1OILA

Structure of lipase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
320
structure length
320
Chain Sequence
b'ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPASE
molecule tags Hydrolase
publication title The crystal structure of a triacylglycerol lipase from Pseudomonas cepacia reveals a highly open conformation in the absence of a bound inhibitor.
pubmed doi rcsb
total genus 124
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1996-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oilA00
5AICA 2J4CA 1MX9A 3AIMA 5CT6A 5AKKA 3NGMA 5CT4A 5AH0A 3ESDA 2G5TA 5ALUA 2OAEA 3HXKA 5FP0A 4KE9A 4LYEA 3FCYA 3FYTA 1FFAA 3IBTA 1THGA 4ZGBA 5AKZA 4E46A 4UBMA 1IUNA 2QM0A 3UMJA 1KU0A 4B0OA 4EUSA 1VXRA 3E1GA 1WB6A 3HEAA 3I1YA 1VZ3A 5ALVA 1ORVA 2O2IA 5D7BA 1UK8A 5K3CA 1CUSA 4PQEA 1KEZA 2WTMA 1QJ4A 3FSGA 4KR0A 1ODSA 3VJMA 5T4HA 5FOQA 1EI9A 1YSCA 5DYWA 5ALYA 4MEAA 4X94A 4S0XA 4Y7DA 4IH4A 1MNQA 1QOZA 4H7KA 1YR2A 1HPLA 3WKCA 5LZ5A 3SX4A 4J3JA 4OU4A 1XLVA 2D0DA 5EHXA 4LYDA 4BDSA 2I78A 5JZ9A 2JBWA 4X6YA 4GBGA 2O7VA 2V96A 1HL7A 2FJPA 1WB5A 4INZA 4EY7A 4G9EA 3VVLA 5CXUA 4DNOA 4UPDA 4E11A 3H2JA 4L9AA 1X2BA 5D3ZA 3V1NA 4MWSA 1YAHA 4PO3X 1C7IA 2GBGA 5AKLA 1N8SA 1FSSA 4BTLA 1ODTC 3HJUA 1R1DA 4WFIA 2WJ3A 5AK6A 3GA7A 2CUTA 2EDAA 2PSEA 1CLEA 2DCMA 1ETHA 2P8SA 3QH4A 2PU7A 4C87A 1GPKA 4QDXA 1SCQA 1XQXA 2H1IA 3G9ZA 1LLFA 5JD6A 3FLAA 4FFVA 1JMYA 4Q3OA 1MN6A 4BP8A 3VJLA 5LYYA 3H18A 3G7NA 1DQYA 5DTJA 2V97A 4J0DA 2JGFA 4X97A 4GXNA 4PSDA 1CPYA 3IUJA 3A2NA 4FBLA 2PUHA 1THTA 4H18A 4ROTA 5LZ8A 1UOOA 4OB6A 2GZRA 4QLAA 2BFNA 3G9UA 2NW6A 2PX6A 4H7HA 2QUBA 3EF3A 1MX5A 1QIHA 4FLMA 1AKNA 3FVRA 2OCGA 1PFQA 1QIKA 2OQVA 5JALA 4JUIA 3L1HA 4FFWA 3WK7A 2GYUA 4Q3LA 5E4TA 2V98A 1BRTA 4WDQA 3ANSA 4BRSA 4AZ0A 4OYLA 2GYVA 2OQIA 3UUFA 3A2MA 1EINA 4L72A 1H2YA 1FFDA 3FNBA 1UWCA 2X5XA 1UK9A 2AJDA 5JAOA 1XZGA 3NOXA 1EVEA 4CG1A 1TAHA 4CG2A 2QS9A 3C6YA 1B6GA 3DEAA 2QUAA 3ESCA 5F4ZA 2WIGA 5AM0A 3ESAA 4PSUA 4BRZA 1J06A 1AGYA 1ZIYA 4BC0A 4B85A 4J0HA 5ALPA 3G0DA 1LNSA 1W76A 5HK9A 5A62A 1U8EA 2W6CX 4GWLA 4GECA 1GT6A 3M83A 3LCRA 1S8OA 3WYNA 5ESRA 1RP1A 2HFKA 2ACKA 5BWCA 5AKEA 2ROQA 2WFMA 3DYIA 1N5RA 2XE4A 5DJ5A 3WWCA 3DKRA 1EDBA 2B4KA 1FJ2A 1H2WA 1EK1A 2HIHA 2OGSA 3M81A 3AZQA 3V1KA 3WKDA 2CZQA 3FVTA 3IIIA 3D4LA 5JAPA 2PKYX 1EDDA 3CN7A 2YASA 2OLEA 1ZIXA 3DDUA 3RARA 1ZI8A 3W9BA 2I03A 5C81A 2VT7A 4Y2XA 2WU3A 1ZD2P 3BXPA 4W9RA 2QXUA 3IUNA 4RNCA 4C01A 1DINA 1Q0RA 2XMRA 5K3DA 4X6XA 1UOQA 1TRHA 3H2HA 2HL6A 3STXA 2ONCA 3DL7A 4U2DA 3R3UA 3C6XA 1XRQA 1G42A 4MQLA 3RM3A 4JYPA 4Y9SA 2CKMA 2DHDA 3JWEA 2B61A 4G1FA 4X71A 3WK5A 2ZYIA 5LKAA 2XUIA 3ED1A 5T4FA 5LZ7A 1R3DA 1CQZA 5I9IA 2XMSA 1HKHA 3CN9A 1IVYA 4BCBA 4CG3A 4HRXA 4KAJA 2WLSA 2VSQA 2R8BA 3BE8A 5CT9A 4Y2VA 2HU5A 4G5XA 1WB4A 5BV7A 3E3AA 1VZ2A 2QRUA 4N8SA 3DS8A 1ZICA 4EY8A 5CT5A 4IH9A 5AOCA 4W1QA 1MT3A 2Q0XA 1TCBA 4AB1A 4OU5A 1I6WA 4MYSA 3MGAA 4MXDA 4JEIA 3ZLUA 4X85A 2WUFA 2ZJFA 4DMCA 1DTEA 1BEEA 1EB9A 1W1IA 3CCBA 4Q34A 2Z8ZA 1AMNA 4A5SA 1ZD3A 1XZEA 3WIOA 3H04A 5KWJA 3BIWA 2GYWA 3D7RA 3BL8A 3I6YA 4AO6A 5I7UA 5DNUA 2WSLA 1UT6A 4OSEA 2VTVA 4B80A 1P0IA 1QGED 5AI4A 1DWOA 2WIFA 3WZLA 4I4CA 4NMWA 2DQYA 3OTQA 4UFOA 3MUOA 5AM3A 1BE0A 1D07A 1AZWA 5JYCA 3D5EA 5T4EA 1CUYA 5FXMA 3KDAA 5AM4A 3WL7A 1UKCA 3F96A 4K6HA 1K5PA 1JI3A 1QIGA 3IURA 4ITVA 5CH8A 5IVIA 1CUUA 4FKBA 4TPKA 1XZJA 2R11A 3GROA 1MAHA 3U0VA 3WL5A 4ETWA 5AK5A 3PUIA 4UHBA 4DTCA 3TGLA 3L1JA 4J0JA 4IHAA 1HDEA 2WHRA 1BCRA 3I2IA 4UHCA 1UKAA 4X3CA 3QBJA 3VISA 4CIBA 5HF8A 4HAIA 5K5EA 3GUUA 3G8YA 5FPQA 4K6KA 5KREA 3AILA 4JNCA 4E15A 1DT3A 2FJ0A 3WL8A 3H17A 1DU4A 2BAGA 3G0IA 1DWPA 1TKRA 3LIIA 3DQZA 2XLBA 1O6GA 2BUCA 2OCLA 3STYA 4UBIA 2WG0A 4QA9A 1XROA 4DSZA 4C4YA 2HFJA 2OXEA 2CMFA 5CT8A 1AC5A 3STUA 3STWA 1XZLA 2RONA 2E3JA 1CUXA 3OG9A 1P0MA 4BAUA 3VKFA 1GXSA 2XUOA 1J2EA 3NWOA 1GZ7A 4BAGA 2BUAA 2XMGA 1WOMA 3WWDA 4H7IA 4F21A 3QM1A 1CUWA 3C5WP 4XJVA 2W22A 4B7ZA 2WM2A 2B9VA 3WK9A 4C6HA 1VA4A 1BU8A 1ZJ4A 4AN0A 1HLGA 5BOVA 5FDFA 2ES4A 3E4DA 5LIPA 1TCAA 1CQWA 4IQ4A 4WY8A 4DGQA 2BUBA 1CUIA 2Z3ZA 4Z49A 2WG2A 1VKHA 2ECFA 5CH5A 3W06A 5AK4A 4B82A 1HBJA 4A23A 4CCYA 1J07A 3CCCA 2WHPB 3BDVA 4DIUA 4OB8A 2ZSIA 4RGYA 4H7JA 2XUDA 4TGLA 2DSNA 5A7FA 4WDRA 1ORWA 5K3FA 2HADA 5AI9A 3WWPA 4BCDA 1DX4A 2C0QA 2GBIA 5A7GA 3A6ZA 2Y6VA 2WU4A 3KD2A 5AP9A 1MPXA 3I2HA 4F5ZA 4W1RA 2QJWA 3M82A 2PL5A 1GGVA 3RLIA 2YYSA 2XLCA 3DOHA 5ALWA 1LBSA 4X92A 2X76A 3LP5A 2OGTA 1DX6A 4GHWA 3ZWQA 5JD5A 3V1LA 1IZ7A 2WUEA 1CVLA 3PI6A 2VJDA 1H23A 1IUOA 3O9VA 1YA8A 1HQDA 5JANA 3R3YA 3IUMA 1ZGBA 2J4FA 3DL4A 5ALJA 4UBLA 4M0EA 2ACEA 3IB3A 3FAKA 4BE9A 3H19A 1T2NA 5DNVA 1CUHA 2VAVA 4M0MA 3F67A 1DT5A 3OM8A 4WJLA 1CV2A 2WFLA 2OCIA 3EQ7A 3HLKA 4BZWA 2HA7A 3PFBA 4GLBA 5IH7A 5IKXA 1JMKC 1QFSA 1EB8A 5DNWA 5DYYA 3DCNA 1KU6A 4U2CA 1YASA 4W1SA 3DD5A 5E4YA 3O4HA 2VT6A 2QVBA 3R3VA 4UUQA 3ANTA 1F0NA 5HKAA 1W75A 1ZGCA 2DHEA 3ILSA 4KACA 3H0CA 3WQHA 2HA0A 3GELA 4CFSA 1CR6A 4Y2JA 3O9MA 4H7DA 1XLWA 3D3NA 1U65A 2D5LA 3FSGD 1ZOIA 2QXTA 3A70A 4W63A 3P2MA 2AJCA 3I2GA 2RHWA 3DKKA 4FMPA 3NUZA 4LIPD 2HDWA 3V48A 4HVTA 4HTAA 3VJKA 3PDCA 1QZ3A 4O08A 4XVCA 1LPAB 4FBMA 5ALEA 2ZJ7A 4K6GA 5AK3A 3BDIA 1C7JA 3LLCA 2O2GA 1BCSA 2VF2A 1BN7A 4Q05A 4ZXFA 4ARBA 2VJCA 1WM1A 3STVA 3C8HA 5C8VA 3FLEA 1JU4A 4NVRA 1Y37A 3IUQA 2WJ4A 3S2ZA 2XUGA 3PF9A 1CUBA 1LZLA 1XRLA 3A2LA 3IA2A 4BVJA 5AI6A 3TJMA 3HC7A 3HACA 2AXEA 1O6FA 5ALLA 4FNGA 4BTVA 3G0GA 1LPBB 3WJ2A 2QOEA 2WIJA 1R88A 2WUGA 2YXPX 5HZGA 1ZI9A 4CCYB 4BVLA 3G0CA 2CJPA 2JGLA 3I6MA 2ZYHA 2DR0A 2I3DA 5EFZA 5ALGA 4KAFA 5EGNA 5C7YA 3FWHA 1M33A 4YPVA 1A88A 3R3XA 3S8YA 2WIKA 5ALRA 5SYNA 5ALOA 2AJLI 4H35A 2PSJA 4QLOA 5AKHA 1LPOA 5AIBA 1JJIA 3B5EA 4WCVA 5H3HA 5ALKA 2QKYA 4X93A 4PNZA 3I2KA 4NS4A 1Q83A 5CW2A 4EB0A 4G8BA 5AO9A 1LPPA 3N2ZB 1CUCA 4HXFB 1K4YA 1SCIA 2VJBA 3WLAA 1A7UA 3MUNA 3OPMA 4FNMA 4QDUA 2JGIA 5HQ3A 3D2BA 3WWEA 4B9EA 5KWIA 4DMFA 1YB6A 1ACJA 2XB6A 3DJYA 4U2BA 5LP1A 1N5MA 2XQKA 1QE3A 1SCKA 4N5IX 2OGZA 2XQGA 1Y7IA 1AX9A 3LS2A 1TK3A 3WK4A 1LZKA 3VDXA 3WK8A 3FBWA 1P0QA 1AURA 3ICVA 1B41A 3ZV7A 3I2FA 3U1TA 1XRMA 5ALXA 2QJRA 3C70A 3FYUA 2BGRA 1CEXA 4IH1A 3AUKA 3KWJA 3GFFA 4Y2PA 4AZ3A 1OILA 5A71A 2QT9A 3JYHA 2WTNA 4P08A 3M3DA 4FWBA 2Z3WA 3IULA 4X00A 2HA4A 2C5FA 1XZBA 5JARA 7YASA 4EZIA 4X91A 2EDCA 4QWMA 4J0CA 5K3EA 5DWDA 3WKBA 2HRRA 4BAZA 2UZ0A 2B20A 1NU8A 4ZV9A 4A16A 4UHFA 5DTIA 1UXOA 4G4JA 3PUHA 3WL6A 1K6EA 2WHQA 2WIDA 2WQZA 4ZRDA 2O2HA 5JD4A 4IO0A 5CXXA 5LZ4A 3VVMA 2YH2A 5IVHA 5AIAA 5AOBA 3OOSA 4C4ZA 1ZD4A 5FPPA 2PVSA 1CUDA 4FTWA 1PV1A 4J7AA 5JZBA 4CI9A 3STTA 1QIMA 1Z68A 4WY5A 3WWOA 4OCZA 3WI7A 1MNAA 3I2JA 1SC9A 1IZ8A 3OC0A 1CUFA 3KSRA 2CEKA 2WFLB 3ZI7A 3CXUA 4DMHA 4YX9A 5AJHA 5K3AA 3BJRA 2V9ZA 4MEBA 2Z5GA 4CIAA 3KWFA 3DNMA 3EIOA 3BIXA 1CUJA 5J3JA 4X95A 1XZMA 1U4NA 3QPCA 1W52X 4EHBA 5ALMA 4PSCA 4U2EA 3AZPA 1WPXA 1A8SA 4MJ3A 5EIHA 3I6ZA 4X6UA 5JZSA 5IVKA 2XQIA 4B81A 5JADA 5ISMA 2C58A 5CBKA 3FLBA 5AKGA 1GPNA 3HI4A 2XUAA 3WIBA 4BYMA 4ZWNA 3ESBA 4I3FA 2XUKA 4ZI5A 4ARAA 1ZI6A 1CFJA 2C7BA 2OPHA 4BP9A 4M0FA 4UBKA 2PBLA 4QWWA 2OAGA 5EIAA 1QIIA 4KE6A 3H2GA 3HYSA 3D2AA 3KOOA 5K3FB 4J0IA 3RKSA 5HK8A 4BATA 1LGYA 1YB7A 5D3KA 2IITA 4BB0A 1VXOA 1VJ5A 2ZJ6A 1UK7A 3HSSA 1TQHA 2O7RA 2PUJA 5FV4A 4L0CA 3LIPA 4RE6A 5AI0A 1AUOA 2IIVA 4C4XA 2WFZA 3VXKA 1YAJA 5LZ9A 5JAUA 3SC2A 2CB9A 4G8DA 5A2GA 2C4HA 4HS9A 4YK7A 2JGMA 1BEZA 2JF0A 4U2FA 5AKIA 2DQZA 2K2QB 1C4XA 5AKXA 1LPSA 5AM5A 1XZAA 4WFJA 1DQZA 1XQYA 5HKBA 2G63A 4QNNA 1XQVA 1E3QA 1CUAA 5ALQA 3C5VA 4BZZA 3OURA 2BKLA 1H2XA 4H7EA 3WYDA 1SFRA 1QIFA 2C0PA 1XRPA 1AQLA 5FRDA 2I3ZA 4EY5A 4FDMA 5ALSA 2HM7A 1E89A 4LXGA 3L1IA 2H7YA 4LXHA 3D2CA 1QO9A 4KEAA 1IUPA 1WHSA 3DLTA 3W2TA 5CRIA 3SWWA 2G5PA 5ALHA 4B6GA 3V9AA 3C6ZA 2DHCA 1E8NA 1TIBA 3W9UA 1N1MA 3WKAA 1QFMA 4AN1A 3F8SA 3EBLA 1QIDA 2WJ6A 5EHZA 5JATA 4UHHA 1BROA 5JIBA 3K2IA 2HA6A 4XX1A 1QO7A 4L3WA 3R40A 4B84A 4BDTA 5CTAA 1IMJA 2JGKA 4MQMA 4ZV7A 4Y2UA 4FLEA 1L7QA 1GKLA 1Q0ZA 1VE7A 3WA6A 3R0VA 3K9BA 1R4ZA 1L7RA 3HABA 2WHPA 2XQJA 1EDEA 1BN6A 2XMBA 1U2EA 3WKEA 5IVDA 2ZYRA 2ZYSA 4Q1VA 4X7BA 2RGUA 2XMQA 2JIDA 3C87A 1XQWA 1OXMA 2FX5A 3PICA 1EHYA 1QTIA 2J3QA 3F9CA 1CUEA 5ALDA 5YASA 3UUEA 1P0PA 5C8XA 1R50A 4XIIA 1TCCA 5FLKA 2QR5A 4PV7A 5ALTA 1USWA 5ALNA 4KJXA 4J0KA 4OUKX 4HXEB 1YS1X 2HU8A 3QMMA 4LKOA 2XUPA 1WPRA 3R41A 2XUFA 3X3HA 1VOTA 4W1PA 3WMRA 4P92A 2H7CA 1E8MA 3C6BA 2RI6A 3QPAA 1W6RA 1YA4A 5D6OA 4UBNA 4GW3A 1MTZA 5AHXA 1LPMA 3IDAA 6YASA 3WZMA 3C45A 4OB7A 1JKMA 4KE7A 1E8DA 1FFBA 1GKKA 5BWBA 1F6WA 4QDZA 4P93A 3G9XA 3SK0A 3BF8A 4B83A 4C88A 1ISPA 5I8PA 2CBGA 1ZD5A 5JAHA 3PE6A 3EQ9A 1QONA 3N0TA 4G9GA 4UFPA 3IVMA 2PM8A 2QZPA 1MAAA 2VEOA 4DMKA 2XMDA 2WUDA 1QLWA 3Q8WA 1UFOA 4BCCA 4KE8A 4F0JA 2QTBA 5HQ3B 4EY6A 5AI5A 5E4JA 3PFCA 2VQ6A 3QZUA 1JU3A 5HCUA 2XI4A 1W4LA 1EVQA 3EQ8A 3QITA 2Y6UA 3D0KA 3I28A 3FYUC 1EX9A 5CURA 1XZDA 1F8UA 3QYJA 3QVMA 1JJFA 1E5TA 2BGNA 2FUKA 5FUMA 4E14A 5LKRA 5AM2A 2GBCA 4DLNA 3WJ1A 1BS9A 2XMZA 1CUZA 1EH5A 4G4GA 4J0GA 5FKJA 1A8QA 4QZVA 1LBTA 1K8QA 5AKJA 4AO8A 1JJBA 4DSAA 4DNPA 1WHTA 5EI5A 3QMWA 1VA5A 4HZGA 3W05A 2AJ8A 1GQSA 4EA6A 3FYUB 1H2ZA 3O0DA 3YASA 1ACLA 1XRNA 4I19A 1MO2A 4MWTA 4B0PA 2Y2UA 1MU0A 1CUGA 3O4GA 4EY4A 4ZREA 2PSFA 4KYVA 1JFRA 2EEPA 1R9MA 4LHEA 2OCKA 5KBYA 1MX1A 3O4JA 2PPLA 5EHNA 3PF8A 2VJAA 1F0PA 1XKTA 3H1BA 1G66A 2XUJA 1XZFA 2DFPA 1T4MA 2Z8XA 3BF7A 5SYMA 3Q0TA 4Q82A 4OPMA 2HA2A 3QPDA 5AM1A 2VAXA 1GQRA 3R3ZA 4Y2TA 4UHDA 1GPLA 2HHAA 3AIKA 5T4BA 5CH3A 1EXWA 5DLPA 1XFDA 3MVEA 3T4UA 5A6VA 3ZLVA 3I1IA 1G5FA 4BVKA 3BJMA 4MYDA 4DNQA 4QDTA 4V2IA 3C8DA 4QEKA 4X90A 4AMYA 1X70A 1R9NA 1XLUA 3DOIA 3RK4A 3H2IA 2X8BA 4H7FA 1PJAA 4JYMA 1FFEA 2J3DA 5HF9A 4OD0A 4LXIA 4UHEA 4DM7A 4H77A 5AOAA 1JT2A 1QIJA 4N8DA 1ZJ5A 3O4IA 4RPCA 4NZZA 4AMZA 2RHTA 5EIEA 2GBFA 5HFNA 3TRDA 4YASA 1UOPA 3HZOA 3WK6A 5A7HA 4UFNA 4D9JA 3AFIA 4BE4A 4N8EA 5LZ2A 4Y2YA 2XT0A 1NX9A 2LIPA 1NU6A 4FLFA 4OYYA 3GZJA 2ORYA 3ZPXA 2PSDA 4Y2QA 1UZAA 4AX4A 2RIPA 4J03A 4C89A 4N5HX 1RWQA 4CCWA 4PW0A 3D59A 1L7AA 3W04A 4QE3A 5ALZA 4GEGA 2BJHA 1VE6A 3GBSA 1FFCA 4KAAA 4GI1A 4KRXA 2JGJA 1G4HA 2OG1A 1XZIA 3HRHA 3AJAA 3AINA 5JASA 1A8UA 3B3QA 1CRLA 2HA3A 5AI8A 3O95A 5C8ZA 1CUVA 1H22A 4FOLA 4FHZA 1UKBA 1DWQA 1QTRA 1Y7HA 1XZKA 1YS2X 2IX9A 1VLQA 2HU7A 4B9AA 1EK2A 3ZLTA 2Y1KA 5HF6A 2H9YA 3G0BA 5LLSA 2XUHA 1WCYA 2C5GA 4XWGA 2HRQA 2XQFA 1ODCA 4K5QA 2JEZA 2WKWA 4BBZA 4HRYA 4Y2RA 4WFKA 1YCDA 4H0CA 3BWXA 1XZHA 2PU5A 4AQDA 2JEYA 1UK6A 2XMCA 4GDMA 2VA9A 5ALIA 1LPNA 3AZOA 3FOBA 1EA5A 2XUQA 5HF5A 4F60A 2HA5A 1MJ5A 2Y2VA 1RYYA 3H2KA 2G4LA 4U2GA 1K63A 1OCEA 1SOMA 4UBOA 4EBBA 4TVKA 1XKLA 2PSHA 5CMLA 3F97A 4HXGA 3JW8A 4RE5A 3B12A 4DYHA 4Y2SA 5E2IA 5EHQA 4G8CA 3TEJA 2BCEA 1J1IA 3WA7A 3F98A 1CIJA 3DYVA 1E66A 4Q3KA 5DYTA 3FCXA 3H1AA 4UBJA 4G4IA 3E0XA 2RAUA 1X2EA 1Q84A 4P9NA 3T52A 2ZVDA 3G02A 3K6KA 2VATA 2QMQA 3QMVA 3R3WA 2WG1A 5ALFA 4PF1A 2WILA 4K2AA 2XDWA 3AIOA 5HFAA 4BC1A 2JGEA 3V1MA 2ZSHA 3ICWA 4QDOA 2H7XA 4AO7A 2AJBA 1XRRA 3KXPA 5K3BA 2GZSA 5AKYA 3C43A 4JH0A 4KRYA 1QIEA 3G9TA 1XZCA 4AXBA 4DNFA
chains in the Genus database with same CATH superfamily
1W8IA 4EKNB 1P4HA 3H5OA 3HVRA 3CVXA 1ZH0A 1C2TA 4HDRA 3L4KA 1NQWA 3EA5A 4LN1A 3BD8A 3RH0A 2A5LA 2FFRA 4RPLA 2IEZA 4WHMA 5CT6A 2VC2B 2WMOB 2SKDA 3MJSA 5AKKA 1S7GA 3KVRA 3H86A 4YXWD 1ZK3A 3TQCA 1P17A 3UO8B 4OJQA 5JJIA 4F1WA 1EUZA 2PH3A 3ESDA 3JD2A 1JSRA 4PZPA 3E22B 4MVJA 3HXKA 2P62A 1P5RA 2ZRCA 1UBSB 3KR9A 5B55A 2NSJA 4LOJA 3AUSA 4NBUA 4R1LA 2CSXA 2WZDA 4AFNA 3VHQA 3VNRA 2BMVA 1ND5A 1MQ9A 1U0EA 2NG1A 4GPZA 3VPDA 1W7AA 3C48A 3FMOB 1THGA 4FQ7A 4Y6GB 4RZ2A 5B1EA 5KTKA 3GPBA 1EUDA 3QVOA 4E46A 1SHUX 1NMZA 1BX0A 1ST2A 4UBMA 1EK0A 3DGFC 1E92A 4DJ5X 7GPBA 2A7QA 3UXMA 3P9ZA 1KMHA 3VUFA 2J30A 4WLVA 2HMVA 2H51A 3LX8A 5F9HA 4J6EA 3FJ1A 4CF6A 2PHZA 2BGIA 1FQJA 1BNCA 1CX9B 1D2CA 4NF2A 2R8ZA 4MRVA 2FY8A 3I1YA 3WQRA 2V58A 4MQBA 5DN6A 3ITDA 3WX0A 1JBQA 2AH5A 3IOEA 5KYYB 4IYJA 2K6GA 3OWOA 4DLTA 4MRSA 4P0TA 5CFPA 2FPGA 2I7XA 2LKCA 3OJEA 4OL0A 3VR2D 3E05A 3FCOA 4JP8A 4LDQA 5DXAA 1B2LA 3OWHA 4V2UA 4EG7A 3AKYA 4IFIA 4QTZA 3WNVA 5U4XA 4YCCA 2R65A 2N0SA 4R1NA 4WKOA 3RB8A 3UK7A 5FTJA 5C5DA 3W2EA 3HRIA 2I4MA 1IJFA 2A88A 3B85A 421PA 2PUEA 1NA5A 1ZNZA 2Q5JA 4GMKA 3BICA 3M4NA 2JIPA 2W6QA 3JVUA 4QBKA 2NTYC 2GN4A 4H4EA 4FHCA 4DRZA 5JSUA 4F2DA 4OQLA 4V3BA 4AURA 1HNXB 2A84A 5FB3A 1QJ4A 3QP9A 4KR0A 5J5CA 1U7XA 3D4PA 3SHOA 3CFYA 1J8DA 2UVQA 3ZE0B 2WT4A 3NASA 4BB5A 4NZMA 1MUUA 2KWIA 3L7OA 5BT9A 5JHHB 3WMFA 2OUIA 1D6JA 5HVNA 1KI7A 3GBVA 1GVNB 5ALYA 2VPPA 4S0XA 4Y7DA 1SU6A 4X7PA 1O5OA 3RUEA 3V4LA 4DLZA 3K0BA 3TLBA 4Q47A 1ZKDA 4CIDA 3UG7A 2DUNA 2X8AA 4KV9A 1Y33E 4NTZA 5CAEB 1NW7A 4LHWA 4L1KA 1IZ0A 3SZRA 5MN5A 4YT4A 3U61B 2G71A 2F3RA 4YAUA 2EZ4A 3BAZA 3ZJUA 3PYMA 3TCNA 2Q5EA 4YXWA 3H6KA 4YPOA 4Q02A 5CK4A 3A27A 2JBWA 3SS7X 1BMFA 1RXEA 2I4NA 2QORA 4RIFA 3T5CA 5DM60 1QP4A 1DTSA 3OM0A 4K6CA 3N0VA 1MB4A 1DUSA 1MO6A 3L7DA 4JOQA 4YR9A 3OCJA 4JBWA 4EMTA 1KK0A 4NZOA 4F8EA 1M8GA 5JSZA 3SQWA 1WG8A 1GM5A 4G9EA 1D1PA 5IJ0B 2GD6A 1DFGA 2X6QA 4HLQB 1W4RA 4DNOA 3VDNB 4E13A 3H2JA 1O7JA 3KOYA 1NPTO 1XUOA 1N1GA 4MKXA 2IU0A 4L9AA 3L0CA 1H2BA 3LA8A 5DZSA 5JISA 3TZKA 1KK1A 1QYDA 1SHKA 3ICPA 1GO2A 1KJWA 2IFTA 2JCSA 4M7RA 3RTEA 3V1NA 8OHMA 2GBGA 3S2IA 5A3JA 2RD2A 4NEGA 2B5VA 1XWFA 4HADA 1ODTC 5GVRA 3W8NA 3GLHE 4XWTA 1ZHOA 1V8FA 1RRGA 3DFUA 4I99A 1XMVA 1R1DA 5DHFA 3V32A 1L2TA 4HNSA 3PDWA 4WFIA 5CJPA 4L5IA 5DRYA 4Z0TA 3RAPR 5HZMA 4DR7B 1OIVA 1PFWA 2X1MA 3L8HA 3BWBA 2H1SA 4P31A 3UK2A 1NZDA 4ETMA 5C1OA 3DMFA 4ZYTA 2EDAA 3BXGA 3FGPA 2PSEA 2QX6A 2PL3A 4GVPA 2BF4A 1MB3A 2XD4A 5EYPA 3NS7A 1WMBA 1Z3CA 5JNTA 4DYDA 3JQEA 1NP7A 5TQ2B 1O96A 4HDAA 3KUCA 4C05A 4R2WA 3EXHA 4GR9A 3PX3A 5F7XA 4XD7D 3BRWD 4W5HA 3G2IA 1CF4A 2H1IA 4FE7A 1IFXA 4QPZA 3N75A 1G6OA 2DKOA 1LLFA 1US8A 2WM9B 1S2MA 4BJ5A 3O38A 1TA4A 5PGMA 4EGQA 1C3VA 3IQEA 2GVZC 4FFVA 4YT5A 2JHCA 4ITUA 4F2HA 3OQ1A 4O6VA 1HDZA 3R5JA 4N41A 3SPXA 2J46A 3WO0A 2BEUB 4A92A 1HE8B 5LYYA 2JHPA 3H18A 4I8DA 5MN4A 3WRXA 3G7NA 1Y8AA 2YFYA 2ZYAA 4LWQA 4D4GA 1XJ0A 2B3DA 1YL5A 2V4MA 5I9SA 4F3RA 1GUAA 3PFKA 4TVOA 3RPEA 2JGFA 2P5SA 4X97A 1ZX1A 2BW0A 2F00A 5IM5A 2FI1A 2Z83A 1GZ3A 1CPYA 1L3BA 3IUJA 3ZWNA 2O52A 4YO7A 4DPLA 2IOFA 1FFXA 5HKLA 4H18A 4TT3D 2Q5LA 3SDBA 4ALKA 3A6HA 3OY2A 2K2WA 4NJEA 2XGSA 2WWWA 5IDYA 2XT9A 3A9WA 3UKOA 4I9UA 121PA 4BO9A 3WNBA 1N5LA 1UOOA 4X9XA 1KC3A 4MV9A 3VZDA 4DKXA 2B5OA 4OB6A 3ODGA 3KPWA 2H8KA 2BH2A 1S0UA 4ILEA 1PDVA 4BBJA 1Q3TA 1UFQA 3JQPA 3IP3A 4R0NA 4RPIA 3Q9SA 3CF6R 3RUDA 4KO1S 1KO7A 2C54A 2EVWX 1L3CA 1GHTA 2GZRA 3AHEA 3ANMA 2DGDA 2NXCA 2PX6A 3TJZA 4CF5A 4GYWA 3S99A 1OYWA 1JRLA 3QVVA 5EWJB 4F6CA 5HRCA 1ZMBA 4GPEA 4BU1A 3WGMA 4H1WA 5JDCA 1L9KA 2JFWA 3KLNA 1FXWF 2QM7A 3I1JA 4RZ3A 4UU7A 2L2QA 1ULSA 3O8BA 1QE0A 4BJ6A 1UMCB 4JUIA 4MO9A 4N82A 3L1HA 1BQ4A 2D3WA 2HQSA 2XVZA 2GPWA 2JI8A 4J1NA 3TL3A 5BW4A 4ZU1X 2WJAA 3CVOA 5I7FA 3C3YA 3VR6H 1X7HA 2J5BA 3B6EA 2C92A 5FPHA 4J2TA 3OSZA 1AKVA 3RC8A 5LMZA 2FA9A 2IHKA 4IIJA 4CDGA 4UVHA 4AZ0A 2H07A 2GYVA 3C7KA 4Z8YA 4EGFA 1HYBA 1NVAA 2W71A 4LI3X 2BFFA 1EINA 3AV0B 3D54D 4Q9HA 1FFDA 3FNBA 3U9TA 2JD0A 3ER6A 1UWCA 2CXQA 2X5XA 4EATA 3EMDA 4RD0A 1PNTA 4O59O 4XD7A 5JAOA 2E1PA 2A9PA 3EGIA 2FWJA 3G2KA 3TPCA 1EVEA 3CY6A 2CMGA 1WZ2A 2OV2A 3PKJA 4YGXB 1S2DA 1JR3D 3PC2A 1TAHA 4A3SA 4D98A 2YZGA 1DLIA 3E58A 4YV1A 4BKUA 1JEYB 4P53A 3RASA 2CBXA 2OD9A 2FN9A 1ADYA 3MB8A 4MUHA 2YJ4A 4FZJA 4LVOA 3N6VA 3JTEA 3LOUA 3COSA 3N6RA 4K1XA 4KXQA 1HNWB 5KC8A 2A6PA 4PSUA 1J06A 3BTUA 3VZSA 1GPUA 3GFQA 1SBIA 2X77A 1RLIA 1ZIYA 3AM5A 3LWBA 1K88A 5AMXA 3ZHOA 5C9ZA 4CEIB 3FUTA 4BFUA 1DBQA 4ZZIA 2OXFA 3PNPA 3ZCXA 1A97A 1KH3A 2AK3A 5LDDC 1Z0SA 3X1ZA 1I36A 4CU5A 1YMQA 4U7GA 3UPDA 3HCCA 2CF6A 4FGLA 4KQXA 1DKLA 1PQUA 1ADGA 1W76A 4QFMA 5HK9A 4DIKA 5HS4A 3RIGA 3AR2A 4CR7A 2EXXA 3PZBA 4GECA 4LNHA 1ORIA 3LBHA 3HM9A 3KLBA 3LCRA 4NL4H 2YBEA 2Z2YA 4UTZA 3B9PA 1ZUD1 4WN3A 4IUDS 5U4QA 4LRXA 3RCBA 3B2QA 2ODTX 4CF3A 1E2JA 2PLRA 5IPFA 1IY2A 2X0FA 2PTHA 3WYNA 5ESRA 2XYHA 3K31A 3O2NA 1EUCA 1ICIA 2HFKA 2XH8A 2G8NA 2FRVA 2WJWA 5AKEA 5B64A 5LN1A 1S3SA 2VXYA 3FW1A 2XE4A 3IQXA 3JQBC 4QTTB 3UMYA 4JJGA 2YDXA 4RHTA 1IQUA 1XMPA 2NTVA 2A58A 2VPYA 1EDBA 3D7NA 3IHWA 3Q10A 5B30A 3OX4A 4LYFA 1FJ2A 5GVSA 4RPGA 2XDYA 4ENTA 2Z5VA 1U3FA 1VRWA 4GMHA 2IZ0A 4QOJA 3S2FA 1W36C 3EG9B 2IUYA 5EMKA 2HWXA 1PS0A 1L4UA 1W87A 2QSYA 4G24A 4MUXA 2OXTA 4DHEA 4URVR 1V11B 1YFZA 4HMPA 1GQYA 4J91A 2Q62A 4KVAA 3I04M 4RF5A 3LBNA 4BX2A 1RPTA 2O7SA 3KTDA 3VZPA 2WMDA 4ZVKA 1N8TA 1Z4MA 1SO8A 2X0NA 3BB3A 1XTKA 1EDDA 1E3SA 2WWGA 3P32A 2R6JA 3KXIA 3AKEA 3N39C 4HNGA 3FY4A 4CM4A 2J9YB 5D2CA 5JWRA 2PXHA 4PPNA 4ZFNA 3L4SO 1ZI8A 2VHQA 3HJAA 3HU1A 4M0UA 4V0ME 5AOVA 1E2PA 3K9CA 2JLBA 2P2NA 2XV1A 1Y3HA 3I37X 4ZT3A 5C81A 4U9UA 4YMIA 2Q7OE 1UANA 4HEA1 3IIJA 2JG3A 2D06A 4YUAA 3MLBA 2NYRA 3DLIA 5K8LA 1W34A 1Y3BE 2ZUFA 1OTHA 1U8XX 4EB8A 3JALB 3Q0IA 4OIMA 3SIRA 2QROA 3VPFA 5J47A 1OU0A 3UEOA 1I0IA 1II8A 2E5LB 3ZD8A 1EU1A 3EVNA 3JQAD 1RQGA 1DINA 3NM5A 2FXIA 3PENA 4EL0A 2V8OA 2VBCA 2QTLA 3AOGA 4RDXA 5ETJA 2DETA 4Q9LA 4FFDA 5H02A 4YJ2B 1UOQA 1OWLA 4UDNA 3MWEB 3UA3A 5C1PA 3WICA 4MVJD 1E79D 3DL7A 2QHXA 3W3ZB 5GTDA 3O21A 1ZGGA 4GEKA 4J4BA 4R6XA 1XRQA 2C3YA 2FCRA 3AHDA 2BEWA 4XYMA 3RM3A 1RBZA 4JYPA 5L9AA 1DP4A 4BQPA 3JD4A 2BI7A 3O6VA 3SLRA 2AMLA 2FPOA 4QD3A 4OMCA 2Q50A 2ZYIA 3PV0A 1SVLA 1BWQA 1ZN9A 4KQ6A 5KOHB 3V8BA 1X14A 3ED1A 3LECA 4PRLA 4TMTA 5LZ7A 4N6NA 4F46A 2A3NA 4MV1A 4HB3A 5M29A 2QRVB 4R8KA 4C0AC 4X60A 5DULA 1GTJ1 2PYZA 2B2NA 1Z37A 1YZYA 3CN9A 4ZZ2A 3HXOA 3L0PA 4NQZA 2IEGA 4CG3A 4HRXA 1ZL2A 2WLSA 3H5NA 1WXXA 1NUHA 1JSCA 3AHGA 3HU5A 3JQGB 1LDEA 1GPH1 1OU4A 2W6NA 3BCUA 3WISA 3FSRA 1NHWA 4X1YB 4Y2VA 1WB4A 5BV7A 1T9ZA 1PI3A 2EFEB 5IN5A 1VZ2A 4FOTA 2A9VA 1E63A 2JASA 1H93A 4N8SA 1FVHA 3DS8A 3HUUA 4EPWA 3WTBA 3R7DA 4NOMA 1KOLA 1UADA 4H3KB 4IF6A 4W1QA 1MT3A 2JC3A 3TXAA 4ISCA 3G0HA 4D9KA 4OLBA 1HDXA 2OAP1 2WD9A 3HV2A 1C0EA 4RWZA 3Q7RA 1JQEA 4OJMX 4XVRA 4C21A 1ZP6A 1Q15A 2EX0A 2WUFA 2ZJFA 1HRKA 4BNNA 4DMCA 2H31A 2EBWA 2ZRJA 5BNFA 1W1IA 5AESA 1Z39A 4B3HA 4WUTA 2ANCA 4YROA 4A5SA 1R10A 1YK0A 3M9LA 3O1JC 4AJEA 5IC4A 4PNPA 2ZSJA 4IS2A 3WIOA 1P5HA 4CE6A 2ZKIA 4P82A 4RK7A 1MFZA 1ZIDA 1OLOA 2ADFA 3PQ7A 1XRJA 2BBTA 3AOEC 4R9SA 4YAJA 3BL8A 4AO6A 4H3SA 3FNFA 1JUDA 2BZGA 4MCJA 3UF0A 3VMMA 4EUKA 1I14A 3I9KA 2PK3A 4JIGA 2ZATA 4OGKA 3JAMA 3PRYA 2WSLA 1N2XA 1I10A 1OFVA 3DDZX 1UT6A 4NNPA 3NM6B 1YL6A 1Y7LA 1QP7A 2NO5A 1ZN2A 3LX6A 3TZCA 5BNIA 2A3RA 4KHPB 3JQQA 1H4VB 2C99A 2UVPB 1SBYA 1QGED 5AI4A 1AT1A 4TL6A 4S3MA 3OFJA 3WZLA 4BX3A 2Q7DA 4PZZA 1IWPB 5EMJA 2VS1A 1M8PA 3U3JA 3KL2A 3KR1A 2RGEA 2H4WA 3KWLA 4GGOA 3HJCA 2W6ID 3VU8A 4I4TF 2I91A 3EX7C 2YHSA 4OMFG 1WETA 1E6KA 1ISRA 3PRKE 2JFOA 4TTSA 1GCIA 4U6SA 5E0KB 3N7AA 5HBRA 3QMPA 4G6ZA 5IEBA 1LI7A 2VNSA 2PLFA 4L5AA 1OWOA 4J8PA 4YFVA 5FXMA 3QIVA 1K4MA 4NLLA 3Q4GA 4NAHA 5FULA 3WL7A 2G4VA 1GCGA 3HY6A 4I50F 4K6HA 1K5PA 5B6IA 1PNRA 1ZAYA 1ODIA 3NAQA 5FTLA 3CS3A 2CJWB 3PUVA 1NQOA 1FTGA 3EIFA 4KQ2A 3E7PA 3V4PB 3TM5A 1DIOB 3K6SB 4B3GA 4GMFA 1WKCA 3DLBA 1GN8A 3U4QB 1RAAA 1QV7A 4C7VA 3A9RA 1Z2NX 2X0KA 2ZTHA 1P73A 3H11A 1OW3B 3COJA 4PBRA 3PJFA 5C1DA 5JO0A 5K20A 3AJRA 4UNQA 3VTKA 4LJRA 3WL5A 4BUJA 1WXIA 1RMTA 1FUEA 1K0UA 2PGNA 5AK5A 3K8QA 3T7KA 4UHBA 4A8PA 2CVZA 2AQIA 3ZWDA 4EHDA 5JI2E 2IF0A 4IJQA 4DTCA 2ALJA 4L50A 3T7TA 2I7VA 3NOOA 2CJXA 4ISBA 1HDEA 2FW1A 2WHRA 4J0JA 3VBEA 3I2IA 3KQPA 3OEWA 3W6PA 4E51A 4FONA 4KR3A 5EN4A 1GQ2A 2UYQA 5E0OA 3NYQA 4RTRA 2IHJA 2PX0A 3MAAC 2YS6A 1JAXA 3OJOA 4M0CA 1MABB 5HF8A 2XYGA 1R4MA 1JALA 5K5EA 2FCAA 8GPBA 2WV9A 1MMFB 3GUUA 1MO3A 1NSYA 5I7WA 3DC7A 3IBYA 1HE2A 1FRQA 1OZ0A 2EX4A 4E15A 3TINA 1IHDA 2B25A 3ZDEA 4QREA 1DT3A 3GLGA 2FJ0A 4R2MA 2WKPA 2NSDA 3CEAA 3MJRA 1NW6A 3MINA 1WCV1 3R23A 2PD4A 3G0IA 2B1GA 2AEFA 4FN4A 4KU4A 1TOAA 4R68A 4ASUD 4D74A 3MOGA 2H63A 2V9CA 3O26A 4PONA 4A82A 1H9AA 4Z0PA 3UIEA 1YUBA 2XLBA 3EDRA 1O6GA 3QKRB 4RA6B 4UD6A 4MI3A 2B8EA 1NJGA 4LRWA 1HF3A 1QKKA 2OCLA 4NC9A 5DI3A 9ABPA 1FJGB 1AF7A 2XTMA 3ON5A 3AVYA 3OECA 5BNWA 3IR6A 3DZDA 4DSZA 4G0MA 3OEYA 1W94A 3OQBA 4MWGA 2E4YA 5JSFA 1B0AA 5FUVA 5HZHA 3L02A 4HQRA 3AUFA 3RYHA 1V8BA 3W5DA 2OGWA 4CFYA 1FX0A 1YC5A 3I3OA 3W6OA 4PO8A 3NHWA 1P0MA 3UK0A 4JQZA 3FNIA 3ZWWA 4F2PA 1H2EA 3FPSA 1GU1A 4JL6A 3TX6A 1J20A 1GXSA 2REOA 3QKWA 3WRXC 4E5PA 4ER5A 2JLVA 1OR8A 3PIDA 2H5IA 3ROKA 5C46F 3L5OA 4O1MA 3NHLA 3S2EA 1ECFA 4HUJA 3QVLA 4WW0A 4JVSB 1WPQA 4NY1A 1GZ7A 3H9BA 1YJAA 3T5AA 1KZ1A 1P2SA 3CNOA 3KOUA 1XXHA 2ODNA 3DBLB 5KO2A 1EFHA 2KM1A 4ZI2A 2E4WA 3EVTA 2DTEA 1X7YB 3OX3A 5GM1A 1G8MA 4IXMA 3S29A 3N87A 4B71A 3E7WA 1MIOB 3NORA 2QMOA 4MQEB 1XTRA 3ZTWA 3OMWA 1WOMA 4QBFA 5LLDA 1Z45A 4OAOA 1F48A 1OFTA 2FLKA 3NXSA 4KCGA 2BTQB 4RVSA 3RU7A 2YKGA 3ANNA 1RKUA 3WNCA 4JL5A 3SDZA 2F59A 1X39A 3HVHA 3P9PA 1PZMA 3QM1A 1CUWA 4OUDB 1NMEA 4XJVA 4NATA 4OQXA 1LV8A 4B7ZA 5TS3A 1R6AA 2VP0A 3PHGA 1TAUA 3D8RA 4F85A 1Z29A 1R0SA 2RC6A 5J2TB 1XGKA 4C4SA 2W90A 2W2OA 5EZYA 1VA4A 5KYVA 5I7RA 3WNDA 2O1SA 2W2VA 4BP3A 2BLNA 5BUQA 2C2WA 2Q1SA 5GGXA 4KWTA 4AN0A 3AEKA 4FJ2A 3PWKA 1U9JA 1T6NA 1V5WA 2VSFA 3A4VA 4HAZA 5FDFA 2ES4A 3U60B 3IO3A 1TCAA 3AKDA 3G2MA 4CMGA 4OHCA 4IQ4A 3BE6A 2IDJA 2Y4OA 2BUBA 1IWBB 1S4QA 4WY8A 1FSZA 3E0QA 4AF8A 4RTJA 4PAGA 3RVQA 4CLDA 2ECFA 1LFDB 3W06A 4D25A 1AGXA 2OC9A 5AK4A 1JW9B 2XRFA 2WAMA 1AK1A 3MRVA 3BZUA 4RYLA 1C9KA 1AXGA 5CXQA 2JVJA 3LHSA 1AKWA 4OB8A 1ADCA 4C2BA 5IDVA 1TTTA 2I66A 3UMSA 5BRNA 3NZEA 2AN1A 1VL1A 4O8CA 1D6SA 2ZRHA 2BCGY 1JQDA 1ZM7A 2OO5A 5EAIA 1J6UA 1QYXA 1WD7A 1ZCZA 2KI5A 1UP4A 1C3XA 3RRZA 3DUFA 3KJGA 2W0SA 2A9KA 3E35A 3G2OA 2FZ5A 3GMTA 3Q7EA 1CQPA 3D8NA 2QDKA 3KYDA 4M9ZA 4LJ5A 4PG4A 4C76A 2AUMA 5UKDA 4E33A 1UMBB 5CD1A 4I6GA 2P4EA 1K5GA 4B48A 2HADA 2DTDA 4JZKA 4MS3B 1E6CA 3WWPA 3FDJA 3NUQA 4J3NA 5A4IS 2C0QA 1E7SA 2FKAA 2OFOA 2R86A 3NH9A 1FU4A 3TUJC 2HDNB 4F12A 2ZFUA 4LTDA 1MDBA 3B48A 4M8LA 3QHPA 1N0VC 3ZQKA 5HM6A 3T7JA 4ZEVA 3NIBA 5A5DA 2BHNA 2G25A 2VHEA 2XB2A 4YBRA 5FTMA 4KIJA 4ZJYA 4TS4A 5IBCA 4OHXA 1XD2A 2H5EA 4O25A 3L8CA 4G0XA 4CM8A 3S1AA 4C0BA 1R0ZA 1U2QA 2G0TA 3BORA 2IYRA 3NC0C 3L6BA 2QJWA 2MSWA 4P3YA 2UYYA 4MVJE 3U37A 4Y9DA 3W1VA 1ISIA 1GGVA 4K26A 5DCYA 2WYOA 3FKSD 4YAIA 5ALWA 3WV4A 1PLLA 3CUSA 4PYJA 4MZDA 3FHTA 3HBLA 1WMDA 1NW5A 3ZHBA 2BMEA 2Z1MA 4QOGA 1A2BA 2OZKA 1IZ7A 4L73A 4GL2A 3H42B 2ZBVA 4X1OA 5DN9A 1UMKA 3VGJA 4BX8A 1G6KA 1YA8A 1MJHA 2NAFA 3WSTA 1MORA 1RLTA 4KZPA 2VLIA 2PUDA 2B99A 2MHCA 3R3YA 4TOIA 2DPXA 2JCVA 3FPCA 3GRZA 4ZOAA 5EIFA 5LWHA 2JZCA 1BFUA 4LPKA 1PFGA 2RG1A 5JAMA 4UBLA 5KDOA 1MGPA 2AYXA 1N77A 3KSZO 4MMXB 3N07A 4HWRA 2FPXA 1ZJZA 1W88B 4Y8VA 3EAFA 1DI0A 1KYZA 1C3EA 4NXMB 1E2DA 5DNVA 1A9PA 4AWXA 2AOWA 2C4WA 3A11A 4CCSA 1QH9A 2V7XA 5CVTA 4OLHA 4P36A 2W11A 3F67A 1DT5A 3OM8A 4FGJA 2P9CA 1G5IA 3JWGA 4I55A 1VJ1A 4LXUA 2OHFA 1B0PA 2BFDB 4FDAA 4F9EA 3G8AA 2DX7A 1IN6A 3C41J 2XADA 4MPDA 2HA7A 4U1RA 5HIMA 4BLSA 2P41A 2FX2A 4GLBA 4ZVLA 1K75A 2ISCA 1RWBA 5IKXA 1CZLA 3QI7A 2QG6A 4G3XA 4Y1GA 1NNEA 1MPTA 1YT5A 4A8HA 5DNWA 5ADUS 4W5OA 5DYYA 1AIPA 4ZVRA 2YC2C 3H9QA 4U2CA 5CJ2A 5THQA 3KP1A 3SHWA 4CMJA 1LJUA 4IQ0A 3THRA 1JQBA 3IAFA 1GQFA 5E4YA 3WHPA 5DX1A 2Z9BA 2G08A 2ZI7A 3QE3A 4HAXA 2D62A 3ANTA 1GRRA 1W88A 4HNAA 4DNXA 4EDHA 1I7SB 1ZOPA 2NUAA 1FU7A 3EFHA 3A25A 3NTXA 1M2VA 4TT8A 5LJIA 3ROEA 1ZGCA 1QQAA 3NHZA 4YQFA 2A9OA 3C5CA 1QZZA 3ZY3A 5FWYB 3I01A 4OG2A 3QV1A 2WKSA 5EVCA 4M0LA 1V4BA 4W5WA 1KJ8A 3HCOA 5I4KA 2ID4A 1D04A 3IT3A 3NETA 1V3TA 5IDWA 1ZK1A 1HM5A 5FTKA 1RFGE 2Q07A 3T9BA 2XRYA 1YQDA 2E1RA 1YQQA 3DH0A 3EEYA 3B1ZA 4UD2A 3O9MA 3HB9A 3AFHA 5FUBA 1P0CA 3AL0C 2MYPA 1EWQA 3FYDA 1F2UB 4QOFA 1MJNA 3RC7A 3SC2B 4LF5B 1UFVA 1XLWA 3F6PA 1NQ5A 1PFUA 1U65A 2ONYA 3HKDB 1ZOIA 4OLAA 2AWNA 1DKMA 3RHFA 2QXTA 2VSXA 1A7JA 2OO5C 3KB8A 4UW9A 5K51A 5IT4A 1NOKA 1TMOA 2Y4NA 1IQ0A 3DR3A 2POQX 5G3YA 5C7OO 4ARZA 3KS9A 3MJHA 3DKKA 5IX8A 4W9MC 3PIRA 4YACA 1KPIA 1IOWA 5LP6C 1W0KA 2I6QA 4LIPD 5C7IO 3L0DA 1Y8QA 2CY0A 2XAAA 3HWWA 4D8VA 3L84A 2O3UA 4O08A 1LPAB 3W79A 3VAAA 1B3BA 1QCDA 1T9GS 1DWUA 1Z8FA 2R6AA 4IPTA 4JP2A 4IJKA 5DSZA 1Q0LA 1RQXA 3UQZA 3KR2A 3KT0A 1E1CA 2DY1A 3AHHA 3F8WA 1C7JA 1JDSA 4KN5A 4M38A 3ZCPA 4PVDA 5CFZA 1M1ZA 4HB4A 5KNLA 4JQSA 4R2HA 2OFFA 1GR0A 5FBLB 2O2GA 5LXTF 2G04A 4PWYA 3MJEA 2NO4A 3MINB 4K9RA 4NE7A 3KETA 1UJMA 3CJRA 3PVCA 4H15A 4Y6PA 2ZR0A 3ROMA 3ZV3A 1ULBA 2VSYA 3PQ8A 2EKDA 2QRVA 1Z2EA 3E8SA 3I45A 2IPOA 3FZYA 4NPHA 1JU4A 2CLSA 2G0NA 2PRIA 5C8VA 1H9CA 3WYCA 2CFRA 3RYCA 4ZT7A 2QU8A 5CB4B 1LZLA 1IQPA 2FP4A 2A57A 4Y2GA 5TJHA 3LT4A 5HKKD 1KOFA 3IAUA 4V0OA 2P2DA 3IA2A 3W4JA 1RYEA 4KWCA 1P3Y1 3BFVA 1K0FA 2VHCA 5K8TA 2BEWB 1UBMS 1R0YA 1QQTA 3HC7A 1FVOA 2ZWIA 5CDFE 1P0FA 4MW9A 1ECLA 2A4MA 3FXAA 4L5YA 3ZIDA 2MIIA 2ADMA 2PE5A 4BTVA 3N6XA 2CL6X 5H16A 1LPBB 5B3LA 3EFBA 4Q66C 1R0KA 1U1FA 4J16A 5L3RA 4NBRA 3LCJA 3U4CA 1P1CA 4GX1A 1DQRA 4AN4A 3HJRA 4XYGA 3PK0A 4OMUA 1UDCA 4R8VA 5L3VA 1S6YA 4E09A 3WTCA 1X8LA 2WTUA 2H4FA 6PFKA 4E21A 2G1KA 2YQ4A 4YR7A 3CINA 3T7IA 4EY3A 5DBFA 2ZWMA 1HT0A 3QYPA 2ZYHA 5F12A 1KYTA 2PMWB 4GP7A 2GRUA 2ZB8A 221PA 1N57A 5FTNA 3O4RA 4RUKA 2I3DA 3RYIA 2GF0A 3TEMA 3SZUA 3UICA 2C7OA 4NBWA 3O8OB 3MB5A 3IPXA 5J2UA 3FH0A 2AHRA 2AFIB 4ONEA 3VYSB 4C0JA 5C7YA 4UUOA 1JDBC 2ETXA 3FWHA 3IAM6 5DFAA 2I6TA 4P7BA 3CHYA 3ORYA 2I29A 4YPVA 5B57C 2ZI3A 3S8YA 1TYBE 2PRSA 4M53A 4A7PA 3MFYA 4LX8A 2AJLI 2CT8A 2AFVA 3M4XA 3UCFA 3CE6A 3C98A 1ZLYA 4MDYA 4EKIA 4CVNA 2WUVA 4WNAA 1ZH8A 4ER3A 1YRHA 2BL4A 3B5EA 1MB2A 4JVLA 3HB0A 4C5CA 1KP9A 3BTVA 4I55B 5H3HA 1QRRA 2Q49A 3K0AB 5ALKA 4EFLA 1DRVA 2QKYA 4RTNA 1JMVA 2XYQA 1EJ6A 4RX1A 4X93A 4JB2A 2Z9DA 3I2KA 2D1QA 1GG5A 1E1DA 3CH7A 3FFBA 3OLYA 2ZXUA 1QHXA 1KO8A 1L7NA 4G8BA 4ZYLA 1Y8RB 1XAHA 1XWIA 2LUOA 4FGZA 2HMAA 4PNHA 1QO0D 1H6AA 1DCTA 1ESDA 1LPPA 2X4DA 2XCIA 5KYUA 2G7ZA 2JK1A 2J33A 4A0RA 1K4YA 4Z0NA 1FDRA 2IT1A 4F56A 1OFGA 2OZVA 2CNKA 1NMQA 5EXSA 4U7FA 1IPHA 3V8MA 2YW9A 4IM7A 4BPBA 4HY3A 1A7UA 1U0LA 2PUWA 2I62A 1KH1A 5CEEA 1LD3A 2G4CA 4PYLA 1CQXA 3GP5A 5HQ3A 2J3IA 2C2OA 4L7VA 3WWEA 1E1YA 2R60A 5IMBA 3S81A 2P2GA 1ACJA 3LP6A 4RVOA 3VR5H 2G72A 3G88A 4U2BA 3DJYA 3NKFA 4HAYA 4JR0A 1OWNA 4I1VA 4QSMA 5LP1A 4DTIA 3DDCA 2QTGA 4FEEA 2B1RA 2XWPA 4CT0A 4YIHA 1SCKA 4G1UC 3UMVA 2IIBA 1KVRA 4IZHA 3UTCA 4DKJA 4D3YA 1MH1A 1OXVA 2OO3A 5F33A 5IW8A 2V6JA 2W2QA 4TLDA 4ZDJA 3KQUA 3NNDA 3P9XA 1SIWA 3RWOA 2GFQA 3I3SR 4MI1A 1SM4A 3BXOA 3VDXA 2G88A 4L08A 3ONVA 3D8BA 2ZIZA 1YDHA 1XD2B 3R8XA 4LHZA 3TOZA 4GX0A 1P0QA 4GX2A 1FMFA 3TXXA 3L04A 3IP9A 2AUNA 3A26A 4LS3A 2HAEA 3U1TA 4Q4HA 2QJRA 2YZ2A 4LX0A 3AV3A 4LUCA 2XKJE 5CX1A 1BMQA 1Z5PA 1GZSA 2WF5A 2I54A 4FGWA 3KKMA 5GM2A 5J5VA 3AEZA 2FWPA 1PJRA 3AUKA 3WVNA 4RZXA 4H4DA 1NPYA 2WZCA 5A03A 2OB1A 2H1LA 2N1BA 1HEYA 1K9SA 5DTQA 1YQUA 4Q9KA 4W5RA 5KVVA 1IM5A 3JVVA 1I2CA 2I9KA 3KKNA 3DBIA 1J2JA 1UWLA 1M7BA 1Z5VA 3A4IA 1G3QA 4Q01A 4N76A 5HCNA 1KFEB 1EK5A 4W6ZA 5A71A 3DV9A 3JYHA 4JOCA 5D7NA 1NKSA 1U1DA 2JAQA 4O4HA 4DR6B 1Y8CA 1RIIA 2ICAA 2W6JA 3DKIA 2DR3A 4OXKA 3DXFA 4FE3A 3TUZC 2HA4A 3MWFA 5ELMA 3N0WA 3N7UA 2HSEA 5K09A 4D0LB 3KIPA 4IFEA 4B7CA 2X9NA 3EG5A 1B0UA 2C96A 4OXXA 1BWSA 1XKQA 1EM8B 3F6CA 3OEED 5DLYA 4EZIA 2C0CA 1E5LA 4LGMA 2GWHA 4X91A 2EDCA 2NTJA 5DTEA 3QWBA 5K3EA 4G0OA 5E7QA 4E88A 4CM9D 1C4KA 1I2BA 1R0CA 1V5GA 2ODPA 1SKYE 5F1OA 3PX7A 3DEHA 3FCUB 4YAOA 5E3JA 1HO3A 1U2DA 3NP7A 4JLBA 1HE5A 2AOXA 4R05A 3A37A 3CRMA 1Q1ZA 4FINA 5EXEA 5AVKA 4J9VA 1M2KA 3C1UA 4PYQA 4AKTA 4E32A 3USES 4YLGA 1JWAB 3BYZA 3P9SA 3X2FA 4J07A 5HEKA 1SUIA 1ZH4A 3LVQE 4BXOB 5C34B 3WBBA 3E53A 4Y0VA 4TTAA 4A36A 1YCGA 2JFHA 3RVDA 3M6FA 3WL6A 5HM8A 1XL1A 2WHQA 2WD7B 2WIDA 4OKIA 1TM2A 1KI2A 2H1FA 3PEVA 2C2KA 4IO0A 4AMVA 5A4MS 4IG4A 3BK7A 4UOEA 3CIOA 1LDGA 2CNDA 1XHFA 1R9JA 3MIIA 1W0JD 4KPGA 4QYWA 5FOTA 3MWJA 4DLUA 3WDKA 5CXXA 5LZ4A 3MK31 5A4FS 1ZL0A 1M34E 2DHQA 1C7ZA 3L92A 5FPPA 2B83A 3W5CA 2O5RA 1PV1A 2XTNA 4GXTA 1HX7A 3FBTA 2H4XA 2O2EA 3S5JA 3BX1A 3FTDA 3TQFA 4B2YA 4DA6A 1QIMA 1Z5OA 3H16A 3OT5A 2FWNA 3ABQB 4IXDA 2IHYA 2H2DA 3LXMA 5A5FA 1FZQA 4OCZA 3WI7A 3A32A 3I2JA 1E3WA 2F1JA 1VPVA 1GGMA 1NVMB 1DCFA 1L8OA 2YZMA 1TRKA 3HFRA 4NU5A 4U3JB 5I9NA 2FGKA 4MQEA 2UU9B 2EJVA 3IELA 1F6BA 2P2CA 2QD5A 4AP6A 4KLRA 2ENUA 2HQBA 4XVHA 4DR3B 1XXLA 2C9ZA 2X9VA 3MAGA 3ACCA 1LBIA 4P35A 4TXNA 1DCMA 4V0RA 5IKEA 2WWFA 4AG5A 2ZPAA 3IAM1 2WFLB 1IBLB 4GQAA 1C50A 2AL7A 2GN1A 2PR2A 5IJZA 4YX9A 4H7PA 1W1UA 1E1RA 5AVWA 3U09A 1L7DA 2HO5A 3FTNA 1GUYA 5AJHA 5DK6A 4CIYA 5K3AA 4BMZA 3BJRA 3WO1A 1ORTA 1FYDA 2FPUA 1OB5A 2PYIA 2QN9A 3P2JA 5I8WA 2R8RA 5IFKA 1R3UA 4RFSA 3NI2A 4WA7A 1Q14A 3DE5X 1NUQA 5K6AA 4BRWA 1EFTA 5FOXA 1CUJA 2P30A 4X24A 4JJKA 3FOAA 5BSEA 5J3JA 1Q5PA 2XRMA 4MQ4A 2J31A 4PU0A 1XZMA 3LXUX 3IODA 2I1LA 4RD4A 4X95A 3TXYA 3IILA 1VKNA 2Q5QA 1SKQA 1YRYE 4QUIA 1V8DA 1QCZA 1Z22A 2ZUSA 4MS3A 3HLYA 4RMHA 4PSCA 2A5JA 3KX2A 2Y1WA 1D7AA 2Q4EA 4HYYA 5BSHA 3GFOA 4JT4A 1B0ZA 4MJ3A 5E9AA 2RB4A 4LWPA 3VO2A 2JGDA 1PSZA 3ASVA 4CM6A 3NTUA 1WMFA 5DOVA 4EEXA 5JZSA 2B6NA 3FWKA 4RS3A 1CG6A 2X14A 2CSUA 4MARA 3UMMA 4MAMA 4MV6A 2O50A 3VH3A 1SUEA 2G9UA 1F4PA 1C9EA 2XQIA 3LH5A 3FLBA 2CFOA 5IF3A 2H52A 1KYWA 1R4MB 4EGJA 3OQMA 5F2NA 1GPNA 3HI4A 1NN0A 1I4WA 3GUHA 2CDBA 1RAEA 3L93A 4XWYA 2VDMB 2XUAA 3N5CA 4OATA 2VDNB 3WIBA 2IXFA 2LDXA 3QJYA 2I80A 1DKRA 1KJ9A 3M6AA 3ZZNA 4I3FA 4ARAA 4LYAA 1X6VA 3K2BA 3OI7A 2B98A 2OPHA 4EJMA 3DL2A 4UBKA 4FR0A 4P84A 1DQSA 3DO5A 4DDVA 2KW5A 2QNIA 3M89A 4BO8A 4MHSA 2YN4A 3PTLA 4GFDA 5CFMA 3BRWA 1YRBA 3PP8A 3HYSA 1IWOA 4US0R 3V7FA 2OT3B 3M33A 1A76A 4YJGA 4HH4A 2B0CA 1ECCA 1Q2XA 2XBMA 1II8B 3RKSA 1F60A 5HK8A 1V1JA 2AOUA 2FLWA 1JG1A 4H6PA 3VU3A 3T1OA 4BATA 5CLIA 1GSHA 5FA8A 3DL0A 1QBKC 3K0KA 4QATA 1NY5A 2YY7A 3BZBA 3C3CA 1VXOA 1DBSA 4CN8A 1E0SA 4NKRA 4GM0A 2GK7A 1Z4LA 1EZZA 3ANXA 4N3BA 2EKQA 2JCYA 2O7RA 1E4EA 3EASA 1JDZA 3OPNA 4IOKA 2CN1A 2GB4A 2HLNA 3UENA 1RZVA 4UVEA 2ZJZA 1SQ5A 2MT9A 1JTVA 3NHYA 3PRJA 3CYFA 4HMQA 4O02B 4ID3A 1B8OA 1M2GA 5KQPA 3RVLA 4KVFA 2LIVA 1F3OA 4BQIA 3CZMA 3DDWA 4L51A 1M6VB 4B6FA 1JHDA 1JIUA 4XGRA 4E08A 5DX0A 2QPOA 3P94A 1CDZA 1OJLA 3TZEA 4F84A 4G8DA 4F4IA 6REQA 3M0EA 2D0OB 2H3HA 5IJAA 1FNDA 3VSAA 3D5QA 1MW8X 4MGHA 2H4ZA 4EVSA 1EIZA 3V1TC 1MC1A 3D7KA 2RH4A 3RRBA 2MSDB 4CM1A 2HSZA 2OQ2A 4E12A 2BFBB 4K87A 4KXMA 2OYSA 1FNNA 1OI2A 1RC8A 5LMNB 1J23A 2X5JO 4WZ6A 1SXJB 4TMVA 1JHPA 521PA 4ERXA 2Y1CA 5L7TA 3H1FA 1RKQA 1CY7A 1PYGA 1GL9B 4YEDA 2EV9A 4WFJA 2F1OA 4Q39A 3L8MA 1EUCB 1SXJC 2R44A 3C74A 4FFBA 4NDZA 1S3FA 4QNNA 5H5JA 4PR0A 4DIEA 4QAJA 1EAYA 4DR1B 3WB1A 3AG6A 1CUAA 1X80B 3R6WA 3LZ6A 1RE1A 2P1ZA 1HFKA 4EI9A 3K8ZA 4MJLA 3C5VA 1Z0ZA 5EKUA 3N5KA 3B8HA 4ER7A 5KNCH 4UTNA 2J9FB 1UPXA 1NVGA 4P4LA 3I62A 4L8GA 4OP1A 1YBFA 4H4CA 3S5UA 4JYZA 3SCZA 1XRPA 5AVTA 1WUYA 1VJRA 2H1HA 1ESZA 4RO0A 2Q4TA 5KQMA 3DV0A 3EQZA 4RKWA 2FWAA 2NZJA 4P58A 2EG9A 5ALSA 4B5KA 4BGDA 5L3ZA 1OE0A 3LQ1A 4PQGA 2FJUA 4LXGA 5GV8A 3A1VA 2RMKA 1SCUA 2RHLA 2QNBA 4EKEA 4I9NA 3FBGA 1JSZA 3AERB 4C7MA 4LF9B 1MZVA 1G59A 1G5TA 2H7YA 3R0IA 3RKRA 4BWVA 3ZZUA 5BSFA 4B4DA 1ZA1A 4AYTA 5KOJB 3D2CA 2XAUA 4LSZA 1VKZA 5ILGA 4D80A 4WXRA 1WHSA 2C4UA 3NU1A 3DLTA 3FUWA 4IKOA 8MHTA 2QL5A 4JEHA 3TAXA 1X1SA 3SWWA 4HB0A 3WWZA 2CNWA 1HT1E 3TE7A 2DM6A 1D2EA 1E59A 2ATCA 1N5OX 2DHCA 1NFQA 2C42A 2RH8A 2VUSA 1YCHA 3ZHCA 4DJTA 3D3QA 4HYEA 4RGBA 2CXXA 2PPVA 3KSMA 3AUUA 1N1MA 3GGPA 2ZU0C 4TLEA 2R9VA 3H05A 3P19A 2CLHB 2W7TA 3UHFA 2FX3A 5KPDA 1C8LA 3WKAA 3C8MA 3TI7A 3LDHA 2BRUA 3PI7A 2HJSA 4GNKA 5DHTA 1QFMA 3FRIA 4YJ2A 1AA9A 1GVHA 1SXJD 1UBUS 5DWQA 5IK2A 4G0VA 1ACMA 1P7YA 1QV6A 2YOHA 1U28A 2FW9A 3KZXA 2JHFA 5CVJA 2AKEA 2WP8J 3UAOA 3EBLA 3GUZA 3FD8A 4UHHA 1BROA 3L77A 5C3UA 1SVSA 2GARA 3K0CA 5EWJA 1CDEA 3HDQA 3K2IA 3SZLA 4WMLA 4DARA 5CR9A 5AYVA 2OSVA 4XX1A 5CB6A 1AXRA 4L3WA 3AVXA 2PY6A 4RKQA 4ALMA 1RIFA 1GEGA 4R3UC 1Z7EA 1HG1A 4M7PA 4PYNA 1I5OA 5CDUA 4L8WB 4P7JA 4LF6B 5CTAA 1WXGA 4P2BA 5H68A 3GT0A 1GAQA 2QSUA 4E4TA 1N0UA 1ZYUA 2ERXA 4YUXA 3LWZA 2O3JA 2WDZA 4E07A 3UWMA 1U81A 4Y2UA 4FLEA 1XE3A 1L7QA 3KJZA 1WUTA 2WJVA 4L2IA 1CU1A 1U1IA 3PX2A 4DUGA 4GSKA 5BQ3A 4LV6A 5JCOA 3UJ6A 1JHAA 1U8CB 3URKA 4IEFB 4WXYB 1EJ2A 2GH1A 3BMCA 1AKMA 5T57A 3VZRA 4Z5XA 1DAKA 3RU9A 1XZNA 3EXG2 4MRPA 2LTAA 3R0VA 2XCSB 1KKMA 1L7RA 2CE2X 1GRVA 1JQLB 4OI4A 3WYAA 4L0MA 3IKVA 4LJ7A 1RRCA 4M6WB 1XL0A 3R0XA 1N6LA 1BX1A 1TZBA 1UZLA 2YWDA 1SHJA 1U2EA 3RVSA 2G67A 3HN7A 1IULA 3D3EA 4MPPA 3V2IA 1CJBA 4U3JA 2J08A 1K7XB 1KMHB 1XEFA 2X0JA 3DZHA 2WZQA 3V55A 2JIDA 4B6QA 5CB4F 1P75A 1YR8A 1EE9A 5GADl 5LBUA 2JBAA 4X0EA 3HS3A 1RBQA 3BMOA 3V4VB 9LDBA 3EXIB 1EHYA 2PMEA 4E5YA 2I2AA 1QTIA 1QYRA 2IPMA 1M67A 2ZANA 2J3QA 4FZRA 5J4HA 3EDOA 2BKUA 1CUEA 5GONA 4OAPA 1PUXA 5ALDA 4C0HA 3UUEA 2BP7A 2FUEA 4HP8A 3QW2A 1SU4A 2FPLA 3RVOA 1Z7BA 2QR5A 2XY4A 5DCLA 2ZREA 3I9LA 3LDGA 4ND4A 2Q3DA 2OLJA 2YWJA 3TLXA 1FQOA 3P2EA 4GZ3A 4RIHA 3W9YA 1TZ2A 1HKUA 3L9XA 1UZNA 4HMOA 3MYYA 4Q4JA 1PCXA 1Y4DE 3DTVA 1AKEA 1GN9A 4R83A 3NGLA 2O54A 2OHXA 5B4UA 2YRFA 2YXLA 1P19A 3RS4A 2C77A 4YJ3F 1TQ6A 4YMWA 3ZYZA 1XMOB 1PR2A 4JBLA 2AE2A 4I0WB 1X74A 1WPRA 3R41A 1PO7A 1EVIA 4RKFA 1OAKA 2OV4A 1P1IA 2Z1NA 3Q1KA 2XUFA 4JBYA 4Y6QA 5TT0A 5CYFA 4RXUA 1ONBA 1T25A 2EHJA 3I9V6 4KXNA 3CO0S 3WYBA 1PD0A 1I7NA 4ZZ0A 5CAEA 3C6BA 1FDSA 1P72A 3ONNA 3OLWA 4WACA 1U80A 2XZDA 3UV6A 2P9BA 2NWQA 1NC3A 4EPRA 1WLYA 4P86A 4B6PA 5D6OA 1Q1BA 1BD4A 2N46A 3NTRA 4GW3A 4ZOLF 2UYGA 2R85A 2CHVA 5CYGA 4CMAA 5AHXA 3IDAA 3IH5A 1XYVA 4R9VA 3WZMA 1K5HA 1P77A 1A5SB 1PIWA 4OLJA 5DLEA 1CY6A 2WRZA 4JI0B 1DADA 2AS0A 4KFTA 3VR1A 3PWZA 2PQMA 3LUBA 2AYZA 2NADA 4BFSA 1WCWA 3O3CA 3G89A 1TU3A 5KDLA 1A77A 2HYDA 3ZE1B 4BLUA 4IBOA 1FFBA 2V3VA 2C82A 4ZO8A 5FLYA 4I55F 1YE5A 1VJ0A 3G5UA 3G79A 2IEDA 3DOFA 4S0ZA 3G9XA 4U2KA 3SK0A 3ZE7A 3BF8A 4DDMA 3BPSA 4EB6A 2IE8A 3N8NA 5FFFA 3RDPA 2CBGA 5BV1A 5I8PA 3E9ZA 5D6NA 3S55A 3ADCA 5G3ZA 4AM8A 1ZD5A 2PZGA 3AI2A 3KQVA 2QRHA 4ZVOA 1F0YA 2Z2KA 4U7TB 3ROTA 4EHFA 1T34A 5H4GA 3QEKA 3Q0EA 1ZCJA 2R8OA 4N40A 4M1MA 4Z9BA 5K7SA 2JIZD 3IPLA 3GRAA 3Q85A 2VSOA 3LDFA 4G9GA 4UFPA 3MTEA 3T8YA 3LVFO 5EA2A 3JVIA 1ZCFA 2O6HA 2WWVD 2E4UA 1H2RS 1U8UA 4N7RA 1MAAA 4DAOA 2Z6AA 2GM3A 4L5BA 1RD4A 4QOSA 4RTMA 2VEOA 4NBNA 1GU7A 1VB5A 2P91A 1P61B 1I3NA 4J1TA 2WUDA 1QLWA 2Q9UA 1AUVA 2A33A 1DL5A 1F3LA 3O7MA 2VFAA 1JP7A 1J7KA 2QI9F 4DCPA 2Y0DA 4GMDA 1I6MA 3E3NA 1AM4D 1U2TA 4RVGA 4WQMA 1ZKMA 3OO0A 2GVNA 4Y0AA 3M4YA 2ZS9A 4AK9A 5EE3A 3T38A 4URXR 1A1VA 5IBQA 5AI5A 5E4JA 4MVJG 5KYWA 4ZI7F 2X1LA 1JIVA 3MFQA 2ZKLA 5KJ1A 2MDTA 2I9PA 2XI4A 3CSSA 3ELUA 4OFXA 2Q2VA 5LWQA 3TECE 5GAJA 1USGA 2HQRA 3CXRA 4DUZB 3IO5A 1EVQA 3EQ8A 3PD7A 3A31A 2F43A 2GAFA 3VPXA 3TR5A 2GZMA 3I28A 3TM4A 1LSOA 5L8VA 3PCTA 2ABWA 5IVPA 2QBYB 1LVUA 2O1XA 3FYCA 4RTSA 4DV5B 1XZDA 1ZH6A 3UGQA 4CGYA 1RXWA 4MKZA 4BKQA 3TRKA 4EJSA 3RSOA 4AZVA 4KYTA 4BFXA 2DT8A 2I6XA 1UH5A 1PWZA 3OCWA 4AY4A 3UV7A 2H18A 2JJ1A 5LKRA 5IWCA 3OHSX 2CJYA 2W6ZA 4UTVA 1WZIA 4QJ4A 3VDRA 1JBEA 2GBCA 5E1MA 3OU2A 1E0JA 2XMZA 1CUZA 1O96B 3SGLA 1KDPA 1U3DA 1VJDA 1XVVA 3K4PA 2F48A 4LHVA 5FKJA 2AGVA 5IZCA 3E5RA 4LZLA 5FYQA 3HVIA 1W9HA 4JI1B 4I5GA 4QZVA 3OJXA 3VJRA 1RQ2A 3SHVA 3BWYA 2XNDD 1WNTA 3NATA 4OUDA 4RVFA 5H59A 3B38A 4AO8A 1P7WA 2LW7A 5FWDA 3RK0A 1Y1LA 3PWSA 4GU5A 1JJ7A 3LC2O 4DN6A 5ECWA 1VMAA 4KIFA 1TYAE 4CKEB 1WQ1R 4DNPA 5ICCA 1NTRA 2R8XA 2UYCA 1Z6YA 2HT6A 1H85A 4M9RA 4ZU6X 5IBRA 2OCPA 3TD6A 1K89A 1PVVA 2YV2A 1IJEA 3IMKA 3UAVA 4G84A 2BFPA 3OCYA 4HZGA 4QJ5A 3GIDA 3V00A 3QHAA 1Y4SA 1L5RA 3AR5A 4CUZA 2A0UA 3CR3C 5KOHA 4E5MA 5IZ4A 2IWHA 4N0DA 3RIXA 2B7CA 3PDIA 1H2ZA 2JA2A 2ZT8A 2HNKA 4KMOA 4KXUA 5AHOA 4UQLA 1FYFA 1O57A 1RJGA 3AXTA 2JK0A 2DU8A 3RWBA 4D4LA 4FB5A 4PLFA 1MU0A 3E8MA 1WCXA 1SU7A 3BOSA 3ONEA 2X13A 1TFRA 3O4GA 3V2UA 2JGDB 3ZUGA 5HQTA 5GINE 4RZUA 2NO9A 5A9RA 1C1XA 2OMEA 3HCDA 3MD0A 2R68A 3LHDA 3RFTA 2EEPA 5KNCD 3GLFE 1XDZA 2XVXA 1AO0A 3FYHA 4LOLA 1MC4A 1MVLA 1WXWA 3FFTA 1BJKA 3PBKA 4LHEA 4M86A 1D2HA 2OCKA 4NHOA 4QRHA 5EP4A 3RVRA 1MX1A 4YP5A 4BO1A 1KVSA 3GA0A 4BPRA 4H31A 4XRRA 4HSEA 1XKTA 3LMKA 4RAOA 2ASEA 3H1BA 4Z4FA 1G66A 2XUJA 1YZ3A 3U31A 2WSYB 4YCBA 2YIVX 3K70C 3F5DA 3WJAA 1TYEB 1IY8A 1D4FA 1NW4A 1E9VA 3NHUA 5F2EA 5EP3A 1KDOA 2HA2A 3HDTA 4IS3A 1TA9A 3C16C 2DBQA 1GQRA 3OAAA 4TROA 3IE2A 4F7DA 1C81A 4IZOA 3S68A 1KMMA 4LBYA 2CYBA 5LA6A 2OBFA 3FDFA 1KBZA 3QSGA 4Z4QA 3Q7SA 4RJIA 5T4BA 3RSGA 5E7JA 5IAEA 2V1XA 5CH3A 1NMSA 1G0OA 1E5VA 4JB0A 4YY3B 1XU9A 5HE9A 2J07A 1HWYA 2HPAA 3MVEA 4UE6A 4Z0HO 3T4UA 5F9FA 4B09A 3PNYA 4BO7A 3ZQJA 4LZNA 1QZTA 1P4RA 1DBPA 1N9GB 2VWHA 2CV0A 4YJ2F 4DSOA 5DBIA 4PYMA 2KLBA 3IT0A 4FYVA 3HR8A 1CY4A 2HF7A 2DKFA 2IXAA 2O0JA 3H5TA 5EXTA 5IWAB 1ODKA 2C1XA 3JQAB 2OKCA 3Q7IA 4UTXA 1M7GA 3KXKA 1WL8A 1M1YB 2ZBPA 1JB1A 3ISJA 4BKMA 4MYDA 1ZXBA 1U02A 3VR4H 4V2IA 4QKQA 4JBNA 2NAPA 1RM4A 4RZQA 3QUCA 3RSQA 1GPWB 1JI0A 4PZCA 1R9NA 5JAIA 3UMCA 2GUWA 1E0DA 1ZD1A 1K8ZB 3PR2B 5JSYA 5FUQA 4JUBA 3Q87B 1RAGA 2BYTA 1GAWA 2GCNA 3RK4A 2J6CA 5HKKA 2Y8EA 5KZMB 4CMHA 2ZBQA 3LQKA 4DGSA 5EKTA 2QP4A 2C95A 3ZCTA 2X0DA 4HDKA 5CB8A 4JIMA 2LDBA 4ZVVA 3T7SA 2B21A 4UU0A 2DPYA 3ZOZA 2BFBA 1YQWA 3QF4A 2C59A 2I6UA 1ZMTA 1XVUA 4GKAA 3IP1A 1Z8DA 5CDFA 3PT5A 1QIJA 2GHQA 1ZJ5A 2YV3A 1YOVA 2JW5A 4IAOA 4EJ6A 5A4DA 4KRFA 2BBOA 1C29B 2O5VA 3OF3A 3PXEA 3VOBA 3JVDA 3TCKA 4OREX 3ZWBA 5HUQA 1C0LA 4ENSA 2ZUDA 3H9EO 1E6MA 5DWVA 1EK6A 4ZAFA 4JBHA 2XJ9A 3DLHA 2X2OA 3CZCA 4S1WA 1R6VA 1ISHA 4YASA 1IEQA 5SY9A 3WK6A 3O8RA 4JXKA 2QTZA 3CGGA 3QBVA 2Q2OA 2IZ7A 1MEJA 4RK5A 3T5TA 4OHZA 1DC8A 2G40A 3UA4A 3ZNOA 1ZG3A 4XPIA 2C29D 2ZI9A 2QD2A 3I52A 1E69A 5TQJA 1YU6A 5FI3A 2ORED 3ILVA 1O94A 4NBTA 5CUQA 4G67A 4JMLA 5AJYA 4EGSA 2QGNA 2X22A 2OEPA 4ED9A 1L7PA 2XT0A 3SJBA 1TMKA 1DXYA 4IDDA 1FS6A 1TM7E 1NU6A 5KU7A 2NMVA 1R8QA 4I4TA 4FLFA 1ZNXA 1Z15A 3GT3A 3MJDA 4O4JF 4BMSA 4CLOB 2FOXA 4C43A 1PYDA 4OYYA 1K08A 1X9GA 1GNLA 4WWHA 2XNHA 4ZOEA 1F1JA 1YRLA 4DM4A 3RJTA 2SCUA 1GG9A 2Z57A 2JI6A 3ZV5A 1ZXLA 1IH8A 1Y9ZA 1VBMA 3NYWA 3EGCA 3G2LA 3AVUA 1W0JA 4TUYB 1M6HA 3SSNA 1FTQA 1KMCA 4BV8A 1ML4A 2DFLA 3IPRA 2JFZA 1U9ZA 1GL7A 2LR0A 1F06A 2R6CA 3CUTA 4NPAA 4O4IA 5AJXA 5I5GA 2CXSA 1KSGA 4AX4A 4F8JA 2ZDGA 4Z3OA 4TS1A 4N5HX 2CLOB 1NVVQ 1D5WA 1KNXA 3QLUC 3D59A 3GGOA 2EHDA 5G1NA 1M1XB 1VLMA 3SQLA 4DUGD 2IEIA 3EHDA 1GZ6A 1KI3A 1NAHA 3A9VA 1JNXX 4QE3A 3PVSA 2ZWVA 1EXMA 2VJKA 5IYZF 3PNKA 3JU3A 3C15C 3P20A 4BMPB 3CE9A 3LY7A 1BW9B 4GEGA 2BJHA 1KH2A 5TT1A 5CEFA 1KYXA 1U90A 1UFRA 4GM1A 4Q15A 1ZOLA 2GCOB 1FFCA 4JKYA 4AMUA 2Z5FA 1OROA 4G56A 4GZ5A 4D0SA 2F1HA 1GFSA 1U7ZA 3FFXA 4JUFA 3RROA 4KRXA 3SQMA 2JGJA 1T36A 1G4HA 5LQRA 3L0SA 2K7FA 2IYVA 3O47A 1P39A 2Q1WA 3EUAA 3TSCA 5J23A 2OG1A 3I5UA 1XZIA 3A3NA 1NVKA 2RB5A 2IH2A 3AINA 1KJJA 3QJGA 3UXYA 3G49A 5BPHA 1EUDB 1UPTA 4CV1A 4JSYA 2RHOA 2HMTA 4MS4A 1Z08A 5I4IA 3D4BA 4GUDA 4D79A 2I4RA 2BFAA 4RZHA 1CRLA 3AO0B 3PC3A 5AJTA 1HDIA 4BRUA 1BWPA 1GNTA 2VAMA 3LHIA 5KYUB 3HY3A 5GONB 3T9EA 2EEZA 2C57A 1A7KA 2GCIA 4LXTA 5KQSA 3DE7X 2PWBA 1CXZA 1JPJA 1GWNA 1G8KA 1DLJA 1QTRA 2FF5A 1H1LA 1J24A 2V4UA 3F4KA 4JJ4A 4EX7A 4TTQA 4F9GA 1F8FA 4AY6A 2AX4A 2J7PA 3OKFA 3HCPA 1Q6ZA 4GC5A 5COQA 2B8NA 1EK2A 2X4GA 4X1KA 3ZLTA 2F2TA 2Y1KA 3IP6A 5C35A 2W2PA 2VCEA 3U9LA 2LCFA 4WCFB 5E7MA 5KQGA 1H2AS 4URUR 1PDWA 1PBNA 1T3ZA 2ZU6A 2AN5A 2ODWA 2A59A 4YGYA 3WGVA 5HKOA 1G5HA 2FN3A 1CCWA 3ZTTA 2C5GA 2ZWPA 4XWGA 3DMNA 5D86A 4CQMB 1H0HA 1NJ5A 4DWVA 2BSXA 2ERCA 2GEFA 2X7HA 2LE0A 4FILA 1P1JA 2JEZA 4HRYA 3IDOA 4C4RA 1SH7A 1X1AA 3ZWPA 2J8ZA 3BWXA 2RC5A 1CB7A 3HFGA 4HL6A 1ZRNA 3F5QA 4KGXA 4DV3B 4AQDA 1LX7A 4X20A 1N7JA 2JEYA 4HOYA 4EQ6A 1Q77A 1OVMA 1XNHA 2RK4A 4RORA 4Z4CA 1UK6A 3MQ2A 1WVIA 1G1MA 2VAWA 3R09A 4YDRA 4RMIA 3DV2A 4WD3A 3SYLA 5HUHA 4HBZA 2ZJ1A 3OAAD 1RWOA 5KPJA 4GDMA 4XAQA 3VNSA 4ZV4A 2VA9A 4KAXA 5GQSA 5J1SB 3UB2A 4WASA 2FR1A 1QNFA 4KTVE 2NO0A 3ROGA 2PKQO 1EA5A 4CL0A 3GDWA 2CL5A 4ARVA 4CMKA 4ZMBA 1JPVA 2GKSA 2XUQA 3MOIA 3D6MA 4KFSA 4XCXA 3SQOA 4BFLA 3A1SA 1QXSA 1W36D 1CJUC 1YOVB 2HA5A 1N6OA 3WC4A 2EGUA 3EG9A 2WWXA 3RSCA 2BM8A 5EEGA 3UV3A 3MWGA 1K63A 1SOMA 3F1KA 5G0TA 2QLTA 1HDGO 1Q1AA 4HUQA 3HCFA 4UBOA 1C4WA 4QPCA 6LDHA 1E2GA 5KHOC 4G0YA 3VHLB 2IOFK 1XKLA 4I6EA 2PSHA 3CLSD 2PZMA 5BQXA 3WGNA 1YR3A 2CVQA 3QX8A 4Q9NA 3EGWA 2VWQA 4HXGA 3JW8A 4MITA 2BD0A 2BGGA 4V0MA 2ZVJA 4GXQA 1PE0A 3PYLA 4O4HB 4V38A 3WLNA 1YULA 1WF3A 5EHQA 4ZANA 5FR1A 1THZA 5KTPA 3MT9A 2VF7A 2BCEA 3CNBA 4IFBA 4R51A 3SJ7A 1JR3E 1KQNA 4O4JA 3H9UA 2HLPA 4HEJA 1E66A 4I8XA 4CODB 1H4TA 2Q8PA 5DYTA 2RAVA 2Q46A 1FYVA 3FCXA 3H1AA 3MTDA 4UBJA 3L18A 2ZGVA 3OT1B 4IIDA 1RE0A 4QBTA 5ED0A 4C22A 2ZDQA 3LOPA 1QO0A 5DW0A 3T4EA 3L4JA 4UJ5A 3VM6A 1T2CA 2ZULA 2QVYX 4L78A 2VWGA 5HDQA 2RAUA 2JARA 3F5MA 1N9GA 2F9LA 3B9RA 4X41A 3UHJA 1OTXA 2BWJA 3ZQ4A 5KTNA 2BMAA 4MR9B 1VI2A 3TIIA 4J0EA 3H3FA 4DA8A 5BUZA 4TRMA 3ABIA 5A6SA 4P9NA 4PGHA 2FPSA 4OK3A 5KOYA 1A9QA 4ENQA 5K9ZA 4O4LA <