1OILA

Structure of lipase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LIPASE
publication title The crystal structure of a triacylglycerol lipase from Pseudomonas cepacia reveals a highly open conformation in the absence of a bound inhibitor.
pubmed doi rcsb
total genus 124
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1996-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oilA00
3FSGD 1YA4A 2HDWA 4X85A 1LPNA 4PNZA 2XUJA 4ROTA 2VT6A 1FFAA 4XX1A 3KOOA 3EIOA 3ICVA 3HI4A 4J7AA 1F6WA 3WKBA 2PU5A 4EY5A 2GZSA 4BYMA 5FRDA 5AKZA 4RGYA 4B6GA 2CZQA 4AMYA 4YK7A 3V1LA 1RWQA 1VKHA 2YH2A 2HL6A 1ACLA 1F0NA 3QPCA 1H2YA 3AIMA 1MU0A 3DDUA 1YR2A 4AZ0A 3M81A 2HU5A 3DKKA 2BUCA 5D3ZA 1R88A 3PFCA 4HXGA 2OG1A 4PF1A 4HRYA 4X3CA 3FCXA 2XMDA 5AK5A 4WJLA 4KR0A 3WL7A 4M0EA 1AKNA 3QM1A 1CFJA 4CCYB 4I19A 4F5ZA 1ZD4A 4GI1A 1DWPA 5AKEA 3QPDA 4PQEA 2HA0A 2WG1A 4MWSA 2HA6A 1QTRA 2E3JA 4QWWA 3WIBA 2V97A 1DT5A 2ES4A 5AJHA 1PJAA 5JZSA 2B20A 1XRNA 4OB8A 1SOMA 3VISA 3AZOA 3W9UA 7YASA 1J2EA 2Z3WA 2FX5A 2PKYX 5ALTA 2G5PA 5DYWA 2XB6A 2D5LA 1OILA 5JIBA 4KEAA 4AO6A 2VA9A 4DSZA 2PVSA 3KD2A 1FFBA 2GBGA 3R3VA 2PSHA 1K8QA 5E4YA 2WUFA 5F4ZA 4N5IX 5DYTA 2PSFA 3ZLTA 1JFRA 5K3FA 1AGYA 4WDQA 4BC1A 5ALNA 4Z49A 1G4HA 5K5EA 5AKYA 2XMCA 2HRQA 1CUWA 3DCNA 3O0DA 5K3DA 2WUEA 1JJIA 3K6KA 3FNBA 1XRPA 4J0JA 4XWGA 3TEJA 4Q34A 1MPXA 1RYYA 4MYSA 3AZQA 4N8SA 4AO8A 4CG3A 4KAJA 3STYA 3S2ZA 2XLCA 1HLGA 4NZZA 1UOQA 4BTVA 4Q3KA 4IO0A 2QXTA 3Q0TA 4BCCA 4GXNA 1W1IA 2XQKA 3BIXA 4EHBA 3H1BA 1VOTA 2RAUA 5JYCA 4HVTA 2HFKA 2R8BA 2O2GA 4FLFA 5FLKA 1ZD3A 4HXEB 3GELA 1DQZA 3IBTA 2XQJA 4N8DA 4C4ZA 1LBSA 4UHFA 5CH3A 1WB6A 1CRLA 4KAFA 2HA4A 4QDOA 1IMJA 4UHEA 2G5TA 2JIDA 2I78A 3STTA 5DYYA 3WLAA 3VVLA 1AX9A 4Y2UA 4GDMA 2C0PA 3NUZA 4CCWA 2VJAA 1HBJA 1CEXA 3ICWA 2I3ZA 2QTBA 2RI6A 4UBIA 5ALRA 3BDIA 1KU6A 1N5RA 5CW2A 4ZREA 2BGNA 2HA3A 1HKHA 1X2EA 1SFRA 1QOZA 1GT6A 3PF9A 4H77A 2CEKA 3ZLUA 3PF8A 3D5EA 4UUQA 1ZD2P 4AXBA 3I2IA 4DNFA 3IVMA 5JASA 3G0CA 2WKWA 5ALFA 3O9VA 3HC7A 2C5GA 1W76A 2X5XA 1QGED 1H2WA 2Y2VA 2WJ4A 1W6RA 1TCBA 1VA4A 2P8SA 5IVHA 3W9BA 1HPLA 4Y2TA 2ZSHA 3WK5A 3CCCA 4QNNA 4OUKX 3FLEA 3F98A 2ZJFA 3GZJA 2IIVA 3G0DA 3U1TA 2HM7A 4LHEA 1R4ZA 2WTNA 3V1KA 1JMYA 4H7DA 1CUEA 4RNCA 1QFMA 3NGMA 5FDFA 1J07A 1EVEA 1LGYA 3F9CA 4ZWNA 3WJ2A 1W4LA 1THTA 4JUIA 1FSSA 4ITVA 4X6XA 4BE9A 4KRXA 2WFLA 2DQYA 1R9NA 3WWCA 3Q8WA 3BXPA 1CUUA 3WKDA 2PBLA 5I9IA 1JU3A 3C6YA 5CBKA 5AKXA 2PSEA 2WTMA 2QJWA 1TKRA 5D7BA 1IZ7A 4OYLA 4MJ3A 1ZGCA 4BRZA 2V98A 1SCIA 1XQWA 1CUZA 1AUOA 4AX4A 5ALKA 4GW3A 2WIDA 1CLEA 3H04A 1XZFA 5ALWA 3WK7A 3VXKA 4A16A 2B61A 4DSAA 2BJHA 2YXPX 4KE8A 5C8XA 3GUUA 1YB6A 2XMZA 1UFOA 4J0KA 5AKLA 4X91A 3G9ZA 1DQYA 4QA9A 1NU8A 5A6VA 5EHNA 3DYVA 4V2IA 3I6MA 3HYSA 1GPNA 2YYSA 3P2MA 4CFSA 4XVCA 3FOBA 1B6GA 5DNUA 5CURA 2RIPA 1XLVA 4Y2YA 1DINA 1C7JA 3ZPXA 4UBKA 5JAPA 1MN6A 4DMKA 4UFNA 4DLNA 5SYNA 4HXFB 1FFDA 3HACA 2XUDA 3U0VA 1ZIYA 1VA5A 3O95A 5AKGA 3WYNA 4BC0A 1IUNA 2OCLA 2QUBA 5FV4A 3VVMA 3STUA 4BBZA 4AB1A 5EHXA 3WKEA 3O4IA 5HF6A 2ACEA 2GBFA 4WFIA 1XZDA 3FSGA 3D59A 4EY4A 3PFBA 5AI4A 5EFZA 3A2NA 2HU8A 4QE3A 1AC5A 2O2IA 5D6OA 2JGMA 4U2FA 1ETHA 1LZKA 1DWOA 2WFZA 1C4XA 2GYUA 4J0CA 3DJYA 3BJMA 3WA6A 4FLEA 1CUVA 3H2IA 4UHHA 3WA7A 4BATA 4C4YA 4FOLA 1BCSA 1MJ5A 5K3BA 1G42A 3R0VA 3PE6A 1DT3A 1MO2A 4MXDA 4WFJA 5J3JA 1PV1A 2XMSA 1T4MA 5LZ7A 2QUAA 1XZHA 2OGTA 5AP9A 2BGRA 2WIKA 3C5WP 3C43A 2HIHA 1XFDA 2Z8ZA 3OTQA 1EI9A 4FDMA 5AK4A 3C6XA 2XDWA 2PUJA 3FVTA 3A2LA 5IH7A 1XROA 4INZA 1QIMA 3T4UA 4H7JA 2RHWA 5D3KA 3FYUA 1VJ5A 4U2EA 5JANA 1QIIA 1T2NA 3G8YA 5ALYA 4Q3LA 2XI4A 4JYMA 4Y2JA 1ZGBA 1JJBA 1AQLA 2VAXA 3GA7A 1JKMA 3ESBA 2XLBA 5ALIA 2X8BA 5A7GA 1TCAA 5CRIA 2V96A 4B82A 4QLAA 1LPAB 4MQLA 3IDAA 4X7BA 4BZZA 4JNCA 5FPQA 5LKAA 2EDAA 3WZLA 3NOXA 1W75A 3QMWA 1GZ7A 3STXA 3ILSA 1ORVA 3AFIA 1E66A 2XMBA 1QIDA 3DYIA 2VTVA 3QMMA 1WPRA 3F97A 3CXUA 3C87A 4PSDA 2BCEA 3WKCA 3C45A 4EBBA 3HJUA 2WJ6A 4XIIA 4LYDA 4E15A 2Z8XA 2JGLA 4A5SA 3ZWQA 1ODCA 2HA7A 3PICA 5CT5A 5AM4A 2NW6A 2G63A 4BP8A 4KE9A 5LZ2A 1U2EA 4L3WA 1O6GA 1QIKA 1LPBB 5CMLA 2CMFA 2PX6A 5HCUA 3QBJA 2QVBA 3ANTA 1ORWA 5K3AA 1LLFA 1MNQA 1DTEA 2WIJA 3R40A 3QH4A 3QYJA 3WL6A 1GKLA 2C4HA 2WU4A 4PO3X 5A71A 4HAIA 1Q0RA 5HZGA 5DTJA 3QZUA 1BS9A 4X92A 1F0PA 1WHSA 1XZGA 4EUSA 3BIWA 1MNAA 5AI8A 5AI0A 1Q83A 1QO7A 1YS2X 3C5VA 4GWLA 3ESDA 5FUMA 1EB9A 1MX9A 4B83A 4BTLA 2BUAA 5BWBA 2RHTA 4Y2SA 1YSCA 1FFEA 2JGJA 5ALEA 1BRTA 2C7BA 3ED1A 5ALSA 1EX9A 2XMGA 3OG9A 5T4FA 3QITA 3VDXA 5ALUA 5ALXA 4UBOA 1L7QA 2BFNA 5SYMA 1BE0A 4P93A 4H0CA 4G4JA 2PPLA 1R50A 3SX4A 4GECA 4C88A 1LPMA 4TVKA 3G02A 4RE5A 1ZIXA 3FYUC 4I4CA 4P92A 4H7HA 3UMJA 4X97A 5AM1A 5JALA 5IVKA 4U2GA 2AJLI 2PSJA 4ZI5A 2WHPA 1BU8A 5EIHA 1E89A 2OQVA 2ROQA 2ZYSA 4B9EA 1E3QA 3G9TA 2DHCA 5C7YA 1DX6A 3TGLA 2O7RA 1YB7A 1EINA 5JAUA 4HRXA 2OAGA 4ARBA 2K2QB 1A8QA 3M83A 5CH8A 5EIEA 2DSNA 4O08A 2OCKA 1BEEA 4LXIA 5BWCA 3SK0A 3KXPA 2EDCA 5EGNA 3D7RA 4BAGA 1TAHA 1TRHA 3PI6A 3G0BA 1F8UA 5FOQA 1E8MA 4W1RA 1LNSA 4B9AA 4A23A 2XQFA 1ODTC 3C70A 5JAHA 2YASA 1TIBA 5AI5A 4ZRDA 5E2IA 2J3QA 1XZJA 1LPSA 4FTWA 4G4IA 2LIPA 3WWEA 4FNMA 3YASA 3WL5A 5LZ5A 3AINA 3X3HA 3W06A 3BL8A 3OPMA 2H1IA 3LP5A 3VJMA 3M3DA 2OGSA 3IIIA 5CTAA 2HU7A 5C8VA 2G4LA 1ISPA 2WHQA 3N0TA 2C0QA 1S8OA 1U8EA 2I3DA 5K3FB 1EDEA 5JARA 1UKCA 5HF9A 4DIUA 5ALJA 3STWA 2O7VA 3S8YA 5KWJA 3FVRA 2OCIA 3G9UA 4G1FA 1EXWA 2WIFA 4G9EA 2XUPA 3I2JA 4H7IA 3V1NA 1JMKC 2AJCA 1USWA 3M82A 4UHDA 4B0PA 3EBLA 1NU6A 5AKJA 4K5QA 1P0MA 1HQDA 4GHWA 4B7ZA 1XRQA 1CPYA 1THGA 3PDCA 1Q84A 3FCYA 2JEYA 3DL7A 3FWHA 2R11A 1A88A 2PSDA 4ETWA 6YASA 3F96A 3FBWA 4Y7DA 4FMPA 2XMRA 2CB9A 4UBNA 5HFAA 4JEIA 3ZLVA 3W05A 3V48A 1C7IA 3WQHA 4OB6A 2XE4A 4AN1A 3VKFA 2AJDA 3D2BA 1XZAA 3HRHA 5HQ3A 4HS9A 5ALMA 3MUOA 3KWFA 4JYPA 4E46A 1HDEA 1CUJA 3B5EA 2QR5A 4FHZA 3R3ZA 3SC2A 1JI3A 2QT9A 2XT0A 5LZ9A 1CR6A 1QIGA 2IX9A 5JD4A 2ONCA 3AIOA 4EY6A 3ESCA 2PL5A 3DOIA 4P08A 4OU4A 4QDTA 2VAVA 4Y2PA 1TQHA 4BAZA 5A62A 4B84A 4C01A 2DCMA 5AK3A 3JW8A 2DHDA 3RARA 5LIPA 2J4CA 5ALPA 3H2HA 1XKTA 1VLQA 2WJ3A 5AOAA 1CUGA 4EY7A 5CT4A 4XJVA 3R3XA 2VATA 1JU4A 3G7NA 3CN9A 1UOOA 1CUYA 1GKKA 1FJ2A 3HZOA 2AXEA 2WLSA 4X6UA 4ZV9A 4WFKA 3D2AA 2HADA 3H2JA 5K3CA 4G9GA 1EH5A 2WFMA 2H7CA 1QO9A 1XZEA 3QVMA 2OXEA 3E3AA 4BVJA 2CBGA 4BVLA 4MEBA 2Y6VA 1XRLA 4WDRA 4B85A 3I2KA 2HA5A 1UXOA 3WZMA 1CUBA 5CT6A 4L9AA 5ALGA 4Q82A 4CG2A 1Y37A 3WJ1A 2UZ0A 2ACKA 2WFLB 4N5HX 3I2GA 1UOPA 1XQXA 4DNPA 3IUJA 4MQMA 2B4KA 1MAAA 3E0XA 4QWMA 1YA8A 1Y7IA 5ALLA 4NMWA 5CXUA 4FBMA 1UK7A 3K2IA 5A2GA 3H2GA 2J4FA 2VJBA 4EB0A 4LKOA 5BV7A 5LZ8A 4PW0A 2X76A 1CUFA 5LKRA 2QJRA 2XQGA 1XZIA 2OPHA 1CQZA 4H18A 4LIPD 4QLOA 1WCYA 3PUIA 4OD0A 4F0JA 3LIPA 5AKKA 1ZOIA 4I3FA 5AHXA 5ALHA 4YPVA 1EDBA 4IH9A 3G0IA 2ZYHA 3I1IA 3C6BA 4WY5A 1R1DA 3FLBA 5AI6A 4B0OA 5AH0A 1SCQA 1IVYA 5AKIA 4UBLA 2FJ0A 3IULA 2QXUA 2JGIA 5CXXA 3RLIA 1EK2A 1VXOA 4L0CA 4H35A 1G66A 1CUHA 2PM8A 3D3NA 1GPLA 4MWTA 5DTIA 3H2KA 1A7UA 5AI9A 1BN7A 4LXHA 4LYEA 2GBCA 3H19A 2ZYIA 2VF2A 2VT7A 4DMFA 4KE7A 4E14A 1BCRA 4U2CA 5AK6A 1VZ2A 4X94A 5AIBA 5EHQA 1QZ3A 3NWOA 4OU5A 4AQDA 4QEKA 2JEZA 1XZMA 4IH4A 3E4DA 4EZIA 2WG2A 5K3EA 3EQ9A 4J0HA 3G0GA 1CUCA 4PSCA 2AJ8A 4Y2QA 1K5PA 2IITA 1EDDA 2ZVDA 2ORYA 4J3JA 4Y2VA 1QLWA 3QMVA 3AIKA 3OOSA 5ISMA 4UBJA 1IUOA 2JGEA 4WCVA 2EEPA 1VE7A 2VEOA 3BJRA 3UUFA 3SWWA 3H18A 2Q0XA 1DWQA 4GEGA 1P0QA 2XUHA 4BAUA 2WILA 2XUIA 1FFCA 1X70A 1A8SA 4DMCA 4X95A 3F8SA 1K6EA 1CIJA 2ZYRA 1SC9A 3MUNA 4UHBA 4CI9A 4Y2XA 1O6FA 1H2XA 1WB5A 1JT2A 1L7RA 3ESAA 2DR0A 1LZLA 1XQVA 1WOMA 4BP9A 4GBGA 3CN7A 2Z5GA 4BZWA 4P9NA 1A8UA 5ALZA 1CUXA 1AURA 2WIGA 4Y9SA 2FUKA 2PU7A 3L1HA 1LPOA 3LS2A 4TPKA 3WWOA 1I6WA 4QDZA 1MX5A 3WYDA 3BF7A 3ZV7A 1UK9A 1XQYA 3FYUB 4HTAA 3EQ7A 5I7UA 1QFSA 5JZ9A 1Q0ZA 2HRRA 1UK8A 1QIJA 4K6HA 1QIEA 3DL4A 4NS4A 4S0XA 5DWDA 4QDUA 3VJKA 3DEAA 3LCRA 2W6CX 1KEZA 3WWPA 3R3UA 4X93A 2GBIA 3IA2A 1XZCA 4M0FA 4YASA 5LLSA 2WHRA 3O9MA 4YX9A 4H7EA 2JGKA 4C89A 1UKAA 5YASA 1E8DA 2RGUA 2XUAA 4IH1A 1XLWA 5T4HA 1GXSA 1BEZA 2Z3ZA 1N5MA 2QS9A 5C81A 1W52X 4KACA 1J06A 1VXRA 1YAJA 4BB0A 3KDAA 3AZPA 4U2DA 3V1MA 1DX4A 2BAGA 4J0DA 3H17A 4G8CA 3HXKA 1CVLA 5FPPA 3GFFA 3WKAA 5CH5A 2JF0A 4UHCA 3BE8A 3B12A 4HZGA 5FKJA 5HKBA 5DNVA 1OXMA 3AILA 5AKHA 1WM1A 2WQZA 1ZICA 1RP1A 4DGQA 4RE6A 3G9XA 2VJCA 4G4GA 1D07A 2RONA 5AO9A 4LXGA 3W04A 2JBWA 3I2FA 3QPAA 4OPMA 4K6GA 1LPPA 1XRRA 3EQ8A 5AICA 5ALQA 4ARAA 4DMHA 1H2ZA 1QTIA 2QRUA 3WMRA 2GYVA 1SCKA 1BN6A 4U2BA 3N2ZB 3C8HA 1ZI6A 4EY8A 5AM3A 5LYYA 3D0KA 4Q05A 4J03A 5LP1A 1BROA 5EIAA 2HFJA 4X00A 4DYHA 5CT9A 3WL8A 1QJ4A 4BCDA 5I8PA 5IVDA 5JADA 4KYVA 4L72A 4F21A 2OGZA 2WUDA 4PV7A 5ALVA 4PSUA 4KE6A 4B81A 4Y2RA 2BKLA 3GBSA 2XQIA 3C8DA 2WHPB 3BF8A 3F67A 1MX1A 1UZAA 3OC0A 5JZBA 3IUMA 5KREA 1YS1X 3RK4A 2QKYA 2AJBA 3PUHA 3BWXA 2OAEA 1VZ3A 1CUDA 4H7FA 1GGVA 1IUPA 4AMZA 3A2MA 2QMQA 3FAKA 4DM7A 3MVEA 1P0PA 3WK9A 1XLUA 2XUOA 3WK8A 3E1GA 3HABA 4Q3OA 1R3DA 2XUKA 4RPCA 5HK9A 2B9VA 1N1MA 2CKMA 1U4NA 1MTZA 3O4JA 5EHZA 1L7AA 4J0IA 4KRYA 3O4GA 4UFOA 2OLEA 3A6ZA 1YASA 4H7KA 3BDVA 4WY8A 2Y2UA 3FLAA 3IUQA 4CIAA 1VE6A 3ANSA 5JAOA 2Y1KA 3DQZA 2C58A 4K6KA 1UT6A 2GZRA 2ZJ6A 5A7FA 1CUIA 4MEAA 1GQSA 4TGLA 2CUTA 4W63A 1EA5A 4FBLA 5H3HA 1TK3A 2HA2A 4W1SA 5AM0A 4KAAA 3T52A 3DS8A 5FXMA 5IVIA 1JJFA 1XZBA 3DOHA 1EHYA 2H9YA 5T4BA 4X90A 3GROA 1AMNA 1X2BA 1CV2A 1XZKA 4FNGA 5ALDA 3H1AA 2H7YA 5KWIA 1WHTA 1QIFA 2FJPA 2QOEA 1ZJ4A 3OM8A 5AOCA 3DLTA 2XUGA 1MAHA 5HFNA 1DU4A 4C4XA 3HLKA 2HHAA 5E4TA 1K63A 2V9ZA 2DFPA 3HSSA 4IQ4A 3R41A 1WB4A 2WU3A 3I1YA 4ZXFA 1ODSA 1TCCA 3EF3A 4X71A 1E5TA 5DNWA 4G8BA 2OQIA 3R3YA 2CJPA 1NX9A 3JYHA 1UWCA 3IB3A 1E8NA 1OCEA 2VQ6A 3DKRA 4BE4A 4DTCA 1CQWA 2W22A 4KJXA 5DJ5A 5JD6A 1AZWA 5EI5A 5C8ZA 1ZI9A 3LIIA 3UUEA 5E4JA 2XMQA 1M33A 4G8DA 1P0IA 5HQ3B 4ZGBA 2JGFA 4BDSA 3I28A 5HF8A 2ECFA 1UKBA 4BCBA 4C6HA 1GQRA 2WG0A 3KWJA 5KBYA 3AUKA 4CIBA 4BVKA 2DQZA 3HEAA 4FWBA 4OSEA 4JH0A 1G5FA 4UPDA 1QE3A 5HF5A 3STVA 2DHEA 1XZLA 1N8SA 1UK6A 5CT8A 5T4EA 3I2HA 3WWDA 3WIOA 4M0MA 4G5XA 5HKAA 3CCBA 2O2HA 1HL7A 3R3WA 3VJLA 5LZ4A 2I03A 3L1IA 2ZSIA 5IKXA 2J3DA 2VSQA 1K4YA 4C87A 1EK1A 2C5FA 3RM3A 3JWEA 4FFVA 5JD5A 4W1PA 4ZV7A 4OYYA 5ESRA 1ZD5A 2OCGA 5A7HA 4E11A 1H23A 3ZI7A 4F60A 4BDTA 2BUBA 1U65A 1Z68A 4BRSA 3B3QA 4CG1A 1H22A 4IHAA 3WK4A 5JATA 4OB7A 3RKSA 2QZPA 2QM0A 4GLBA 5AM2A 1GPKA 2WSLA 4DNQA 5ALOA 1CUSA 4AN0A 4DNOA 3AJAA 3IUNA 3H0CA 3D2CA 4QDXA 5FP0A 1Y7HA 1EB8A 3DD5A 4W1QA 3TRDA 3I6ZA 4D9JA 2H7XA 2GYWA 4OCZA 3D4LA 4AZ3A 3W2TA 3FYTA 2Y6UA 3A70A 4NVRA 4FKBA 3I6YA 3L1JA 1XRMA 4X6YA 1QIHA 1KU0A 2WM2A 1LBTA 5BOVA 4UFPA 3V9AA 2VJDA 4Q1VA 1EVQA 4J0GA 5AM5A 4K2AA 4N8EA 1IZ8A 3IURA 4UBMA 2XUFA 3TJMA 4AO7A 4FLMA 2XUQA 5HK8A 1ZJ5A 1B41A 5AIAA 4B80A 3DNMA 1CUAA 3WK6A 2PUHA 4CCYA 5DLPA 1ACJA 1XKLA 1PFQA 2D0DA 2WUGA 4FFWA 1YCDA 3C6ZA 3K9BA 3O4HA 3KSRA 1J1IA 4EA6A 3OURA 4W9RA 5AOBA 3WI7A 1YAHA 1MT3A 2ZJ7A 4MYDA 3LLCA 1QONA 1R9MA 1ZI8A 4QZVA 3MGAA 1WPXA
chains in the Genus database with same CATH superfamily
3QLVA 3IXLA 1YQUA 4ZOBA 1PJ8A 1VP9A 1Y3AA 2WKRA 4CIXA 1LPNA 2O07A 1B6TA 1H4TA 2ECKA 4NPCA 1KEEB 1DG1G 4JEMA 4LFCB 5FL7D 4DCOA 3MS4A 4XX1A 3AI1A 1M10A 1R6BX 5AR1A 2ZAGA 4M1YA 3HI4A 5FT9A 2IBSA 1N6PA 4MWOA 2RJNA 3GDGA 2CJWA 1FB5A 2OCYC 2VQ3A 5CAEB 3LBHA 1KI6A 1J49A 2BGLA 4HFMA 3TSZA 3JWHA 3W5IA 2PU5A 3BULA 1HOXA 4XGKA 4YAKA 1KKUA 2ZWOA 1NAIA 4BNHA 3WRYC 4ZAVA 5AW5A 2JPDA 3KQNA 5K6AC 2JFNA 4XB6B 4Z5XA 2OV6A 3COSA 4BYMA 3PFKA 4D4MA 2CFIA 4A8JA 5AKZA 4D99A 2DFDA 2G71A 3FWNA 2CZQA 4RGYA 2Y4OA 3DO6A 1PFVA 3V1LA 4PICA 3VVBA 4AMBA 4TZ6A 1XMXA 1H5UA 4HDQB 1MV5A 3M3PA 5I3CA 4RZSA 3K15A 4RD2A 2ZE5A 2B5VA 3I6QA 3KQKA 1E9BA 2IJGX 2NYVA 2O2XA 2Z57A 4IVQA 4LV8B 3FJ1A 4N3BA 2DB3A 2IS1A 3AOGA 3FG9A 2EL9A 1H2YA 2LKCA 1CJVC 1L4GA 1SOUA 1EVLA 2V9PA 1KTVA 2YWFA 2GWRA 3DDUA 2XTMA 2HU2A 3PUXA 4KLAA 3EPKA 1Q7GA 3RT9A 5HWSA 1FYFA 3QKTA 5JLAA 1I2AA 5F5NA 4HNVA 4RTSA 4QELA 3F6YA 4AZ0A 3M81A 3CMMA 1PEKE 2PWYA 3N0VA 4P80A 1WTAA 2WNIA 2NYAA 3DKKA 3HY3A 4PNPA 1R88A 3C0KA 2VJQA 4QPDA 3PLAE 1ISRA 1WY7A 1RC8A 1L5MA 4HXGA 5IM4A 1IK6A 3BN3A 1FXUA 4EL5A 4YCNA 1MKYA 2PTGA 1WDTA 3DC2A 3IFSA 4LDAA 4RAOA 5LA6A 3RIXA 4DIBA 5KYYA 1R8XA 2C2YA 2JD2A 4X3CA 4YCJA 2DM6A 3QBEA 3EARA 3SPXA 2OBFA 1T5DX 5FR1A 5BYKA 2QX6A 1YS4A 3O8RA 2QTAA 1QWSA 1IRIA 2ET6A 3WL7A 4RQBA 1FPMA 3EXHB 1J0AA 3PQ6A 2J5QA 5LNK1 1JDBC 4I19A 4WK6A 1YS7A 3WXBA 1X38A 1DC7A 2PXHA 3QSGA 1YRLA 4YECA 2V4MA 2KJQA 3OZRA 4OOEA 1WDMA 4GI1A 1G9XA 4WVFA 3QPDA 1BDHA 1CY8A 3N70A 2CMDA 3K8ZA 3P9SA 3DQPA 3RHFA 3TX2A 3FPSA 2OGWA 4JNKA 3LHSA 2PUBA 2DUNA 1E0SA 3WGHA 1R66A 1C3XA 3HVHA 1E18A 5DHUA 3RU2A 3KVOA 4PXAA 4LVOA 1QFXA 1ZVKA 1YIOA 1OFUA 3DBOB 3C7AA 2VL7A 3I4FA 3IRVA 1TCUA 2O1EA 4QWWA 5JSUA 1UEXC 5IN4A 2ES4A 5FA8A 3WNBA 3M34A 1E3SA 2VLBA 1PJQA 3GRPA 3HYTA 2B20A 1GAJA 4OXRA 2A1IA 1KFCB 5G1NA 4CN8A 4EYKA 3HVIA 3ZI0A 3WYGA 1ELOA 1HYGA 1ZUWA 3ISJA 4JKIA 2QT0A 4AJ2A 2I9KA 1HYBA 3KCQA 4WV3A 1LDGA 2IP2A 1QPGA 1XUOA 3Q8XB 1XDBA 2CXPA 1JVSA 2GN4A 4NYIQ 2N0SA 5KKAA 3K5WA 3KSUA 5ALTA 3VO8A 3FZEA 5CNJA 3RBZA 3GN2A 2CJWB 3QPWA 1ODKA 1U0GA 5DYWA 2UZ1A 3AESA 1ZJWA 1K4MA 2D5LA 3GEIA 2FP3A 3IPLA 2RH8A 4O63O 1OILA 4Z4IA 3FFBA 4RY9A 1ODJA 3HXOA 1ECPA 4RS3A 3FPAA 3TAUA 4DSZA 4UTPA 2UYYA 1AMUA 1J2JA 1YR1A 3O74A 1Z6YA 4D6PA 4LF9B 1WUTA 4CTKA 2PSHA 4GGMX 4OYHA 5C18A 3FAZA 4UUMA 1Z0ZA 1JEQA 2RBGA 2WUFA 2ZRHA 3TZEA 1CS4C 1AHIA 4N5IX 4ZCPA 2IE0A 3ZLTA 1DJLA 3I3OA 1AGYA 1DHTA 3FRIA 2GD2A 2CMGA 4HEA1 4WDQA 2QN9A 4M1KA 2FTKE 2V7EA 5ALNA 3TE7A 5H3LA 1FYDA 1DJNA 2Q2NA 3BGWA 3W7BA 2PRSA 2UZAA 3P2EA 3HO8A 1G4HA 2Y71A 3CR7A 4KVGA 3V1TC 2SHKA 3P0JA 1IEXA 4P0TA 2HRQA 3BE4A 5CG1A 1NI5A 2YJ6A 1CUWA 2X0JA 3VGJA 3VH1A 4GXRA 3BIOA 4JOSA 3DE0X 1RHJA 1WUHS 1CP3A 4Q7KA 1EHIA 4GPBA 1HQKA 1WUYA 1OH8A 3MMPA 4ZCMA 4J0JA 2VCYA 5LA6B 5J58A 4QUKA 1Q21A 1H5QA 1VSVA 3DVAA 3MQFA 2BKEA 3OA0A 4FEGA 4IKOA 4E30A 2HCBA 3C3XA 5K0SA 1QVAA 2FB9A 3AZQA 4EATA 4BJ1A 4CG3A 3K73O 3FFXA 4J90A 4AKGA 5DKFA 3L7DA 4G5QA 3MS7A 1WXWA 5IAEA 3B2NA 5BN5B 3QU7A 3T7JA 2C77A 4LBVA 1ZNQO 3L6EA 1GTL1 4DLUA 4IHQA 2DUJA 3EFBA 4YJ3B 2IT1A 3DKVA 4C6SA 3M4YA 2LCFA 5L8VA 2F8MA 4IF4A 1A27A 3KFVA 3TQTA 4M9ZA 1F8XA 1EFTA 3RC1A 3GVCA 2CXTA 3WL4A 3BXFA 1W1IA 1V5FA 4CF6A 3B48A 3HGTA 4IZIA 2F1RA 1UR5A 4RA9A 1IUKA 3UBMA 2FR1A 5IAOA 1YMUA 2LRHA 4INJA 3DMHA 2BI8A 3BIXA 4P7FA 3WOVA 4NXNB 1KOGA 1Z16A 2VHYA 3UT6A 1VLHA 3GJ6A 3U3OA 1KEVA 1WCIA 4HVTA 2HFKA 4C0QC 2TSYB 4BLUA 3DD1A 4ZOCA 4ZMBA 1DPFA 5LMZA 3ZHTA 4GAEA 3ETLA 1TEHA 2W6MA 4FLFA 4LDJA 5FLKA 3A7DA 3VU1A 4KQXA 5EJ2A 1KFJB 5IHPA 3R9XA 1XP5A 4QD3A 4CMBA 1UBRS 3H6GA 1E9RA 2FX2A 3NHAA 2VJLA 1OPXA 3L04A 5JWOA 4BEJA 5GTDA 1K06A 2XQJA 1SPBS 4LTDA 3OZGA 2E0IA 3WSWA 2ZZKA 1NQUA 2EFEB 4PSCA 5E1MA 4CTOA 5JJ5A 2GXAA 2P40A 1LBSA 2D2IA 2BFPA 3V9PA 2NXCA 3WQSB 3FMGA 2R8XA 3KVYA 3L4EA 3IR7A 4ZGWA 4GPIB 4MRMB 1EIWA 1SHTX 1UP4A 3KAQA 3MIZA 1WF3A 4QGHA 5ICCA 4RTNA 2VZ8A 4ZTUB 3LC7O 3M9XA 3PFFA 4QUDA 4DDMA 3Q87B 5JAIA 3LY7A 2AX4A 3O8QA 1REQB 2HA4A 3KZMA 1UJCA 1HV8A 1NA5A 2RHCA 3QQ5A 1DJQA 2WSSA 4RDIA 2JIDA 3FR8A 4XYBA 3T54A 5LL6P 1FF9A 1BX0A 3EG5A 1FDRA 4W8GA 3SIWA 4X65B 1LSOA 1NJ8A 3JQFA 3VVLA 4A6DA 5BURA 5JRZA 3I61A 3H4MA 3UB2A 5DLEA 3D8BA 3VX4A 4MUFA 4CCWA 4N0MA 3GR6A 4HPWA 4A6PA 3A1FA 4XGRA 3I53A 2X9NA 1F7VA 1CEXA 1FMTA 1MMFB 3IAM1 3PPXA 3V4ZA 2ABWA 3HDYA 2B4TO 4ZVVA 5H68A 2AFIA 4D3SA 4LXTA 1JHRA 2QLLA 2W93A 3V7UA 4I1VA 4M8NE 3SFVA 2PX0A 3DNPA 4DQXA 4NENA 3OTIA 4RELA 5SZKB 1HDYA 3EGIA 1I7NA 1NONA 2CMHA 4KQKA 1MAUA 3D3EA 1WQ4A 2C9OA 4LBWA 4XQ9A 1MOPA 3TMKA 3WP0A 4BNGA 4EELA 4WLFA 1B15A 1YQ9A 3SQMA 2WUVA 3K70C 1P6UA 5E6RB 3EX7C 5GV7A 1DQNA 1HKHA 2QQGA 1X2EA 1XZ8A 2CXRA 3MOSA 4TRNA 3W3ZB 3EZYA 4EJ2A 3SSOA 2OV2A 1LLQA 2II6A 5F73A 2ZBDA 2H48A 1E3EA 4LSGA 1DZ3A 5ES3A 3C8ZA 2R68A 3NH9A 3G8BA 3L6CA 1L7DA 4P4GA 1O7JA 1FJGB 2ZIUB 3HVKA 4MUKA 5KKNB 2IYVA 3EVBA 4D57A 5EMKA 3DV2A 4U7FA 1QVWA 3R6DA 4V24A 2FX3A 1EBUA 3KAPA 2VPIA 2H1OA 1S4QA 3KDSE 5AXAA 4OI1A 1OW3B 3ZBUA 5L3QB 3RO7A 2HQOA 1CRWG 1FNNA 1HK7A 3EMKA 1GNVA 5JCOC 4BO6A 4NSNA 1OAKA 4NBVA 1ZJ6A 4Y3UA 3KSBC 1EP3B 3H42B 4XQCA 1M0TA 3W7AA 3IP3A 3QG5A 1FSFA 3H97A 1UXKA 4RA9B 3I5YA 5TGZA 3HXLA 2OESA 1D0IA 2PZ8A 4HLUC 2QLNA 4CJXA 4J1TC 2HD4A 4YXWD 3GAMA 2X5XA 1OTYA 4WKCA 3ZVMA 1QGED 1H2WA 1WCIB 5AUOB 4TZ0A 1U3UA 4EJSA 1OWLA 2JBAA 4HWTA 4CM7A 2FW0A 5BV2P 1TCBA 1U9JA 1P5JA 3ABQB 2HMAA 1E9EA 2CUZA 3Q41A 1S1MA 1HG1A 4I55B 3R9XB 3A27A 2ZI5A 1F9EA 4V0SA 4Y2TA 5KIAA 1NNLA 2Q29A 3CCCA 4QNNA 4ZZ0A 1THZA 1S6YA 2GO1A 1BJKA 4OUKX 1D1QA 4HDMB 3VA7A 1OQAA 3EGCA 2YVKA 1J2YA 4KPGA 2W2QA 4Y0AA 3HWX1 2GASA 2G36A 4WD3A 3WLLA 3CC8A 3W2GA 3WLSA 3TAXA 3QU5A 4NBSA 5FAKA 5KNLA 3OIDA 2IU3A 3G0DA 2HM7A 1LBQA 2Y99A 3A28A 1R4ZA 4MR9B 4OI0A 5KTTA 2GHTA 3RLFA 1GPJA 5BOSA 1NG1A 4JLAA 1RYZA 3LGSA 4WCFB 3HCPA 1COWA 3A3OA 4RNCA 4LOAA 4WIAA 1QFMA 4AX8A 3WQBA 4F4UA 4ZYVA 5BWMA 1VI6A 4RHYA 5SY6A 1Q20A 3GJXC 2XCTB 4B45A 3IAFA 1J07A 1CVIA 5KX5A 2VTBA 4ZWNA 3E9QA 2ZI7A 3WJ2A 2BYTA 4N76A 2D4AA 3D6AA 3FY4A 2QZ9A 1PS0A 3CFYA 2IZ5A 2X86A 2UV8A 3DZDA 1E9CA 3HJHA 1GUBA 4ITVA 4NPAA 4CQMD 1J7KA 2FSVA 4LZAA 2XQVA 2G6BA 5IFLA 2PVCA 2VXBA 4URFA 3R7DA 4KYUA 1E69A 3ODPA 1N6IA 4KIJA 1NIPA 2I4IA 1UAGA 2ZTHA 3PEYA 2AVNA 2QIPA 2AFIB 3D1VA 3VR4D 1M75A 3A1EA 5KHLB 2ZRKA 4ZI2A 2DJIA 4NENB 3BXPA 1U28C 4KQGA 5EPUA 2G1UA 1CUUA 2VWQA 1ZK0A 3KM0A 4R2LA 3OZBA 1B23P 2V6FA 3N8IA 4RC9A 3FMVA 5EQFA 5I9IA 5KWVA 5ITSA 2WTMA 3DLPX 4GLOA 4KIFA 5JV5A 1Y48E 1CZLA 4Y0NA 5HCIA 1TJYA 4GPD1 1NYTA 4E5VA 3ROMA 3IDZA 4LZLA 1R18A 4PNHA 3P2OA 1ISMA 4GSLA 1XK6A 2J32A 1H1TA 4BRZA 1Q2XA 2I8AA 1SCBA 1GZ5A 1PSWA 1G5IA 4RJIA 1PWHA 1P2TA 2XGMA 1CLEA 5JS7A 1FUIA 1ESZA 3X44A 1XZFA 5ALWA 1N2SA 4QULA 3H1PA 1YTLA 2PRYA 3QVUA 4ID3A 2OXIA 3WK7A 2J0VA 2I4LA 3GCGA 4C76A 4DREA 1G38A 4B6RA 1MTOA 3L18A 1E1RA 1GGKA 4L5AA 5TIIA 2GARA 4KE8A 3PUJA 1TIKA 3OECA 1QAQA 2ZJ0A 4NYJR 5BSWA 1UJ4A 2EX4A 1ESCA 3THYB 5JZMA 3AHEA 4IQ8A 4O33A 4PLCA 1MH1A 4C7BA 4YUAA 5AKLA 4YT2A 2IUSA 4IP0A 2JBAB 2DQSA 4GMDA 1DQYA 1H05A 2O8VA 3K5PA 1OYOA 4NH0A 5EMLA 1WSAA 1WVIA 5LR6A 2JIMA 3HSYA 5SV2A 5I7VA 4U7GA 4RLSA 2CB0A 2R47A 4H6XA 1QU2A 1CNFA 3TLZA 2E89A 3HYSA 4XVRA 1P4JA 1LBHA 4UTOA 3V8MA 2YIMA 4M0UA 5EP1A 2JVKA 3G8CA 4J43A 1B6GA 2Q21A 3EAFA 4CLOA 3DOEA 4JDUA 3WV4A 3U6KA 4OUDA 2IUFA 4L5YA 2IWRA 2JFVA 3A1CA 4HAUA 1H0KA 4TLAA 5KDLA 4Z7JA 4OBXA 1T0PA 3WGJA 3H8JA 3HU5A 1C7JA 3E81A 2OA0A 4Q4CA 4GYKA 5JSZA 2O59A 4CLRB 2BN4A 5BVHB 3OP1A 4DN6A 3P45A 3PHBE 1OT5A 2EXXA 5FPYA 1H8HD 3PXAA 2A0XA 1SHZA 2H4XA 2R6HA 3BUSA 4DMKA 1EGAA 4UFNA 5T3UA 4BMDA 3UV6A 2R79A 4MIYA 4ZEWA 2JD1A 4YWHA 2X1VA 4DLYA 4L74A 1CW2B 2HH9A 3KQVA 4QYXA 3WRYA 1PNRA 4X84A 1E64A 3CWQA 3CTPA 1ECFA 1P60A 1VA5A 3ET5A 3SF0A 1ZD1A 4AXXA 4D74A 1VGVA 4JB0A 4ZQEA 5AKGA 4ZZ3A 1GA6A 4AMVA 5LQDA 5C46F 1DIOB 2H5JA 3MAGA 3E5MA 1GTJ1 1U0HC 1IUNA 1G19A 3IIJA 4ESHA 3VR2A 1ZP6A 1IJBA 3A9VA 4EUEA 5FV4A 5JXWA 2JFFA 3WAGA 1V7QA 2C5BA 3AVOA 4ZIRA 1POWA 2BEUA 1C14A 3LDUA 2W7TA 4N3NA 4UNQA 1FLVA 3E0QA 4OXQA 3GDWA 2QUJA 3TSAA 1ZM3A 5CXSA 1HFWA 2RAFA 4Y6QA 3HI6A 3OMXA 5D2CA 3VVMA 1H1LA 1E98A 1FDOA 1SUFA 1UJMA 3A25A 3CXRA 1WVMA 3UFXB 5DMXA 1U4OA 4KQFA 5J5VA 3ZE7A 1I7DA 5ESWA 3L7NA 4BVBA 5HX7A 4G56A 5E9WA 3L0BA 4P3YA 2OCAA 1TKAA 4WXPA 4ZJUA 5B6PA 2FZWA 2ZUUA 3O4IA 4MA5A 4RZHA 1C8LA 2Z09A 4J2OA 4E5YA 4NEHB 4EB3A 4AKHA 4JVMA 1A3CA 2WSIA 3BCSA 3PR2B 5E8JA 5HF6A 2ACEA 5CM8B 5IDWA 3RI3A 1VSTA 3HLTA 3PFBA 4G81A 1TFUA 4WLEA 2ZDGA 5FORA 1T0JB 5IARA 9ATCA 1E2LA 1JWLA 2JLSA 1DRKA 2DPLA 2I34A 3INTA 4L6CA 3A2NA 5EFZA 4Z53A 3FPHA 2OCBA 3ZHZA 1N6RA 3WLHA 1BAPA 1AC5A 2O2IA 3G2QA 3UUGA 1IEVA 2F3QA 1BE1A 2PX4A 2ZJ8A 3C39A 5TX7A 2Z5FA 3ZXUB 1ETHA 1DWOA 2OTCA 3AHFA 2BGUA 3GAAA 4RVGA 2GYUA 5PGMA 1WLSA 2O9JA 3PI7A 3TRIA 4FVTA 3S7ZA 5GADl 3F7NA 4FGLA 5F77A 4L5IA 1P1HA 1YE8A 2Z6AA 3WA6A 3MCTA 5JAMA 3R5JA 3H4IA 3H2IA 1VJ0A 3M1IA 4UHHA 3SS8A 4BATA 3VC2A 1GZDA 1H2FA 3O3OB 4GR5A 2VHTA 3TZBA 1LNZA 1PYDA 1BEUB 1GGFA 2DLCX 2ERYA 3CRRA 3HB4X 3ZWMA 4OV6B 1JFTA 5TDHA 3I5XA 1QUFA 2JGNA 2O2CA 2BIFA 4LJ8A 2P6RA 1VMIA 3ROTA 1DKPA 1G42A 1PSZA 1BXGA 3EEFA 3SXUA 4YR9A 4KITB 1CHDA 3PE6A 1DT3A 1SAYA 4NU5A 5HRCA 1EDOA 4PANA 4TT8A 2G40A 4K9KA 4DIFA 1PV4A 3P20A 1DIBA 2HBQA 2POQX 2QUAA 3QEMA 2B83A 4JI8B 5BWOA 3FTDA 1ZKDA 4KR9A 1FP1D 4KO8A 1DJPA 5FTNA 2NT3A 1MIOA 1K7YA 1R74A 3C5WP 3O2JA 3FDJA 4O2AA 1P2UA 4RPJA 3ZV6A 4N3GA 5IASA 3C43A 4NHEA 3TEFA 3S4YA 1W0KD 1ZRHA 5JBIA 4ZFNA 4ND8B 2FK8A 4UU0A 4YRFA 5AVJA 5LQNA 5CDTA 5AK4A 1QG0A 4HV4A 1G1AA 2WQ6A 3MWJA 4N82A 4JLNA 2XDWA 5IH7A 1YRYE 2VYQA 1JEYA 3OQBA 3KL2A 1UOEA 3AR9A 1XROA 7REQA 4LY0A 4MGHA 2PR2A 1EX7A 4EYQA 1NW7A 2P30A 3HY4A 2OV1A 3B1KA 1QIMA 3DT6A 3EIWA 4MTCA 4XX0B 2H1LA 4NJMB 4D6YA 1USUA 3O1JC 3U4HA 4MQEA 1M3SA 4US0R 5EINA 1VJ5A 5CB4A 1YWGO 3B53X 2JRCA 3TI9A 2J9ZB 2XKBA 3KQPA 3O91A 1G8GA 3PGMA 2I7XA 4GOLD 2R6GA 3C6QA 2V55B 5FBZA 1A2QA 1D2RA 4JSYA 1Q7CA 2FF7A 1DKUA 1NP7A 1RPNA 1YB5A 2CVHA 3IT2A 1ZGBA 2ONYA 4PYQA 1U8UA 3SYNA 5KNCD 4QRHA 1NN0A 4DG8A 4PE5B 3FKQA 3NM5A 5I7EA 3EEIA 3TR0A 4N9WA 3TD6A 1DQPA 4NH4A 4NPHA 2IYXA 2PUGA 2JLQA 1Z4JA 3BICA 2QP3A 2PJDA 2ZBGA 5HQTA 2ATIA 2VS1A 4AY2A 3CVYA 2R0QC 4GI7A 1S4MA 1ND6A 3IQHX 4FNAA 2B99A 2JAOA 2V96A 1Z7GA 3RYIA 3GP5A 3GGGA 2CT8A 4G1MB 2BFCA 1OLSA 1XTUA 5KTPA 1MV8A 3PUKA 5BN1A 1QANA 2VA8A 3U3JA 1GGNA 1D4AA 4ZOAA 5HP4A 1KZGB 4TXHA 1TM7E 1WSBA 2FPOA 2QEQA 4H0FA 5FPQA 1QM5A 2EDAA 2OZKA 5LKAA 3RF6A 1F0KA 3IHKA 4PIMA 3PVSA 4A0QA 1OI4A 4LRTB 3KOWA 4MRSA 3TIXB 2PS0A 2PFKA 3STXA 1ORVA 1VBKA 2YXBA 1JEDA 2G6TA 3FJOA 3KOXA 3AFIA 1E66A 1TF7A 3LKZA 4QHSA 2FWJA 2REOA 3OI7A 2UYQA 2C92A 5EE0A 3OEEA 1I3KA 3URKA 4A7PA 2F8LA 2WPDD 4MV0A 3W9YA 3L7IA 4KN6A 3ULKA 3F9IA 4GMXA 4LZPA 4MVJG 1C2YA 3F97A 4LS3A 1U80A 1E1CA 1G59A 2J6CA 1GWNA 1TRKA 4BMXA 4K03A 3G17A 4LYDA 3ROQA 5HE9A 4EI8A 1HDGO 2JGLA 2W0SA 1FY2A 3OHSX 4JZYA 3S44A 3W6OA 2QVCA 4CPDA 4V1CB 2QM3A 1ES9A 5HZGA 3D54D 4K3VA 3OUTA 3ZWQA 1G9TA 3JQ9C 1YC5A 3FD8A 3PXDA 3VDRA 2AF4C 3VYTB 3ZE0B 4BX2A 1J0EA 5DI3B 4EYEA 2H1HA 3LO8A 3WGTA 4ZC1A 4BP8A 5C4MA 1JILA 5LZ2A 2O5VA 1NUSA 3B3GA 1PEDA 1U2EA 4Q1DA 4EW1A 1ZK1A 3REOA 1LPBB 2OKGA 1DFHA 1Q17A 2CMFA 2DH5A 5CMLA 1IPHA 2AD5A 1C7ZA 1Y4AE 3AUTA 1TYEB 3JQCA 1E3WA 3QBJA 4QPPA 3ANTA 1JEYB 4YCLA 4PWYA 1LLFA 4EKDA 1XTSA 2JJMA 2YV2A 1M54A 2O57A 1WDWB 3L4JA 5A5EA 1R8SA 3LUCA 4P54A 3QH4A 2J4DA 3TZLA 2Q5EA 4FDLA 1OHHD 4NBNA 3WL6A 3ZWBA 2I4OA 3A8TA 3K4QA 4BVGA 1I6LA 1FJHA 1GKLA 4R83A 2C4HA 2RHHA 3G23A 4YJFA 2ZM5A 1FJXA 4MQEB 4D9GA 3ZJTA 3DZIA 5LJIA 3OZVA 1LLUA 1ECCA 2G7MC 5CEEA 1TQDA 3AK4A 3NRCA 3ONFA 4MGZR 3CKMA 4QGFA 3TNLA 2WBLC 4F38A 3D8UA 2HYDA 3OKFA 4CR6A 2PZGA 1GLVA 3HP4A 1KVQA 1XZGA 5EE9A 2Z4TA 4RBNA 3CISA 2WT8A 3IEIA 1D8TA 1GJRA 3QXSA 3A10A 3D6VA 3HKBB 3FOFC 4E1BA 4WZAB 1Y5RA 2PZBA 1QO7A 3C5VA 4OFXA 2Q07A 3L7MA 1NVFA 3ESDA 3SD7A 2H2IA 3L1UA 2HBRA 1MX9A 1Z63A 3LOPA 5HZHA 3C7KA 1JX6A 1PR9A 1GZVA 4MW1A 1QV6A 2AEJA 1QOQB 4QXRA 2TYSB 4F4FA 1L8XA 4GWKA 4MV1A 3R7FA 1DAGA 5T8KC 3BAZA 2Y3IA 2IYPA 2QK4A 1E4OA 1CK4A 5EE1A 4BMNA 5JXIA 1YSCA 1LXCA 4LRXA 2XAUA 2F1JA 4R05A 4BMVA 4F3KA 2JGJA 1TM2A 2POCA 3DE4X 4IGIA 3IV6A 1CR2A 5EZQA 3X43A 2C7BA 1MR3F 3ED1A 3FI0A 3COPA 3LQYA 4IS3A 2G1AA 5ALSA 5C31A 3NMUF 4CDGA 1EX9A 1N5LA 1LV7A 4W6QA 1KF0A 3IXMA 2WWRA 4FGKA 5JCOA 3GLQA 1AVTA 3UCEA 3VUEA 5DP1A 1V8OA 3N2GB 5CDUA 1AO0A 5SYMA 3UG6A 5FNVB 1PGJA 4HDNB 1D6SA 1D9XA 4Z8XA 4D4GA 1MRSA 2PL3A 2FCAA 1NUPA 3ORFA 1J00A 4Y6GB 4HLUA 3JQBC 3IVAA 3DL0A 4J1TA 4LBYA 5L3ZA 1F4PA 2BKUA 2WYVA 3PV0A 5DN6D 3WAJA 3GWGA 3BMQB 2MMGA 1FS6A 5C1BA 3IKLA 2A57A 4TVKA 3G02A 2QBYB 4MI1A 4RE5A 4B6FA 4D9NA 1N8KA 1R7RA 2GAFA 3EXG1 3GARA 4GSKA 3D0RA 1TJ4A 3ZU2A 4Z3KA 4MUEA 1HF3A 4H7HA 1RWVA 2JJQA 3NX4A 3HBMA 2RKWA 1RPJA 2P67A 1G7RA 4OHXA 3SZUA 1EVKA 1UCFA 4RQUA 3WY9A 1F4LA 1GNSA 4B09A 5IAAA 5HRAA 2IGTA 4TWBA 5EIHA 1TM5E 4K87A 5DMHA 1XD8A 3AY3A 3NW9A 4NX2A 3IQXA 4HNTA 2B8JA 2ZS9A 3GOHA 3MCZA 3FYDA 3UJ8A 4RPIA 2ZYSA 2Z1DA 4EKGA 1E3QA 5JAZA 5K6TA 2ORVA 4B4UA 5GV8A 2NADA 3WZ2A 1INLA 1YB7A 2J6HA 1T5LA 1EINA 1TQ2A 4OLHA 4L73A 2JLVA 4XPIA 4KWCA 4K0RA 1FX0B 2WF8A 2OAGA 4ACAA 5KNDA 5MN6A 1UKVY 5EIEA 3ML1A 1UMKA 1U9YA 2QVYX 2D0OB 3K2BA 1BEEA 3IIEA 1U6JA 4Y6OA 4ZVQA 3TMAA 1JFFB 3T94A 2OXCA 5BQXA 5JXHA 4XPZA 2ZEJA 3E5RA 3FZGA 5A4MS 1I0LA 1S2IA 2A1UB 2CZGA 2EDCA 5EGNA 1FVOA 3EVDA 3QVJA 1R4MB 4JR0A 4Y0VA 4I4IA 4WNYA 2P2GA 1U28A 5L9AA 3H5AA 2ZWVA 1EBFA 2R7MA 3N2YA 5AXCA 5FOQA 1QHHB 2QD2A 3CWCA 4JOBA 4N47A 3SDBA 4W1RA 1RXYA 1GFWA 3ZLBA 2I2AA 4A23A 3MTAA 4F4HA 2GAOA 2GPNA 3FHTA 2ZAIA 2I6XA 5TMEA 2WSMA 4M0KA 2CLOB 2FSIA 1I33A 3IVRA 5MHTA 1QG4A 3KT0A 3E27A 3KHUA 4P84A 1CZOA 2YASA 3NIBA 4DV4B 1E0KA 1YZTA 3JAMA 3L5KA 2BGWA 4UU1A 1KBQA 3AUXA 1JEJA 3UW3A 1PEAA 2JK1A 4OI2A 1LPSA 4NZMA 4XDHA 4JLWA 5FBHA 3UY4A 4Y2HA 4FTWA 2OHVA 5A1TA 3ICQB 1MO5A 4PRLA 4FNMA 5H9VA 3ZS8A 3W9SA 5FIUA 1MC4A 3SJAA 5ENDA 1CIVA 1GRNA 5J9FA 3PPIA 3X3HA 2WWFA 6Q21A 3O21A 1DEHA 1YZ3A 1HE4A 1QVZA 1YZHA 2RCYA 1A8HA 2FSUA 4FGJA 3O8OB 4REOA 5JDCC 4D44A 4EDFA 4MB2A 1U8XX 2C2KA 2ZBUA 3SJUA 3UMMA 1RWMA 1ABEA 3HGQA 4WKOA 3BQ9A 3K6JA 3CX8A 621PA 2V1XA 1V1MA 4UVDA 1GT91 3VJMA 1NM5C 3LX6A 1FLNA 1CLUA 4L2IA 4MGYR 4MV9A 4WLVA 5KJ6A 2H1SA 5LD2B 1U0TA 4AF6A 1K68A 1S1CA 1UPCA 3P2IA 5C8VA 3BRCA 2G4LA 1E5LA 2IW1A 3AOEC 4L6IA 3SOPA 1S8OA 3R8CA 1LVGA 2I3DA 3VR5D 3LOQA 1E1NA 5A9TA 5BR1A 2WE8A 1XJCA 2Y9MB 4DB2A 3KIPA 4LY3A 4DIUA 3FA2A 2GESA 3H11B 3M4JA 3DR3A 2HMVA 3P32A 4NP6A 1IJKA 1PWYE 2R48A 3LRTA 5ALJA 5AUPB 4LF8B 5BT8A 3G2MA 3TCNA 1WMDA 2IUUA 4UZSA 2HNBA 2ZIAA 1PBNA 4CR7A 5FFMA 4QPCA 1ANKA 1Q14A 1IK4A 6AT1A 5KWJA 2AXNA 1IC6A 3QWAA 2CYBA 5DGXA 3H3XA 2Q49A 2WVAA 4FN5A 3MJHA 3P4YA 4US2R 5HMMA 3TM5A 1A4XA 2P9BA 3LT1A 2R6ZA 2XA1A 1NQWA 5ULLA 3NDPA 4BO5A 2C42A 2W90A 1JECA 3U4DA 3EIEA 4XRRA 2WIFA 5DBOA 1NY5A 3A26A 5IMBA 3WG9A 2G06A 4EG3A 2FE1A 4PFKA 3RF7A 1YBHA 4UEQA 3V1NA 5JT1A 4RY2A 4Q03A 2VXYA 2AJCA 4R2IA 4DZZA 4IIXA 3KJXA 3MJTA 1RLUA 1W2GA 4NG5A 2YYZA 4YMWA 4Q9DA 2P1RA 4UUOA 1XVTA 3PQEA 2Q45A 2PGIA 3M82A 1S89A 3WQQA 1KXJA 3AW8A 3AYZB 2BF7A 4LZOA 3M49A 3AB8A 2Z43A 4K5QA 4AWAA 3EA0A 1NRXA 1R5NA 2H5LA 4J8PA 4MGEA 5CVEA 5FA6A 3WO0A 5KVSA 3HJNA 4FYIA 3MT8A 3E82A 3W3AA 2ZRLA 2E37A 3BFVA 4JKOA 3X1XA 2R8ZA 4YO7A 4FU0A 1UEIA 1QVRA 1BMTA 3FCYA 3PDCA 4UDYX 1MOSA 1MIHA 4R2JA 2VHXA 3GLGB 1TA4A 1C0LA 2IHJA 3FWHA 1YGPA 3GO4A 3RS7A 5LIRA 3GH3A 2E6UX 3SSAA 1NJ2A 4RJLA 4JJ6A 2JLXA 1VKZA 3IELA 3IL2A 3BXZA 3I0MA 4MDHA 1JUDA 4KOEC 2C2BA 1DCTA 1MJFA 4EGFA 2XMRA 3FGOA 5MF6A 3ZGLA 4LBZA 3QE9Y 2CVOA 3V48A 5JQGA 1C7IA 1LBEA 2O5EA 4GP9A 1KGDA 3R7AA 2NSJA 2E5WA 1CJSA 1GKYA 2EZTA 1UXJA 5NLLA 4U00A 3FSEA 1DMSA 4B3GA 2CL0X 3GEGA 3OF5A 1P6QA 1XU4A 2GRJA 4IJMA 4LGVA 3AMVA 2CD7A 2EFYA 4FJ1A 4FZVA 3LAWA 5KNCH 5ALMA 1FSZA 1NBWB 1Z5WA 3AR7A 1UWKA 1M73E 1Z82A 4JYPA 3W8NA 2HUNA 3OPQA 4FFNA 1FDIA 2CLFB 2I1VB 4FFDA 4AJHA 4AWXA 2Q7DA 4IS2A 4E46A 2YIVX 3VFDA 5HDQA 2OMEA 2H16A 3BXHA 1QDEA 5J2UF 1Z2NX 3ZDAA 4DG9A 3LCMA 1Z5VA 3GJ7A 3E6AA 3EG9A 1WXIA 4IFIA 2V1UA 3H5LA 1T6NA 2EJVA 1DX9A 3QOFA 3HFJA 4FR2A 5CR9A 4I8DA 1AKYA 4C07A 2LV8A 3VR4H 1BIFA 2X40A 4KDFA 4MUBA 3HDVA 4G1CA 3HADA 1JI3A 3SVZA 3IIKA 2VKQA 4ZDJA 2I62A 3ITKA 1ADBA 1F6BA 1W34A 1LWNA 2V45A 1G6OA 3RVKA 3BREA 3T06B 1HLPA 1E20A 1PTKA 2D0PB 1QIGA 3B85A 3L4SO 1CVRA 3OFNA 4DEYA 4EHAA 5JD4A 3FOAA 2ICAA 3MLAA 3NYIA 3PRHA 4JOQA 3EUFA 2VYCA 1LNQA 1OX5A 4HEQA 4DLBA 3QHQA 4IOJA 4C3OB 3W5HA 1R6UA 3NV9A 3G0HA 1T8YA 1N1DA 5LFAA 4LI3X 5EKSA 3ESCA 4MV6A 4C2UA 4YCAA 1WAMA 2YXDA 1JSXA 3UT5A 4EG7A 2BBSA 2WYHA 1SUEA 4HX5A 3MJEA 1ZIOA 4YLGA 3ZE6A 4WNAB 1YQEA 3G59A 2XDQB 4HH4A 4YMTA 1ONOA 4QDTA 2VAVA 4Y2PA 5BV8A 2OO3A 2VFAA 1DKQA 3AHIA 3IERA 4RJ2A 4UEKA 3QLTA 2N75A 5U1PA 5A62A 2DUUA 2QTTA 2Q8NA 3TOCA 3CUYA 4YJDA 3EGOA 2VQFB 4A36A 4IR7A 3W1EA 3AIIA 1E0DA 2YJGA 3NLLA 4BMCA 1K7SN 3GT4A 1UQTA 4C0JA 3QEAZ 1Y1PA 3EQZA 3NAMA 4F2WA 1PT6A 2J0UA 4K6CA 3ZU3A 2EYUA 4D9FA 4OJNA 4ZKDA 1M6NA 4EMUA 2ENWA 1EWRA 1Y6GA 1FDVA 4ZKEA 1JFSA 3MTEA 1M6WA 5ECYA 3BIFA 3K0SA 1N78A 1PJBA 1M8KA 2C9BA 2D2XA 4WKPA 5FYDA 3WRWA 1ORRA 1XYYA 2RBKA 3MMZA 3PK0A 5DV9A 2VATA 4A1FA 2IYWA 1P1IA 3LUHA 4G86A 5DM4A 3CN9A 2B94A 4AIIA 1KZ4A 1JBKA 1GGEA 4MW7A 3G0OA 1FDWA 1GKKA 1OLXA 3COWA 4W8HA 4KUEA 4PTLA 3LWBA 4DV5B 2FPIA 3IBYA 4Q1FA 3TBKA 1GRQA 5E2AA 5AW8A 5K0JA 4TMKA 2HADA 2X0RA 3EZ6A 1GHTA 3VTZA 1AK9A 1G1MA 2FW1A 2H7CA 1AHPA 3SKYA 4CODB 3GPCA 1JYFA 1RLMA 1JALA 1N75A 3LVQE 2WAMA 2W98A 1AN9A 2C4WA 3E3AA 1T8SA 3SJBA 4YQZA 2CBGA 1KMMA 1BVYF 3GLKA 1XO1A 4BVLA 1MXHA 4TKMA 1OASA 3OPXA 8OHMA 1AJEA 2ODQA 1RXIA 1UC8A 2JJ1A 1E6MA 4OGGA 1QS0A 1FC0A 3ROKA 4EI7A 3I2KA 3W1WA 1V48A 2AB0A 5F12A 1UXOA 1PF7E 4DS3A 4EUHA 4YV2A 3M4ZA 2G8NA 1UBLS 3HKCB 4DSOA 1YKGA 2M6KA 3H99A 3MA0A 2QN7A 4OQLA 4WN9A 4A2QA 4CG2A 5C7OO 2H4WA 3WJ1A 2F55A 3QVLA 1JLHA 4C4PA 3BZWA 1RXUA 1B6RA 1IEWA 1MXFA 1T1GA 3ENZA 3KNZA 2GLXA 3I2GA 4JSRA 2B1JA 1UOPA 4PBTA 3ZN2A 4D56A 3G49A 2HQSA 5KMGA 4JI2B 4DNPA 1KJZA 2X22A 4BBAA 1C7QA 1XR3A 2B4KA 2WY2D 5AJUA 2EWVA 4INOA 1XMIA 2BT4A 4HFRA 4S1PA 4TSFA 4UAGA 3N07A 2HJ9A 4NV1A 4OHVA 3E0XA 4QWMA 1YA8A 5ALLA 4NMWA 4EPXA 5CXUA 3BS4A 1XTTA 4A8PA 1G2QA 2QAJA 3RT1A 3K2IA 1Z6ZA 3V8EA 3VH4A 1JLSA 1QO0D 2QSJA 2ZRBA 3AEYA 2WF9A 4HLQB 1N3YA 2XNSA 4XUCA 5BMOA 3F9RA 5ADVA 3U6BA 1NQXA 3K96A 3CSUA 4IRMA 3JQ9A 4D92A 1USVA 2GDZA 1ZMTA 3H13A 1DTWA 3SHQA 4AUNA 4LF4B 4KK3A 2VPZA 4PQGA 3A1TA 4FIDA 4IMPA 1I5RA 5LZ8A 2AKAB 2P27A 3ABSB 3MGKA 4RVNA 4CR8A 4D0GA 2X76A 1CUFA 5LKRA 2IYFA 3DBRA 4L51A 5JZVA 3P9RA 1PV2A 1PX0A 5K45A 1XZIA 1JAZA 2OPHA 2Z9CA 2OM2A 5KS2A 3AEXA 2BVNA 4OQNA 4LJSA 3B5JA 4RYDA 3DL2A 3E7DA 3HCFA 4U02A 2OLKA 2E49A 4QLOA 1VI2A 1U9ZA 1WCYA 3R0JA 3UJ7A 2PWBA 6PFKA 1ZU5A 3JQ8B 3OWOA 3LIPA 4RW0A 3VC1A 5AKKA 3HCBA 1WZ2A 1CY0A 4KIUA 4RD3A 3ZCSA 4L4XA 3KSMA 3T9DA 2CC2A 1SQ0A 4AY4A 4M1SA 3U3XA 1ADFA 1KMNA 4KRGA 4PR3A 3CY6A 4CKWA 1BYIA 1E7QA 1LKZA 2GWHA 1VJDA 2Z2KA 1UBNA 5LMNB 2EJWA 1L7VC 4DLWA 5CA1A 5LMCA 2RI1A 2YFYA 1H2AS 3FLBA 2CBZA 4WXEA 2HSDA 1FRQA 4P82A 3RSCA 4TYPA 3NOQA 2GJAA 2HIMA 5CLFA 1OLXB 4G9BA 2QD3A 1N8NA 4RS4A 2CFCA 5AH0A 2H4JA 3RC2A 1DJOA 3EJWA 1N2CE 1SCQA 4F71A 1PSDA 1ZNXA 3AKYA 1TMGE 2XNDA 3AP2A 2V7VA 3V7FA 4KIGA 1KJQA 3ED5A 3ZDQA 4JI5B 3D8RA 2P62A 1J2RA 2QXUA 2AQIA 5DDIP 3KKMA 4FFPA 4REQB 5T8KA 3LF1A 1G8PA 1E7MA 1W96A 2IEYA 3F5DA 4UVHA 5CXXA 3RYCA 1PTJC 3RLIA 2BWJA 2WSBA 1YVPA 3PEUA 2VP2A 5K0TA 3Q2IA 4DM3A 1KO8A 1KDZA 5DGTA 2RHBA 1VXOA 2NO5A 4S04A 1RRFA 2FKNA 4HCJA 4PWZA 1CRQA 2W0MA 4H35A 4FX2A 4Z86A 1BVRA 2OHOA 3VSEA 4DV0B 3UW1A 4E2XA 1CT9A 4P1ZA 4WGFA 1SC6A 2O2EA 4WRRA 5LCXA 4EBFA 1G6HA 2E87A 5AI9A 4CDNA 4JI7B 2RGRA 3P9ZA 4LXHA 3DE1X 4HVCA 2NNLD 4Z1MA 1XX6A 3X1MA 3NTRA 2AR9A 4HNAA 3H19A 1E9DA 4UNSA 4WN9B 2ZUEA 2VT7A 2FN4A 1N6HA 1TIPA 1D09A 5DO9A 3JQBA 3VO2A 1L6IA 3M4NA 4PG5A 4EKIA 4LV6A 4TKVB 3W2IA 3SBOA 3PEFA 4EYSA 4IJQA 1T3TA 2IY7A 2X0NA 1DC3A 3D31A 2NXWA 2PZLA 1HRKA 4PIVA 3NWOA 1O0CA 2FDRA 5FTMA 4KRFA 3AFHA 4HDSA 3KKZA 3WYCA 4Y1EA 2SNIE 1W5BA 4CTMA 2BGMA 5J40A 3VDNB 4CFYA 1MQAA 4KTVE 3BTUA 4X7RA 2IODA 2EYQA 4KN5A 2HIAA 2J45A 1PYGA 1WD5A 1ZN2A 3AF4A 3E35A 3LX8A 3PEVA 4R40A 5ICMA 4BO2A 1KGSA 1CIPA 3GJYA 1RCUA 2WM3A 4EZIA 1L7OA 2IDZA 3GQVA 2XOKD 3LQ4A 3BQNB 1X1QA 1C0KA 2VWHA 5I45A 1E1MA 3G0GA 1FP6A 4DDWA 2QZ4A 2A9QA 3RB8A 1NVUQ 4RUKA 4Y2QA 3AERA 2IITA 4XIYA 4XSVA 5AHWA 3NVMB 3DLAA 3P4UA 3KO8A 2ZVDA 3LVBA 2O3QA 1ZESA 2PK3A 3FKSA 1RHQA 4KXYA 3NM6B 4O2BB 4TM7A 1QLWA 3QMVA 3AIKA 3PBKA 3DSRA 2PD4A 4EAAA 3M2PA 5C53B 2WU1A 2B2CA 3VI4B 4DCMA 2JGEA 3N0RA 4WCVA 3LUJA 1QYXA 2ZUDA 4R16A 3A1UA 1RABA 4ZCQA 2AZDA 2H92A 2HDHA 2OQ2A 5DHFA 4EG0A 5CBPB 2PE5A 1C30B 2NUPA 2PGNA 5CA1B 1RWWA 3K3PA 2R00C 2HWKA 4WL0A 4PAMA 2FW8A 4BX3A 2YJ3A 1V1RA 4QBHA 1L5KA 2P4HX 3MBIA 4GEGA 1P0QA 5CA0A 3TJRA 1EX6A 2IRWA 1NZJA 1BCSB 3Q85A 4IOMA 1V8DA 2CE7A 1RD4A 3TMYA 2Q3CA 2E6KA 3K1TA 2QRJA 3MGBA 3N7UA 2B1GA 3DMTC 1D4FA 4WTOA 4X95A 4WN3A 3F8SA 4E2FA 5AVYA 4OMDA 3KR0A 4XEUA 3MUNA 1M2KA 3BKXA 2ANCA 3JRXA 4YFYA 5FJJA 5KDOA 2PXXA 1RKBA 1EUYA 2YVLA 1JVBA 1SBTA 1P9LA 2L82A 3UPDA 1ZCFA 2PUEA 2PKXA 4ER3A 5A1JA 2DR0A 1G17A 1LZLA 4LVNA 5CYFA 4X1IA 1M8GA 1YBAA 1AV7A 1E99A 3TH5A 4L4SA 5FWYB 1QCZA 4CLXA 1JTVA 1SB8A 3ICCA 2J48A 2QX4A 5JDCA 4WUTA 1JZSA 4OHKA 4HNAB 3ADKA 4P9NA 1P91A 3BCHA 1CUXA 2PS9A 1F06A 3K0BA 2PFGA 2WIGA 1SKQA 4W8OA 2L19A 4A0FA 5CFZA 2B4RO 3CRNA 1NM5A 1GZ6A 1IG3A 3BFXA 3SGLA 3VMMA 5DTEA 4LMRA 3VZPA 3ESYA 4L4ZA 4HF7A 1CDOA 1Z62A 4TPKA 2ZT6A 4P3PA 4OMCA 1JNXX 3RIGA 1HDRA 4BRWA 2Z4RA 2G8LA 1MX5A 2B98A 4QDZA 5LP6F 4IIJB 3C4JA 1QR2A 2WHYA 3ZDBA 3AOEA 1F9AA 4ROSA 3ZJ5A 4YT8A 3EY4A 1EA7A 4CG0A 5AHOA 1OPRA 1J33A 3P19A 1OBOA 2HJRA 3C97A 5I9MA 2QN3A 5I4BA 4Z2YA 5I7UA 3LHKA 3ME5A 5JZ9A 2VKTA 1UK8A 5KSYA 5C5IA 1R6AA 4BKOA 2HV9A 3DL4A 2ZB3A 4YLYA 4FQ5A 3RSHA 1TO6A 4JP8A 5DWDA 1SOVA 2AXPA 4G09A 3E9DA 1BS2A 2L42A 4ZEXA 3ICOA 1JQLB 2E4AA 3VJKA 3VMFA 4Q39A 1JG7A 4GRAA 3VYUB 3THSA 3NP7A 1U2ZA 5IXJA 5HJ5A 1E2GA 3AERB 3SHTA 2MCFA 4B31A 2GBIA 3DLHA 1NTRA 4Q7MB 4X24A 3MINA 4NBWA 3ANLA 1WBBA 1U0EA 4X6LA 2LR0A 3T7RA 1XZCA 5JNSA 5EXDA 2MTBA 3S2GA 4E2WA 1CY7A 1E77A 4R0VA 4M9RA 3PUYA 1ADYA 4ZQCB 1IHOA 3G68A 3VKWA 3OX4A 1PE0A 5DBFA 2C4UA 4IV5A 1Z4NA 1C9EA 1KS2A 2JGKA 1D6NA 1WR8A 1JWBB 4H7EA 4IMRA 5LQSA 2ONJA 4X85A 4K40A 4KHPB 5JYEA 1KI4A 3GEMA 1FXWF 1RWKA 1U11A 2XUAA 1V16B 2JH9A 4MW5A 4F3CA 1W85A 2NUPB 1MH9A 3KBBA 4UVIA 5T4HA 1GXSA 2CNDA 4IXMA 4AYWA 1BW9B 4KFUA 1M2JA 1N3IA 2YHAA 4PFQA 5G0WA 4CE6A 5C81A 5DTMA 3KWMA 4NE2A 3FUUA 5EWLB 2XVXA 2PGXA 1E4EB 4EI9A 3HBFA 5JQWA 1QHEA 2R7KA 3BM5A 1YAJA 2RKBA 1XAGA 4FCVA 3SEZA 2AYYA 3JQRA 3NFRA 2BD0A 3NHSA 4FS8A 3VDMA 4AWBA 3AJEA 1GU0A 4I4TF 3AZPA 3RVRA 521PA 4BS9A 2H4YA 2OXRA 1CY1A 1U98A 3LK6A 2GTPA 4F2HA 4J0DA 3LWDA 3T3OA 4HADA 1CVLA 4X1IB 3CLSC 1PVVA 5FPPA 2GGSA 3M1AA 2I6UA 4XYLA 1VPLA 4QQFA 4U7PB 1K3FA 3KHKA 3HN2A 2KLBA 3GFFA 5B1SA 2WZCA 4PN7A 4XZ3A 3ZD7A 2VWPA 3L7YA 1TQ4A 4LOKA 5BN4A 1NRWA 5DOZA 1OIXA 1NVVR 1W48A 1WDLA 2IKQA 3BE8A 5KC8A 2MR5A 4YP7A 4OY3A 5G2OA 5JHHB 3KVVA 3ZTYA 2VDWA 2IELA 3ZVRA 3PDUA 5E9AA 3V4RA 2XWJI 2PV7A 3NHLA 1D8AA 3E4CA 4BU1A 4IZOA 4PIPA 1UIMA 3OIYA 3JARB 1WM1A 3PHIA 1ZICA 4BNKA 1EFAA 1J0XO 5LVAA 3H75A 4ND1A 4DGQA 1HG0A 3ENWA 4FT4A 3ZVLA 1TT5A 3ZWKA 4P6VF 3IO5A 4G4GA 2IYYA 1SY7A 2RONA 5FFNA 2NU8A 1LFAA 2O14A 4R6WA 2OWDA 3WGUA 4UD6A 4CL3A 5LDHA 1UZLA 1VCNA 1BWRA 2Q3MA 4F3YA 4JODA 5JWRA 3U44B 4ARZA 4RZUA 3ZVKA 5LLTA 2YJZA 1H2EA 4FS3A 2J0SA 3VPXA 2JFZA 3BX1A 5BNFA 1QG6A 2BFEB 2Q1UA 2DWUA 3UHOA 1MC5A 1RZVA 2QLFA 1CFZA 1NW9B 3JAKA 5TC4A 5DASA 4LMAA 1RJEA 1QX3A 3EQ8A 5AICA 3ZBPA 4OG2A 3N39C 5SY4A 2B7BA 1Y6ZA 2E21A 1JFLA 1XDZA 2XB4A 4LK2A 1JP7A 1N9GB 3MINB 1VTKA 1GPYA 3KBOA 4LX0A 2CYCA 3UOWA 3UKDA 1YVEI 2NO1A 2H0RA 4B4VA 1T4CA 4R01A 2XXAA 4O0MA 2X8AA 3H6KA 3OSUA 1IE3A 3VHLB 4RVFA 4AMGA 1U63A 4CKEA 2GB4A 2HJWA 4YAGA 4PYNA 4RLFA 3TLYA 2I22A 4HDOB 1JLKA 3D0KA 2P3OA 1AU9A 1JJ7A 2VDPB 3KXLA 3O0TA 2OBBA 2PX2A 1Y8QA 2R96A 4HRAA 3LA8A 2PLWA 3S2FA 3TVDA 1DFGA 4Q05A 5K0LA 5CD9A 4FINA 1KDVA 1BH2A 1K98A 3OJ0A 5IEJA 2H1FA 3F1KA 4RO0A 1I32A 1C1DA 2DWQA 2PO7A 1L2TA 5FAXA 4G24A 3VYRB 5KJFA 4LKRA 4TKUA 3VR5H 2PBZA 3SHVA 1OYYA 3KR9A 3UHAA 3WL8A 4D9MA 2YTZA 5FOSA 1OJLA 3LZCA 1YZFA 3M1YA 2BFBA 1I8TA 1V3TA 2D7JA 2YWXA 4G8JA 4JC0A 4L72A 1EGMB 5F5XA 1CJBA 4M4SA 4MS4A 1Y98A 4FT2A 4M0CA 5HNKA 4AS1A 4B5KA 4KR6A 4YI5A 3MJRA 3TQOA 1RXCA 1HSOA 3WFJA 3RC3A 3S1AA 2ODTX 3GVHA 4PAOA 4BKQA 2H4ZA 3AHDA 3ECCA 1Y5IA 3N2EA 2VF4X 1UJ5A 3HN6A 4DXDA 1W5TA 1WY5A 1P62B 1SBQA 2WHPB 1VJRA 3JVDA 4BGDA 3HCOA 5J4HA 5E95A 4L8YA 2ID9A 1ZGGA 4BTEA 4Q7QA 4R1UA 1U0FA 3ST7A 4ALJA 1BXRB 4XCQA 1YOVA 4KI0A 5JZBA 3I04M 2X8LA 4Y1RB 1M9NA 2WWVD 2NYRA 3OLXA 4NHOA 4CHGA 3F6CA 3FHJA 5KREA 5JPDA 3ZUPA 3D6FA 3R9KA 3S99A 3U13A 1YQXA 3NYWA 2BMDA 2MWMA 1Z8NA 4IM7A 2I6FA 4RKFA 4M53A 4BNTA 1OXXK 5IC6A 3UZUA 1UQUA 4RETA 1CUDA 4JJGA 3NTUA 3KT3A 4TMYA 3A2MA 1RYMA 2J5RA 4HYYA 5L53A 3C3MA 1UZNA 3VH3A 5GM1A 4M99A 2C4TA 2G1PA 4QPJC 1OB2A 1VKOA 3TINA 2D5AA 1X80A 4UMEA 1IBKB 1QZXA 1U7UA 4R1NA 3NR2A 2D54A 4R2XA 2OFOA 4A2WA 5KOHA 2XUKA 3FN4A 4E4TA 1EUDA 5CPBA 1U3TA 4DFDA 1M34B 3PFHA 3SE7A 3VTFA 1KXZA 3HA2A 1M72A 2X6QA 4ALLA 4C7VA 2C2XA 5L7WA 2FMFA 3OE7A 3ABOB 3ZIUA 1ZR2A 1MTZA 1PT9A 3O4JA 4R31A 4GD3Q 3T0IA 1GTRA 4AS2A 4NNPA 4FC6A 3DZ8A 4MVJF 1XXHA 1IY2A 3GEPA 4KRYA 3O4GA 4LC1A 5IDVA 1A98A 3C6MA 4X7MA 3U49A 2QL7A 4UTVA 1YONA 3S8MA 2VT3A 3D1JA 2Y1FA 1RZRD 1CEEA 3QF4A 3DUFA 4WY8A 1P17A 1XN4A 4GC9A 2PQ2A 1UBJS 3FLAA 2ETXA 3HEBA 4BZPA 1IB0A 3TSCA 5MGBA 2FN8A 5HBGA 1PYOA 2EHJA 5JSHA 1C7FA 1NQAO 4K9MA 2GZRA 1RXWA 3T95A 3M6IA 4MEAA 3CVJA 1GQSA 4H4DA 4TGLA 1X9GA 4KGZA 4W63A 2XWBF 5F33A 4FWTA 4DV1B 1NQOA 4QT0A 1Y3DE 2LUOA 2AR7A 4P0QB 3KJZA 3WTCA 1C3VA 1W4ZA 2JS7A 2XNKA 4Q3CA 4Q9KA 2Q1TA 1NVBA 1YZLA 3I9LA 5AM0A 3ROZA 1J23A 4LSZA 3AEQB 5ABPA 2Q4RA 3DAPA 2XAAA 2ZSUA 2A9VA 3Q0IA 4AUEA 4BGIA 4TMXA 3V46A 2F8TA 3U7HB 1JJFA 5L3SA 3C1TA 1R2QA 1Y9JA 4EG1A 1XZBA 4OI4A 5KDDA 3IJ5A 8ATCA 5B4VA 4EHHA 1XK7A 4G63A 4QUBA 2CDNA 4E3WA 4ESVA 1MRNA 5K6RA 1OMOA 1LSUA 1CG6A 1Z4OA 2YQ5A 2CDCA 4JLJA 1JB9A 1A5BB 2WSSD 2C78A 5ED0A 3GLIA 5J2UB 4BXOA 1M76A 1TTPB 2HT6A 2RARA 3OH8A 4RA6A 4X90A 2ZT7A 4YP1A 1X2BA 3RD5A 1PTJA 2PGDA 1RCTE 2PMFA 3FR7A 4FNGA 2PT6A 4GQIA 3MN1A 1B73A 4X1YA 5ALDA 1OFGA 3DMFA 1M6VB 1YOVB 1SIWA 3FPEA 4JQYA 5JSYA 3UH0A 5IJ9B 2BP7A 2EP8A 1WHTA 3AU8A 2XD4A 3LE8A 4JFAA 5AVZA 1L3BA 5KWIA 5JWHA 1LEHA 4LECA 4JJKA 4KMOA 1BX3A 3K32A 3OM8A 4YV0A 4LPSA 3DLTA 2XUGA 1N32B 3N53A 1DU4A 4M60A 3TSWA 3BH0A 1OI7A 1ZKMA 3HLKA 4JL6A 4Q48A 1TU4A 4RADA 5E4TA 5J5CA 3DDCA 3DBLB 2IYLD 2YV1A 3H9CA 3VU0A 3ND6A 2ZYWX 4MUMA 5GY7A 3EW7A 5C35A 4NZOA 4PHCA 2C04A 3U4QA 1U0NA 1L1QA 1WB4A 2WU3A 3C48A 1ODSA 1RWPA 4Q0MA 1QX4A 4W7HA 3QKSA 1NBMD 5JMOA 1P18A 2X5NA 4X71A 5EXPA 4AYXA 3X1YA 5DNWA 1LU9A 2KYRA 5AXDA 3ZWNA 5JQGF 4TZKA 1GAXA 1Z28A 3VU9A 2J41A 4RTQA 3ESQA 3ZE1B 1YB2A 1N0UA 2W2KA 1Y3HA 4DHWA 1OD6A 3GB9A 2AC2A 1KERA 2GERA 4GX0A 4I9GA 4MR7A 4BE4A 4OHFA 2W22A 3KT8A 4BUJA 2EAUA 5EWJA 3S3TA 4KJXA 4BJ6A 2P9HA 1NW3A 2Q5HA 2ZT8A 3GY0A 1QF6A 4QQNA 5ED4A 3VNUA 1I7PA 2FNAA 2EW1A 1GN8A 1NUQA 2CLSA 2OP1A 3NBMA 3DUFB 4HBGA 4EEKA 1GVHA 2FRVA 2A4KA 2Z83A 2BEWA 4FDUA 4JU8A 5DXAA 1T1JA 1FP4A 2J5BA 2HCRA 1M33A 1NJ6A 2O23A 2XMQA 3QVSA 1RLIA 4G8DA 3I01A 1V71A 3BZBA 5A5FA 3OQVA 2UUCB 2XZLA 1BXZA 1YQTA 3AQIA 2QROA 1X87A 4QSMA 3T5GA 1OXKB 4F4JA 4DXHA 4GPEA 4G5RA 2VR1A 1W581 3LW8A 3GUVA 4WZBE 4JLMA 3THRA 1X15A 4MQ6A 4BCBA 2ZWPA 4ODIA 2WR8A 3KWJA 3OJWA 1L0BA 4G01B 3S55A 4IJWA 5M34A 1I2DA 1G5RA 1MA3A 4TTPA 2BEVA 3QG1A 3F6RA 4IOLA 3ECSA 1EUCA 3GP3A 3HEAA 3I32A 3I9V6 4FWBA 2QTVA 4JH0A 4OSEA 2R00A 3G6KA 1CB7A 2C07A 4H31A 5HMLA 2GHQA 3CCFA 1MB0A 3UMFA 3UWOA 1QE3A 1IY0A 1CZHA 2HLHA 4JBIA 1R6TA 3STVA 4NNOA 3TAHA 4DLAA 3NWBA 1ORHA 1CWUA 3EGEA 1R8YA 1VP3A 3E7PA 1N8SA 5GJVC 3OSZA 5LYJA 3FUCA 3LRPA 4E7PA 3Q8LA 3UMCA 3GK3A 2MSCB 2IW3A 3DMTA 2JNWA 2O4UX 4LI0A 4TYNA 5J4YA 1OFVA 3Q6MA 5HKAA 1SXGA 2DY0A 4XW2A 5LQMA 2O2HA 3OIVA 4M6WB 1QPZA 1HL7A 3VM6A 1NZFA 1VB5A 3V33A 2IEGA 3T9BA 1SKYE 1A8PA 2P41A 3FKJA 5HILA 2WUWE 1HA3A 1G16A 1OV6A 3AUFA 3GXBA 5LZ4A 3UOGA 3UA3A 2M9MA 2FLVA 2P78A 4B71A 2P1DA 2ZSIA 1T3GA 1KMCA 4HB2A 3IKVA 4FB4A 1J0CA 5HKKA 3MMSA 2A9RA 2J3DA 4E0BA 4NNJA 4TS4A 4FFBA 3VKGA 4DBLE 3TVTA 3OKCA 4BN4A 5HQJA 4C87A 4HG2A 4QGGA 4LE2A 2C5FA 3GVIA 1M5UA 3QQPA 4L57A 1EU1A 2JGDB 4RGBA 1QB7A 5DOVA 3RM3A 4PZDA 2ZUBA 4W1PA 2WD8A 1BVHA 2I3BA 3GHHA 2OCGA 5A7HA 1U7TA 4X8LA 3ZBQA 2QRMA 5KQRA 4K9PA 4CMEA 3UHFA 4E11A 4Z4HA 2B78A 2P5SA 1TJ3A 2Y05A 2XVYA 4LOLA 2B8WA 3ZI7A 1TZKA 5JJBA 1PS8A 2BUBA 1KP3A 3HKEB 2PT5A 1Z8FA 4KLNA 1PDOA 1RWOA 4GKJB 1H22A 4FHCA 5EP3A 5JATA 2ID7A 4QYWA 2YXEA 4YRJA 4IYJA 3EEOA 3DCJA 2AI3A 2AZ4A 2QM0A 2JD0A 4WPGA 3W7VA 4QECA 5AYVA 3TE6A 4UOEA 1B6SA 2WDPA 5ALOA 4YRBA 3PC6A 4DNOA 2AQKA 6CHYA 5CFMA 1NSTA 3AJAA 2PMBA 5FOWA 4EA8A 4TQUS 5CYOA 3A9CA 4RTKA 4C0KA 2X8JA 1NF3A 3H7AA 5JVDF 4DY4A 1JG4A 1TGYA 5EZYA 1P4RA 1Y7HA 2A94A 3RAFC 4IICA 2UZ3A 1EB8A 3OT1B 4Q12A 5GIPE 2FOLA 1V26A 1WUIS 2Q9CA 5L4SA 3U4QB 1KAQA 2BEJA 1E2PA 3FPCA 1I1OA 2EZ8A 3TRDA 2H1CA 1M8FA 1XEWX 1UANA 2ZSKA 2CKDA 5FPKA 4DRYA 3WGZA 3UMBA 4BNFA 3CHYA 1TZJA 3Q98A 4YQFA 1XTQA 2F9MA 1S5PA 3KSZO 1KWKA 1UMBA 1XDUA 2HPVA 4L8LA 4PGMA 4IDBA 3IILA 3FYTA 4FX5A 5K4GA 1QP4A 3QBDA 2Q7OE 1DI0A 1YULA 3R3JA 1SCJA 4P4TA 4DUYB 4KREA 3I6YA 1AQYA 1ZUHA 2XBLA 1KJ9A 3CQ9A 2M32A 1XRMA 1P4GA 1VLVA 2QTVB 4FE4A 1Z4LA 3K1ZA 3DP9A 2OOSA 4ZOLA 5BOVA 4HWOA 2IY9A 2P3QA 1RP7A 4E5NA 2IC5A 2WWHA 4R9SA 4CU5A 5CM9C 2IDJA 1LY1A 2F1KA 3LM8A 3OTHA 2I4MA 3I52A 1UPUA 3BOSA 3E84A 4LZJA 4HQNA 2FA9A 4TTTS 5AM5A 3LYLA 4K2AA 2A1TS 3T5CA 2QVLA 4QFCA 2O7SA 4LDNA 1N34B 1ORTA 3TTUA 4KMSA