1OILA

Structure of lipase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPASE
publication title The crystal structure of a triacylglycerol lipase from Pseudomonas cepacia reveals a highly open conformation in the absence of a bound inhibitor.
pubmed doi rcsb
molecule tags Hydrolase
total genus 124
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1996-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oilA00
3I2HA 3ZLUA 3WL7A 3WK4A 3R3XA 1NU8A 5C8VA 5BWBA 1XZAA 3RKSA 5T4FA 4KAAA 1Z68A 4D9JA 1XZHA 5JD4A 4KE8A 3PUIA 3I6MA 1LPSA 5T4HA 2ES4A 3ICWA 4X92A 3NOXA 3E3AA 4FLFA 5AKZA 2RHTA 5A6VA 3C43A 3GBSA 1TRHA 4B85A 2C4HA 2WU4A 1AUOA 3H2HA 5ALOA 5AHXA 3H2IA 1F0NA 1Q84A 2D0DA 3D0KA 1CLEA 1YS1X 5JADA 3GA7A 4WCVA 6YASA 3OG9A 3H1BA 4BCDA 5EHZA 3WWCA 4K2AA 2ACEA 2VT7A 2VQ6A 5YASA 2XUKA 4L0CA 2WJ3A 1LPOA 4FFWA 4G5XA 4Y2UA 2XQKA 3K9BA 2OAGA 4BC0A 2O2GA 1EDDA 2FUKA 3M81A 4J0HA 4UBOA 2DHDA 1WB4A 3X3HA 2QTBA 3STXA 3KXPA 4B6GA 5EGNA 3FAKA 3V1LA 1LPAB 5KREA 2XMZA 5JAPA 3VJLA 2J3DA 1VXRA 4IO0A 3FCXA 3NGMA 1LZLA 3DYVA 1EVEA 2ZJ6A 3F98A 4A23A 5LP1A 1EINA 1AX9A 4AQDA 5AIBA 1XKLA 4KAJA 5ALIA 4FNMA 3WL8A 1Q83A 2OCLA 3IBTA 4G8BA 3JW8A 2C5GA 4WY5A 4LIPD 5FOQA 1ORVA 1E8MA 1ODSA 5K3FB 4XWGA 2Y2UA 4J7AA 4HXEB 2LIPA 4HAIA 3QVMA 3UMJA 3F97A 3AILA 3VISA 3STUA 2P8SA 1XQYA 1BU8A 4J0DA 1FFDA 3ED1A 2FJ0A 3FSGA 4OB6A 5E4JA 2OGSA 5FRDA 2XMSA 4AMYA 2CMFA 2XMDA 1ACJA 1AC5A 1H22A 5LZ4A 3G0CA 4HRXA 5FDFA 2HADA 1ZIYA 1GPNA 5HK8A 3BDIA 5A7FA 3FYUC 4UHHA 5DTJA 3V9AA 5J3JA 2H7CA 4C01A 1UKCA 4GHWA 2RONA 2AJDA 2YYSA 1LPMA 5K3BA 4EY5A 3R3VA 2EDAA 3KOOA 4K6GA 1QIGA 1KEZA 2OCKA 1ORWA 3WK5A 5JAUA 3QM1A 3L1IA 4FMPA 4G4IA 5CBKA 2XMGA 1J06A 2DSNA 3PUHA 4F0JA 1HQDA 1TK3A 3W9BA 4BZWA 4WFJA 3PE6A 1SFRA 1W52X 5ALZA 5EHNA 2XI4A 1DWPA 2G4LA 5AKYA 4H7JA 5EHXA 2H7YA 5KWIA 4B7ZA 1K5PA 4UUQA 3B3QA 5FPPA 1QIFA 3WI7A 2BUAA 5AM1A 4PV7A 4BTVA 3ESAA 2FX5A 1FFBA 1R1DA 2Z5GA 5CT9A 4ARBA 2OGZA 1A88A 1ZICA 3KD2A 4AO6A 2GZRA 3A2LA 1BS9A 2W6CX 4YX9A 2J4FA 4BRZA 3SC2A 3WKDA 4FBLA 4AZ0A 5FXMA 2C0QA 1QIHA 1ZGCA 1BRTA 5IKXA 3ZLVA 4ZV7A 2WM2A 5IVIA 1UKAA 3STYA 1QIMA 4G8CA 1MTZA 3VJKA 1F8UA 2BUCA 3L1JA 4W1PA 3R0VA 1QOZA 1EB8A 1ZI6A 3V48A 2CBGA 5E4YA 1W1IA 1ISPA 3PFCA 2VEOA 2QVBA 2ECFA 5CRIA 4WFIA 4C6HA 4FLEA 1HKHA 4DSZA 2O7RA 3QBJA 4FFVA 4NS4A 3WKCA 4H7DA 1GT6A 3JWEA 3WK7A 5FKJA 2AJ8A 3QMVA 2Y6VA 4EHBA 1RP1A 1AGYA 1YA8A 4M0FA 4OYYA 4C89A 2QT9A 2HL6A 3DL4A 1GQSA 1MNAA 5ALJA 5EHQA 1ZD4A 2WIDA 2HU7A 3DYIA 4C87A 1TIBA 4BAGA 2WIKA 1CUGA 4HS9A 1TCAA 3H04A 1Y7IA 2PSEA 4BC1A 3WA6A 3ESBA 1VJ5A 1K63A 2GYWA 5T4BA 3A70A 4X3CA 1FFAA 1P0QA 1CUEA 1R9MA 2V96A 5ALXA 4AX4A 2RAUA 5FV4A 2VAXA 2Z3ZA 5ISMA 3ZLTA 3HACA 3B5EA 4ZREA 1ACLA 4BVJA 3DJYA 3KWFA 3KDAA 3IUQA 4FNGA 4BZZA 1W75A 2GYVA 4HXFB 1WOMA 2JGJA 4W63A 3FVTA 3EQ7A 1Y7HA 3BL8A 3QH4A 3LIPA 2R8BA 3EQ8A 2ORYA 1XRMA 2BAGA 1LLFA 1LNSA 2ACKA 3QYJA 4PF1A 2JGEA 4X6XA 3I2KA 2WFZA 5AJHA 3WIOA 3I2GA 1I6WA 2ZYRA 2CKMA 5LZ9A 1AQLA 5A7HA 3DOIA 1IVYA 5AM5A 3WWOA 4N8SA 4J0KA 3C6XA 1CUDA 3STTA 3WQHA 3O0DA 1UOOA 4HZGA 5CT6A 5T4EA 2B61A 1W4LA 5SYMA 4GECA 3STWA 1CQWA 3CXUA 4K6HA 2HDWA 1HL7A 3AIOA 1IUNA 4OU4A 4FTWA 2X76A 4UBLA 2EDCA 3ILSA 1ZGBA 3CN7A 2IX9A 2XUPA 5EIEA 4C88A 1TKRA 2XMRA 1B6GA 2AJBA 4QWMA 2Y6UA 2ZSIA 3H2KA 4U2FA 4M0MA 1UT6A 3WK9A 2WIJA 1WCYA 5AKKA 5AKLA 4E15A 3FNBA 5K3AA 4A5SA 1E89A 3HC7A 3DOHA 4H18A 3BJMA 1CVLA 2H7XA 5AK5A 3D2AA 5HZGA 1YB6A 5CH3A 4L3WA 3C45A 1MNQA 1OILA 2XQFA 1X2BA 2WHPA 4G4JA 2NW6A 4BDSA 1XZFA 1WHTA 1KU0A 1ZJ5A 1YB7A 3AFIA 2I03A 2OXEA 2ZJFA 3I1IA 5JATA 3GROA 3ANSA 4J0GA 2BGRA 1UWCA 3FYUA 4RPCA 3R3YA 5HCUA 1JMYA 2XT0A 1KU6A 1L7RA 1YR2A 5EIHA 5CW2A 4C4ZA 5AOAA 4W9RA 1QGED 3WWEA 4X85A 2VAVA 3KWJA 2RHWA 1FFEA 1XQVA 1XZDA 5ALUA 4DTCA 5JANA 5AKXA 3OPMA 3HABA 3BIWA 1XRPA 3D2CA 3D59A 5JZ9A 1GKKA 1A8UA 4XIIA 4ROTA 4M0EA 3IDAA 2PX6A 2XLCA 4HRYA 1ZOIA 4OCZA 1CRLA 3Q8WA 1XKTA 4EUSA 3RK4A 1IZ7A 2R11A 4Y2YA 2BKLA 1UK7A 3C5VA 1CUZA 1CUVA 4QEKA 3L1HA 5AKEA 1R50A 3R40A 1AURA 2XQIA 3PICA 4BTLA 5A62A 4K6KA 4INZA 1ODTC 3OM8A 1QTRA 3M3DA 2DHCA 3FLBA 4HVTA 1YSCA 1CQZA 1AMNA 1UZAA 2XDWA 4YASA 1EDBA 4EA6A 5DTIA 1LBSA 1LGYA 2OCGA 3VKFA 5AH0A 3O4GA 2HFJA 2WFLB 5K5EA 1XZBA 4G8DA 3QPDA 4U2GA 1GPKA 2CB9A 4WY8A 2B4KA 4IH4A 2WG2A 4X6YA 3QITA 1QONA 4DLNA 4QDOA 4DNPA 4BYMA 4P93A 1P0PA 1UK6A 5AK3A 1TAHA 2B20A 2WJ4A 3WKBA 2HFKA 5K3EA 2JIDA 3ZV7A 4UFNA 5ALNA 3QZUA 3FLAA 2QXTA 3QPCA 5I8PA 3I2IA 4AN1A 5AKGA 4Y2RA 5A2GA 4X7BA 3VVMA 5ALEA 3WZLA 2WG0A 4WFKA 3HXKA 5EFZA 1Q0ZA 2WTNA 3WZMA 2C0PA 4PW0A 3O9MA 2QOEA 2BFNA 1LPBB 2WUGA 1VKHA 4OU5A 5ALFA 1JFRA 1H2ZA 3FOBA 1XZLA 2OG1A 4DMHA 1C7IA 3DS8A 3S8YA 2XUQA 1UK8A 4I4CA 5AI4A 1TCCA 4WDRA 2WFMA 1NX9A 1DX6A 4UBMA 2C7BA 4Q1VA 5ALYA 4P92A 1BCRA 2O2IA 5HF8A 1QE3A 1CUYA 4LHEA 3W9UA 3SK0A 2JF0A 4P08A 2VJDA 3G7NA 5HFAA 1GXSA 3SX4A 1CUAA 4V2IA 4DNOA 4B82A 2DQYA 5FPQA 2G5PA 2HA7A 1H2YA 3A2NA 2XQJA 5JIBA 1K8QA 3C70A 4NZZA 4J03A 2PSDA 4HXGA 2V9ZA 3DNMA 4ZI5A 4UHDA 5AI6A 3M82A 3SWWA 2WQZA 4U2EA 5AI0A 1VLQA 4HTAA 4NMWA 1H23A 2YH2A 1UXOA 1HDEA 5HK9A 1XLUA 4DMKA 2HRQA 3HRHA 4Q05A 4N8DA 1QJ4A 4AB1A 4X91A 5ALMA 1J1IA 5DYYA 1IMJA 1WM1A 1XZCA 1N5RA 1L7AA 4UFOA 2QMQA 4FBMA 2QUAA 1DINA 2BUBA 1QTIA 4CIBA 3TEJA 3A2MA 3WYNA 2I3ZA 2DHEA 3BDVA 3F9CA 2WKWA 4A16A 3WIBA 1AZWA 1J2EA 1DQYA 1F0PA 4F21A 1CIJA 3BIXA 3H0CA 3WMRA 4J0CA 2DR0A 2JEZA 1E8NA 4DM7A 4OB7A 3C6ZA 3P2MA 1O6FA 2XMCA 3DQZA 1XZMA 2PUJA 4CI9A 1P0IA 2CZQA 1CUIA 2OLEA 3WWDA 2WJ6A 4Y2TA 1QFMA 3CN9A 2XUFA 4DIUA 3UUFA 2YXPX 4EY4A 1C4XA 4CCYB 1EDEA 1CUHA 2XUAA 3WA7A 2OQIA 5HQ3B 4B0PA 2XUHA 1SCIA 3G0BA 5ESRA 2WUEA 3G9ZA 3GELA 1GKLA 1BN7A 2QJWA 3CCBA 2W22A 5ALTA 1S8OA 5HKAA 5LYYA 4AZ3A 5E4TA 1R9NA 4Y2XA 3WJ1A 3DD5A 4FLMA 3B12A 2PBLA 1VA5A 4Y2VA 4Y7DA 3UUEA 4U2CA 1MPXA 5AI5A 4ZXFA 2G5TA 2HA3A 4J3JA 2JGLA 4L9AA 1U8EA 5BOVA 4H7IA 1CUWA 5DNWA 3WL6A 3FLEA 3WJ2A 1JU3A 3QPAA 2XQGA 4QDUA 1HBJA 4GW3A 3W06A 5ALLA 1ODCA 4BE9A 1N5MA 4WJLA 2WUFA 1WPXA 2JGIA 4KAFA 2PU7A 1DWQA 2B9VA 3RARA 2HM7A 1LPPA 2VA9A 5AKIA 3E0XA 3AZQA 4AXBA 2DQZA 4UFPA 3H18A 4E11A 4GXNA 4Z49A 2XLBA 2GZSA 3V1MA 3LS2A 1VOTA 4XX1A 1MX9A 2OGTA 3LLCA 5HKBA 4AN0A 1SCKA 5AM4A 2BCEA 2V97A 1YAJA 2BJHA 3IUJA 4BE4A 1DT5A 1X2EA 5JAHA 2HA5A 1QIIA 1DQZA 3EIOA 4AO7A 2C58A 3OURA 4OYLA 2VT6A 2J3QA 3AIKA 3YASA 5DYWA 1QIKA 1L7QA 4KACA 4GDMA 4PSUA 5H3HA 4BVLA 1LBTA 1XLVA 2CJPA 4C4XA 3N2ZB 3C5WP 3AZPA 4FHZA 4EBBA 2CUTA 1JKMA 4KRYA 3JYHA 1BN6A 2XB6A 2IIVA 1A8QA 4UBIA 4JEIA 4TVKA 1NU6A 4F60A 5JZBA 1PFQA 3G0GA 2O2HA 1MO2A 4X00A 1SC9A 1MAAA 5AK6A 4B81A 4B80A 2Z3WA 4BCCA 1IZ8A 1CR6A 1VE7A 3FSGD 2VATA 4FOLA 2AXEA 3H19A 3RM3A 4PNZA 1MJ5A 4UBKA 1JT2A 3DL7A 1G5FA 4J0IA 4Q82A 2WHQA 4OB8A 5ALKA 4K5QA 1QIJA 5C7YA 4N5IX 3QMWA 4QE3A 5AOBA 2YASA 3FCYA 2HRRA 1BROA 4H35A 3FYUB 4DMFA 1QO7A 3IULA 3CCCA 5A7GA 2PM8A 3N0TA 2QR5A 3R41A 2EEPA 5LIPA 3PDCA 4GLBA 1MU0A 1CUFA 3IUMA 3MGAA 4OPMA 3D3NA 4UHBA 4CCWA 1R3DA 1R88A 5A71A 5CT5A 5HF5A 5AICA 4GEGA 1ETHA 3C6BA 2QM0A 3DLTA 5IVDA 2HA2A 5IH7A 3A6ZA 4W1RA 5ALRA 1EX9A 1JU4A 4I3FA 5ALSA 1C7JA 5JARA 4MWSA 4MWTA 5LLSA 5I9IA 4H7EA 3EBLA 4DGQA 1MAHA 4KE6A 5KBYA 4CG2A 5AKJA 2PSFA 1H2XA 1THTA 5IVHA 4Y2SA 1DX4A 4ETWA 2HA6A 1BEZA 2Y1KA 4DMCA 3C6YA 3IIIA 2VTVA 2JEYA 1UFOA 4QDZA 2RIPA 3V1NA 5JD6A 1QIEA 5HF9A 5CURA 5ALHA 4QNNA 3M83A 1ZD2P 1FFCA 1THGA 5K3DA 1CPYA 2ZYSA 4IQ4A 2JGKA 5DNVA 3FBWA 1QLWA 4W1QA 5CXUA 1K6EA 4BAZA 1EH5A 4I19A 4XJVA 3G0IA 4BB0A 2Z8XA 3WKAA 5C8ZA 3H17A 2I78A 4WDQA 3O9VA 3C87A 2I3DA 4BAUA 1EK2A 2X8BA 2ZYHA 3ZPXA 5BV7A 3D2BA 4PO3X 1MX5A 2DFPA 3LIIA 3STVA 3I1YA 2JBWA 4IH9A 5AM0A 4DNQA 4JYMA 4G9GA 1XRRA 1XRNA 1N1MA 1XRQA 1YCDA 4CIAA 1ZIXA 1XZGA 4E14A 5DLPA 5AKHA 2BGNA 1MX1A 2ROQA 3OTQA 1EI9A 1E66A 2PKYX 3V1KA 4X93A 4GWLA 4EY8A 2OPHA 2RGUA 1BE0A 1YA4A 3HSSA 5AI8A 1UK9A 3NWOA 3ESCA 2OQVA 3HLKA 1MT3A 1X70A 5CT8A 1EA5A 5LZ8A 5FUMA 5JALA 1FSSA 4FWBA 4G1FA 5CH5A 1QO9A 2WFLA 4H7KA 5JASA 4RE5A 5AK4A 3IURA 2VJCA 2XUDA 2XUJA 4B9AA 4QA9A 2VJAA 3GFFA 4BVKA 3QMMA 3ZI7A 1OCEA 3BF7A 2E3JA 3DKRA 5DJ5A 1XZKA 2O7VA 1CUUA 4MXDA 4EY6A 2JGFA 3C8HA 4LYEA 4QLOA 4JYPA 4X94A 5FP0A 2DCMA 2QZPA 3AIMA 3W05A 5AM3A 4PQEA 1P0MA 2G63A 5DNUA 1HPLA 4Y2QA 1XROA 2ZYIA 1O6GA 4KRXA 3D4LA 1G42A 3WLAA 1R4ZA 3Q0TA 1CUSA 3AINA 5JD5A 2Q0XA 3R3UA 3O4JA 4PSCA 4L72A 1JMKC 5LZ5A 5AI9A 4OD0A 1U2EA 4IHAA 5FLKA 4DYHA 2PUHA 4X90A 1ZD5A 3WYDA 3HJUA 3IVMA 3H2GA 4CFSA 2GBGA 5K3FA 5AIAA 2D5LA 4CG1A 2VF2A 3S2ZA 1JJFA 1XZIA 4AO8A 4TPKA 1N8SA 4B9EA 2PSHA 3ICVA 5I7UA 5D7BA 3K2IA 1GPLA 4LYDA 4X95A 3C8DA 5AOCA 4MQMA 4GI1A 1VE6A 2GBIA 1LZKA 3O4IA 1QIDA 4MEAA 5HF6A 1FJ2A 5LZ2A 3D5EA 4KJXA 2XE4A 2VSQA 3I6ZA 4KYVA 5AM2A 4F5ZA 3I28A 3KSRA 3O95A 2HU5A 5ALWA 2OCIA 1MN6A 5K3CA 5LKRA 1XZJA 3PFBA 3T4UA 3MVEA 2ZSHA 3W2TA 2PU5A 1T2NA 2H9YA 3G9TA 4UBNA 1BEEA 5EI5A 4BBZA 3I2JA 4ZWNA 3ESDA 4Y2JA 1D07A 2V98A 3FVRA 3IUNA 4RE6A 1DWOA 1XZEA 4X71A 4B83A 3E4DA 3DEAA 5KWJA 1UOQA 2PL5A 5ALQA 5AP9A 4YPVA 5D6OA 1SOMA 4CG3A 2HU8A 3HYSA 3E1GA 2H1IA 1RYYA 1CUBA 1SCQA 3OOSA 5BWCA 3VDXA 5E2IA 4BDTA 1VXOA 2WIFA 1EB9A 2X5XA 1YS2X 4AMZA 1USWA 4H7HA 1GZ7A 4BRSA 2AJLI 4B0OA 2HIHA 3WL5A 5D3KA 2WIGA 5EIAA 3G0DA 2WUDA 3PF8A 5ALDA 3BE8A 3AZOA 3H2JA 4P9NA 4ITVA 4H7FA 3HEAA 4MEBA 4IH1A 4BP9A 4MYSA 1WB6A 4FDMA 4ZGBA 1PV1A 1VZ2A 4G4GA 2WLSA 2XMBA 2PPLA 4O08A 5CT4A 1M33A 3LP5A 4LXHA 5DWDA 4CCYA 3K6KA 1B41A 3WKEA 1DU4A 4LXIA 1DTEA 2PSJA 5HQ3A 3G9UA 2QJRA 1CUCA 1WHSA 4X6UA 5ALGA 1Y37A 3G9XA 2HHAA 1DT3A 5LKAA 3ANTA 2WU3A 4ZV9A 4G9EA 4H0CA 2ONCA 3BF8A 1E3QA 1XLWA 1GGVA 1CFJA 4ZRDA 3F67A 2WILA 3PF9A 1OXMA 5C81A 2ZJ7A 4GBGA 2XMQA 3WK8A 4Y9SA 1F6WA 4DNFA 3GZJA 4KR0A 2IITA 5CXXA 2C5FA 1YASA 5AO9A 1JI3A 5ALVA 1CEXA 4EY7A 3PI6A 3WK6A 7YASA 2JGMA 4QLAA 3I2FA 1U4NA 1EHYA 3HZOA 2K2QB 2Z8ZA 3RLIA 4OUKX 5CTAA 3F8SA 1UKBA 2WHRA 2Y2VA 4BATA 4PSDA 5CH8A 1YAHA 2GYUA 2QS9A 4Q34A 3TJMA 4FKBA 5C8XA 4UHCA 5D3ZA 1W76A 3BJRA 4JUIA 4Q3LA 1QFSA 3G02A 1BCSA 2XUGA 2FJPA 3G8YA 1IUPA 4UPDA 5IVKA 4BCBA 2XUIA 4UBJA 4X97A 2J4CA 5HFNA 4EZIA 3T52A 3LCRA 4KE7A 4KE9A 3EF3A 1VA4A 3R3WA 4W1SA 3F96A 2GBFA 1T4MA 5JAOA 3VXKA 4H77A 4BP8A 2GBCA 4JH0A 3TGLA 3ZWQA 1XFDA 4UHEA 5CMLA 2HA0A 4MJ3A 4E46A 3AUKA 3EQ9A 4S0XA 2WHPB 1U65A 5ALPA 1HLGA 3WWPA 4MQLA 1ZJ4A 2QKYA 2WTMA 3U1TA 4C4YA 1A7UA 3DCNA 1E8DA 3MUOA 1TCBA 4RGYA 2UZ0A 4B84A 3DKKA 2CEKA 4UHFA 3FWHA 3MUNA 4OSEA 1AKNA 1CUXA 2ZVDA 2RI6A 3GUUA 1JJIA 1XRLA 3HI4A 2QRUA 1G4HA 2AJCA 1CUJA 1VZ3A 4N8EA 2PVSA 4Q3KA 4JNCA 1G66A 3D7RA 1A8SA 4U2DA 2QXUA 4MYDA 1JJBA 1XQXA 5JZSA 4DSAA 4N5HX 3W04A 4EB0A 4U2BA 5JYCA 1WPRA 4QWWA 1E5TA 4LKOA 4QDXA 1ZI8A 1K4YA 4QDTA 1EVQA 3BWXA 3DDUA 1W6RA 3VVLA 2OAEA 1H2WA 3OC0A 4XVCA 5LZ7A 1GQRA 1QZ3A 2HA4A 4ARAA 3AJAA 5SYNA 3H1AA 2QUBA 1CV2A 4NVRA 2XUOA 3I6YA 1UOPA 3FYTA 1XQWA 3BXPA 4Y2PA 4J0JA 1LPNA 2WG1A 1IUOA 3TRDA 1EXWA 4YK7A 5F4ZA 4Q3OA 1ZI9A 4LXGA 1WB5A 1RWQA 4QZVA 3VJMA 5DYTA 3NUZA 1Q0RA 3U0VA 3O4HA 2VJBA 1PJAA 3R3ZA 4TGLA 1TQHA 4KEAA 4RNCA 1J07A 3IA2A 3IB3A 1EK1A 2WSLA 1ZD3A
chains in the Genus database with same CATH superfamily
3U7RA 5LFAA 3WL7A 3WK4A 4R31A 5BUQA 2C84A 3SICE 1G38A 2GB4A 1NU8A 2J9RA 1KP9A 2C1XA 1QHHB 1QFXA 1UR5A 3FFTA 1DAMA 1SOWA 4F3RA 3EMDA 5FWYB 3R5TA 1EXDA 2GNAA 4XDHA 4HNUA 4E5PA 3U13A 2JAQA 1TO2E 2BV3A 4EW1A 2J9ZB 1QR6A 1U04A 2QQGA 4WA7A 1AQYA 2QA5A 2RKOA 5JD4A 1OV4A 1DCTA 2ZIEA 3DOJA 4N3NA 1C3JA 4Q7MB 1NVKA 1T3LA 1HE3A 3L0PA 4E07A 2NZXA 1U0OC 3C4QA 2ES4A 1XCMA 2LCQA 3E3AA 2ZTVA 3EGXA 4FLFA 4MI3A 2RHTA 5F3RA 3WMWA 4OG2A 4GKAA 3WMEA 5L3VA 3EZNA 3H42B 2F43B 2QNRA 2RHDA 3MHPA 2CLLB 4B85A 2Z5VA 2HEGA 4X9XA 1HM5A 5K9ZA 5I47A 3OZRA 1R8SA 5IKPA 1KYWA 5KS2A 3H2IA 2FH5B 5ENDA 4E30A 3U2QA 1XN1A 2FLWA 4LFAB 2QGZA 4I99A 4CEHA 1U4OA 1NF3A 3MWLA 5BYKA 2QVZX 4XGQA 2AH5A 3GA7A 1CNEA 2E9SA 2JZCA 1KEPA 3KSAC 3OG9A 3SHOA 2H2IA 1J0CA 1L8OA 2F3UA 3GFRA 1YIAA 1N2OA 2N1BA 2Q5HA 2X6RA 4NBNA 4P53A 4XWYA 4ZCSA 4DMMA 2FRDC 1LBEA 4NONA 1RM4A 2X4LA 1RRVA 1BKYA 4R81A 5DHTA 4ZU3A 5A6SB 1RADA 2FZVA 3AHJA 3OSZA 4UATA 2WINI 3CZRA 3A0RB 4HDKA 4L0CA 3CO5A 4V03A 1MBZA 4G5XA 4NG4A 4Y2UA 3CVUA 5IUNC 4M22A 1TAGA 5CVDA 4EA7A 4Q9NA 2O2GA 2XCLA 4GP7A 2YZ7A 2ZIWB 4UBOA 3MMZA 4ML3A 2Q8PA 5D5QA 3B60A 3G1UA 4J49A 1M2VA 1FQKA 1E9FA 2DHDA 1SRRA 2HOQA 4OHKA 3W8FA 3EIXA 1IK6A 4I8XA 3U9TA 3UWDA 3ZU3A 1V3QE 4UTRA 2W90A 1MC5A 2WFAA 2A1TR 4TLMB 5KNCA 2UYGA 4X20B 3RTGA 4WXYB 3IIJA 2XGOA 3FAKA 4GUAA 5FHRA 3SM9A 3D7LA 4V3BA 3H3FA 1PG0A 3W3AH 1ICEA 1J9EA 4UM9D 5J2TA 2BIFA 3NASA 4GICA 3PNKA 4PAQA 4EB6A 2FR8C 1VXRA 5DKFA 4JBHA 3SF8A 1II0A 1P1HA 2MSNA 2WSSA 2RKWA 2ORED 1O03A 2YFYA 3IHLA 1LZLA 3M9LA 5GVSA 1EVEA 4L27A 1ZBQA 5HWSA 1ZMXA 2XVZA 1X9HA 2LPMA 1KI8A 4A23A 5LP1A 4AY3A 2P7IA 3LZDA 4JC4A 1Z4PX 3PXBA 2PCLA 3GEMA 3G5MA 3KR1A 3VAZA 4ZEOA 3AI3A 1XKLA 2GHQA 4G37A 4IX1A 5E95A 3SU8A 1KJ9A 2EFGA 1MO6A 2E4UA 3P0RA 4IJUA 4QVGA 1XDDA 1PLLA 2W0MA 4ZO6A 5DT2A 3ZG6A 1EJ0A 4KIFA 3U61B 2AV6A 3ZD6A 4C7BA 2Q99A 2B1GA 3GVCA 3OAAA 4D02A 1O96A 1HFWA 3MTAA 4EIWA 3EC7A 2FMXA 4G8BA 4GI2A 1UINA 1MIHA 4LZJA 4QICA 1JA0A 3BCSA 1XHFA 5HCNA 2J09A 5C1PA 2QAIA 2G6TA 1SVLA 4PANA 1ORVA 3NRJA 1E8MA 5K3FB 3TZ6A 5CEJA 5BN3A 1KQFA 3IPRA 1AA9A 1N2EA 2L19A 1AVTA 3BD6A 5C5IA 4EO9A 5AESA 3LT5A 3LC2O 1J4AA 3FMOB 4NZYA 2DRIA 3HADA 5K8JB 5KYYB 4OM7A 2I2BA 2HMAA 3ZU5A 3EJ6A 1AO3A 3FNRA 5CX1B 3GOQA 4YJ3A 4HG2A 2G0AA 5CFLA 1XYYA 4B7XA 5AJYA 1VHJA 4KI7A 2C4UA 1XQYA 4GNKA 5F7ZA 5H3LA 4OGKA 3SPXA 1RKVA 3JZIA 1X9IA 1NI4A 1ZX1A 3HKDB 3VYUB 4POOA 1FFDA 4CT4B 4EL0A 4C0LA 5I5EA 3LOPA 1UJNA 1NOJA 3M9XA 5ERXA 2ZIGA 3ZOZA 4KGXA 5K51A 2FWPA 4HUQA 4Y18A 3UMFA 1QAQA 4H1UA 2IIBA 3NTQA 3VNBA 5IYZA 2ET6A 3LY5A 4R2JA 2BGWA 1PEYA 5BSFA 3H99A 4A0GA 1QZXA 1TUBA 3HCAA 2XMSA 3EG5A 4DY6A 2X1LA 1A7KA 1NLZA 2FW1A 3IXLA 3BWEA 1WRBA 2C5BA 4EH1A 3OTGA 2JD2A 1SHLA 2FLKA 2AI3A 5TNXA 5KOJA 5F9FA 3AG6A 3REOA 1TDJA 1QF7A 2Z5LA 4M1KA 2WPDA 2ZTUA 3GNSA 4XFKA 5JNTA 2H92A 5KOHA 1AC5A 3QXGA 3H3XA 3A28A 2QAGB 3G0CA 4G67A 2KX7A 4PXAA 2HADA 1ZIYA 4TRNA 4C7VA 5ICFA 3G88A 3R5JA 1PWXA 3U49A 2Y1LA 2GAFA 4KGVA 4NESA 1DB3A 4MDFA 3AT1A 2YWHA 4UM8B 3D6MA 5HUJA 2O8BA 1G63A 2EBHX 2IPNA 3IR5A 5J3JA 5FUWA 1IOVA 3C3MA 1UKCA 4MP6A 1AK9A 3DAYA 3QE0A 4GHWA 5DGCA 4BN0A 5DLYA 5LMZA 1Q7EA 5H81A 4FM9A 4MKGA 5LQRA 2FF5A 3MCTA 4MAMA 2YYSA 1N9KA 3WNQA 3U3OA 1EFVB 1F2VA 3TAUA 4DG9A 1AN0A 3NIGB 2OAQ1 5D84A 1QP0A 3NYWA 3O31A 3SR0A 4G63A 4D0GA 5KVAA 1XSEA 4OI0A 1AQNA 1LVHA 3B1YA 4GMDA 2IW3A 2BFFB 1QGUA 1D2MA 1ORWA 1PNOA 3OECA 5HJ7A 3FSJX 3PPXA 1YQ9A 3L7IA 3FW1A 3IE1A 3QEMA 2FSGA 1KXJA 2H8KA 4QGGA 4UTZA 2EW1A 1F2UA 5CBKA 5A9SA 3COPA 4HNVA 2A9OA 2QLBA 1J06A 4KMOA 1ZONA 2GDJA 1PJ4A 1Z2PX 2VRCA 3D02A 1TK3A 4HVLA 4J16A 1LX7A 4WFJA 1U3CA 2B4RO 3F3MA 1PG5A 4ZOCA 2FY8A 1SFRA 1V4VA 3RFUA 1JAHA 2J9FA 3VI3B 1HT3A 5B37A 5EXSA 1JU9A 4Q6BA 4IGKA 5ALZA 3CB2A 1VB3A 1PFGA 1XF9A 1JE0A 2PVCA 1DWPA 2F7SA 1UFQA 2ZU0C 4NE9A 5JR3A 1E94E 2G4LA 1I2DA 4MAAA 1FDIA 2ZXEA 3CUUA 3DMPA 4FMCB 1VJ0A 4GR9A 2KSQA 3QELA 4XDGA 2D2VA 2ZWOA 4MUIA 2O2XA 3WVNA 4YWJA 4WBNB 1K5PA 4JI0B 1ZHOA 1P4RA 2NU8B 1E1NA 1W8IA 2Y1FA 3T3OA 3R9WA 3NT5A 4Y9UA 2O7NA 3NC4A 2YZKA 4QOGA 5EMKA 1QIFA 1YJBA 5C1IA 3VFDA 2OQ2A 4TS9A 2EP5A 1NIJA 1V1MB 3EZFA 3KJGA 4PV7A 5AM1A 3O8QB 3SDSA 4YT2A 3BJIC 3C7KA 4YRMA 2COKA 4QXOA 5JS8A 5KVCA 4R1TA 5J2UA 3TLXA 3S7ZA 5A3RA 1G291 1TA9A 2H2WA 3EMVA 1E6WA 3A6FA 4QGAA 4JP3A 3ANYB 5F52A 4DEYA 2JKZA 2HIAA 4HQLA 1WJGA 2OGZA 4U0KA 3IODA 3SOPA 4B7AA 1YVPA 1MC1A 2IT1A 2Q5LA 3KD2A 3SYLA 1AK1A 3NTUA 3D6AA 4LZWA 4YX9A 2Z4TA 5F98A 2FPIA 5KC9A 1WV1A 1YI0A 4UDYX 4BRZA 4PC6A 4DLSA 3RT1A 2ZEJA 2C96A 3EASA 3VMMA 1EUCB 3REGA 3RS4A 1I30A 2WF5A 4FN5A 2CXHA 2FOIA 4U2KA 1OXKB 1ZM3A 3DFKA 2GPTA 3GLFB 3WTCA 4JB3A 1BRTA 4Q3CA 3ZLVA 3HXOA 1DAFA 1I4LD 2WM2A 3G2OA 1ADCA 1UKAA 3FZGA 4HDMA 2W2LD 2V3WA 5J1SB 3KQVA 1F38A 3ASZA 1J42A 1WXEA 2G4VA 2Q2VA 3E8SA 2W48A 1TA0A 4JT9A 3UXEA 4BB9A 3VJKA 4RY9A 1Z12A 2J31A 3CF2A 5DM4A 3NW9A 3LU1A 1L7PA 3BE4A 2WWXA 3L1JA 2R8OA 2WK1A 4RHYA 5C53B 3ETDA 4AS1A 4MINA 1FSZA 2WJJA 3H5AA 4TOIA 4UZEA 4BMXA 4II2A 3NHRA 3V48A 3Q11A 4CKCA 4HJRA 5AFSA 4MLPA 5JYEA 3L0ZA 4IQGA 4KITB 1AQUA 1ISPA 1OA1A 4ETMA 3OPXA 4D1YA 3ACBA 2VEOA 3VV2A 3NV7A 2VDUE 2VDWA 1M5UA 4R01A 3DHYA 4HGYA 4C21A 3NVDA 1NA5A 1AIPA 1T9ZA 3DCJA 5J23A 1BXRA 3WL4A 3NOVA 1NDUA 3IAS6 4MV9A 4DRXA 5LXTA 3CUYA 3IC5A 4IJVA 2O7RA 4ESHA 1CIVA 2ENWA 4FFVA 3WOHA 4NS4A 2OBXA 1RLOA 3L18A 1OLXB 4UMDA 1Q95A 3JAWB 1RZ3A 5F64A 5FKJA 4RJTA 1RBMA 1YZFA 3HKCA 3QMVA 4EHBA 1XDSA 4MVJI 3DNFA 1RP1A 2VHZA 4HDOB 5DI3B 1CZLA 1NUQA 1XVIA 1YA8A 4V3CA 2JAPA 3E1SA 4C89A 3JALB 1YQDA 1HI9A 2VQ3A 4N40A 4N82A 5DCLA 3M5CA 3SF0A 1HA3A 1OBOA 2AA3A 2EBUA 2X7JA 3GCXA 1GQSA 2ZREA 1MNAA 4F96A 1FJXA 3DMTA 1KKUA 2A5LA 4MO2A 1NKSA 2R87A 1LLDA 5EHQA 4X0EA 1QH1A 2KQUA 3HA7A 1YCGA 2O2EA 5DTQA 1P2BA 2FUNB 3BILA 3Q41A 3KQMA 1GNTA 3NH6A 4IM7A 5DIFA 5G3ZA 4R2XA 2WD9A 3H65A 1IOZA 1TB4A 2CJXA 2D5IA 3R7LA 3EVBA 3OA0A 4WUVA 4N3GA 4MZXA 3LHDA 5TF4A 1GUDA 2Y0DA 1ZVMA 3B7PA 2GDZA 2WJPA 2WIKA 3FPSA 4CN8A 3THWB 1DRVA 4HS9A 4B3XA 5CDFA 1H42A 1D6SA 2IYOA 5TPZA 3ZGVA 4EFDA 2H2GA 1JG6A 1Y7IA 2ZPTX 5DIZA 2PY6A 3PUZA 4NYMQ 2YY6A 4BC1A 5FL3A 3T6KA 2X4GA 2XKBA 3ESBA 3R7WB 5T4BA 1K63A 1LI7A 2FPMA 3LO8A 4RV4A 2R96A 1RIIA 1FFAA 4OF4A 1TEZA 2CV2A 1G20B 3OFND 3RW9A 4QM7A 1P2GA 2FXIA 4CDRA 3PJEA 5E3HA 4NCHA 4UJ5A 2H4YA 2ZYAA 4J6EA 4RXMA 4ND7A 2SKEA 1X94A 4G6ZA 2FEWB 5FV4A 3K6JA 4HFMA 3CLUD 3TTTA 3GRPA 4WQMA 3Q8KA 3PD7A 2RK6A 4GU5A 4W8OA 3D0OA 5EWMA 3ZKWB 4D0NA 2P9BA 3F5QA 5HEKA 1ELOA 1LBQA 3S1AB 4CG0A 1M6YA 2I4IA 2R3SA 1NNI1 3Q87B 4OHOA 2Q8QA 4JLPA 3ZHRA 3HU2A 3KDAA 4RU1A 2J0SA 4M0PA 2Z08A 3QG1A 3TR6A 2IPLA 2F4NA 2ZWPA 4BQQA 5JMWA 4L0MA 5DF1A 3SJAA 4DAEA 2C94A 2GZ1A 4QUBA 1G17A 2X8WA 1S89A 4HXFB 1L9KA 2QN6A 4MRPA 3GBPA 4E7PA 4HOYA 4NK4A 2F48A 3E23A 3BL8A 1UDXA 3PDJA 3LIPA 1YH3A 3GG9A 1USUA 4RL6A 1T3HA 5J4LA 2BAGA 1G5HA 2QORA 5NULA 4TVBA 2OBLA 3OF5A 5F7JA 2QM8A 3A9RA 4O2BF 3IDQA 2JGEA 3GDWA 3NIDB 4MV3A 5DCUA 3NAZA 1SY7A 3KUCA 3AJEA 2CBZA 1D0VA 1XR3A 2XPCA 1J9ZA 1QG0A 3CLKA 3I2GA 2QYHA 3K35A 3L77A 4YCNA 4ER5A 3DQQA 4YAFA 5FD8A 3RANA 2CSXA 3OVMA 4HAYA 4TVOA 4YEDA 5HIKA 2LIVA 1CE8A 1NWHA 3DXZA 1WSWA 2ZYRA 1UP6A 4EOGA 4K86A 3PGLA 1ABBA 3DOIA 4KQFA 2OLJA 1G98A 2VDMB 2AK2A 4MUEA 1LF0A 1Q1ZA 4BMOB 5JAIA 1CY8A 2JGDB 4ZEVA 2YCLA 1CDOA 4MWDA 1DIAA 3IOYA 3JQEA 3HKEB 421PA 3K9FC 4H6XA 5FORA 4Z0TA 4NU6A 5IASA 5BRAA 2YXNA 2PEZA 3PHJA 4AC9A 4RGVA 1CHNA 3MS4A 1ZCAA 1PJRA 4JT8A 4NJEA 4URWR 1Z22A 1XG5A 1XELA 5T4EA 1P29A 3R9IA 1FW6A 2FEPA 2PD6A 2FMKA 3EEOA 2WM8A 2YNMC 4XYLA 4JHLA 5IW8A 1GSHA 3L6OO 4UHKA 3STWA 4DB2A 1CQWA 3BWYA 3S7TA 3RYCB 3WB1A 1DV2A 4ZXPA 1SEPA 4JAVC 2P77A 2F8MA 3U3MA 5FNVA 3G59A 1VYTA 4WXHA 2Y0PA 4ON9A 2VOEA 3CEJA 4U9IS 1G6Q1 4MW9A 2YMQA 1PNVA 1I4DD 4HVAA 3RC9A 1U94A 4EITA 3ASVA 4CLXA 2CNWA 3AIOA 4URZR 4MIKA 5LQSA 2OO7A 2FMFA 2NADA 2ZRKA 3VPHA 3CWCA 2X76A 4UBLA 2BHNA 2V6FA 4FP9A 4Z9XA 3ILSA 1C9JA 4EPVA 5ICMA 2HQSA 3CN7A 5AW5A 1RXWA 3MTJA 4C88A 1C9KA 2FMHA 4YCCA 1Z4QA 1TKRA 1GZHB 3P26A 4QFDA 2Q4OA 1RR6A 3F5DA 1C30A 2BGUA 1HETA 1T5OA 1ULSA 2ZVJA 1QYRA 1EMDA 3SR3A 4BB6A 2ZSIA 4GXQA 1N92A 4N5LA 1QH0A 2NX2A 4URXR 1WY7A 4YRFA 3FGZA 4ZCMA 1UT6A 5CVJA 3RV3A 3TLKA 3VPFA 3WK9A 1JHUA 5JYBA 2EYQA 3P9ZA 3RWMB 4M7OA 3WLEA 5AKKA 4BVEA 4Z4GA 1XNGA 1F3LA 4KLAA 4Y3UA 4I2VA 1QOPB 2DFDA 4WTOA 4BNHA 4NECA 4F3KA 3UJNA 3LP6A 3MJCA 1V9CA 3RF7A 1M1ZA 2DQSA 7AT1A 3M6XA 3DOHA 3X1ZA 2O8FA 3BJMA 5B1HA 2QUHA 3CONA 2WVHA 3IBSA 4RGBA 3FMIA 1KQOA 3COYA 3D2AA 2ZXFA 3KSBC 1L5HA 1JL3A 2QQ5A 5IFLA 5CDSA 1R6XA 1N3LA 5IDQA 3IILA 4LSWA 3DWFA 5EZ6B 1XMQB 3FDZB 1O0SA 2VBFA 2CNBA 3AGPA 2JAWA 3OJ0A 4Q7JB 2IPOA 3KJEA 1Q7CA 4LY6A 1MNQA 1L5WA 4RK0A 1S7CA 4KO8A 2N42A 1Z26A 1UJ2A 2ZU6A 1KP2A 2VDVE 4KW7A 4L8LA 5AUPB 4GOOD 2Z4RA 3O74A 1S01A 1VJ1A 2QT0A 3FDIA 4TMVA 1WHTA 1KU0A 2B69A 3HMKA 4GQAA 5SZKB 4HTFB 4J1TA 4OK6A 1JMVA 3IERA 3UW3A 2V0NA 4F4UA 1GRVA 1S2IA 2JAOA 2ZJFA 5GADl 1LUAA 3AK4A 1SVKA 3I1IA 3HN2A 4CL8A 3HV2A 1DTWA 3A25A 4LJ9A 2MCFA 4YAJA 2D2XA 2L69A 2PUBA 3IP1A 2DBZA 2LW7A 2R6R1 3CNEA 1B6SA 1FDSA 2WNSA 3RFCA 4N6OA 4YUWA 2BGRA 3SFZA 3UEOA 1JFLA 4OXIA 3U17A 4AY2A 3DC7A 4OKIA 3FOWA 2WJIA 4IVQA 3VR5A 3FYUA 4F97A 2G71A 4RPCA 1Z8DA 3OOYA 3R3YA 1XLTA 4ZC8A 1ONNA 4RMJA 3R3SA 4WZAA 5I7EA 1YJXA 3D6TB 2W2KB 4V0QA 5DYIA 1QRAA 4P7BA 5BSTA 1YTUA 3DUFA 2BZSA 4KQWA 4U3JB 1ISMA 2XNDA 3CRMA 2GN0A 4MGIR 5HRUA 2PRKA 4C4ZA 1FP1D 1G21A 2WMNB 4ZHSA 5AOAA 4U7DA 3HA2A 4F11A 1KAGA 3UUGA 3ZE7A 5ADWA 4TXJA 4G0XA 2O3SA 1TPYA 4KFSA 1PZEA 5KWEA 1R4AA 3Q1KA 2AX4A 3MTDA 2I6TA 3KWJA 1M1UA 1SHUX 3QU2A 4LWOA 4CCSA 5KTKA 2NU7B 5KHOC 1M1XB 1SK9A 1U9YA 2XXJA 4YDHB 2X4IA 2I2XB 2ZBRA 1WKBA 4PAGA 5TQ0A 1RAIA 1SHKA 4DA7A 3PCXA 4EGSA 1FXUA 3D6VA 1DDIA 2PRJA 3OPMA 3T61A 2XODA 3OT1A 2ZROA 3VU8A 4C0WA 2DPYA 4FX2A 1T8RA 3N8IA 3TDNA 3BC1A 4ZT5A 1PG2A 3FX2A 1D4ZA 3D59A 5SZIA 4D6PA 1A9ZA 3AB3A 1FVOA 1DSSG 2FPPB 1GL6A 4G0WA 3EH2A 2QSJA 1DC6A 1JHMA 3UB4A 1MEOA 4DJFC 4YMVA 1OPXA 1SA0A 1X1DA 2VYND 4RM2A 2VJKA 4D2IA 2OENG 4AL4A 4ZP1A 1I7LA 1QANA 2WA2A 3KE9A 3GBVA 4I8DA 4HRYA 5B3JA 1ZOIA 2VBCA 2Q3HA 2XHZA 1X7YB 2AUMA 3E8MA 2A14A 5EOVA 2XIQA 1NQVA 2QW0X 3STHA 1CF4A 3MSCA 4ZQFA 3WXMA 2C9DA 5GWXA 3VZRA 1CS4C 4AROA 5BUZA 3OTHA 2CMKA 4O4HA 4PQGA 4HT3B 3DV9A 3S0JA 1UK7A 2CFCA 4A2QA 3C5VA 1KKMA 1CUZA 2F9FA 2XVMA 2ZRFA 3AUXA 4G5GA 4EMSA 1CUVA 1XD9A 3KNZA 4D8VA 3A1SA 4QEKA 2Z6UA 2EX1A 1QGOA 1JI0A 3MFQA 4LSMA 2NXWA 3UT5A 4R1QA 3NDBB 1R50A 2HMYB 4UU0A 5LWQA 1BFKA 4LGMA 3UY4A 4W9NC 2GJKA 2GD6A 3V4LA 1NVTA 3BN3A 4MRSA 4NP6A 3MYYA 4DARA 5KINB 3QG5A 5U4QA 4FWTA 3ELBA 1ZM7A 3RAJA 3MT0A 4ZO8A 1WZIA 3AI2A 1QTRA 4ZTBA 1EXMA 1ZU4A 2W6NA 3M3DA 2NYRA 1W47A 2ZBPA 4V0LA 1T5IA 3IXMA 1RHKA 5DISB 3ZE1B 2AI1A 1N6PA 3AX6A 3DVRX 1CQZA 1J2TA 1WR8A 2QTRA 3C3JA 4BVFA 2NZ8A 2C8VA 1K8ZB 3ZW9A 2QD1A 1IFXA 1QRRA 4BXOA 4MS4B 2G0NA 3AJDA 4RTNA 1BMFD 5JPDA 1Z74A 2PLAA 1LGYA 3GF4A 4MVCA 4O4JA 4ZAWA 3QVUA 3VKFA 4PBTA 5L6MB 2BCGY 3NWEA 1C8VB 2NXJA 3H2YA 3FYSA 3MTEA 2HFJA 1FDUA 4AUNA 4EHFA 4YRQA 1JPJA 1JHRA 3U7EB 3ZJTA 1FSFA 2A94A 3WGYA 1EESA 4C08A 3R3HA 3LSYA 1PQWA 1RJGA 4A1OA 2RAFA 3AEQB 4IH4A 4O0MA 4A0HA 5ICSA 2FMTA 3K20A 2O2CA 2P2DA 4Q00A 1E2PA 2FEKA 5ERYA 2BSQA 1NFFA 4EEZA 1AMOA 1L6IA 1W48A 2ZUWA 1UJBA 1IWBB 2YJ6A 2QTGA 1XMPA 3B5JA 5AK3A 5JAZA 2QTLA 3U48A 3WKBA 4JGIA 5DE3A 5KC8A 1EZZA 2HLPA 4Q19A 5F35A 3KXIA 1L4LA 4EL5A 1PR3A 2BGMA 1KPHA 1T4BA 4UFNA 5TR9A 3B13B 2ZK7A 2R9VA 1UJ4A 2VDQB 3AETA 4EP1A 4R6WA 3ISVA 3W5AA 3TSZA 5HVNA 3I2IA 5E6UA 4UE2A 3THYA 4Y2GA 2A9JA 3V7WA 1O4VA 3HZRA 2I6GA 1YRAA 1MOSA 2E2WA 3ED5A 4ASUD 3F2VA 5L3QB 5REQA 4BP1A 4Z7NB 3K71B 3KKQA 3DLIA 5ALEA 5EVCA 3HDGA 1C7RA 3T9AA 2BZ0A 4WFKA 5FOUA 1RU3A 2GGSA 5HUHA 1PK8A 1MJNA 1EK6A 1FJGB 4M89A 4O2BB 3DOCA 1ZGZA 3BWVA 4UNIA 4BB5A 1Z82A 3L9WA 5G3YA 1WUHS 4YDSA 3WLNA 3QX7A 1E1QA 1PQ4A 3OJXA 1U5CA 1QRSA 3DBLA 3S99A 4X8HA 3TXYA 2XITA 3T35A 2G9ZA 3I01A 3O9MA 3MERA 3DL2A 1L4GA 3KM0A 1OB2A 1Y8QA 4R2MA 5CBPB 3BDAA 3IEIA 3HSKA 1WCIA 2Z1NA 3LYUA 4OU5A 1PJZA 4KUGA 2IP1A 1PD1A 2UZ3A 3FOBA 3KV3O 3QUQA 3T1YB 1IM5A 1YS9A 4RKRA 1H2AS 4RIEA 1I80A 3PFGA 2AHRA 5CB4F 3HB5X 1KZHA 1KZ9A 1WQ3A 8GPBA 3DS8A 1NQAO 3AP2A 2A7QA 3F1LA 2XUQA 4RPGA 5KYUB 2BFDB 4WDRA 4C1BA 1CY6A 3CF4A 4M1SA 3LK6A 4O2LA 5BT9A 1GCAA 2CDBA 4OP1A 2HW8A 4GR5A 2IHZA 3K4QA 1WMEA 4LOJA 1ZH2A 1I7PA 3QVSA 4YAGA 4KN5A 2BWJA 4HEA1 1GJRA 4MS3A 5MN5A 5FTWA 8LDHA 1LC0A 2AEFA 2PYDA 4LCEA 2PJRA 3CUKA 1ND6A 1A9PA 4IEIA 4L2IA 5M34A 1AQJA 4C2TA 3UO8B 3H9QA 4BNWA 3ECSA 1P4HA 2QUKA 4QECA 1SNYA 1X7WB 2PSSA 3OH8A 1KIMA 1IAVA 4XIGS 3OZTA 2YZ2A 3RC2A 1DPGA 3G1WA 3ZIUA 3PYMA 1FQWA 3RS8A 2UZ1B 3ZJUA 3G9QA 3SX4A 2ZUUA 4CT5A 5FLYA 1CUAA 2FSFA 1KHTA 2QL6A 4DNOA 4HPWA 2G83A 1AH2A 4EI9A 1CJUC 3ZIAD 4COKA 3AEKB 2WU0A 2G5PA 1GPWB 3KJFA 4JUCA 1XX6A 3A2NA 1P8JA 5IAEA 2HMSA 3ORSA 3C70A 4BJ3A 4QREA 5JIBA 1YR3A 2PSDA 1WTAA 1JG1A 1R3UA 2ZE6A 3I32A 2X58A 4OXNA 2OHIA 3FUWA 5JAQA 3GFPA 3OX2A 4UHDA 1C8BA 2UVPA 5A04A 4DCMA 2NNLD 4A27A 1VGQA 2ZSUA 1DDOA 3BKXA 3IALA 4Z3KA 1PV4A 4CGZA 4DT1B 3KUDA 1BVHA 2HCBA 2OXIA 4AAYA 5LQJA 3KIPA 5I9TA 3O3CA 4KN6A 2H4ZA 4TL7A 1J0BA 2UU9B 5AI0A 1VLQA 2VRBA 3ONFA 1N7JA 4HTAA 3DVAA 4B6FA 4TYQA 2PA0A 1H23A 1X7ZA 3HBLA 1UXOA 2J0EA 1SXQA 1VI6A 5G0TA 2NU9A 2L2QA 2GK7A 4RF4A 3N8KA 1R0YA 4DBZA 3URKA 3MWDA 2HGZA 3TLGB 5CJJA 3LT2A 3CTPA 5BMVB 3ZHBA 4AMGA 4CI0B 1RNLA 1I2ZA 1C2YA 1JIUA 1P9OA 1HYHA 1TL7C 1XLUA 3FGNA 1PTJA 2AX3A 4P7JA 4RDCA 5HE8A 4DMKA 4IGEA 5C2JB 4MHTA 3QYAA 3DHWC 1ANKA 4D26A 3HRHA 4E5YA 4B3SB 1JWLA 4Q05A 4PG4A 4GOXA 4X91A 2IELA 2ILTA 4F4HA 1JDNA 3OF2A 2OE2A 4YRLA 5JFGA 3TJRA 2AUTA 4S1OA 1IMJA 1DKMA 3MBKA 1ODKA 4Q39A 3SKYA 4RSMA 2BGJA 2W6PA 1P9NA 1XZCA 3RSCA 1QPZA 2JCBA 3DE4X 4EUFA 3B7WA 1RKBA 1CKEA 1O95C 3LUFA 4HNSA 5C1OA 4CIWA 2QEQA 3A4IA 4IDOA 5ALOA 4LF9B 4BIMA 4FBMA 3DOOA 5TC4A 1R5JA 3OM0A 3W3AA 4RMHA 4DQLA 2R7KA 1RJWA 1ULHA 4XUEA 1TMGE 2QENA 4FYVA 2E4WA 3NM5A 1J0DA 2QRJA 4L0DA 4MIEA 5EA2A 4YXWD 3UWKA 1H2EA 1VG0B 5DTRA 2R6AA 3WBFA 3B9BA 2AFIA 3NNSA 1CIPA 1UMCB 4UHJA 1TYBE 3TRHA 5IABA 4MW5A 3ETNA 2I3ZA 5M29A 1FJHA 2AD5A 2VC2B 2VNKA 3TVTA 4CYMA 2FDCA 2W43A 4PYMA 4ZOLA 1QQ6A 5GPBA 5T67A 1D5CA 4TQ9A 2WKWA 3W9SA 1SQSA 1ZFNA 3OQIA 2RSLA 3KEMA 2AFHB 2OK7A 2Q4DA 4TZKA 1A04A 1K7XB 5CFZA 2Q2QA 3T3MB 2F1JA 1MXHA 1T13A 3W5UA 1N78A 1BSVA 2MR5A 3KKMA 3KU4A 2GD0A 3WMRA 2FGKA 3MF4A 4G5FA 5B55A 3HYNA 2VBGA 4J0CA 5DEIA 3ND5A 2EFCB 5C5DA 3MJEA 4B4VA 2XUZA 3DA8A 1OXSC 2QU7A 2C3PA 3ND8A 4FZJA 4LDPA 5FT9A 4DQVA 1SCUA 3F5FA 4F45A 5KYTA 4JYCA 1O6FA 2PZGA 4KLRA 1V26A 2XMCA 4NR0A 4DYVA 5IJWA 2C2YA 3V32A 1FRVA 4QXRA 4MTCA 3PXDA 2D5CA 1JGTA 2Q5QA 2A1TS 4WXRA 3WSTA 1GGMA 4MPTA 5EC8A 3WWDA 1MXFA 4GVXA 5TMEA 3E03A 1N2JA 1ZCFA 4YP0A 2B8TA 5EE9A 1WE2A 3CW2A 4WL0A 3BHIA 1ESMA 3JYPA 3P71T 3PA8A 4ME6A 2AN3A 3DBHA 5K20A 2L42A 1F4VA 1C4XA 3BMOA 3T3GA 1EDEA 2J1LA 1CUHA 1QB7A 2XYRA 2APJA 2XUAA 3ZDQA 4CF7A 2MTBA 2O6HA 5EVJA 3FHTA 1TJPB 1JE1A 1LNZA 1R0BA 2Q3DA 4KH1A 1E3WB 3IO5A 3NHBA 4UXJA 1WCV1 1RCUA 3ZGZA 1JHPA 4DR1B 3L8CA 3SEQA 4Y6OA 2NZVG 3JWPA 3NIWA 2GOYA 3ZWYA 1GADO 4O3FA 3URMA 4EHAA 2V7QD 1IY2A 4L73A 4MROA 3TSYA 1MFZA 1E98A 1GKLA 4U6QA 1ZNXA 4MQFA 3LSTA 3I3SR 4QXPA 5JZMA 2QJWA 3W1EA 4QJ4A 5A3JA 3CCBA 4PAOA 4CKEA 4EABA 5HKAA 3L6BA 4R1SA 5FO1A 3RRFA 3WQRA 4AZ3A 2QRQA 5DX0A 5E4TA 3QUTA 4KVAA 1UPFA 3LQQA 5AQ1A 1DQPA 3BE5A 3CBGA 3K8OE 3O82A 2HPAA 5BUCA 2JJ1A 3BEOA 4E94A 1ZNWA 1HNNA 5F9HA 3B12A 2A57A 2PBLA 1V8OA 3Q85A 7REQA 3A4MA 1LI5A 4CNBA 3MIIA 3FIUA 3D4OA 2ZPUA 2P67A 4YECA 4LECA 4U2CA 5E6SB 3OTWA 4AG6A 1RD4A 1GSIA 3HO8A 3VPAA 1MPXA 3K9GA 3QFFA 5AI5A 4PLTA 1NSTA 2YRXA 2VSYA 1I3LA 1DIRA 2BHSA 2HA3A 4V0SA 2Y99A 4RVUA 1U8CB 1A2QA 2XB4A 3HEBA 3QP9A 4M46A 3HJNA 3QYFA 1OW3B 4QT0A 1ZUHA 5IT4A 1Q11A 3GMSA 4BO2A 1X19A 1B3RA 5ELXA 1AD2A 1R66A 3AYXB 2E49A 2JLXA 1AZLA 5TGDA 4FUTA 2GAOA 3WLRA 1NP6A 3TZQA 4BJHB 1P1FA 3OPYA 1DZIA 1HDGO 1OX4B 2QTHA 3MWJA 1FW8A 1HE1C 3LC0A 4RESA 3EDMA 4C4PA 4DCCA 4DC0A 2HPHA 2WWIA 4NZ9A 4WY2A 1JU3A 5CVUA 1DKNA 5JRJA 5MN4A 4MW7A 5JEEA 3GLRA 4NWIA 2O7SA 3TLAA 2IBTA 4QUAA 2AD1A 1NXVA 1R18A 3E7WA 3L8GA 4CIYA 1N5MA 4JC8A 5LYJF 4WJLA 3LX6A 1BFDA 2AF3C 2XXAA 4IDCA 1WPXA 2R5FA 3UB2A 2Y1EA 1PIWA 2CKDA 1XA4A 2KE5A 3DDNA 3ZBQA 4IIBA 4OSOA 3ZDAA 1DWQA 5FQOA 4FMBB 1OOEA 1REQB 3JTEA 2CXUA 4G0NA 4A8JC 3EXG1 2HM7A 1WY5A 4P33A 4EMTA 2IVZA 3BWMA 5JTUA 4HDRA 5CB4A 3AJ8A 4QODA 2HNKA 3BFXA 4TXMA 2PK3A 4UCXA 3AZQA 2JFVA 3EDYA 2O05A 2H2AA 3AEZA 3ITNA 4UFPA 1BCSB 3HNRA 4Z49A 2GZSA 4G1BA 2B5OA 2YOHA 1SOUA 2VNSA 3T7EA 3V9PA 1VC2A 1GNPA 2M6KA 2M1ZA 1BQEA 3VZCA 4WXMA 1NXTA 3DFMA 3LS2A 1TUGA 4MEJA 5FAKA 1INLA 2A9KA 2I99A 3JQGB 2IU0A 5CHYA 1MX9A 5DHUA 5FL7A 4AJ1A 3H11A 2WF9A 3LLCA 1EQAA 5GP1A 2QBYA 3U4GA 1TK2A 4HPJB 4OP2A 4F38A 1SCKA 3BZUA 4MWGA 5AM4A 5E9JA 5H4HA 1RCTE 4KVZA 3ENQA 4BMPB 2B5VA 1MABB 4P0TA 4WXEA 3SXUA 1QVZA 3SBEA 4IV8A 3EXHA 3NONA 3O93A 3KCNA 4XRRA 2JRCA 3EZ2A 3GDFA 1T9KA 2GRJA 4F8JA 5KTOA 3IUJA 1YJ5A 1EXNA 4BE4A 1X2EA 3V7FA 4PYQA 5B1YA 3NX4A 1CC1S 1R0ZA 2RGNA 3R0ZA 5F4BA 1SBQA 1C1YA 1DQZA 1YDMA 2Z3VA 3EIOA 3A10A 3RIGA 2DR3A 2JI7A 4I36A 2C58A 1P7VA 2YN2A 4C0BA 1NNEA 3UTDA 1UFKA 4PAWA 1ODIA 4FC6A 1L3BA 3O4FA 5AW0A 1X7GA 1WXDA 4AJIA 5JROA 2B2XA 4R1UA 4IZOA 4NENA 4H4DA 3KCQA 3ZVKA 2QMZA 2EGUA 2ZGVA 3GA0A 4EKDA 4NYMR 2IEGA 2WAXA 2C83A 3GFQA 2MSDB 5H3HA 1KEEA 3MC1A 2HIGA 3VV3A 5BR1A 1Z35A 1WU7A 1OF1A 4TTSA 2CT8A 1MCZA 3OZGA 4QBTA 6REQB 2OV4A 3MMSA 1DAKA 2BFPA 2EZ8A 5K0GA 2UUBB 5KNDH 2BFEB 4WOPA 3ZGOA 3CT6A 2CUTA 1D0IA 1JKMA 1WMFA 2DLCX 4UAJA 1PJ3A 2ZS7A 5REQB 3PDIA 2XB6A 5C3UA 5TJ9A 2GEBA 3TB6A 1ID8A 4WLOA 4F60A 1MF7A 1NUUA 3H1TA 1UWLA 2F67A 1PFQA 3GVHA 3PUVA 1OMOA 4KQCA 1C0KA 2OV3A 4L9WA 4A0SA 1DQSA 2YVQA 3W1VA 2WKQA 1XMOB 2PRYA 1R0KA 1G8JA 4D8WA 3TLMA 1FQOA 2X3UA 3Q6NA 2PL9A 3IJ5A 4IIJA 1GO2A 2JLQA 2W93A 1WL8A 4KXUA 4RPIA 3HYLA 4ECEA 2Z3WA 1NF9A 4QL3A 1CR6A 4BFCA 3IE2A 4OHBA 5F7XA 2GK3A 4FOLA 1WQ4A 1JEAA 2Q3EA 3TZKA 5KYXB 1EX6A 3FCOA 1Z0AA 4PNZA 1MG5A 3R9XB 1ISJA 3P2KA 1NBOA 4V39A 3DEIA 2GUGA 3IVAA 1HSZA 5TEVA 2O5CA 1KY5A 4PM4A 4AXXA 3L5OA 2V0GA 1JPNA 2AMLA 2JIOA 3SZRA 5AW4A 1W5AA 1OYWA 4NV3A 4JJKA 4ZD6A 1JT2A 3PQ4A 3HB7A 3SM3A 1VLLA 3DL7A 1L5NA 1G5FA 1GNQA 4J0IA 2CNDA 2HEIA 3QKWA 4MLCA 1F1JA 1KQGA 4DV4B 3QEAZ 2JAXA 5KDDA 1AS2A 1G3IA 3PK0A 2AQHA 4OQQA 4AQ7A 1JDJA 3AVTA 1DO2A 2DH5A 2NQ8A 4N1AA 1B00A 3B48A 4LI3X 4UM7A 5A03A 2HRRA 1LF5A 4FI3C 1BROA 4Z53A 3QBDA 1RM0A 4R4JA 4AY5A 4RKFA 2O20A 2DXIA 3ZGYA 4RDXA 5AQEA 4LOIA 1FYDA 1BXGA 3EG9B 4NKRA 1SIOA 2R68A 2Q8NA 2AMYA 4DLZA 3P0IA 2BMWA 1RWMA 1RM5A 4IS2A 3RODA 1E5QA 1I33A 1QYWA 2E5WA 3AH8A 2QR5A 1J5XA 3IVCA 4OHUA 1D2GA 4EYQA 2JFXA 5FUBA 1NE2A 2OP1A 1FNMA 1G2IA 3JASA 3R41A 3DPIA 4HLNA 4U6SA 5LIPA 2AWNA 1NUHA 2I34A 4RKQA 3S2FA 5LP6A 2ID9A 3ONDA 1ZOLA 4GYWA 4YALA 1FFYA 1QFZA 1U3TA 1ZH4A 1PW7A 4XUCA 4QUIA 1R3DA 2CWWA 1C0IA 1N6RA 3D4BA 2D00A 4R1PA 2D1FA 1PHPA 3NG1A 4NV0A 3VGJA 3WMGA 2P79A 3E5RA 4DLTA 3VO9A 2PL3A 1DXOA 2B7CA 5HR5A 3VH3A 4ENTA 4EPXA 4DM4A 1NRJB 3LT0A 3RYIB 2H31A 3PQEA 2A5GA 4LN1A 5JYDA 1QG2A 1QR2A 3VKGA 3H2BA 4M8LA 3IUPA 1SXJC 4ND4A 1NLYA 4CI9A 1JU4A 4I3FA 5IBCA 1JRLA 1R6BX 4BV3A 1L5RA 1UDCA 1WPQA 1C7JA 2VHYA 1ZLXA 1YRQA 2O8NA 3AQ4A 1AZSC 4JQOA 4MWSA 4O4LA 1ZHFA 1XP5A 1OXXK 5LLSA 2J7KA 3BS4A 1T6ZA 4RLSA 5IVPA 4CG2A 3JWIA 3ZC3A 2B6NA 3RJZA 1KMQA 4YCSA 1D4OA 3ZHZA 1DHTA 4IDEA 1NR1A 1FIUA 5E9QA 4GL2A 1OTXA 3GLGE 3DTVB 2QE6A 3PXXA 1Q0PA 4X65B 2PS3A 3QNUA 3L4SO 4IG4A 4QOFA 5D3MB 1VMDA 3T9EA 3F7NA 5HM8A 4GC9A 3THXA 1GTSA 3H16A 1RT9A 4DMCA 2BKUA 2AKEA 1BEUB 2JEYA 2VZEA 2WEKA 1KVSA 2AVDA 2CHEA 4PGFA 3OOJA 1XTRA 5JLAA 2RIPA 2PG3A 1XQ9A 2JD1A 3OT5A 2OSBA 2RG1A 5HF9A 1K1EA 3TH5A 2WP8J 2PH1A 3IP9A 1E62A 5HOQA 2Y71A 1Q1BA 4DR3B 5ALHA 3R7DA 4UREA 2D06A 1HT2E 4CDNA 3LQ1A 5CA1F 1G8GA 1U2GA 4PFKA 2CFOA 1NMQA 3DDOA 4HN9A 4EVIA 1FFCA 4UNNA 4K8RB 4BYGA 4D8TA 5K3DA 4MLDA 1NPDA 5KKAA 4ZYVA 2QP3A 2ZYSA 4Y7CA 1O9HA 3MQFA 1KSGA 4J9VA 1E79A 2FZGA 3QUCA 4K9OA 3TS1A 2LCFA 1QLWA 2C42A 4TKLA 3TQFA 1EM6A 2XRMA 1CNMA 1JBEA 4AURA 4CQMD 5JRZA 2WVJA 4BAZA 4O02B 2NUTB 1A77A 2EAUA 3GP5A 3OCJA 2SCUB 3GGCA 4MI9A 16PKA 5L3ZA 1P6QA 2JCXA 1ZPDA 3G0IA 4RIIA 5T64A 3GJRA 3RFFA 3ONVA 3ZLBA 1MVOA 1WW8A 1ZUIA 3DPUA 3K0FA 3RK1A 2GLTA 2NGRA 4W8HA 1X38A 2IIQA 3C24A 3NBZC 5FTJA 4BKOA 1DUSA 1WMSA 5CDUA 3NBFA 1BE8A 2I78A 1O9GA 1U8YA 2AIRA 2H07A 4A6DA 5TGTA 1ZNYA 5FOVA 4DADA 3JQPA 4MMYB 2X2EA 3O9VA 3PC4A 1IXZA 1O6BA 4BAUA 1HKUA 2OESA 4MRRA 1T3SA 3HVRA 3J80A 4MVJH 3HCNA 3S55A 3D1VA 3ZPXA 3K94A 1LQ2A 3DVQX 5BV7A 1DLIA 3R6DA 3IBYA 1WP9A 2XDQB 5CM8B 4GKVA 3WAKA 2UKDA 2B36A 3ZY5A 3SC6A 3KZNA 2XWQA 1UKVY 5IZCA 3ZE6A 2DFPA 2XD9A 3SBOA 3IAEA 2X1MA 2IA5A 1NV8A 3STVA 3EPLA 2XQVA 3RVKA 3CVOA 3VR1A 3KXKA 2AMVA 4CBVA 2DR2A 4IH9A 3LPCA 3P9YA 4A82A 1AGRA 1KMIY 5FWAA 3UAWA 3R6LA 1IEQA 2GM5A 1BD3A 4LJLA 3P2EA 1SEVA 521PA 5THQA 4JLJA 3CQ9A 1KF0A 3WLMA 3ZGLA 2HT6A 3TFQA 4B6QA 3CSDA 3S8EA 4MP3A 4DCUA 1SVIA 4I1OA 2JDID 1ZIXA 4YC7A 4ZYWA 4D43A 2ZYGA 4MUAA 2P5SA 2PR2A 3OIWA 2EJWA 3ZX4A 4DB4A 3ZD7A 4AJPA 3C3AA 3GJ3A 5AXCA 2BL4A 1FX0A 4COOA 4WZ6A 2BZ1A 2EFHB 4AD8A 1NZDA 3IKTA 4XOIA 1HFJA 4GGMX 1RYZA 1E66A 1GKUB 3DZKA 1UPCA 1Y8AA 3IQZA 3KEOA 4EY8A 4UNPA 2NUAA 4HKTA 4CLOB 5IJ0B 1GUFA 1CU1A 2H1OA 1NIPA 3QX9A 4DZTA 3FGPA 1HEIA 4DDWA 2VHVA 2YIMA 4FINA 4OH7A 4U7FA 4XARA 2W37A 5CW1A 2ZXUA 2LDBA 3HLKA 5KQPA 5F51A 3OX3A 1L5YA 4EFKA 4QGBA 1EA5A 3E8XA 1WMBA 1P2FA 1RPTA 2HSGA 2V58A 3TW8B 5FUMA 2I2CA 4FWBA 3V6MA 1IPEA 1IM2A 4G1FA 4R5HA 3PEEA 5JSYA 5I4CA 2WFLA 3OFSA 2I9KA 2X9NA 2GEJA 2YYZA 3LGAA 1Z5ZA 1UJ6A 3D6NB 3K70B 2ORIA 4ZK6A 5JASA 4LXUA 3TSWA 4QARA 1H0KA 3MOIA 5AK4A 1OZHA 5F1OA 5AHRA 3DEJA 4RA9A 3M4ZA 1GSOA 2Q7OE 3V00A 1KI6A 2VJCA 1ZCZA 3PG5A 1PEKE 3KT3A 4RANA 4UTOA 4KMRA 1PR1A 1SD5A 4WOCA 4EYKA 1LK5A 4WNYA 4BVKA 4PZAA 5DYNA 3ZI7A 4AM8A 2C5HA 5B58C 4YBZA 1NNLA 1A5AB 3K5WA 1PX0A 2E3JA 5DJ5A 2R1TB 2C8KA 2V9PA 3AB7A 4EY6A 1W2HA 2X0IA 3BXHA 3WIVA 4H31A 5IJ9A 3E3OA 2B0JA 3HDJA 1RIFA 4JYPA 1BJKA 3WGKA 4I5EA 1H2FA 1CTQA 1IXKA 1FS4A 1ZCBA 2EXXA 2VH5R 3DWEX 2I33A 1KH3A 4C4RA 3V8NA 1C9NA 4AZVA 2E89A 1VJDA 3BOSA 4EHKA 3Q9NA 1MA3A 4ESEA 1WZ2A 2ZS9A 3O1IC 5SV2A 1Z0KA 1BD4A 1BIFA 1OASA 3OUZA 2IS6A 2FX2A 1E4VA 2VLBA 1G42A 4C3VA 2BGTA 2FLVA 3H5WA 4WACA 3WLAA 2PN1A 3I9V6 3T5BA 2MOKA 4B6EA 3WLTA 1GFWA 3M4NA 1NX6A 5A0FA 2JI6A 3O4JA 3UAXA 4X64B 4CQJA 5JOQA 2VQSA 2NSLA 1XCPA 2VZ9A 1PDWA 2JBAB 3DO5A 4MRMB 3W5CA 3B8HA 1JMKC 2B83A 3KU1A 3JQFC 4KVFA 3RHTA 1IY8A 1VGRA 1ECCA 2YIVX 1U2EA 4DLAA 2HCJB 4DYHA 2PUHA 1PZGA 4X90A 3F3KA 3FI0A 2OD2A 1KJWA 1EAYA 1CJTC 1UFRA 3O75A 2CF5A 3L4BC 3MGCA 4G36A 4N01A 1N4AA 4W5TA 5K3FA 1DBSA 3GT3A 3HXTA 2FFQA 2QX8A 2WPNA 2VF2A 2R47A 3N2GB 4PPGA 4TT8A 2VYVD 2IXGA 1YZHA 4MIOA 5KVQA 3S2ZA 4QU5A 5KYYA 4FIZA 3ANNA 1YB2A 1IDOA 3NS7A 5DT9A 3W2HA 4ENSA 4P2GA 5L3SB 1V7ZA 2I0FA 2PSHA 1SKMA 2LBPA 3CG0A 4NIMA 1XCLA 4MKRA 4REQB 4HB3A 1LDEA 1T2VA 2Q1WA 2YXEA 3ZDFA 5FWNA 3M5PA 1FA9A 2EKQA 3UHFA 4F1KA 4OQPA 1FK8A 2HI0A 2VUTA 3HCOA 5AVJA 5ECGC 4UMVA 1Y7LA 5D7BA 3OBIA 1JR3D 3E6AA 3HKDA 3AI1A 3K2IA 3I8XA 3PWTA 1JDVA 4L6IA 3SX2A 4EFNA 1AQIA 2ZRCA 2FE1A 3D8UA 3QXHA 3PE3A 3AKDA 1KK3A 4WK0B 4MUXA 4I5GA 1IQPA 3BMQB 4U9UA 4UCWA 5JCJD 4HP8A 2JCSA 1R5BA 1C29B 1IN8A 5ESWA 5JG7A 3IEVA 1IDN1 3NLLA 1ZWLA 3B1VA 4FSHA 1UWKA 4MEAA 5LZ2A 2Z43A 3D5EA 3U5ZB 3Q10A 2WE7A 3MCZA 4LRTB 4TL6A 2IHVA 3AEYA 3WBJA 4BNDB 2AFRA 5AVZA 4CZ2A 4NG5A 4JLMA 2Z56A 5B7PA 4MYHA 4GZ5A 2QAGA 1YF3A 4LZZA 1MW8X 3WYFA 3BSYA 1GIAA 1P4AA 5FR2A 2ZPAA 3O95A 4J9UE 1U3VA 1XNRB 3H5VA 3NOOA 5ALWA 3T5AA 3LPMA 4LG1A 2C7RA 5LKRA 5IXSA 3QE3A 3B9QA 4F5EA 3BIFA 3OM1A 1NUAA 3V7NA 4BQSA 1DEOA 3BXZA 4TM8A 4R3UC 4E4RA 3L5KA 3SC2B 1MP0A 1HT0A 1U9IA 3NUQA 5MFPA 2ZSHA 2PYZA 3BA1A 4LW8A 3SHVA 3K6SA 4OAOA 4NCXA 4P4LA 1XCBA 4B44A 2RARA 4WLNA 1Y81A 4YTEA 4LK3A 3I2JA 2ZYDA 3ESDA 1JLLA 5CVVA 1DDGA 5DHRA 2PHZA 5AVKA 5B1DA 3ET4A 2JANA 4A8TA 1VHWA 2Q0SA 2PKXA 1GCIA 1DWOA 1Q16A 1XZEA 3E9ZA 1DIOB 1VLJA 3IDFA 3NHAA 3OBBA 4OA8A 3EWSA 5AJXA 2GJ9A 2ZBUA 4UW9A 5LUBA 1EUQA 4Q3DA 2HH9A 1NG9A 1NQWA 5KWJA 5HBGA 3KBBA 5I4BA 5AP9A 3QI7A 4YPVA 2AQKA 3MJHA 5F78A 4NBUA 1DIBA 3QHQA 4DZZA 1GU7A 3K09A 4BJ6A 1CETA 4KB5A 4AS2A 2V7PA 4BNUA 1U98A 1QHIA 5ICCA 4X1YB 1Z4LA 4KQIA 3EWAA 2X0NA 2HU8A 1KC3A 5C8YF 1EJ6A 3MUEA 4MCHA 1J00A 5CA0F 1E2LA 3MBOA 1I7DA 2A78A 4LE0A 1I9CA 4EFLA 2ADFA 2PT9A 2QGNA 1ESEA 1R8XA 2P35A 3JY6A 3OJOA 1SCQA 1MDFA 1Q6ZA 3OOSA 1KERA 4B46A 5B2ZA 2PZLA 1RQNA 3IL2A 1EB9A 3PTLA 3TXAA 5ES4B 1WEHA 4RF3A 1XPOA 3TVYA 5D01A 1VJRA 1Q1AA 3DZCA 3RVPA 2JA2A 2CXPA 2Q27A 3RF6A 3RRXA 1UP4A 1KGDA 2DLDA 5CA1B 4R0VA 5WRFA 5ILGA 3VTFA 4JQZA 4DM3A 1UJCA 4LX8A 2QN9A 4BRSA 5DCWA 2W98A 3QU7A 3FCEA 3IKLA 3MS2A 2OK8A 4GPZA 2F1OA 2HIHA 2X0RA 3HR4A 5D3KA 4B0OA 1PQUA 4F2HA 1UKZA 4M0DA 3UQYS 3MGGA 4TYNA 3G0DA 3NP7A 4QIHA 5KMGA 3I0NA 3PF8A 2BEUB 5ES3A 3DCYA 5CNMA 5T5QA 3P0HA 4B3JA 3PGKA 3BE8A 4L51A 5K6AA 2VBIA 3AZOA 2HB6A 1OA0A 3H2JA 3DH0A 4ITVA 3KETA 3ZXUB 3G23A 4DE5A 3AVWA 3EGDB 4QXMA 3M6VA 1Y1RA 3TZEA 1GCOA 2C03A 1PTKA 5CFNA 2P30A 1ML4A 3Q7SA 5A4AA 1P19A 3QMPA 4YDRA 1LBIA 1UC4B 1C50A 4FFNA 1JQ3A 5IKMA 3CBQA 3PEYA 4JFRA 3AF2A 4FDMA 2QYSA 5FIUA 1DHRA 2F9MA 2C2KA 3FWYA 2ZVPX 1JQAA 1PV1A 1E3JA 1L7MA 4ZYZA 2D7CA 1L5OA 3MJSA 1SBNE 2K87A 2WLSA 2XMBA 5ED4A 3L4EA 1Z63A 4P4GA 3NAQA 4ID3A 4JB2A 4CODB 3ROZA 3PGMA 4IEFB 4WERA 3ZWWA 2ZATA 4CCYA 1AO0A 2HBZA 1B41A 1WXGA 3KTDA 3X43A 1LQTA 2BTEA 1OLSB 1FU7A 3ZCTA 4IJ5A 2WP0A 4DG8A 1ZOPA 4KKXB 2PO7A 2HWUA 3DMNA 4O63O 3LPDA 5CGQB 1CUCA 3OZWA 3MLAA 4EEXA 1IG3A 2R6HA 5LU9A 3JAKA 2QB5A 4X6UA 5JBQA 4GMXA 3PDHA 2JARA 1RM3A 4IFBA 1BO6A 3WNCA 3WYAA 4OKNA 3C6MA 1Z2CA 3N2KB 2W2NA 3LDHA 4TZTA 5FTKA 2QG9A 2HHAA 3SQNA 1DT3A 1OLXA 1T3ZA 4QM6A 1VBNA 3K96A 4IF6A 4G9EA 1P31A 2JGRA 1MRSA 4F1WA 3K1TA 1D0SA 1KH2A 4G1VA 2FU5C 3P2OA 4IKPA 4V02A 2ONCA 1XLWA 3QV1A 5EPOA 3ZCUA 1U90A 3BUSA 1FLNA 1CFJA 2DUUA 3EQ2A 4XB2A 3IAS1 4G97A 4CL0A 1HG1A 3CKKA 1UBMS 1ZN7A 1II8B 4LHWA 3GB9A 5DYGA 5TE9A 1XK6A 3JD0A 1BOFA 1BS2A 2CCGA 2Y1CA 2ZJ7A 4B17A 1CJVC 1HE8B 1FFHA 1OHHA 4Y9SA 1QAMA 2Q1XA 4CIVA 4JMPA 3QPVA 2HN9A 4LY3A 4DG5A 4F56A 2W2TA 1OH8A 4Y6QA 1X1TA 3CFYA 2IITA 3THWA 4TYWA 1WPGA 1CJSA 2X5JO 4OK5A 1M66A 2VIIA 2HCTA 5E38A 2PUVA 4QQKA 2BKAA 2Q9BA 4LRXA 4HYEA 4QAQA 2AKYA 2C5FA 3LOQA 1YUNA 5KTMA 1JI3A 4HRVA 4HFJA 1RAHA 5FLXA 3NWBA 4Q5IA 4P58A 2XSZA 4HAXA 1QX4A 2ZP1A 1J39A 1N5JA 5LOVF 1ZL2A 4P7FA 2P3LA 3P9RA 1H4SA 2BYTA 1EHYA 2JIRA 2C92A 4R0NA 2OZLB 3NDRA 5F2OA 2W83A 4XSHA 4LFBB 2QU8A 5AJTA 3JPWA 3GG2A 1F0YA 1EUYA 4ZT2A 3GLTA 4ABTA 5JMTA 3RGGA 4BATA 2FPLA 3ICQB 3WGLA 3V8RA 3IP8A 5GINE 3I0ZA 1B8UA 4MGZR 3RT9A 3LMKA 1FZTA 3VI4B 3OA2A 4TWIA 3PUXA 4QQ8A 3V3KA 3RUEA 3GQBA 5EWJB 1SC3A 2FSHA 4IHJB 1ORRA 2RBKA 1T0HB 1WUYA 3L7OA 3LFTA 4NJOA 4TXLA 1HURA 3JQCA 3SZOA 5C8XA 4QBHA 4UHCA 3R2JA 1JAIA 3TX2A 5C34B 2C9CA 1KARA 1YULA 4P5EA 3TIFA 4DWWA 1D2CA 1FX1A 2F2TA 2FRDA 1N2SA 3RU9A 2GNPA 2ZANA 5HHTA 2OZEA 3K8YA 1OZGA 4BUCA 4E2XA 3K3PA 3U62A 3H87A 2FJPA 5B1EA 1ZD8A 2DFNA 1J8FA 2NVBA 4GYKA 3G8YA 4DLVA 3R8FA 1OFVA 1E2UA 1F2DA 1JH8A 1Y3AA 2DX7A 4UPDA 2HJSA 3RSLA 4F6RA 5I9BA 5U1PA 3QKTA 5SY6A 4RJJA 1H3EA 2BN4A 2ZI5A 3NEYA 4RV5A 4X3OA 2UZ4A 2GRUA 2AOUA 2PT7A 4X97A 3TSAA 2J4CA 4XUDA 2HQOA 1A9RA 5D1NA 1WZNA 4B6SA 4DDTA 1HQKA 1V11A 2C3MA 3LCRA 3LK7A 4AJ2A 1HFKA 1UDBA 2GO1A 1R6VA 5KYKA 1X13A 4EF5A 1OWMA 2Q9UA 3EF3A 1WVMA 4UUOA 3HVKA 4ESVA 4W1SA 2DWUA 2IOHA 2GBFA 2H2DA 1T4MA 2HF7A 3B38A 2C98A 1TEXA 2PQ2A 1AXEA 3R6GA 1JYSA 2SECE 2BF4A 3W1WA 1TVCA 3PFWO 4PO8A 1BAPA 1A4RA 2HTEA 4BP8A 4JH0A 5BNIA 2Q5OA 5IPFA 4I9HA 3ZWQA 1EA7A 5EXTA 2JJYA 2JIZA 2FR8A 5F5XA 3EGCA 4EG1A 4FOSA 3T06B 3V34A 3QVWA 1KOJA 3BD8A 5DBOA 3ZGNA 1VIAA 2XF8A 4MJ3A 4E46A 4NMHA 4URUR 3HKEA 1BNCA 2HWXA 2ZJZA 3DBRB 2Q45A 4RAQA 1FLAA 3DG9A 1JYFA 3BREA 3FA2A 3WP1B 1RS0A 1ZN8A 5D86A 3ZQ4A 1Y1KE 2AOXA 3WWPA 1KEVA 5KWVA 3EXIA 4JLUA 4NFSA 1ZJ4A 3UJ9A 4B71A 5KDOA 2OOKA 1CY4A 1AKUA 1TYAE 2QKYA 2WTMA 3A1UA 4G2NA 4C4YA 1RC1A 2OP0A 3MUOA 3O3NB 3QOYA 3JQ9A 3P2IA 2V0CA 4LE1A 3AKZA 1YFZA 1Z6XA 3JVEA 4UPVA 4K6OA 1H1TA 4PIPA 2UZ0A 4CEIA 2ZWAA 1U9ZA 3P0EA 4Z0PA 3HEMA 2R8PA 4AP5A 3A1TA 1IPFA 1NN3A 1XNJA 4RVDA 1VDZA 1X1BA 4UM5A 1AKNA 1TXGA 1X8JA 1Z6TA 2Q6IA 2QMHA 4GBJA 4ZRMA 1ZXLA 2EP7A 3FBGA 3JQAB 1PJCA 3QOWA 4M9RA 3ZE8A 1G6KA 3HUDA 1V5EA 3AFOA 1JUDA 2RHMA 4BJ5A 1T4CA 3PHGA 1YHNA 4P35A 4AULA 3E0QA 5NLLA 4YDQA 4M3NA 1F4LA 2C5AA 3EHEA 2H54A 2J67A 4N8EA 4QVIA 2K7ZA 1EVZA 2AOTA 4XD2A 4RFSB 3ILYA 5EQDA 3ROEA 3UV3A 4JNCA 4DCVA 5INTA 1JFFB 2QRKA 2ZB3A 2VQFB 1YOVA 1C1XB 4U2DA 5G40A 3I1FA 3NM6B 2QXUA 4M7WA 3TKAA 4EKEA 1E2BA 4MYDA 5JZSA 4RTRA 1NBEA 1YBVA 3ITKA 4ZVMA 1BG6A 2PUDA 2FCAA 4LZNA 2QPAA 2POQX 3AHEA 3IQXA 3W04A 4EB0A 2C9MA 2QNIA 2QUJA 3L07A 1C3VA 1FTQA 3WGJA 5BW8A 3MA0A 4KHPB 3MQ4A 2XEDA 4KDRA 2FX3A 3WADA 5BPHA 1H3NA 1KXZA 3LCUA 3LA6A 4K7JA 3KAJA 1EQUA 5FJIA 2HO5A 3W5BA 1C0LA 3NHJA 1PL6A 3OTOB 4QDTA 1J2UA 3EXFB 2REQA 4D9HA 1Q0TA 4LF7B 2WJVA 5JNUA 4KWHA 2UVQA 5FX2A 1SUWA 2O3QA 3OC0A 2J5XA 3BL5A 2PZFA 4TTIA 4WADA 5LZ7A 1I0LA 1MT0A 1KMHB 2H57A 1N9ZA 2WD7A 3LDFA 2HA4A 3T7DA 4ZCRA 4MB0A 3N05A 1H0HA 4CF4A 4LJYA 4J29A 4KBFA 3H1AA 2QUBA 4LEIA 1V71A 3A9UA 3WLHA 4W5OA 4C3ZA 5KVSA 1ISSA 2IHBA 1G3RA 4YNBA 4LJ4A 1S2LA 1WDWB 4MVJP 3ONEA 1UXJA 2FN4A 1NVUQ 1PT7A 2GM4A 2XTNA 3C1AA 3VR2D 3ILHA 3KYIB 5KNDA 3ESRA 1LPNA 3UK7A 1ZINA 1NMYA 1KH1A 2CLKB 2WG1A 1IUOA 2Z2JA 1R7RA 3DEYX 3QVKA 3ZWDA 4CR6A 4XPIB 2Q6KA 3VOAA 5C37A 3TRDA 5F1PA 1VB5A 4GRIA 2I4MA 4Z4CA 5F4ZA 2I7TA 3UANA 1A1SA 2D1TA 3S6JA 4TT3D 4LC1A 3IMGA 1WB5A 1NF8A 2I62A 2W2KA 2CL0X 2MIIA 3GZ4A 1RWQA 2BSXA 3PR1A 3R24A 4RVHA 4YO7A 5AW7A 3LBIA 1N5DA 4RK5A 4LVUA 3WIDA 3TG8A 4ZAVA 1IXYA 3DE7X 3TIVA 4TTTS 5KSOA 3BH0A 3NUZA 1FMLA 1ZZEA 2GAIA 1YHZA