8OA 2OSVA 4ARCA 5HQ3B 3UXYA 1EDOA 4R2WA 3AERA 5IJ0A 4F5WA 1Z7EA 1ITZA 3FOWA 5IS2A 4DV4B 1SC4A 2VJOA 4N54A 3TSAA 3U4QB 1A96A 1LBSA 3KK0A 4XM0A 2D1TA 1J1UA 5H3HA 4JR1A 3IAEA 4NCJA 4CNQA 4ZMBA 2HAEA 2OZLA 1MBZA 2Q5FA 3UGQA 5AVZA 5L3ZA 3AEZA 4OP1A 3LDGA 2CKDA 5BURA 4TV8B 1P75A 4KPUA 3E82A 4CMCA 2X8JA 4P92A 1ZD2P 2IXAA 5F35A 1NNSA 3HZZA 2GBIA 1E92A 2Z5LA 4LYEA 4UEKA 3HM9A 1DFHA 3VPXA 2MHCA 3QWHA 1FX0A 2DBVO 3S2GA 4EI2A 3DGFC 1XD2B 4D9HA 3ZTWA 3VU1A 2R5NA 3GD7A 4EJ0A 1E3JA 3AF3A 4M88A 1JPUA 1UBEA 5BMVB 4GRAA 2ZAOA 2MR6A 2HD4A 1T0JB 3D0RA 2WKPA 2RAUA 3MINA 1G9TA 1R6TA 4KTVE 2W0SA 2PQ2A 2QSYA 4I9UA 1RQ2A 3D7SA 3KPYA 4LYAA 3EVZA 4BVBA 1BX1A 4BYGA 2VCHA 5EE1A 1R10A 3BIJA 5FLXA 4ZJUA 4BBPA 5K8LA 3ICVA 3KUKA 2FLKA 5AI6A 4N76A 2N1MA 1NXOA 4IFIA 5AKXA 2UUAB 5HOEA 2FMIA 2DQYA 4ENVA 1XCLA 1RZ3A 2RI0A 1RRVA 2OLKA 3E9NA 3UHJA 3T1HB 1ACJA 5MGNA 3NHUA 3FMIA 1T2NA 2GCOB 2HMUA 3LXMA 3VSCA 3GLIA 5EZYB 4YWJA 2BCJQ 1CY2A 5CYFA 2W2OA 3BAZA 4MP6A 3RU9A 3CCFA 3LX6A 3T15A 1JQLB 4ZGGA 1NLZA 2OOKA 3AF2A 5BSKA 5AW2A 4AY2A 3R0ZA 5D6NA 1U1CA 3NYWA 4RW0A 5HYVA 3UGJA 2XUGA 4OQPA 4C04A 2QN2A 3FHOA 2Q0QA 4OFXA 4WGFA 3TIXB 2YMMA 2DLCX 2C20A 1N0IA 2RC5A 3BQ9A 3K9HA 3QKSB 4RK6A 2OUKA 5K0LA 3Q7RA 4DE5A 5A1JA 3EDMA 2ZAYA 4LECA 3MHTA 1DI0A 5CVDA 5DHTA 2X1HA 2B1RA 4AF8A 2JAUA 2PAAA 1FSSA 1E5QA 4KRXA 1V5EA 4DC1A 1SC3A 5AW0A 1YJCA 3DMTC 1WNFA 4FFPA 4E22A 1ZISA 2A59A 3K2EA 2ZVDA 4N6NA 5A9SB 3M83A 4WK0B 3DNFA 4BCDA 3I6BA 4YT5A 3T9CA 4RPIA 1X1AA 2GPBA 5MN6A 2VDVE 1ETUA 4V24A 2WE8A 4MR8B 3KVNA 4NQZA 2ECKA 2BZ1A 3ESQA 1KHTA 2PEYA 4E5MA 1FVFA 3VNBA 4Z49A 1UPUA 4AO7A 1YS7A 1YZHA 4C0WA 3RSSA 2CE2X 2P5YA 5C8VA 1H23A 2X76A 4KXXA 5C3UA 4AJNA 3IVAA 3T5GA 3DL7A 4XTRA 2X2OA 2Q5OA 3ZJUA 1TVCA 1XTZA 4A2PA 3EEIA 3O47A 4HDMA 5BWBA 3AR6A 3M82A 1V1JA 4G9GA 4TTAA 3KEOA 1G3QA 2JAXA 2QU8A 3NBXX 1T1IA 4GRDA 3VR1A 4LDPA 1G291 2W6MA 1GDTA 1T15A 4M55A 2WWTA 3QXJA 2Q6TA 5E4TA 3C3WA 4BCBA 4Y98A 2BDUA 3GGSA 5JQGB 2F67A 3EMKA 1Q1EA 3CA8A 3WIEA 4M9ZA 2HCRA 2ET6A 2EDAA 2EFYA 1EGVB 4M7WA 1NRXA 3STUA 3CVXA 3KT3A 4L8GA 4KXYA 3H8WA 4GC9A 4U5QA 3PJGA 2WVGA 1RRPA 1ODKA 2BL4A 4O33A 4P98A 3W5CA 1GDDA 2HQRA 2RHJA 4Z8XA 4S0ZA 4D57A 3SBDA 4EITA 4J2TA 4BEVA 4NZYA 2AN1A 4R2IA 2IPXA 3IB6A 4G37A 3KFLA 1FYEA 1H6CA 3F6CA 3LIIA 5HF8A 2IUFA 4ISCA 2C9ZA 3NXSA 2YWDA 5JPIA 2OHHA 4LE0A 5KSWB 1NVMB 5KWSA 2GLUA 1WB9A 2GYUA 2I9PA 1D2MA 1SVUA 4C4TA 1FVHA 2C0QA 2EZTA 1AXGA 2P9TA 1KJ9A 2HL6A 2NU8B 2ICAA 2NZXA 2IOQA 3NHJA 4K86A 2B4TO 4OTZA 2GCPA 5DYYA 4B3TB 5ELMA 1JEYA 3UPDA 2YW9A 1I5RA 2ZRHA 4WA8A 4Q93A 4NARA 3WO0A 3OSZA 1VKRA 2ECFA 3R40A 3QBEA 2Q99A 1BXRB 2QN8A 4S35A 3OZDA 4HN2A 4PLPA 2BTEA 3SIRA 1KDRA 3RM3A 3K53A 2IU3A 3KQNA 1CNFA 2G4VA 5IC4A 1LB1B 1WMSA 3DVAA 3K09C 2QVLA 1PG2A 3EQ6A 3QPCA 4JC4A 2B4YA 4LNUA 4ZT3A 4D6XA 4I2VA 3CE6A 1Y5LA 1L0BA 3F7NA 4BO3A 1EUDA 4OB6A 1GL7A 1T8YA 3QFTA 4GPBA 2F55A 5CGQB 3DHWC 3KHUA 3CO0S 3M6WA 1LY1A 2P3LA 3M89A 3SS9X 5C1BA 1PZNA 5AKEA 3JQ7B 3H4TA 3PICA 2AS0A 2DWCA 3FCCA 3QMVA 4LPKA 3UAWA 3LUAA 1Z28A 1BQ4A 1Q17A 1SMKA 4EG4A 5IPFA 2IYQA 4LQCA 3E9CA 3IOBA 4WD3A 2YBEA 3EDQA 3UWSA 5KVVA 1RQNA 4YCNA 3GX1A 3KJZA 4YGYA 1SGWA 2YCBA 2CL5A 3QPBA 4FNOA 3P2JA 4XIFA 1LWNA 4J3NA 3RYIB 4AB1A 1HZJA 4A0HA 2O59A 2VJKA 1EP3B 3D3WB 1OLUB 4Q15A 1G17A 1OZGA 4JLOA 2Y9PB 2JGMA 1U4NA 2YV1A 3A32A 4LWPA 3LCJA 4ND6A 2QYSA 3NPAA 1I7DA 1PKEA 2ZCJA 1R00A 1VIVA 4HGNA 4K05A 3DC2A 2WP0A 4Q37A 4YAOA 2FRDA 1F3OA 1EEXB 2XUOA 4RJ2A 2P65A 3IT2A 2JF0A 4AN4A 5K3EA 5KJCA 1CB7A 2Q6OA 3NWOA 1W9MA 4MS3A 1B74A 1J7JA 1DJLA 1B4DA 4BGIA 3Q3HA 4DCGA 1MB9A 3RSGA 1AN0A 4OI2A 3NC0C 2P6OA 3H9JA 3I8XA 4FNGA 4Q4DA 1YIOA 4JR0A 5CTAA 3T99A 2YZKA 3QH4A 4O4LB 1FFHA 5FPPA 4RK1A 3TJMA 3TUZC 4HLNA 1LBEA 4HWOA 2C4KA 5T4HA 4DS3A 5DW0A 4GVLA 4IIGA 2NNWB 2QTBA 4C01A 2ZS7A 3AI7A 3SY8A 3GJ0A 4XWYA 1V0JA 2CXTA 4LRTB 1M2OB 3DMNA 4AX4A 2PXXA 4D96A 4AS1A 3RK4A 3DBLB 4U7DA 4GBED 3PFIA 5EKDA 1CF9A 4M0MA 1KQ3A 2BMVA