1JIKA

Crystal structure of s. aureus tyrrs in complex with sb-243545
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
319
Chain Sequence
TNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords tyrosyl-tRNA synthetase
publication title Crystal structure of Staphylococcus aureus tyrosyl-tRNA synthetase in complex with a class of potent and specific inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 105
structure length 319
sequence length 319
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2001-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
A PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1jikA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1jikA01
1MOPA 3ELBA 1Y42X 1B6TA 1NURA 1GTRA 4RPIA 1KQPA 3OP1A 4MW9A 4KR9A 1P7PA 1NUTA 4DDMA 3RJZA 1F4LA 1OWLA 1JGTA 3DPIA 4MLPA 1ILEA 4QRDA 1T6YA 2CYCA 4MUJA 1O95D 2JANA 3FDXA 3MLAA 2AZXA 1N2OA 4MW2A 3SYTA 3N8HA 3IMCA 4K0RA 4EFKA 1MRZA 4ZT3A 1ZUNA 1YI8A 3N9IA 1O97C 4MUIA 2NZ2A 3PNBA 1G8GA 3TS1A 3CLTD 4NX2A 3ILVA 1M83A 4KR7A 4MWBA 4HK4A 4S1OA 2PZAA 3ZUGA 4AQ7A 1PFWA 3DLAA 5TS2A 3UOWA 1YULA 1U0BB 4HJRA 2IP1A 1KQOA 4NAUA 1F7VA 2A1TS 1VBMA 3TQOA 3PXUA 3H97A 5JBNA 3GLVA 3HGMA 3DV2A 4EG3A 1WXIA 1ULHA 2H29A 2CT8A 2DERA 2DLCX 1QNFA 4EF6A 3KT3A 1M8JA 3N05A 2D54A 2QTMA 1IRXA 4ZCQA 4MVYA 5HUJA 4U7JA 2A1TR 1WJGA 1N1DA 2GOYA 2A84A 1OWPA 3A05A 3L92A 1T9GS 4K03A 3RFFA 3TZLA 3G5AA 4XFJA 4ARCA 4JZYA 3FETA 5BNZA 2ZP1A 3INNA 3TZEA 3IUEA 4R2LA 1WXEA 1IVSA 3AIIA 1IQUA 1J1UA 1I6MA 3H9BA 3CLTC 2ZUEA 1PG2A 1OBHA 4ZCPA 2GKSA 3CLSD 4MWDA 1T9GR 1QRUA 4MUFA 4Q16A 1N78A 4PBTA 4TS1A 4OUDB 4ZCRA 1QU2A 5DEOA 4G6ZA 3D6VA 3ND7A 3IODA 4U8HA 2DEUA 5IHXA 1K97A 3IOBA 3SEZA 3ZGZA 3RK0A 2CUZA 3ZXSA 2EJCA 2OQ2A 2QTRA 2R5WA 3HV0A 2QUHA 3FH0A 3COYA 1QRTA 1O6BA 1Q11A 4QBTA 3L93A 1I6LA 3X1JA 4MVCA 1GPMA 4MUHA 1OD6A 1GLNA 1LI7A 4DDHA 2ZUFA 1FFYA 3H99A 2JA2A 4X0EA 1PG0A 4F4HA 3FOCA 2EL7A 2AKEA 2YXNA 3FI0A 1NUPA 5LLTA 4MW5A 2A1UB 2A4MA 1U3CA 4ZT7A 3CLRC 4FZJA 4RUKA 1YUMA 2O5RA 1J20A 2PFSA 1Q15A 1F9AA 2E18A 3X1MA 1TYCA 5IJXA 3C8ZA 3QTTA 4NATA 1N2HA 3IOCA 2QUJA 3G59A 4DLPA 3A4IA 3CVVA 3D6UA 3FIUA 3IUBA 5J5AA 4DJAA 1M8PA 1O0BA 5EKDA 1O94D 4JXXA 2Z08A 1QQTA 1WQ4A 3OTWA 4HJXA 2J09A 2CYBA 3VRHA 1N2GA 4KPUB 4OUDA 4MAFA 5K0TA 3IMEA 1WXGA 2DXIA 2PZ8A 1IHOA 1GN8A 1F7UA 1KKUA 4XFDA 1MAUA 3K32A 3IVGA 2JAXA 1QU3A 1VBNA 1JHDA 1LI5A 1LW7A 4P2BA 5J58A 3VU8A 3NBAA 1FYDA 3ND6A 4NDAA 1QTQA 3CVUA 5K0SA 2V0GA 2B7LA 4MW4A 3SEQA 1MAWA 3CR8A 3RHSA 1TQ8A 3ZJTA 3UMVA 5TEWA 1O5TA 1R6TA 4PBRA 1IQRA 3NV7A 4F3RA 1KORA 4CDNA 3AKZA 3UY4A 1MJHA 1KAQA 1JZSA 4H3SA 2X1LA 4DE5A 1MC1A 2A1UA 2VTBB 1M1ZA 2E21A 4GRIA 4Q93A 4I6EA 1JZQA 1EXDA 1IQ0A 2J08A 4ZT2A 1GZUA 2BYTA 4OJMX 3H9CA 1O95C 3AG5A 2DPLA 3MUEA 1N77A 1K92A 3CLUD 1ZH6A 3HMQA 3HZRA 2HGZA 2QJTA 3GMIA 3KT0A 3Q10A 1MB9A 1IH8A 1N2EA 5KWVA 4R2MA 1ZJWA 1Q77A 3COZA 2IJGX 2VXOA 4MW0A 4J76A 1V47A 5FO1A 3MLBA 4CDMA 4MQ6A 2RD2A 1EFPB 3AFHA 4KPUA 2G36A 2A86A 2J5BA 1G8HA 1PFUA 3IMGA 3IOEA 1OWOA 1EUQA 1H1TA 3A04A 2E89A 3QTBA 3P0HA 5F23A 2CFOA 5TGTA 2YY5A 1MB2A 1NUUA 1J21A 3PNVA 2Z09A 1WKBA 5TEVA 4YP5A 4BWVA 1V8FA 4JYZA 3A2KA 4XSVA 1JIKA 4EG4A 1D2RA 2CSXA 4MUKA 3FWKA 3FHJA 3FY4A 2BTEA 1QJCA 5HG0A 3SZGA 4YBRA 4MWEA 1X6VA 2WB2A 4G5YA 1N75A 1HYBA 2XRYA 3PRHA 2CYAA 3ZIUA 2VTBA 4ZT4A 3RBAA 1KAMA 2AG6A 1J70A 3KT8A 1EJ2A 1N2IA 1UFVA 1NYLA 1TFUA 2DUMA 3HL4A 4J75A 5FNZA 1TEZA 1O96B 5H7XA 3I05A 2V0CA 3U1VA 4NAHA 1OWMA 3TQIA 1KR2A 1TYDE 1KH1A 2D13A 5HUHA 1COZA 3ZXIA 2Z3VA 4MVWA 1QRSA 3DO8A 3TNJA 2J07A 3CVXA 2O8VA 1K4KA 1WXHA 2I1LA 4EGAA 4KKVA 3LOQA 1G59A 4ZCTA 1YUNA 2PZBA 3JXEA 3CLSC 2A7XA 1XJQA 3KT6A 4ZCSA 1I6KA 2RE8A 2X1MA 3IVXA 4MW6A 2XRZA 3ZJVA 3ISJA 1BS2A 1J1ZA 3IH5A 1PFYA 1EFVB 1S4MA 1U3DA 1X8XA 5DK4A 3K9WA 1WZ2A 1DNPA 1VLHA 4ND6A 1G8FA 1JEDA 3PNYA 3ZJUA 4NZPA 3Q4GA 3BL5A 1JEEA 3G6KA 1TYAE 2HZ7A 1RQGA 1WXFA 1JMVA 2OV4A 1EUYA 4EG1A 4JFAA 1XNJA 3COWA 5LFAA 1WQ3A 2IELA 4KR6A 3X1KA 1T6XA 3S3TA 3CVWA 4YP6A 2E0IA 1PFVA 4U63A 5H16A 4ND7A 1WOYA 1U7DA 4MW1A 3HFJA 1GAXA 1CT9A 1EE1A 1N2JA 2CV2A 1NSYA 3LCJA 2CV0A 1H3FA 3N2YA 4PBSA 4A91A 3AL0C 3CVYA 4EG7A 1O96A 3UK2A 2PXHA 1Q19A 1M8FA 2DR2A 5KCMA 3IDFA 1R6XA 1KH3A 3Q12A 3SP1A 1JIIA 1OBCA 3H05A 3IVCA 4G5FA 4E1AA 4I6JA 2PIDA 1H3NA 2QJFA 5J59A 1U7XA 3FG9A 4ZT6A 4EG6A 2DETA 3M5WA 1JIJA 5KHAA 3LE8A 1O94C 4L2IB 4WSOA 1KQNA 4MULA 1YIAA 1NI5A 4MUEA 5AHWA 1KH2A 4UZEA 1XNGA 2QUIA 2QUKA 3COVA 1O0CA 1A8HA 1M8GA 1JECA 4CQNA 2X3FA 3VGJA 1MBZA 4EG5A 1EFVA 2QTNA 2C5SA 2J4DA 3CA8A 4YMIA 4YP7A 1K4MA 1KP3A 1NZJA 1XNHA 1JILA 1TYBE 2GM3A 5DASA 4PY2A 4MW7A 2WQ6A 3CLRD 1NUQA 4CT0A 4DNXA 1R6UA 4MUGA 1J09A 4MUNA 2YWCA 1N3LA 3SDBA 3ND5A 3F3MA 1SURA 5LM3A 4AS1A 3RK1A 1IFXA 3P52A 2QJOA 4I6GA 2HMAA 4ZT5A 1VBKA 5FO0A 4GU5A 1OWNA 3FNRA 1WY5A 4DDKA 4MWCA 4R0NA 1N2BA 1O97D 3MMXA 2PG3A 1GTSA 3KFLA 3CLUC 2WSIA 4QREA 1KP2A 4HPWA 4ARIA 3AG6A 2X0KA 1YIDA 1H3EA 1I2DA 2WQ7A 2TS1A 1NP7A 4L2IA 2A88A 2H2AA 3P0JA 4EG8A 1VL2A 2CV1A 1M8KA 1ZH0A 4MVXA 3SZ3A 5DB4A 3E27A 1T6ZA 2NSYA 3QE4A 2D5BA 3MXTA 4UZFA 3GUZA 3UC5A 4JXZA 1NUSA 3P0IA 2YWBA 3NBKA 4WNYA 1EFPA
chains in the Genus database with same CATH superfamily
1W93A 3W6OA 2WMDA 3T99A 1SUDA 3CF4G 3ELBA 4TM8A 3P9CA 1VG8A 4PRKA 4BNHA 1PQPA 2VP5A 4MV5A 1BNCA 1E2NA 1OFTA 1UK8A 2X6RA 1V26A 3KJNA 4GUDA 1KYTA 3C4VA 5E8JA 2BLLA 1P7PA 4AKGA 4P31A 2D0IA 3JTMA 4DNOA 4NAVA 1WF3A 4DMMA 2WFAA 3B85A 1KDOA 3H9UA 4L08A 3SFVA 2XHEA 3FTQA 3TB4A 5I8WA 1BX3A 2XMPA 1F0KA 5IABA 2A94A 2I34A 3WB0A 2NO5A 4IBOA 4JP1A 5AWFC 1BJRE 3PBKA 3SLGA 1FQOA 3AKCA 3LY7A 2HMYB 4IGAA 3KTFA 2CLFB 5AW4A 3ORYA 1FXWA 2ATEA 1PSZA 2JJ1D 1PI3A 2ES4A 2OE2A 2X9VA 5KQGA 4JC8A 1FLNA 1FP4B 3OZVA 1PRYA 4J7AA 3IE1A 4TS4A 3AEZA 2F62A 3M6XA 1VIYA 1X1DA 3LUDA 2CD7A 1JSRA 4FYIA 3TPZA 4NU0A 4JWKA 2C0PA 2CD9A 4OHBA 5C8ZA 3NVAA 3ILVA 3L0PA 5AP9A 2V6JA 5ALUA 2CC2A 1T1EA 3F9CA 3PSAA 5EE0A 1MC8A 2R84A 3TINA 3DGEC 3TNDA 1NJSA 2ZJ1A 4MOWA 1KI4A 1WUTA 3UTDA 5CFQA 3M6VA 4P7FA 4ZIRB 3DDNA 2A9PA 4Z4FA 3WJ1A 3KPJA 1CE8A 5HFAA 2AOTA 3BHIA 3U81A 5A9SA 2VN8A 5KYKA 2NU8B 2M1XA 3V5NA 1WOMA 2F9FA 3VV2A 2QN8A 1B42A 3DOFA 4NBTA 3EXG2 1A4UA 4R7GA 2PJRA 3M6WA 3W1WA 3AVVA 4FPXA 4EHHA 5BMVB 4FONA 2BR3A 4BVKA 2JJQA 2OCYC 3K31A 2QN7A 3FLBA 2C7PA 2DR0A 2GTHA 1WDMA 4NENA 2I54A 2OZPA 1VFNA 2IITA 2PV0A 4R68A 4WA7A 5WRFA 4RK5A 5EXDA 4Z3KA 2J41A 2NNLD 2P6UA 3F9IA 4LY6A 4DGQA 4Q05A 4A8JB 3O26A 4B32A 4W5QA 5I4IA 3LGAA 4MRSA 3EGWA 1ZM3A 1NUHA 2AFHB 1ZI9A 3FPAA 3DKPA 4NBWA 2WJ3A 4GZLA 1IEXA 3IFSA 1TEXA 1KDRA 4R2IA 5EIAA 5SY4A 3OZDA 1HFJA 2AEFA 1UJ4A 2UXCB 3M7IA 2V7UA 3A6LA 4QYTA 4OHFA 3RODA 4IYRA 2Q5JA 4Z0TA 3O75A 3B1FA 4CFZA 2O2JA 3IUEA 3H2YA 1P72A 4M49A 4M0EA 5BQ5A 1Q0LA 1E77A 1QHFA 1WHTB 4Q1CA 1XG5A 3JX9A 4C5AA 4E15A 2IS2A 1UBNA 3PSHA 4UPVA 5ECGC 4IIJF 3DZGA 4WJKB 5CBKA 1POXA 2H2FA 3CHYA 2OR3A 3QPBA 4KE8A 1P29A 1SUAA 1H66A 2WJAA 1AD2A 1KVSA 1OBHA 3FSRA 3AI2A 2QZZA 4B71A 1AY0A 4J0GA 2J87A 3EPPA 2KBFA 4IIYA 1QFMA 5K6AC 1SVLA 4JBWA 1I51A 1M1YE 4ZCRA 2Q2WA 3DFKA 5DEOA 4OF4A 3V32A 3QRWA 5IHXA 4YRNA 5HW0A 1JWAB 4B44A 4HRAA 4OK3A 3DT6A 3UJBA 3L4SO 4MHTA 3ZHBA 3D5QA 3HBNA 1PX2A 1E0DA 2QSUA 4GOXA 4M1EA 3DSRA 2QTRA 4MKIA 1YR8A 1OAOC 2C8VA 2D06A 2XMQA 4LDPA 4CL2A 5EERA 2B8EA 3DZKA 1ANKA 3BHMA 5G3ZA 4ZTZB 4JR1A 4XLTA 4IMRA 4PTZA 4MQEA 3UWPA 4ALMA 3ZWOA 1SHTX 3OJ0A 2PDAA 5EKSA 4MVCA 4AICA 2X5OA 3HO8A 3LUKA 4MS4B 4LXGA 4CDGA 2DUUA 3CW8X 4N5HX 3T38A 2Y67A 3OO0A 3V4VB 3F6EX 3WL8A 4NCNA 3QE2A 2GF0A 2CLMB 1UBLS 1L4GA 3LPLA 1VYHA 3E3MA 3O7WA 3TJRA 3JRWA 5K0EA 5KNCD 2C7RA 3A6EA 4AIIA 1REQB 3FMGA 1P33A 1D7AA 1XP5A 2B0JA 3QENA 2A4MA 2IU0A 3SHFA 4AMUA 4Q47A 5IYZA 4TLAA 1XMJA 3LI2A 4K81B 1E79D 3QUQA 1CETA 3DOHA 2Z5VA 1TCVA 2WYUA 1FDWA 1QYVA 2FMUA 1F9AA 1ONPA 2PHZA 5JPIA 3B48A 3G6WA 5AQ1A 3VSAA 4AG5A 1PNVA 2E87A 3EUWA 3P97A 1NNEA 4O3FA 1XWFA 5LMCA 2FE4A 3U19A 4A0FA 1QYIA 1LNSA 1LZKA 1X7WB 3ZWDA 4ZYYA 3PC3A 4GZ3A 3REOA 1KK2A 1MT3A 2EF0A 5HXAA 3BOSA 3A26A 1UPAA 1G20B 2G6TA 3K2BA 1DVRA 4IDDA 3PE4A 2H00A 1G2QA 4DBLE 1RM4A 2QLBA 2CK3D 3GFFA 3H2SA 4L02A 3EPJA 2ZS9A 3CJTA 3GLIB 3B6MA 1J0XO 1P17A 4N47A 5JY1A 4I50A 1JJ7A 4RJTA 4ACAA 3LQ2A 1WXGA 2DXIA 4D82A 1N57A 2FPSA 3JAKA 1I9CA 3BDIA 4N5DA 4EW6A 5KVAA 3QELA 4KO4S 3MTAA 5FWYA 1GDTA 2XSZD 1KKUA 1YDWA 4PO3X 2WT9A 4E6EA 5CH3A 1VBNA 1LI5A 1YQWA 1Z3IX 2YVLA 1SXIA 3OT1B 4FZ3A 3WHPA 4CETA 5EZYF 3AI7A 1R8JA 3RUDA 3TL3A 3TOSA 3PCXA 3CEMA 1R5NA 2NTNA 3WP1B 5JNVA 4PQGA 3B8HA 3M9XA 4TL6A 3ZE9A 5J4KA 5K0SA 1JIUA 4P38A 4RF2A 4UVIA 1UEIA 5HBGA 1P1RA 2D0DA 521PA 3VR4H 1XCPA 2QD3A 1BXGA 3KBOA 5DHPA 1P77A 3D3QA 4C0QC 2K5UA 5E7IA 3OY7A 5K4GA 2H0RA 1H2HA 2BLNA 4PYOA 2IV3A 1TCBA 1CULC 1YS1X 2VQDA 2C3OA 1JG3A 5LIRA 4X85A 1YF3A 1VFPA 2YYAA 3DBIA 5LA6F 3QLJA 1JIVA 2C4WA 3DULA 4H08A 3R23A 4EUFA 5KTNA 2AVNA 3VU1A 3PYMA 4Q93A 1FNMA 3HE3A 3DYBA 3N0WA 1GPDG 1XXHB 4PC2A 2I8AA 3WRVA 1GXSA 2C95A 2J08A 4FE3A 5BV7A 5KOHA 1P2TA 2G76A 1GZUA 5DM4A 1RQXA 3WY9A 3A4MA 2QMEA 2E2WA 3MUEA 4D9KA 1O03A 1DADA 3OEWA 2WMNB 3OMLA 3IURA 1QDEA 3K9CA 5L4NA 1VIDA 3GW8A 4XYGA 3PC4A 1A9SA 2PUEA 2IYSA 3JV7A 4X6LA 5KNBD 2QNIA 1JZTA 1ADFA 4D9MA 3IUNA 5JYBA 1K68A 4QYIA 4F04A 5EI5A 1KDYA 4DLNA 1EFPB 3DF9A 4MV1A 4NH4A 4RMHA 1HDGO 3WLPA 4QTZA 1HK7A 3EWSA 1G8HA 1IMJA 1JAXA 1YQEA 3ETEA 3HTXA 2FPOA 3L8EA 4R1QA 2DFTA 4TTQA 3TDMA 2X0JA 5JS1A 3LS2A 3ZY2A 3G23A 4YJ3B 4PZAA 5D1NA 1L1QA 1C4OA 1W1UA 1LC3A 2II6A 3E05A 5LQDA 1RQ2A 1Q1NA 2P4QA 2Q3CA 4E2WA 3AFGA 5GIPE 1G4UR 3A6ZA 3ZWWA 4CVNA 5JTTA 1YA6A 3A28A 1FRZA 3HWX1 4YHBA 4C4ZA 3TDKA 4DYHA 1K2VN 5JI3E 1V8FA 1C80A 2CFRA 2H1VA 3KQTA 4BP9A 1SZPA 1TEHA 2D1TA 2WYIA 1W1WA 2KSQA 1C3OB 1GD1O 3BULA 4FILA 4P35A 5HUQA 3N2ZB 3EEIA 4UM9B 3LLMA 3HCCA 1U8AA 2R66A 4Q3NA 3T6KA 5C1OA 3TMKA 2RGEA 3FHJA 2OVFA 4TL7A 4LHWA 1ZXBA 1GKUB 4NBVA 4KQXA 3RS7A 5I51A 2ZJ5A 4JDPA 3A9VA 1N8TA 4EUHA 3EDRA 4C03A 1P2FA 3DOIA 1FNBA 3QWFA 3JY6A 4EATA 1Y6QA 2JASA 4BUJA 2NXWA 5A71A 3TRHA 4HEA6 4EEXA 3OZXA 3WK8A 4MXDA 3M49A 4FBGA 1V71A 5BMVF 1SPBS 4O1IA 3DKRA 2IQ5A 4LNUB 1U7UA 2RGCA 3QFCA 4GP6A 1SWWA 3ZQJA 1G2OA 2EFJA 3GDHA 4R71A 4ZK6A 1GCIA 5FOQA 1VSVA 1N7JA 3C4QA 2J07A 4EL0A 1WHSB 1IIRA 1K4KA 4DDWA 3KYDB 3DO5A 3OX2A 4U39A 1VM6A 4ZVVA 3U26A 4BGUA 2C9CA 2PZBA 4KIGA 4OB8A 1Y6FA 3IVMA 1DHRA 4ZCSA 2BMDA 4R31A 3B60A 5DNVA 4MW6A 2X8JB 5EOVA 3NRJA 2PQ0A 2EG5A 1DAEA 1JKMA 2ZJ3A 3SIPA 4A3SA 4HMOA 2WVJA 3QBEA 3EVFA 1D4FA 2IC5A 1LC0A 1AUVA 1TKAA 3D8SA 3A6HA 1UK7A 2WM3A 1ZD4A 4JX8A 2JLUA 4HGPA 1HOXA 4UOEA 1TZMA 1OXKB 2Q5CA 3A4LA 1BDMA 2IPMA 1NPYA 4WKPA 1M2VA 1G5HA 1RAHA 2DHCA 4RD0A 2JLZA 4A4DA 3Q8KA 1B1CA 4RK1A 4WXPA 3H5LA 4C2BA 2FEAA 1LXCA 5EKTA 2Z5GA 3OQBA 4N0EA 1UDAA 4YI5A 1WBBA 3QE3A 4ZO9A 1E2KA 4ZO8A 2HIHA 5JYCA 2IDJA 4YP6A 2X22A 3B1ZA 4S0ZA 4JFRA 2ZIEA 3CSSA 1MXFA 1JI0A 2HJGA 3R5SA 3S27A 5CEJA 3KJQA 3DDSA 1AXEA 2FEWB 1QGOA 3H8SA 3W2GA 4GSYA 5IKEA 3TQHA 5AUQA 1MJFA 2XKBA 1E1NA 1VG9B 1KPGA 3R41A 3SHTA 4BPBA 1YQQA 1DC3A 3VKWA 3CVYA 1DG9A 5GZ1A 1E1RD 1JDUA 5AI5A 2Q6LA 4ZAXA 2QZ9A 1EFRA 2FRXA 4WOBA 4Y67A 2DR2A 5KCMA 1AN0A 3I92A 1KH3A 3E23A 2ODEA 3UHAA 4LGVA 5BNWA 3GFQA 4C4YA 1FUYB 3UWSA 4CKEA 1KI6A 1GZVA 1C8KA 1P7VA 2FW6A 1E1MA 3N2KA 3FFBA 4W5HA 2A92A 1VPLA 2DFDA 2CCJA 2YZGA 3A9TA 5EIOA 1CRQA 2C54A 3FDIA 1NW9B 4YJKA 3F1LA 1LUAA 3LO8A 1OX6A 4B35A 4D3ZA 4MVJH 4G1CA 1P9LA 2VQSA 3PFCA 5K8UA 3A1FA 3JQQA 4EVSA 5BVHA 2XKKA 3HVHA 3IAM6 4E94A 3U4MA 1JEJA 2QUIA 2QUKA 2H9YA 3GLSA 2YDXA 5HKLA 2JLYA 1OXTA 4ZQCB 2Y1LA 3HRKA 5B1IA 1E58A 1RZRA 4LWPA 3FN4A 3GJ7A 1BKSB 2AYXA 2OO3A 2Q3DA 3EXEA 2EKLA 4N3BA 2UKDA 4P58A 1IVNA 5AKJA 5KYUA 5TR9A 2ISQA 2F8TA 1DAOA 1XZLA 2C84A 6AT1A 2O23A 4DBLC 2C4KA 3LT5A 1NQ5A 1E92A 3MS2A 5FI5A 3K09A 5K1ZA 4KN8A 1TJNA 3KXLA 3ZOKA 2RHBA 4PY2A 2MSCB 4WNAA 2WZQA 2X4GA 3CLRD 3ZQ4A 4TYPA 3K9BA 4RJKA 5F33A 3D0RA 4HVLA 1EESA 3ZWXA 2Q9AA 4DS3A 4RYLA 2BKEA 3O9MA 2OBXA 2QDKA 1M6VB 5LQMA 2WPDD 5IBRA 2JEOA 2RBEA 4UXJA 3TFQA 3BMOB 3OPMA 3ZTYA 4U7DA 2VP9A 3AHIA 2YIJA 4B3IA 4COOA 3I5XA 1P3Y1 4Q9AA 4AUNA 3GEGA 4K9LA 4QDOA 3VYTB 5CH8A 4GU5A 5JH7F 3HDGA 1MH9A 2JL1A 1SVKA 2OBMA 2CWDA 3L49A 5B58C 1P31A 3H19A 4OK5A 4B4KA 2ZCVA 1YB4A 4JQZA 2JKYA 1Z2CA 4PLCA 1L1FA 3ABRB 4ZRMA 4XUGB 3EXIB 4FE7A 3GJZA 1O6GA 1KSHA 2V7WA 2MYUA 1WVMA 3CLUC 3ZWCA 2A6PA 2MMGA 1W76A 3E5NA 2HHLA 3R3WA 4BJ6A 2HFJA 3ETLA 1ZITA 2B98A 2X0KA 1GGFA 3KG2A 3STTA 2GZ3A 2R8YA 4ZOLB 3T1OA 2BC9A 1VG0B 4BQOA 4ZPXA 4DR3B 1Z15A 2ZR0A 2FE1A 4FBMA 1CY6A 4F8EA 4O2BB 3V1MA 1NM5C 1VL2A 1N6IA 2QD2A 3F6CA 4O8CA 4H7EA 3ZZ1A 3CNQS 2BMAA 3E27A 3I9OA 4CM8B 4R8RA 1GG2A 4DCVA 2OYCA 4BNIA 2PUBA 1TOAA 1ZQ9A 4H35A 4N6GA 3P0IA 3DXYA 3UCEA 3N86A 2YKGA 1BRMA 2VPXA 3V00A 3VAZA 2P6RA 2DP4E 2X2PA 2V97A 1IK6A 3O2JA 1EX6A 2DBQA 1IVYA 1C41A 1VB5A 2C5AA 3LC0A 2JKZA 4XVCA 2BHLA 4YMHA 1ZISA 5CYGA 1W96A 3CV3A 3I5AA 1UK9A 3WL4A 4CTNA 4HYQA 4J07A 1XQ1A 1NUTA 1U1CA 2EP5A 2B0CA 3H2ZA 1FU7A 3V7NA 5BSFA 3D02A 3KTAB 3WGJA 3UA4A 1W5FA 3OT4A 4PZEA 2D3WA 4XM1A 3U5ZB 3CRVA 1RAAA 1C9YA 1G0OA 1QTIA 1YTLA 1D6NA 1E32A 2FGJA 4G0QA 4MUJA 4V0NA 4BZQA 5EJEA 3VH4A 2R6AA 2VJQA 1NI3A 3E0QA 1TU4A 4EL5A 2R8ZA 4BFVA 5K6TA 4J2TA 1R74A 1R0ZA 1W87A 4G1MB 1WPQA 4HLUA 5F1KA 1ZUNA 3AY0A 3AHJA 1D9ZA 3OZEA 4HWSA 3TW0A 2XOXA 5TPWB 2HA7A 2GPTA 3QPCA 2R4TA 3ZHZA 5F76A 4EBFA 4V03A 2XZTA 2O3RA 5SV2A 3D6JA 2QTVA 2VSXA 4Y9SA 3CW2A 4OHZA 5B6IA 4MLDA 2ODPA 1NF9A 4HK4A 5AW2A 2CMDA 2Z6VA 2TYSB 1QQ7A 1SC1A 5IAAA 4G26A 4J0IA 4PVDA 2BR4A 4YAWA 4CV3A 2JBAA 4BV3A 5D3MA 3CQ9A 2RGGA 3O3CA 3TIVA 3L8MA 4FFPA 4FINA 5E8RA 4A1FA 2C9OA 5MN5A 4NICA 1SVNA 1SHZA 1VSQA 2KWIA 5TF0A 5CVTA 4AO7A 1Y5IA 2IXGA 2W0MA 5TQ0B 2ZSJA 1P6XA 1LBHA 2ETVA 4GFDA 3L84A 5ITSA 4DA0A 4KAJA 1U63A 4PAQA 4D4IA 1IATA 3DM5A 3AINA 1GPAA 1NBWB 1PKXA 3IALA 4P82A 4NYIR 4KW7A 4WLOA 2WHEA 3EFOA 3CNNA 3ILSA 4D79A 1IY1A 1Q20A 4ZZIA 1GR1A 2GNPA 1U11A 3GCZA 4ECEA 1T0BA 4M8IA 2NVUB 1NLUA 4Z4CA 3I2JA 1ZR2A 1QIMA 4KI0A 4ZCQA 3K0SA 1NC1A 2XDQB 2Q1YA 5DLDA 3MOSA 2BGKA 2WZDA 3KKNA 4TSFA 3KVRA 5B58T 3FKJA 3W8RA 4BIIA 1KWKA 1ADGA 3IL2A 4MP6A 4J9UE 1O6ZA 1V7QA 1LDNA 1KYYA 5AVOA 3V8BA 4EARA 3K5IA 2HAEA 2IIQA 3DP9A 1NVAA 2BAGA 5TT0A 1PSWA 1M0WA 2WTEA 3NM4A 3Q6MA 3USCS 3EOZA 4FMDF 4YAJA 3E03A 1YD7A 1V8ZA 1EFHA 5B30A 5H4GA 2WVAA 4G25A 1JSLA 2AZTA 2H65A 3U0BA 3EIEA 2G04A 1IOZA 3SD7A 3V9AA 1XRSB 2QROA 5J40A 1P81A 4LPKA 2CNLA 2DPMA 4GXQA 1B00A 4MRVA 3VI4B 4QQRA 2ZG6A 3A2MA 2W2OA 1G5PA 3ZDXB 3H2KA 2LPMA 2QRVB 2WD7A 4A82A 4O63O 4A2PA 1B73A 1L8OA 1E1YA 3L04A 2WINI 4KJXA 4XGIA 2B5WA 2KS6A 2NZJA 3LY8A 3MT8A 4YLEA 3D5EA 3LLCA 5ALHA 4E7OA 5K0BA 3JATA 2C2KA 4Q39A 3ND7A 5ENZA 4PHTA 1K7EB 2DEUA 2X23A 3EOAI 3JZFA 3TTTA 3DDZX 4E2YA 3K0KA 5TRTA 5JHGB 2LZ0A 4L3VA 4QUHA 1RHUA 1A8SA 2FTKE 1T2DA 3ZGZA 1AV6A 3BGWA 4LAFA 5AIBA 2QXUA 4RKFA 4AW9A 1OVMA 1H8HD 2YN4A 3H65A 3KR0A 3NFYA 4FLEA 5LU9A 4HSGA 1BX1A 2AGVA 1LU9A 4B7CA 4EFMA 4QHTA 4RLQA 4EPRA 1DJMA 1HXHA 3CWQA 1VPDA 4LC0A 2GN6A 3WIEA 3INRA 4UW9A 4ALKA 3UMJA 5C1BA 4O4IB 2H3EA 1SCJA 3QOFA 3I76A 1FSPA 4YK7A 1GPMA 4MNTA 1H42A 5JSZB 5AR1A 1WS6A 3PQ8A 2QTLA 4KC0A 3LBYA 3AY3A 3PR1A 2CXSA 1GNVA 4EI8A 4G0OA 3MWEB 3K6RA 1QHHB 2WF8A 4EB6A 3B3QA 1CJSA 3ETJA 4J8PA 4TYMA 3HM9A 2IE8A 1N4DA 3I9V1 1OU4A 3QWHA 5K3FB 1A9OA 3VJKA 5JRZA 5H16A 3DVSX 1ZNXA 2DSTA 2M6KA 1A1VA 121PA 4KXYA 1JFRA 2VDJA 5TB5A 5BV1A 5T67A 2CLIB 3FDZB 5EUMA 1WRBA 1AURA 2C77A 3R3HA 2P90A 2PNJA 4ZARA 2H54A 3C8ZA 2QV7A 2BZSA 4NATA 1VE1A 5EKUA 5A5DA 3FUUA 1YA4A 2BRUC 3S2ZA 2YJ6A 1SKUA 5AOCA 3D4LA 4D8VA 1OGYA 5BXQC 4PAOA 4FSDA 2Z08A 3I9V6 1WQ4A 3PZRA 3BFJA 3UAVA 5AT1A 4HJXA 4ENVA 1PL8A 4C2UA 4GOMD 3F4LA 5BW8A 2CLDX 2WHXA 4H9GA 3P9PA 4B3HA 4EK9A 1COWA 1RQPA 4MAFA 4DLWA 3D59A 4F84A 1M9NA 3DJYA 5CFPA 2VJNA 4LJ6A 5AJHA 1RHMA 4X93A 2IEZA 4BO5A 4JUCA 1Q1AA 1G7SA 4A7PA 5IH7A 1RABA 4PC3A 4KR3A 2L18A 2IHTA 1NUAA 1TF5A 2H57A 4OHUA 4XFDA 5C32A 5C5DA 4EELA 3EZ2A 3QUTA 3L4BC 2RB5A 2P2SA 4F3KA 3HKCA 5TJHA 4EJ6A 3CZCA 4KXXA 3DBOB 3V33A 2E4ZA 1WLYA 2J0VA 2Q3JA 4CG0A 4B6JA 2R6GA 5ALZA 1Z4JA 4JLUA 1CEXA 3AVQA 3CZ9A 3I52A 1HT2E 4L07A 1CUBA 1AK9A 1GTVA 5FJIA 1MAWA 1QMPA 1PTJA 3EUAA 4TWAA 1U98A 5ECDA 1SQ0A 1B2RA 2IEYA 3IRUA 3ZGXA 1XEFA 3ITDA 1YV9A 1MXHA 2YMPA 5CDUA 1YSCA 2WY2D 3U31A 2R6HA 3DBRB 3A3KA 3RVBA 1NOIA 1Y1QA 4DE5A 1BOOA 1PJLA 3U3XA 3QVGA 1AGNA 2IZ1A 2JS7A 3UJ6A 1LLDA 4GXTA 5CUQA 5HZGA 1M1ZA 3PEEA 2ZB2A 1JZQA 5JD5A 3U7IA 5AW0A 4N65A 3IAHA 2HXGA 4NJEB 2DJ5A 3GYBA 2CFSA 1O95C 2JBHA 2C0QA 5DGTA 2G07A 1DT3A 2Y8EA 3T9DA 2V03A 1KGDA 2H1LA 2NXCA 4Q7MB 3KT0A 4GLOA 2REOA 1BE8A 5LQKA 4ML3A 3I83A 3COZA 5EQTA 5LOVB 3IUQA 4BXOA 1U2GA 2Q4OA 5DYGA 1LDYA 1X42A 2WIJA 3QIVA 4D92A 1W2WB 3DFMA 3BILA 3E9RA 4S3MA 4DVJA 5HKBA 1RSZA 3W2TA 5KU1A 1SBZA 2J31A 4FDMA 3MERA 4GPEA 3FLAA 4DA6A 3DEYX 1P2GA 3WGLA 4JLDA 3U7FB 3ZD7A 1U6KA 1A04A 2BM9A 4JQYA 4G0NA 4E03A 4EYQA 1TLFA 2VT2A 3CZRA 3JZMA 3GLFA 4XOUA 3HO1A 1TO1E 3QTBA 2ATCA 3OTGA 5H3CA 4CKBA 2HKIA 4IMJB 1FC0A 1H6DA 2JJYA 4UEQA 2VUTA 2RHRA 1P1KA 2VP0A 1KAOA 5KJ6A 1D5CA 4ZTBA 1C9NA 3TNFA 3SVLA 4RFSB 1YU6A 2JD2A 4PE5B 3OTHA 5IJ0B 1KFKB 2RKBA 2YZMA 4ITVA 5EWMB 1HC7A 2HREA 4PSAA 4ZAWA 1ISPA 1Q3KA 2C5FA 4FOSA 1X15A 2FK7A 2XA1A 1K2WA 3KJHA 4CG3A 1VJRA 5F77A 4XH9B 3NANA 1O57A 5J9FA 1N75A 3WNCA 4P7KA 1KYIA 2HBZA 3A3YA 1PLLA 4RGYA 3A9SA 4D6XA 3PRHA 4FLMA 4QBIA 4LHSA 4DNQA 5KTYA 3PZBA 1JLMA 2PE5A 2TMKA 4MDHA 3KT8A 3I2HA 1Z39A 3O4IA 1NYLA 1P4GA 4X24A 1L4NA 1NJFA 5EHNA 2ZRGA 4EDFA 4H3KB 1H2XA 2V0CA 3W6PA 1P2DA 3FOWA 2GFQA 4L9RA 2R00C 1M1NA 1FB5A 2HV9A 2CHGA 3GPLA 1L5OA 3FCEA 4CQJA 1OH7A 2Q4RA 3ZV4A 3B6ZA 4XWTA 3IAAA 3WXBA 3N75A 4N0DA 3IKVA 4HGQA 3W8FA 1S1MA 2GM9A 2EBWA 2O8VA 4FCTA 4PX3A 3ROKA 4FNMA 5FL7D 5T4BA 3STVA 4E5NA 5K0CA 3LOQA 4COKA 1FTNA 5FHRA 1GPKA 3RS8A 5B7GA 3VSBA 3WFZA 3EGDB 1RZUA 3JD4A 3RBVA 2RE8A 1OVGA 1G3MA 5JSUA 3HZHA 2O8DA 4HTAA 2VBGA 3R4VA 4R8SA 5ALPA 1EWQA 2QL5A 2NSDA 2O14A 4JL6A 1P1FA 4F1JA 2BR5A 4KLRA 3GNTA 5BWOA 1QAMA 1A2BA 3OHPA 1QRRA 5PNTA 5IFLA 1ZVMA 2YFKA 4KHPB 3AVTA 1JEEA 1E96A 3A1SA 1OR8A 1JMVA 1JA9A 2FPUA 1RC1A 5DM1A 3D6MA 3WOHA 2O8FB 2RIPA 3R7BA 4JFAA 1XNJA 8ABPA 1NXWA 2AMJA 1NP3A 2FEKA 3PS9A 1ZMXA 3SQDA 3E5MA 3TLZA 3GARA 4INAA 5E9AA 1JQBA 2A3NA 3TQCA 3UYLA 2HY7A 4HXEB 2BFAA 1ZBQA 2FMKA 2Q6VA 1A82A 2E85A 2Z8ZA 3HKEB 4PWYA 4UBLA 1ISMA 5EJGA 2I1QA 2JFHA 1E1KA 2ZAMA 4V0RA 2JDIA 1NBIA 2ZQYA 1W5TA 2XHZA 1MPTA 3CPEA 4FEGA 4Q00A 4YMSA 4LJ8A 5SICE 1XPUA 3LT0A 4N6NA 3QY9A 1S2IA 1XBTA 2XRMA 1R8XA 4AQDA 1XJ5A 3BJZA 4HDKB 4YJFB 1DV2A 1VHTA 3AXTA 4N0PA 4BRZA 1CR1A 1KMHB 1WWKA 1J97A 1YZGA 2ZPUA 4CM4B 4FMBB 3FPGA 1UOPA 3DCYA 4QJ3A 3I4CA 2I2AA 3C3KA 1O7JA 3L1JA 1KEKA 3FZQA 3H9EO 2XUDA 2QJFA 4ZT6A 2OHOA 2CVOA 1N3BA 5CVUA 4FLFA 4ZCLA 5D86A 1W85B 1PK9A 2QPTA 4KH0A 3ZE1B 3ZLTA 2OHVA 2PEZA 1KQNA 3ZXUB 1E66A 1G21E 5SYAA 3VC3A 1B43A 1CBUA 1O08A 4X1YB 1P7YA 3PA6A 4P3XA 1P1JA 4Q0MA 5AICA 4CGYA 5KTMA 5F9HA 2CEKA 3VYUB 2P4HX 4JAVC 3PNPA 1ZK1A 2J9XB 2NT3A 2WPNA 3GH3A 4IO0A 1E7QA 4P08A 4TXJA 1IUKA 4WNIA 2V74B 3VGJA 3AR5A 4S12A 3ZD6A 3GPBA 2AOVA 2OL4A 5GY7A 2ZQ5A 1QPZA 2GEVA 3C5VA 3ZXYA 1WZEA 5FL3A 4BDSA 3F2IA 3RWBA 3W5UA 1GGEA 4JVMA 4O6VA 2QX8A 3UH1A 3I73A 1KP3A 1OHHD 3JPWA 3H2JA 4BZPA 3PE6A 5IASA 1TYBE 4H59A 5EIBC 1XQ6A 4GPD1 2Q0XA 2HSZA 3KKPA 4BMYA 4QYMA 4TTJA 3T9EA 4RWZA 2W6ZA 3JWGA 1MV8A 4Z7OB 3GJYA 4YWJA 2V7EA 4EB3A 3WI7A 1PN3A 2XZDA 1SUBA 4CT0A 5FLXA 5BRNA 1Y3AA 1OAKA 1SOUA 2I76A 2JGDA 3HUUA 3BK2A 3KUCA 2UZ3A 3IGFA 2XNDD 4BCDA 2H06A 1FP7A 4O4JA 3FKSD 5HMMA 3WK4A 1FJXA 3J81A 4YV2A 1ZHHA 2GBLC 4I6GA 1CIPA 5FNVA 2X0EA 3PVZA 4AN4A 1R8QA 4I66A 4TQGA 3WNVA 2H51A 2IHBA 4DDKA 4Z0HO 2O8CA 4LFBB 1J0AA 4YCBA 1XKTA 5TS3A 4AZWA 5BV0A 1DTEA 3O8BA 2C5EA 4ZREA 2JIDA 2BEJA 5KSYA 3LU1A 1RMTA 4XM2A 4I55F 5IHPA 3RTGA 4B73A 2ZB8A 2NG1A 5BN5B 2AJCA 1FLVA 4B9AA 2HHCA 1KQFA 5IWCA 2IHYA 1L5ZA 4ESVA 3MBKA 1FYFA 4IICA 3DNPA 4CKXA 4LWQA 3KSBC 3VNAA 4H1WA 1KIAA 2JBWA 1MO3A 2XQVA 1HM5A 2YC2C 3DZFA 4L2IA 3OC0A 3MTJA 3ET5A 4Q4JB 2A88A 3UO8B 3VNUA 1CFJA 3U7RA 1XOIA 2D59A 2EZ8A 3WZLA 5IC5A 3ZU3A 4HAXA 3FYSA 1CUFA 3N87A 4NEHB 2OKGA 4PRZA 7ADHA 5JXWA 3PGLA 5ITZB 1DHTA 4IDEA 2B8JA 4DLSA 4MJXA 1C29B 1Z2DA 4WEQA 3BMCA 3D0OA 3O8CA 4TMYA 2NZ8A 4XYLA 1MOPA 1SD1A 3IBCA 1JTVA 5HCUA 1ZU5A 2P9ZA 4NCHA 4P1ZA 5MHTA 4UMVA 4TLLB 2W6IA 4H1TA 2OCGA 3A14A 4MLZA 2VFAA 4HVCA 2XUGA 3GLTA 2ZIXB 3KQWA 3M1YA 4HEHA 4KR9A 4PM4A 2P7IA 1TT5A 2PKWA 3B1WA 4LSGA 4XR9A 4ZVTA 4ZI7B 3BIFA 2VNIA 1I3LA 2QIOA 1JFTA 3RIHA 4BQFA 3BK1A 3EYWA 2QSZA 4EI2A 3FMPB 2HMVA 1SKBA 4CEIB 3KWFA 2IU3A 4UHJA 1RRKA 5KC9A 1SFRA 3DMTA 1T6YA 3AP2A 1F0NA 1LB1B 3NBZC 5AFSA 3DM9B 4OHWA 4F4IA 3GA5A 1MX5A 1G7CA 4TRJA 4XLLA 3VHXA 3JWPA 1CHNA 4QGFA 1RM5A 1L4BA 1DIHA 1YQGA 2GN9A 2SICE 3BFPA 3IMCA 5HJEA 2PRSA 4C7VA 5BUSA 2E37A 4EYGA 2TECE 2YBDA 2ZJ0A 1U2SA 3PEWA 4DHWA 1VZ2A 2DAPA 2VWQA 3CF4A 1CJUC 4OLFA 4PLFA 4Z9BA 2Y0PA 3V6MA 4ZEMA 1X7YB 4XLZA 4TV8F 1MQ8B 4JC5A 2ZDGA 1PU2A 3PLNA 4H2DA 1F3OA 1T24A 4PXAA 3ICOA 3W79A 3ZI0A 4CQMD 5IDQA 1T8TA 1GGJA 2CHVA 3GEEA 1JKIA 3OIYA 2VJKA 1Z16A 2I2BA 3TIXB 4LDRA 2B30A 4JI7B 621PA 2H8GA 3B6JA 2NUPA 1G5RA 2B61A 1QIIA 2IHJA 4BECA 2XPCA 5ALSA 1C7ZA 2FPLA 1KI7A 2OXFA 2P3SA 1AZWA 3CRNA 3SYLA 5A6SA 2TMGA 1A69A 1UQUA 5I7EA 2VYND 1ZL0A 4M9QA 2HPHA 3FF1A 1R00A 1H5QA 2J30A 4PQYA 5DNEA 5JWRA 3MJEA 5ALGA 4BQEA 5KWEA 3ONNA 3RAJA 2W11A 2XA9A 3IXMA 3X43A 4AN0A 3U7JA 1P3JA 2HOQA 4Y8VA 2BKVA 5GGXA 2QTTA 4CUKA 4KR2A 3SQLA 2FG5A 1BD3A 2XCOA 4KOAA 3AETB 3TB6A 3HV2A 3ZHYA 1C81A 1IUNA 4BRWA 1MDFA 2W22A 1KE1A 1E1CA 2JCSA 2NSHA 2YZNA 4TS9A 2A1TR 5EXTA 3FYTA 1OU0A 2RGUA 5BN3B 5LQRA 4I7EA 4IM7A 1P0MA 2PKXA 1LRJA 2KPOA 3DA8A 2HSDA 2Z4SA 5BOSB 2O20A 4PN7A 1QB8A 2PT9A 4HH1A 1EQ2A 1XCGB 3NTUA 1NW7A 4JBLA 4NNPA 4XIJA 3RFFA 5LZ4A 2JFZA 2ZB7A 1DQPA 1YXMA 5C53B 1QR2A 2Q3LA 2PT5A 3CTMA 5BWNA 1E18A 2VQ6A 4GYWA 4N7MA 1I0LA 4JKIA 4YB8A 2IZ5A 2UYGA 4MA4A 4LZOA 2OQVA 1RI2A 4XJSA 5B1DA 1GILA 4XKJA 1DAIA 1JT2A 2V3WA 1I6MA 3GBVA 1S7CA 5CXXA 2HW8A 1RLJA 1A88A 3MPUA 1QGED 4FHCA 3MMZA 1DXQA 4HBZA 1MENA 2HO5A 1QJ4A 4EYEA 1GL3A 3EIQA 4OI2A 2XYVA 2V54A 4HYTA 4PBTA 1FLDA 1SUSA 2LRHA 2XR1A 1M0SA 3IBGA 3KVOA 1H6AA 3HB1A 3O83A 4L8LA 4JN6B 4Z1MD 3TW4A 4BGDA 1V6CA 4II7A 2XCSB 2ICAA 2ORED 2I29A 1SELA 1Z2NX 2ZYAA 3WO0A 4B6PA 1T5HX 5JQGA 3ZXSA 1XVLA 4DLKA 3DW1X 3MMPA 5D7BA 3PDIB 2J1LA 1U0TA 3OIDA 1XU4A 3VH3A 2RB4A 3OJLA 5ES3A 3T7SA 1AT1A 2B6HA 4MAMA 2JGLA 3KDSE 1V1RA 4P7BA 5JASA 3T7DA 4B76A 1Z36A 4UUBA 4DNPA 8ATCA 4BQSA 2OECA 2Z3ZA 4QDJA 2IU4A 4DAEA 5DTEA 2WVGA 1CQJB 4JL8A 4QSMA 5MGNA 1SCUA 5AMXA 1I4EB 4KOEC 1RI5A 3H0EA 1RP1A 3JASB 5K09A 1DQZA 4BY9E 1N2CB 1SC4A 4X0EA 3FCSB 5DULA 1T0JB 3H1TA 4CLHA 4Q3KA 1OTYA 4QC2A 3SQNA 5AW6A 3DBLA 4LFCB 4QWMA 5K8IA 4RHCA 1QYCA 3I12A 1NUPA 1YBVA 2ZSBA 3CKKA 3OWOA 4RKEA 5AHOA 5J4VA 3THYA 4B75A 1RWBA 1EG2A 1OPRA 3EG9B 1A4RA 1PGOA 3SSAA 4E5VA 6ABPA 4E4TA 1H1LB 5C0OE 2DUJA 5ARDA 2Y0DA 1YRBA 3OEEA 4O8ZA 1XKXA 4D46A 3LNTA 3MQ2A 1Z0JA 1A4IA 1KP9A 1VCMA 3LQYA 2C5BA 3O8OA 1L6IA 1DAGA 2FWMX 3Q9LA 4W99A 1U7HA 1XLUA 2B82A 4PEVA 3T9CA 3PXAA 3WRXC 2R8PA 4NEQA 4YRKA 1LLFA 1WEKA 3BXGA 2YOGA 1M8PA 4WECA 1NXVA 3R7WB 3CO0S 2QR2A 5ERGB 2XT0A 2YR0A 2ZE7A 3DMFA 4HWRA 4LHVA 4X54A 4ZQFA 1XCBA 2ERCA 1ELOA 2BKAA 2OCAA 1L7VC 3E3NA 1YOVB 4FTWA 5BN4B 1Q0TA 3L6CA 4A0HA 1YVEI 3H16A 3EGVA 4MK4A 4IJVA 4QT0A 1K6EA 5LUAA 3DTTA 3TLEA 5D00A 1R6DA 3N6VA 3WGOA 4JJZA 2JIMA 3LK6A 4QGSA 2AD1A 1CCWA 2C2XA 3PUVA 3HEAA 5IMBA 3PJEA 1TJ4A 5B2EA 5ER6A 3BD6A 3DEZA 1NY5A 3B9BA 3K32A 3VZQA 4EGFA 4ZYZA 2IBTA 4CKWB 4XPZA 3WYBA 2Z2YA 4KG7A 2WT4A 2XEDA 3SF8A 3WLAA 3AJEA 4MA0A 4WLVA 2ZJBA 4DJFC 2J7PA 1GL9B 2WG1A 1UJ6A 1RLUA 1QLWA 2F1OA 3R3JA 5SY6A 3QVLA 2H11A 4PC7A 3HVRA 1F1JA 2ZIGA 1TIBA 5F21A 2AI2A 3UMVA 1ZJYA 4LVUA 3DAOA 5JQWA 1QSGA 2UVQA 1WMSA 2YVQA 3EEYA 1KORA 3C8UA 3DCJA 5CLLA 2YXEA 3LVQE 4A8TA 3DEKA 3BMQA 3JU3A 3PNOA 4L6IA 2ZWPA 1CUYA 3B1YA 1XZBA 4TT3A 4TRRA 2UZ4A 4HN2A 2JLRA 1E9VA 2WP0A 4HUTA 4FKZA 2ZRMA 3THWA 1ORIA 3RIGA 4X91A 2ZTSA 4C0AC 4IGKA 2P11A 1BIFA 4RZQA 1FX0A 1U90A 3ER8A 2HMTA 4LZLA 2P5YA 4WEOA 5TXGA 5J2TB 2WFZA 1D07A 2O0JA 1KOJA 2VSOA 3VOAA 1CJCA 5DLPA 1IIBA 3R8XA 2JFNA 3KAKA 3QE0A 3Q10A 3QEMB 1VMDA 4YDRA 2IUSA 2X4DA 3AFIA 2WIDA 3EWNA 2QT9A 3P2KA 3P1JA 4RHUA 1ZGBA 2LXNA 3LQKA 3DEFA 2WM9B 4J76A 3WXMA 4DYVA 3G0IA 4QPDA 4Z5XA 3NLLA 1RHJA 2CFCA 4N7RA 4FB4A 3HXMA 5BURA 2I6QA 4C88A 1XX6A 1ECFA 1AO3A 2H92A 3WMEA 4G2TA 4JUBA 4BMSA 4EPVA 2G36A 1VQ1A 2WKQA 1XFDA 2A86A 2AG5A 2K87A 2WTAA 4HSEA 5FWXA 3RHZA 4GI7A 1OWOA 1BS9A 3GFGA 4I5FA 1ISHA 1CX9B 3K9FC 1USGA 5IJWA 5TX7A 3HXTA 2IWRA 4BLQA 4LECA 2CL6X 2GFIA 1DWPA 5TGTA 5U4QA 1KJ9A 4YJGB 5T4FA 1RADA 1YKFA 5EJ5A 1GG8A 3VVMA 3IDOA 2FSPA 2G28A 4HADA 4ARZA 2FFAA 3CISA 5BQOA 5SZJA 1EK6A 4C14A 4EGCB 3TW8B 1V8OA 1IONA 2YWGA 3JRXA 5L45A 1F9EA 3X1WA 4EG4A 3OKFA 3R4CA 4FBLA 4TWRA 5FLYA 2JJ8A 3B78A 3NH9A 1ZIPA 3PPXA 4M99A 4MUKA 4QFCA 1NI4B 1YMQA 5JPCA 4RHEA 1DS6A 5JZOA 4ROTA 1K9SA 1HDCA 3TFOA 1AX9A 1T4CB 3EBOA 5KOYA 4FZVA 1MB4A 3EISA 3JSXA 5BV2P 5KNDA 4PG6A 2JGEA 3BJEA 1GGMA 4MYRA 2OB1A 4RA6B 1Y63A 1V8BA 1YJCA 4IOMA 4PGMA 2AN4A 1TAQA 2ALJA 1KO1A 1SUPA 2VJMB 2FGKA 4KHZA 2RH9B 4MS3A 2KI5A 3M89A 3SDSA 1F17A 4ENQA 5H7XA 1BGVA 4DM4A 1U5BB 3RTAA 1Z7GA 2IYRA 3ICQB 4ER6A 2VUHB 4DCOA 1QZXA 2VP3A 4Y7CA 1UDCA 3FUTA 2VAVA 1KHTA 4MVWA 2HZBA 5IYZF 2EGHA 4UEWA 1YVRA 4N82A 4J3FA 4DXDA 4Q37A 1SUCA 3G88A 2GAOA 1JPVA 2I6UA 4UAGA 5GVSA 2O7RA 2EIXA 1QG2A 3RSSA 4X41A 4MV8A 2P9JA 4GMHA 2WYOA 4LBZA 4QPNA 4TTAA 3RSOA 1I6KA 2OBLA 1U8TA 1PZMA 5CIYA 2H48A 3ADBA 5J5CA 4M38A 1B6SA 1NNSA 4I3GA 4RPJA 4U5XA 2MYNA 4OXNA 3WLIA 1DWOA 1S4MA 2G1KA 4NYMR 2X7XA 3J7AC 2C4TA 1GYRA 1TZCA 5E2IA 2G9NA 3ISVA 2WNSA 3AP1A 1KMMA 4I50F 4OKNA 4LTMA 4H15A 5JAUA 2O07A 4NMXB 5IWAB 4R16A 1ORTA 3OQOA 1Z7EA 1YRYE 1YVUA 1P2UA 3DL4A 4EMSA 5D5PA 3E15A 4IXWA 4FFBA 4N1AA 3AEUA 5JDCA 5LFAA 2IUUA 5I9BA 1FJ2A 5B64A 4ASUD 5CR9A 1QKKA 1M2OB 2G1JA 4V0OA 1DFGA 3I8XA 1DPFA 1ZWKA 1QRAA 2UV8A 3HDQA 4U63A 2OA0A 4GXRA 4PLYA 1U7DA 2ZZNA 4C4SA 3GCWA 4MB6A 3QKSB 4I3HA 3TCKA 1U94A 1PD0A 2OV3A 2Q99A 2XIJA 3C1UA 1L7AA 3C43A 4X3PA 3T3HA 1T2EA 3OCVA 1F2UB 1BJKA 6REQA 3NCHA 2JD0A 1RBZA 1Z17A 4PBSA 1XMVA 5EG5A 3P8ZA 3IQDB 2IUYA 4PX5A 4IXDA 4EG7A 3RUPA 1PBNA 4Z4GA 4HAZA 4UTVA 1Q19A 5IKPA 5FR1A 2ECQA 2GCOB 2EKBA 1M8FA 4URZR 1B0PA 1U7TA 4KQ6A 1RBQA 3IPXA 1TKCA 2CMGA 1PR2A 4CIVA 2C4MA 1ZP6A 2EJUA 4DA9A 1T0UA 4R5MA 4TKUA 4EG6A 1G38A 1HMPA 3AFNA 4GM1A 4W7SA 3L18A 5DWDA 5AJTA 4YAFA 4ETMA 5AVYA 3TZQA 10MHA 5FR2A 4ZVRA 3Q8XB 1WV1A 3B5IA 5GAJA 4QDTA 4IFIA 4GDFA 1ZC4A 3KHSA 4D0NA 4FUTA 3QXCA 2DZDA 3JQCA 2FV8A 4E5UA 1SC3A 1I13A 2NSLA 1EJBA 5DHQA 5IUJC 1A72A 1DBVO 2HFKA 2X3FA 4FFRA 2BFNA 4IHJA 2PV7A 3DR5A 4CQNA 3D8TA 2Y27A 3KKLA 3HLTA 4B40A 1T0HB 3JVIA 4FGZA 3UA3A 721PA 5GVRA 5AI0A 3F67A 4Z2YA 3I3OA 2GN1A 3NHFA 4GYKA 3VPBA 4BQPA 1NF3A 2A0YA 2VPIA 4M1KA 3H11A 4LMAA 1LSOA 1XTBA 5BT9A 3IULA 5EMMA 1ZH2A 5MFPA 1TYEB 1FRVA 1XEXA 1R0CA 4ZQEA 4F72A 2FMIA 5B7QA 2G5GX 5DX8A 1U8EA 3FYUB 1RQNA 3M83A 1HX7A 4G0MA 1Y82A 2PJDA 1RJEA 2HF9A 4NYIQ 2YWCA 5A4FS 4JI8B 5DO9A 3DC7A 2A5JA 3AIMA 3GRFA 1Q44A 1Y7IA 1J06A 3IP5A 3N0VA 3NOQA 3P52A 5CP8A 2QJOA 1E9CA 2UUPA 4N5MA 4ICIA 4N3AA 5EYPA 1CUXA 1PKEA 1T5TA 2Q1UA 3R9IA 4BKRA 8ADHA 3DDCA 3TF5A 1UT5A 1S5PA 3H42B 2C5GA 1RXUA 3QFFA 5HQJA 2Z4RA 3GOHA 5ESXA 4TMXA 2HN9A 2J3QA 2OY0A 4PR3A 4DUGD 1HLFA 2XEXA 3RUFA 1QK4A 4ADSG 5LP6C 2PG3A 4M1OA 2I4TA 4WVLA 5BQ3A 1TEVA 4NV1A 3ZKWB 2DPGA 3KQNA 3KZOA 1XDDA 4GP9A 4M83A 4W7IA 2D2VA 5A3SA 5IZCC 2EKQA 3EDQA 5L7WA 3G2QA 4UAUA 2X5KO 1YIDA 1H3EA 1G5TA 1I2DA 2JFXA 4Q7KA 2TS1A 3SX4A 3L8FA 1V3VA 3DD1A 4LC9A 3WYAA 1JWLA 2JLBA 4H17A 4ER5A 3CMMA 1Q1ZA 4ZVKA 3S7TA 3NQ41 1I7LA 1YNSA 3FDJA 3E9NA 4AP6A 1V39A 5IG2A 3EC7A 2F3SA 5JE8A 1MRNA 1QOPB 2DQKA 5FADA 3Q2OA 4Q48A 5KTRA 2HCRA 1JA0A 3TOVA 4JXZA 3U16A 2BFOA 3EPHA 3H9QA 4HT3B 2UYQA 2X1HA 1VMAA 2ZZKA 3S2EA 3T7KA 1KTVA 3V1KA 3W3AH 1CR4A 4U2DA 4YONB 3V7YA 4RCZA 3T5MA 2VDWA 3NPAA 5M7EA 1IHXA 3OP1A 4V0SA 3V2GA 1OFGA 2QRUA 4BEBA 1E2UA 5AJVB 4L0MA 1ZGCA 1PS0A 4UUQA 3NRBA 2XQIA 3GH1A 3LYAA 2YHAA 4DDMA 5AKXA 2J5RA 3F98A 3IBYA 4MJLA 3TBHA 1LQ2A 4AY6A 4YT2A 1J99A 1EUDB 2R6ZA 5BPHA 1GEGA 3FGOA 1P39A 1RAFA 4IRUB 2ZM5A 1XZ8A 4PCVA 4PYLA 4QDUA 1V4VA 2PH7A 3FDXA 5HTOA 1CZHA 2VHZA 3D7MA 3I2GA 1L4MA 2H59A 3K6SA 1P80A 1RXSA 4C5CA 5HIAA 4K9NA 3GB9A 3K30A 4OYRA 2G9RA 1KMCA 4RPKA 3M34A 2AR9A 2BELA 3K0AB 4C22A 1EXVA 1KSFX 1TD1A 1QZZA 4MQFB 2HJWA 2P3OA 1GPLA 4KE6A 3IP1A 1ZONA 2IFTA 3I01M 2NACA 1MDBA 2GYWA 2CB9A 1UBHS 4HR7A 3PITA 4QKQA 3KDAA 3L02A 3WQQA 4EPWA 5LXTB 1GNTA 2AJ8A 2PZAA 3T3PB 1YRQA 4KQ9A 5FFNA 1XZEA 2M6SA 3M5DA 3ESCA 3KZMA 1YULA 3PGKA 1MQSA 2X0DA 1IPFA 3VNVA 4F38A 1OQAA 2IP1A 1W48A 3EBLA 3AV3A 4ZYTA 4PZ9A 1PR9A 2Q5LA 2RGYA 5FAKA 3QPWA 1TU0A 3PHJA 4D4MA 4C6TB 4XWAA 1JMYA 4EGSA 1BWPA 4RMNA 3IB3A 3KUKA 3PXUA 3BXHA 4RXUA 1I4TD 2G6BA 3WS7A 2EZ4A 3D81A 4FU0A 1TVKA 2F1KA 2SHKA 4UASA 2VQFB 5LLDA 1I94B 3PRKE 4KSCA 1H1DA 3V1LA 4UTRA 1R18A 1QWOA 3D8UA 4XB2A 3PC8A 5E6RA 5FIUA 3RC3A 3LUPA 3T4XA 2I0FA 3DR3A 3KKMA 2CJYA 4F4DA 2NMVA 4OQDA 2QMOA 4US2R 2HU2A 4PG7A 3JS5A 4URWR 4BC0A 2XZLA 4QEDA 4X7RA 4ZC1A 1X1EA 4F46A 3QM1A 5JO0A 1F1BA 1K86A 3PKJA 2GTIA 3NDPA 4HDOB 4M0FA 2ZPAA 2QL9A 4CQMB 2QTBA 4YCMA 3GOQA 1AB6A 4BE9A 4QG3A 4PS1A 4Q4HB 4RH1A 1VYUA 3QW2A 4JI1B 2VHWA 4RM3A 1G3RA 1PR0A 1QE5A 3BWMA 3LHKA 5A06A 1P75A 4GO1A 2HIGA 2J5QA 1UANA 1ZG3A 1O0SA 4KQEA 1T3GA 4RVFA 3TVYA 2AOUB 4N3NA 5LKRA 1U2TA 4MH0R 3MWKA 1QOZA 1QYRA 4BQIA 2ZTLA 4EY4A 5L3QB 1GSHA 2G17A 1IJKA 1TB4A 3H9GA 2PY6A 3OFND 3CX3A 1BROA 3Q5EA 4OLJA 1FP4A 2CXHA 2WUFA 3DLTA 1Z5PA 4BGVA 1TK3A 3V4OA 1MAVA 1I3KA 1L5SA 2EBHX 3DTVD 3FSGA 4DLXA 1SK9A 3DAGA 3A36A 3PVCA 1RE0A 3EDCA 1CQXA 1QP0A 3BF8A 1HKUA 3DC2A 4C21A 2OFXA 3IODA 3RS4A 1FEZA 3HVJA 3K1AB 3MZ0A 4NJOA 2VAMA 4K8OA 5LYJA 4HLNA 3VHLB 1T34A 3A2NA 3PQ6A 1U8UA 4QUBA 4ZIRA 5TIIA 4L5BA 1ST3A 4AROA 1A5AB 2V59A 4BKUA 1XJCA 2BZ0A 2GILA 4I5EA 2GNAA 3VBCA 4CKYA 2R62A 2NU8A 3NIWA 1RRGA 5C9ZA 3F78A 9LDBA 2XMGA 3EEQA 4XAQA 4FGKA 4ZHQB 4CF5A 4L8GA 5EJ7A 1FUEA 1SD2A 4L9WA 2FB9A 3UCFA 5HRCA 2HWXA 2FK8A 1ITZA 4QUDA 5FI0B 5H68A 1A7KA 3IXLA 4KYVA 1YCHA 3OKAA 4RTLA 2FSGA 2B6NA 4XWOA 3OOSA 3ZDDA 5HE9A 3UBMA 3PFKA 4YTEA 5ALTA 2W5UA 4A8JA 2ZCJA 4O59O 1SULA 2NZXA 3HR4A 4HVAA 2UUAB 1VRWA 4XARA 1UWCA 1GQ2A 4GGMX 1WZIA 3R0XA 1GZ5A 4UVEA 3NIFB 4QECA 4BC1A 4EY8A 2ISCA 2AC2A 2QYHA 1EK2A 3REFA 5AIAA 3NFRA 3GDFA 5EIEA 5KYNA 1L7XA 1J20A 1ZRMA 1X1TA 3GIWA 2G0NA 1GAEO 2J6BA 3NGXA 3W05A 4BKMA 2QX6A 1I14A 4NU5A 1NBME 1QLHA 1QWSA 4RV9A 5F3DA 5G40A 1QGYA 4GLBA 1E9RA 1YQUA 1C1YA 2VEOA 3BB1A 4HC4A 3TX2A 1FA9A 3ZK8A 1GG5A 1XRPA 1P4JA 4M0UA 1DMSA 4RU1A 3F8SA 5E95A 2BFEB 1C0EA 2QXTA 1Q0ZA 3QHQA 4K88A 4BNVA 2ZR7A 2XUAA 1IE3A 3QOYA 4MR8B 1X1SA 3V4SA 4CODB 1N2GA 4L72A 1ES9A 1G8KA 1YZHA 3RBXA 4E07A 3G2KA 4YAGA 5EZ5A 1ZZGA 4DA7A 4DADA 2IXEA 1II9A 4R1UA 3WLMA 3LIIA 4GI2A 3DFUA 4B17A 4XVQA 1DUSA 3C74A 3HCWA 1KC3A 2D5AA 3C5WP 2RI1A 4DM7A 4KPFC 4KFTA 4RIFA 3SOZA 1SXGA 1XGKA 4U0KA 2AHRA 4JI3B 1W52X 3NJ8A 3TGLA 3TUJC 16PKA 1ZLYA 1NV8A 3PYLA 5MN6A 1JMKC 4JU8A 3E9QA 2ZJ2A 2OHFA 2ROQA 2XYHA 4KMRA 2HJRA 4QWWA 2ZYVX 2WWXA 3S8EA 1ZU4A 3E8MA 3H9JA 4POOA 1TO6A 3LZDA 4AJEA 1QZUA 4M46A 4MS4A 2F8MA 4A0SA 3AF1A 1AKQA 4B6SA 1A96A 1XMXA 2HLPA 4J7UA 4E11A 3B1XA 3RE1A 3PX3A 1T2VA 1RVDA 1VJ1A 3WL5A 1SCDA 3RIMA 1KAQA 2PUTA 3GJ6A 3OE5A 1NFFA 2B7CA 4FJ0A 4FZRA 2HBYA 4H3SA 2DUNA 3K5PA 1REQA 2YXDA 4OQLA 3SLKA 2OM6A 3CG4A 5G1NA 4MP8A 4V3BA 2I7DA 4YASA 3NTRA 1BVYF 2OOSA 2DHDA 4R8VA 4JBNA 1U1IA 3DOUA 3ZWAA 3N74A 2GD0A 2ZTVA 3MTBA 3PIRA 2J0UB 5K0NA 3ABIA 3F5FA 1R0RE 5L3ZA 1Y6ZA 4YDHB 3IC5A 5LC1A 3VPAA 2HA3A 4Z51A 2Z3WA 2ZT7A 2BH9A 1JQ5A 1WCIB 3W8NA 3IJ5A 1KI3A 1X7WA 3EA5A 1N7HA 4UHDA 4JJ8A 3VDQA 4PZLA 4DIBA 2HBQA 1ZJWA 1W47A 2QLTA 2BJWA 1OKKA 1ACMA 1G20A 1HKHA 2C2MA 5AJZA 5L3RA 5B3KA 3P9SA 3UT5B 1MOQA 2K7ZA 2RJNA 4CDMA 1BEUB 4YYZA 2PAAA 4IJ5A 4YFYA 1DKLA 2BEKA 4A03A 4DQUA 1GKLA 1GSAA 3ESAA 1WV0A 5A4MS 4HB4A 5J3JA 4KNWA 3GLIA 1T0IA 3LW8A 3NORA 4W8HA 3IOEA 2ET6A 4A36A 3KOZA 3AX6A 3VR5H 4UNSA 3A04A 5JYDA 1H65A 1FDTA 3W6ZA 5EY5B 2X7JA 2X0IA 1L8LA 1WPRA 2EWMA 4YMVA 2FW9A 3FLMA 3OT1A 3JQRA 2R2GA 3EPLA 1IOVA 2OCKA 4GQBA 4LOKA 4DEVA 3D3WB 4Z8XA 4BWVA 5BSEA 4Y0AA 1YS6A 3DEJA 3CN9A 3SBXA 3WWDA 2CNWD 3UG7A 4V1CA 1DC5A 1VHQA 1YBFA 2EFGA 3GXBA 4OI0A 3CTPA 2GPJA 1R4NB 3VR2D 4A8PA 4E5MA 1ETHA 1HDRA 1E8DA 3FWKA 3K0HA 1SCKA 1FFDA 1JHQA 5ELMA 1WX1A 1XALA 3QVKA 2F48A 1FNCA 3JQAD 3N5CA 4AMZA 4F5YA 5LU8A 1U0HC 3SBOA 3RYTC 2XRYA 4HPXB 5IXSA 1EDBA 1SPXA 2ZU6A 1GNPA 4WLFA 2C4NA 3G8YA 5DI9A 1QTRA 4ZV9A 3AY7A 5K9ZA 1QANA 1UOOA 4B3CA 1CVRA 4W5WA 1G20E 4RPGA 1TFUA 1XXHA 3VGPA 3VOSA 2FPWA 4BEJA 1OT3A 1VI5A 1UODA 3PE3A 3SQXA 2HQ1A 1SOAA 3KQPA 2GNOA 4R8LA 3GLIE 5TGDA 4ABTA 2PUWA 3B7GA 2BI7A 3PHIA 4ZI2A 1J5EB 5AI9A 3NYIA 2I67A 1KR2A 4NPCA 4JZKA 1COZA 3NATA 3WLHA 1E99A 3P9IA 4K1XA 5HA5A 1DAPA 2FSUA 3DHVA 3RIYA 3FBTA 1LD3A 7REQB 6YASA 2ID7A 4EKNB 1M1YB 1YMUA 2E5FA 2HF7A 2P9QA 1LSUA 1MVLA 2XJ9A 1PYDA 4ZMBA 2GCEA 3EGXB 2VZ9A 1QHEA 1ZMRA 4UU0A 5CX4A 5C5IA 4N12A 5EWLB 1Q7CA 3PYXA 4HN4B 4I4CA 3HFRA 1MTOA 3ZWPA 3RARA 3C8HA 2IZOA 4V39A 3SNHA 3L8HA 1WB9A 4JJKA 4OJQA 4OBWA 1DDIA 1H05A 1KJ8A 2DQ4A 2YHSA 4TTVA 5HCIA 3MWFA 3UUWA 1YDHA 4YJ3A 4QOEA 3NHJA 1YZNA 1Z08A 1TJ5A 1Y1RA 1X8XA 4KK3A 2PLWA 1DNPA 2VNKA 4ND6A 4UBKA 2RONA 1DO0A 3ZHVA 3FGPA 1RE1A 5CD9A 5CLIA 4M0KA 1JJIA 1TIPA 5BSWA 4CKCB 1Q0QA 5CT9A 3ED5A 5KAPA 2C3YA 1C3OA 1MKYA 4LSWA 4BX9A 2VYFA 1FP6A 3C3EA 4JNCA 5EIBD 3QEOA 4DBZA 1XXHE 1DT5A 2A9VA 2PX5A 4GR4A 3OE4A 5HYVA 2BMEA 3H5IA 5JAIA 4YIKA 3X1KA 4CYMA 5JG7A 1E1LA 2QVYX 2NO0A 3CE6A 3E8SA 4UNRA 1SCNE 1PR6A 5B4TA 1PFVA 2AR7A 5BSHA 5CG1A 1E2GA 2QS9A 1QRDA 3NTLA 4TM7A 3DL2A 4LCJA 4HX2A 5I4BA 4MW1A 4UU1A 3OIWA 3WBFA 3EEOA 4F6RB 2Y1CA 4QARA 1C5KA 4HQ6A 4L51A 1BQ4A 1NYQA 5CVCA 4I1OA 4I14A 3H5AA 1RFLA 2P2YA 2HLDD 2W98A 4JLOA 4GKKB 5A9TA 3H04A 1RRMA 1E60A 3GLKA 3OI7A 1J23A 4KYIB 4PGFA 3T61A 3TTUA 3EN0A 3IBTA 4LFAB 5E3IA 5KVCA 4ENUA 3SP1A 4Y9RA 1Y1TA 4OXRA 2Y9PB 1GZ7A 4YLYA 4MA5A 1KEPA 2NVBA 4OHKA 5A1TA 4G8BA 3DONA 3MCUA 2QMHA 5E9QA 3RT9A 1WHSA 4G4GA 3P2JA 4GHWA 4G84A 3KYDA 4DAOA 2PLNA 1EFDN 5EPOA 3O6VA 2XD4A 5DBOA 4X7PA 1KH2A 4FCCA 1JUDA 2W6JD 3KSDO 2VRCD 4R9VA 4UZEA 2KX7A 5JCJA 2RAVA 2QD1A 3SYNA 5CK4A 1YZTA 3COVA 3CZ5A 5JO9A 3SKXA 2X8JA 2LGJA 4P3KA 1RWNA 4KQIA 3JQ6A 3P19A 2ECFA 3V97A 4QODA 3ZU2A 4L9SA 5IBQA 3PX2A 3M8KA 2HBRA 3WADA 1M2NA 4PX9A 4GGPA 3M2TA 4C3ZA 4D9BA 3DUWA 3Q40A 3V8VA 3KPYA 3O47A 5D6OA 1QB7A 2QQEA 3G1UA 2Q1SA 3G0DA 3S81A 1JKFA 3QKRB 5TPZA 4OU5A 4FHZA 1WSAA 3GC6A 5E4FA 3T4UA 5JS7A 2HWKA 3F6YA 4JX9A 3CUUA 2OLJA 3NKFA 3PUHA 4PLGA 3RSHA 2DKOA 4YRBA 4F0JA 2J0QA 4JEUA 1TO2E 4QPZA 3SDBA 4PNPA 3TAHA 3PR2B 1UKBA 5LM3A 3HUTA 4RZ2A 3Q0EA 4QRIA 4U02A 1GVHA 2YVKA 5CD1A 3ESRA 5ELLA 2XKJE 1U2RA 7YASA 5BN1A 3GCGA 4GRAA 4RADA 1J42A 5ICCA 4JNKA 4QO7A 3DEHA 3RC9A 4OBXA 3G13A 1M2KA 3LBFA 2AKAB 2JRLA 4NCXA 1WABA 1PWXA 2FW0A 4LY9A 2ECKA 4MB0A 5CGQB 4NZYA 1ODSA 1FSZA 3MMXA 5FWYB 3PC2A 3ZLUA 5H59A 5LD2C 4TZ6A 4OA5A 3CWZA 4Q7QA 3P9RA 1H69A 3EMKA 4EJFA 5JZSA 2YJGA 3EZGA 2VZEA 2QB5A 3DXXA 2IK8A 3PXEA 3R5XA 2BW0A 3ILXA 1T8UA 1GNRA 1J4AA 3IJEB 3IKJA 2VPTA 1BDIA 1NVDA 4J03A 4PLZA 5H3LA 4JI4B 2QRGA 4S0XA 1YB5A 3DWIA 3H7IA 5KZMB 1HV8A 4FZ5A 4MVJE 5KBYA 1ZVQA 4KLAA 4TQ9A 4K9MA 3HCFA 2JCGA 3VUFA 3WHIA 1XZFA 1C1DB 5DB4A 3KE9A 4DV5B 4W7HA 1KAHA 3DE2X 1QVRA 1VGQA 5DGHA 1R6AA 1Q7BA 5E4YA 3U3RA 1LBTA 2MWMA 4R54A 1EGHA 1UQRA 4DCCA 4F06A 3RREA 1ZSVA 5FV7A 2OGSA 5DLQC 3K1YA 4KQ1A 4OHRA 4B4VA 2HYIC 2Q4DA 1KQPA 1R88A 3L01A 5AVKA 1DWUA 3CZQA 3U3DA 3ZY5A 3A10A 3K0FB 1KOLA 1ZL2A 4EEZA 1Z8NA 2AV6A 4P4GA 1FRNA 1OAAA 4XQ0A 1QO0A 2A5YB 2BBSA 2WBLC 4NBLA 1Y8RB 3AVPA 1QGUB 5IM4A 3OX1A 4QQFA 4HH0A 1M6VA 2BBOA 3P0FA 4UUNA 2LVBA 1Q1QA 3BMOA 1VZ3A 2JFQA 3ORSA 2XF2A 3KUDA 3Q0TA 1JRLA 2IF2A 3H86A 5FBRB 4MW2A 1NJ2A 1U4NA 1X1AA 2W6QA 3BZBA 3MRVA 2F3QA 1JAIA 3VHQA 3SVTA 3ESYA 1P4RA 4WA8A 1MRZA 3NVKI 3URKA 3SJCA 2DPHA 1BDBA 2CE2X 4Q21A 4U2BA 1A2QA 2QR3A 4MUIA 4FYXA 2NZ2A 3ND8A 1UZNA 4U9IS 4CI0B 2A1IA 2Q7XA 5TMEA 1Z6XA 3NHSA 2UUOA 2W6MA 4BNTA 1CZRA 2H6EA 4JJIA 1VIVA 4NX2A 1SOMA 3G2PA 4WCDA 2AC4A 4CMCA 2GVDC 3EXIA 1LJ8A 4HNSA 5ES4B 4HL6A 1BH6A 5CCDA 1Z4OA 3R6WA 4C6SA 3HI4A 2E4AA 3NHMA 4AZTA 4UNNA 1UFOA 5ICMA 2WE8A 3K35A 1TQ4A 1P8JA 1WR8A 1LFAA 2XDWA 2ZOSA 4CN9A 2JH9A 2PX0A 4ZOLA 3RABA 4RDCA 2DCMA 4LF6B 2Z2ZA 3AJ9A 4L4YA 1EQAA 3DL0A 1UP4A 4O2BA 4Y2QA 5JBNA 1T5LA 2PWZA 2Z04A 4AKTA 4R2WA 3GUCA 3QV1A 2G4LA 2FWIA 4CM8A 2PLAA 4WX2B 1CDZA 3QLVC 5EL0A 2BM0A 2KBEA 5E9WA 2FR8A 2ODBA 3T95A 5CLFA 4UEJA 3EZLA 1AKNA 3H87A 1TX4B 4IWXA 3H1PA 1VPEA 1P2BA 2QTMA 2XF8A 3TQRA 1R0YA 2BEVB 1VCIA 4LQDA 2IPLA 3ANYB 1FDVA 3OFVA 1E63A 2FUEA 2IYQA 4HDMB 3GDGA 1N1DA 4U7JA 1RPTA 1H0HA 3NOVA 4AZ3B 4XRRA 4MS1B 1HDOA 5B3JC 1E7SA 2QMUA 2XX3A 2LW7A 4Y6LA 3RVMA 4ZGBA 5KDDA 2W2PA 1Z28A 3KTAA 1TJ3A 3FI9A 2DT5A 4L28A 4PWZA 2QXYA 5FTNA 3IAUA 1K7FB 4AY5A 4XFJA 3LQQA 3NNNA 1ZXXA 1JB9A 2XITA 3RSGA 1TPYA 1XVVA 2VRNA 4HDNB 4IF6A 5CMLA 1MEOA 3VPGA 1NPTO 1BS1A 3MILA 1NDQA 3IPRA 4K6FA 1WXEA 1I5OA 2Q49A 2VBCA 4H6XA 4XR4A 4DKJA 3GJRA 1NX9A 1L8AA 5C5EA 5E4JA 4CLOB 4YMWA 2PZFA 4LV5B 1XAJA 3NS7A 1U3TA 2ZRBA 3LHDA 3OJXA 3RM3A 2XUPA 4FS8A 5LWQA 1Z4KA 1U7OA 4IXMA 1UIRA 2QSYA 3VOBA 1XPOA 2IVZA 2V9ZA 3LXMA 3AK4A 1AKYA 3QMMA 2B4RO 5TPWA 3HJFA 2AUTA 3AF3A 5GV7A 3W4KA 5BSVA 1NHGA 4CF3A 4O4JF 4ZODA 2EFCB 1UCFA 3F46A 3MD9A 5HE8A 1QZ3A 3HDHA 3PUJA 1W46A 4MWTA 5GOTA 2D4AA 5FNVF 4ESEA 4OX9B 4ETNA 2ZJOA 3R09A 3DFZA 4EQ6B 4I9GA 4B3DA 4NL4H 3SEZA 4C4AA 2HK6A 4C6RA 1O8BA 4MJ7A 3UQZA 4RQAA 2R6FA 3AVYA 5CW1A 1HG1A 3T8YA 3SHVA 1K1EA 4E5PA 3ZCSA 4XYEA 5TQ0A 1VP9A 5FUMA 1GVNB 1FRFS 2QUHA 1V1MB 1P91A 4M7WA 2ZW9A 3NBXX 4GC9A 5BSUA 2VHTA 1H85A 2E9SA 3C6ZA 3O1LA 1WDLA 4CG1A 2WJ4A 1KY2A 2BHNA 2Y4OA 2PQ2A 3ZTWA 1KIMA 2JJ1A 1KFEB 4PHCA 2QNRA 4YRFA 4K9OA 2AC7A 2Y68A 4M9ZA 4L16A 3AUAA 1LI7A 2NVUA 3CPHA 4N8DA 3CRZA 3DTVB 3FCUB 3SMQA 4IJ6A 4ZYVA 2DSNA 1XT6A 2GA8A 4LZNA 2ZUVA 3K4QA 3QFHA 4IJWA 3I0NA 2OO5C 4LBWA 1W2HA 4ZDJA 1Q0PA 4MDEA 1NMQA 5IARA 4FCVA 5THKA 3RF6A 3O8LA 1AIPA 3SC3A 3C6XA 4DEYA 4YXFA 1PJ3A 2IL1A 4Q01A 2WAOA 5EJ2A 1U1DA 5HIMA 4D6YA 2DYKA 2JFPA 1E5VA 1AS3A 3Q88A 5SYNA 5KS2A 4DQDA 2WU0A 1MGPA 1IDN1 3RC8A 3KYIB 3IOCA 1FFGA 3QNMA 4J0QA 1RLMA 2VCYA 5HFNA 2X2EA 3VAYA 1G8JA 1T8WA 2JH3A 1H2AS 3FA2A 5FOTA 2ZRAA 4NBUA 3NC0C 1C9MA 3AM3A 4K9SA 5EKDA 3F5DA 5AHXA 4DQKA 3Q2IA 1ZD2P 3RVJA 3V4PB 3GGDA 2QRVA 1NQOA 2WRZA 2QRJA 4GMKA 1Z5NA 4EF5A 2XCIA 2ZJFA 3T5CA 3V34A 1MJNA 3KLMX 2EZTA 3P0RA 1DIGA 2AEMA 3W3ZB 4GL2A 3RK4A 4KN6A 1RXYA 3Q9UA 3UB4A 1T1JA 5JJ5A 5LQUA 2IGBA 2H07A 4E2ZA 1PWZA 2FJPA 4JVSB 3ZVLA 2ZU0C 1QIFA 2ZAIA 4E51A 3VU8A 2OCBA 3NBAA 2VTDA 1P0FA 1VSUA 1YZFA 4A0RA 3VU3A 2OK7A 3IPAA 5K4HA 4DXAA 1CG6A 3JCZA 4KDEA 1GZ4A 2G67A 4KQHA 2R97A 3T3DA 1RU3A 1NNUA 2ZS7A 1Y3BE 4O4IA 3WQSB 2I66A 3TI9A 4B6FA 2YJ3A 1PT8A 3EAGA 4FVTA 3LDUA 5TEWA 1KAGA 2P3LA 5FAXA 4E7PA 2Q0SA 2Z95A 1J2RA 3IQXA 1JEQB 1KR5A 3QF4B 1QYXA 1J8YF 2MINB 3F4BA 4RS3A 3C3MA 3MWEA 2WF7A 3ES9A 1QHHA 4NYMQ 3M81A 4YGYA 4RULA 1JPUA 3KEGA 1YC5A 4QELA 5LDHA 4KPEC 3I8OA 4K6KA 4X1IA 5TJ9A 4LOAA 3MM4A 5K3FA 1MC1A 3QUSA 4PC6A 2F9LA 1SU6A 3H5RA 3RFVA 4B2PA 4C0WA 2V9PA 4Z6KA 7MDHA 4B4UA 4TPKA 3USES 3NHRA 1K66A 1MZPA 5G02A 2F3PA 1JIQA 1MORA 2JI8A 3FDZA 3RWOA 3ODPA 4CF6A 5EXSA 5SZIA 2JCXA 2VCHA 2YTZA 3H9CA 5CT5A 1E9AA 1NVEA 4OQEA 4HYEA 4Q9KA 5JFGA 5JSQA 1U02A 1XTPA 2VLIA 3FTNA 2V7VA 4PGAA 3GXOA 3OECA 1GPH1 4PNZA 4FDVA 3G79A 3ZD9A 4F2HA 1JPJA 1L5LA 4PGGA 5AXDA 4DT1B 4CGZA 2VRWA 3EVEA 4M9UA 2N75A 3WBJA 3D5TA 1DCMA 1ODLA 2QLFA 3MF4A 5E7MA 1U1GA 2QI9C 4O0LA 3R7LA 4I1PA 1JDTA 3RGWS 5CDFE 2O4CA 1WMAA 2V8BA 4P5PA 3ORFA 3AOGA 2RD2A 3TECE 1T3HA 1CQIB 4DJTA 3IDZA 3UMSA 4DCUA 3P0EA 1Z8DA 4NU6A 1EGVB 3WV5A 2B92A 3AZPA 1VE6A 5KNCA 4LRYA 2QM0A 4IFEA 4RVUA 3ZW8A 2HV8A 1JAZA 2XGGA 3V3KA 3STWA 3WLEA 1IJBA 1JAYA 4KRXA 3AUFA 2BCJQ 5M5BA 1E79A 2YJ4A 1T13A 5TQJA 1Q14A 1YBMA 3QXXA 4MICA 4O33A 5H8WA 2VP6A 3BD8A 5FUVA 4BVLA 2PUDA 4TZ0A 3C41J 1SXHA 2F64A 3DBVO 1YR6A 1AGPA 3DLPX 1TUIA 4YC7A 5CTJA 1E3EA 3DCIA 2QBYB 2D8AA 4M8KA 4XSHA 4B34A 4FX5A 4KMSA 5EP4A 4YACA 4YP0A 1UZUA 1ZWLA 3SHOA 3K4PA 1IUPA 4YV7A 3RHTA 2J9ZB 2W2KB 4RXMA 5BSKA 2CSXA 3CR7A 3D64A 1M6HA 2YRFA 3SC4A 1Z33A 2ZVQX 3MRXA 4PG4A 4KQKA 1G8SA 1NYRA 1QAQA 2VSFA 1ADJA 1X6VA 4QD3A 3IT0A 3DBRA 2CK3A 3M3HA 1M34A 1VI2A 1HPLA 3MOIA 3SXJA 3LP6A 3UAYA 3UGQA 1KI2A 1TA0A 2F90A 2PKRA 2G88A 3EZNA 5TY0A 1DKRA 1G6Q1 4OM8A 5EUBA 2IGTA 1E4YA 4J75A 2XSZA 3KB6A 1T35A 2Z4TA 1ZO8A 1GPBA 2A3RA 3CNLA 4FD3A 4NJEA 4E1VA 3IR7A 5IK2D 4HFMA 3K5HA 3AJ8A 4X6XA 4X8HA 4Y2UA 1VHLA 4S04A 3OA0A 1OWMA 2FN7A 3TQIA 2WWHA 4EMTA 1R8YA 4OQYA 4BX8A 4EGQA 2X77A 5DYWA 3LUBA 3B13B 3CVXA 1QGZA 1UBUS 2AXPA 5LOVA 3F3YA 3HB4X 4XTCS 4D5GA 1QO7A 2FLKA 1NQWA 1XMQB 1J0BA 2H2DA 2VHXA 2YV1A 3B9RA 1QH8B 4QU5A 3JQAB 3KT6A 1PV2A 2C07A 1HDIA 3K9LA 4QASA 1NLYA 4YREA 3U2QA 1WUKS 3W2FA 5KTOA 1G291 3M4YA 3SQWA 3ST7A 3N2LA 1T8RA 3RJ5A 5I7UA 1MG5A 2WAMA 2EJB