1JIKA

Crystal structure of s. aureus tyrrs in complex with sb-243545
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
319
Chain Sequence
TNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tyrosyl-tRNA synthetase
publication title Crystal structure of Staphylococcus aureus tyrosyl-tRNA synthetase in complex with a class of potent and specific inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 105
structure length 319
sequence length 319
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2001-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
A PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1jikA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1jikA01
1I6MA 1NSYA 1I2DA 3QE4A 4MWCA 3HGMA 1PFWA 4RUKA 3COZA 4F4HA 3Q4GA 1IVSA 4MVYA 3AG5A 5H16A 4KR7A 4G5FA 4HJRA 3VGJA 1G8HA 1QTQA 3KT0A 1J21A 3ZXIA 4MW0A 4JYZA 3MLAA 1S4MA 3Q10A 3AL0C 2E18A 3MMXA 1MC1A 1TEZA 2DLCX 1U3DA 4YP5A 3CVXA 5TGTA 2ZUEA 4YBRA 1N2HA 5LLTA 3ZIUA 4G6ZA 1YI8A 4NAUA 3I05A 1MRZA 4H3SA 5IJXA 2QJOA 4QRDA 3INNA 1ZH6A 2AG6A 1KQPA 3H9CA 3IODA 4KR9A 2GM3A 3UC5A 1M8GA 1KR2A 2OQ2A 4YMIA 3X1JA 3SZGA 3ZJVA 3FNRA 2Z09A 3OTWA 4U63A 3GLVA 2V0GA 1EJ2A 1G8FA 4MUGA 4XFJA 3HFJA 4MUFA 2WQ6A 5J58A 1OWLA 3P52A 1WXGA 1MB2A 2DR2A 2JA2A 4F3RA 3TNJA 5K0TA 1PG2A 4EG4A 1QU2A 3IOCA 3CVUA 3IMGA 2QJTA 1GLNA 3NV7A 4E1AA 4YP7A 3E27A 1X8XA 1M8JA 1H1TA 1WY5A 1IQ0A 1N2EA 3A4IA 3FWKA 1KQNA 4EFKA 1CT9A 3ND7A 2QUHA 1O95C 3UOWA 1NI5A 3KT3A 3ILVA 4ZT6A 1Q19A 4MVXA 3CR8A 2OV4A 3SEZA 1I6KA 3VU8A 3FG9A 1J1ZA 4ARIA 1WXFA 3FI0A 2A7XA 4MWDA 5J5AA 2QTMA 3ELBA 1JIKA 4ZT4A 2PFSA 2J08A 4XFDA 4I6GA 2V0CA 1F7VA 4UZEA 4DLPA 3CLTC 3PRHA 1IQRA 2QJFA 3C8ZA 4MW9A 3HV0A 1LI7A 4EG3A 5JBNA 3HL4A 4MW6A 1QNFA 2GKSA 4RPIA 4X0EA 1XNHA 3IDFA 5FNZA 4MUEA 3LE8A 1YULA 5AHWA 2IJGX 1GTSA 4MAFA 1QRUA 1IHOA 1NURA 1OBHA 1PFUA 1NP7A 2E0IA 3DLAA 4DE5A 4MW2A 1O95D 2O8VA 2XRYA 4MQ6A 3A05A 1ZUNA 1EE1A 1EXDA 4KPUA 4UZFA 3SDBA 2J09A 1OWMA 3CVWA 2CV1A 4L2IA 1MAWA 4K0RA 2WB2A 1D2RA 1Q77A 1WXIA 2D13A 2IELA 3DO8A 1N2GA 4DDKA 4J76A 3N05A 1IH8A 1TQ8A 3DPIA 2YWCA 3ZJUA 3AG6A 3CLTD 3CLSC 2B7LA 3P0JA 1SURA 1IFXA 1J09A 3GUZA 3LOQA 3FY4A 1ZH0A 3BL5A 4KPUB 1GN8A 2GOYA 3COVA 4MUHA 2E89A 4MVWA 4PBSA 3HZRA 1NUQA 3A2KA 4L2IB 1JIJA 4MWEA 2CV2A 3IVGA 1O94C 3PNYA 3PNVA 3G59A 3SEQA 1R6TA 3LCJA 2X1LA 1O0BA 4TS1A 1QQTA 2EJCA 4NZPA 4OUDA 3NBAA 1JGTA 3OP1A 3FOCA 3IOBA 3FIUA 1BS2A 4ZCRA 1XNGA 2QUJA 4ZT2A 4HK4A 3CVVA 1O97C 4BWVA 1H3EA 3RHSA 5BNZA 5DK4A 1QRTA 3X1KA 4EG1A 2X0KA 4YP6A 3FHJA 5J59A 1B6TA 3UK2A 1QU3A 1KKUA 2DPLA 3CLSD 4KKVA 1Q15A 1IRXA 1A8HA 3COWA 3G6KA 3RK1A 3H05A 2CV0A 3FH0A 1PG0A 3MLBA 5IHXA 3L92A 4MW1A 2X3FA 1JZSA 1YUMA 4XSVA 1TFUA 1KAQA 3RBAA 1KAMA 2TS1A 1GZUA 4P2BA 3AKZA 3K9WA 3SYTA 1NZJA 4JZYA 3FETA 1WJGA 1J1UA 3ZUGA 3CA8A 3JXEA 1WQ4A 4PBTA 3D6UA 1YUNA 1KH1A 2A88A 3ZXSA 3CLRC 5HUJA 1NUPA 4EG8A 4JXXA 4ZT3A 3TZEA 1J20A 4MLPA 4CDNA 3IUBA 1F4LA 3HMQA 5KCMA 2J4DA 3H97A 1O97D 4I6EA 1WOYA 5TS2A 4EG7A 1N75A 2A1TS 1LI5A 1EUQA 3RJZA 2Z3VA 5EKDA 1JEEA 1R6UA 3N2YA 3AIIA 4KR6A 3DV2A 4EGAA 1N78A 3QTBA 4ZCPA 4DNXA 1KORA 1NYLA 1U0BB 1N2BA 4MUJA 4ZT7A 2D5BA 1UFVA 4MULA 1T6XA 3U1VA 1KP2A 4MW4A 2PIDA 2QTRA 3VRHA 5H7XA 2NSYA 2O5RA 3SZ3A 2ZUFA 2DUMA 5DASA 4ZCTA 4AQ7A 1TYAE 3IMCA 3D6VA 1NUUA 4MVCA 2A1UA 3TZLA 2VXOA 2JAXA 2Z08A 3CLRD 3QTTA 4FZJA 4J75A 3RFFA 3RK0A 3AFHA 2DERA 3X1MA 1K97A 5DB4A 1IQUA 3TQIA 4U7JA 3M5WA 1VLHA 2PXHA 1M83A 1O5TA 1ULHA 3GMIA 1U7XA 3ISJA 4CDMA 2BTEA 1U7DA 2HGZA 1JMVA 2IP1A 1XNJA 4I6JA 1M1ZA 4A91A 3KT6A 4AS1A 2I1LA 2DETA 2YXNA 1NUTA 3P0IA 1VBNA 1KH3A 3IVXA 4NX2A 4GRIA 3K32A 4G5YA 2CFOA 2CT8A 2ZP1A 5DEOA 1MOPA 3NBKA 4NAHA 3P0HA 1P7PA 3COYA 2A84A 1T9GR 4GU5A 1U3CA 2QUIA 5TEVA 2AZXA 1VBKA 2RE8A 2C5SA 1KP3A 1N2OA 1VL2A 4ZCSA 4EG6A 3N9IA 3UY4A 1MJHA 2CUZA 1QJCA 4JFAA 1PFVA 1WKBA 5FO1A 3UMVA 2A4MA 4PBRA 4MW5A 4EG5A 1V8FA 4MUIA 4EF6A 1N77A 1Q11A 5LFAA 4R2LA 2XRZA 1KH2A 1ILEA 4MUNA 4ND7A 4S1OA 1PFYA 1COZA 3Q12A 4ND6A 2X1MA 4CT0A 1WZ2A 1HYBA 1V47A 3A04A 3PXUA 1N3LA 2WSIA 3IOEA 4MW7A 5F23A 5HG0A 3IMEA 4MUKA 4JXZA 1JILA 1LW7A 4OUDB 1ZJWA 1N2JA 2YY5A 3PNBA 3S3TA 2J07A 3KFLA 1O94D 5HUHA 1QRSA 1MBZA 1VBMA 2CYBA 2QUKA 2EL7A 1X6VA 1O0CA 1T6ZA 2PZAA 4NATA 1GPMA 2NZ2A 1O96A 1J70A 4QREA 1G59A 2AKEA 3L93A 1H3FA 1KQOA 1WXEA 4R0NA 1EUYA 2RD2A 1YIAA 1K4MA 4PY2A 1GTRA 2CYCA 4QBTA 3MUEA 2R5WA 2H2AA 3F3MA 2D54A 1OD6A 2G36A 1M8FA 1OBCA 1N1DA 2BYTA 1EFPA 4ZT5A 4CQNA 1JECA 1EFVA 4Q93A 4Q16A 5FO0A 4NDAA 3TQOA 2VTBA 1XJQA 1WQ3A 4HJXA 4DJAA 5KWVA 3H99A 3CLUC 3IUEA 1F7UA 2CYAA 2HZ7A 3ND5A 5LM3A 1JZQA 1N2IA 1RQGA 1O6BA 4R2MA 1M8KA 1FFYA 1MB9A 2QTNA 3H9BA 3N8HA 2HMAA 4WSOA 1O96B 2PZBA 3G5AA 4HPWA 3FDXA 2PG3A 4ARCA 1NUSA 2J5BA 1F9AA 2CSXA 1T9GS 2E21A 1DNPA 1OWNA 3SP1A 1JHDA 1OWOA 1TYCA 3ND6A 1G8GA 1K4KA 1FYDA 4WNYA 1M8PA 1R6XA 2DEUA 1H3NA 1EFPB 4OJMX 2A86A 2JANA 1EFVB 2H29A 4MWBA 4ZCQA 3IVCA 2VTBB 2PZ8A 2DXIA 1TYBE 1OWPA 1T6YA 2WQ7A 5KHAA 4K03A 1JEDA 3TS1A 1YIDA 1MAUA 2A1TR 3KT8A 1WXHA 5K0SA 4DDHA 3IH5A 3MXTA 2A1UB 1TYDE 5TEWA 3ZJTA 1JIIA 3CVYA 1K92A 2YWBA 1I6LA 4U8HA 1GAXA 1Y42X 3CLUD 4DDMA 3ZGZA
chains in the Genus database with same CATH superfamily
4OFWA 4RA6A 1QHNA 5GJCA 5KZMB 1W2WB 2PT6A 3URKA 1DUSA 1KEPA 1OX6A 1I2DA 1G9XA 3L7YA 1G3RA 1QCDA 3T1OA 4JIGA 2XE6A 2VEOA 4HAYA 4EUEA 1QTIA 1USUA 2NZYA 3NATA 5DGHA 2CCGA 4TLDA 4MDEA 1B26A 1G19A 4C1BA 1HKUA 4YBZA 3INTA 2OCIA 1ATZA 1GAWA 2I3DA 3EWSA 2BONA 2QS9A 1PF7E 1R37A 2GF9A 4N4AA 4YJ2F 2HH9A 4UTXA 3RM3A 4EO4A 5FUYA 1Y8RB 4CMBA 3N0WA 5LVAA 4U2EA 2AX4A 4CZ2A 3O94A 4X90A 3AH8A 4ZAVA 2QPAA 3I3SR 3LOPA 2C78A 4C07A 5JE8A 3TIFA 3CVXA 3P2EA 5SYNA 3RARA 4ACBA 4IIJA 2OXCA 3PQ8A 4G6ZA 4QFBA 3V4VB 2PSFA 3HEBA 4IM7A 1DBVO 4FEGA 4NPCA 5D87A 4URUR 5M3BA 3ETNA 1W5BA 3URMA 3H9CA 5IMBA 4K0KB 3OZFA 1QR6A 2ZR7A 4B5LA 1ZY2A 1OCEA 1T2AA 4DQXA 1M1UA 3WNQA 4J4HA 3U60B 3ES9A 4PLGA 3W4KA 2W8BB 5I9LA 3NTQA 4Z0HO 2Z4TA 3KQTA 2OBLA 1XYGA 2P1RA 3B3AA 4RYLA 2YHIB 1J9ZA 2DX7A 1F6WA 3DVAB 3WSWA 2EKQA 2Q7DA 2F2TA 3A1CA 2FPPA 4KWTA 1ZJ4A 3LO8A 5KTSA 1VJ0A 2RGAA 3IT3A 4P0TA 5K0TA 4JIMA 1NTRA 4UVDA 4RVDA 2GDJA 5TPZA 3ROEA 2DY1A 4BMZA 2P7HA 4MKGA 4ROTA 3TMKA 5BPHA 3CVUA 3RRFA 1QE3A 1G6Q1 5B3KA 2O7SA 5JTUA 3KJIA 1L5RA 4GKJB 2EQAA 2FMKA 1RAHA 4YP7A 2FE4A 3GY0A 5CVUA 1FQKA 1M8JA 1IN7A 4YRPA 5AI4A 3CB2A 5HCNA 3WWYA 1DRUA 3GLQA 1HFJA 1NW5A 2ZWMA 1K2WA 2IYVA 1P62B 3IDZA 2IU3A 3ICPA 1CDEA 3NBUA 8ADHA 4MRMA 2J0UA 5A5GA 3E15A 3KTAB 5KTYA 1H2XA 4A8HA 1NJ8A 3FPFA 2WWIA 3M5DA 4O4HF 2JG3A 4JLAA 5KIAA 1Y4ZA 1HC7A 1GU0A 1QGOA 2PRIA 2FUKA 4M1OA 4OBWA 3UBMA 4WI1A 1P2SA 3L0SA 3AY3A 5CVDA 1O95A 3VVCA 1G8MA 2D2EA 2RGEA 4YRJA 4L0QA 3UK1A 3AF0A 1PT5A 2JGJA 2PKYX 3E8MA 3GMSA 4GBMA 3ELBA 2VJQA 5L6LB 2IYZA 1A5SB 4RSMA 3RU2A 4PXAA 1SIBE 3NJRA 2A5DA 4R1QA 4CMEA 2SICE 3JX9A 3UANA 1OV4A 1YRYE 5BQ5A 1N3BA 1YQEA 5JSFA 1KSHA 1V16B 5CHYA 3OCXA 2QJFA 4QGFA 3EMVA 2OQRA 5HEKA 3OHPA 7MDHA 2Z8XA 1TF7A 3ENWA 4IXWA 4IFEA 4Q39A 4I8XA 3PNPA 3TI7A 3STYA 3KC2A 1E5VA 5LDDC 3AP2A 3U9TA 4TWAA 2VDQB 1AGXA 2V6JA 3IPLA 3JQGA 4F21A 5MFZA 1UMCA 1LK7A 3ESYA 3O9MA 4V0OA 2B8JA 4B3MB 3K4QA 1QRUA 3VR4D 2OV3A 2C9MA 4LK3A 4ZHQB 3OUUA 4U0JA 4U5XA 3JW8A 4PYJA 4D3ZA 2OY0A 4R1OA 3SDSA 1TKCA 2AQKA 1NMSA 4B46A 1DJQA 1WW8A 3OBBA 4KCGA 1DKLA 3VVBA 1R4AA 3AEKA 2EYQA 3R3ZA 2NX2A 4GGPA 3NFRA 5C7LO 4K86A 3VX3A 1KZ9A 4FFWA 4JLPA 2WYIA 4HWGA 3EQZA 1UH5A 1A4XA 2RI1A 4DV7B 4BEWA 2W2PA 4IXMA 1NBME 3BMOA 4FNOA 2J33A 1H0SA 3TZKA 5T4EA 3WRXC 4D25A 1TFRA 1H0HA 9ABPA 4OHUA 2FP4B 5CCEA 1FDTA 3ZE1B 2Z9BA 4BMPB 1XV5A 4ARZB 1IDOA 2QXYA 2WU3A 5IC6A 3EZNA 1Z9BA 2NYUA 2VBFA 3TLZA 4WLUA 4B4UA 3BBLA 1ZNYA 3SHOA 2B7BA 2ACVA 2Q6IA 5BNFA 4TS4A 2A57A 1R8SA 1UPXA 1YAJA 3FUXA 4MQMA 1NN5A 4MYHA 2CFTA 2P40A 2PUHA 1J09A 2BLNA 2R8OA 4FNGA 4B43A 5C35A 4E7PA 2HJWA 4OI2A 2LIVA 4F38A 4EJFA 5IYZF 4K6FA 2H0QA 1HTWA 2H1SA 3OQ6A 3TQIA 1YVPA 4XASA 5BW4A 1V35A 4JKYA 5HRUA 3OTQA 3ROGA 1U5CA 3CFYA 4RZ2A 3ZI0A 1C7IA 5TQJA 2NUAB 4CJXA 4FWTA 4X44A 2H4JA 4GM4A 1R0CA 5TSDA 4WLOA 1RLTA 1O94C 2NUBA 3Q7RA 1ORIA 4I1VA 4RSGA 1JHYA 4GLFA 2QW8A 5JEDA 3BHNA 2HD4A 4YRDA 5FWYB 5A3JA 3D8HA 4ZZ0A 1JGTA 4J9VA 2QMQA 1MFPA 2EV9A 4N47A 2HBYA 2ZJZA 1PVVA 1WSDA 3K5PA 3S8EA 5IK2D 2VH5R 3MUFA 4F71A 4RQTA 4PVDA 5JNTA 5HZGA 3IBCA 1P1KA 1VJTA 3I0MA 1KMIY 3E23A 1ZK2A 2W2LA 3FCXA 3T95A 4C0AC 1S8OA 2ZIXA 3WHLA 2FOIA 2Q7XA 2YIVX 3L5KA 4PQGA 3GBSA 2LCIA 4RHTA 4ISCA 2DJ5A 2V55B 1GZ3A 2QW1A 3D8TA 2WDZA 5BSTA 4J0CA 1U28C 1X3LA 2RG1A 3LXXA 5JAHA 1JEJA 3L0ZA 5DBGA 1U2GA 1XRSB 2QWXA 4F4DA 1EGMB 1W52X 4R7TA 4E15A 1KAQA 5TR9A 2HWUA 2MSWA 4QQ8A 1KAMA 3EY4A 1D4OA 2PKWA 4P2BA 1TE2A 1M7BA 2FMXA 3Q5EA 5CDFA 2NQTA 3D7MA 2P2GA 2BFFA 4LXYA 1KI7A 4YRFA 5B1HA 4C4RA 2CNWD 4EJ0A 4EUNA 2VPIA 4J4TA 3C3JA 4M49A 4MQUA 1NBMD 1W25A 1RXIA 3KO8A 1SVWA 3ZGXA 1ADJA 1DBRA 1OIXA 1KSFX 3GJ0A 4RH1A 1K88A 3RS2A 5TVGA 3QU7A 1A9OA 3RSQA 4U7TB 1V8OA 3G2IA 5DEIA 4I50F 3GNQA 5PGMA 4YVFA 1EWVA 2CF6A 2A1TS 4TX1A 1EUQA 5C0OE 5AVOA 4R9VA 5HIMA 3Q1KA 4IW3B 3W6UA 4C3UA 4EYGA 3F2IA 5IJZA 1LGYA 1NW8A 5K4HA 1VIYA 3IQZA 1M5UA 4L95C 3FWPA 4MTCA 1UDXA 5ICSA 1VGVA 3DBHA 3EDRA 4PTYA 5JLAA 5TB5A 2ZRPA 4B4DA 4AJOA 1K8YB 2YHSA 4KK3A 3QMVA 3W05A 2EQBA 2W4MA 3CBGA 3Q40A 2H57A 3H65A 4RW0A 1KTIA 1P4RA 3OLCX 2B4YA 2B7CA 1IOZA 2NSJA 2O2EA 1BFDA 2QLNA 4M1MA 3I83A 3R3XA 4AO7A 4JI5B 3A06A 3EVZA 4LMRA 3LSTA 1RJEA 2F59A 5BMVF 3LBNA 4N3GA 1N9GB 3RTBA 1JHUA 3AR9A 1Z38A 1KY5A 2XQFA 5AW7A 1QQ6A 4YLGA 3KXPA 4HH3C 2NTVA 3AOEC 1BX0A 1F2TB 4BLOA 1YZTA 3RU7A 3VBCA 2W9XA 1FFSA 3B6IA 3SJ7A 2PWZA 5HJ2A 2QR5A 3I5XA 2W42A 1U0GA 2BKEA 2QLJA 4NS4A 2Z95A 4DC0A 4EO7A 2P9CA 4E5NA 3GT0A 1MU0A 4LTDA 3TRKA 1MVNA 1E3TA 1T2VA 1T9KA 1RCUA 1ZHOA 4KSCA 2JLVA 1SG0A 2QSZA 4L0MA 3A1NA 4IH1A 3RK4A 3ITKA 2XNDA 1MX1A 3AZOA 1GQRA 2PXHA 1KL7A 2NIPA 1TYZA 4MYRA 1ZM2A 5FLKA 3UMMA 3PUZA 3Q3HA 3QJYA 3DE1X 4BO1A 5IC5A 5CA1F 4G1VA 5JXHA 1NMZA 1DVRA 1T8YA 5KMGB 1C2YA 5A5FA 1ZVVA 1ZU4A 3AUJB 4AS1A 1J9EA 1Y7IA 2VL7A 3G0HA 3KIPA 1GAEO 2DB3A 4L5CA 2FUG1 5E3IA 5K3EA 1P5JA 3VNQA 4GKAA 5LQDA 2HAEA 1B8OA 1K8QA 1UK9A 2YVKA 3T5CA 4GL4A 3ZBQA 4FGZA 4FX2A 3CIFA 5A2QA 4AKSA 2QVXX 4UPDA 3BMNA 1V5FA 3ESAA 4YRGA 4LHZA 1ZIDA 1KVUA 1QRRA 5FV7A 2IODA 1P39A 4RK4A 5IF9A 2EFDB 4YXFA 5DEOA 2JJ1D 4JBLA 2ZIVB 1Y33E 2AGVA 4FGKA 3KETA 4YRRA 1P7PA 1V5EA 5L7WA 1ZAKA 2IX3A 3A10A 2PCJA 3P9ZA 2OAQ1 5G3ZA 1JB9A 3SQDA 5T6MA 2XB4A 1W9HA 2O3QA 4RMHA 2J30A 4JA0A 4RZ3A 3FWHA 3KFVA 1P4GA 3HCNA 3GL9A 1W4RA 4QPPA 3T0GA 1E1KA 4DCGA 4EG6A 1NJ6A 2BCGY 4JR2A 5LQJA 2WNSA 3GEMA 1VG1A 4IUDS 2MIIA 2F4NA 5ALXA 4A8JB 1SBQA 4B71A 4WKCA 4NNPA 1PUJA 5E4YA 3CRMA 3N6VA 3P0RA 1GL9B 1OE0A 4IX9A 4G5HA 4CQJA 5LP6A 2IW3A 1HG0A 3DL2A 4R0VA 4Y2HA 2C4NA 1SUDA 2PMWB 1JTVA 3UXEA 4EW1A 1CQIA 1GQFA 2ZUUA 1NUAA 3EGWA 4QTXA 1P9OA 2ACKA 2I8CA 3L8EA 2B1RA 4WNAB 1NSFA 1SXQA 3UBTA 4MUNA 4EM6A 4FHZA 3HUTA 3R0XA 4MS1B 2I4IA 3T7RA 3GDFA 1PL7A 4LOAA 1MXFA 4BWFB 2A9VA 4YI5A 1CUWA 4KN8A 1HTBA 3LKBA 4LJLA 3W4JA 1U1DA 3WS7A 4BB0A 1MORA 4H1TA 3SI7A 4OP3A 1CUFA 1CWUA 3Q8XB 4PG4A 5IEBA 1GPBA 3UYLA 3ICCA 3M9LA 2GERA 5EWMA 2I65A 3V8VA 5CXSA 1P8JA 1NV8A 2ZRLA 1GFZA 1ZK1A 2QG9A 1SVIA 1YZNA 2P1DA 2P8JA 4JBXA 5ES3A 4DGQA 1M2NA 1BS1A 4LJ8A 5AKKA 2QRZA 2ZSFA 1LSSA 4OUDB 4DA9A 5IJAA 1X86B 1SCJA 3E9ZA 5DI3A 3RJ9A 2K7FA 1H9CA 3UAWA 3K53A 1FSGA 3HU1A 4TYPA 2HIGA 1MW9X 1AUPA 2GN0A 5E7MA 4J0JA 2VSXA 2XUFA 3DD5A 4M8SA 4FHCA 4WEQA 2WAOA 4YAOA 1G38A 1R18A 4FCWA 4PFSA 1DIBA 1QF7A 3B51X 3OY2A 4QLOA 4A1OA 1DRJA 4P4SB 1O96A 5MF6A 2B2NA 4F4UA 1JDBC 2ECFA 3L93A 4MGHA 4TKVA 2OCXA 4PAGA 1JSCA 1BXRB 1XROA 2R2AA 1VCOA 1QV7A 2Q49A 3JQRA 5JFTA 2WIBA 1RTKA 3TQCA 1XPUA 1E6UA 1X2BA 3EW7A 1N57A 4Y3UA 4Y6QA 1MAHA 1A88A 2JLQA 3KJNA 5L3VA 2R6DA 1SBTA 1A71A 2UKDA 1PX0A 4PWZA 1R0RE 4CQNA 5ECYA 1PK9A 4I2VA 4HGNA 4D5EA 3JQ7B 1NONA 5AK6A 1U0TA 4CKYA 1XJQA 4ESOA 1WWKA 5KWVA 3EH2A 5EZYF 3UHFA 4RJTA 2YOGA 3AWDA 3O84A 3C97A 4LNUA 1TVEA 1BC5A 4XJVA 3N8DA 2KMLA 1E2IA 3SSMA 4R7ZA 1GQQA 1JQBA 1KPIA 3KB8A 2HDNB 2WUVA 2XITA 3M2TA 4XIFA 3OEYA 4BCDA 3OQOA 5IDYA 4JP1A 4OYYA 2HSDA 2IV7A 5I51A 4R2KA 2JIBA 1NKTA 2EXXA 5KNLA 2ZI9A 1ZJ6A 2R5NA 3AJRA 4G9BA 4HPWA 1QYWA 2PG3A 1NBEA 1S9HA 4FKBA 1W0JD 2Q41A 5D1HA 5FR1A 1I2ZA 2NT4A 2HQBA 3SKYA 1U0OC 3BCUA 3PXXA 3TW8A 3UMYA 4O3MA 1C9EA 4UFOA 4ZEMA 2QM0A 4UHCA 3BZUA 3O9VA 1OWOA 4RKWA 4WGGA 2IWHA 5M34A 5E7QA 1F6BA 5EWJA 3EXHA 2HT6A 4GOJA 4P08A 3KVRA 5ALGA 2JGMA 4D4GA 3AR4A 4BVLA 2JCYA 5CTAA 2D4AA 3FZYA 2AA3A 3EFHA 4QUBA 5B3JC 3FD8A 5KX5B 1UIRA 2DXIA 3LY9A 1Y4DE 3NRCA 1VOTA 1PS8A 3GJ6A 1RJWA 2QUBA 4RVFA 1E58A 3H87A 4MKZA 1NFQA 4YCMA 3DDHA 3BFKA 5AVSA 3L4KA 5F5NA 3DKIA 4D74A 5A9SA 3SSNA 5KREA 5IVHA 3AK4A 3REQA 1XLTC 2I87A 4JJ8A 4DDHA 4GBED 3SC4A 4UAUA 5F78A 2E5WA 5AI0A 5HX7A 1UXJA 2ZDHA 3ZV7A 4Q4CA 1OI4A 4PG8A 3LXRA 2JFXA 2VVTA 5JDCC 3ZKWA 2PJUA 2VAXA 2X4LA 5I3CA 1JV2B 3AEQA 4I55B 1NC1A 1DARA 2IYOA 4HGZA 2N1MA 2VYQA 4OHZA 3CNQS 3L6UA 2XMPA 2WF9A 4MVYA 1NPTO 4AP6A 1V96A 2WBLC 3L7NA 4UHDA 1ZVQA 3C15C 1VKNA 2JH8A 3P5BA 1MB3A 3BWCA 1XL0A 1G8HA 1E2UA 3KV3O 1W87A 3PA6A 1M2OA 3GT4A 2FLWA 2RHRA 1YCFA 3GELA 1C9YA 3SXJA 2VRCD 5L3SA 4J0DA 2RB5A 5EP2A 2FUNB 2GYUA 2VHUA 3CLVA 2XUIA 3RC8A 2MYNA 3GZJA 1KPGA 2RC6A 3AFIA 4WIAA 3FHOA 3ZOZA 1G5FA 3LVQE 4R40A 3DO5A 4RHFA 1W36D 1LKZA 4D79A 2CVHA 4I9GA 3PTAA 1N8NA 1Y5NA 1T8TA 2HC9A 3DFIA 4M37A 3TLCA 5BN3B 2G71A 3WBJA 4J0GA 3I05A 2E4VA 2C5HA 4V38A 4Q7JB 5H02A 4ZIRA 4HFMA 1VE5A 1IU9A 2NSDA 1P19A 1GUAA 1DAEA 2HA6A 1ULUA 4OM8A 4D6PA 1KR2A 3RUPA 3ZJVA 1YZYA 2X76A 2G07A 3IP1A 4BFVA 3TIIA 1IAQA 2AJ8A 1HXHA 1Z5GA 3BL6A 4M22A 1XAJA 2BHLA 1ORWA 1Q3HA 4H9GA 1U9YA 2ZIZA 1WCYA 1HMYA 1YU9A 2Y1KA 3KZ1E 5BSMA 4E70A 4XFJA 1MGPA 1XRMA 1VA4A 4BBAA 5A04A 5DW0A 3HLYA 2OFXA 1WXGA 1A8SA 4Q19A 1QAOA 1K1EA 2JZCA 1JDNA 3ZHQA 2IZ0A 3NHAA 4YFVA 2CKDA 3DR3A 2V98A 3AF3A 2ZAGA 3CZMA 3M6XA 4IVQA 4PYOA 1T43A 2PX4A 4P3XA 1RXSA 1Z4JA 3QLEA 2QJTA 2W37A 1A8IA 2YDYA 2V3CC 2ISCA 1SJ9A 4PNPA 4E5KA 1WSWA 4IIJB 1JALA 1EUDA 3CCFA 3LJKA 5B1IA 4E22A 4TXJA 1SUIA 1D4AA 1SPBS 5DM2A 4AJNA 2ZLBA 1Q0RA 3RF7A 1ZGZA 1DAOA 4N48A 2C94A 3DMTC 3ND7A 2WJPA 2GZ2A 3NDPA 2IUUA 3SSOA 1U7UA 2V59A 4Q66C 2JHAA 4ZC1A 3VO8A 2DBQA 2I99A 1QYDA 3RKSA 1PCXA 2J85A 1XU9A 2P65A 3LC2O 3LX4A 5EERA 4H0CA 5THQA 1XI2A 3ZW7A 1O5OA 3H4VA 3MFYA 2H2WA 5E2IA 3P32A 5DHTA 5DPMA 1XWFA 4I5IA 4MP8A 4PZYA 2ZJ1A 1J1ZA 1NXTA 2VFAA 3FCCA 4ARIA 1RWKA 1BH6A 2CXOA 2J46A 4KC0A 3CLHA 3B8EA 3MJDA 3H6HA 3M3PA 2VEDA 4K6OA 3UKOA 4NU6A 1GYRA 3FYTA 4NV1A 4GMKA 4PQRA 1GPLA 3OBIA 4RV4A 3HU3A 3IE2A 4U3JA 3WOVA 4AZTA 2ZUDA 2NYAA 3C8ZA 1R5NA 4GQBA 2G04A 4QOJA 1LI7A 2A0UA 3EC2A 1KNXA 2HA5A 3EDMA 3P4XA 1NI3A 1W34A 4P7BA 2COUA 2BBOA 1MOSA 3IDFA 5DOZA 1U8CB 4MRMB 2CNNA 2J0UB 1BWSA 1Z4PX 3NHYA 4LXIA 4DLTA 4ZZ1A 1GT6A 1TO2E 3LLVA 4BV9A 2SECE 4MPPA 3GCDA 1PFUA 4BNDB 5TGZA 4GX1A 3SX2A 2XUKA 3IBGA 5LZ9A 3AY6A 1L4KA 1L4HA 4P9NA 5FTJA 2PGOA 1XHLA 1TJ4A 3NC1C 2BKLA 4BBPA 3I0ZA 2MTBA 4FZRA 2BSXA 3T12A 1WZCA 2QV7A 4QJBA 3GEPA 4FEEA 4UZFA 3GUVA 3Q6NA 4AN0A 4J3JA 2IWRA 3STXA 3U1BA 2IGBA 2H63A 3CUSA 1L3CA 3DW1X 4DCMA 1P80A 2YWJA 1QJ4A 3O8BA 3ZZ0A 2WB2A 3LLSA 2HX1A 2D13A 3DO8A 5AVXA 5L53A 1SUWA 2ERXA 4TMWA 4IV0A 3GAZA 1GRCA 4E5PA 2P6OA 3GNSA 1FRFS 3O4FA 4YCLA 4N5IX 4HT3B 1ECLA 3GDHA 1I3CA 1ZGGA 2YJ4A 1Y4AE 1L4MA 2GESA 3AG6A 3AJ9A 4D02A 2JLWA 3DJYA 3FBTA 3I0NA 4IDEA 4FNMA 2J59A 2VQ6A 3JQGB 1C1YA 1UMCB 3PR1A 4V03A 1PQWA 1FK8A 1OKKD 1NJ1A 5HQ3A 4JC4A 1RADA 5A3QA 1TO1E 1VJCA 1OXMA 1Y1SA 5JV5A 621PA 2O8CA 3PX7A 4O2RA 5J2UA 3WRYC 3TINA 2X41A 2W2KB 3T9FA 3P0EA 4D9KA 3W2HA 3AEKB 5K5EA 4IQGA 2E5FA 4NULA 5FOSA 1TTQB 1AS3A 2JRLA 1FFHA 3OIYA 4L4SA 2RJOA 3M4JA 4UEWA 3CM0A 4ZHSA 3BG5A 3T9BA 1QC5A 3HWX1 3NKVA 3EHEA 5K0NA 5IZCA 2OCKA 2PZFA 1LSUA 3BMOB 4IQ4A 5FQOA 2WUEA 3GRCA 4Z9FA 2F90A 2GK7A 5CB4A 1MTOA 1V4NA 2HKIA 4CEIA 3LDHA 4WXPA 3ZZMA 4D3XA 1KGSA 4H60A 1XRPA 1C3VA 1ODSA 1XGKA 2OV1A 4XLTA 3DZ8A 1Z2OX 4IBOA 2PWBA 2CVPA 1YL7A 2IEIA 2FA9A 3UUGA 4IP0A 1E9RA 2IHBA 5G53C 1KJQA 1GKKA 1L4EA 1D6SA 1FZQA 2R6FA 3JRWA 3OZEA 5BUZA 5K0EA 1V4VA 1R0BA 3IX7A 5KOHA 3COPA 2X0FA 3G9TA 3GJSA 4EA8A 4QGGA 3RRZA 3W5CA 1T13A 1LJUA 4R9RA 2H2FA 2ZRKA 2ZB2A 4WKOA 4JN6B 3OJ0A 4MW1A 1AZLA 2P9TA 4RMGA 1XZJA 1ZR4A 4C3VA 4BQSA 2EBUA 3ABIA 1CF2O 3H6GA 3HO6A 4YECA 3PSAA 4IGKA 3RBAA 3U31A 1UXHA 3ZQJA 1ODFA 2WM2A 2QV0A 4IIHA 4I46A 3F98A 4QG7A 4YROA 3KQPA 5TC4A 4F6RA 4K9KA 4RAQA 1WB5A 2VDUE 1RTTA 1UQTA 3WKBA 2Y6VA 2PFGA 3AM4A 4L16A 4Y2SA 1B43A 1WQ4A 1YRQA 1FUEA 3NTLA 3IEIA 1E2LA 4WXRA 4UDXX 2CDNA 3BGWA 4DC1A 3ZQKA 1YNSA 4S04A 4ZT3A 3KLNA 2WKSA 3TZEA 4M2LA 1PS0A 4AIIA 5F5XA 4POOA 3CURA 3RVJA 2IYRA 4Z49A 3B2NA 1F0NA 3Q7QA 4WCDA 3E22B 4F9FA 5FL7D 2JFGA 1CUUA 2ZIXB 3NONA 3KKNA 3ZLUA 4BAZA 1STOA 2P78A 1ZP6A 3WYNA 1CRPA 3Q85A 3ZVNA 2IW1A 4ND8A 5H83A 4H1WA 1RBMA 4NABA 1DEOA 4KLCA 5E4TA 3RVBA 1T2FA 4JP8A 4KLRA 1N0HA 5CIQA 3PE3A 2D00A 2Y1WA 1KKMA 5TPZD 3P94A 4F5WA 2ZG6A 2BI4A 4OGFA 4J8PA 1YRLA 2REOA 4RAOA 5I9NA 3O6VA 1ZCBA 2G1AA 2V7WA 1H0KA 5T6BA 4JD5A 1E2QA 2CKMA 4G65A 1IBMB 1YVUA 2BEWA 3I5YA 1B0UA 1IZZA 2ZOSA 3K31A 4LPKA 4M1KA 2P1ZA 3WV5A 1KI9A 6GPBA 3ID6C 2GETA 1QG2A 5A4MS 6NULA 4LJRA 2WMOB 3SZ3A 3K15A 5I4BA 1ZC4A 2GS9A 3PF9A 3MIZA 1BGXT 2IY7A 3B82A 4WZAB 2PSJA 4CMHA 4DA0A 2ZVDA 3UOAB 1E96A 3DPSA 2VDRB 4XW2A 3R23A 2UUCB 4OXIA 5ARCA 1GWNA 1LPAB 5EXXA 2XIQA 3VJKA 3RKRA 4CM9A 4JC0A 1SOWA 5ERYA 4HF7A 1E6CA 2JAPA 3R5HA 4MUXA 1AK1A 2A5GA 2RGXA 5G2OA 1CS0A 4KJZA 4N1AA 4UM5A 4HDSA 4XQ0A 4G09A 1YMVA 4R3NA 1E6WA 2Y27A 5JSUA 3MWGA 1E1YA 2QD1A 3LUAA 1B15A 4K87A 3KQSA 5CEJA 3UPUA 2OBNA 3RB8A 4ER3A 4ZVVA 4ZA2A 3E4CA 4URFA 5CUQA 4BRWA 1SZDA 2PN1A 4GZ5A 4M0DA 2XMBA 3ISJA 4WHMA 5KAMA 1U8XX 2DFPA 4IMPA 3QEAZ 1XNJA 1JN0A 1EZ4A 1R7RA 2VZLA 2ZRAA 3R5FA 1R50A 4G0VA 2FUG6 4R4JA 5HCIA 2OCLA 3ZBPA 4CIYA 2OXTA 4Q9HA 3F67A 3R7NA 1OTHA 4IO1A 4F56A 3KDSE 4MR7A 1NUTA 3UMFA 4AO6A 3G5TA 2VF7A 5T7BA 1M1NA 4OGGA 3U4MA 1W0CA 1M74A 2C7QA 1BG6A 2IPMA 3MNFA 4JBHA 2MSKA 4JOCA 5ICFA 4IIVA 3AF6A 3FYHA 3K32A 4HOYA 4MVJH 3ASVA 5DK6A 2B6HA 1GNRA 4F5ZA 4B82A 5DCWA 5BWBA 1ETUA 3GJ7A 3AHCA 3IDAA 2CT8A 3JD3A 3VAYA 1A7AA 5DGTA 1DDIA 1P5ZB 4QRIA 2I2FA 3BB3A 2WM8A 3ZHXA 3RPEA 1X77A 3VR2D 3I62A 2JL1A 5TT1A 4CL8A 3IESA 2V4UA 4I5GA 2D1YA 2GPJA 1QBKC 4BNXA 4DTCA 2RE8A 1QHHA 4BNTA 2VHTA 3GF4A 5EYPA 1CNEA 4EMSA 2GWHA 2D2IA 1NJ5A 5EIHA 1QS0A 2FVXA 2YFYA 3EXIA 3MTQA 5LQCA 2ZTLA 2QUAA 3AP1A 4C5AA 4MS3A 4YASA 1QDUA 4BNIA 3UY4A 2F9LA 4PAWA 4IZHA 1SXJC 1PJ3A 1L5WA 4G8JA 5B58C 3DW3X 1A5TA 3DJFA 2JFZA 4S05A 2NTYC 3AGQA 2JZOA 3G2NA 1DPFA 3V7YA 4A16A 1KMCA 4TVOA 4A03A 1SWVA 5FYQA 1E2EA 3UICA 3RG8A 4H4EA 3BMNB 3CKYA 4IDQA 4NP6A 4OHMA 4BO2A 2YICA 3WR5A 1S7CA 3AO0B 5F1OA 4ZVMA 4DG5A 1GGJA 3KU1A 4ENUA 3DULA 3FDIA 3THRA 3RGGA 4RF2A 2Q2WA 2XYPA 2BMDA 4LY3A 4S1OA 3ZEAA 4IH4A 4J2TA 2ARKA 2BCJQ 2R85A 3NR2A 3WK7A 3A2MA 1YS7A 4F2HA 5T3UA 4MDYA 1HYBA 1CDZA 1X1SA 3TCXB 3NASA 3A04A 3VXKA 5FBHA 1SD2A 2OV2A 4C4TA 4UTNA 5JPCA 4EW2A 1SKAA 1QH1A 2JK0A 5A02A 2JARA 4KZPA 4WBXC 4E7OA 1BXKA 4DARA 2YY5A 1LBTA 2ZW9A 3C3BA 1YB1A 2HBZA 3MINA 1KAHA 4CODB 5ILOA 4E03A 1ELOA 1X1DA 2C4WA 1LF5A 3CVOA 1T3HA 3DA8A 3MIIA 5EQTA 5IFLA 3WQSB 3TUZC 1VRVA 1SQ6A 1SHZA 2R1VA 3QA9A 5JRZA 2CYBA 1RWXA 5IN5A 1SELA 1YRBA 5ITWA 2XNKA 3T3NA 3EPHA 2W2LD 4RWEA 3MTDA 5LP6B 2JFVA 3IP7A 1OZAA 3GUCA 4ISBA 3AGPA 5GGXA 3WKCA 2FW0A 3P4UA 1R74A 2J0EA 4EFLA 1THGA 9LDBA 3E53A 3K0EA 1F20A 2EL9A 4M99A 2ERCA 5B57C 5FA6A 2G72A 4A8TA 3K05A 1WHTA 3ROXA 2RD2A 7MHTA 4C4AA 2A6PA 1ZD9A 2GBCA 3NOQA 3PVZA 4RC9A 4AMVA 1AURA 1L6RA 4EAQA 1VECA 2CXUA 4R51A 4MV6A 2SKDA 5EWMB 2A58A 5K4AA 1JDSA 2H4YA 4U9IS 1LF0A 2VK1A 2Z3WA 2HBRA 2EVWX 3O4GA 3EVCA 3DP9A 2HBQA 4CYMA 4NH4A 1GGFA 3TOXA 1EK1A 3R8XA 3WLMA 3V5NA 4NDAA 3HVRA 4WQMA 5DI3B 5GGYA 4AJHA 4HJXA 3HKDA 1SMKA 3DAHA 1GKIA 1R16A 3TM4A 1GUYA 2FK7A 4W4TA 4MEJA 3H99A 5AJYA 1X0XA 4S1NA 1Q6ZA 3NWOA 3VR5H 1RYHA 1ZL0A 2HJRA 1GFIA 1XQWA 4BX0A 4M1TA 1D1SA 2BN4A 3B53X 2DPGA 5LQKA 4O6VA 1ZH8A 2H06A 1N0IA 1O96B 1SQ5A 1JG6A 1TVMA 1VG8A 1Z6XA 2PZBA 3NYQA 2E7ZA 4TKVB 1VSVA 3FDFA 4C0HA 1SC9A 2ZSBA 1A72A 3UAZA 1YR7A 3TIGA 3OKPA 4JCCA 1POWA 3OFSA 3UGTA 1C0PA 2I29A 1CZKA 1DNPA 1P5RA 3DFKA 3IAFA 3QQPA 4IDAA 4KMRA 4MPRA 4PX5A 5G1OA 4TN1A 4RXTA 4G67A 2OPBA 1DT3A 3M6UA 3IMFA 2C5FA 5EE1A 3DZGA 4HDNA 5EC8A 3D59A 2Y76A 3RS0A 2ALJA 3D8UA 3VKVA 2Q2OA 3E61A 2AN1A 4KN9S 1IWOA 1FJGB 1E3MA 4RY9A 3U7IA 1Y5IA 4V3BA 3IVCA 3L4BC 2P2NA 3I9MA 2DQKA 1FB5A 3L8YA 2C4MA 5DMHA 1HDXA 4ZOCA 2VPXA 1QH8A 4I1RA 4LNUB 2JFBA 3K16A 1USVA 3GLUA 4TYMA 4MVJA 4KITB 1VGQA 1DEAA 2P4SA 2BD0A 1JAYA 2XT6A 5DGXA 2GNAA 5K8UA 4ML3A 2W2VA 3SD7A 4DMKA 1Y42X 4TMZA 3RI3A 2WJGA 4B79A 1TEVA 1K3UB 2MYUA 1KQFA 5EKSA 4QFCA 5KSOA 3TW8B 2VWHA 3L8FA 5GOTA 3TOCA 4GYJA 2ZWIA 4YRSA 4UNNA 1KJJA 3KOXA 1H05A 2KSQA 4JLOA 4KDEA 1Z3IX 2L69A 5EWJB 3Q2KA 1P2BA 1WMAA 3GUYA 4XLLA 5DIFA 1Q95A 5FRDA 1Z35A 4H6VA 3O3OB 5H16A 1WG8A 1XDUA 3RJMA 4URVR 3IIKA 2Q28A 4FW8A 1ZOLA 2GDZA 1AMOA 3CO0S 3QUSA 3WRVA 3CE6A 4U00A 1TK9A 3SBOA 3U3XA 4LJYA 1X42A 5HQTA 1UBLS 1S4MA 1UP6A 2X9VA 3K0CC 1JJFA 4BO4A 1KFCB 4P34A 4UREA 5EESA 1DIGA 1MC1A 2JIDA 2HLDA 1TB4A 2YWHA 4RVCA 1ISJA 2QYHA 4JL5A 3LNCA 4RVGA 5A9SB 5KDOA 2C2OA 1DIRA 1K0UA 2BFNA 4ZQCB 1NRIA 3RHZA 1TUBA 1I13A 3ZIUA 2KQUA 1NU6A 1YI8A 1UDBA 4HAOA 2AKAB 4CFSA 1A95A 2XXAA 3E2MA 5E6SA 1MJ5A 1W88A 1RVV1 1NHGA 2EX4A 3IODA 3L79A 3ZKWB 4DR4B 1DZ3A 3MBOA 1UDAA 1C1XA 3AEQB 4UM8B 4FLFA 3RT7A 4PCLA 2BTQA 1CR2A 4AUMA 3NVKI 1P9RA 2WJ4A 1UWKA 3TIVA 2Q3HA 2JGRA 4YV0A 3OT1A 4IKPA 4YR7A 1EBUA 4Y2JA 5CCBA 1FSFA 3OLXA 3RUEA 4RGBA 2C8KA 1OAKA 4IY1A 4GRDA 1M2OB 1MB2A 2RH4A 4KQKA 3O8DA 5BNIA 5L3SB 3OQHA 4DLNA 4REOA 1D1PA 3W4IA 1NBOA 4OMDA 2XGJA 1DBPA 1Y9AA 2FSVC 3CUTA 4QODA 4L57A 4PRYA 4GBJA 1ZNXA 3IMGA 3R7WA 1K68A 3MG9A 1QPGA 3KQNA 2W6OA 1B8UA 4YJGB 1E5XA 1W85A 3SDZA 4TQUS 4R1LA 4ZIRB 5HFNA 3CW2A 2WYVA 2O2CA 2B78A 2I6SA 3JZDA 1JA1A 3NUGA 1LXCA 2Y8EA 3WGTA 5FEUA 4X66B 3NFYA 1SUFA 1MDFA 3A3PA 5BY2A 4TMXA 4AMZA 5JYBA 4ZT6A 3ILVA 3EXG2 1EM8A 1PKXA 3TUJC 3FGPA 3TL3A 5JY1A 1NF9A 1S3IA 2YJ3A 4JELA 4IZ6A 4C06A 3H4MA 3RODA 1CZRA 1NXOA 4N0QA 2LCFA 4ID9A 4I4LA 1JZTA 3H5IA 3MSXA 4R8RA 1C4XA 1SCDA 1GGNA 3N87A 5GONA 1GLVA 2OORC 2UUPA 2XD9A 4M9QA 4RK6A 3QHPA 2PU5A 4X6YA 1MGOA 2V7QD 1JIKA 4OHVA 4DA6A 4LJ5A 3DLIA 2NM0A 4OB8A 3AJDA 4FB4A 4OXKA 3PE4A 2Y0DA 4YUWA 1UMKA 3TR5A 4ZANA 1ZONA 3MHTA 1EUDB 1Q16A 3OX2A 1EI9A 4C6TA 1M3SA 5K2MA 4O2BA 5JBNA 3CF4A 2XUHA 2Z43A 4XRRA 4DSNA 4ERXA 2E48A 3GJZA 4HX9A 3ZJ4A 4W5WA 1K8RA 4DLKA 5FUXA 4XRGA 5KC8A 2ZJAA 2BR4A 3LL7A 2JI4A 1ORTA 4X45A 4QO7A 4IFBA 1SRRA 4RKQA 4OF4A 4FGUA 4OJYA 3EVEA 3LPCA 1OYWA 3MJVA 4FZVA 3V8NA 4Z9XA 4MQ6A 3A05A 4K26A 1ANKA 1EE1A 1TUIA 2BR5A 3ASYA 3NALA 4FYXA 4XEUA 5B37A 4X6LA 5JYCA 1PSWA 2DBYA 3K1AA 1U3TA 3HSSA 1YJ5A 4OA5A 2Z8YM 2HO4A 3WGGA 4L2IA 3UGQA 3MRSA 4XCXA 2PUAA 1J24A 3ZDDA 3HKBB 2BMAA 4EPTA 2F3TA 2CMHA 4U3JB 5DYNA 5LJLA 4HGYA 1QGED 3TSYA 1W581 3G79A 5KYNA 3SC6A 1NVEA 1E64A 4RL6A 1IOLA 3EARA 5J9FA 4NZYA 3Q3JB 1G8AA 3DEZA 2GRAA 3QEJA 4DANA 1P6UA 1EB9A 2BFBA 2OC4A 3PYXA 2OD2A 4QTZA 1UANA 3RR2A 4CNQA 4C30A 4QPJC 1L5KA 2WTAA 1GUFA 4DREA 1N5OX 1NVXQ 3X44A 1JLKA 1H2EA 3JV7A 1JWAB 1NR7A 3G2JA 4FYIA 4C22A 3TLBA 4KGDA 2C3UA 2PBFA 1ZA1A 3FY4A 1S2NA 1FVHA 1PEDA 2H92A 4J7XA 5FJIA 5B12A 2IYNA 2BOVA 1IRIA 4BRUA 1YDFA 3E8SA 4OYRA 2QN6A 4KMOA 2A14A 5BV1A 1JIJA 3BJMA 3EEBA 3TRHA 3VH2A 1SC6A 2GN6A 1PTKA 3QE0A 3LUDA 1J2RA 3F3YA 3PNYA 1G60A 1RLUA 2LDXA 4EFDA 5T4BA 3WLJA 1WQ1R 3Q7IA 1OC4A 5A0TA 5EPEA 1QYVA 1U2RA 4KX3A 5CXQA 2O52A 4CKEA 3DM9B 2VXCA 3R3HA 1J0DA 3QVGA 4XQ9A 4IIBA 5ALUA 3SR0A 3TLXA 4AS3A 1LQ2A 1Y4UA 1LPMA 2W6ID 4ZCRA 1M10A 2QUJA 1R6VA 4J7UA 1R27A 4LA4A 4Y2RA 5I7RA 3CVVA 1HTTA 2ZR8A 3KOUA 4NYJR 5C8VA 1N5LA 2CL6X 1NIJA 1TW2A 5EXDA 3ZHZA 4E2YA 5B55A 1CEXA 2ID9A 5CVTA 2BGMA 1LTKA 3ONNA 4NL4H 4OSPA 6REQA 2KHZA 2DPLA 1XNRB 3SR4A 2O8CB 5A4AA 2PL9A 1E0AA 2GAFA 3BD9A 4KYVA 5J2UB 1KETA 4M87A 3RSOA 5C18A 1YFKA 5C37A 5HZMA 1KYXA 3MUNA 2UYHA 3MCUA 3RAGA 4LXQA 3SE7A 2AVDA 2PX0A 4TUYA 4WK4B 2ODQA 5ALZA 5A5DA 1T9HA 4NI5A 2B8TA 1EP9A 221PA 2YV3A 1XMQB 3EGEA 3MW8A 1L5MA 1NHWA 2BBSA 5TQ0A 3TLYA 1PUIA 1QC5B 1ZVKA 3NOOA 4FYMA 2BPOA 3HR7A 1NZJA 5I9MA 3RSZA 4XWKA 4BFLA 2D1QA 5CB4B 3ZUGA 5LQAA 1FMJA 3WDMA 5EKTA 4CEIB 4KB5A 2IYWA 1RAGA 3I9V1 3BILA 4Z53A 4EG8A 3R0IA 3GRZA 4LZLA 1ZMOA 1YC5A 4B31A 4M8NE 5CFOA 4QFDA 2N1BA 2PSEA 1ZNQO 2EG5A 1BMFA 1Q7CA 4Z7JA 2W0SA 4A5SA 5KOHB 3GEGA 2CSXA 1AZTA 1ENZA 3FHLA 4E09A 1UUFA 2QI9C 3QELA 2ZYGA 3JY6A 4FDMA 1Z4IA 2XYVA 4F97A 1A5BB 1Y3CE 3MJHA 3ZTTA 4X84A 3QQ5A 4H7FA 1D5CA 2ZTVA 4L28A 3U17A 3ZWPA 3ZDRA 1NYLA 4A73A 4DKXA 4Q9JA 2VAPA 1L5FA 3OO1A 3GFBA 3VYVA 4FIZA 3SVLA 2HSGA 4GZMA 4O1HA 4A6PA 1BGVA 4F6RB 3R9WA 3WLEA 3J7AC 3E5HA 4GI5A 2UZIR 5F12A 2QAGA 3K70D 3R8FA 4O33A 1YJBA 4UAJA 5DTEA 4P38A 2IH2A 4Q3DA 5HKKA 1F06A 4PZ9A 5DXFA 1Y6JA 5H7XA 2XXJA 4K2HA 1JLSA 2H1CA 1QORA 3BGVA 4LWPA 4EVSA 1REQA 3OHSX 1KDOA 1QH9A 1T5OA 2HFJA 3BJIC 4L5IA 4LZZA 5DI9A 1Z6TA 3KQMA 5DX1A 3ZE6A 4F0JA 1DFHA 2X0IA 2XAUA 3H9EO 3K5IA 2L2QA 2BSAA 3KZVA 1GCIA 1N2ZA 1MPXA 1GPH1 1VMEA 3IBTA 2I67A 3TDNA 3UJ3X 1UCFA 1B14A 1KBZA 1UZUA 2HEIA 4IDGA 4MP3A 2GO7A 4OHOA 4ND8B 2GJ4A 3TJRA 3V9PA 1W19A 3TTWA 1FRZA 4JDUA 4P8RA 2XDQB 3RFFA 1Z63A 1P81A 1G20A 2RG7A 5F2NA 5JT1A 2FWNA 3H1FA 1LLFA 1TZJA 3AIMA 1AB6A 4C7BA 2YWEA 1ZGJA 1IOWA 2JASA 2BEWB 2G08A 1C7QA 3ZLJA 3IIJA 1IY8A 1I30A 3D8SA 4BOYA 3AY0A 1RWQA 2X8JA 4M60A 1RKUA 3F6BX 2P2CA 3BWXA 4MHOA 4QUEA 1XZDA 5E38A 5A1JA 1YF3A 2O54A 4LOKA 1CVRA 1XTUA 5EHNA 1HPLA 2PMFA 2OQIA 3EVNA 3HLTA 1R6AA 3FRJA 1T91A 1Z8FA 4R05A 4URYR 5EMNA 1XMIA 3NBFA 3TXYA 3VU1A 1XMXA 4HXYA 2I8LA 2CB9A 2A0FA 4QJ5A 5SZJA 3B78A 5GV7A 5K3FA 2PX6A 2DPYA 2ZP1A 1DXYA 1N1EA 2JDIA 3NEYA 2BWJA 1S8NA 2GN8A 3K9LA 1CS0B 2ZTSA 4IJQA 4HDSB 3FJYA 4HDRA 4JI7B 4FCCA 3CHYA 3IUYA 3SYRA 2VJMA 1NQWA 1RRFA 4DNOA 4G0YA 4HDAA 4W99A 3C3CA 3ABQB 3WLRA 2FTKE 1Z37A 1T5HX 3N2ZB 4XQGA 5FI3A 4QAQA 1MJHA 4NCKA 1R9GA 3DE6X 4JENA 5KEIA 2VSFA 3EW9A 5KJEA 4M55A 5DOVA 7AT1A 4MR7B 3OZSA 4FFRA 3IALA 3LQ4A 1RWBA 2IEYA 1M1NB 5I7AA 2V8BA 2HNKA 1W4AA 5FL3A 1WMDA 4ON9A 5DNVA 3KQLA 1SHKA 2Q07A 1VSBA 1Q11A 1ZXBA 4HS9A 3DNPA 4Q24A 1OJLA 3M83A 4RF5A 5BO5A 4ZYVA 2R7MA 1E5TA 2X1HA 3G0BA 3IULA 1NVVR 2R1TA 3LDUA 5ALVA 3GDOA 3DBIA 1ILEA 3CUVA 1BMDA 3NMUF 1XTBA 4AJ9A 3ZHBA 1FNCA 4E14A 3ZVRA 3PWKA 5LQUA 1Z08A 3LX5A 1JG7A 2G63A 3ZDCA 3M6MD 1VL6A 3NT2A 3IP5A 2IHUA 3NPMA 3D3EA 1MV5A 1MH9A 1N3LA 2R3SA 4P93A 4QEKA 4KEAA 2ZE8A 3H1BA 5EYPB 5KYUB 2XTNA 2GUWA 2C9BA 2ZJ2A 1QS0B 1XYVA 3EXIB 821PA 3S2IA 2Q5OA 2LZ0A 3ODPA 4K28A 4MS3B 4BX8A 4H77A 1JUDA 1C9DB 4QUIA 1AY0A 3S3TA 3T0IA 1NN1A 1V25A 1KIFA 1TAGA 3ZY2A 3RVLA 1XQYA 3TG2A 5D7BA 1PYGA 4DQ0A 2Q29A 1U2DC 1QRSA 2CHQA 1WY7A 1EVLA 1Z2DA 4M0EA 2TSYB 4ZO4A 4L8YA 2PM8A 4H6PA 3ZGOA 1KA9H 4TVBA 1BRTA 1CB0A 2I3AA 4JUAA 1WPRA 5T64A 2AKEA 2FRDC 3GYGA 3DHVA 3C7TA 2Q4OA 2C4VA 3NOVA 4PYNA 4M1QA 2DR3A 1YK0A 4PYMA 3TBHA 1V1MA 1UC4B 1EUYA 4WTOA 3WQHA 5JROA 2MMCA 2BZ1A 1X1RA 2AUNA 1KZ4A 2D54A 1SKYE 4X61A 2G36A 4I3FA 5IHPA 5JI3E 1N1DA 1L5LA 5IM4F 1QH1B 1JFTA 1DWQA 1JVBA 4EB0A 4DABA 4DLVA 1N25A 2R65A 3MINB 4PHTA 1LLQA 2O07A 4LJ4A 1EFAA 2ZJBA 2ZJFA 5F33A 2E4YA 2R1VB 2ZWVA 2ONKA 3OCYA 1FNSA 1T3LA 4WBNA 1QG4A 3FCOA 3HTXA 2QL6A 3L0PA 1K7SN 4F2PA 4JSRA 1BXZA 1GG5A 2C2MA 4TLBA 4IIUA 3H9BA 5E9WA 4GLBA 3TQTA 3V00A 3DE0X 3L3BA 1L8LA 4MQEB 4FYYA 1XTVA 2PS0A 1BN6A 5JWHA 1E9FA 2VC2B 4EUKA 4JY7A 3FOWA 1T9GS 1U6KA 1R9MA 1WHTB 3AVTA 3P9RA 2XCRB 3CEMA 1OXXK 1FDUA 1PLJA 3CQ9A 4N9WA 4CG1A 2Q0QA 3CUEF 4EOGA 1FYDA 4LY9A 4ZHQF 5H82A 1CUSA 1MJGM 2D5CA 2A9QA 4OU4A 3WGZA 3KUUA 1NY5A 4CG2A 3F3KA 2VDNB 1DE0A 4IIFA 3NHSA 3HKDB 4BGVA 1M1YA 1NATA 1OWPA 2BF7A 1Z17A 2ZYWX 1CYEA 4DWJA 2JBAB 2OGWA 1KYVA 4O59O 4DV5B 3KQQA 2V5UA 1B8VA 1R8XA 1E77A 3MYYA 3NORA 4QA9A 3LMKA 1E3EA 2FQWA 4WL0A 1DBWA 3JYQA 1FFEA 4JZKA 4G4IA 4D6YA 2Y1DA 5BN5A 2IQ5A 2BGNA 1GKYA 1K89A 2CDRA 2GCOA 1H9AA 2C7VA 4LZJA 4F4FA 3ZGZA 1OBFO 4XZ3A 1J2UA 1ORVA 4JB0A 3L49A 4U6NA 4EEKA 2QIPA 3QXJA 4JLJA 4OU5A 4B45A 2JCGA 4NU8X 3PIIA 1MZVA 4BFXA 4RUKA 5KUTA 4X1OA 4F4HA 1C3LA 4NPHA 3VU9A 1OR8A 4HDNB 5C9ZA 4MRRA 1IHPA 1C5KA 4OGLA 2IY9A 3T3OA 4LKOA 3BC1A 3Q8MA 3VTZA 5EJ6A 1J8QA 5TPWA 2P2SA 1CNFA 2PMBA 2IZ1A 1QP7A 1E94E 3QG1A 2V6MA 2EATA 3D2AA 3FTCA 3HL0A 1FFDA 4NYJQ 4ZQEA 1COWD 4X5OA 4EZIA 1QH8B 5ALLA 4XYEA 2GNPA 2YVAA 2YV5A 1TEZA 4M8LA 4BMSA 1HEYA 2EZ9A 2IZ6A 3VOAA 1Z75A 4K9NA 3LHSA 4N18A 2ZYAA 3EG9A 4ME6A 2R4UA 4GIBA 2BEKA 5IMSA 1YE5A 1NXVA 3VVLA 4PCAA 1PL0A 2JLBA 3NGMA 4RHYA 4YMIA 5ENDA 4TQAA 3X1JA 4B80A 3W5BA 1X1EA 1YVDA 1QKJA 3KSDO 1JF8A 3T5AA 4QM7A 3WG9A 4ZYXA 3FNRA 2JZNA 1EHYA 3G0IA 2PL5A 2ILTA 3PYLA 2ZI3A 1V5GA 3BJRA 5AVQA 5I7HA 1EZZA 1Z5UA 4MV1A 1VL5A 4IWXA 1RYNA 3PG5A 3W6PA 1Q1GA 3TXAA 2B9EA 4G0XA 4NDNE 4HSEA 5B3LA 1PUXA 3LWBA 1JSLA 3ROFA 4OXNA 3V7UA 4D9GA 4CQLA 5IVKA 4BMXA 4YO7A 3EGIA 5DZSA 3BICA 1WB9A 1HQCA 1GRQA 3F7MA 4KK4A 4JQZA 2D0IA 4OKSA 1XR3A 5DLYA 5ENZA 1OLUA 2OCGA 5EZQA 5HMMA 1ZKDA 2JPDA 3ZD8A 4J2HA 1W44A 4NJMB 1TUBB 4G5QA 4B7XA 2JATA 3WICA 4DFDA 3PUWA 2A9OA 1TZ2A 2UVPA 4OI1A 2XXAB 2WQZA 3DL0A 1W88B 3JD2A 1J00A 1NW4A 4G41A 5E6SB 1HGXA 1EXNA 3LC1O 1C1XB 2H4WA 2VT3A 1XTIA 1U0LA 2QA5A 3FHTA 2BTQB 1L5VA 3ECCA 3K0AA 3KT3A 3MJCA 4QPDA 5C7OO 2UUBB 3FSGD 4BVGA 2R62A 3CPHA 3OT1B 4Z8XA 2PU7A 4E33A 1RXEA 4MRSA 3OKCA 3K4PA 2C96A 3CZ4A 3SEZA 3GROA 3NBMA 1Y3AA 5DHAA 2VQ3A 3IA2A 3LL4A 2ASVA 2BFOA 4JL6A 4RHCA 4EZEA 3H2HA 2H18A 4XDYA 2ZB3A 4C7MA 4UUBA 4ND3A 4ZT4A 8GPBA 2PFSA 4P0QB 1GZSA 1MT0A 4R3WA 3I12A 3MQ4A 1R5BA 3CTMA 3G2MA 3K1TA 3TFQA 5MGBA 3R7WB 2YWDA 3H42B 4PINA 3RS5A 1IQRA 3KPJA 3LZCA 4Y6LA 1DAIA 2V6FA 1B0PA 3DVSX 2WF7A 2B3TA 1W85B 3NNNA 3RTCA 2IT1A 2HI0A 3RROA 3UK7A 4V0LA 3I8OA 4TL6A 4Z1OA 2CUNA 4X0EA 4F5YA 4MIYA 3T4EA 1P60A 4Y0AA 3P27A 1ZJWA 3R5KA 2PH1A 5ETJA 1QIEA 5EIBD 3RJ5A 2E5LB 4Y6OA 1CR4A 4QVKA 1DPGA 4LF9B 1EM8B 2NNWB 1X8LA 3R20A 1H2HA 1K5PA 1XHFA 1KMQA 4QXPA 5AXBA 4ZEOA 1NP7A 5HZKA 1O4VA 4N41A 2B8EA 2GN4A 1M7GA 2QRGA 1EM6A 2SKEA 2FMHA 2WHPA 1T2NA 4PGAA 4MW2A 4P22A 1D2NA 1U7PA 2A5FA 3E1KA 4JUBA 4QU5A 5DNYB 5GONB 1FTWA 5B2EA 1XCBA 3DBRA 3P8ZA 3WTBA 3BE8A 3C6ZA 1UC8A 1ONNA 5FHRA 2BM1A 1CY7A 4RVOA 4WCFC 1H5QA 3UMRA 3OM0A 4GWKA 1XZLA 3HJFA 4QAJA 2OK7A 1IBLB 1HL7A 2FMIA 3P9QA 2NO6A 4OY3A 3T1YB 5KJ6A 1C50A 2JJYA 1T3SA 5KO2A 4UHEA 5DN6D 1Q0SA 3VV2A 3NVDA 3K0FA 3RIXA 3C1AA 3LP5A 1BKYA 4QOFA 1IH8A 3C4VA 1DAPA 2P2DA 2GPBA 3MERA 3N2IA 3OX4A 4UDYX 3OEHA 2XWPA 3ELWA 4Q3KA 4QSMA 4ZDWA 4Z1MA 2EP8A 5B1EA 1SIOA 3C6BA 2YRWA 3AV3A 1US8A 3RLFA 3JVDA 1J25A 3S40A 1HNZB 5B7GA 3MMSA 1W5SA 3D7KA 4MTLA 1RP1A 4BNNA 2AF3C 1DP4A 3P0FA 3WK8A 3L41A 4DRXB 1SK8A 1LDNA 4MYCA 1KSJA 2FAXA 5HF8A 5E3HA 1AXEA 1EZ1A 2Z6QA 4QJIA 4FE4A 5AKXA 1RRMA 2G0NA 3K0KA 1DQYA 4RFSA 1IVNA 1E6KA 2FFRA 2YJTD 3TTSA 2FPSA 3KXKA 1DOHA 3AVVA 3O4IA 3O73A 4HN9A 3FX2A 3I2GA 3LY7A 4NBTA 3SBEA 3EQ2A 2NU9A 2FN8A 3K1AB 4MUHA 1TADA 1T0PA 1V3UA 2CXQA 3EZ6A 4ER5A 4YMLA 4L2IB 4M1SA 2OENG 1NVVQ 1QHEA 3EFEA 3W2IA 3E48A 4JL8A 4F2WA 4O1IA 3HZOA 1BVRA 2PLWA 5AUPB 5E7JA 5E8JA 1KK0A 1TM4E 3WYFA 1N3YA 3W5JA 1H4QA 5A4IS 5DJ5A 4RZUA 5FUMA 5AXAA 4U6SA 2X2OA 2ZYUX 3D6AA 1OMOA 4WECA 1GNPA 1U7TA 1ZD2P 2I78A 3A31A 1O94A 1SQFA 3DMNA 3PQ5A 5EGSA 2IPOA 5EMKA 5JQGB 2BFBB 1FA9A 1H3EA 3OTHA 1UBOS 1MX9A 1V1RA 3CSUA 3DT6A 5DK4A 4TOIA 2C5AA 3LUHA 4FS3A 5LB2A 4UNIA 1V9LA 3HP1A 3RRMA 3K4HA 4FW9A 3TKAA 5AQEA 2H2DA 2IOFK 3CRW1 4ARBA 3A0RB 3RVSA 2G06A 4Z5XA 4YJKA 3H05A 1IUKA 2P77A 1DHTA 1JNXX 3AERA 1SHUX 2O2IA 1C0IA 1H2RS 1KJWA 1QIDA 2R84A 3FFBA 4KJXA 3DZJA 4QU8A 3DLHA 4PSKA 2IV2X 1YUMA 1IZ9A 4N40A 2VOEA 1JH8A 1UBJS 2CLKB 3A14A 1CVLA 4Z2YA 1SVUA 5E1BA 3BPSA 1U28A 3W90A 1Q6YA 4K1XA 3I92A 5LZ8A 2YW2A 1DC5A 4YLYA 3ETHA 2AWOA 3TSZA 5K99A 2TMGA 4JZYA 2GHTA 4EX6A 2JF0A 3CRVA 3ETLA 2J4FA 3A1VA 1ZITA 3I9V6 1AA9A 3FBGA 3QVGB 2XCLA 3O2JA 4CKEB 1E2DA 4MEBA 3UAOA 2W2NA 3IBYA 3WLOA 1CVIA 1Q1BA 3WL6A 5BMVA 2R8XA 2ORWA 1WDMA 2PO5A 2R6AA 2NMVA 1CLUA 1PT8A 1U0SY 2OO7A 1EWTA 4MLPA 3EDCA 3IUBA 2MINA 4EHNA 1M75A 4JNCA 4C14A 1LC3A 1A2KC 4DUGA 4GQAA 2C92A 3B85A 4A0RA 3H3FA 1E4VA 3KEQA 2DQSA 1WOYA 3L7OA 4L7QA 2GPSA 1F0PA 3NJ8A 5EI5A 4Q0MA 4CLOA 4A2PA 4PF1A 3H5RA 4BB9A 3KE8A 4MGZR 5EKDA 3OT5A 2FDCA 1T36A 2I6TA 3AIIA 4TUYB 4PAQA 4F5DA 1KRXA 1SN7A 1L5GB 1E60A 1CD5A 1ZBDA 2PDAA 1CUDA 4DUZB 2QJRA 4XLZA 1IATA 4MV7A 3HU5A 4IIXA 5TQ0B 3KEMA 4AY4A 5DM70 1YQ9A 1AUQA 1NN3A 4MULA 3ROZA 2R751 1ML3A 4WDRA 1ENPA 2CLSA 2YKGA 1CFJA 3D5EA 4X1IB 3KUCA 1B7GO 3K8ZA 1FMCA 1PDWA 2QTRA 3HCFA 3I4CA 4TS3A 5LNK1 1QV9A 1ZQ9A 3IV6A 4KLNA 5M2QA 4U02A 3OD1A 1LBEA 1KDPA 2DUMA 4TZTA 1ECCA 3DAOA 3QA3E 1K6IA 3ESXA 3GYBA 2JFFA 4GMFA 2O1WA 1L7VC 3E18A 5AM5A 5BV8A 3AEUA 5G3YA 4DG8A 4ENTA 4XR9A 4D9EA 1W9MA 2D74A 2DLDA 4RQAA 3RSCA 3NTXA 3Q8KA 2GNOA 1UC9A 3SOZA 3QELB 2CMFA 4OBXA 1CUCA 3I6ZA 3VR5D 1CZHA 1PT6A 2JVJA 3AOEA 3FDZB 3WYAA 5JY6A 2NT3A 4KO3S 3FNEA 1C8KA 1RPJA 2J41A 5DB4A 3ZWVA 4DIOA 1U1GA 4FK8A 3H1PA 3IEUA 2ID8A 2HMTA 2GSWA 4CM3A 1O5TA 1X7XA 2HMSA 3E7FA 4DNQA 2ZCJA 4RLHA 4NZ9A 4ZV9A 2AUTA 1AKNA 5KS2A 1CUVA 2QAGB 5JZMA 5KX5F 5H9WA 5GQSA 2HTFA 2H2HA 2PXCA 3JZMA 4FDTA 5A4DA 3VNSA 1H5NA 3EBOA 1DQSA 1NR1A 2Q9AA 3E9CA 3QBVA 1REQB 2X2FA 1Y6QA 3RSLA 4CKBA 1KJ8A 5BQXA 4U7WA 2YY6A 3OFND 3R6GA 5AW6A 2ZQYA 1KDZA 3ENNA 3ANLA 3TF5A 5EJFA 1CB7A 3EGOA 1X7WA 4D43A 1EB8A 2GTHA 1RXVA 2KYRA 5H5JA 1GZ6A 2L17A 4BASA 1X1AA 3PCXA 4OSOA 2CLIB 3ZLBA 3BXXA 1L4UA 1UXIA 3JD4A 4WV3A 3VU0A 4I55F 4DR2B 4AJ2A 2DMRA 4ZRNA 1TCBA 1BHO1 1C30B 1IN1A 4CM9D 5J4VA 2PRSA 4GGMX 1E1DA 1G20B 2C4TA 2ZPUA 5TEVA 3EC7A 5J40A 3TZ6A 3ZYCA 1SZCA 2WINI 3FGZA 2OP0A 1ZCFA 3NNSA 1Y8QA 4IG4A 4KRGA 4MCHA 5FB3A 3ELYA 3C7AA 1TQ4A 3IT1A 4EY8A 4RNDB 3B1KA 2J0VA 1XQ9A 3NP7A 1EINA 2YY7A 2DECA 5ALOA 5AESA 1KKLA 3F0TA 2B69A 1IUOA 2X8JB 2C31A 2UZ1A 5DWVA 3HDJA 3WE7A 3ISVA 3THSA 1J49A 2WAMA 3U7EB 1Y34E 4KYIB 4PBRA 4HXGA 2VJCA 5IULC 5J4YA 3TTVA 2WJZB 3GUUA 2P2YA 5EIWA 4EW6A 1V5IA 2AG5A 3D8NA 3K9QO 4OXXA 3EIHA 5DLEA 1ADCA 4WZBA 3OAAD 4G81A 2WILA 4XB2A 5EUBA 4Y1FA 5G1NA 3BFPA 1YR3A 1P2TA 1HFEL 1O6GA 2O7RA 1WMBA 3DUFA 3FLEA 3ETGA 3IAHA 4NCNA 4Q1BA 4QUJA 1WZ2A 1J8YF 1EDBA 4FFBB 1SHLA 1I01A 2GCPA 2VJMB 3O1JC 3R09A 4LBZA 2DKOA 1J99A 3IYLW 3RNLA 2WJJA 3PU6A 4RS3A 4BO6A 5ISMA 3WLAA 3HYLA 4UNSA 4TZ6A 3TUIC 1XRLA 2FN7A 5H68A 5C5EA 1AGRA 4AMUA 2MDTA 1Y1RA 4AWBA 4MLCA 4PHGA 3AT1A 5EZYA 3RDPA 4F1WA 4BNWA 4CGZA 1Z8DA 4X94A 1E18A 1BW9B 4G5RA 3S0JA 1KOJA 3GRAA 2WVGA 2B1GA 4PSAA 2VNIA 1NF2A 1JQKA 2CL5A 3ON5A 5A4FS 2X5NA 4N3NA 1RRCA 1BKSB 2R1TB 4JHLA 2G67A 3CZ9A 1ZHFA 1WXEA 2PA3A 4EYSA 2WT9A 1JU3A 2YW9A 4FDLA 1GTRA 4G0WA 3NCTA 5EQDA 2IEBA 4XPIA 3FM9A 3RYIA 3I6BA 5JAQA 1E8MA 4UQOA 3ZDZB 1VG9B 2JEZA 1YU6A 4YQEA 3ZI7A 1RAFA 3VR2A 2NZVG 2Y0PA 2J87A 3ADOA 1N4DA 4AMGA 4AP5A 4YIHA 2R6R1 4DIEA 3IAM1 1CV2A 2NPOA 3SMVA 5JASA 5JJLA 1XALA 2G9VA 3Q1LA 4MI3A 4RGYA 1KXZA 2J9XB 2R25B 3CUWA 5K3CA 3SAJA 3F97A 3T54A 5B64A 1QPBA 3GK3A 5HKAA 4BNUA 2QGZA 2IEGA 5KKNB 3GPIA 1DZIA 5GTDA 1KAOA 4OX9B 3DO6A 1ZOPA 2FF7A 1TPZA 5A0VA 1HZJA 1M6NA 4BJHB 3LWZA 4Q6BA 4ERNA 4P31A 1JAXA 4KHPB 2C98A 1BMFD 1O6BA 3E9QA 1Z7WA 1JYSA 3HYCA 4F9GA 3GAMA 5K0BA 5DYWA 3TQFA 2P9HA 2XA1A 1Z0FA 3EIXA 4YHHB 2FSHA 1Q7EA 2QK4A 3DL7A 3JD1A 3H5LA 5J2TA 1QCCA 1ZFNA 1V1MB 1WU7A 2E21A 2RHOA 2G80A 2WF6A 3QVWA 2C58A 4FMPA 4C4SA 3QW4B 3ITDA 4EB6A 1UBMS 4JJGA 5I4IA 4HVLA 4Q7MB 4C4OA 3JS5A 1BX3A 3G2LA 3B48A 3SLGA 3RVOA 4F9TA 4AYTA 2FPUA 1EIWA 4ZALA 3ZWDA 2HY7A 3D81A 4XVHA 5KVSA 2DEUA 1XKXA 2AC7A 1EFTA 1ZGHA 1AK9A 2PX3A 1QP8A 3OE1A 4HSGA 4I1IA 5HKKD 3OWHA 3OECA 1PD0A 1OQAA 2Z4SA 2QB5A 4FTWA 4UU0A 4DLWA 1V7CA 1II8B 1FFGA 1LX6A 2EDAA 5EJMA 4D9MA 1F38A 5KYWB 3A2LA 4EBBA 5KSPA 1U4OA 3LCRA 1M2GA 2IXTA 3E5MA 3KJFA 4LGMA 3IQDB 3Q88A 5B3JA 4ENRA 4WBNB 2HF7A 4O5OA 1J2YA 3ILSA 1XJWA 3IXMA 3ZU3A 2E4AA 5AVZA 2Z57A 2WVHA 4U8HA 1I6LA 1GAXA 2PBLA 4D41A 4BKMA 3FMFA 1GP2A 1XLTA 2J3IA 5BQPA 1I6MA 1QUFA 3B12A 4WVFA 3CH5A 2QRJA 2OFWA 3LF1A 4KI0A 3I2YX 3VC1A 4B74A 4FONA 4S0ZA 4B34A 1AQ6A 4G25A 9ATCA 1A97A 1GPNA 3N7AA 4S0XA 5C4MA 5JDCA 3QUAA 1S2MA 2X23A 4G26A 2XMZA 1GRRA 5IWCA 4FDVA 1Y6RA 4CKZA 5DH9A 3TK1A 1CF4A 1J21A 3D6JA 6PFKA 2FR8C 5EJIA 2ZUSA 1M1YB 3OOYA 5DNAA 2ATVA 3KYJB 3TIXB 4YALA 3JSAA 1QFXA 5DIZA 4JT2A 4KIGA 3B5EA 1HFKA 1KJNA 1U8UA 4M9UA 4UMVA 3EBLA 4DMLA 2G9NA 1MRSA 2B21A 1ZIOA 2ZE6A 3NYWA 4NFSA 4C4ZA 4L1KA 4DZTA 1E1CA 4TRMA 5E1MA 5HM6A 3TZBA 2DFVA 1YOVB 2GCOB 3FBWA 2J5RA 4EI7A 3DT8A 2BGWA 4KR9A 2GM9A 4RIEA 4BNGA 4CDRA 3K71B 5P8WA 1L5ZA 4C0KA 5K8TA 2VHEA 3GLGA 2VWQA 3DKVA 5CVVA 5DRTA 1GCAA 4IV8A 1GNVA 2B5VA 4GS5A 1GHTA 2EFEB 3VU9B 1EJ2A 3ZBUA 5TF0A 4I08A 4OGKA 2WQ6A 3BK2A 5TPWB 1J22A 4BRSA 1XQ1A 2ECPA 2PYIA 1TZKA 2Y4OA 4FFDA 1KI3A 4JQCA 1PR6A 2VHVA 4P82A 4G23A 4IOMA 1NV9A 1EVJA 1PR9A 1GYPA 2DUUA 1FU4A 3C5CA 1EVQA 3UXMA 1KJ9A 1ONOA 4XJTA 1CBUA 5EJ8A 5BWLA 3EIEA 4B7ZA 4AY5A 3V8MA 1IEQA 2FR0A 5TJ9A 3SHVA 1EFRA 3G2OA 3JPYA 3HABA 4FJ2A 4WA7A 3TXXA 4IJUA 3M6FA 2HYDA 3EG9B 1RHUA 2BFEB 1NVFA 1P75A 1E1QA 3JQ6A 5FUBA 4AG5A 4GGOA 2M6RA 2XQGA 3B20A 3MSCA 2LKDA 5AKYA 3ZLTA 1YKSA 5CBPA 5KWSA 4QL3A 1M2WA 1M0SA 3QF4A 4ZMSA 3TL6A 4P84A 4XVUA 1L4NA 2Q3FA 4UU1A 2G09A 3VDNB 3OTIA 7GPBA 3R3VA 3W04A 1M1YE 2JA1A 3CU5A 1ZM4A 3DMTA 1P2VA 3JAKA 1WLYA 2IQIA 4MAMA 4HS4A 2NSLA 4KSBA 3W78A 3WAGA 3ADBA 1ACLA 3C98A 1QIFA 3PV0A 4TS9A 1XZIA 4BKOA 3ZDXB 1SC3A 2JLAA 2BGJA 1QHFA 3R0VA 3K1YA 2VF5X 1UBRS 3F1LA 3U4DA 4CQLB 1VA5A 2A7XA 3EDYA 5HR5A 1RLJA 2IHKA 1HX7A 3T4XA 3C41J 2HIMA 1Z13A 4ZEVA 3ELDA 2YXBA 4QDOA 2CHFA 5FYDA 4OXYA 1OLUB 4QPZA 4UZEA 1EKXA 3CLTC 3Q8WA 1I9GA 5KYVA 1BGWA 2AMVA 1ZIYA 2R60A 4G07A 5F2EA 4C5BA 2UVPB 3VZPA 1XDGA 1ZJZA 2C42A 4CDGA 5LC1A 4MCIA 5LR6A 3ZCUA 4PTZA 4QYSA 3B9BA 3PUVA 4FDAA 1FFBA 1Z5NA 3EOAI 4OAQA 4MUEA 4LF6B 3E9RA 1W6UA 1YULA 2O2SA 1IXYA 3AR8A 3K0AB 2EX0A 2Q1YA 3UUWA 5CT4A 3KXDA 5EIEA 1OBHA 1FVOA 4I4NA 4XD7A 4DILA 4EMBA 5AM3A 1U8AA 3LECA 3W2EA 3OUTA 3EXG1 2ODNA 2VPQA 3OQIA 5DKFA 2O8VA 4XM1A 1OGJA 1GO2A 3OC0A 1XK6A 2JHPA 1CQWA 2HWWA 4IGAA 2ZBEA 5SV2A 1Z8NA 1J2EA 1PN3A 3OCJA 4HV4A 2ZRIA 1PBNA 4NMXB 5IP5A 1QPZA 5F9HA 1Q57A 5I6DA 2PXXA 1D2RA 4D9BA 1W48A 3DOIA 2OP1A 3A0UA 3A1WA 4GR5A 5DP2A 5DVZA 3AEYA 1U8EA 2QVZX 3K1ZA 4PYIA 1C3OA 1JT2A 3HCOA 7REQA 1PJCA 5JJCA 4KWCA 1JHZA 5LUBA 3PPXA 4QUDA 3ZJUA 2WLSA 4BNJA 4OYLA 1KHTA 4R98A 3ZWXA 4KQJA 2XBLA 3WLHA 4MQFA 3I04A 1HT0A 2QRUA 3GD5A 5G0VA 2VUIB 4BV3A 5I47A 1PWZA 5EJAA 1OAOA 2RHMA 3NW9A 1P5HA 2M32A 4O2AA 2RKBA 3UYKA 1KP9A 1VM6A 3EVBA 2DUNA 2WHPB 3LOQA 1J07A 1VE6A 2HQRA 4KL8S 2D4HA 4PAMA 3VR0A 4YI3A 1DS6A 1CRQA 1N0VC 2X7XA 3DBRB 3C5HA 4JLWA 4UNQA 3ZVLA 1BNCA 1RLMA 2XVMA 3LGXA 2FHSA 4FOPA 5BR4A 3QU2A 1NXXA 3U9LA 4MVWA 4V0NA 2A9PA 3UW1A 2PY6A 5DHFA 3WYDA 3WRYA 3HC7A 3MVEA 1A82A 3TAUA 3OA2A 3HDTA 2ZBVA 5B4UA 3W7BA 2VAVA 2FJ0A 3K0FB 5GJBA 5JZOA 2Q1XA 1RCTE 1W35A 3V34A 3R9KA 5A0FA 4MMXB 2C2HA 2EHDA 5DDIP 5B7PA 1JIXA 1U7OA 2WTEA 3MS7A 4HEA6 2IYEA 4HQOA 4P7GA 2Q7OE 4CFZA 2EERA 3EK2A 3LYAA 3RHSA 4EVQA 1DG9A 1US8B 4S3MA 3RYTC 2C03A 5GJVC 4N39A 1CY8A 2X5KO 3FPJA 1G5HA 1XTKA 2Y9PB 2ZRQA 3PJDA 4ID3A 4YP6A 5J59A 5KWIA 3CRNA 4XQEA 5DGIA 4Q9KA 1KKUA 2BHNA 4YAKA 1DTEA 1L5YA 4MROA 4KKVA 4AQDA 3UMGA 2AJTA 4P7KA 2RCNA 1YA6A 1SVMA 2WA2A 3DKPA 4RFSB 1AF4A 4A5OA 4GWLA 1E1LA 3KPYA 1P45A 3N6XA 1T1IA 1XCJA 5FFNA 3EEQA 3TW4A 4QECA 3RAPR 1UJNA 1TK2A 4ZICA 3A9TA 2YQ4A 1CYDA 4OEHA 1YL6A 1EA7A 5IX8A 4F7DA 3K6RA 2ZGVA 3SYTA 3AZPA 3LY8A 1YA4A 1G1MA 1GARA 3Q9LA 4TGLA 3MB8A 1CHNA 3LDAA 3UHOA 4EHLA 5ADVA 3WGJA 1KH1A 2GAAA 1VCIA 3ECAA 4PYRA 3GGDA 5I01A 3KSBC 2Q0HA 1J23A 2XZPA 4OJKA 5MN6A 1D2EA 4CR8A 3ORRA 1LUAA 3M0EA 5LP6F 3QNWA 3FB1A 4GMGA 3GQBA 4AJIA 4UC0A 3ZUPA 1L7QA 5ECDA 3QPCA 4IVPA 2AZ4A 5TS2A 3UMVA 5CFLA 3ERCA 3QVJA 2Z2XA 2YXDA 3KLMX 2I3GA 4V2UA 5MGNA 3AERB 2GBLC 5K45A 4PSCA 2GK6A 3N2YA 1HOXA 1PP4A 3A6KA 2OKGA 3ZNNA 4BTVA 4K9RA 5AVYA 2PWAA 2QTLA 1F2UA 2R97A 2QF7A 3F90A 4D4IA 3KTDA 3V33A 3STTA 3RVKA 3ANTA 3S29A 1SC4A 5CIYA 4WNIA 5E95A 2W6QA 1QYRA 2WKWA 4IH9A 4NOJA 5C52B 1C3JA 2JCSA 1Q74A 3ZKAA 2PUBA 1E2MA 3UGJA 3X1XA 2ZSIA 3IKMB 2FLVA 2O19A 1IB0A 4AQ7A 4NYIR 5BUCA 4KWEA 4U7HA 5BW6B 16PKA 2I2WA 4AG6A 2YC4C 3OA0A 2MINB 1PRYA 1IUPA 1CF9A 2JEYA 4O63O 4D8UA 4EIWA 6Q21A 5AW4A 3GH3A 3GJRA 2DHCA 3B7PA 4WJKB 3RD5A 4HLNA 4UE3S 5JW6A 1IG3A 1GOTA 1R00A 4AJ1A 4MX8A 2CDAA 3GA0A 3VMFA 4US2R 2DERA 3NB0A 2I54A 1T36B 3VH4A 1LTQA 4S1WA 1T1RA 4KV9A 1BJTA 4QSHA 4JYAB 4TKMA 5FWDA 2H1VA 3F5QA 2PFKA 1YTLA 1LRJA 2CD9A 3HMKA 4CUZA 4HB2A 3D8BA 4ZKDA 1WBBA 3GMIA 4MRNA 2Z30A 1WMEA 4NEQA 4OP1A 4YFYA 2FWBA 4YAEA 4B2IA 4AC9A 3GI1A 1KMHB 3RANA 3N0XA 3VSEA 1N9KA 3FVQA 4B48A 5FPTA 2XYRA 2ID4A 1WNFA 3TH5A 5AD1A 4IHQA 4XUEA 1UEJA 2CXPA 4G2NA 4WLNA 5KU1A 1Z6PA 3H4IA 5I7UA 3A3YA 1GSOA 3IVXA 1GTMA 2IP4A 5FR2A 2C2BA 2O2JA 3O3NB 1J8MF 2PLNA 3AEUB 4WBSA 3C8DA 1P0FA 1Z0IA 1M5RA 3TNDA 4D9FA 2FU5C 3FTPA 4H08A 1QZZA 2RIPA 4IYRA 3EPJA 3R40A 3S2UA 4DM4A 5E9JA 3ZDAA 4OK3A 3WYCA 2IX9A 3NUZA 2C2ZA 2NXWA 2RAUA 3CF0A 4CLEA 1CUXA 3WSVA