1JIKA

Crystal structure of s. aureus tyrrs in complex with sb-243545
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
319
Chain Sequence
TNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcus aureus tyrosyl-tRNA synthetase in complex with a class of potent and specific inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords tyrosyl-tRNA synthetase
total genus 105
structure length 319
sequence length 319
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2001-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
A PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1jikA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1jikA01
2A1TS 1GAXA 2DLCX 1GLNA 1XNJA 4JYZA 3Q10A 1EFPB 4JXZA 3N05A 1TYDE 4ZT3A 1YIDA 3A04A 3ND6A 3ISJA 4MLPA 3H97A 3TZLA 5KCMA 3ZJTA 5DK4A 3FOCA 2IELA 3FNRA 3SEZA 1MJHA 4MW4A 2TS1A 1NUUA 4ZT2A 3CVUA 5K0SA 1D2RA 3IUEA 4Q93A 1G8GA 1WXGA 4MWEA 1EUYA 4J76A 2QUJA 1JZSA 4NDAA 3PXUA 4E1AA 1BS2A 5KWVA 4WSOA 4MAFA 2DETA 2QUIA 2E21A 2QUKA 5EKDA 1ZUNA 2Z08A 3FWKA 3Q4GA 4H3SA 1YULA 2VTBA 2H29A 3LOQA 3VRHA 4MVCA 1ZJWA 4K0RA 1GTRA 3UK2A 3IVGA 1ILEA 4MQ6A 5TEWA 1N77A 3COYA 4CDNA 4PBRA 2VTBB 4MVYA 4ZT4A 4MUNA 3ZUGA 3S3TA 2J5BA 1EFPA 4L2IB 1NUPA 4MUHA 4DE5A 3D6UA 3D6VA 1N2OA 1OWOA 1X6VA 1U3DA 3SDBA 1WQ4A 4F4HA 1OWLA 5LM3A 2RD2A 1JIJA 1NZJA 1TYAE 2QJOA 4RPIA 2A84A 1Q11A 3QTTA 1Q19A 4R2LA 1LI7A 1KH2A 4R2MA 1K4MA 1J09A 2GOYA 1COZA 1N78A 4L2IA 3K9WA 1QRSA 1R6XA 3K32A 1KR2A 4NX2A 3KT8A 3ELBA 5K0TA 2D5BA 4DDMA 1JZQA 1T9GR 2X1MA 4AQ7A 3DLAA 1N2EA 3CLTC 3CR8A 4XSVA 3PNVA 4MW0A 1T6YA 2JANA 3ZXSA 1PFWA 5DASA 1N2HA 2BYTA 3KFLA 3HZRA 1M1ZA 2A1TR 4I6JA 2QTRA 1WQ3A 5HG0A 3FY4A 3COVA 5FNZA 1OWNA 4EG1A 2RE8A 3N9IA 3X1KA 4ARCA 3NBKA 2A7XA 4ZCQA 5F23A 4S1OA 3ZXIA 3UC5A 3COZA 3N2YA 3VGJA 5IJXA 1JEEA 1KAQA 3IMGA 1NP7A 2QTMA 4CDMA 3FIUA 1EXDA 1QNFA 1T6ZA 3FG9A 1KQNA 1O95D 1MC1A 3CLSC 3MUEA 3L93A 5TS2A 1S4MA 4ZT5A 4MULA 4ZT7A 1OD6A 4XFJA 4MW2A 2EJCA 1IQUA 3OP1A 1N1DA 2EL7A 4QREA 3N8HA 2O5RA 1U7XA 5H16A 1J1ZA 2WQ6A 1VLHA 4HK4A 2ZUFA 1QTQA 2PFSA 5LFAA 4MUFA 2HMAA 2WQ7A 5H7XA 2HGZA 3ZGZA 2WB2A 1GTSA 1M8KA 1H1TA 3OTWA 1JEDA 3NBAA 2V0GA 3PNYA 3AL0C 2C5SA 4QBTA 2DPLA 1QU3A 4MWCA 3IDFA 1MOPA 1I6LA 1KORA 4OUDB 3CVXA 2YWBA 1JIIA 4CT0A 1R6TA 1PFYA 4U63A 3E27A 5IHXA 1IQ0A 3TQIA 1PG0A 1VBNA 1WXEA 1G8FA 4NZPA 4MW9A 1GN8A 1I2DA 3DO8A 1OWMA 3AIIA 1MB2A 1Q77A 1UFVA 1M8FA 1G8HA 4GU5A 3GMIA 1EJ2A 3MXTA 1OBHA 2X0KA 1Y42X 1WJGA 2DUMA 1F7VA 2PZ8A 1N2BA 1N2IA 1VL2A 3H99A 4P2BA 4ZT6A 3F3MA 1H3FA 2A1UA 1KH1A 2JAXA 1NI5A 1T9GS 3HMQA 5J59A 1JMVA 1P7PA 1QU2A 2QUHA 4R0NA 5J58A 2BTEA 2X3FA 1O95C 3CLSD 1YI8A 1MAUA 2ZP1A 3RJZA 3U1VA 4MUGA 3G6KA 1HYBA 3CA8A 4EF6A 5FO0A 4NAHA 4ZCSA 4MUEA 3G59A 3IOBA 3VU8A 1WOYA 4YBRA 2AZXA 3ZIUA 1TEZA 4PBTA 1KAMA 1N75A 5KHAA 4Q16A 4EG6A 3H9BA 5DB4A 3CVYA 3IOEA 3H05A 1JECA 4DDKA 1O0CA 1F9AA 3MLBA 3PNBA 5BNZA 3HL4A 2OQ2A 2QTNA 4CQNA 1IFXA 1U7DA 1ZH6A 3ZJVA 4MW7A 2CYAA 4WNYA 1NSYA 4QRDA 4U7JA 4MW5A 2E0IA 4A91A 2H2AA 2XRYA 4KR9A 1NYLA 3ND7A 3PRHA 1M8PA 3UOWA 3UY4A 3P0HA 1O0BA 3SZGA 5JBNA 4ZCTA 1WXFA 1J70A 2CUZA 3A4IA 4DDHA 2CV2A 4G6ZA 4MW6A 2IJGX 4OJMX 1F4LA 1T6XA 3IOCA 4ZCRA 1J21A 1O5TA 3CLUC 4DJAA 2AG6A 5TEVA 4F3RA 4KR6A 3ILVA 1FFYA 2B7LA 1V8FA 3Q12A 3FHJA 1KP3A 1K97A 2XRZA 1WXHA 3IODA 3ZJUA 4EGAA 4TS1A 3SP1A 4RUKA 4FZJA 3UMVA 3FI0A 1VBMA 5J5AA 2J08A 4YP5A 1O96B 3LCJA 3MMXA 3SYTA 4MUJA 5DEOA 4UZFA 4G5FA 4YP7A 2J09A 1EFVA 3DPIA 3IMCA 4PY2A 4MWBA 1QQTA 1XJQA 3AG5A 3I05A 1QRUA 2PZAA 3HFJA 4NATA 1MAWA 1IH8A 1KKUA 4DLPA 3GUZA 1J20A 2J07A 4ARIA 3COWA 1N2GA 1TYBE 2QJTA 1U0BB 4EG5A 3IH5A 4JZYA 2PXHA 2IP1A 4EG8A 1EFVB 1YUNA 1A8HA 2CYBA 4KPUA 4MVWA 2CFOA 1O94C 2E89A 3FDXA 5TGTA 2QJFA 1U3CA 2AKEA 3IVCA 5FO1A 1IRXA 3CLTD 4HJRA 1QRTA 3KT0A 1OWPA 4YMIA 3L92A 2DR2A 3X1JA 1F7UA 2A88A 4JFAA 2V0CA 3C8ZA 2A86A 3AFHA 3DV2A 3RK0A 1R6UA 2VXOA 1JIKA 2A1UB 4KKVA 1JGTA 4GRIA 1GZUA 1RQGA 4MW1A 4MWDA 4KPUB 4PBSA 1N2JA 1WZ2A 1I6MA 1YIAA 2Z09A 2PG3A 2E18A 1H3EA 1PG2A 3TQOA 1MBZA 1MB9A 3LE8A 1M8JA 2R5WA 1IHOA 4I6EA 4HJXA 3CVWA 3KT3A 1CT9A 1O96A 1QJCA 1K92A 2J4DA 3CVVA 1VBKA 1FYDA 1M83A 2O8VA 4MVXA 3FH0A 2HZ7A 3NV7A 1ZH0A 3BL5A 2X1LA 1TFUA 3RFFA 4ZCPA 1EE1A 2CSXA 1WKBA 2DERA 1TQ8A 2CV0A 1KH3A 3GLVA 4BWVA 3A2KA 3MLAA 3X1MA 3HV0A 4NAUA 2GKSA 1KQOA 3CLRD 2WSIA 1EUQA 1IQRA 1XNGA 3ND5A 1JHDA 1NUQA 1XNHA 2DXIA 3M5WA 4XFDA 3CLRC 3SZ3A 2YXNA 4DNXA 2NSYA 3TZEA 3IUBA 1NURA 3G5AA 2CT8A 3QE4A 4U8HA 1OBCA 2PIDA 2A4MA 4YP6A 2CYCA 4OUDA 1IVSA 1I6KA 4I6GA 1X8XA 4K03A 4ND6A 4G5YA 4X0EA 1WY5A 3INNA 1LW7A 3P52A 3QTBA 4MUIA 1GPMA 1WXIA 3TS1A 2GM3A 4AS1A 5LLTA 3IMEA 1YUMA 1O94D 1PFVA 3AKZA 2YY5A 4HPWA 2G36A 1NUSA 1PFUA 2JA2A 1TYCA 1KP2A 5HUHA 3RK1A 1LI5A 2Z3VA 5AHWA 4ND7A 2NZ2A 3HGMA 1JILA 3JXEA 4MUKA 4EG3A 1B6TA 3H9CA 1V47A 3AG6A 3P0IA 2OV4A 1N3LA 3RHSA 1MRZA 3P0JA 2I1LA 4EG7A 1H3NA 3FETA 1J1UA 4UZEA 2DEUA 1K4KA 1DNPA 1Q15A 3RBAA 4EFKA 4KR7A 2ZUEA 3IVXA 1O97D 5HUJA 2D54A 1NUTA 4EG4A 1M8GA 4JXXA 2D13A 1ULHA 1G59A 1SURA 4J75A 3SEQA 2PZBA 2CV1A 3A05A 2YWCA 1KQPA 1O97C 1O6BA 3CLUD 3KT6A 3TNJA
chains in the Genus database with same CATH superfamily
3UAXA 5A4DA 3BGIA 3ILYA 1JQ3A 5IMBA 1TTHA 4N8EA 3ES9A 2OZVA 4S1WA 1RJGA 1W52X 1R15A 1AQ6A 3B53X 4TQ9A 5JSZA 2I9KA 2OLJA 1E7QA 1IXZA 4AUMA 5ALJA 4LHYA 1B3RA 2XIQA 2BF7A 4JBLA 2F8TA 2C20A 1VTKA 1C4WA 3CCBA 4J0CA 2H7XA 3IOYA 1DJPA 2AYZA 2G9VA 3LBNA 4ZT2A 4QARA 3WOVA 2QTHA 1YU6A 4EI8A 4UBJA 3T12A 1YNSA 2CJWB 3HCDA 5JOQA 3VR3D 3COJA 3MINB 2R87A 1BS2A 3DMRA 2PA3A 4WZZA 1U8XX 2BT4A 1NI4B 4BEBA 2V6IA 3WLOA 2BDUA 3VZDA 4OAOA 3RC2A 5EKDA 4Q00A 2Z08A 2GN0A 1W1WA 1T1RA 3FCSB 1VI6A 4KJZA 1E6UA 5F12A 1A88A 1G9SA 2HPHA 3CBGA 3KLPX 2QM3A 4R2IA 2NW6A 2FPUA 4K0RA 3KTAB 1F2VA 2ERYA 2RFLA 3CZCA 1A5BB 3H0EA 4QYIA 4BNTA 5J1SB 4LY9A 3U56A 5A05A 1WTAA 4LSZA 4B8ZA 3U09A 3WFZA 4BRSA 4KR0A 4WVFA 1DCKA 3U39A 3F3SA 3N3AC 1IL0A 1T2DA 1WG8A 3S99A 3OE4A 4A9AA 1TJ3A 2X19A 3JATA 4TRMA 4HFMA 2X9NA 4LNUB 3Q98A 4L2IB 5ICEA 5KPDA 5KREA 3D6UA 4X62B 4K6MA 1Q20A 1YQXA 3BSFA 3WQQA 2ERXA 2Z6UA 2JJ1D 4FLEA 5BT9A 3U5ZB 2I4IA 1JWBB 1LV7A 1YDMA 2ZJZA 1H0RA 2Y0CA 1H69A 3U81A 2VUUA 4P33A 1CFJA 2Y1KA 1Q11A 3QJYA 3PQ4A 3V32A 5B6JA 1DPGA 1ZWKA 1YRBA 1LZKA 3TH5A 1Y3BE 2Y1LA 3PYLA 4GM4A 1LPNA 3K2IA 4IXDA 3ZHTA 4OYHA 4OI0A 4EDFA 3ZCXA 3U7EB 1VE9A 4QUIA 1FL9A 1A97A 1DXHA 4LYGA 1E4YA 4MKRA 5B58T 4C6TA 1QRSA 3AO0B 3TQCA 2X0RA 3BX1A 5I6DA 4BC1A 1X1TA 1Y7HA 2RC6A 3UJ6A 1WB6A 2XKBA 3K94A 4F4DA 1JZQA 2Y6UA 3V9PA 2WW8A 1CUAA 4XSVA 5DPMA 4XFKA 3X2FA 1NWCA 1T6YA 3O1JC 4Y6QA 3OTOB 1WAMA 3EHEA 1JIVA 1SQ0A 3QKUA 5ECWA 4BQNA 5EIFA 2AD1A 2HU5A 5DHPA 1HFEL 4D3ZA 3OQNA 4KTTE 3AF6A 1P1KA 3UT5B 4AULA 4X1IA 3B13B 1GYRA 2BFDB 2P2GA 3ZG6A 1BDHA 2DKNA 1D9XA 2DU8A 1ZHFA 1H93A 4W8HA 2DBZA 4XVHA 4DFDA 7YASA 1ONSA 3JAKA 1YHNA 1OXVA 5DCYA 3V34A 2JLRA 1A96A 3IKMB 1U2RA 1CUCA 2G0TA 3NBUA 4O63O 4PC3A 5IJ0A 3KYCB 3SS8A 4MA0A 5AW4A 2TSYB 4IDBA 1P5RA 2HA3A 3BB4A 3H5TA 5B7PA 1T4MA 1PK8A 3DV9A 4CUJA 1U2SA 3QLJA 4N01A 3QW2A 1JR2A 2DY0A 3RVLA 4ZMSA 1TM2A 1BN7A 3M9WA 2ZWOA 3HDYA 3F47A 1E92A 5BWLA 4X20B 1NULA 2AVNA 1KJ8A 5TS3A 2JC3A 3F8SA 1G60A 1ODSA 2ZPTX 3B8EA 4JYMA 4OVKA 3WLTA 1LS6A 3H1EA 4D6YA 5BN3B 4X8MA 2BP7A 2FV8A 1ZK2A 2RAPA 1WXWA 2VDRB 5HK8A 2CY0A 2WWHA 1XYGA 4M4SA 1GAWA 3FTFA 1XFDA 4KU4A 1LLFA 1VSVA 1MORA 2AQHA 3AR5A 1WB9A 5IULC 2PDAA 1E3MA 4KODA 4ZHSA 2BGKA 5AVOA 3O73A 1G20B 1YR9A 4D3YA 4ENPA 4UQOA 2QRMA 4UQLA 1E1CB 3OTWA 2ZI4A 3JWEA 1DFGA 2QE7D 2ZATA 3QKRA 2FRXA 1PJRA 1ADYA 1HTBA 2Y99A 3AR6A 4RTSA 4LJKA 1VMEA 5A9SB 3RU2A 1H65A 2WFAA 3L84A 3EZ2A 4UCQA 3G2QA 5JZMA 3G8YA 4CM6A 1SELA 1UFKA 1HYGA 4D9JA 3JARB 2P6OA 2B94A 4A6XA 1GUDA 4KIJA 1CP2A 4U5XA 3DBOB 2FN7A 1SZPA 5TPZA 4LMRA 3RREA 4E2YA 4O2RA 2W93A 2DPMA 4UOZA 2Z8YA 3QF7A 5CLQA 2V7XA 4WLOA 2DBVO 5HDQA 3G68A 5IK2D 3BWYA 2CCGA 4MDFA 3V1NA 1Y6ZA 1H23A 2ZTSA 3Q85A 4Y18A 1FK8A 3UBTA 1A4RA 4GMXA 2G25A 1ZUNB 2OAP1 3Q0TA 2PHZA 4RKFA 1RBMA 2FY8A 4MOWA 4NYJQ 4OFZA 2H3EA 2PMEA 1SBIA 3IDOA 3EVCA 4RIEA 1AF7A 4CLRB 5CBPA 5HKBA 2HJHA 3E4DA 4AUKA 2Q6KA 2XX3A 4AJJA 4MCIA 1Y42X 4IFEA 1WJGA 2DUMA 2QN7A 1DAKA 5C1BA 1F7VA 4F60A 1JPVA 1MCZA 2BGGA 5CLIA 4UDOA 2NUAB 1UUFA 4TKMA 2XE4A 1QVVA 2I2BA 2QG6A 3R3YA 4RSMA 5DXJA 4A6PA 4DV5B 3AUXA 4Q5IA 3IQXA 4L8GA 2A1UA 2CC2A 5BO5A 3ZQKA 1JPJA 4NE9A 1MOZA 1UXGA 3DBLA 4KDFA 4B3GA 1H05A 1P1CA 2WHQA 1ZPDA 5BSFA 3ZBUA 1QU2A 2OGTA 4FFMA 3KEGA 4IGAA 3OZGA 3ZLTA 1JR3D 3GQBB 1LBSA 1CS4C 2EDAA 2QMOA 4JP8A 5JSKA 4B3RB 4W6ZA 5HQ3B 3PT5A 2RHOA 3EVGA 4KQ1A 2HQ1A 2RBGA 1PGPA 3DZJA 5DGHA 1AJEA 2FN9A 2ZUBA 3CZPA 3F5DA 3UO8B 3HVHA 4J0FA 2IQIA 5AW8A 4A15A 3DWEX 3FAZA 1JSCA 2YJ4A 4JEHA 2DQSA 5LBTA 4F8EA 2F62A 4LRSB 4UCWA 1TZBA 3RGWS 3FOWA 5IUNC 3LWBA 3HN2A 1NBOA 3E7DA 4F5DA 3E3LA 4HADA 2ENUA 5DVZA 3VFDA 3GP3A 4RWEA 5HILA 5LQSA 2UZ3A 1RYNA 5B1HA 4S35A 5AFSA 4LF7B 3VHXB 1O0CA 2AOTA 5D5PA 3C5WP 5CB0A 3F0TA 3MLBA 5C3UA 4EZEA 1KU0A 2GPYA 2HU8A 4YCAA 1PQYA 4F6CA 3KTFA 4QL3A 2OQ2A 3IJPA 2AJ8A 3AUAA 2VXYA 3RS7A 2V0NA 1W6UA 3BE5A 2EARA 3LAWA 4HLDA 3H5OA 3HCPA 4IBOA 2CXQA 5E1OA 1UJ6A 1UWLA 3RUAA 2XLCA 1NTOA 1YCGA 2UUOA 3EVTA 4EX6A 1Z2AA 1R0ZA 3W9BA 2P5TB 5EJ4A 1G9TA 2C2ZA 2YNMD 3HU1A 4FNAA 2C59A 4UOEA 4YUAA 1E3LA 3ND7A 1KZGB 4I3HA 3N74A 1EH5A 1DE0A 4OBEA 4DSZA 3P97A 4MS4B 5C1DA 1E5XA 4CV1A 3AK4A 4I2VA 1TEHA 3EIWA 3SJ7A 3ZDYB 3AY3A 2FPPA 1TTQB 3UV7A 3OD1A 4O2BA 5C7IO 4XLZA 1XWFA 3MF4A 4LYJA 4XXHA 2G71A 1Y8RB 5F2KA 4WA7A 4RETA 4BX8A 1E3SA 4C0SA 1DKOA 1UJBA 5CYOA 2X9GA 2R0QC 1O5TA 4BZXA 5JUWA 1E7YA 1RBZA 3DH0A 4FS8A 3U7QA 2ZZMA 1SBQA 4RF2A 1NW3A 1V9SA 1Y8AA 2P6MA 4CVNA 2PAAA 1G3UA 2RAVA 3BCSA 1DX6A 1AMUA 3WLMA 1B73A 3AINA 2K87A 3KX2A 4MS4A 1SHZA 2NLOA 3ZJUA 3QUAA 5AKYA 4TMTA 4AJOA 2M9MA 2RIRA 2ZPUA 1B15A 1SMKA 1AH2A 1YL5A 2FSUA 3PUKA 4OBWA 3IMFA 4B7AA 3GXBA 4G8CA 5IG2A 3OLXA 1T9BA 1K7CA 1U02A 4P35A 2TMKA 1KEPA 3BRWA 1KBZA 3MMXA 1KI2A 2ESRA 4QDKA 1T6NA 3GH1A 3IERA 4E32A 4QOIA 3BE6A 2J09A 1I7PA 2VATA 2YMPA 3JRXA 4M36A 3R8FA 5T41A 2M1ZA 3DAPA 1XJQA 1CY1A 3E8XA 1TLFA 2OFXA 1RBQA 1VI2A 1CF2O 1JXOA 2LDXA 3OIFA 1G8YA 5CXUA 4YY3B 1XZKA 4RCVA 5D3MA 5ES4B 1NG9A 3WKBA 5FBQB 2V97A 2VP3A 5G0SA 5BWOA 3JD0A 1UINA 3VPCA 2QMEA 3ICWA 4QUKA 2QYOA 5HXAA 1EK1A 2ZRKA 3PHJA 1RZUA 1GITA 1V8DA 2VXBA 2X8AA 3DYBA 4G3XA 2BELA 2IYFA 1PK9A 2OCYC 3BPSA 5THXA 3MWEA 4HC4A 2VHQA 3ZD8A 4FBLA 1L5MA 3CEJA 3SIPA 1XRMA 4U5QA 2O7NA 3PRJA 3DYIA 3OWHA 4A0RA 2ORIA 4D1YA 3EDQA 1AUQA 1TCBA 4QTTB 2P91A 5IYZA 4F2GA 4I50F 3C24A 4J1SA 1M6HA 1ZEMA 4LJ7A 5TF0A 3S1LA 1GVNB 1SUIA 2KE5A 3ET5A 3F6YA 2JLBA 3OZRA 1QQ5A 3ANYB 3CX6A 3I6YA 4UTVA 4ZIRB 4V1CA 1GDHA 1AA6A 4QC2A 1PDOA 4TT3A 1GU7A 5T4BA 2FH5B 4EKNB 2A14A 1NW7A 4AO6A 4IF4A 5TXGA 3C0KA 3W05A 4BQPA 4ARAA 2BBWA 2G76A 1Z38A 1RWXA 4NVRA 1OYWA 3H2YA 3KP1A 3R3WA 4FE4A 4I8DA 3GV0A 4OQLA 5J4VA 2BTEA 4OHXA 4PINA 1SU8A 2JW5A 1ZXBA 1IXSB 2HCJB 2QL7A 3T7CA 1J25A 2FWNA 4BMXA 2AF3C 4H08A 4HLQB 1J56A 3K6JA 3R3ZA 1I33A 4V0QA 1FLDA 2B99A 4CIVA 2IDKA 2JPDA 1DKPA 3TZKA 1RWVA 1U2ZA 1A9XB 1PG2A 3Q3VA 4KDRA 4Q82A 3WGJA 2G5TA 1KZHA 4ES6A 5KKCA 2IPNA 1UEJA 3UK0A 3WK4A 3RRMA 4CTOA 4YMUA 2FWRA 5JJBA 2WOJA 4MVJD 3SHWA 2IXGA 1KSJA 1E6MA 1S8OA 4PX2A 1WPGA 5AXAA 1KXJA 1KKLA 1MIOB 4LMBA 1JA1A 3IT2A 1ML4A 1O57A 5C32A 1XZHA 1RIIA 4PZLA 1X80B 1GTG1 3OESA 3IHLA 2G82A 4ZREA 2W6QA 1N6KA 4Q39A 3EQ2A 3THOA 3PNLA 3TSZA 1JUDA 2Q4DA 2DGDA 4K40A 3NIFB 3LHSA 4G41A 1WBBA 4GDFA 1AT1A 1N8SA 2I29A 5GIPE 1XCPA 2IZ7A 2QW1A 3K1TA 1I1NA 2MTBA 4LJAA 2V7QA 5E9AA 5BSTA 3RQIA 3T6KA 2CSXA 4LJLA 1ENYA 4B6OA 1SVNA 1KVUA 4TRJA 4M0FA 2XE7A 3GCXA 4J4HA 3TE6A 2A9KA 2Q9UA 2C95A 4G8DA 3O4RA 1IHDA 4I1SA 2OK7A 1TM5E 1YK0A 3DMDA 1G0NA 5A6VA 2OCDA 1X9HA 2FZVA 2D06A 3JVEA 3QMVA 3MRSA 4YHHB 1G4HA 2B2NA 4FJ0A 2QAGC 4AWBA 3DVRX 4LBWA 1A9XA 3RTEA 1FUKA 2LIVA 3M5WA 2G4CA 1LFDB 2NADA 2H2GA 5AHKA 1P0PA 4ZV4A 4G36A 3LPDA 5JY1A 1AUPA 3FPFA 3QKRB 1KZ4A 3WGVA 3STUA 3SLRA 1YBMA 2CT8A 1JLRA 1MW9X 1MJGM 4DBLE 1L7XA 1PQPA 1XK6A 2BMAA 2GYWA 2MSLA 1E2FA 1WDMA 2FW7A 4YJHA 4LOJA 5KNCD 1XVVA 3LVFO 5AT1A 3IL2A 3PPWA 1DEOA 5DTEA 2YBDA 2YYYA 1CQPA 2AUTA 2LGJA 3IP8A 4IHQA 1Z6YA 2QZJA 4XEUA 1A2QA 4QXRA 5B3JA 1XZPA 3D3KA 4LPKA 3UM9A 1X39A 2PGAA 4EPVA 4JLKA 4D6PA 2BGLA 3HB0A 4WTOA 2XJ4A 1PD1A 2HLNA 4PR0A 2O06A 4AY2A 1SU7A 4G9GA 1UPCA 3AKZA 3CRMA 2G36A 3FLAA 1KP2A 4G86A 2R79A 5J2TA 2J3HA 1IC6A 4DTIA 3DMYA 1MEJA 4DBZA 4OTZA 3FX2A 1ZKDA 3NR2A 5B1IA 3R74A 4CMIA 4ZOAA 4CM9A 3NHBA 1QLWA 1NN1A 4HNUA 3T41A 5BQXA 2YTZA 1C1HA 1N3LA 1U9JA 2HRQA 2WWWA 4QRHA 4X9XA 5A1JA 2RC5A 3TLGA 2II6A 1NRWA 3GLFE 3DP9A 4TLBA 4JR0A 3WRVA 1I3OA 4TLLB 1U7HA 3HO1A 3HKCB 1XA4A 3H9EO 3NYWA 1LVUA 3NNNA 3O7WA 3USCS 3K0CC 1BE0A 1D4AA 1P6UA 2G83A 4I46A 2B8EA 4REMA 3SG0A 1MO4A 5TVGA 5HUJA 1L8LA 1W93A 1P2VA 2Q5CA 1NLZA 5DNEA 1C1DB 4WJZA 1LNZA 5ICFA 2PSEA 1BS9A 1YB1A 4BLPA 2P6RA 1PDVA 3V2HA 2WUVA 1P1RA 2GXUA 4P81A 3F2VA 3I3OA 1Z33A 2IL1A 3AF4A 2O3TA 1NVAA 4GH5A 3W4IA 1YS4A 1NQWA 4WBSA 2NV6A 2P1RA 4DJJA 4H17A 4WX2B 4JH0A 4EPXA 3K8QA 1GKYA 3FMPB 5FBHA 4D5GA 2P90A 1TYDE 2WJ4A 3GRKA 1KEEA 3TTWA 4AJ4A 1QC5A 3KLNA 2CVFA 4U1RA 4ZAYA 1JSXA 1T3SA 1JVBA 2X8JA 1NVTA 3FNRA 5DHQA 4BIMA 4F4CA 4LFCB 5KYYA 4ZOEA 3RFXA 1GTMA 4PSVA 3CQ9A 4JHXA 4AS3A 4IR7A 2XRMA 2NIPA 1WB4A 2B1QA 5K0ZA 2X6QA 1JDBB 4HYTA 5KYXA 4CR7A 4J0JA 4MQBA 3HJBA 3WTBA 3F5FA 1Z26A 4Y0VA 1IOZA 4L07A 4LNUA 4O02B 5TQJA 5GONA 3E4CA 3IKVA 1VP3A 2FPLA 3L8MA 1KKMA 2AOWA 3ONNA 1J07A 2A0FA 4N76A 4BZQA 4YPFA 5JQGF 2F9MA 1GA1A 4HNQA 1F6DA 5GVRA 1ZUD1 2OXFA 3G5LA 5DI3B 1ZJWA 4JWTA 4CN8A 3KJQA 1SUFA 2GN9A 4EHBA 1GM5A 5AJZA 1FNCA 4DKXA 1JTVA 1JLHA 2I4RA 3KD3A 4JUCA 3A70A 5H9WA 1Q57A 3WMWA 5EZQA 3NUGA 3O4JA 4JP2A 2W98A 4IHJA 3HBFA 3T0IA 1JEYA 1C3JA 5FL3A 4IOJA 4MQEA 4G81A 1Z2PX 4F96A 3C45A 4BV2A 5A6SA 1R4MB 2KJQA 2ZYSA 4YAIA 2BN4A 3HYCA 4GGMX 4NXMB 4RZIA 5ULLA 4XDGA 1T5HX 3H4TA 3LC0A 4INJA 4DW8A 1XVTA 1HQCA 2QJOA 1ZNZA 3KLMX 1ONNA 3KB2A 3ANSA 2XUAA 4UMDA 1JHZA 2X15A 4XD7D 1D1TA 3ZR4B 3WLKX 1M1NB 3TI9A 5ELLA 4TT3D 1I4DD 3K0AB 2V9ZA 2J4FA 1UDRA 3HI4A 3WGLA 1U7PA 2FW0A 2GZ1A 2XDQB 3DT8A 1KARA 3EXHB 1K4MA 4J2TA 4R2MA 5L4LA 3HRIA 4PZDA 3PB3A 5LZ7A 2GT1A 1RLTA 2VYCA 1XCMA 1SHTX 4GLJA 3RH0A 4KTVE 4AXBA 2ZSDA 5CXSA 5J2UF 4BNDA 4PZAA 5A0FA 1LDGA 1S7CA 3Q3IA 4DDMA 5K0TA 4YPVA 4KQIA 4O4HA 4X85A 3CLTC 5JS2A 2BGWA 2PBRA 3N8GA 5JRDS 4B81A 1AVTA 2I2WA 3GJSA 2O48X 2W2PA 2DQYA 1CETA 3IR6A 4YJ3B 3AR4A 3ZCRA 3ZTWA 1KGDA 3U0VA 3KKKA 3W3AH 4AFNA 1MN6A 2C5AA 5IWAB 1LBQA 2ZK7A 1RIFA 3JX9A 3M89A 5FNZA 2RE8A 1G5PA 4P7GA 2GQ0A 3GL9A 1AC5A 3Q1KA 2QMYA 2EL9A 4IXNA 2EV9A 4MVJE 3A11A 3KE9A 2DHRA 3I1FA 3Q9LA 3WMGA 3FMIA 2Y9MB 3NWBA 1VJTA 2VH2A 5JY6A 2O2GA 5JVDA 1DTWB 3KPUA 4AUNA 4EF4A 4CETA 1RQ2A 4G26A 3WQRA 2XZOA 1U0NA 4RH3A 1IJKA 3O4GA 1P7CA 2P79A 4OQPA 2V7WA 4HEHA 2CMFA 3K9HA 3LY7A 2XUDA 2FDCA 3U6BA 3OPYA 2O2HA 1L7AA 1PWZA 4P4TA 5AVXA 1HORA 1ONOA 4JEIA 4YRGA 2AR7A 4ZPJA 2QE7A 5KNLA 5EMJA 3G17A 4XFJA 5IAEA 1A50B 3QEAZ 5F3WB 2EJCA 1RMQA 2VQDA 3K0FB 1QYXA 4JJAA 4JLDA 1I80A 4XX0B 2HWXA 5AKIA 3RS2A 4M8LA 3L6EA 4E5MA 2MSDB 3N8HA 3D0RA 3QI2A 2NT3A 3OE7D 3R0XA 3KVYA 4ZARA 2F7SA 1GTZA 2A78A 4I3GA 2EG9A 4KR3A 2M98A 3HN6A 2FB9A 7REQA 2GETA 5IEJA 1Y8QA 2F1HA 2Z95A 1I2BA 3PTLA 4TTQA 4AJ1A 3D1LA 1Z4QA 4EHIA 2ZKIA 2Q3HA 3V1UA 2DPLA 1X7DA 1LXCA 1R6DA 3CR3C 3TW0A 1AD2A 3OIWA 4PPFA 4ZZ3A 4UHJA 1Q16A 2HA2A 4DHEA 3VNVA 2D1YA 2P9GA 3B12A 3C48A 4DNOA 1X15A 2O5EA 1M3SA 1B42A 1RWPA 3E18A 4Z9BA 2PGIA 1PEKE 1UDBA 3GIDA 1ZCFA 4N8DA 5KYVA 1Q12A 2OBNA 3T3MB 2DHQA 1JA0A 1SR8A 3L4SO 4KVZA 5AUPB 5KO2A 3OM9A 1Q21A 1PG0A 3NIWA 2EGHA 4IICA 3AVWA 4EPYA 2OV8A 2XRFA 4U4AA 1FMFA 3UMGA 4F2DA 1DKLA 2HA0A 2VPTA 4MV3A 5DHFA 4RAOA 1HMPA 1CUYA 1F38A 2GYVA 3AIIA 3SMVA 4LSGA 2I4MA 4O3FA 1E6CA 4HLCA 4WKPA 1QPGA 5DCUA 2Y3IA 4ALNA 4URWR 2QMZA 2BW0A 1BFDA 1CP3A 3LVQE 5E6SA 4EUSA 2DHDA 3BMQB 4I4IA 3BD6A 4YYEA 3ZX5A 2AG1A 1TM4E 2P4UA 2NZWA 4K6HA 2OUIA 4XWGA 1DOHA 2FZWA 3T35A 1PYOA 3PSAA 1DARA 5KYUB 1EJBA 3IIIA 3DR5A 4OHMA 2C9MA 2DBQA 1O0SA 4CJXA 2XVXA 5T6BA 4HB3A 1ZG3A 2RARA 3WL5A 4HPXB 4NP6A 3U49A 3HWWA 1E8MA 1BYIA 2CNWA 3ESRA 3QNUA 1XT6A 2FP3A 5KQGA 4KN6A 3H3XA 2Y92A 1CSEE 3A9TA 3D4BA 1NU6A 4J0GA 2BBSA 5KSZA 6ADHA 3PUZA 2ZYVX 5EUMA 3LT1A 2R8XA 4FZ3A 4M3NA 4RPHA 3BJEA 3FUUA 4BIIA 4P98A 1E3TA 2R1ZA 3HXLA 1QZTA 3GCDA 2FUEA 3QVMA 1NJ5A 1NR7A 2AXEA 3EIUA 1J0DA 4JA0A 5E3IA 3SC2A 5BUSA 2JI9A 5FCDA 2GPAA 2WU4A 3NS7A 1J39A 1C8KA 1XSEA 2HTEA 2O2SA 4WKOA 3CO0S 5K0NA 5DRTA 4GMGA 3TRHA 5EP3A 2A5LA 2POCA 3BWBA 4GVPA 4NBNA 1YJBA 3B7PA 2BAGA 5T5QA 5KHAA 1IOWA 4EG6A 3L07A 3PKIA 2Y1XA 1HDYA 4GZ5A 4GOKA 3T7RA 1A04A 3WLRA 4C9BA 3ABOB 3L9WA 1KIMA 2BUAA 3Q5GA 4A27A 2PRYA 4HS9A 4AP5A 3IPYA 4FFRA 5G41A 2BI4A 5L3SA 3E8MA 3LOUA 4OHKA 3IEXA 5DM70 5JSQA 2FA9A 1E5QA 2N0SA 3C6XA 3EZYA 3HUTA 3KKMA 4LX0A 4QJ4A 2ES4A 3DOHA 4EIWA 3KQMA 3RS8A 1QIDA 5H3HA 3KOWA 2EFDB 3KKEA 3CX4A 4BAGA 2XVZA 2AYXA 1N8TA 2C07A 3DHVA 2VYNA 4Z6KA 3ZEAA 1JBKA 1ECJA 1K3TA 3UAYA 3VHRA 4N39A 1O0BA 3SZGA 1DQZA 1ZCZA 1KRXA 3KKNA 2BKVA 1W0KA 5CXXA 3SHTA 4IHJF 4UD6A 4XR9A 4EJ0A 4EVRA 1E7SA 3Q8XB 3ZBPA 5KQRA 4BNXA 4BFUA 4HNTA 1KYXA 2LIPA 1FBNA 5BPFA 1IBKB 1NE2A 1XPUA 5FBWB 5DIFA 2QNRA 4R5MA 5ILQA 3OHPA 1V16A 3LK6A 5JAHA 2B83A 3A9WA 2XEDA 3KCQA 4N4AA 3ZJYA 3HBMA 3TNLA 4EW6A 2ETXA 1KEWA 4OXRA 4M0LA 3T52A 4BLWA 4TSFA 3TQQA 3NDIA 4RTNA 2FSHA 4PWZA 4TS1A 1KOGA 1LK7A 4HG2A 4MVJF 4QO8A 4WERA 3PC4A 1OVMA 4AECA 3BMQA 2CMHA 5CDYA 2Q6OA 3HCBA 4RLFA 1VBMA 1RKXA 4E2XA 2NVUA 2VJKA 5IJ9A 4U6NA 3SSAA 5CAEA 4JV5B 1EWVA 1QBKC 3DBRB 3U7GA 2UYQA 1U2QA 3PF9A 4BJ5A 1J5XA 1E1CA 1PCXA 1RTTA 1YJQA 2XNHA 2Z9CA 4PAGA 2WTMA 3FZEA 3GY0A 2NTNA 5AHOA 3ZVRA 4CEHB 5A4IS 1QV9A 3KZXA 1JMKC 3HFJA 3KYDB 2BFEB 4QOSA 5EFZA 4JELA 3L1VA 1LY1A 1NQAO 3CTMA 2WEKA 3QU2A 4MWZA 4XYBA 5F3DA 5K3SA 2IDMA 2EOAA 2H2HA 4DLPA 1BQEA 1G7TA 3F7TA 1B2LA 3M4NA 4ZU6X 2Y1GA 3COWA 3C1OA 5K3EA 4DA4A 4PSDA 4X6LA 5EY5B 3GJ8A 4BPRA 3ZY3A 4OOEA 2R8PA 4XVQA 4TVBA 4Y2SA 5C46F 3W2TA 1R12A 1WXDA 3B6EA 3SIXA 1LSJA 3PQ6A 1IJBA 4LOAA 3ROPA 1FS4A 3H0CA 3QITA 1ZMBA 2FPGB 3ZS8A 1QHXA 2F2TA 2ZIVB 3AJEA 4LQDA 1SKAA 2OC4A 2E1RA 2KHZA 4MV0A 1R0KA 2IHJA 1NQVA 2Y66A 1IM5A 2J3MA 3G85A 1UOEA 1PJAA 3WSWA 1SZCA 2JIQA 1HDZA 4XDZA 5BVHB 1V1MB 2WJWA 2P7HA 3OMXA 3L7JA 1T1IA 5DM1A 2GF0A 4AZVA 2ID7A 5KKNB 3GAAA 1JAYA 1WNFA 2C2HA 2XQFA 4BJ3A 1YH3A 3SFTA 3ZS9A 4R9NA 2AFHA 4BO6A 2DUJA 2JIDA 1LEHA 2P4QA 2QZ9A 5SZHB 2NO9A 2AK3A 3F8WA 5IM5A 5JALA 3OI7A 3DW3X 3RJ5A 4C29A 1G8JA 3FVWA 3HU5A 4G0VA 4PO8A 4AX8A 3U44B 4DCVA 3WHKA 4RL6A 1V5IA 4E5YA 4CQJA 1YE3A 1DTWA 2HJGA 2IYXA 2CFCA 2QXYA 3G9XA 2VZ9A 4GM0A 4R8KA 1TJPB 5AKEA 4QATA 5E0OA 3ZU2A 1THZA 2PD3A 4K9SA 3A6KA 3K31A 5FUVA 3WK8A 5BORA 4YO8A 5F9FA 4EVIA 1S8AA 3L06A 1OY1A 1EXWA 2V7QD 3OJXA 4RVHA 2UZ1A 4GGOA 1PBTA 3EC2A 3QXXA 4N7RA 1KY3A 4OHBA 4ZRDA 2J9ZB 2NUPA 4G0MA 4UM8B 2NZJA 4EKGA 2WIJA 1UODA 1WZEA 4IDGA 1V5WA 1E98A 1ENPA 4KITB 4MB2A 2Y2UA 3CVVA 3RKSA 1FYDA 3GFVA 1R8YA 4OBBA 4LJRA 3KQUA 4EUHA 2KLBA 4PO9A 4TLEA 2PQ0A 2DLDA 1E9CA 3GK3A 3SXUA 3LA8A 3VV3A 4JVOA 1EFCA 3UT6A 4KQKA 1W19A 3PLNA 4X94A 3SHFA 3W5JA 3E7PA 4E11A 2F55A 3FA2A 1PX0A 1IN6A 1O9HA 2QVYX 3A3NA 2JD1A 3WK9A 4HV4A 1VSUA 4UNRA 5HZGA 4RABA 3R4CA 4URUR 1F5NA 1AUVA 1J7JA 4HDSB 1RI3A 2GKOA 3L7LA 2DUWA 2D4AA 4GOXA 1OA0A 3UTCA 3PVZA 4MI6A 4B8WA 4ZKDA 4Q4AB 2HIAA 4GBMA 3SDSA 3DW1X 1JE0A 1JKIA 4MV9A 1XNGA 1HE8B 3FW1A 3BXOA 5CH5A 1YDWA 1WVGA 1FUUA 4JLWA 2DJIA 1Q5PA 5CRIA 3EFOB 4L08A 3VM6A 3LPMA 1KFBB 1RC1A 3DDNA 3E5HA 4I4TF 4A10A 3D8RA 2YWDA 3FYUB 4XQCA 5DI3A 4AD8A 5CW1A 4UVEA 3AF0A 4FKBA 4FEYA 3G5AA 4G89A 4PYNA 1NXXA 2OKCA 1V2GA 2JFPA 4W5RA 1LZLA 1O94A 1OX4A 1OBCA 3BJZA 2FGJA 2NO7A 1YSCA 3F6BX 3I01A 3W4KA 2WAMA 4GMKA 2ZB2A 4UTPA 4D80A 4F04A 3GLIB 1BW9A 4YI3A 4R3UC 2FEAA 1KI8A 4X0EA 3ZZ1A 2ZI5A 1KHTA 3ZOKA 1MC4A 1YQQA 3ETLA 1JQBA 1AV6A 1RWOA 1CZNA 1RABA 1GPMA 1SUEA 1T0PA 1U2PA 1YBHA 2BM9A 2N9UA 2O0MA 2QMUA 5LA6A 3VNQA 5KTKA 4M1MA 1W1UA 1Q84A 4NEQA 4X95A 2F43A 3PVCA 5EQTA 1NW6A 3DTYA 4P38A 1SWVA 2YY5A 3K8YA 1WV1A 4I50B 3JZDA 3MS7A 4Q3DA 2NYUA 4W1SA 4JVNA 4ER6A 4OGGA 1HE4A 2DWCA 4FW8A 3TO5A 2OORA 5BV0A 5AVWA 1Y7IA 4X1OA 1V47A 5I9NA 4GX0A 3C98A 4X92A 1Q6YA 4XQEA 4IIUA 1X7YA 3GWGA 3ONDA 3P0JA 5J2TF 2DQZA 2HHJA 3TBKA 3CZ9A 2UZ1B 3EDRA 1J1UA 4MS3B 1XZDA 1YZTA 1Z37A 3D8SA 1DNPA 2ZUWA 3F74A 4IV5A 4QBIA 3RSGA 3LXMA 4AZ0B 1EQ2A 4B6FA 5LR6A 5CB4B 2OA0A 4BE4A 1Z7EA 1WNTA 5JSFA 4ZRNA 1T5DX 3VAYA 4U9UA 4CEIA 3OPNA 4OXQA 5H83A 2TMDA 4H59A 1PGJA 4PNPA 3QVXA 4LAFA 5FOSA 2ZT6A 4XGIA 2YWCA 1SQ6A 1ZX1A 1JQEA 3EEFA 3DEIA 2ZEJA 1O4WA 4QELA 5FULA 3OX1A 5G3ZA 3TNJA 2FNAA 4G0NA 1EK6A 1Z5GA 2MR6A 4G1FA 3RRZA 4E5UA 3DLHA 2VHTA 3TOSA 4XQGA 2UXBB 2NP6A 5LYJA 3GJ6A 1K75A 1ZM7A 1C8VB 4ZT3A 1A8UA 2BH2A 1Q1EA 4A73A 1FFGA 1G55A 3MFQA 5E3JA 2A0XA 1HDEA 5FUXA 1SIUA 1GGKA 1OLSB 3F4BA 5HKAA 4FFLA 1DJLA 1I36A 5IAAA 2BMDA 1MJHA 1YI1A 2P77A 3QU5A 1FTQA 4LY0A 5AKZA 4WASA 4LYEA 1T5SA 3LDHA 4N6GA 4L5IA 1IIBA 1WXGA 3SLGA 5JCOC 3O3MB 4GVXA 1RQPA 5EP1A 1WCV1 4BGDA 3KZOA 3B3FA 3FNBA 2F00A 2CXSA 2EG5A 5DYNA 5KWVA 3P9PA 4WSOA 4G84A 1NJ8A 1VL6A 2AN5A 2BPOA 3MWYW 4MEJA 1IEWA 3EMVA 3L8CA 3RU9A 1OE0A 4RZQA 1GNTA 4JA2A 4M83A 4UARA 3LW8A 5GTDA 3M6VA 3PE6A 4HVTA 5FORA 1ESEA 2C8VA 5ESRA 1V37A 3S5JA 3I12A 4D9GA 2W4QA 2HWYA 3DVQX 3T3EA 3LKBA 3JYNA 5KTMA 4Q1DA 3AOEA 4TKLA 2JBAA 3GLGE 4A2WA 4CHGA 5EMKA 4PBRA 2F3QA 2RHWA 3FKJA 3FVTA 4N9WA 1VYVA 3H2JA 2J5BA 1UEXC 2CJXA 3JRNA 3KKLA 4XIJA 2SKEA 4XOIA 5LMUB 1HLFA 1ULAA 1KVTA 1XA0A 2OCPA 4IL5A 3D6VA 2B36A 2GM9A 1GG8A 1S2IA 3EK2A 3HDJA 4NYIR 4XCVA 2VQFB 1X6VA 1O8CA 1JBEA 3JZAA 3WJ1A 4OX9Y 2H1RA 3E7WA 2NVUB 1RXYA 2A5FA 5IJ9B 2C7QA 1JIJA 3BWDD 3O21A 2R6AA 4KCGA 3UW1A 2HSDA 4DV1B 3WO0A 1MA3A 1XHLA 3PENA 2YIMA 2L69A 2VEDA 4X6UA 2Q3LA 1HYQA 2R2GA 1H9AA 3ZDRA 3QZUA 5JEEA 4QNMA 4WXRA 4IRMA 3LT0A 4YCDA 4AICA 1AUXA 1E2MA 3EH1A 4ZJZA 4KFRA 1JHOA 5L53A 4YJ2A 4KI0A 3VNRA 2E37A 3V8VA 4LZAA 5LBIA 2ZI9A 2UXCB 5EP2A 1YDHA 5LP6C 3EVNA 2NVOA 1CIJA 2G0AA 4L57A 3WBBA 2Z0MA 4AJIA 1A9TA 3D2CA 4R7GA 4ZVPA 1ZY2A 4KREA 1FU8A 2C7OA 1YKSA 1I2AA 2JANA 4J07A 4QA9A 4TMVA 3QOXA 3EC1A 3CZ5A 5GJCA 2NP7A 3ADOA 1OLSA 2O50A 4R81A 2BLLA 2B7BA 3EN0A 4LF5B 5EIAA 3RUHA 1FYVA 1US8B 1CUFA 3H4VA 4OHWA 4QQ8A 3H86A 4D3DA 4UEWA 2A7XA 2NV2B 1I32A 1TK2A 4NYMQ 3B6IA 2V5UA 2AK2A 4OY3A 1E0DA 1Z2DA 2LWIA 4QQNA 3GUYA 4RM2A 1A3CA 5DNUA 2QAJA 1Z6QA 1K2VN 2ATXA 2BGNA 3ETCA 1T6ZA 3Q88A 3BRSA 4YWJA 2BSAA 4FOSA 1FFHA 2R65A 3OKPA 3Q3GE 4HXFB 1QHYA 5A3VA 3TW6A 5JWHA 4AX4A 3FHTA 5ALIA 1JL3A 2ZWAA 3D9QX 1T2CA 3E5NA 4EAAA 4DR1B 1W5FA 2V9CA 1KDVA 4TYMA 2QD2A 3OX2A 3WLFA 1FVXA 4V03A 1U31A 1J8FA 3ORHA 2PK3A 4NZYA 1ISJA 1O1YA 1OZGA 3LBHA 3N2LA 3NWEA 2GK7A 2AN1A 4TUYF 1N8KA 1D6MA 4C0WA 2HJRA 2JBHA 2Q2QA 4BY9E 3OEED 3I34X 5ES3A 2EL7A 3GRFA 3SBXA 4E5VA 2A67A 4K1LA 4FEGA 4HXGA 3FUCA 2FFBA 5JU6A 5T4EA 4D3FA 3HJHA 4BMDA 5U1PA 3D7MA 1W0JA 1YDFA 1N0UA 2PFSA 2SBTA 2VDWA 3HUDA 4KC0A 3RTBA 3KYJB 4B6PA 5FWDA 2PVCA 3MLEA 1GPDG 2ZJ3A 3KG2A 2YS6A 1R8SA 5ENZA 1YXMA 2VOJA 1K3UB 3ANNA 3WLNA 4CN9A 1U7UA 4FSXA 1CVRA 4CLOA 5F4BA 2OT3B 3F7MA 7MDHA 7ABPA 1KEKA 4OB8A 5ALDA 3WRXA 5DWQA 4KRYA 3HDGA 1KJYA 4J2HA 4KHZA 3ZDAA 2IXAA 3WQHA 1QOQB 1E1MA 2HO5A 1UOOA 3S2YA 2AB0A 1JIIA 1H2WA 1RRKA 2B8JA 4MV7A 1EUCB 3I62A 1RHKA 3A3YA 1J0EA 2MMCA 4LE1A 1IQ0A 1NVUQ 2ZRFA 4MPJA 4UVGA 4TVSA 6AT1A 1D0SA 1NQUA 4AB1A 1ZOPA 4GX1A 4QUDA 4MK4A 3RRXA 5C1PA 5FI1B 5CXQA 2YN4A 3IAFA 3UJDA 3NHWA 4RQUA 1Q77A 1YOVB 4XCXA 5BOVA 3IPRA 1CZLA 3H7IA 5CMLA 1KMHB 1Z6AA 3GMIA 3EFOA 2BMEA 2H1CA 2FPKA 5TQ2B 4HDSA 1WMDA 4EAQA 4ZI7B 1HDXA 5BNTA 2GZ3A 4N0PA 2NXJA 2GZDA 2FZKA 1JFVA 3IHWA 4M8IA 1I1QB 5DISB 1AF4A 4MHTA 1V48A 1T35A 4HMOA 3WWZA 1B8UA 1NFQA 1ST2A 3E1SA 2QR2A 1Y63A 3OC0A 1C4OA 1X13A 1YJ8A 3GGJA 4UHHA 3JALB 3W2GA 1T9GS 1J9GA 1GQOA 2AMJA 3B1FA 3QG5A 3L7CA 4BNKA 3NMUF 1DEXA 3OM1A 2QDXA 3CKMA 3CVJA 3QPBA 4M1SA 1VB3A 4P4SB 2ODNA 5E3HA 4C7MA 4D25A 2RHJA 1NFRA 5ALTA 1H2FA 3MAGA 3TBHA 5BNIA 3I5AA 4J3FA 2O8BA 1QDUA 3A4TA 2VUIB 4UXJA 4C0XA 3OJFA 2IWHA 1FQWA 4C2UA 1WQ1R 2R1TB 4LZPA 5KTYA 3BF7A 5ADHA 1OFIA 1HYBA 2CEAA 5SZIA 4Y1FA 4DLXA 3F6PA 4WADA 3M4XA 1CY2A 5CD1A 3OFND 4D9CA 3DNPA 2D2EA 3GLUA 2OK8A 4KBGA 4E3WA 2OSVA 3EMDA 3LO8A 2JAWA 5H82A 2IZOA 3AI3A 4JSTA 4M1EA 3STHA 4DB4A 1I7SB 4C04A 5A2QA 3WP1B 4I1PA 3VTZA 1LPBB 3BKXA 2EJTA 5BWCA 1XD2B 4GKAA 2YWHA 4J7UA 4R3NA 5TY0A 5T64A 1AE1A 4HP8A 3FWZA 3VO2A 1I5OA 4LV8B 3WAJA 4TS4A 3LCCA 3P45A 2PIAA 3I8OA 2CD7A 2LTAA 3JQDA 4BLQA 1BMFA 3BFKA 2CUTA 4ROSA 2NZUG 3LI2A 2AFHE 4B48A 4DA0A 2AOTB 1T0BA 2DT8A 2JLAA 3DUFA 4DMRA 3ZE6A 3VO9A 3DC2A 3DMHA 1PAUA 4TKVB 4U3JB 4Q4LA 3R7LA 3UB2A 4HTFA 1MX1A 5AESA 4I9GA 3CT4A 4LZJA 5EKTA 3VGPA 4YCNA 2IF2A 2Q3EA 3RIMA 1UJCA 4KO8A 1P5HA 3G9ZA 3P0HA 2ZIEA 4YV0A 2A9OA 2R9VA 5JCZA 4NPAA 1XDUA 3MTEA 4A1OA 1J7KA 1EGQA 1PNVA 2IUYA 2PLRA 1CQZA 3I8XA 1EVQA 2A5GA 3UBMA 4MRNA 3H1PA 4L4RA 4UTZA 1Y5IA 5LQAA 4C2TA 2PX5A 3HKBB 4IWXA 3WKCA 4PRZA 4K9LA 2ZQYA 4JMPA 3PTZA 5B58C 2WNIA 2RGAA 3K9LA 1LJ8A 3LKZA 1LDNA 3UB4A 3E15A 4JOCA 5BOSA 5HIJA 5TEVA 2BFEA 4BB9A 5T3UA 2ZM6B 1SEVA 1XAGA 2B3TA 1E77A 4JJ4A 3A4YA 4R1SA 4WOJA 1RT9A 3CFYA 5TPWA 1T43A 2XDQA 3FB1A 1K97A 5A5GA 3IODA 4P54A 3AVUA 4FKZA 1M1XB 4G09A 3P9CA 3SVLA 5KNBA 3FI0A 5HCNA 3THSA 2DFPA 5FLKA 2I7CA 4CM4B 2FCRA 3NO4A 1KYIA 3AJ9A 2C61A 1OW3B 3KO8A 3MJFA 4L6IA 4WRRA 2PZMA 1ONPA 3HO6A 3S44A 3QBDA 5EHZA 3GR6A 1O96B 4BWYA 3F4LA 3UQYS 2AZTA 5CCEA 1DC3A 4X5OA 3TNYA 4DIKA 3IMCA 1E9VA 3OUUA 4PY2A 4EKYA 1S89A 5HGXA 3I04M 4MQEB 4B47A 3AFOA 3KU1A 3EVDA 4HVCA 2B4QA 2P69A 1XTRA 2YJGA 2BBOA 4NOKA 2C2XA 4Y30A 2QT1A 4NATA 3WRWA 4WI1A 1TVKA 2R6ZA 3GOQA 1E5TA 4WCDA 5DN6A 3AUFA 2K2QB 3KQTA 2HQRA 2XUQA 1Z7BA 2JVKA 3JQ7A 4X90A 1TYBE 4C22A 4DCMA 5AHRA 2XCQA 1U0BB 1KI1A 3V2UA 2VKTA 1UIRA 1BMDA 1XTKA 3DOEA 4EJSA 1OAAA 1Q22A 4ZOLA 1JDUA 2IW1A 3FNEA 3DQQA 1E6KA 4GI7A 1E2LA 1YB6A 5A5VA 1KE2A 2FU5C 1DIHA 1V71A 2VA8A 4KX5A 4OLJA 2QBYB 1VM6A 2DPGA 3E58A 1SC3A 1S0UA 3PK0A 4FMCF 3H9UA 3UG7A 3WP0A 4BFVA 3KFVA 4Q7QA 1D09A 2J0QA 3SY8A 5CVTA 4GBED 3MGKA 3KPWA 4JY7A 4EEKA 4BHTA 3SF8A 4KAAA 1EGHA 4DR3B 1OXTA 4Y2TA 1JQLB 1XMSA 2ODAA 4B6GA 3L92A 3G13A 4B3IA 1G9XA 4F2PA 3KSUA 4LRXA 1SOMA 2ZJ2A 1QXSA 3OZ7A 3RSZA 1E5VA 2JJ2D 3LWNA 2GZHA 4M9ZA 4UCXA 4UHCA 4QODA 5SY6A 3FGZA 4E03A 1EI9A 3FOBA 1E1LA 4YROA 3GROA 2OHVA 4G5QA 5IAKA 1C29B 2B8TA 3BWMA 3GEIA 4C88A 3N75A 3D5TA 1U90A 4PAMA 2CEKA 4QTYA 2PS9A 4HH4A 3VZCA 1L4EA 2BFDA 2A8YA 2IHUA 3WWEA 1SXJC 1XQVA 3B9QA 3H1BA 1E89A 4P4GA 5P8WA 5HR5A 1YO6A 4JVLA 5LQNA 3SF8B 4EUKA 2VHCA 3WNBA 1K4YA 4X65B 4B85A 4CG3A 2GFHA 4BQIA 3TG8A 4PRLA 5KNCA 4CDRA 5AKXA 4WLEA 2D5LA 3JAKB 2BZ1A 1H5UA 1X86B 1CT9A 1TEVA 3FMOB 4IMJB 2AVDA 4KPGA 1Y34E 4NARA 2ZSHA 4QPZA 5BSKA 4YRIA 2WD8A 4C4PA 4HWPA 5DK6A 5LZ2A 4YJDA 3PA8A 1BO6A 1BZYA 1AKYA 1CG6A 3CBQA 3LQRA 4Z8XA 1LTHR 4FQ7A 2QVZX 5DJ5A 3C5CA 4IJWA 3V4FA 2HZ7A 3AC0A 2HHHB 1K1EA 3JZMA 2I3BA 1GVHA 1EE1A 2X4IA 1JR4A 3UGQA 1XBTA 2HMSA 4FHGA 4WOKA 1Z6ZA 3RANA 4ZDWA 1N7JA 3BSSA 4WKGA 4LZWA 4EQ6A 2BL4A 3CSSA 4IG4A 5GAJA 2R1UA 4FDTA 3DB2A 3C7DB 3V80A 1FMCA 5I7FA 1OAOC 1M5RA 1K8QA 2O7QA 2OP1A 3PR2B 4Z8YA 1RYFA 4R8VA 4XSHA 4HPJB 4BP3A 4JYPA 1SCUA 3E05A 2OGSA 3KR0A 2WYHA 2ODQA 3F7OA 4FMBB 1V8BA 2R7LA 4IYRA 2HIGA 4F8YA 5KWIA 1SOWA 2BSQA 2H57A 1FZTA 1QLHA 4C3UA 3ZKWB 2XA9A 2I2CA 1HQDA 1XQ6A 3MW8A 1YJ5A 3BFPA 3DZBA 3UENA 1BXKA 2RH5A 5A0TA 2YXNA 3D3JA 4PCVA 1I14A 3TZEA 1D1PA 2AOUA 1NLFA 3H2GA 3EFEA 4EI7A 3FCOA 5CX4A 1R1DA 1SVMA 1H0SA 1QAMA 1T0JB 3IQDB 3P1JA 2ZROA 1IHXA 3GHHA 4L3WA 1KDTA 5DYTA 1G6OA 3RFVA 5EP4A 3QEKA 1IVSA 4JI8B 1S2GA 2FZEA 1RE1A 1ICIA 2O3RA 3N28A 2XGJA 1W5BA 1KEVA 1XJCA 2GYUA 3AFMA 5FQNA 1NDHA 2R25B 3EODA 3GPBA 5D6NA 5EWMB 4ITRC 3L1IA 4MVJM 1DRUA 2R8ZA 1EHYA 3QJGA 3IMEA 1F0KA 5EQFA 3R09A 2WAOA 3N0WA 3SAJA 5B1SA 4QG7A 1J2JA 1PFUA 2B6HA 3O4HA 4HQKA 4R68A 1CQWA 5AW3A 2EF1A 1LI5A 4TYNA 4EVQA 3QOYA 3LRPA 3KHUA 5F33A 4N9QA 4RGQA 4XWKA 4W1QA 4MI3A 4JI6B 3FHLA 4XH9B 1RMTA 4TKVA 3P2IA 1Z22A 3BKWA 4TGLA 5EOVA 5IBRA 9LDTA 1P2BA 3VAZA 4D3SA 4EG7A 3Q1LA 3E03A 2OV3A 3QVWA 2BHRA 1Y0BA 2DKFA 3QHPA 1YS6A 1MAVA 1YA4A 3DG9A 4ZV9A 2H16A 3OECA 2XMQA 5JBQA 1E0AA 3G0GA 4DVJA 1Y4DE 2O7RA 1KI6B 1NUTA 1YGYA 1MQ8B 4UJ5A 3AOGA 1AQLA 3PUWA 4CKZA 4GKVA 4OGFA 4JXXA 3T3OA 4H7IA 4NV0A 1DC7A 1D04A 1KYQA 1ZM2A 2HD4A 2I4TA 4R54A 2PZBA 4V0MA 5EJMA 3RTCA 3RUPA 1W94A 1TVMA 1M6YA 1DKRA 1V5GA 1KQPA 1CIVA 1PJSA 2Q1UA 4IDAA 2E5FA 4JNKA 4QSHA 3ZIAA 3DDUA 4HB0A 4DLNA 5AW0A 2PLFA 1CYEA 3NRJA 1NQTA 2P5YA 1PGOA 3IHTA 4CV3A 5AKKA 4EUNA 4DARA 4BNJA 4BKRA 3B3AA 5D84A 1ABBA 3ZGXA 4D4KA 1KOJA 1KY2A 4AQYB 4TM8A 3OPQA 4CM8B 5B4VA 1DWUA 3C3DA 2WNHA 5CM8B 4ZEXA 2HDOA 1C1XB 4PYMA 4DMUB 2DAPA 2OO5A 2TS1A 1SUDA 4FC7A 1CVIA 1MHPA 2NXNA 3ZWMA 1CDZA 2XTMA 1V35A 2XXJA 3D7LA 1T3GA 3GDWA 1LTQA 4NMLA 5MFZA 5FNVA 1F8XA 1GZDA 1G2IA 2BR5A 2CKMA 4YRZA 1W30A 4GPZA 1GFZA 4FFSA 4MZXA 1UT6A 4KW7A 5CFRA 1Z7GA 2RJNA 4IIJB 3C6MA 3I0MA 3KSDO 1JZSA 4BFWA 1K5DA 4QHYA 1C7FA 3EXG2 4UUAA 4H3KB 1ZWLA 2XNKA 3FNQA 1BS1A 1UF9A 4YT4A 4F3KA 4L74A 4YAOA 1T3TA 2QN9A 5F1YA 1PNTA 2X0DA 3EXHA 2YZGA 3G1WA 2O2JA 1NVFA 1O3YA 3R3SA 4L1KA 2PUHA 4RTOA 3EZFA 1B16A 1OFUA 1SVUA 4H1TA 3GHYA 1SXIA 5FFFA 1JYEA 5TEWA 3FYDA 3C5EA 3MVEA 5HMLA 3F1KA 3R7NA 5I3CA 3TX6A 2AHOA 3QU9A 1A5ZA 3M4ZA 2IEBA 3MWDB 1PKXA 3UMFA 5AVQA 2JFWA 4B9AA 5IF9A 1HG0A 3GEBA 4LSWA 4IVNA 3LLVA 1T0HB 1PT6A 3TW4A 1PD0A 1EUCA 1P2SA 2OG1A 2IU3A 4PQRA 4QBHA 1DQYA 1R6BX 3CW2A 3WB2A 1SUWA 2MT9A 3WE7A 2GVDC 4GO1A 4WMLA 4DABA 3RE1A 3TI7A 3OQMA 1KE1A 1E3DA 3LVRE 4FC6A 4MUYA 4B3CA 1RTKA 1YBFA 2AXPA 2IHNA 2OO7A 1ZEJA 4ISCA 2P40A 2PGDA 4HMQA 2ZETA 2J3KA 1FUYB 3U4HA 2QAGA 2P8JA 2BM1A 3PPIA 5CA1A 1SWWA 1RRCA 5CT8A 1UXHA 1GGNA 1CWUA 1OXBB 1XF9A 3OT1A 4TXJA 3NHZA 5ALUA 2H52A 2Q7OE 3T9BA 5C8VA 1XROA 2A2ZA 4XCQA 3DLAA 1UPUA 1EQAA 3RIGA 3HUFA 3OPXA 2GXQA 4PEVA 3RUFA 1R8XA 1VYTA 3KHSA 2YX1A 4RK1A 4ZVRA 4Z4IA 1G20A 3A2LA 3NANA 4TWZA 3ZXSA 3PIRA 4TMKA 4DCUA 2HLHA 1PR0A 1C1DA 3B1XA 3B52X 3ZLUA 5C3MA 2QIPA 1G291 4I6JA 3KQOA 5H59A 4F11A 2P9EA 3HWSA 2HHAA 4RF4A 4M60A 2PJUA 2QMHA 4RMJA 2Z1DA 3W3AD 4IZ6A 3R7SA 3VDXA 1CB0A 6REQA 1F9EA 1I7QB 1Y9ZA 3VSDA 3IMGA 1XZCA 1EM8A 2BKLA 2PZFA 5A3QA 2BSXA 4K9QA 3WZMA 1LSOA 1D2CA 2UUCB 1LS1A 1IEVA 3AQIA 1U3FA 1YL7A 1HGXA 2AHRA 3P71T 3AUTA 4BMCA 4AG6A 4JP3A 3DL4A 4NZMA 1HT0A 3M4YA 1WY7A 4BLSA 3DHEA 1GAEO 3CRW1 4J0EA 3TLKA 4JKIA 3T4XA 2R4UA 1E1RA 2BD0A 1K0FA 1QVZA 2BFNA 1PLJA 1WXXA 1R0LA 2H2IA 3CNOA 4YDSA 4B87A 4MYSA 1C5KA 4OATA 2O3QA 4R31A 3HDQA 1IOLA 1OT3A 3G7UA 3GT4A 5JNVA 2YVAA 3LPAA 2QP3A 1GPH1 1XMJA 3RF7A 5JRJA 3A9UA 4BNUA 3JQFC 1J2YA 4HUTA 2WQ6A 1RCFA 1W88A 1EBFA 1T36A 3MWKA 2YVLA 3SYKA 4HNVA 2I3AA 3M0EA 5T6MA 3C3CA 4JB3A 2HMAA 4HYYA 5E9JA 4OLBA 1UPTA 2X77A 1GTSA 1M8KA 4GPBA 1TADA 1ADJA 1U9IA 4ZA2A 2JRLA 5I45A 1V1RB 2Z8XA 3PNYA 4E88A 1YR6A 1RFLA 1MA0A 4HWSA 4AM8A 4MWCA 4B5KA 4QG3A 4F5YA 4M0EA 1ZXXA 1W29A 1V6CA 2PL9A 5T4HA 3WDSA 4BOYA 1TTTA 1G63A 1RAAA 2I80A 1DWPA 1H2ZA 1Z3CA 1DFHA 4IIGA 2IGBA 2LW7A 4YRAA 5MN5A 1R27A 4GEKA 4K2HA 1R6TA 3R5JA 4QAJA 1DCTA 3AESA 4OP1A 3IUNA 1B8OA 3NVKI 3E27A 2I6SA 2XTJA 2O2XA 5ADUS 5D8DA 3TM4A 2EC5A 3T54A 2WINI 4JT9A 3EQZA 1UZNA 2SKCA 3UMMA 4Y6GB 1MB2A 4V0ME 4NULA 5IVIA 2J3LA 1XPJA 3UH1A 5JROA 4BFSA 1XI2A 3ENZA 1T1JA 3EPRA 3OEYA 2NU6B 2GARA 3GLFB 1EJ2A 4YO7A 1U5AA 5JAMA 4L28A 4NABA 3ZE7A 4QFBA 4F6LA 3D0OA 2XQVA 1L7OA 2R8RA 5CYPA 5B6PA 1GYQA 2X14A 2BVNA 3RT9A 1CUWA 1H3FA 1Q50A 3E0XA 4PG5A 4RKRA 3R7DA 2JAXA 4GKBA 2Q3JA 3DO6A 2VYND 4NNJA 2VEOA 3T1NA 1V3QE 4IJUA 4DLZA 2AQKA 2HFKA 2IFTA 4AL4A 3TSAA 1QCDA 1BOOA 2XUGA 3NTVA 5MGBA 2EFYA 4Q24A 2YJZA 1LX6A 2EW8A 1CYDA 1ZSVA 1YI8A 2D8MA 5I8ZA 3LT2A 5AIBA 3B2NA 3HYNA 1NBIA 1U8AA 1V9CA 3MJEA 3BWXA 4X7BA 1ZGZA 3G6KA 5FBLB 4XX0A 2W2KB 1GG2A 2GMWA 3EW7A 4OMCA 3UWMA 3V1LA 1E1DA 2WUWE 4Y8VA 4MRVA 4UUQA 4DQUA 1W8DA 5IAOA 1XG5A 2FR1A 1H6AA 1PTKA 3EXAA 3G59A 1GQSA 1X19A 1FVFA 1GO2A 1ODTC 3DKVA 4W9MC 2A0WA 3V1KA 1W46A 2B0JA 3WLHA 5AM4A 1OLUA 4S1VA 2IXBA 2WF6A 4CV0A 1KTVA 3UQZA 4ZI3A 5ABPA 1JECA 1S02A 1E2DA 1T4CB 1UOQA 4YIKA 5JWOA 2NMVA 3DQZA 3RI3A 4RIGA 5I9MA 5ISMA 3LKDA 4WPGA 5TE9A 5BNZA 2A59A 2NXCA 5E2IA 1A9RA 1ZOIA 1E3JA 2R86A 1IFXA 4OK6A 3H5WA 4TTJA 3TTXA 3ZQ4A 3ZJVA 3O9MA 2X0EA 4WXMA 5AK4A 2NUPB 3D4IA 4I81A 3B9RA 2Q7DA 3SC2B 4E2WA 3ILSA 2EZTA 1IJEA 3H1FA 5H5JA 5BUZA 2FHSA 2ORYA 1XRLA 3AHJA 1OBOA 3C14C 1XJ5A 4XPIB 1FP4A 2GBLC 2XD4A 3C3YA 4GLFA 2X7JA 2CHVA 2YIJA 4I50A 4NCHA 1Y1PA 3LDGA 4M0MA 5AI8A 1QHSA 2OVBA 4YLGA 3WK6A 1QP4A 2FR8A 2JIPA 4HGQA 2ZE5A 5EIBC 1NX6A 1ZA1A 2HEIA 3T3HA 2YRFA 1RWQA 4LF4B 4LJ8A 3GP5A 2CV2A 1USWA 5ER9A 3WYAA 1IZ7A 4G23A 1MTOA 4JC5A 4PLFA 1BEZA 1I0LA 4B9EA 1W0JD 1JLKA 3HFRA 1P2GA 1TQDA 4QU8A 5EJ8A 1P72A 3DJFA 3I09A 5KDLA 5F5LA 2QSZA 3G0CA 3GGDA 3TDNA 3ZWKA 4FNOA 1CJKC 3I61A 4AO8A 3GLGB 2DE0X 3AUJB 3JQGB 4PS0A 5LWHA 1UKYA 3E22A 4IDQA 5FP0A 2ZGVA 3UTDA 1SY7A 3CRRA 3GGPA 3TMKA 2JLUA 1UAGA 1BVUA 1DJQA 3TTSA 3AOEC 1K27A 4AZWA 2ORVA 4MI1A 5EUCA 5TMBA 4ERXA 1QH8B 1CQJB 3SE7A 2XD9A 1VECA 5T8KC 3EXEB 1KVSA 5B57C 1Z2OX 1CC1S 1F1BA 2OZPA 4DSOA 2H1FA 3NEYA 4O1IA 5AK0A 2WJZB 2ODPA 1YRAA 2EEPA 2CXHA 3UUWA 1IAVA 1REQB 1YQTA 2ARKA 1LCIA 2M2IA 3M34A 2JGLA 3CEHA 2SCUA 2Q2VA 3QU4A 1AN0A 2I5PO 1U9ZA 3KUCA 4IJKA 3B85A 4JJIA 4TLCA 4TLAA 4EDHA 2HN9A 4EO7A 1MAWA 4RD6A 3A7DA 1U7OA 4I1UA 4UPEA 2I2FA 4B71A 3TDMA 4DMKA 2GZSA 1SN7A 3HEMA 3OSZA 3TSOA 5JPCA 3GJYA 3V8QA 1PJ3A 4IKOA 2IXDA 3IQIX 4EGJA 3LBIA 3MAJA 3PUXA 2Q1YA 3HBLA 4X1KA 4LWQA 3WV5A 1F2UA 3ZHQA 1HZJA 3DMGA 4Q1AA 3VVLA 4DGSA 1RZRA 1YGPA 1KMQA 4OA8A 2DFNA 1ACMA 2PL1A 3TZHA 1HM5A 4EYEA 3I9V6 4Q66C 5G53C 5JARA 3OWXA 4C14A 2O3UA 4GE0A 1U7ZA 3FUTA 4A8JA 4WBNB 3EPJA 2FWBA 4BB6A 1AKWA 2DP4E 1XZLA 2AKEA 4R1TA 2DHCA 3K1YA 3I2FA 1Q91A 4DDVA 3KT0A 4D9BA 1QS0B 5I7EA 1S2MA 4RVUA 3PQDA 4U00A 4JFAA 4X24A 1GL6A 2YS7A 4FWBA 4DLSA 5HDBB 3OFNA 4I8XA 4TYYA 1ID1A 4KDCA 1F48A 3O2NA 3QNWA 4IEFB 1EEHA 3J7TA 4GNKA 2IV3A 1UBOS 3PXGA 5LPNA 3A1UA 4MWDA 4KPUB 4OJQA 1ILWA 2F90A 2F3SA 3OUTA 1FUEA 1YE8A 5JMWA 3R41A 1NZDA 1USKA 4YIHA 3N5CA 1VCNA 4Q47A 4EHKA 2WJJA 1AQJA 1SUCA 2PG3A 2WJIA 4Q6BA 3DOIA 5HIMA 3LE8A 3DAFA 3MMZA 1TU0A 5KQLA 1OHHA 2HLPA 1EQUA 4DQVA 4HRAA 3ZVNA 2NACA 4JLVA 4QD3A 3L6CA 3X1XA 3I04A 2NYRA 1QO7A 2O0LA 1D2EA 4MIKA 1ZIYA 4UZSA 5IS2A 1SIOA 1CRPA 4C21A 3LVBA 3DL7A 2QX7A 3DUWA 1IWBB 1OAKA 5C5EA 4DT1B 1JHYA 4U0JA 2LCQA 3O9ZA 4G5XA 1TD1A 1A9ZA 2XYPA 3GBPA 5DHUA 2YUTA 1LVGA 1S1MA 2QLTA 3CYFA 4GLBA 2NN3C 3BRCA 4R9UC 4TQAA 5PGMA 3G2MA 5ELMA 3FFTA 4FMDB 1LD3A 4OXIA 4AP6A 4C0AC 2Q9CA 4ND2A 3PSHA 1TGVA 2R00C 3PFHA 3ETGA 1K8RA 4KSCA 4DIDA 2WSIA 3L5KA 4KZPA 221PA 1BIFA 1H1LB 1Z4IA 2NZVG 4UDXX 5BXQC 3KDSE 1LJLA 3OQ6A 4DV0B 1NUQA 2WIKA 4LHZA 4BWGA 5KBYA 2HMTA 2O19A 3FGOA 1HL3A 4P3NA 2BGTA 1VJ5A 3T9CA 2HADA 5I5EA 3OZUA 2OD2A 4BX9A 4NMMA 3CF4A 1ZESA 4NOJA 3ZGLA 2H9YA 3KOXA 3PQCA 4K9RA 1RJ9B 3ONVA 2GAOA 1VE3A 1SXJE 3DEZA 3PFNA 3H75A 4WZ6A 4CHTA 2D5IA 4KO4S 2W8BB 1QE3A 3EXHC 3QBVA 1P31A 1ZOSA 1I01A 2ZDHA 4RLSA 1KERA 4GOMD 5SY9A 2CWWA 5TNXA 3W8RA 2QUBA 4TKUB 4A23A 5BWMA 1LW7A 1UQRA 5L6MB 3QX7A 4BBAA 4MPDA 3NH6A 1X1SA 1IY0A 2VTKA 4P7FA 3E3MA 2XADA 4URHA 3VJLA 1QCYA 1SBTA 2EQAA 2G67A 4ZOBA 3BH0A 4QQKA 2FPRA 5L3ZA 1GPJA 3O8RA 4DA7A 3H2ZA 5IM4F 4O4HF 3NC1C 1PS9A 2X2OA 3RK1A 1XDBA 3HP7A 3GDOA 1NJ1A 2PT5A 3TKAA 3VNAA 4LF6B 3CNQS 2CW5A 1EP1B 4F8JA 3TOCA 1DXQA 3ACCA 4BKMA 1K98A 1Y37A 1T4GA 3AB7A 4IIXA 4OXKA 1OXKB 3X1WA 3CUWA 4PLCA 1SRRA 4GR5A 4LJ5A 2VCYA 2O1XA 4WGFA 4RFSA 1SVSA 4R2WA 1FNNA 3ZWBA 4I1OA 3VR4D 1UBJS 1UBSB 3D6HA 4HMPA 4Y2VA 3K6SA 2YMLA 2CDNA 1HV8A 1LQUA 1KI4A 1LRJA 3IAXA 3IVXA 1Q0LA 4R41A 2FMFA 2AEJA 1NNEA 5JH7F 4FFVA 5K05A 2CFSA 3NBQA 4UFPA 2R97A 2I0FA 1M2HA 3IESA 1FNSA 1EHCA 3GJ4A 1P4HA 3UKOA 3INGA 1PS8A 1NYQA 1MXHA 2VAVA 1AB5A 1XGKA 2PR2A 3CN7A 4FQ5A 1NPDA 2ZIXB 5KJ1A 2DUUA 4DPKA 1WDTA 1IDN1 3AKYA 1SCNE 1EFPB 4Y2HA 1XD9A 3HBNA 5U9CA 3UICA 2FUCA 2TMGA 4E1BA 3QA3E 3OC6A 4LK2A 2AXNA 1ELOA 4BGUA 2P9FA 2VRCD 5DK4A 2A7QA 2QU8A 1UBLS 2VRNA 4GKKB 3CH4B 2QRZA 1TKCA 3DO5A 2CHFA 2J9FB 5IJWA 2IRWA 4CKEB 4ZGGA 4CG1A 3ZH2A 5K0SA 4BFZA 2WJ6A 1W25A 2V7TA 3JQ8B 4KXYA 1FFXA 1MJFA 1ZSNA 1M72A 1E99A 2Z8ZA 4BRWA 1W581 2Z98A 4C6TB 5K8JB 2RHLA 4D6XA 3EGEA 1IZ9A 1K6IA 1V8ZA 2RBKA 3KXLA 3GT3A 4YASA 1NXQA 1PSDA 5IARA 1GPKA 3FCYA 2QRVB 2DETA 3QUBA 2PZLA 1RMYA 2EJBA 3O74A 1FDVA 2Q6TA 4LDAA 5CB4A 3URKA 2EHJA 2IV7A 4AJ9A 1QVRA 3R76A 2KPOA 1NJFA 2EYUA 4KVAA 4PONA 3PG5A 2HHLA 2O8NA 1J8VA 1Y5NA 3NASA 3ROXA 1ECPA 2F1RA 2OXCA 1XZMA 1JG2A 1J42A 3OMLA 4QHTA 2VTBB 1F1JA 2NSJA 4X44A 5FLXA 2FK8A 1PZMA 4HZGA 2IE0A 2Y0DA 3I2KA 1CHDA 1QGAA 1VLVA 2G40A 2NQ8A 3QIVA 3O8NA 4IXMA 5HIKA 5DNCA 5DLDA 4MCJA 4OUKX 5EJ2A 5ETJA 2RD2A 4M1QA 4QPJC 4OV6B 4PZ9A 2OBYA 2A0UA 3U7QB 1BXRA 2PGXA 1CPYA 4RCZA 1ZD8A 4I9NA 1KH2A 2V7BA 3RW9A 3PFFA 1V7PC 4F56A 4RQAA 1FW6A 3KPVA 1B4DA 1GILA 2GOYA 1DAPA 5CDFA 5SV2A 4Y2XA 1N78A 3K4PA 2ZQ5A 3KT8A 2Q28A 2BFFB 5FI5A 4BAZA 4RYLA 3EZXA 3ELBA 4J8PA 3TCNA 3VKGA 2PS0A 4KXWA 5HFNA 1Y81A 2CXOA 1R4MA 2D5BA 3W3AA 4IG9A 5IDWA 3HRKA 3JAWB 4ZVTA 4UE3S 1BSVA 1PL6A 1MEEA 1USGA 1GTJ1 2OSBA 3FCCA 4MW0A 4YBZA 3UEOA 721PA 3L9XA 4XARA 1GDTA 4IGKA 4F2WA 4GSLA 4ZTUB 2OFWA 2BYTA 3V8MA 3KFLA 1I94B 3F97A 3L49A 3L8HA 3QUQA 5CUQA 2MU1A 3K1AB 3W5DA 1OWNA 5JATA 5HP4A 3LHDA 1IJFA 1RXEA 1JNXX 4PGHA 5HZKA 3T5AA 3CIFA 2Z6VA 3RJMA 1NMYA 2Y4OA 5JFGA 1OTHA 3C6KA 2FLWA 3B70A 2QTMA 3IOMA 1E8NA 4IDHA 3ZLBA 2VNIA 1L8AA 2PMBA 4B73A 1Z68A 3FG9A 1XTZA 2GDJA 1GYPA 1QKJA 2RKWA 3LIIA 4UE6A 3BMCB 4L5YA 4HWGA 1MNQA 2A92A 3U17A 2LDBA 4EKDA 1Z5NA 1RAEA 2WPDA 3C85A 3MUEA 4C5CA 2O05A 3KIPA 4W99A 3CEAA 4HDNA 5GP1A 1ZVKA 4B76A 4CLHA 1CNMA 2XGMA 4Q4JB 2QI9C 4FFBA 3R7FA 2PSHA 2D74A 2PT7A 2WU8A 4Q9JA 1TXGA 3VTFA 1OD6A 3Q87B 4IFIA 3OM0A 1TW2A 4YRSA 3N39C 3QFSA 4FSHA 5L3QA 2ZIGA 3TVDA 4I08A 4KUEA 5JLAA 1F51E 2G5PA 3U0BA 4OFWA 2WLTA 2YDYA 4F21A 1XKLA 4FSDA 4HK4A 1YR8A 3I3SR 3PXBA 3QBEA 4V0RA 2R6JA 4J94A 3T0GA 5H7XA 3CJQA 3ZYCA 2JFXA 5M2QA 3AVXA 1Y1QA 3L6DA 4HI0E 1EWTA 3V8RA 4B7ZA 4DJFC 1ZCAA 4FCCA 1PR9A 4KVFA 4PLPA 1Y3IA 2C5SA 3AEZA 3RSOA 4RDHA 1YMVA 2BH9A 3CY6A 3N2ZB 4L7VA 4N7JA 4EABA 3AVYA 1IXRC 2ACWA 1DJNA 4P82A 3NOVA 3H2HA 4MHOA 3A58B 3LLUA 2JAOA 1YQEA 5DLQC 3FTNA 4WOPA 1II8B 3TR0A 4MLDA 3CVXA 3L46A 1E4OA 1TRKA 1CV2A 1WRBA 2P9TA 5IHXA 4FYKA 4MB0A 4ALMA 1F0PA 3BORA 3UW3A 1LBTA 4O4JB 3TLXA 2N1BA 3O0TA 2IC5A 3RS9A 1NSTA 3ELDA 1JT9A 2AJCA 2HKIA 2VNJA 2WMDA 1X70A 2V7UA 3AUKA 1SZDA 3C6ZA 2A30A 4IDEA 1CR6A 1DUSA 3IQHX 1USIA 1M8FA 1WULS 3EB9A 2CCKA 3WGHA 2FFAA 4W82A 3W7BA 2WAAA 3G2IA 4NCNA 3D1VA 5BVHA 4EYSA 3L7AA 1CCWA 1BGWA 2DKOA 5LP6B 4FR2A 3JARA 1QHHB 3G89A 3R3JA 2EZ9A 3UCEA 3ZDEA 4BYGA 1EUDA 4DMMA 5T67A 1EX7A 1G8MA 4MPPA 3H99A 1FSFA 3R8CA 2AR9A 1UPBA 3VNBA 4D43A 1Z5WA 4P84A 4KQEA 4RZ3A 3SR0A 2QRJA 1Y1RA 1L5SA 2EFCB 2ZE6A 4JT4A 4REQB 4DJEC 4HN4B 4H2DA 3C4QA 4X7MA 1A27A 4FFOA 4PGMA 2QUHA 3CM0A 3RYTC 3ZHUA 1A77A 3I9KA 4R0NA 5ALZA 5DTRA 3S70A 4BMYA 4HYEA 3JALA 5J58A 4RTRA 5HS6A 4ZGBA 3TB4A 3NFRA 3OQPA 3RS4A 3SQWA 1P0MA 4RF5A 1EA5A 4E5DA 4MMZB 5JCJD 1SVOA 2O2ZA 2O4CA 1GAJA 2J9GA 3Q5EA 2VBCA 3AKDA 3OJEA 2HF2A 1R88A 1EP2B 4LUCA 3UHAA 1W36B 2H1WA 2OILA 4OLHA 4R2HA 3CA8A 3RHFA 4CE6A 4E1VA 1WLYA 4FP9A 3H83A 2Y1CA 3KB1A 4ASUA 5CLJA 2Q8NA 1KO8A 1TCUA 5BSUA 1OR8A 3TSYA 4ETWA 2AZXA 4ABTA 3BAFA 3MJTA 4K86A 2XW6A 4LKOA 4IGIA 1JHQA 2JGMA 1V8PA 4B3TB 5F1OA 1Q1NA 3UPUA 5EMLA 1PHRA 5HGJA 1RQXA 3L7MA 2KS6A 4K6OA 3WLSA 1BXZA 2LRHA 1ORRA 1WB5A 2XNSA 3ME5A 3P26A 2WAYA 4G9EA 3SMQA 4QPCA 1XTTA 4QNRA 2QM7A 1RQNA 3B6JA 3UUFA 1L7EA 2X86A 1U7DA 3VR6A 4W9RA 2E1PA 4HQLA 5KSOA 1SCJA 2O8EA 2Q0QA 3A9SA 1J06A 1QDEA 1XMIA 5LUBA 1YVEI 4LHXA 4EGSA 1E2NA 2X23A 3CPSA 5EWLB 2WZBA 2CL6X 3SHQA 4EECA 3J80A 4KR9A 3NT4A 2H1SA 4CFZA 4X3OA 5FKJA 2EF0A 1BEUB 4IAOA 4IMRA 2ZTLA 1BA2A 2GERA 5J9FA 3WMEA 2GB4A 4D0LB 2K7FA 2PAFA 4TN5A 2EWMA 1QV6A 1E2GA 5HKLA 3R7WA 3VKUA 1ATIA 2D0DA 1O5IA 1PI3A 2FEPA 3H18A 4XB1A 1GEEA 5CNKA 5AJYA 1ZRHA 2QZ4A 1RHUA 3KJIA 1VB5A 4G01B 3QYPA 4OHRA 5FIUA 5BYAA 3PX2A 3WADA 3QPWA 3FRJA 5JCJA 1R64A 1YCDA 5HOEA 1RSZA 2PSFA 3ORSA 1GPYA 4MS1A 4NDNE 1BRMA 3RR2A 5JDCC 4TMWA 3TSWA 5F98A 3EMKA 3Q7IA 2QA5A 1H4SA 3OZFA 5EXPA 3O75A 1THGA 4LRWA 2FRDA 4DCPA 5FEUA 3C39A 4FYMA 1C1YA 2EIXA 3M5PA 4MH0R 5BNFA 1ZSYA 1E3EA 3ASVA 1ZIXA 4K9MA 1KP3A 2DOKA 2QRPA 2VDMB 3LUFA 4KQFA 4O33A 3U3JA 4JBNA 3TR6A 3JQ8A 2YQ5A 4LI3X 3UMVA 4DIBA 1ZN8A 3QK7A 3KTOA 4JCOA 4ZOLB 2AN3A 4LE0A 2WSMA 4HLNA 4JI3B 4EJSB 3NDBB 3MWJA 1FBTA 4UM5A 1O8BA 2CL5A 5KSPA 5JYEA 3CIOA 2Z5VA 2JHGA 4MUJA 1KDOA 1S9HA 1UM9A 1VZ2A 2J7PD 1PGNA 2VRWA 4G8JA 5EWLA 2VPPA 3I6MA 4ZALA 4N47A 3VPGA 4BFYA 3ZE0B 1JFTA 5J40A 2HR1A 1QP8A 3BGVA 4ZVVA 4NBVA 4F45A 4D9MA 4UVIA 4JYCA 4KMMA 3T5PA 2JI8A 1YVPA 3OE1A 1IH8A 2PCLA 1KKUA 2PPLA 3C3WA 2NO5A 3I45A 1G6HA 3L7NA 3WXMA 5BV7A 2CXPA 3V4SA 4G4SO 2HJSA 2QD3A 4UASA 1M2VB 3IDAA 1J5PA 1NF2A 1JPUA 5BNWA 2IY8A 2IP1A 2X0JA 4D4JA 2R44A 5GIOE 4NI5A 1VMKA 1THMA 5DNAA 3S55A 2VJOA <