1OILA

Structure of lipase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPASE
publication title The crystal structure of a triacylglycerol lipase from Pseudomonas cepacia reveals a highly open conformation in the absence of a bound inhibitor.
pubmed doi rcsb
molecule tags Hydrolase
total genus 124
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1996-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oilA00
3WL5A 1MNAA 2GYVA 5EIHA 2OCLA 3LIPA 3PICA 4FFWA 2I78A 2DHEA 5LZ4A 2BCEA 4BP9A 3WZLA 4A5SA 2WIFA 2R8BA 1A8QA 2JGKA 3H0CA 1ZI6A 4Q3OA 2WJ3A 4PO3X 3STYA 4BVKA 2WIKA 1ZIXA 3W9UA 1YB7A 3STVA 1FSSA 1CUFA 4F0JA 2XUAA 1CUIA 2RAUA 2PX6A 3FOBA 2HADA 2WHQA 4W1QA 5ALZA 3WLAA 4J03A 2JF0A 2AJDA 1LPSA 3DL4A 1FFDA 4WJLA 4WCVA 2XMGA 1QIMA 5T4FA 5AKKA 1GPLA 1CUZA 1MPXA 5FV4A 2XE4A 1A88A 1TRHA 4QLOA 3FSGA 4BC0A 2XUJA 3FBWA 4U2EA 5CH3A 3UUFA 1FFBA 3G0DA 2CZQA 3DNMA 3H2GA 3G02A 2JGLA 5JZBA 5C8VA 1XZEA 1TQHA 2OCGA 3SX4A 1R50A 1ZD5A 2OGSA 4UHFA 4G4GA 3D7RA 5HF6A 1ACJA 3L1HA 3WJ2A 3P2MA 1AZWA 2G63A 4M0EA 1W75A 1CR6A 5SYMA 4GBGA 4QEKA 5C8XA 4Y2VA 2O2IA 4KAFA 4XJVA 4FKBA 2HA3A 4AX4A 2OG1A 2O7RA 4W1SA 2RHTA 3DD5A 1Q83A 4C89A 1QIGA 1LZLA 4RE5A 2GBFA 2VJBA 3I2KA 4INZA 4FWBA 5AKIA 1Q0RA 4XIIA 2WJ6A 2WG0A 5HK9A 2PU5A 1CEXA 4UFOA 3I2GA 2ZYHA 3BIWA 1W6RA 1YA8A 4N8DA 1TK3A 4Z49A 1UK8A 2VT7A 2IIVA 4C88A 4CG1A 5ALDA 3HEAA 2C7BA 2XB6A 4LXGA 4H7EA 3RLIA 1QONA 1AQLA 3QZUA 3WKEA 1EXWA 4OB7A 5C7YA 3HC7A 4N5IX 3DOHA 1ZD3A 4E46A 1JKMA 2WLSA 2QR5A 5JIBA 7YASA 3ESCA 3O4JA 1O6FA 4UHHA 3PDCA 5AK4A 4LYEA 4ITVA 5HQ3B 1EX9A 2QVBA 4KE6A 1XZKA 3C8HA 4LIPD 3K9BA 1WHTA 1WCYA 4G5XA 3GROA 3KSRA 4U2BA 3V1LA 1L7AA 1JT2A 5AM4A 1AURA 2HIHA 2P8SA 2ZYSA 4JNCA 1ZD4A 1WB4A 2VTVA 5K3DA 4LYDA 5BV7A 3AZQA 3GUUA 4K6KA 5AHXA 2C4HA 2ZVDA 2WILA 1BU8A 4NVRA 3HJUA 3G0IA 4LHEA 4KEAA 1ZIYA 4OB8A 4GW3A 4HXEB 3KOOA 5FLKA 5JD5A 2G4LA 5ALVA 3H18A 4X00A 4Y2TA 1H2XA 1CUAA 4AB1A 1BROA 5AI6A 4CIAA 2VT6A 4F21A 3JW8A 3ESDA 1JJFA 1N8SA 3VVLA 1MX1A 1D07A 3C70A 4BVLA 1B6GA 1H2WA 1UWCA 5T4EA 1EVEA 2RONA 3D2CA 1CUJA 3FAKA 5ALWA 5AK5A 1F0PA 1GQRA 1XQYA 3HABA 1XRMA 3AZOA 4GECA 2XLCA 2XLBA 3BXPA 4KACA 4F60A 1GKLA 1HL7A 3ZLTA 1UKAA 3DDUA 4KR0A 2QUAA 4QDUA 3PE6A 4BP8A 1MAHA 1DT5A 3WL7A 3IUMA 3WIOA 4DNFA 4B85A 4AZ3A 5ALOA 4O08A 5T4HA 1DQYA 2W22A 3MVEA 1SFRA 3GELA 5DNUA 1VLQA 2Z8XA 4BZWA 2Y2VA 1Z68A 3DCNA 4B83A 4H7FA 4QWWA 1N1MA 1VA4A 4H7IA 3O0DA 3VJKA 2XI4A 3I1IA 4W63A 4UHDA 2ZYRA 3O4GA 3E0XA 3OURA 3ZPXA 1QJ4A 3IB3A 4AO6A 4AO7A 4GLBA 5LYYA 5DTIA 3D3NA 5HZGA 3QMMA 1WOMA 2WSLA 1LBTA 4C4YA 4PSDA 2BGRA 5AI4A 3VJMA 2Z5GA 4DMHA 5DNWA 3QYJA 2XUFA 5IVDA 3H19A 1LLFA 4HRYA 4JUIA 1XZAA 5ALMA 3AZPA 4L72A 1PJAA 4L0CA 3FLEA 4Q3LA 5JD4A 1R9MA 4U2DA 2Y2UA 1THTA 4BDSA 3M3DA 1DX6A 4RNCA 2OCIA 4Y2SA 3QM1A 2VAXA 3QH4A 5K3FB 1LBSA 2B9VA 4C87A 4KJXA 5AICA 4K5QA 3QVMA 2WHPA 4H7DA 2AJCA 5ISMA 1VXOA 1DT3A 4QA9A 3WYNA 4Y2JA 3F9CA 1GKKA 3G0BA 3B3QA 4DLNA 3W9BA 1XZFA 3BDIA 5LLSA 1UKCA 4NS4A 1GGVA 4RE6A 3VISA 1G5FA 5JARA 4MQLA 4MQMA 1XLVA 2OAGA 4GWLA 2GBIA 4Y2RA 3WKBA 4J0GA 1QE3A 4BAUA 2OQIA 1W52X 3IULA 4BCBA 2CKMA 1TCAA 1P0MA 5FP0A 3AUKA 2X5XA 5KREA 3I6YA 3BDVA 4U2CA 4M0FA 1B41A 1WB6A 2XUPA 1IMJA 4W9RA 1F8UA 4ZV7A 4A16A 4QDTA 1ODSA 5DYYA 5ALQA 1K5PA 5ALJA 2RGUA 3QPCA 4B9AA 4B0PA 3HI4A 4UBLA 3PUIA 1ZJ5A 1XROA 2H9YA 5AOCA 4J3JA 2WTMA 4K6HA 4MXDA 3KWFA 3V1KA 3R3UA 4AN0A 1DX4A 2QJWA 1CIJA 2OGTA 4OYYA 4KAAA 3B12A 4DNQA 3S8YA 5LZ9A 3I6ZA 4X92A 1PFQA 1QGED 2VA9A 3AIKA 3F8SA 4OB6A 4HTAA 2I3DA 2JGEA 5ESRA 1QIDA 1VOTA 2I3ZA 4IH4A 5JATA 1GQSA 1JU3A 1EI9A 1J2EA 4BCCA 4UBOA 3TJMA 3AILA 5IVHA 1G66A 3CN9A 3SWWA 2CB9A 5E4TA 3CCBA 1RP1A 4G8BA 5CXXA 1XKLA 4GXNA 2G5TA 5EIEA 2VJDA 1XRNA 4BDTA 1ZD2P 4Q34A 1OILA 1CQZA 1XQXA 3WWEA 2JGJA 1GXSA 2HA7A 1UFOA 5JALA 3U0VA 1BEZA 1BCSA 2W6CX 3IBTA 1HQDA 4BBZA 4PV7A 3HYSA 1BCRA 5I7UA 1FFCA 4S0XA 4FDMA 5I9IA 1ACLA 5ALUA 3W2TA 4H35A 4B9EA 2ACEA 5AOBA 5F4ZA 3ILSA 2PBLA 2O2HA 4EA6A 5HKAA 1ZI8A 1QLWA 2PL5A 5EIAA 4DNOA 1YAHA 3C5VA 5AM1A 2ZJFA 2X76A 4N5HX 3C87A 2ACKA 4IH1A 5ALIA 5AK6A 1H2YA 3A2NA 4B82A 1DU4A 2HU7A 3W04A 1UKBA 1A8UA 3TGLA 2WHRA 5DJ5A 3A2LA 3EF3A 2EDCA 1LPNA 3G7NA 2BUAA 4U2FA 5EHNA 4BE9A 2E3JA 4I19A 1USWA 5FPPA 5CT8A 2B4KA 4KRXA 3VJLA 1VXRA 2PUHA 3BJMA 2FJ0A 4G8CA 2DHDA 3FVTA 3KD2A 1JMYA 3O95A 4B84A 1LPBB 1IZ8A 3C6XA 4C01A 3D5EA 5K5EA 4Q3KA 2HA2A 4EB0A 5AM2A 1LNSA 2RIPA 4P93A 2WJ4A 3FYTA 1QIJA 3R3VA 3WK8A 2WIDA 2Y6VA 2JBWA 5ALFA 5D7BA 2BUCA 3EBLA 3MGAA 5DYWA 5J3JA 1U4NA 1E8MA 1OCEA 1E5TA 1AKNA 4K2AA 3GFFA 2H7YA 5AO9A 1ODTC 5JAHA 5IVKA 1HKHA 4BYMA 2O2GA 3QPDA 3WWCA 2H1IA 2ONCA 3ZLUA 1LPAB 4X6UA 5HKBA 5CTAA 1XQWA 4X7BA 3STTA 1BE0A 3C5WP 3AJAA 3VDXA 3PI6A 2DCMA 5AKZA 5ALTA 1XZDA 3KXPA 5LKAA 5ALGA 4IO0A 4G9GA 1TKRA 4DMKA 4AO8A 1NU6A 1XZCA 2XDWA 3WQHA 3MUNA 5AI5A 1EA5A 2VAVA 5HFNA 3HXKA 2J3DA 1CUBA 4DSAA 2BKLA 2C0QA 3AFIA 1F6WA 2Z3ZA 1CVLA 3VVMA 5T4BA 2J4FA 4OD0A 2VATA 1IVYA 3PFBA 3HRHA 2PVSA 4FMPA 3LLCA 4XX1A 1CUCA 5AKHA 2DR0A 2XUHA 2WTNA 3V1MA 1QFSA 5A7GA 5A62A 4PF1A 4PW0A 4Y2QA 2HA0A 1MN6A 4IH9A 2HHAA 2YH2A 1EDDA 5AJHA 2O7VA 2WHPB 5EFZA 2YXPX 3VKFA 4BAGA 5C8ZA 2XUQA 1UK6A 3F67A 2OLEA 1EK2A 4DIUA 5AKJA 4LKOA 5A2GA 1YB6A 1MNQA 5JASA 4FHZA 3S2ZA 1FFEA 3RK4A 2WM2A 4Y2XA 4DMFA 1WB5A 4QWMA 3FYUA 3E1GA 1VZ3A 4KE7A 2K2QB 1XZIA 2Z3WA 4WY8A 1U2EA 5AI9A 5AKEA 5JADA 4N8EA 3LP5A 1QIEA 3WL8A 1P0QA 2QZPA 3H04A 2QJRA 2AJBA 5ALRA 4OYLA 1IUOA 5LP1A 1DWPA 3T4UA 4BRZA 1YA4A 1EINA 3OG9A 1OXMA 1JFRA 2H7XA 4WFKA 4UHCA 3JWEA 1FFAA 1GPKA 5ALKA 2NW6A 5CH5A 3X3HA 3GZJA 4GHWA 5LZ7A 3HZOA 3R3ZA 3I2FA 2HM7A 1Q0ZA 5CRIA 3ZI7A 4YASA 1CV2A 4HVTA 3WWOA 1XZLA 5LIPA 5HCUA 1XZJA 1WPRA 4X71A 1XRPA 5LZ8A 2HA4A 4H18A 3R3XA 1GPNA 3D2AA 1XLUA 3AIOA 4L9AA 2DHCA 1XRLA 2PSHA 2XQGA 1DQZA 4EY7A 1XZGA 2YASA 3I2IA 3CXUA 5AM3A 2GZRA 3NWOA 5YASA 4OCZA 1ORWA 3H2HA 5JANA 1ZJ4A 2WQZA 4FNMA 5K3CA 5AM5A 4X94A 4UFPA 4HZGA 2HFKA 2ORYA 1TAHA 5ALYA 4KE8A 5JD6A 1SC9A 4HS9A 2QS9A 5ALPA 1I6WA 4ROTA 4AMYA 4EHBA 3PF9A 1J1IA 4GI1A 4BAZA 4TVKA 1CUYA 3WIBA 1X2EA 3FSGD 2GYWA 5CT9A 1AGYA 2ZJ7A 1VKHA 3WJ1A 2FJPA 3IA2A 5AIBA 5D3ZA 4J0JA 3DEAA 5CT4A 1K8QA 3DS8A 4Y7DA 3GBSA 2JGIA 5CURA 3OPMA 2I03A 4E11A 3STUA 3M82A 5AK3A 2XMRA 4EUSA 5EHZA 1EK1A 2C0PA 1YS1X 2WU4A 2Q0XA 3L1JA 3G9TA 5DYTA 5FPQA 4AQDA 3ICVA 4ETWA 1BS9A 3QMWA 3FNBA 4DM7A 3WKCA 2GZSA 4UBKA 3H1BA 4QDXA 1JU4A 1VA5A 3LCRA 3IUNA 4DGQA 5JYCA 2R11A 2VF2A 3H1AA 1CUGA 4Q82A 3SK0A 1QTRA 3C43A 2PSFA 5SYNA 2XMDA 3G0CA 3I1YA 1QIFA 1MU0A 1X2BA 4B6GA 3WYDA 2XQJA 1MX5A 1BEEA 1E8NA 1HBJA 4MEAA 1DWQA 4HXGA 4MWSA 1EHYA 4YK7A 2YYSA 4B81A 4OU4A 4ARBA 5JZ9A 3R0VA 1ODCA 3O4IA 5EI5A 5HF9A 3IVMA 5C81A 4N8SA 5EHXA 1L7QA 2B61A 2Y1KA 4OUKX 1ZICA 1QO7A 3BL8A 3V48A 1QFMA 4WFJA 3V9AA 4BE4A 1J07A 3G8YA 2HA5A 1L7RA 4OPMA 2VJAA 3DKKA 1EH5A 4G9EA 4X97A 1CRLA 1UT6A 3I28A 3ESBA 5AKGA 3IUQA 3R3WA 3W06A 2QM0A 5CH8A 5LZ2A 2XUGA 1CUUA 5ALHA 2VEOA 1H23A 2ES4A 3DKRA 2JEZA 5A7FA 1ZI9A 2AJ8A 4Y2PA 5EGNA 4P9NA 3YASA 5LKRA 4RPCA 4MWTA 4XVCA 4UUQA 1YSCA 1CUWA 3GA7A 2WIGA 1K63A 2IX9A 1H2ZA 2FX5A 1LGYA 1BN7A 1R3DA 1DWOA 5A71A 4AN1A 4Q1VA 3WMRA 1E89A 4FLFA 4QLAA 3F98A 2WFLA 4LXHA 1Q84A 1T4MA 2ECFA 4CCWA 1UK7A 4B7ZA 2OGZA 4KRYA 2JGMA 4FNGA 2QUBA 3PUHA 1UOPA 1A7UA 2AXEA 3RARA 4E14A 1QZ3A 5A7HA 3D2BA 1TIBA 1NX9A 1CPYA 4X3CA 1W4LA 3TRDA 2B20A 2DSNA 5E2IA 3AINA 1IUNA 4KAJA 4G8DA 4X93A 5DNVA 4D9JA 3WKAA 5KBYA 4ZGBA 4UPDA 4AZ0A 2XUIA 4DMCA 5KWIA 4P08A 4PSUA 2OAEA 3LIIA 5CT6A 4KE9A 4CCYA 1HPLA 1VZ2A 1SCQA 3EQ7A 1P0PA 4QZVA 1UOOA 4C4ZA 1XLWA 1KU6A 2OQVA 1AMNA 4F5ZA 3BJRA 4FLEA 3MUOA 4CFSA 1WPXA 2V97A 2Z8ZA 3IURA 4J0KA 3HLKA 3O4HA 4CI9A 1TCCA 3FCXA 4K6GA 3ZLVA 3R3YA 5FXMA 3OTQA 4MJ3A 2PM8A 4ARAA 1EVQA 3ED1A 2HU8A 2QRUA 4X6XA 1JJBA 4WY5A 2VSQA 3WWPA 3EQ9A 3K6KA 1R1DA 2JIDA 3FYUB 1C4XA 3WK4A 4W1RA 4BCDA 4UFNA 1H22A 3DQZA 1QIKA 4J0DA 4G4IA 1WHSA 5A6VA 4C4XA 4HAIA 2CEKA 4HXFB 4QDZA 5K3BA 4ZRDA 2WUDA 4CIBA 1TCBA 2HRRA 4DTCA 3L1IA 3ANSA 4IHAA 3WK5A 1PV1A 4UBMA 3I6MA 3OC0A 2CMFA 4FLMA 4ZI5A 3STXA 2OCKA 5AIAA 4BATA 3NOXA 4X90A 3PF8A 5KWJA 5BWBA 2VJCA 2XQIA 3R40A 6YASA 4KYVA 2XUDA 3WA7A 2VQ6A 5AKYA 2WFZA 3RKSA 3QPAA 3SC2A 3I2JA 1LPMA 4HRXA 4MYSA 3A70A 1EDEA 3K2IA 4JYPA 3KWJA 2HL6A 1XZMA 3D4LA 3HACA 4X95A 5DLPA 3BWXA 5IH7A 4UBIA 3WK9A 4J7AA 1K6EA 1NU8A 2G5PA 4MYDA 1XRQA 1UK9A 2J4CA 5HF5A 5ALLA 3Q8WA 4L3WA 2ZJ6A 1UOQA 4EY5A 5K3AA 5FKJA 2X8BA 2JGFA 5AKXA 2XQFA 2PKYX 5E4YA 3EIOA 1F0NA 4B0OA 2AJLI 2BUBA 4BVJA 5ALNA 2PPLA 3H2KA 1GZ7A 5AOAA 5CT5A 3D0KA 2GYUA 3DLTA 5AH0A 4BTVA 1O6GA 4V2IA 3DYVA 2UZ0A 1YS2X 1CUVA 1ISPA 3V1NA 2JEYA 2RHWA 3LS2A 4JYMA 4FBLA 4B80A 5FRDA 2ROQA 1HDEA 2WUGA 3DL7A 3JYHA 4Y9SA 3WL6A 3G9UA 3NGMA 5D3KA 1CUHA 5E4JA 3DJYA 3N0TA 1CUSA 4FOLA 4H0CA 5AKLA 3CN7A 1Y37A 4QNNA 3EQ8A 4G4JA 3DYIA 3C6ZA 2CBGA 2QTBA 4OSEA 1SOMA 3BF7A 1BRTA 3IDAA 4FTWA 3H2IA 4H7HA 1E66A 4BZZA 3O9VA 5AI8A 1P0IA 5IVIA 1BN6A 1K4YA 4GDMA 4DNPA 2EDAA 2XMCA 2WG2A 3ZWQA 4EY4A 1JMKC 2EEPA 3T52A 2XUKA 3WI7A 2LIPA 1LZKA 4NZZA 1T2NA 3IUJA 2QMQA 2ZSHA 1U8EA 3U1TA 4EY6A 5HFAA 4EY8A 2HRQA 4H77A 2WUFA 4YPVA 4ZV9A 4BC1A 3WK7A 5AP9A 1LPPA 1CUDA 4E15A 1E8DA 3WK6A 1R9NA 4IQ4A 1Y7HA 3IIIA 4PQEA 1XZBA 3BIXA 2GBGA 3G9ZA 4X6YA 4Y2YA 4P92A 1RYYA 1XKTA 3WKDA 3KDAA 1DTEA 3UMJA 4C6HA 1KU0A 1CFJA 1CUEA 3FYUC 1SCIA 1CQWA 2D0DA 1ZGBA 2QT9A 3NUZA 1G4HA 1HLGA 1C7JA 4EZIA 1IUPA 4AXBA 4MEBA 3F96A 3FWHA 1QIIA 2WFMA 3C45A 2C5GA 3STWA 3C6BA 2IITA 2WU3A 4J0CA 3N2ZB 1KEZA 5CBKA 5BWCA 3G0GA 1M33A 1VJ5A 4CG3A 3UUEA 1R4ZA 3QITA 1AX9A 3FCYA 3WWDA 2C58A 4RGYA 3RM3A 3WZMA 3FLBA 1THGA 3I2HA 2BJHA 3TEJA 5HQ3A 2BFNA 2XUOA 1YCDA 2WFLB 4I3FA 4NMWA 1ZOIA 3A6ZA 5ALXA 1X70A 5IKXA 3C8DA 1XRRA 2HA6A 5AI0A 4CG2A 4JEIA 4X85A 2QXTA 4TPKA 2WKWA 5I8PA 1JJIA 4JH0A 4PSCA 5H3HA 4ZWNA 5JZSA 1MTZA 2XMSA 4W1PA 2HFJA 2PSEA 1MX9A 4OU5A 1IZ7A 5D6OA 2XQKA 3AIMA 2PUJA 2ZSIA 4DSZA 1Y7IA 1ZGCA 3QMVA 4Y2UA 5DWDA 3D59A 2V96A 4J0IA 5CXUA 1YAJA 4YX9A 2GBCA 5CW2A 1MAAA 1SCKA 1QTIA 3W05A 1MJ5A 2BAGA 3WA6A 4UHEA 4G1FA 1VE7A 1AC5A 2QXUA 5EHQA 3B5EA 2XMQA 1VE6A 1RWQA 3M81A 4ZXFA 1R88A 4CCYB 1W76A 3A2MA 2Y6UA 5ALEA 1W1IA 1ETHA 1MO2A 4H7JA 5K3EA 1A8SA 1G42A 1C7IA 3ICWA 1WM1A 4J0HA 1XFDA 3OOSA 4TGLA 2FUKA 4FBMA 1N5MA 3FLAA 3F97A 3QBJA 4I4CA 5LZ5A 1CUXA 4LXIA 3VXKA 4UBNA 4Q05A 4BTLA 4XWGA 2WIJA 1J06A 1ORVA 3DOIA 5JAPA 3BE8A 3Q0TA 2XT0A 1DINA 4QDOA 1MT3A 3E4DA 2QKYA 2J3QA 2WG1A 4U2GA 4DYHA 1XZHA 1QO9A 3M83A 1EDBA 5FOQA 3H2JA 2CUTA 1LPOA 4WDQA 4X91A 2OPHA 3HSSA 4EBBA 2BGNA 3OM8A 2PU7A 2CJPA 2QOEA 2RI6A 5HF8A 2XMZA 4FFVA 4ZREA 1CLEA 2C5FA 4WDRA 4M0MA 2PSJA 2DQYA 3CCCA 2DFPA 3O9MA 4GEGA 4BB0A 5BOVA 1FJ2A 1S8OA 3E3AA 3BF8A 4A23A 2DQZA 1XQVA 1UXOA 2D5LA 2HU5A 5DTJA 3H17A 4QE3A 2WUEA 3ESAA 5AM0A 3FVRA 2PSDA 3R41A 5HK8A 1JI3A 1QOZA 5FUMA 3G9XA 1YASA 4AMZA 1EB8A 2HDWA 1UZAA 1QIHA 1N5RA 1U65A 2H7CA 3PFCA 1EB9A 1E3QA 4UBJA 1AUOA 2ZYIA 3C6YA 3ZV7A 5CMLA 2OXEA 2XMBA 4H7KA 3ANTA 5K3FA 4BRSA 5JAUA 4WFIA 1GT6A 5FDFA 1YR2A 4UHBA 5JAOA 4PNZA 2V9ZA 5ALSA 2V98A
chains in the Genus database with same CATH superfamily
2C4MA 4D1YA 3ETHA 4GPD1 4IMPA 5IVPA 1V48A 3S1SA 2PO5A 2AMJA 4P58A 1VCHA 5A03A 5KYWA 4MWEA 5EIFA 3LIPA 4L8LA 2NYAA 3OE5A 1EWKA 4JC8A 4I55F 1PK7A 1XU4A 1QCZA 2I4RA 2XV1A 3LUHA 5EJAA 5ITZA 3EJ6A 1SVUA 4KQKA 2WIFA 1K88A 3M4NA 3KLBA 2PGXA 4M98A 5L4NA 3WHLA 1EGQA 1V5IA 3KKZA 2JGKA 4PCLA 3CO5A 2REBA 4LVCA 2LGJA 3SM3A 4URVR 2NV6A 1DC8A 1U9CA 3H0CA 5GOZA 4GLJA 2FPXA 1L5MA 2GYYA 1MOQA 2OP1A 1AG9A 3BK7A 2Y99A 2WIKA 3PFGA 3R0ZA 4BVKA 2PZAA 3EZXA 1X9IA 2EWMA 3STVA 1F8GA 5DHFA 5KNDD 1H6DA 1SU7A 2K5UA 3GCDA 4LE2A 1CUIA 2RAUA 2BKVA 3C5HA 4B31A 4RORA 2H0RA 4GE3A 4KW7A 4C14A 1X80A 3WYFA 4TSRA 2WTEA 4X3PA 3SJUA 4TT8A 3VPDA 2HADA 4YP9A 1GFSA 4X61A 4GMKA 3HN7A 1NBEA 3B1VA 1PI3A 3LF1A 1Q2UA 2G6BA 3E0QA 3EG9B 2XWBF 4Q02A 2AJDA 1ISHA 1MQ9A 4L3VA 4ZT3A 5TB5A 1YKSA 4FOSA 4QFCA 2WU8A 3IVXA 4ZCPA 1LBQA 4BX9A 5FNVA 2FHPA 2P69A 4HRVA 3LUAA 4CV2A 3DB2A 1KQOA 4NH0A 1K2VN 1SB9A 3O8OB 1RYFA 1QIMA 2XMGA 3MTJA 2GPNA 4LQLA 2ZUDA 4U6NA 3SZLA 4N0QA 2IDZA 2Z1NA 4UOQA 3S1AB 1GZ6A 3FX2A 3EZ9A 4B4DA 3NNDA 4LMRA 1LDBA 5AKKA 5D3QA 1QX3A 1WXFA 2VN8A 3KKOA 4LGVA 3RAJA 1LEHA 2F59A 4IV8A 2QU8A 5CPFA 1QH0A 3RBAA 3WGNA 3R0QA 1M6NA 4RA9A 1FFXB 4ND8A 1A88A 4QDJA 2BOVA 2SBTA 1H8ED 2V1UA 2UYGA 4N5DA 2AEEA 3O1HB 1V96A 4NDNE 5CH3A 2W71A 3UUFA 4MKZA 1XR3A 2A86A 5KSZA 1H6CA 1Q44A 1AGNA 1T8TA 2NGRA 1P2BA 1PR0A 2YXEA 4D97A 4TKUB 3GLFB 2CXNA 2DTDA 3B36A 4JEHA 3RYFA 3AQIA 2QX8A 3ANNA 1JEJA 4Q7JB 4RY8A 4U3JB 1WXWA 2LE0A 5J2UF 3ZE1B 2HSEA 2ID8A 4IHKA 4NCIA 1XHLA 2JGLA 3M4JA 4ZVTA 4TROA 3S2SA 1BJTA 3AVWA 2UV8A 1C8LA 1TQHA 2PVPA 1R50A 4IDNA 2V7UA 4RDIA 5FL7D 4ZYLA 3O91A 4FYMA 4QM7A 1MCZA 13PKA 5CDGA 3CE9A 1LJ8A 2OGSA 4D3SA 2E85A 4WKBA 1OB2A 4FC6A 4GL2A 4CETA 1WXIA 4ME6A 3F3YA 3OKCA 3GJQA 4Q5IA 2VWPA 1EFDN 4NJOA 4NKRA 3UAGA 2NYUA 3MWLA 4FDVA 2H1FA 5GONA 3AJRA 1GL3A 3CBGA 4ND4A 4QEZA 3ZQ6A 1E2PA 1CR6A 3ZHRA 4P80A 5L9AA 5J2TB 2WSSA 2ZJ1A 3KHUA 2WNHA 5HUQA 2UUPA 3U48A 4YO7A 2W98A 5ILQA 4QEKA 1D04A 2FN9A 5CG2A 3LK6A 2O2IA 1UZMA 5IAKA 3SQMA 1KI4A 1MXFA 1NBAA 3ZNOA 1J0CA 1ISGA 2LWIA 3E35A 4AX4A 5BN3B 2OG1A 2O7RA 8OHMA 2EYUA 5JXIA 3S7ZA 1HYBA 3JWGA 2GEUA 1LS6A 3EXEA 1QRDA 4FN5A 4Y9TA 4ZPJA 5EZ5A 3VUEA 2OORC 3DD5A 4K9QA 2BBTA 4XIGS 2XUZA 5DYIA 5GPBA 4EGFA 3LI2A 3K9NA 7MDHA 4KXXA 3JQ8A 4P22A 1QIGA 2BMWA 3O8LA 3PEWA 1A1VA 3KXIA 4RE5A 5HJ7A 3D6NB 3VTZA 1I9CA 1HLFA 1IY2A 1KL7A 2VJKA 4HQFA 4YUXA 5B7NA 4I46A 3QSGA 1BW9A 2YWBA 3UV6A 3O1IC 5ECGC 1O97D 3K5PA 3PQ2A 4N82A 5JTTA 3AEKA 4DCVA 4IILA 3MJVA 4OOEA 4NULA 1CEXA 4NWIA 4YJ3A 5KVQA 1W2GA 3FZEA 1KVRA 1HEIA 1XA3A 2G08A 2GUGA 2R25B 3RVSA 3U13A 3X1ZA 1PNTA 4R0MA 4Z49A 1KKUA 1IQUA 5EINA 3ZOZA 2XNJA 1SXQA 5JC1A 2VT7A 3FBTA 2IIVA 1B0ZA 1PZHA 1ZU5A 3NTRA 5SY9A 3T7DA 3PLAE 2OB2A 2QP4A 5EPUA 1SIBE 2ZRPA 3VR6H 3NNNA 1AK9A 1TC2A 3KYCB 4S2EA 5AXCA 1U7ZA 1JRLA 3BIFA 3CC8A 4W5TA 1K66A 1FTGA 1LV8A 1RQRA 1RYDA 2AF4C 2XB6A 2Q41A 4H7EA 4KBYA 4LXGA 1AQLA 4M60A 4TWRA 4R7GA 2C9BA 1RQPA 4NCJA 1QH8A 1EXWA 2O3JA 3NHJA 2O8BB 3I0ZA 2QYTA 3N2IA 1QQBA 3FTFA 3S29A 2J45A 4G3XA 4KVFA 1CETA 3HC7A 2JAPA 3TSWA 4DC9A 1G5PA 3U44B 1VE1A 3E82A 1QBKC 4L75A 5DNAA 4HCJA 4N5IX 3DOHA 4R41A 4F72A 4RJTA 2EJWA 2PH3A 9LDTA 5IMSA 1EP1B 1ZD3A 4F3TA 4JQSA 5A06A 2NU8A 5LQNA 5C1BA 1RXSA 3TJZA 2WMOB 2ZFUA 3NHUA 4JJ4A 4RL4A 2WLSA 3SQDA 2E0IA 2QR5A 2QENA 4TKVB 2C04A 3ESCA 3O4JA 4XPIA 1NDQA 4XWKA 2X6RA 1KAHA 4PZAA 4XDGA 3ZQUA 4UHHA 4KX3A 5DN6A 3PDCA 1VSBA 2X6TA 2DPHA 2GAAA 2IUUA 1ZN8A 2AFRA 1NQAO 2Q4RA 2QNBA 3NUQA 2D5IA 5M5BA 1LSOA 2JRLA 1DCFA 3HE3A 1Y5NA 3E61A 3C7DB 1J4AA 4KE6A 3L4JA 1L4KA 1EK5A 4UUNA 4YMSA 4EEXA 3S55A 3COJA 1DG9A 3QJGA 2FMTA 1M6WA 1X6VA 4S05A 4GPBA 2WA1A 3DTVD 3GJ4A 3TI7A 4DCCA 4F97A 2NNLD 3HVRA 2ZAGA 3SAJA 3K6JA 1N32B 2XVYA 1MJHA 4RJIA 3KKQA 2QLBA 3WWZA 1WB4A 3ROPA 4XA8A 5BV7A 2Y0BA 4NECA 1DRWA 1L9KA 1OX4A 1EGAA 2UZAA 5E6RA 1VPEA 1Z38A 4NLLA 1C9NA 1KK1A 4K6KA 4M4SA 5AHXA 2OC9A 2XCSB 2ZVDA 3D02A 2ZJ5A 3NUGA 2R6GA 4KXVA 4WRRA 5IM4F 4CM7A 1OLSA 4PAWA 3D7MA 4PTLA 1Z7YA 4FJ2A 3UV7A 2TECE 5DM4A 4COKA 1D9ZA 1BU8A 1J97A 1M7GA 2ZBRA 2JFNA 1CJTC 1FXSA 2FR1A 2FZGA 2QU7A 4HN4B 4I2NA 4NZ9A 6REQB 4YCSA 2QG6A 4PPGA 4RPLA 3AUYA 4HXEB 2QRQA 2O8FB 2W8BB 2AN1A 4OK6A 3P9ZA 2F8SA 1XVAA 5JD5A 4LF9B 3UENA 3SXUA 5ALVA 3BTOA 1IU9A 2PANA 1H2XA 3ACCA 5LDHA 3CZ4A 4JJ8A 4D9GA 1Y8QB 4IR7A 1FW8A 2E6KA 3G2IA 3AETA 2JVIA 1D6JA 1M1UA 2OKCA 3JYPA 3MILA 4E12A 1JJFA 5E3IA 1DEAA 3I9FA 1N8SA 1TJYA 1KZ6A 2JGNA 4QDKA 3MZ0A 1BKYA 3TI9A 1D07A 1PU2A 2A0KA 3HCCA 5B36A 2XGOA 1B6GA 1R0LA 2QPLA 1E9AA 1WXQA 3TLJA 1LWNA 1NQWA 1H0RA 4PC2A 1Q0TA 4H7PA 2EAUA 2YYZA 4L50A 4AY3A 2IXFA 3B6MA 1P5HA 3E9QA 1WXDA 2W5UA 3E7FA 3IQEA 4MCHA 1R0KA 2B25A 4UATA 1F0PA 4LWPA 2I2WA 2G71A 4BKQA 1I4TD 5B30A 1XRMA 1BGWA 1Y9AA 4ER3A 4LKRA 1SXHA 5JAZA 2XLBA 3BXPA 2PL9A 3IPRA 3WOVA 5LQAA 1C5KA 2H1LA 3T95A 5HSGA 3JV7A 4DWWA 4DR5B 5ARDA 4L02A 1R8SA 4TTTS 2ZCJA 1RFLA 3JVDA 4WZ6A 4DQVA 1YRLA 1J33A 3UAXA 2ZUBA 2EFDB 3K72B 3DDZX 1GKLA 3HJNA 2Z09A 3ZTWA 1A4RA 1H2EA 1UKAA 5LQSA 1KI2A 4OQ4A 1R5OA 1X77A 1B3RA 3CRVA 6AT1A 1NVFA 2P2CA 1G20B 3JAWB 3TLMA 1A5TA 1U9JA 3ZE8A 4BP8A 1IJBA 4KCGA 3QNUA 2Z2JA 3RK0A 5I7FA 3MCAA 1KPGA 2LKDA 4HAWA 2FLVA 3EGDA 5K3OA 3IQFA 1RJEA 1C3EA 1SXJC 2Y92A 3IUMA 2OP0A 2GH1A 4HKTA 3WIOA 4LA4A 5CVEA 4YRIA 2OCBA 3H2YA 3SYRA 4O2AA 5K0BA 4KUGA 2HXYA 1VLHA 2A0FA 2P0YA 3DOEA 5G3ZA 3TBHA 4O4IA 4AZ3A 3RK1A 5KYGA 4DIEA 3AI3A 4WASA 3JQRA 1JDZA 1PZEA 3WNVA 1U0GA 4TWIA 2W22A 4URZR 3V32A 2O5VA 3FZNA 1I94B 1SZJG 1EEXB 4PAOA 4BJ5A 5DNUA 2VHQA 3FHOA 3GP5A 4M7OA 3F46A 3GMTA 4CDNA 4X64B 3RWBA 2GSDA 4FN4A 3HYLA 1XMXA 4WNCA 1US8B 3DCNA 221PA 1FDVA 2BN4A 4H7FA 3VKGA 3W2HA 4K9OA 1OROA 2IPNA 5B1DA 1QZTA 1NVBA 2NT4A 2Q0HA 3ESQA 4MQ6A 4BQSA 3LUGA 4MOWA 1GILA 3UB4A 4TTIA 4E09A 2GZHA 2CNNA 3IJ5A 4I50A 4DZTA 3NYWA 4QG3A 2D1FA 3UT5A 3KJQA 3JPYA 4O29A 2JI7A 4HVCA 1GYPA 1G8FA 4C7MA 3FWPA 3I1IA 4OA8A 3IHLA 4W63A 3PTLA 1QYDA 3N86A 1R0CA 2X1LA 1QKKA 2PNJA 2E21A 3V7FA 3CNNA 3FHCB 1CT9A 4AO6A 1FMTA 2FFRA 3REFA 2WKSA 2EVWX 2OGUA 4YJ2B 2DWOA 3FROA 3OCJA 3Q7EA 4DQDA 3D8HA 4EMSA 2YDXA 3NBXX 4RCZA 3R76A 3D3NA 2OSBA 4KQ1A 3L6EA 3DL2A 3LYHA 1CDZA 4M8IA 3WADA 4ED9A 1H2HA 1TA0A 4KN6A 2J6BA 1YB1A 2ZIXB 3QMPA 1SBZA 2FRDA 4E7PA 5HOEA 3VZSA 4IRMA 2VDQB 3EW7A 5JBQA 5EJ9A 1SVSA 5JVDB 2PKQP 3FNHA 4IPTA 1G6Q1 1KIFA 1VG8A 4ZQHA 2GTIA 4LMBA 2XNDA 4QYTA 1LLFA 2V0GA 1XYYA 2D54A 2AUMA 1ZSYA 2GESA 2I0FA 2PUWA 3ZJUA 4IDFA 1KP2A 1X3SA 2F7SA 4M1ZA 2A94A 4YROA 5DTQA 3ZX4A 4N3NA 3K70B 3RJ5A 3AF5A 5E9QA 1G9TA 1JLKA 1PJRA 2PZGA 3BMXA 1X3LA 3AZPA 4PYOA 4UARA 4B6OA 2CJWB 4L72A 4DE5A 1PJAA 3DO6A 1A69A 2HSJA 3E58A 1BXKA 1M7HA 3PKZA 4B5LA 4JJZA 4PYLA 4U2DA 3QWFA 3DULA 1NQXA 4FXPA 4XLTA 5E2BA 3EAQA 3LQRA 1DKUA 4KWHA 2J41A 2CNWA 4TL8A 2XT9A 5A3SA 3RHFA 5DI3B 4PLTA 5AJVB 3M3DA 1GU7A 4DKXA 5K1ZA 4C7OB 4TSFA 4YV7A 3L2OB 3HR8A 1JNYA 2IHBA 2DLNA 2OYSA 4G0ZA 2JFGA 1GWNA 5K3FB 3ILXA 1AZTA 3BRQA 3LM8A 2ZUUA 4KMOA 1H3NA 3FMVA 4FYPA 3C1AA 3ISVA 3G5UA 1VIYA 4K5QA 1II9A 3AESB 2OO7A 2WHPA 4JU8A 3B70A 4LEIA 4H7DA 3CF2A 2IYUA 4MKIA 3W5UA 4BJ6A 4AG3A 3UCFA 3PJEA 4K9SA 4NARA 1VXOA 1ISFA 1LX7A 1U6IA 4JI4B 3WYNA 2VPXA 3FOAA 3F9CA 4DLNA 5BN4B 1GN9A 1DMRA 1SU6A 4R5HA 2GX6A 1OLUB 2C9MA 3MTAA 3NQ41 3QTTA 4PXSA 3TTWA 4D41A 2P3SA 4YLYA 2H48A 3WGHA 4NZMA 3KCNA 2FWAA 2QLNA 4HWKA 1U0FA 1E2MA 3S2YA 2R2GA 4R9UC 3DL0A 3NAZA 3UYLA 5A1TA 4IWYA 4RE6A 4C1BA 4QTTB 3ZVNA 1P4SA 1POXA 2BRUA 2C5SA 2W6MA 3N2GA 1IN1A 5C34B 2D5CA 3KT0A 1VMEA 1NLMA 3R9IA 2D74A 3KJGA 1ZEMA 1W46A 3C7TA 1H6BA 2R65A 1ZM3A 4ND1A 3LVRE 4Q7LA 4RKFA 4WW0A 3TLKA 4B8ZA 5JO0A 4L8VA 2JJMA 1CZRA 1V9SA 3E8MA 3LDFA 1VI5A 4L6AA 4MQLA 4BFUA 5FUQA 3L7NA 4R31A 1OBFO 4MQMA 2FPMA 3GUZA 1GGJA 5JXGA 3CLSD 1JW9B 3UMGA 4DT1A 2VHWA 1EE1A 3GGCA 4G1UC 4I66A 4OH1A 3WKBA 4LF6B 1EVIA 1W94A 4AKIA 3QVTA 5IULC 1TJ4A 4B3RB 4HQRA 1E3IA 2B82A 1VJCA 1OVMA 1R15A 2CKMA 3EUFA 4KQHA 2C8LA 5EWJA 2HPZA 4MUXA 4EPVA 3UMMA 3F5SA 1N1DA 5L3ZA 2A57A 4Z6KA 4R2XA 3K4HA 1UMKA 4V03A 5FP0A 1I4DD 1CR4A 4B46A 1ITZA 3GRCA 4O33A 2NQ8A 4F6CA 3P9IA 1HQYE 4A0QA 4DPMA 4KQMA 3A4IA 4R2IA 1MP0A 4HH3C 4FYVA 1RADA 2WHYA 1Z7GA 4QTZA 1GZHB 1Y0BA 4LFBB 3JQQA 3ZVLA 5CDHA 5CYFA 4D6YA 4QYSA 3EZ7A 1YRWA 4MK4A 4ZV7A 2GTHA 3ET4A 1OXBB 5SY6A 4OKSA 5CVDA 2P65A 4HDMA 2J3KA 1ODSA 1O9BA 1QUEA 1SHTX 5E9AA 4BB5A 5BRJA 3T5GA 4DRXA 2F90A 3ZDEA 3AHGA 4RLHA 1EFPA 2R7NA 3QPCA 1M3SA 1U8FO 3QKTA 3G6WA 1JDVA 2WOJA 4OBWA 4B0PA 4ZCRA 5SYAA 5BWOA 1HSZA 2QTRA 2ZSEA 3IE2A 4GOOD 4J3NA 2EYQA 1XROA 3FGOA 2H9YA 3TKAA 5AOCA 3D3WB 1UPTA 4J3JA 1EHCA 2HJWA 2WTMA 3EDQA 4BZQA 5AVYA 4IGAA 4DG8A 2YV4A 1SRQA 3EC2A 3V2GA 4CDGA 5KWVA 1XWIA 1OR8A 3ROZA 1ZKMA 4TYNA 1GYQA 1I2DA 5TS3A 4MXDA 1VI6A 4EAAA 1RDFA 3V1KA 4AN0A 2O6LA 1VGVA 2CFRA 2VSOA 2QUJA 1N2BA 1NW7A 1LQTA 1XLTC 3NO4A 4PC6A 2PWBA 3I4CA 5KMGB 3M6XA 4H0NA 3W0LB 3U7JA 1QK5A 2WYWA 1JIUA 3T7SA 4HDAA 2P5SA 1JIKA 3Q7PA 1J70A 4JT8A 4DNQA 3MBIA 1OWOA 1HOXA 4I50F 1G3RA 2NZVG 5CLGA 3LUPA 1Z6GA 3CWCA 3NONA 1TA9A 3NDJA 1AS2A 3LNTA 4XR4A 3B1KA 4MP8A 4OB6A 2VUSA 3VPGA 5LXTA 4IEEA 4O3MA 3GLGB 3RVLA 4Y6LA 2EHDA 3O26A 2OV3A 3LNCA 2WD7A 5ESRA 1WS6A 4IHQA 2I3ZA 1T3SA 3OT5A 4R9SA 4BGDA 4FB4A 4XYLA 5MGNA 2HK7A 5JSZB 3K1AB 3E3NA 2IXBA 1NKSA 1NTRA 1CEEA 4ZTZB 3H05A 1QYIA 3SHFA 1EI9A 1J2EA 1MC4A 1WBDA 3S4YA 1SBHA 2X8WA 1JVBA 2ST1A 3G68A 1H4TA 1G66A 2ZSJA 3QOWA 4G23A 1JEDA 3URKA 4ALKA 1OA0A 4UMVA 3A36A 3DPSA 2OFPA 1N3YA 2FUG6 3AOEA 2DQKA 4ZHQB 4WEOA 2AOUA 1ML4A 1UDWA 1R0ZA 1KORA 2A3RA 3O3CA 5IBQA 2FPSA 3R7FA 5L4SA 1NM5C 3E05A 2PV0A 3E48A 1FDIA 1G7TA 2HPHA 5I6DA 4GXNA 2G5TA 1PJZA 3E3OA 2BPOA 2AOTB 1XRNA 2HQRA 3GMIA 4YREA 2NUBA 2HDOA 2R86A 5AUPB 1NVKA 1CQZA 4Y8VA 1KY2A 4BNJA 1A5BB 1SVIA 4UCQA 4CIDA 2VJQA 3TDNA 5C1PA 1HA3A 4IJWA 1RRPA 2CXPA 4RFSB 4W8OA 2HCTA 3GZNA 1KNQA 3HB7A 3LA6A 3OBIA 1DWUA 4DJ5X 5LA6A 1Z8DA 5JAMA 1BCSA 1Z82A 5I4CA 5AW4A 2W4MA 2ZYVX 3FKQA 3C3BA 5ESWA 1M75A 3H3XA 1ZISA 1E2UA 4FCTA 4N18A 4X1IA 3H8JA 1GSOA 2J5RA 2Z56A 3QFRA 5FA5A 3ADDA 3HA2A 2W90A 3I73A 5IDXA 4G5GA 1H9BA 4R1SA 4Z0PA 4EX6A 4BBZA 5HTOA 1DKLA 1YU6A 3UANA 4ASUD 3VC7A 2R00A 1BCRA 3BJIC 3I92A 2RH5A 1CVRA 1W35A 4GPAA 3WE7A 3NRBA 4BEVA 4DYDA 2Y76A 4O1MA 2CD7A 4TV8A 3HUEA 2I9PA 1O5IA 3BGDA 5LWHA 4WPGA 5EE1A 4H35A 2J9ZB 2QRZA 4AY6A 4C3ZA 1FX0B 5AOBA 2BJWA 1MEEA 1CJSA 4RQAA 3NS7A 1GZUA 2XTAA 4C07A 3ILSA 6ABPA 2PBLA 3JQ9C 2DQ4A 2W9XA 3ABQB 4MB0A 1RR6A 5LQMA 2BLLA 5AT1A 2O2HA 1E63A 4DR3B 1RC1A 5F73A 2JG3A 1IFXA 4R81A 4EA6A 5CK5A 2PA3A 2R7AA 2QE7D 4TV9B 1QWOA 1L5GB 1FS5A 1SBQA 5EIAA 4TWAA 1UDAA 4BLQA 4MS4A 1JDPA 1E0SA 2AW3A 5E7JA 2IOYA 4FJ1A 1TVKB 4B75A 5M04A 1A8PA 1J2JA 2BKUA 5AM1A 4HDSB 2X76A 4KQ2A 1JIXA 3C87A 4N5HX 2JIRA 5C7OO 1X9GA 2BW0A 3UA3A 5AK6A 3RSQA 2BHNA 4QG7A 5DHPA 5TF0A 3VU9A 4MVJA 4MI6A 4UQLA 3P96A 2O0HA 3OF3A 3W6PA 2B30A 4RK7A 4TKVA 5HQJA 3A2NA 2C4UA 3FGPA 2PLNA 4X65B 3DE3X 3HVHA 1DU4A 3H11A 2CLKB 3TW0A 3WMFA 4F4IA 3W04A 4JC0A 4XWTA 1UKBA 1ULUA 5IDVA 4PPYA 4YNBA 2O7NA 2W6OA 2PX2A 1DPFA 3FPKA 3I3SR 3IXMA 3KC2A 5DLEA 3CEAA 3GJTA 3A2LA 4LDQA 1YBAA 4NMHA 1PV4A 3GLSA 2PUDA 1PZGA 1W0JA 5BV1A 1RRCA 1DELA 3EZNA 3GFPA 1Z0FA 4Q4HA 4YJFA 5CEEA 4KDFA 4BE9A 1Y33E 3EXIA 3W90A 4TXNA 3B1FA 3N75A 1GUBA 5FA6A 3HXOA 3DW3X 4X54A 4O59O 3OTOB 4G81A 1H5QA 1YULA 4RWZA 4RA6A 3QW2A 4KQJA 3T94A 2YIJA 1BMFA 3CUUA 1BWRA 2QVGA 3H5OA 2CF5A 1GL6A 1O8CA 4J2OA 2F1IA 3FVTA 3I4FA 5ARCA 3QTBA 1CHNA 3O95A 1RLIA 3MLBA 4P53A 1P39A 1XZQA 5CA1A 3ZHCA 3QPUA 2QX7A 1HE2A 2QJTA 1Z28A 3LY7A 3GGDA 3JQFA 5JD3A 5B2ZA 1WCIA 3AM4A 4G26A 4ZAFA 4BVAA 1UH5A 4Z51A 4B84A 3X2FA 2VZEA 2V7TA 3IXQA 3ZE2B 1AKYA 2PV7A 1ZJ6A 3CYFA 3E03A 4QU9A 5TGZA 3C7CB 3PXBA 1DS6A 1PLJA 3NXKA 4EO9A 5MFPA 2PUTA 5DO9A 4WZBE 1S7CA 4NBKA 4AKEA 1EFKA 5AM2A 4CKCB 2QAIA 4TLDA 3AR3A 2XITA 5IEJA 4R3WA 3L8EA 4KNVA 1JAYA 1UDXA 4X8LA 3ETLA 3DTNA 2IRWA 4G4SO 1B42A 4RIIA 3RRJA 1Z0KA 2WJ4A 1RP7A 2Z43A 3C6KA 2NOAA 2X4LA 3ZCSA 1K98A 3FYTA 2Q5CA 4MV0A 3OVMA 4I0WB 1DV1A 2RB4A 5JQGF 3ZKWB 3URMA 3OTIA 2LVBA 4D4MA 2FMIA 1LK0A 3D3JA 5CIYA 4KLZA 3RASA 2Q2QA 2GKOA 2WIDA 3L7BA 1O95C 1DCKA 4HWRA 5D7BA 5K0JA 4U7PB 1CQIB 3LXMA 2XNCA 4ZVSA 1OWLA 1ORRA 3CH6A 5B57C 2BUCA 4M36A 3OECA 4CKBA 1C9MA 4CE6A 2IHUA 2Q28A 4E88A 4R51A 2ZZNA 2JBAB 1R4MB 5J3JA 2XTMA 2V7PA 4BV2A 1OIVA 1U4NA 1XMVA 2POQX 1D2MA 4ZO4A 4CWAA 4GRIA 4XJTA 1Y4DE 5IBCA 1YDEA 1MEOA 2CXSA 1J0EA 3EMKA 3FRJA 3WR5A 3UH0A 2GS9A 2L0XA 3OTHA 5LXTF 3KB1A 3OSUA 3AFGA 1O58A 3RUCA 2ADOA 3K0KA 1NN0A 2BDEA 2KSQA 3QX7A 2MSDB 1E3TA 3DV9A 3JR3A 4HEA6 4R83A 4M8LA 1T26A 4WLUA 4CQMD 4ENUA 5KNCA 3V5NA 3TUZC 5SZKB 4MCIA 2OZLA 4CM1A 2QRVA 1XTVA 3MWEA 1J42A 3FCEA 1GAXA 1DBSA 4KDCA 5EIXA 1NG9A 1RPJA 4X6UA 1M34B 2Q4TA 4OF4A 1XBTA 4JP5A 4PANA 2QQGA 4GKJB 1DBIA 1V5GA 3LK7A 3STTA 3AJAA 1GKYA 2HEIA 4JDPA 1GRVA 1G2QA 4LOHA 4D3XA 2OCPA 2AK2A 2DFNA 1DJNA 4BVFA 4E21A 2P6MA 1U7OA 2HIGA 3S2UA 2AOXA 2FZKA 3TW8A 1Q91A 2PPVA 5BYBA 4ALNA 3D4BA 5BT8A 1P9LA 4ZANA 1QYWA 3I53A 4JY7A 1NSTA 4JBNA 4LBWA 1SHUX 3FWNA 2VF5X 2YS7A 5BWMA 1PW7A 4IHJB 4DA9A 4G9GA 4JP8A 4R2LA 1NUTA 1T4CA 2OHFA 2ZIUB 4MRRA 3WNDA 1TKRA 3HCRA 5TE9A 3UGTA 4G0OA 4RZQA 5CJ2A 3C1UA 2C2YA 1L0BA 3DFZA 4M83A 2Q6OA 3V4FA 3VNRA 3BMQA 3U09A 2PUEA 1KEEA 2BLNA 1VHQA 3BWEA 4M1YA 3VR5D 3ZGVA 3HY3A 1U7TA 4JBLA 3QVSA 4KQFA 1NI4B 4MKGA 1ZOOA 1XZCA 1E18A 3ZJTA 3RVNA 3JYLA 4QODA 3T1NA 1SD5A 2F62A 1Z2CA 2K4MA 3GJYA 4RHTA 5AI5A 1QS0B 2HMAA 1C0EA 1EA5A 4MITA 1A72A 4N6OA 4TV8F 5COAA 2ZUEA 1H9CA 3FZGA 1GZSA 1EUZA 1SELA 2V59A 3L7JA 5HFNA 1E2KA 4RDXA 1CUBA 3CPEA 1XNJA 5K6AC 2BKLA 2O52A 4FMCF 2ZUVA 1P8AA 2WF6A 1G16A 2N75A 3AFIA 1PQPA 4GUDA 2R6HA 2BEWA 1A0OA 1ATIA 1UBUS 2QM3A 3EW9A 4WZBA 3PHBE 1SN7A 1R0YA 2IZ6A 3GRYA 3QVUA 3NHWA 3MT0A 2IVZA 3L7CA 3P2IA 1QGUA 2A9OA 1JHZA 1KH3A 2RI1A 1WB9A 2J4FA 2ZAOA 3VPHA 1E6UA 4II2A 1ELOA 5FORA 1E3JA 5B7QA 1C9DB 4LZJA 4OD0A 4D9NA 1SCUA 4FJ0A 1FMLA 2D0OB 4AZTA 3EEBA 2C5BA 4FMPA 3LLCA 3ETNA 2QUZA 1UJ4A 1W5SA 5JWHA 2WYUA 4DLRA 5K0EA 1D2HA 1R64A 4TYWA 3WOHA 1AKTA 1FEZA 2JDIA 2QEQA 3KPUA 2O0MA 1VRWA 2DR0A 4ZZ2A 2W0MA 4EUEA 4QGGA 1P1HA 2JGDA 2WTNA 4M21A 5I4IA 4L5CA 5KYYB 5H02A 3RI3A 1PNOA 1LB1B 1QFSA 4I36A 2OBXA 2XVAA 4EAQA 3CZCA 1BHQ1 2REQA 4HLNA 1Y8ZA 2Q9UA 2ZW9A 3TQCA 4MAFA 4MDEA 2LTAA 1GPJA 1HFWA 2X2FA 3DWIA 2OOKA 4PW0A 4Y2QA 5JZVA 2ZIGA 1VHTA 2DGDA 3FXAA 3GRKA 2HLDD 1Z39A 4IH9A 4R1PA 3MYYA 1EUCB 5F2OA 2YV3A 2BTQA 4NEHB 4CF4A 3GU3A 1P44A 3MCZA 4GQAA 1L4EA 5IAJA 3GNQA 1SGWA 5F33A 5LDGA 2NZWA 3VKFA 3W3ZB 5JSQA 2XUQA 3BMOA 1MQAA 3HL0A 4WGFA 1G3UA 4G5FA 2JH9A 3F67A 4NCBA 4HB3A 3VU8A 1Y63A 3RTEA 2AQ8A 4F1JA 2FSFA 5AVOA 3BB4A 1AT1A 3DOFA 3NHKA 1UKZA 3P52A 2QY6A 1V5EA 2GM9A 5KX5B 1GRRA 1XTSA 4RH3A 1MNQA 3QJYA 2EIXA 4LJ4A 3AU9A 3KAJA 2QQFA 3ZY6A 3S1AA 5ITWA 3JAMA 3GYGA 4RF4A 1H4QA 3ANXA 1P1IA 2H4YA 4MDFA 1GQFA 3HSKA 5L3RA 3RK4A 4PQRA 1S3SA 4LZAA 1WIWA 4WOCA 3T1QA 1USUA 4OVKA 4R1TA 3EPRA 2N3ZA 1OF1A 2XT6A 2JLAA 3FYUA 2WI8A 3IEUA 3PRJA 5E0OA 3E1GA 4Z3OA 1VZ3A 4KE7A 5CLHA 2CHEA 2GA8A 1J8DA 1E7MA 1Y3DE 2FE1A 1YA6A 1N9GB 4RD3A 3SU8A 5JCPA 3QU7A 1QE5A 3QYAA 4IJ6A 1ZNZA 4P5PA 4OXRA 4EPTA 1ADGA 2GK6A 1RQLA 1EFRD 3A3YA 3WL8A 1P0QA 1N9ZA 2IL1A 1TZMA 1YR3A 2L17A 4KN8A 2HCBA 3W5HA 4KPYA 5LP1A 4P38A 4U3JA 2RG7A 1KOLA 4GS5A 3T3OA 2DHRA 2X22A 4RZXA 3Q72A 4QIHA 3DBVO 1KAOA 4RD1A 3RYCA 5H59A 2VRBA 3HDQA 1VL8A 4KBGA 2W93A 3A11A 2VSXA 4F5EA 3U7FB 3EVBA 2UU9B 3TZKA 3MELA 1D0IA 4CR7A 1NQOA 3PHIA 4NG4A 2G3YA 3VR4D 4I1RA 4J1TA 1FFAA 1FIUA 5MHTA 2Z2XA 1GADO 3VYWA 3FHTA 3OFKA 4V02A 2NZ2A 3JS5A 1A71A 1QH1B 5ALKA 5EG5A 2VNKA 3EPLA 1RCFA 4GHWA 5LZ7A 5J2TA 3HM2A 1X19A 3A1EA 3HZOA 3JASA 5TMEA 1P73A 2YWEA 2HM7A 5L40A 1Q0ZA 2O2ZA 4FHCA 3GPDG 4MHOA 4RX1A 5E7IA 5CRIA 4CMIA 2J7KA 2A84A 4JN6B 1PL0A 4HVTA 5TX7A 2HT1A 4AYXA 2HRCA 1JEYB 2RAPA 3L8ZA 4ETNA 4HNRA 2IXTA 3PFWO 3C3CA 3ICCA 4UVIA 5AJYA 2ATCA 4B3CA 4TKLA 1Q1GA 4BUCA 1IZYA 4FFMA 4P0PB 1JJ7A 3UQYS 2EG9A 2VYVD 2QN3A 1EDZA 2TRSB 3IKJA 3O94A 2PXAA 3KWLA 4RMHA 4LXYA 3D2AA 5CP8A 1Z4JA 2GI4A 3BZUA 1E79D 2GPAA 3EF0A 3GZTB 2C98A 1K6MA 2WR8A 3TUIC 2DHCA 5I4KA 5EMHA 1TUBA 4F46A 5EJ7A 3DVQX 2W4IA 4PQYA 1F1BA 1DQZA 3RBXA 3AONB 4OL9A 4EI2A 3TSZA 3IJPA 2YMPA 1G0OA 1U80A 2MSWA 5IARA 1P5FA 2GZRA 2G06A 3DTVB 1U3WA 2WF9A 4CIYA 8AT1A 3TLYA 3HU1A 2YV1A 4U9IS 2C99A 2C31A 3FHJA 1P2VA 1ORWA 2C5AA 2P6NA 4URHA 2AE2A 3L7LA 4RFVA 4HB4A 3LLVA 1XDGA 3QXSA 1WF3A 3B7GA 4MB6A 5LU8A 1EFTA 5KKAA 2FWIA 1M8GA 3MJEA 1GA1A 3SYTA 4E70A 4OSPA 1LU9A 4JWKA 4O1HA 1SC4A 4MEJA 2QD4A 3W78A 1JG6A 3KYCA 4U7FA 4Y6OA 3TZQA 4E2ZA 3H5RA 4XWYA 4YFVA 2HFKA 2Q3MA 3NDRA 5HCIA 5ALYA 1M2HA 3ZVMA 1WDWB 5DGDA 4FEEA 5L53A 4XYBA 1D2RA 5JD6A 5JRDS 1ID1A 4M46A 1QB7A 4DVGA 1SC9A 4XLZA 2UVPA 4KV7A 4Q4LA 5ALPA 2GFHA 5BUZA 3JWHA 1T0BA 5SY4A 4LSGA 2QA5A 4P7FA 3O7MA 5C5EA 3E8SA 1WZEA 4HEJA 3NVAA 3W7BA 3GWGA 4X0EA 4ZOCA 4DMMA 4ZMSA 1NJFA 5DX1A 4MS1A 3J7TA 4EB6B 1B00A 4QOJA 1M2OA 1GQYA 3K31A 4MRPA 1CWUA 5A0FA 4TVKA 1GEGA 1CQJA 1V26A 3KE8A 5KDLA 1TO2E 2GYWA 4BO3A 3RRNA 1YHYA 3MEQA 5IT0A 5K4AA 4US0R 1AGYA 1Q22A 1XMIA 2ZJ7A 3AK4A 4Q47A 5T41A 5FEUA 5H9WA 2X19A 5DSXA 4BP1A 1RXEA 1L5QA 5D5HA 4DMRA 2VBCA 4NXMB 3KCQA 5AIBA 5REQB 3TEMA 1B7GO 1Y6JA 4TQUS 5EP2A 4MO9A 5LBUA 1J7KA 1WKVA 4G0WA 4ESVA 1YRAA 3EZYA 3HDYA 2JFWA 3EGXA 4Q66C 1IN7A 2YHSA 1U02A 2HRZA 1YOVB 3IPAA 3L6BA 2E2WA 1PWYE 2HJGA 1DZ3A 2A1UB 2VJMB 2GHQA 3L4BA 3BD7A 3ZZUA 4E11A 1PDVA 3NETA 4HZIA 4ZT2A 2HO4A 5KDOA 4ABYA 3RWMB 1CY1A 1WXEA 2QZ9A 4B2YA 3HKEA 3LCJA 5H70A 4YJDA 3STUA 1FOEB 4Y1EA 5AK3A 3T41A 5J23A 1PW5A 3TFQA 2QR2A 1YS1X 2WU4A 4MJLA 3P5SA 1BFKA 1KHTA 3L77A 2CZCA 2Z08A 3K9GA 5HILA 3M5DA 1L1QA 1RHMA 1YCHA 4WBXC 3UW1A 4AQDA 2R6AA 3AWIA 3FNBA 3HWX1 1E7RA 4LDNA 2C1XA 2G1KA 1P1RA 2XY4A 4OQLA 3TMKA 4MS3A 4UBKA 1KJIA 4KSCA 5BSMA 3T9BA 3WKCA 5JDIA 1HORA 4X1YB 1ESDA 3WMWA 4MUJA 4MWBA 3LCRA 4HEHA 4PXAA 5K6RA 2CGEA 4UUOA 1Y5LA 4KXNA 1A76A 2WJZB 1IK6A 3D7NA 3N9IA 4P3XA 4YBRA 2VF2A 3H1AA 4TL6A 3U9TA 1JHRA 3L0ZA 4DIOA 3VR2A 3A4VA 1P0CA 1N92A 4OQQA 3VDRA 4ND3A 3G2NA 1QRSA 5CPBA 1YT5A 2BONA 3HDTA 3KTOA 4H27A 2XMDA 3I1YA 1NVAA 2N9UA 4HJXA 4P36A 1CIVA 4RZUA 4C5CA 1W44A 2QRLA 5EXPA 3EWSA 1MU0A 2H2GA 1X2BA 1WUJS 4B6GA 4ENWA 5J1TB 5LJLA 3PFFA 3WYDA 5EESA 2WPNA 1KO5A 4UM7A 2X5OA 1BEEA 4D56A 1E8NA 3PUYA 5EP1A 1MORA 1HDGO 2ZWAA 3KEQA 4G8JA 5JY6A 3ASZA 3L8YA 2AL7A 1JPUA 4HXGA 4QYIA 3TD9A 3LPAA 5LIRA 3GT3A 2WVHA 4YACA 1SCDA 1TLLA 1KZ7B 2GNAA 1RQXA 2QB5A 2GCOA 4KIWA 5DP2A 2IDJA 4NZNA 3IDQA 2GM5A 1C9KA 2AX4A 2OFXA 1X1QA 4INJA 3S6JA 3VC3A 1I4EB 3L1UA 3O4IA 4DZRA 5A4MS 3U61B 3CXRA 4M1KA 4YB8A 5FOSA 1BHJA 1BZYA 3IVMA 1KP9A 4X5OA 4KFRA 2CBXA 1RAAA 1J8YF 1OC4A 4C4RA 1E6MA 4HNAA 4B40A 3G7UA 3FR7A 1R0WA 3JSXA 2ZJZA 4YDHB 4BTEA 2ZPUA 1ZICA 2DHQA 2Y3IA 2SCUB 3W6ZA 4CIWA 3BL8A 3TL3A 1WMAA 2XCIA 5FWNA 4G37A 4NQRA 1RBYA 5J2TF 2AN9A 1V1RA 2WJAA 5DBOA 1YRQA 2HA5A 2ZYWX 2FP4A 4KG7A 4F1KA 4C5AA 1O96B 4MUHA 4RABA 4OPMA 3NHSA 1YMQA 5A4AA 5A3QA 3OY2A 4DARA 1QFYA 3CNHA 3RVKA 5K99A 3UJ9A 1REQB 1QDEA 3CHYA 1ILWA 1L6IA 3OWHA 5EE5B 3T3EA 3B52X 1NLYA 3R0XA 2FFAA 4NX2A 4RH1A 4EJSC 3KOWA 3I28A 5FLYA 4JOCA 2GEVA 2FFBA 2Q1TA 1U6JA 1QDLB 3ESBA 4D82A 1JEAA 1WUTA 3IUQA 1BYUA 4B4WA 4DRZA 5HJEA 3W06A 4PHGA 4QTXA 2X8JB 3W5CA 2QM0A 1K8YB 1MGOA 1V5FA 3I05A 3UJ7A 3CKMA 3Q7RA 8LDHA 1CQPA 3CRRA 1K08A 3CIOA 2R97A 4L5YA 2NZXA 5LB2A 5EHGA 4PLZA 2JC3A 3ZD6A 4S1OA 1EAMA 1H23A 3AP3A 4QAJA 3M5PA 2JEZA 5G2OA 1CDEA 4DVJA 2A92A 2MJLA 3ABSB 4A0GA 3D4OA 5C80A 5L95A 3IYLW 3UJ8A 3UJHA 3PU6A 4OIMA 1NE7A 2G0TA 4H3KB 5LKRA 2YIDA 3JD2A 3GG9A 3HGTA 1V7PC 2FHSA 1W88A 5IAGA 4Z2YA 4RPCA 4XVCA 1A8IA 4YJ2A 4YUZA 2AFVA 3SQOA 4CQLA 4Q9IA 1Y1KE 2FSVC 1CUWA 2WJGA 3G3EA 4M88A 4O4HA 1MIHA 4ALIA 1E1NA 1NY5A 3OFNA 1BMDA 1J56A 2JHPA 1X8LA 4XWAA 5C46F 3VX3A 4KNYA 3E9EA 3OPNA 3GMDA 2VYND 4QAQA 2P7HA 2BFWA 3A9RA 4MGKR 3ENZA 5C2JB 1JQKA 1ZMTA 3VSCA 1DWOA 2FY8A 1KFBB 2G07A 1CERA 5EERA 3RVJA 4QPPA 4AN1A 3KKNA 2XF8A 1ZNYA 4PPFA 2XDYA 1T9ZA 3OOYA 1AS3A 1E89A 1RM4A 4QLAA 4F3YA 1RJFA 2HK8A 2O7QA 1ZRHA 2NLOA 1XTTA 3BTUA 3F7OA 2JD0A 3FTQA 1Q84A 1YJCA 2HREA 2QTZA 3JPWA 4LXHA 4XI9A 3ZW9A 4P8RA 3LBFA 3M2TA 1O89A 4CMBA 1ECGA 3MD0A 4Q21A 5DLYA 1UK7A 4GR4A 4X60A 2WIBA 3H5LA 4OQYA 4F3NA 2VP9A 4V1CB 4RBNA 4YCBA 1U63A 1E4YA 3G1UA 3DHWC 1RTTA 5JFOA 1BSVA 3K9FC 3SE7A 3EH1A 5AXBA 3GJ7A 3ZHYA 3TZEA 4J29A 5FR1A 5D7NA 4R7ZA 1PS8A 2R84A 4ZCSA 3RRBA 2JGMA 2CWDA 4NF2A 4YAKA 2QUBA 4BVEA 1JVNA 2C82A 2IHKA 4EKIA 1A7UA 5FV7A 5KAPA 3RARA 4E14A 1GPWB 2FP3A 1G3MA 5KOYA 4QU0A 1P9NA 2JA2A 3H5NA 5E8JA 2DBYA 2SNIE 2OK7A 4OO3A 1ECJA 3OJCA 5FUYA 3AG6A 5KSOA 1NX9A 1WVGA 4JLOA 2QNIA 1B0AA 5I7OA 4KLRA 4L5JA 1PGQA 1S9DA 1W4LA 1Z4LA 2QGFA 3DV2A 4U2KA 2HF9A 5LCXA 3RJZA 3MWJA 3TZLA 3FKSD 3WP1B 5AVWA 4CEHB 3T5CA 2AD1A 2B20A 3TOCA 1U04A 4UJ3A 3LYLA 1WMBA 1AKEA 4BFVA 1NYTA 3BZBA 1OLUA 1V2GA 3CF4A 1ODIA 1G8SA 3M4YA 4N49A 4P2BA 4HQKA 3TIVA 2BFEB 4RS3A 2J6HA 2RSLA 1ZNWA 3O03A 5FOUA 2C3MA 2H4XA 2CBZA 4CMKA 1U5CA 4DM4A 3PXDA 1D8AA 2G1JA 1TU4A 3VZRA 4E2XA 1E60A 2MT9A 5DNVA 5JAQA 3V8PA 1KK2A 5TS2A 3WKAA 5KBYA 2RHLA 3ENVA 1CF9A 3VYTB 3DMTC 1UJ6A 4ZGBA 2ECOA 3EA5A 1JR3E 4TMYA 4ERXA 1T9GR 3D0OA 4XM0A 1AO0A 2XUIA 3LPDA 4ODIA 2VYFA 1LLQA 1ZUNA 2HHHB 1GNPA 1M1NB 3RYTC 3TCXB 2NQ2C 2OAEA 3LIIA 1VGRA 4LWOA 5HWSA 1C8KA 3B2EA 2PRYA 4GSYA 3VOBA 4Z9BA 1HPLA 4CL3A 1JALA 1IULA 4W4TA 1ZA1A 4JKOA 2BKAA 3EQ7A 4HX2A 1PR1A 1UXKA 3QQ5A 4FEYA 4INAA 3SJAA 4G41A 4PR3A 1U0EA 5JCOA 5BVGA 5ITSA 1GPUA 4Z4FA 2Z4SA 3LFUA 3ZWKA 1XDSA 3HVUA 4DCUA 2INGX 4N5MA 3AKDA 2QGNA 2R85A 3KAQA 2OQVA 5LVAA 3AFOA 4MR7A 3N74A 3M1AA 1MABB 5FI0B 1BH6A 3T1YB 5BSUA 4LE0A 3ORSA 2P9EA 5H7XA 4K0RA 3HLKA 4CI9A 3S8EA 5JSYA 1N6KA 4K6GA 4CEJA 3OT1A 4AVYA 4CQJA 4G0QA 1Y98A 4JIGA 4MJ3A 4CEIA 3FF1A 1RBZA 2WA2A 1O9HA 1T2VA 1WBJB 4IQ0A 3RYIA 3T7IA 1RRKA 2QRUA 4OXXA 4X6XA 1HMPA 1JJBA 2OT3B 2V6IA 3ZWYA 2CD9A 2WF5A 2YVAA 3E2MA 1B93A 4JOSA 3IUBA 3K6KA 2G76A 2L42A 4QUDA 1XDZA 3CT4A 5H9VA 2X6QA 5M7EA 4RVGA 3CLUD 1BRMA 1K27A 2O0KA 4MUIA 2CLDX 4QC2A 1UWKA 3HMKA 3K6SA 3AI2A 3ZIAA 1NLFA 5KUTA 2HJSA 5GQSA 3W6NA 4MUYA 2ODAA 3GEMA 1F2UA 5IT9A 1N3LA 2MYNA 1Z83A 4MVCA 1KDTA 2OD9A 5A6VA 2A14A 1NE2A 4HAIA 4K9NA 4RK5A 3C3YA 2ZJ3A 3CUWA 2CEKA 4X9XA 1SUAA 3JAKA 4HXFB 5F51A 3ZD9A 3ZDYB 4CM4B 3UEOA 1WSAA 2Z5FA 3GJ6A 4GMDA 3ZW7A 2V9PA 3COVA 2RI0A 3IV7A 4BNDA 4US2R 1I7DA 2VRNA 2WUDA 1PWEA 4ZYUA 2A3NA 2JJ2A 3W4KA 2HRRA 1I6MA 3I01A 3OO0A 3NBZC 1O94C 4HDQB 1WP4A 2OCDA 2XCUA 3SMVA 1IWPB 3WGZA 3L1IA 4YMWA 1KDYA 4DTCA 1C1XB 1PGJA 4JB0A 5DOVA 3D7LA 2GARA 2SKCA 3OC0A 3OPYB 3PQ6A 4CL0A 1JLLB 4E5NA 4GXTA 1A4UA 2AGVA 3FMIA 1SUWA 1WCV1 4LC9A 1O54A 4LXXA 4MYCA 2JA1A 4UVDA 2WSBA 4WBSA 5ERXA 1C0IA 3SHOA 4H9GA 3STXA 4BQNA 2KW5A 5TLSA 1M6HA 1Z17A 2H57A 1E61A 3DJFA 3RJMA 1NRWA 4B7CA 1OFVA 4LBVA 5CU7A 4YJ2F 4B71A 3OM1A 4AX8A 4MDHA 3UMYA 5IZCC 4DIFA 4BNMA 3F4BA 3DLHA 4O4HF 4D5GA 3OAAD 1UT5A 2YHIB 3DLAA 2Q8NA 3RLFA 2WFZA 2J0EA 1I7NA 1BU5A 1GG9A 1MJGA 3WFZA 1T9AA 1JR3A 3LO5A 1M2WA 4GNRA 4RESA 1XMOB 1ESMA 3C48A 1Q50A 1Y4AE 1AA9A 2P77A 3PFNA 5T67A 3PNPA 3B2QA 4DDHA 4F5DA 1QG0A 10MHA 3I2JA 4LJ9A 4NOLA 1QZZA 2EX1A 2FDXA 3KRTA 5JVDF 1IWBB 3DOUA 3KAKA 4B6JA 3EIFA 4KHPB 1X7WA 3E81A 3RVOA 4UTZA 1ZL2A 1S7GA 2BFCB 2IHJA 1O0CA 1TYCA 4JYPA 5KJ6A 3KWJA 2HL6A 1L3IA 4ND7A 1RHRA 4G25A 1DIBA 3DP7A 4LY0A 5IUKC 4WINA 4ALLA 1VPDA 2EJVA 4F60A 2O8DB 3WK9A 3A6EA 3IHTA 3M3PA 1E1RD 4YXWD 4PONA 3C24A 3MJHA 1X94A 1BE1A 1HYHA 4OA5A 5AHWA 1DXHA 1QHSA 5IJ9B 3NATA 3LQ1A 3RTDA 1JPVA 1TI7A 3S8MA 4EIWA 3S81A 1G6HA 1WMDA 1X7ZB 2FN3A 2V6FA 2XQVA 4NYIQ 1FRVA 4RF3A 5KQLA 1R6AA 1IK4A 4R9NA 3T54A 1DC7A 2CW5A 3Q8WA 1RXCA 1M83A 1MB4A 1NFFA 2VNIA 3ISJA 3NVDA 5B2FA 2XNKA 3AM1A 4E4TA 3PUVA 1ODFA 2AYYA 4NZPA 1NATA 4EQ6B 2GEJA 2VBGA 1QGOA 1ZR4A 1EM8A 2YWXA 2P41A 4FT4A 2IH5A 2OXIA 1H2RS 1A27A 1JWAB 5FBZA 4EY5A 1E1YA 4QRHA 5C5IA 2ZZMA 5FKJA 4F6RB 3BPSA 1X13A 1BKDR 3M70A 3DBHB 1GCAA 2R44A 2X7HA 4HGOA 1V95A 2XQFA 4CT0A 5AVKA 4EEKA 2PKYX 3VGJA 5C7LO 1EA7A 1CKEA 2W6ID 3I9V1 1K8ZB 3DTYA 3IP9A 5EEGA 4GR9A 1JXQA 2NZYA 2AJLI 4Q3DA 1ENZA 2BUBA 3T9CA 1TVKA 2SKDA 2I7VA 1KO1A 2PPLA 3B20A 3H2KA 3K9WA 3PGKA 4BU0A 1HZZC 4NENA 3VHXA 3A6HA 3DF7A 3SPXA 5K09A 2FLKA 3K53A 3L01A 5ECYA 4YMLA 1CU1A 1RLOA 3DLTA 3VUFA 2R6JA 4BTVA 2OD7A 2I6TA 5ADWA 1E3MA 1F4VA 4W5HA 4EDFA 1HNXB 3M6FA 3LHDA 3DYVA 1H3FA 4OM8A 2YWDA 3EQ6A 4RVOA 2B36A 1QV9A 1ANKA 3R7NA 1ZD9A 3G9QA 1ISPA 2FZEA 1FYDA 3QUAA 2WWVD 2IEYA 2JEYA 5ESDA 3LUKA 2V65A 3FDZA 4AQ7A 3LS2A 2F1KA 2GGSA 3JARB 3X43A 3QF7A 4FBLA 2VNJA 3NOOA 1R4AA 1V39A 3N0XA 3V7UA 5FRDA 2R751 5CB0A 1PP4A 2QX6A 2ROQA 2D0PB 2HTEA 3DAYA 2OBYA 3IR7A 5JY1A 2WSMA 5SZJA 4DUGD 4BO7A 1PFGA 1OH6A 3MMNA 4BFZA 3RAGA 4DDKA 2Q3HA 4RMNA 5DKFA 4EBFA 3VR3D 3NGMA 5D3KA 3PL5A 4AS3A 4FWTA 2BP7B 1WKCA 2CV1A 3AHJA 1OI3A 4DQKA 3LXUX 1HDRA 1W85B 2G04A 5CGQB 5AKLA 1E2LA 1HT0A 1JECA 1Y37A 2ZOSA 2HWWA 4CQMB 4E5VA 3VNQA 3V34A 3GVXA 3BAZA 1DLJA 1ADYA 3U3ZA 4QXPA 2C61A 3GRUA 3HBLA 1IY9A 2CBGA 2QTBA 5C53B 3KELA 4WKGA 1AQ6A 2E4AA 2XEDA 2JFQA 4OSEA 4TRJA 3IAXA 4FTWA 4LRXA 1KI3A 3TE6A 1GPBA 3Q8XB 4A0SA 1SB8A 4BZZA 3KJHA 3O9VA 5DULA 2WAOA 3T5PA 1H8HD 3QFTA 4BMOB 1KZ1A 4CUZA 4EPXA 1BN6A 2NUTB 1DEXA 3F5FA 1J22A 3WYAA 4DNPA 4H31A 1FA9A 4C0LA 4GUAA 3AEQB 4M7PA 2YJZA 4WK2B 1X7XA 4EY4A 1BAPA 1L7OA 3O31A 4NMLA 2IEGA 3LH5A 3MMZA 3H3FA 1JMKC 4OI2A 4TXHA 4DQLA 2PUGA 1W6UA 3DCYA 5FX2A 2EEPA 3S40A 4WL0A 3J81A 3WI7A 4NL4H 1M7BA 2O8NA 5CIQA 3GBVA 4FSDA 4KUHA 3ORFA 2NVUA 2OV4A 2WE7A 4TYMA 1SOAA 1YUBA 2QMQA 1N5LA 5IJWA 3BAFA 3I04A 5JSFA 4EUFA 4HAUA 2JRCA 5B7PA 3EIXA 3SR3A 2Q5IA 3AB7A 4EY6A 3BXHA 5HFAA 5I8WA 3E53A 4D0GA 1UBGA 4TXLA 4K6MA 4YPVA 4NNJA 2I1LA 4BC1A 4QJIA 1M76A 1VE9A 2PIAA 2JLCA 1SUIA 3SICE 1KMCA 5D3MB 4DY4A 2R8RA 4LTMA 4E15A 3VVCA 1BVUA 1WX1A 1TM7E 3D8NA 3LFTA 2QW1A 3FDFA 5AVVA 5BUSA 1R9NA 3S3TA 4L6CA 1L8AA 4UMDA 4RYLA 2D8MA 3AEZA 1IBMB 1JH8A 4BEBA 3MBKA 4YQEA 2E87A 4I3HA 2OC4A 1HURA 3BQNB 3WO1A 5JRZA 1XZBA 1VYTA 3EEFA 2GXAA 1OGIA 3BM5A 2GBGA 2ZTLA 3T38A 1VBMA 1JXOA 4CZ2A 3W1VA 4CTNA 2O8CB 5CVTA 2VA8A 4DMLA 2CVPA 4IDQA 1M2EA 4I14A 4MPJA 3WP0A 3ZS9A 3PTAA 1ZGGA 3ZDDA 1O9GA 4MVYA 3KDAA 1DTEA 4C0JA 3W8RA 2PX0A 2IVFA 3IAS1 4LK2A 1HMYA 3CEJA 1CFJA 3D64A 3EG5A 4P7JA 3VH1A 2FUNB 1Z73A 4ZHQF 3C5EA 2I65A 2EX0A 3B3FA 4AKSA 1OV6A 2BFPA 4IICA 1ZGBA 1W36D 3CB4A 1T9HA 1UM9B 2A0WA 2YWFA 1G4HA 4IIEA 4W5QA 1HLGA 1M0WA 4NBRA 4EZIA 1A96A 1IUPA 3FMGA 3NVKI 1MB2A 1HLPA 4MW5A 3K0FA 4MEBA 1Z6PA 5JDCA 3F96A 3WQQA 1QIIA 4K9PA 1E1MA 3CRNA 5BURA 1EHIA 2JAOA 2EEZA 1H1LB 2XZPA 1MO6A 3C6BA 3B1XA 2Q3CA 3AR4A 4ZVVA 2IITA 3OD1A 4WNIA 3RYHA 2WTBA 3GARA 3IQHX 4ARZB 3F7TA 3P26A 3HU3A 3A4TA 4E32A 1C4WA 5CBKA 1DBWA 2V7QA 1YJAA 3WGQA 4NICA 4LTDA 4RXMA 3OJFA 1CJCA 4BFLA 4CLHA 4Q3NA 4CG3A 3FUCA 3D3QA 5F35A 1SIWA 4I1VA 1YD7A 1AX9A 621PA 1IM8A 4IGEA 3WWDA 2I8LA 3ZDAA 3GP8A 5KIAA 4BLRA 3QG1A 1GPAA 4YUWA 3MLEA 3HADA 2J08A 3WZMA 2DECA 4UCWA 4X1OA 1U3CA 1VYHA 2QG9A 1WP9A 3TIGA 3VI3B 4BASA 3TW4A 3I5UA 2YRWA 3FUUA 3HJHA 4GI7A 4LC0A 1QP4A 4H08A 3EJWA 1DKMA 2BFNA 4RK0A 4ZVNA 1ID8A 1GQ2A 5IXYA 3FPJA 4TV9F 4DCTA 1QJCA 4G0NA 3OZ7A 4U8HA 2C5LA 3QEAZ 4D25A 2P5TB 1OWMA 1MDFA 3CBQA 3H9GA 4U7GA 2X4IA 2BEVB 5IKXA 3ZJ5A 4GX1A 1LDYA 3ON5A 1RMYA 5AI0A 3HCWA 1P3DA 2HLHA 2VI5A 1PL6A 3EXG1 3HMQA 4JX8A 3CVWA 4JEIA 3MGBA 2IE8A 4R8MA 1JSLA 2M6LA 2K87A 4LJYA 1XZNA 2YUIA 3LYAA 4TPKA 2PX3A 3TPZA 3TK1A 2LCQA 4LNUB 3FTEA 3G0HA 1R4NB 1T24A 1T2AA 1J2YA 1Y4ZA 2ZANA 3AKEA 3O8DA 4EITA 4XEUA 2ZJ4A 5H4GA 2VTBB 3I9JA 4XD7A 3RSCA 2V7WA 3OQIA 2B1RA 2HMSA 4PSCA 5B6PA 3WG9A 2Q1YA 1AK1A 2WSSD 1OASA 2P67A 2ZVJA 4JJ6A 3ZCQA 4DCPA 2WQ6A 2HFJA 1EKXA 2HX1A 3BMNB 2XECA 3ZBTA 1QH9A 2WMYA 4BO4A 2PSEA 1MB0A 4CVNA 1ZNQO 2LBPA 1UXHA 2DFDA 2V6MA 3BSSA 4JVOA 1YC5A 2CL6X 3M6UA 1MUUA 1DI0A 2JFVA 1ZIPA 3DAHA 4JELA 4RVSA 1VECA 1N3BA 1ZGCA 2HYIC 2FFQA 4Y2UA 1PFVA 5DWDA 3PUXA 5EKSA 4JUBA 2V96A 4BNZA 4CV0A 3CQ9A 2OXTA 1YHZA 4HZUB 1K7YA 3SZUA 2HK9A 1AGRA 1FFGA 2WZCA 4HFNA 4O4LB 2IU0A 4D8XA 3HVIA 5BW4A 3AVYA 3IKMB 4YX9A 3O4RA 1ZMRA 3B85A 1PHPA 3DEKA 4YVFA 2PD4A 3NLLA 4IKPA 3U60B 3EVCA 4P82A 3F1KA 4Z2AA 1QK3A 3H0EA 5F7XA 1YQ9A 1FTSA 3G2JA 3ZE0B 3FPFA 3HB1A 2NO4A 3V1YA 4TVOA 4FYWA 1QRAA 1F8YA 3F1LA 2C59A 5U4QA 1ZW1A 2R0QC 3OEHA 3USCS 4G1FA 1VE7A 3VR1A 1QVZA 2WPDA 1AC5A 1XLTA 1Y1LA 1YQGA 2VJLA 2ZRMA 1N75A 3PNQA 3HUTA 3B5EA 3MPUA 2RCYA 3CX3A 4I4NA 2C5EA 4I4IA 3BGOS 4J90A 4D9KA 3O2SB 1BEUB 3P8ZA 1YS4A 1WF6A 1RWQA 1PTJC 3M81A 4ZXFA 3U3DA 2J3IA 4D9IA 2VP3A 1IBSA 2FLWA 3EXFB 4PGMA 5LFAA 4WCFB 1ONOA 3BXOA 3KHSA 5ALEA 3LKVA 4DPLA 4S12A 3QX8A 4ZAXA 1I7SB 1W1IA 5K8IA 1S2IA 1B8UA 2BFDB 1NNSA 3HJBA 1P4HA 3WLKX 3PC3A 4AJKA 4BOYA 4CLXA 5CYGA 1KAGA 1W9MA 1YK1A 2LDBA 1GQOA 2R8EA 5GJCA 1QC5A 1I0IA 3A10A 3NIDB 3E1SA 2AXQA 3SSAA 1NZJA 2ONKA 4FHGA 4ZYVA 1TYEB 3IEXA 4Q9HA 3RU3A 1KKLA 2RHMA 5KJEA 3KBBA 3M6LA 4FBMA 4FYYA 5E1BA 1C1DB 1N5MA 2QTNA 3C4JA 3FYCA 3LOUA 2FAXA 4V0OA 1YZTA 5LZ5A 1WRBA 1QH1A 1XU7A 5L7YA 2GLUA 4OX9Y 3LPCA 2BZ0A 5DN6D 2ZJOA 1HT1E 1J06A 1ORVA 5DHQA 1GR1A 4ZO6A 1E69A 1NM5A 5LOVB 3V00A 4DRXB 2ERCA 3EDMA 4UU8A 3N3AC 3UHFA 4JBWA 2I7TA 3UTDA 2GFQA 4IFEA 1SK9A 3E7DA 4QDOA 3WS7A 3E4CA 3E4DA 5IU6A 3R4CA 2HO5A 2PZEA 2QKYA 5BN1A 2H92A 1PL7A 2PMDA 2GBLC 4ILKA 1PR5A 1FL9A 4YJGB 1P19A 2NUPA 3M83A 4CM9A 1OPXA 2IT1A 3CW2A 4RJJA 1ZH0A 2X1HA 3A7EA 3MLAA 2CLCX 3SQNA 1LPOA 3V2UA 3ZR4B 1YH3A 4X91A 1DAOA 3KE9A 4PAMA 3WIDA 2DE0X 4LQDA 4C06A 3WGVA 5AQ1A 4EBBA 1U9YA 2CKDA 1DKRA 4GMXA 4IDPA 2PU7A 3HFRA 3A6LA 3PE3A 4IWXA 4PYIA 4XH9B 4D9MA 4E2YA 2WFAA 1WQ3A 4TZKA 5D5QA 3ZNNA 4ZU3A 1M73E 2XMZA 1WD7A 1ZW6A 3W5AA 4ENPA 1ZWLA 4G1CA 4UEOA 3HY4A 1JJVA 3GUCA 4QYXA 4EKEA 4FPXA 2G9VA 2ECKA 3HEMA 4WDRA 3DZJA 2I4TA 5FTNA 3U17A 3DVAB 2C2BA 1FNNA 1DAIA 5TJHA 3SFZA 4CBVA 3P9SA 4YRAA 3IE1A 3O9MA 3UTCA 4GEGA 3H4MA 4G1VA 5JXHA