4JT2A

Structure of clostridium thermocellum polynucleotide kinase bound to ctp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
b'SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jt2A00
4JLOA 2JDID 4MH0R 4B3XA 5ANRB 3KUCA 1S2MA 3A8TA 3EASA 1XZPA 4DLRA 3CUEF 3CWZA 3BORA 1GITA 2EYUA 4URUR 4RKFA 4FCVA 4WVFA 1W5TA 2IS2A 2FA9A 3PUXA 1F5NA 1CTQA 2ODWA 2VL7A 2YC2C 4LWZA 3UANA 2B7BA 3P1JA 1G5RA 4F38A 4YMTA 3EZ9A 4GFDA 4XD7A 1ZP6A 4JVNA 1SHZA 4CRWB 4OQFA 3RS5A 1U2RA 2GBLA 2CNWD 3BD9A 2IF2A 3CONA 4G5GA 1FPMA 4IVPA 2J45A 4LK2A 3VFDA 4BQSA 3K0SA 1ZRHA 3GLGA 2IWRA 1JI0A 2X19A 1D6JA 1P4SA 1WQ1R 5F2EA 1SXJE 2ZSDA 4US1R 3LD9A 2JLUA 3B6EA 4BRWA 3J81k 4MRVA 1ETUA 3AKEA 1A2KC 1E1QD 3DHWC 5F9FA 2W6ID 2V6IA 4TMXA 1ZM4A 4TWZA 1TQDA 2H18A 1ZCAA 2ATXA 2CLDX 2PZEA 3CRRA 2O5VA 1CRQA 3TBKA 1ZW6A 2V55B 4PC6A 5HE8A 1G3IA 3AF3A 1JQJC 1P60A 3LO5A 4MKFA 1FZQA 5G53C 4OHXA 1E9FA 3FMPB 4DLTA 4B33A 3PVSA 3W8RA 1G8FA 2VBCA 4KBGA 3TUJC 4Q4HA 1G4AE 5DYIA 5DO9A 2OILA 2IYYA 1OE0A 4GI7A 2RKOA 2Z0MA 3CH4B 1Z2CA 3GJ8A 4N3NA 3W5JA 1ZM2A 2OFXA 3F8TA 1UKEA 3E5HA 2P0EA 3NTUA 4J0QA 4LX0A 2F3TA 4M21A 1XXHB 3CH5A 4JMPA 4AURA 5IRCD 3KQLA 2W0MA 1AZSC 1OW3B 2AWNA 1XDBA 3FHTA 5FTNA 4A92A 5FR1A 1BH2A 2J59A 3TW8B 221PA 2DWPA 3AKDA 2QL6A 4B43A 1E99A 1PJRA 5B58C 4ZDIA 2XJ4A 3HPQA 3CPJB 1G64A 1PZNA 3T61A 3ASYA 3BB1A 1U98A 4C0KA 2AFIE 4FMBB 1GWNA 4DDVA 5FH9A 3W3ZB 3QVUA 3RRZA 3VHXA 1X3SA 4NCIA 1G17A 4AY2A 2CCKA 3WBKA 4Q66C 1NNEA 3PCRB 4UNRA 1MO4A 2B8TA 1YE8A 3B1VA 1YRBA 3KJEA 2OCBA 1TTTA 2N42A 2ZITA 1NBME 2G0TA 2ZUCA 3HDTA 1KK2A 4MRPA 5SZIA 2IW3A 1OHHD 2OT3B 1NJGA 4CVNA 3MLEA 3SN6A 5TB5A 3C14C 4A0FA 1XMSA 2GJKA 4P4TA 4AYTA 3LLUA 4RZXA 2F1IA 3ZS8A 3G5UA 2N1BA 1IHUA 2BCGY 4Q00A 5KUTA 2MSEB 4A0RA 4PZYA 3KJGA 3A1VA 1CULC 3SNHA 4EDHA 4CT5A 3DZ8A 3G82C 1E2JA 1OB5A 2JLVA 3ND9A 1UM8A 3IDQA 1R2QA 2P5TB 3K09C 4QGAA 2XSZA 4V0LA 1YJ5A 1Z8FA 2QENA 2V6JA 4QL3A 4XSGA 3AVWA 2ZSBA 4TMWA 1OH8A 1AGPA 1TPZA 1AIPA 1G7RA 1YZGA 2Q9BA 3U3KA 1TQ4A 2BIFA 2PMKA 4G5OA 4G5RA 1DE0A 1J7KA 4YONB 1VG9B 1NN5A 3QBVA 5EP1A 4JIMA 3ECCA 2BBTA 3K0AB 3PUYA 3SJAA 1J90A 2XOKD 1I4LD 2QMHA 3E2IA 2BOVA 3EIHA 2ERYA 4AI6A 4GNKA 3GFPA 4URWR 3ZS9A 2DFKB 1VCIA 3SFVA 3IGFA 4HB2A 4WBSA 2CK3D 2JA1A 4I4LA 2JDIA 4C2UA 1FP7A 2ZETA 1CJMA 4E22A 1A82A 2QG6A 3A1WA 2N46A 4IXMA 2ZVQX 3X2SA 4DCSA 2LCFA 4R71A 1M34E 3CKLA 4LZZA 1QVAA 5DH9A 5GVSA 2WM9B 4AG5A 1II8A 4PPFA 4AKEA 2XZPA 2ATVA 2DWQA 1OPXA 3NDPA 4CDGA 2RGXA 4OI4A 4XWAA 4TZ0A 1FQKA 1W48A 2ZRPA 4EFLA 4FIDA 1TU3A 2ZYVX 5BYJA 2FSFA 2HDNB 2IXEA 2ZI5A 1D2NA 4L9SA 4NYMQ 2J7KA 1E3MA 2VLIA 2QBYA 5GJWC 4CW7A 1F48A 4PZLA 1KI7A 1ZMXA 1E1QA 4B3CA 3ZVNA 3RAPR 4PQYA 4ZDKA 3QKUA 1OFTA 4M1MA 2ZYWX 4NYJR 1B23P 3FWYA 2ORVA 3AGPA 1FP6A 1NP6A 4LY6A 1FX0A 3DM9B 1N5KA 1TEXA 2FEOA 1O3YA 2CDNA 4LHYA 3LBIA 2D2EA 4UJ3A 1NF3A 3RS7A 2OBMA 1NLYA 1D5CA 2PCJA 2QE7D 2WIAA 3NEJA 4NL4H 2C95A 5IHPA 3IIMA 2LWIA 3NBYC 4IFEA 4D0GA 4BPBA 4QGGA 1W0KD 2WWXA 3H2YA 1KSGA 2RGAA 1G6OA 1VG0B 3PQCA 3TVDA 4Q9IA 4E03A 4QG7A 2HLDD 3GLFA 3RC8A 5AWFC 2XTNA 1ONBA 1G8PA 2EFEB 1NLZA 3IHWA 3AV0B 4IRUB 4EPVA 1TNDA 2CE7A 2Z6VA 1DPFA 3VNUA 1KDTA 2F9LA 2QPTA 4MA4A 3W9YA 1DEKA 5FOSA 5C18A 4NPHA 2ORWA 2IS1A 1NY5A 1GNQA 2R44A 2FSGA 2VPPA 5SZHB 2XAUA 4HYYA 3AVPA 3IEUA 1TX4B 3GLHA 2RGGA 1Z6YA 3C15C 5K8LA 5KO2A 1S0UA 2QSZA 2VSFA 2FG5A 4NTZA 2KSQA 4MDFA 3MWYW 4FMCF 1KI4A 1WBBA 2QN6A 1F2TA 4NCKA 1OXXK 4D4KA 4LBYA 2GKSA 1SKYB 2KE5A 3VR6A 4V02A 5BW8A 3ZD7A 5JJKA 3A4NA 1PVOA 4TN1A 3U3MA 5JEEA 1CJUC 1CF4A 4LJ4A 3U3JA 1OKKD 3LLMA 5SZKB 4D26A 3AVXA 1J2JA 1CR0A 2GF0A 1T4GA 5FR2A 4TYQA 3ZH9B 1RE0A 3THXA 5E4FA 2D74A 4HSEA 4KYIB 1E2PA 2C8VA 2CL6X 4JT4A 1IN5A 4MRSA 1SHKA 2J3EA 5L3SB 3AF0A 4WIAA 2VEDA 3LX8A 2H57A 3C16C 1XEFA 1E9AA 2WAXA 5F98A 2Z4RA 4WOPA 1OXSC 1JR3D 1LS6A 1N6KA 3N2IA 1P2TA 2L0XA 1VKJA 1E4YA 3QF4A 2ZE5A 3RC3A 1K5GA 1N6NA 3B7GA 1DS6A 4U00A 2WTUA 1E9RA 2W2XA 4X8LA 4Q7JB 2QGNA 3CX6A 4X8OA 4EFNA 2FZLA 2IX3A 1PV4A 3BH6A 4N0DA 2O8CB 1QG4A 1KDPA 1OH6A 4XVUA 4ABYA 3QXHA 1KJYA 3OF5A 3IUYA 3NVAA 3QVVA 1OIXA 4JVLA 4KV9A 3U3RA 2HEIA 1R6BX 4LJ6A 4A36A 1M1YE 3LW8A 3IKJA 4C7OB 2PX3A 1Z08A 2CK3A 3CB4A 1E0AA 1P2SA 4CT4B 2ZJBA 3P32A 1M6NA 3HU1A 1ESMA 3B9PA 4V0NA 1CJTC 3QEOA 1E2QA 3TE6A 2AK2A 1XXHE 3GJ0A 1X86B 3ADCA 1E32A 1GG2A 1AQUA 1W0JD 4KFRA 2BDTA 4TYPA 1GAJA 2BVNA 4NKRA 3MAAC 4RZUA 4XSHA 5JEDA 5JHHB 1VPLA 5E7JA 2QTFA 2A2ZA 3K0CC 3K1JA 2WPDA 2I1QA 2YZ2A 1Z0FA 3RS4A 4BFWA 1U0HC 1KMHA 3GEEA 4IDQA 5AR1A 5BN5A 5DI3A 3BH7A 4F4CA 1CR4A 1OXTA 2F6RA 1KGDA 2VSXA 2ZANA 4L9WA 4ZDJA 5JWRA 1OSNA 2WIBA 2JAQA 1R5NA 2D06A 4R9UC 1F2UB 4PZZA 3VNVA 4Q4AA 1Q20A 1SXJD 3LVRE 4D4LA 2Q21A 2REBA 5UKDA 3DM5A 1SZPA 4V0MA 421PA 2XZOA 1C1YA 2AKYA 3AGQA 5AUQA 3SJBA 4DWJA 3U6BA 1RC8A 1M2OB 2WOOA 3KFXA 2GCOB 4A0HA 1ZUNB 1U9IA 2NIPA 2F9MA 3HWSA 4KLZA 4BFVA 1ZYUA 1XFAA 4HAZA 4MGYR 2BBWA 2JLZA 1A1VA 3T5GA 2QE7A 3AVVA 1PLLA 1T5LA 3DZDA 3QXSA 4QM6A 5DN6D 2AWOA 4DC9A 4Z1MD 2V1UA 1R5OA 1W0KA 2NO7A 3CF6R 1OF1A 3ZVRA 1G20E 1GRRA 1ZNXA 3LQQA 4JLKA 3VTKA 1EWQA 2C78A 3IIJA 5B30A 1XPOA 5FL7A 3PXGA 1Z22A 3QKSB 4JLPA 1YR6A 4I99A 2VP2A 2P65A 3RSOA 2A5DA 3LX5A 1EFRA 2OM2A 5JJLA 2QM7A 4DLYA 1N5IA 2XNSA 4V0OA 5C46F 1W1WA 3W3AA 2EFCB 3IQXA 3NBXX 3WRYC 1Z06A 1D2MA 5JECA 3FHCB 4GOKA 1NL3A 4LHWA 5EE9A 3I61A 2ZJ5A 3QPUA 2DR3A 5B64A 4YDHB 1FUUA 3KL4A 1G7SA 5FBLB 1NN3A 4MITA 2J87A 3NWJA 2ZJYA 1U0LA 2YWFA 3F5FA 4HB0A 2HT1A 1L2TA 3RSLA 2A5GA 4GMXA 5L3QB 4DLWA 2IBMA 3GMTA 1H8HD 4GPTA 3RRYA 3VR5A 3UWKA 4Q7MB 1WDTA 1ZJ6A 1X6VA 3EZ7A 2DY1A 3REFA 3O8CA 1EFCA 2WWYA 2YWHA 4F4JA 1SVLA 1V5WA 1ZUIA 4M0LA 2QPOA 1G7TA 2WJJA 1NBMD 5DSZA 3DKPA 1HH4A 1QZXA 2ODNA 5K8TA 3Q8XB 4A6XA 4S2EA 3U4QB 4C0QC 2FPKA 1P72A 2C9YA 1GOTA 3QPVA 4NCJA 4KVAA 1IN4A 3EWSA 3SJCA 4B73A 3FYHA 5D3QA 2ZPTX 3KQKA 3OAAD 3I4LA 4PTLA 1JJ7A 3S1AB 2H17A 3ICQB 2FMXA 4AKIA 2C5LA 3LA6A 3A4MA 3R8FA 4Q48A 5E7IA 1OXUA 4QJ5A 2V7QD 1JR3A 2ZUBA 1HURA 1SULA 1YZNA 5FPTA 2B92A 3PEUA 2ZRDA 4BEBA 3ADDA 5IT5A 2C77A 2IYUA 3R7WA 1MRSA 1N3BA 4Q7LA 4TLBA 2OUKA 2J9RA 2QT1A 3QKRB 4IDNA 2CMKA 4D4MA 1NSFA 4CEIB 3SI7A 2EWWA 4LRWA 1QVRA 2FFQA 4BE7B 1TL7C 4YXWD 3FOZA 2XGJA 2WWFA 1LF5A 4RCYA 4L8GA 4QM7A 2FU5C 4Y0AA 3TIFA 1DBSA 4NZYA 5KSPA 4BECA 4BFTA 3KXIA 4OJKA 4PC1A 3AEZA 5CIWA 5CYOA 4EJSB 4RSGA 2D7CA 1MO5A 1JQLB 3R9XA 3FHOA 1J99A 4G5SA 2QP4A 1XD9A 4HZUB 1UEJA 4JVMA 1PUIA 4NYIR 4HATA 4BZQA 1UDWA 3EIQA 1BYUA 3E70C 4EPTA 4P32A 1GSIA 2WAYA 2F1RA 3RANA 2P2LA 1WCV1 4C0LA 4ACBA 5A5GA 2W6JA 3HPRA 1ZAKA 4RY2A 2R6AA 4LJ7A 3AQ4A 2F1JA 1D8TA 4YMVA 821PA 5JRJA 4PQRA 3X1YA 3P4YA 3K70C 1P73A 3H0KA 4M22A 4PHHA 2J0QA 2QQ0A 4CEIA 3AVQA 1GNPA 3BIFA 4M9ZA 1ZBDA 4Q1DA 1GUAA 4ZPXA 4OHYA 5AJVB 1E96A 3NHAA 2OZEA 1OIVA 3KJIA 4BLRA 1F6BA 4GBMA 3WMGA 1QHHA 2ZREA 2OO7A 2WICA 4NU0A 2B21A 1BS1A 2DFLA 3FKSD 3MGCA 4OKSA 4PO9A 4PSKA 4TLDA 2O8FA 3IPYA 4JJKA 5IDVA 1YZUA 1SXJA 3RS0A 4ARZA 3ADKA 3EPHA 5FOXA 1C9KA 4JLNA 1VCNA 1SKYE 1SVMA 1AS2A 3CRMA 4L4UA 5E3HA 5FTJA 2FX3A 3BBPA 3MJRA 4Q9HA 4WW0A 4ZIRA 3U7GA 3IBGA 2ZAMA 2GRJA 3E1SA 4JL6A 2FV8A 2K5UA 2KI5A 5HCNA 4NDZA 5FTLA 1PUJA 4TTRA 4ACAA 1P2VA 3C5CA 3MG9A 4H1VA 3GJXC 4BRUA 1R0ZA 1XD8A 2A30A 4LV5B 2ZVPX 1Z0DA 1R8QA 5KNCA 2GVZC 2AR7A 2OEPA 2WJYA 5LBIA 1XF9A 4FW9A 1CJKC 4I81A 5CLQA 5EE5B 5CM9C 4UKDA 3KFVA 1XTKA 5DN6A 1QHXA 4Z1MA 2WVJA 4HDOB 2VP9A 4LYAA 3BB4A 3SS8A 2CXXA 1LY1A 4HUQA 2GK7A 2FFBA 3L2OB 3RRMA 3T1QA 4Q02A 5IK2A 4JLMA 1M7GA 2FPLA 5DISB 2GXAA 4W7SA 3AVYA 1I2MA 2F3RA 3LV8A 5EP2A 5DYGA 3UXMA 3L8YA 4E5UA 2WBLC 3AUXA 1SVOA 4BFZA 5HR5A 5JSZA 1NLFA 3VMFA 5EXXA 3A58B 3H4MA 1AQYA 4JLVA 4AWXA 2VF7A 4M1TA 1R0YA 2E9SA 3BFKA 4DDTA 2Y8EA 5HPYB 3OIWA 5JCPA 3CO5A 4YQFA 3LNCA 2IUTA 1VHLA 4RFSB 1H8HA 3PJRA 3BXZA 1XWIA 1TMKA 3UIEA 4Q4LA 1AA9A 1IN6A 4TYNA 2OCPA 2C99A 1XEXB 2RAPA 2ZI6A 4A82A 4DLZA 1SGWA 4O2RA 2ZRLA 3SOPA 3KQHA 3FGNA 4A2WA 2IUSA 3ASZA 2MMGA 3CX7A 3B1ZA 1KDRA 1CJVC 1DAMA 1NBMA 3M4YA 1Q1ZA 2VP0A 2IYLD 2NTYC 2WWWA 3QXCA 4TLAA 5CIQA 3K53A 3SYKA 4EQ6A 2YKGA 4F91B 1ZU5A 3FTQA 2CVFA 3NG1A 4DZZA 2ZJAA 3UWOA 1VECA 3B82A 1RFLA 1Z07A 1IY1A 3OIUA 4IEEA 1VDZA 3LH5A 3U7HB 1RW4A 4IDPA 3PFIA 4M1WA 1US8B 2AFHE 1XJCA 3T1VA 2XB2A 1E1RD 1KHTA 2BCJQ 1U8AA 621PA 1D2EA 2V7QA 4O0MA 3W6PA 3MSXA 1II8B 2R6GA 4HAYA 3B2EA 4JT2A 3THYA 2QRZA 5HTKA 2VIIA 4H9GA 2FE4A 5KDDA 1KI6A 2BKUA 2IYSA 2BM1A 3PIRA 4OYHA 2Z83A 3I32A 4Q1BA 2J0UA 5KDOA 3BFVA 2RMKA 4PPNA 3M6AA 3U2QA 4DSUA 1E79D 2QZ4A 3I73A 1H65A 2GNOA 3ZVMA 1Y3AA 1SVSA 5FBQB 4YXWA 5FOTA 2GXSA 3SE0A 1WP9A 1WBDA 2QBYB 3PUVA 1W36C 1XRJA 3DKVA 1DARA 3MJHA 4AK9A 5JHGB 4N0EA 2IHBA 4CF7A 4WXPA 1DAEA 1E2EA 2CCGA 3V00A 4P4SA 3SZRA 1F60A 3A36A 1W5SA 4C0AC 3VAAA 5D3MA 5G3YA 1P5ZB 2YNMA 4IOKA 2FJUA 3U60B 4PAQA 2ZAOA 2X1VA 5JCZA 2ZU0C 4JLJA 2J41A 1LVGA 2ZI9A 3VX3A 1I2DA 2V4ZA 1T0JB 4QKQA 2QAGA 1Z0IA 5FI1B 5K8IA 2RGNA 4KODA 2IYQA 3K0FA 4C4PA 3LW7A 4M9QA 2JJ1D 2QTVB 4I1VA 3FVQA 1NVWQ 2IYVA 3RS3A 2HT6A 5J4LA 5J40A 1XD2B 2WKQA 4KJZA 3UKDA 5ELXA 1P61B 3VKWA 1MKYA 3I5YA 3CNNA 3ZQ6A 3FKSA 2FFHA 1Q1QA 1E9DA 2FGKA 4NONA 2JIZD 1FMLA 2UKDA 4R98A 1GTVA 2C2HA 4M53A 3KB2A 4ZCMA 2D7DA 3WMEA 1TUEA 1KK3A 2TMKA 2VTKA 4U02A 1NY6A 2AHOA 3ZZUA 1NG1A 1IXZA 3K9GA 4HLUA 4C9BA 2QI9C 4Z51A 1KY3A 1LS1A 1Z5ZA 2F43A 3OEED 1YZTA 1IXRC 2GAOA 3QF7A 1R7RA 2IC5A 3B5JA 1Q12A 4LBZA 2PEYA 3HR8A 1GIAA 3DOFA 3CLVA 1UKYA 1YZLA 3MRSA 3PEYA 3DL0A 3OIYA 3SR0A 4CEJB 1H8ED 2G77B 4JLAA 4ON9A 4TL7A 2HXYA 5GJCA 2ZROA 1ANKA 1G8GA 1RRFA 2BMFA 4BGDA 1E2NA 1FNMA 4PANA 4W5HA 3N5CA 2PL3A 4IVQA 4IJMA 3FB4A 3GPLA 2UZ3A 1DG1G 3THXB 2FFAA 1K8RA 4WXRA 4WAUA 4TMKA 1ESNA 1EWRA 4UQOA 5G40A 3GJ3A 2H92A 1NIJA 2YJTD 1E9BA 5AK0A 3A6PC 3GJ5A 5KU1A 5CK4A 1EX6A 3WYFA 3NBFA 1NRJB 3HU3A 2ZRBA 1BKDR 4DCVA 1YR8A 2XXAB 3DPUA 2R65A 4OI2A 2ZI4A 2KB0A 3LQRA 2WZQA 1OT3A 4A4DA 5E95A 5J4HA 2ZRCA 3K70B 3IEVA 5KDLA 4DXAA 2AKAB 4A0GA 1VMAA 3QY0A 3Q5EA 4URVR 1DAIA 3PR1A 1ZD1A 4PC3A 4LJ5A 2VF8A 3ADBA 4QBHA 1JJVA 3BS4A 1Q1EA 2DFNA 1D9XA 1VYUA 1L4YA 4PHTA 4L16A 4DLXA 5G41A 2EFDB 1NVUQ 1NKTA 4YDSA 5JS8A 1NN1A 2Q3MA 1XTJA 3ZZ0A 3Q72A 5JRZA 1CIPA 3NBZC 3EA5A 3WNBA 3TW4A 2WMNB 1S8FA 5EJEA 4PPGA 3R9IA 3VHLB 3ZIAD 3BFXA 4LC1A 2OFWA 3NC0C 3B85A 2CNWA 4BFYA 2QGZA 4D0NA 2GJ8A 5H8WA 4IVRA 1BOFA 1S3SA 3PG5A 3R8CA 5L8VA 1E1RA 4NMMA 2JJ8A 4D80A 2BBSA 1GRNA 2XNDD 1BIFA 2P6UA 3RYTC 3TAHA 4DSTA 3GLIB 5GADl 5DLQC 4Z8YA 3L0OA 3ZQJA 2ANBA 4B34A 5C4GB 3ETLA 2ZJ8A 1GL7A 3CR7A 3PEWA 1I4TD 2EVWX 1C4OA 2W6IA 1ELOA 3FMIA 3A4LA 3VR1A 2ZE6A 3THWB 1FNNA 1G8HA 1E79A 4QHSA 1EFTA 2VSOA 3TRFA 4AC9A 4UJ5A 4XJXA 2REOA 3F3YA 4Q4AB 5JWHA 2G88A 5A0FA 3VR4A 5JS7A 3B1WA 1VYTA 3O47A 3SFZA 3B1XA 1CKEA 1GKIA 2GCNA 5FOUA 2GHIA 1ZC3A 1P9RA 2O8DB 4UNNA 3U3OA 4B3FX 1Z3IX 5CDFE 3NH6A 1KY2A 4LDJA 4MYHA 2GBLC 2REXB 5F3WB 3EPLA 1NMYA 2FWRA 1AGRA 4QGHA 1CU1A 1ZNYA 2HJGA 3KKMA 1AZTA 3QNUA 4BLQA 3CPHA 2HF8A 1JEDA 1G3QA 3A1UA 2QY9A 4Q19A 1P2UA 2D62A 3B1YA 1XXHA 2GETA 5KOYA 2O52A 3EZFA 2ZRJA 2X2FA 3EZ6A 4JJZA 2IS6A 4MRRA 1GVNB 1Q1BA 5LD2C 4I1OA 1E9EA 2JJ1A 2XITA 2AXNA 3DEFA 2WSSD 2CHGA 3SBEA 2WOJA 2JJ2D 2CLSA 3AP1A 4UNPA 3EPJA 2WWHA 5TARA 1K5DA 3H84A 3I72A 3JVVA 3THOA 1UKVY 4M1OA 3D31A 2XB4A 4V0KA 1UBFA 5HCIA 2NO1A 3BJIC 4DUGD 2NO6A 1GP2A 1Q22A 3NHBA 4LV6A 4M9XA 1CEEA 2WKRA 3WYGA 5KYKA 1OHHA 3OEEA 4KYUA 4ESHA 4KFTA 1NVVR 2XX3A 3CR8A 2QQEA 2RGNC 2ZJOA 5EE0A 2H16A 1OYWA 2MMCA 5TXGA 2GEUA 2GESA 2VHTA 2YOHA 2ZRMA 4P33A 5G3ZA 1XCPA 2O8BB 1UEIA 4OHVA 5BYKA 1DELA 1E2KA 1N6PA 1UDXA 1CR1A 4R7ZA 3W34A 5HZHA 4CEHB 4B71A 2KWIA 5KSYA 1W36B 3K0EA 2JLXA 1IN8A 1YZKA 2ZIAA 1VIYA 1U8ZA 5FFMA 2A7QA 2R9VA 2FH5B 4RCZA 3C4JA 5DIFA 3C7KA 4C0JA 4LYFA 3M0EA 2BWJA 4B47A 2XEXA 2IYRA 3BAFA 4V03A 3Q7PA 3VR3A 2OE2A 5JWOA 3OHMA 1O87A 5AUNB 1E4VA 2HUPA 2ZRHA 3EXAA 2NZJA 3H86A 1KJWA 5H68A 5J5CA 1T91A 3EC1A 3NXSA 1KO7A 4BFXA 2XOKA 2C04A 3KXKA 2IT1A 2PZGA 3K0AA 2AD1A 4TZ6A 2VHQA 4NBSA 5DI9A 3GJ4A 1G18A 2G3YA 2ZYTX 2F7SA 1S9DA 3CF2A 4AYXA 1Q0UA 1DO0A 3EC2A 1Z2AA 4IEIA 4QBGB 3LRPA 4ZCIA 5A4JA 2YWGA 2OESA 4NCNA 2ZI7A 4HLQB 4LSGA 1RYFA 3KUDA 2EFGA 2QTHA 2R6CA 2ZS7A 2G0NA 4GOXA 1S3GA 2ZS9A 1G3MA 3O8BA 3PENA 4M1KA 1DOAA 3NDBB 1SKQA 1VCOA 5FPYA 4FD2A 2O8EB 1DAHA 5FI0B 4HAUA 4TL6A 4MRNA 4FMDF 4ZI3A 2ZRAA 5JFGA 1CBUA 3AF4A 4O3MA 5JI2E 1HE8B 4X8MA 4A6PA 4D25A 1QG2A 2CL0X 2W83A 3UATA 2ZUDA 3LVQE 4JBYA 4Q47A 1ZC4A 1XX6A 2Q9AA 3X1WA 1AM4D 1EESA 4Q5IA 4KO8A 2GJAA 4PX9A 1DTSA 1Z63A 1E2IA 1XZQA 2H1LA 2WJVA 2ZJZA 3IQWA 1KZGB 4PSAA 1DADA 1DAFA 3HYRA 2BEJA 4DT1A 1T8TA 4Q18A 1WF3A 3KX2A 3EPKA 1RRCA 3C5HA 4WZ6A 1KI9A 4FXPA 4PC2A 1W2HA 1VYVA 4B6EA 2EWVA 4K81B 3OE7D 1XTIA 4RD3A 1T6NA 3LWNA 4JSTA 4XOIA 4DEXA 1JXOA 1G4UR 4B76A 4ARZB 1BO6A 2AN9A 1GM5A 1JAHA 1TADA 2CHQA 1XTQA 3WP0A 5LB2A 4PSVA 1MABB 2I3BA 4NE2A 1DG3A 4XTCS 5K8UA 2HLDA 2GK6A 4B2PA 1E2DA 4Q4JA 3ICEA 4AIIA 2QMOA 1JAIA 5JZVA 4L5BA 3SQWA 3QXXA 2KBFA 2RGEA 3EA0A 3FMOB 1N25A 2A78A 2H8KA 3L0SA 3ZDQA 1LTQA 3AUYA 3OIVA 4DCTA 4DVGA 3VU9A 2WJGA 4E09A 1MRNA 1N5JA 1OLOA 4PR0A 3SU8A 4G3XA 4W9MC 4AKHA 1E2HA 1XMJA 1G21E 2VHCA 1DAGA 1IJFA 2JJ2A 4M1SA 1LB1B 1VG8A 1TUIA 4JL8A 5KSOA 5CK5A 4K46A 1R8SA 1T3HA 3KZ1E 2GEDA 2CJWA 1KI8A 2E1RA 4TT3D 1LV7A 4KAXA 4OL0A 1U99A 5BWMA 4DUGA 2ZSFA 2G1KA 4RD0A 4Q9KA 4XVQA 2XZLA 5KHOC 1FOEB 1OKKA 1T8UA 3DVLA 1JXMA 1Z6XA 3B8HA 4FN5A 4GP7A 3UMFA 2J1LA 2RCNA 1W2GA 1FTNA 4QOSA 3P27A 1W4AA 1P75A 1E2FA 1YRAA 1P7CA 5L3SA 1N2CE 1XB2A 2NQ2C 1G41A 2HXSA 2JLSA 1VIAA 2J46A 2X8AA 4NYJQ 5FUXA 1PLJA 2EQBA 2NZ8A 4CZ2A 4KITB 3IHLA 1OXVA 1FUKA 5KTYA 4MUBA 4I1SA 2Z43A 3FPAA 1XMVA 2EU8A 4BZPA 3GLIE 2NO9A 2R6FA 2BBOA 5KPDA 2J0SA 2ORIA 1NKSA 2A5FA 1XJ0A 1G5PA 3I8SA 4QBIA 1KO5A 5JBQA 1GDDA 1N6IA 3KDSE 2ERXA 3OZXA 5L3RA 4A1FA 4EPXA 2PJRA 2QNRA 1KZ7B 1S4QA 5IF9A 3GLGB 1JECA 1RJ9A 1ZNZA 2CL7X 4Q03A 8OHMA 1E94E 2O0JA 1NI3A 1WRBA 5AJWA 2WHXA 3CBQA 4PPQA 1RKBA 1HE1C 4ZDWA 1Z29A 4OQNA 3WMFA 5J4KA 5LD2B 4DSOA 5DGXA 1DAKA 1QBKC 2GF9A 5HZKA 2XJ9A 3WXMA 1T3LA 4BZXA 4OQLA 2PZFA 4B48A 2IYWA 4IOMA 4KI0A 1P62B 4PO1A 3TLXA 1KI3A 2YHSA 1YVDA 5TMPA 3I3SR 4Q9LA 2YOFA 3AF2A 3FMFA 4IHQA 4LHVA 1S1MA 2V9PA 1W0JA 2C9OA 3VQTA 3BH0A 4Q4HB 1FMJA 4CGZA 5EZ6B 1Z6TA 2RGBA 2ZI3A 3OEHD 1IONA 5CB8A 1R5BA 5J4YA 2Q3FA 5EXSA 2I4IA 3AKCA 2GJSA 4NHOA 2JLWA 1HYQA 3GJ6A 1RPZA 1EXMA 2BJVA 1NMXA 1OFUX 1RVDA 2RGCA 4G01B 3T06B 1A7JA 1KSJA 1G7CA 1B0UA 1MT0A 2GZDA 4NCHA 5TVKA 3K9LA 4KCGA 1F2UA 2X2EA 1E0KA 3M1IA 2ZJ2A 1G5TA 3K0FB 3T1TA 3O8DA 4DRZA 1XBTA 1II9A 1U81A 2FZ4A 1HT2E 3U44A 4GL2A 1G16A 3ONWA 4WA7A 2OXCA 1Z0KA 3QPWA 1L7VC 2ZU6A 3Q5DA 1E6CA 2GCOA 4M4SA 4NP6A 2ANCA 3C41J 3CF0A 3OE7A 1XU4A 6Q21A 1G19A 1XMIA 3I8XA 3K09A 1X8KA 4JVSB 1YR9A 3KJHA 4FMDB 1N6OA 4O25A 1Z6AA 4BFSA 1KKLA 1LFDB 2QSYA 4D6PA 3U5ZB 1KAOA 1OJLA 3FFAA 2QMEA 3OFND 5DHFA 2GZHA 1KK1A 4QGFA 1MO3A 3QKSA 2IHYA 1ZIOA 1ZM7A 4M2LA 4NYMR 3TNFA 4EFMA 3TJZA 4BLTA 3JVUA 5L3VA 3MWKA 2V3CC 3PEVA 2AXPA 5FPKA 3W90A 3MCAA 1OFHA 3QENA 1N6RA 5EUQB 3QG1A 2PH1A 3NC1C 3QJYA 4XWOA 5GJBA 4XH9B 2JCSA 5H1YA 4DCUA 5AJZA 3N2EA 1NG9A 5F9HA 1U9IC 2W00A 3PUWA 5FPHA 4B32A 1TAGA 5FTMA 1N0UA 2UVQA 4RD6A 1IM2A 4PQFA 4LBWA 1U90A 3RRNA 2PX0A 4TT3A 4URYR 1MOZA 2OFOA 2CBZA 1N6HA 3FDIA 2GEVA 4TMZA 4LOAA 3W6OA 1CLUA 1E2GA 2PEZA 3D6TB 4C2TA 3I62A 1OV4A 2ZYUX 4ZKEA 2C03A 2PLFA 1TF2A 1RRPA 1T0HB 3U4QA 1N0WA 1TEVA 2AX4A 4LJAA 5EXPA 4POAA 3OESA 1MR3F 1J8MF 3SYNA 3K9HA 3D8BA 3OAAA 1KDOA 2RGDA 2IUUA 5DNYB 1IY0A 3S1AA 4ZO4A 4MDEA 4FINA 1R0WA 4TMTA 1GL6A 1S9HA 1GNRA 4NH0A 5CYPA 2ZR9A 3GQBA 3RDPA 1TF5A 1CS4C 4II7A 2H7VA 4JYBA 1W7AA 3ZLJA 1XTSA 3AB3A 2ZE7A 1IJEA 1FTSA 3QE0A 1EG7A 3QOFA 4QHYA 3CZPA 1DVRA 2BMJA 3I1FA 1IOZA 2Q0HA 2WJHA 121PA 1SVWA 3QKRA 4US2R 4QXAA 3UG6A 1EK0A 1V43A 4UXIA 2IYXA 2C98A 3ZVLA 4Z54A 3UK6A 1W4RA 5JJIA 3LXRA 1G9XA 1KIMA 4A9AA 2GXQA 4EJSA 1KMQA 3LDAA 1AS0A 1QRAA 1TF7A 5EUMA 3KQUA 1JBKA 3U7EB 3VR2A 4LHXA 4YMUA 2ONKA 3SEAA 4EPYA 4IOJA 2V8OA 1GRQA 4HZUA 1FX0B 3Q9LA 1IQPA 4OK5A 5J4VA 2OAP1 1JR6A 2BMEA 1ZU4A 1GL9B 1Q57A 4DBLC 2DWOA 3DO6A 3QSYA 2VHJA 5P21A 1G3UA 4LV8B 4A8JA 1R10A 5FUVA 3WNCA 1IY2A 1UF9A 1AN0A 1XNJA 2DYKA 4AYWA 5BN4A 4P31A 1UJ2A 3OEHA 1BMFD 1NIPA 2CLCX 1QHIA 4DLUA 4JLDA 1W49A 1E98A 3GP8A 3R9WA 3BK7A 3VX4A 2MSDB 3GLFB 1G6HA 2YOGA 1R0XA 3FKQA 3R20A 5FOWA 3BOSA 2VH5R 4P4UA 3CX8A 4HDCA 4LHZA 1EFUA 1UAAA 4DHEA 2G6BA 4EUNA 1W4CA 2FSHA 3A1SA 4AD8A 2LKCA 1OIWA 2OCAA 2OCYC 4B3GA 3ZYCA 1UADA 3O8RA 2RB4A 1AKYA 4F7WA 3GLHB 3SDZA 1UFQA 2ZRKA 5LDDC 3AP3A 3X1DA 4UNSA 3K9NA 1F3OA 1AS3A 2VP4A 4IFBA 3G0HA 1FL9A 2ZQ5A 4IDOA 1F2TB 1Z0JA 3NKVA 2ONJA 3EW9A 4ZKDA 4G5QA 3W6NA 2CVHA 2W2VA 2IXGA 5AUOB 3KKOA 3Q3JB 4Q21A 3BGWA 5FUYA 4DJTA 4MUAA 2ZRGA 1KKMA 5TV2A 2IS4A 5CDFA 1HT1E 3LY5A 5C4MA 4RVCA 1L4UA 3OFNA 3SJZA 2E87A 4QC2A 4TL8A 4D82A 4MQBA 1XTRA 1L8QA 1X1SA 1SXJC 1J70A 3L8ZA 4FI3C 5KNDA 3RWOA 4DIEA 4TLEA 4I1UA 2HV8A 1AJEA 1CR2A 2QUZA 2OSBA 3MWLA 4G0NA 4F4IA 3CIOA 3SHFA 1M8PA 3VKHA 4NYIQ 5CM8B 1N5LA 3LFUA 1COWD 1P3JA 4UXHA 3CRQA 3P20A 3GLGE 3CZQA 3QEJA 5SZJA 5C1BA 1ZCBA 4HDQB 4RD2A 1YHNA 3F0TA 4LJYA 3KTAA 1T5IA 4RFSA 3QF4B 1E0SA 1KSHA 3PUZA 4JYCA 3K70D 4OJQA 3K8YA 3DOEA 3IPXA 1XEXA 3K0CA 4WZAE 2XTZA 3CNLA 4LPKA 5CJPA 4HB4A 4BEJA 2ZXUA 1NJFA 3X1ZA 2PCLA 2HCJB 1EX7A 4KU4A 2W2TA 2GAAA 2ODBA 5EE3A 1UPTA 1KSFX 3UMRA 1X1RA 3RLFA 2DCUA 3FE2A 4OBEA 3RS2A 4TL9A 1HV8A 1WMSA 3PV0A 521PA 5GJVC 1Q44A 5JMTA 1YU9A 2FEMA 2MSCB 2P5SA 1KNXA 2GTPA 2W0SA 2GVDC 2WSMA 1US8A 2A3RA 2QPAA 4OHWA 1P9WA 4YLGA 1RYHA 2GXUA 1LW7A 4L15A 5JLJA 1OB2A 1XPUA 1UBEA 3L0IB 4JS0A 4HI0E 4D2IA 2VP5A 2WPDD 2OLJA 1KMHB 5EP4A 1N0VC 5KSZA 2QP9X 3SHWA 1NVXQ 5DI3B 4OQXA 1M7HA 4Q1CA 4GMDA 4LCBA 3EWAA 2A5YB 1JPJA 1RZ3A 4ZV4A 1KYIA 5DE3A 5BXQC 2ZM5A 3UMSA 1W44A 3D3QA 2NOAA 5FBRB 4UNQA 1HQYE 4Q9JA 5TY0A 3PITA 1XCMA 3TH5A 2IL1A 3MD0A 2JEOA 5H70A 4EKDA 3AM1A 1LF0A 1JEEA 1Z0AA 4PFSA 4DT1B 2ZR7A 3L0PA 1NN0A 4QNMA 4RD4A 3GEIA 3NIBA 2VHUA 2F1HA 3TMKA 3ZJYA 3UPUA 4G1UC 2BEKA 1A5TA 1HQCA 4PHGA 5CB6A 2Q3HA 2JATA 1JNYA 1WB9A 1W46A 1N6LA 3X1XA 1G8YA 3T35A 2R62A 4HLCA 3AF1A 3N70A 3WRXC 2C96A 2DPXA 4JZKA 2DHRA 1BMFA 1I4DD 4QBFA 1S1CA 1UBGA 2CCJA 4U5XA 4YC7A 4DLVA 2YC4C 2DB3A 2ZRNA 5FL7D 2OAQ1 1XD2A 4Q4JB 4KXFB 2FSIA 3P4XA 5LB4A 1EFRD 1KAGA 3GEHA 5CLLA 1XJQA 1Z28A 4EJSC 2P67A 1QHSA 2JIZA 1KJZA 3VU9B 2BC9A 1YQTA 1GKUB 3HR7A 1Q3TA 2JASA 1VTKA 3KB1A 2NG1A 3TQCA 2QRNA 3HYTA 1OFIA 2CEAA 3EZ2A 3HJNA 2ZS8A 5J47A 4TQAA 1KO1A 4BWYA 1T3SA 4TTPA 2QAGC 2HJVA 3MUFA 4TSFD 1QHGA 4A8JC 4D0LB 3QKTA 4PO8A 2CJWB 2QM8A 2ZSAA 1U8YA 4JBWA 2XTMA 3JZAA 4US0R 3B60A 3CPEA 3CWQA 3BRWD 4M9SA 3V4RA 1QHNA 3BWDD 1H8EA 1JB1A 2OBNA 3QBTA 4CEJA 2BKEA 3EIEA 3VKGA 3AVUA 3BC1A 1G1MA 1GKYA 3WHKA 5EQTA 2OBLA 2OLKA 1ZM9A 5AJYA 5BN3A 3GFOA 4P3YA 2DFTA 2GJ9A 4GT1A 1U94A 3IIKA 4C30A 2RHDA 1W36D 1IBRA 1GZSA 2AD5A 4LYJA 2WWGA 4C3ZA 1TQ2A 4YMWA 1PLKA 3H1TA 1KI2A 1KNQA 3KKNA 4OHZA 2F55A 2IK8A 4LUCA 1COWA 4HLUC 3EG5A 3SBDA 1ZNWA 4B2LA 1ZM3A 4S35A 2XXAA 2GWHA 4GZMA 1XP8A 2I1VB 4DEYA 1RIFA 5FL3A 3BE4A 1OH7A 3R7WB 3V9PA 5FBVB 4MGZR 4QJ4A 4Y0VA 4RD1A 5FBWB 1DO2A 1M7BA 2IEZA 3B9QA 3QXJA 2R6DA 4XVRA 1P6XA 5FTKA 4B2IA 1ZD9A 5M04A 2YINC 4GRAA 1RJ9B 1BYIA 2RH5A 3GJ7A 3TK1A 1P9NA 4BFUA 3NH9A 4ITRC 1W4BA 4Q01A 5HKKD 4IXNA 2IF0A 2V54A 4LJ9A 3ND8A 4DSNA 4XIGS 4C0HA 1TU4A 2VRWA 2NGRA 4TMVA 3QQ5A 3LXXA 2JLQA 2FDCA 3TGPA 2ZRIA 2FN4A 2VP6A 4KBFA 4MYTA 3ZIAA 2ZEJA 3LAWA 5C2JB 2P6NA 3GLFE 1ZINA 1UBCA 1M74A 4HAXA 2W6JD 3QIAA 4BLSA 2XNDA 2G9NA 1XEWY 5EE1A 1X8JA 3GLIA 3WBJA 3TAUA 4C0SA 2WWIA 1R4AA 4B6FA 3AKYA 4LI0A 4UXJA 1XCGB 3BERA 2VO1A 4TYWA 3P26A 1YR7A 3B78A 4GDFA 1YKSA 1XPRA 4TQUS 1CRPA 5EZ5A 4C0BA 1E9CA 2GDJA 1QHHB 1G291 1U0JA 3GLHE 4Z8XA 3THWA 4EPRA 3EARA 3RNLA 2FGJA 4MGKR 1MV5A 3AP2A 3BB3A 3DMDA 4KSBA 5KPJA 3UG7A 4URZR 2AK3A 2PMDA 3TR0A 4B74A 2O8FB 1SXJB 3A1TA 4OQMA 1MH1A 3QG5A 3QI2A 4N1AA 2BV3A 4OK3A 5EP3A 1NSTA 4HUTA 2NO0A 3TSZA 4EAQA 5AJXA 1IXSB 4ZIRB 3AVTA 3U44B 3TR5A 4MKHA 3U6KA 2O8DA 3Q7QA 2B6HA 4RJLA 1W47A 3IO3A 3CW2A 4DB4A 3CNOA 3TKLA 4B3DA 4ASUD 4JL5A 4AKGA 2WKPA 4B35A 1VHTA 3WHLA 2ZRFA 4PC7A 3MWJA 4MKIA 2PLRA 1ZIPA 4LYHA 2FF7A 2G1JA 4ILEA 1QF9A 1IN7A 1J8YF 2J7PD 4TLCA 4YMSA 2EFHB 3HU2A 1KO8A 4QRHA 3ZD6A 1EGAA 2BM0A 4HUQB 4K8OA 2GILA 1FFHA 2WSSA 4E07A 3C8UA 3AH8A 4MKGA 4XWKA 4LPSA 4OK6A 2FNAA 4FCWA 4F92B 1RRGA 4B44A 5IK2D 1K6MA 2IYZA 5E7MA 5GVRA 4RZ3A 1IAQA 4ESVA 1OH5A 3GFTA 2CE2X 2FOLA 5JSZB 2ZR0A 1WE2A 5DHAA 3DMNA 2LKDA 1QHYA 4TTQA 3SYLA 4QNRA 2QT0A 2JGNA 4KFSA 1Q21A 3I92A 2ZE8A 4B3BA 2OG2A 4IW3B 4ZCLA 4IDHA 2QMUA 4KSCA 3RHFA 2IXFA 2WV9A 4TSFA 4HAWA 4RKEA 2Z4SA 2EYQA 5JI3E 2P6RA 5TDHA 5FPSA 2R2AA 2X77A 2ZTSA 1SVIA 2ASEA 3WY9A 2QAJA 5BQ5A 2GCPA 4R2HA 2W58A 2R8RA 3A37A 1SQ5A 4Q7KA 1A2BA 4PXAA 4MYUA 1KOFA 4W5JA 3GD7A 3L82B 2IEYA 4EQ6B 4DIDA 2O8BA 1HUQA 1II0A 4CEHA 4BUJA 1Z47A 2C9CA 2QEQA 3I5XA 2RHMA 4OI0A 2NMVA 1X8LA 4KHZA 4XD7D 2A9KA 3TUZC 1JPNA 1Z83A 3D7MA 5B2ZA 3V4FA 1QDEA 2GA8A 3Q85A 3W8NA 3U61B 2QORA 3GCGA 4LC0A 4TYYA 4HB3A 4RZ2A 3L43A 3B13B 1Y63A 4FMCB 2P3SA 4IOLA 3T34A 2O8CA 3TSWA 4DKXA 1KI1A 3IO5A 2OV2A 1AK2A 4JKIA 2V1XA 3THYB 1Z6GA 2B7CA 4JSYA 4DCNA 4U7DA 4JKYA 4V0ME 1KI6B 1XEWX 5HE9A 2AL7A 2NPIA 2J0UB 2HYDA 4X8HA 1ZVQA 2VA8A 1CXZA 2A5JA 3LBNA 4PAMA 3W5IA 3ZZTA 1ZD8A 4R2IA 4ZI2A 3KQNA 2GZAA 4DDUA 4C7OA 2YV5A 4ERNA 1KK0A 5EXTA 3T15A 2BJWA 4AG6A 2DBYA 2ECKA 2HCBA 4FWIB 2Q9CA 2OHFA 4IKEA 4B75A 5HKKA 3SQXA 3JZMA 4HEJA 2JLRA 1VG1A 2Z5FA 4PHFA 3ZGXA 4A15A 2BMDA 3WNDA 4BASA 2ODEA 1VCMA 4P4SB 2O8EA 3TQFA 5D3MB 4LJ8A 1HTWA 3T5DA 2IA5A 3CM0A 3DDCA 1WA5A 4TQ9A 4BLPA 1E9SA 4LBVA 2PT5A 2D2FA 2QAGB 3REGA 1FW6A 3TUIC 4A8JB 1NVVQ 1UKZA 2WJIA 1JALA 2PJZA 3CRVA 2PT7A 1E2LA 1EFHA 1HEIA 1TQ6A 4KVGA 5FOVA 2J5XA 5LPNA 4F93B 4CYMA 2H5EA 4WZBE 1A4RA 1HY3A 2HF9A 2WMOB 3NEYA 5AUPB 4EPWA 2PBRA 2ZSEA 3TSOA 4Q1EA 3KKQA 4M1YA 1ZUHA 1OYYA 721PA 2QROA 4P0TA 4RFVA 5FUWA 1E0JA 1NMZA 3T12A 1G3RA 3KKPA 1GFIA 1HA3A 4GZLA 2D4HA 4JLBA 1S96A 1E2MA 2YYZA 2NPFA 4BLOA 3IBYA 4GP6A 5CJ2A 3EAQA 3WYAA 4PAOA 3TVTA 2VYFA 4LGMA 4CIDA 2IWHA 4FWTA 1MABA 4HZIA 2F43B 1E69A 4QJ3A 5KNBA 2UZIR 4ASUA 3WP1B 4DDWA 4MYCA 5CITA 4M8NE 2O0HA 4FCTA 2O0KA 1LNZA 2KJQA 4DB2A 4HLDA 5B57C 2D3WA 2J7PA 2QU8A 4D81A 4A2QA 2B8WA 2YWEA 3SC3A 1GILA 1ODFA 1YZQA 2IYTA 1CP2A 2EW1A 4H1UA 4O2LA 1T9HA 2CHVA 1JR3E 2J0VA 3RVBA 2VQSA 3LBHA 4D4JA 5L3QA 2BHRA 3EX7C 3U7FB 2XSZD 4GOJA 4KLNA 4Q1AA 4HAVA 4KFUA 3FFBA 3RABA 4A2PA 4EIWA 1KTVA 2FPMA 3KXLA 2YVUA 4GSYA 2SHKA 3AVOA 2JLYA 1D9ZA 3T1OA 1Q3HA 3CRW1 3IILA 4QHTA 2QA5A 4DLSA 4W5WA 3RWMB 1KO4A 1SVKA 1MO6A 2HYIC 4URXR 4XTRA 4QFMA 2Q6TA 3KTAB 2OXRA 1WXQA 4Q1FA 3HP1A 2QP3A 3MFYA 2KBEA 1FQJA 4OI1A 1AKEA 3MMPA 4JBXA 3QUSA 4MGIR 2G83A
chains in the Genus database with same CATH superfamily
3NOXA 2O7NA 5A02A 5JV5A 2PGNA 4TV9F 3CWZA 3EGVA 1W88B 3BORA 2EYUA 2HO4A 1EE1A 2FUCA 2VJAA 4RKFA 2PMWB 3QU4A 4URUR 5FA8A 3W4KA 2JFZA 4PFKA 3K30A 4P5EA 3OT1B 3SIRA 4DJEC 2P4EA 3O9MA 1Y8CA 3UPUA 2GAJA 1O6CA 1Z4PX 3JPYA 4IR7A 3WHIA 4U6NA 3FWPA 4QX6A 2IHNA 3IAUA 4ZT7A 3EN0A 3FNEA 1VGQA 1I9GA 1Z5WA 3FLBA 3NOQA 5EN4A 2ID9A 2GBLA 2CNWD 2LV8A 3VFDA 4CMEA 2ZB3A 3LK6A 1POXA 4IVPA 3K0SA 1EIWA 2AJBA 1ZRHA 2Z3WA 3KLBA 4N41A 2GK3A 2X19A 1QORA 1ZIYA 1D6JA 1P4SA 2H1WA 1Q0TA 3KL2A 1WQ1R 3GUYA 4X90A 4R3UC 3SX2A 1A4UA 1C4WA 1TJYA 3MT0A 4ZREA 4BRWA 1ETUA 2XR1A 4OHBA 2GWRA 4ARCA 1A2KC 3OE1A 3OOEA 3QVOA 3K1ZA 4BV8A 4LG1A 2QN7A 4MVJD 4Y2SA 1VA5A 1ZM4A 4WZAA 3FCOA 1NW6A 1RVV1 2H18A 3KOWA 3G1UA 2ZIGA 4DJAA 2Z3ZA 4EI9A 2WC1A 1CRQA 3L8HA 4V1CA 3CF4G 1X1BA 5HF8A 3GGJA 3MCWA 4MKFA 3CZMA 4OHXA 3GDOA 3EFEA 4QQRA 3GLRA 5G53C 4ZZ2A 4B33A 5JJ5A 2NZ2A 5IFKA 3ZLUA 1KPIA 5I7FA 5JIBA 3R23A 2QT9A 3EAFA 3L93A 3VPAA 1G4AE 2B83A 1OYVA 5DYIA 3IERA 5DWDA 3NBQA 1Z2CA 1EP2B 1I6KA 1U0RA 1R4MA 4QNNA 3UHAA 1A9TA 1UK8A 2YWDA 2JFOA 3L7BA 3HDQA 1PDOA 3F8TA 4R1SA 1JH9A 1UKEA 1ISHA 2IKQA 4QFBA 3NTUA 4FYPA 2SKCA 4LX0A 4IVNA 3HSYA 1XXHB 2CLLB 1TVKB 1JVNA 4FLMA 1M8KA 4W1RA 2C4UA 3CH5A 5DSXA 1LDNA 5J59A 3MAGA 1MAAA 2WTUA 1WVGA 3ER8A 5FTNA 2X40A 1L7AA 2PRIA 1FX1A 3COSA 5EJGA 1BH2A 1T3GA 3AR2A 1DOHA 4MVJH 3KOXA 4YP5A 4N3AA 1ZHFA 5HILA 1E8NA 2NV2B 1E3TA 1HOXA 1A69A 1SUCA 1P7PA 1TC1A 1G64A 4TS3A 3LLSA 4ZWNA 3BB1A 4C0KA 4MI6A 5FCDA 4DDVA 3HVJA 3EBLA 3KAJA 3W3ZB 1L4MA 2BE9A 5FH9A 1EVJA 3HXOA 3VHXA 3NEAA 4MLPA 3KPVA 1FNDA 1JQDA 4JCOA 1YBAA 3HXTA 1M0EA 3UJ6A 4D6XA 4DPMA 3PCRB 4EGJA 2WI8A 3RROA 5IT4A 1MPXA 4OQDA 2N42A 2A14A 5CD9A 3GB9A 4MW1A 5KWVA 5DU2A 1W52X 4RK1A 1KK2A 3AR4A 5DHSA 3EG9A 1NOKA 1NJGA 3AO0B 4HFRA 1PFVA 3AEQA 3C14C 2EFJA 4A0FA 1KAEA 4P4TA 4CTKA 1CCWA 3LLUA 4RZXA 2YZNA 3RUAA 2F1IA 2WM3A 3G5UA 3NW9A 3DFKA 1SUSA 2PT9A 3N2GB 3TLMA 4A0RA 4PZYA 4D9NA 1TZCA 4JHXA 5AKZA 1IPFA 2AIRA 3A1VA 5AW4A 5H0IA 1K0FA 1J8QA 4I4TA 1WX1A 1JV2B 1EHCA 3AIIA 3LBAA 2IBTA 1JWBB 3G1TA 3O8OA 4JI8B 1T4DA 1Z8FA 1TPYA 2ZSBA 4TMWA 2IKSA 4TTJA 1CQZA 4RUKA 2QVLA 1D0VA 1SU7A 1TPZA 5C8VA 3LT2A 1KRHA 1HE5A 1AIPA 1G7RA 1YZGA 5F2NA 4X1IB 1T2CA 2P3LA 4KC0A 3IJRA 1SU8A 1EHIA 2PMKA 1QYVA 4G5OA 4YONB 3JALA 1JHDA 1I3OA 5B37A 1HFEL 2D59A 2LCIA 2Q1SA 2QJRA 3QOXA 3SC2B 2QVYX 4Y1EA 4DA6A 3GEDA 2QTWB 2IHJA 3Q12A 3PUYA 3K0AB 4JIMA 1PR5A 1I4LD 1PL0A 2QMHA 4J7AA 5TPZA 4LDAA 3ZV6A 1JKJA 2EP5A 2ERYA 4AVYA 1G38A 1EDBA 1RKXA 1VCIA 1ZK0A 4MUMA 3VYRB 4G41A 4HB2A 1BGXT 2R1TA 5BORA 2CK3D 3DNFA 2D6FA 5JSUA 4I4LA 2JDIA 1W35A 1MIHA 3UH0A 4BMOB 4CI9A 3RF7A 3LYHA 4DY4A 4KR0A 1BA3A 3NHSA 4GX1A 3RS8A 3TTTA 2ZVQX 3QNMA 4PG8A 2ZWVA 2X2PA 3CKLA 1Q0HA 1QVAA 3WHPA 3FHJA 3V2GA 1VZ3A 1X87A 1II8A 1WMBA 3QPDA 4PPFA 2G71A 2JFXA 1UT5A 3ETJA 2IHZA 2ATVA 1L8LA 1OPXA 2IU4A 4A23A 3L7KA 5K3EA 4EGFA 1CYEA 4ITUA 1CUSA 1V11B 3N6VA 2H4XA 2R1VA 4AF6A 1W48A 3TQIA 1WZIA 5BSHA 1FA9A 1J5XA 2AMFA 1TU3A 4MR7B 4HTAA 4YYZA 2PNFA 2ZB2A 2C2XA 4AJ2A 3ZHSA 2ZYVX 1P0QA 3E8MA 3OVMA 1U3TA 4M9RA 4TVBA 2Y1DA 2ADOA 4L9SA 1H0RA 3P5SA 4NYMQ 4RIGA 5GPBA 2VLIA 3W2FA 4QEKA 4PZLA 2A9JA 3GVIA 3NCTA 3GZNA 3OHSX 5DTQA 1JHQA 1T24A 2VHVA 4LTDA 4AWBA 4G1BA 3OOHA 2F9FA 4M1MA 1AUVA 4IUCS 4LY6A 1FX0A 2H9IA 3TL6A 3UHPA 1R37A 2VUSA 2FWMX 3F47A 4PWYA 4GKVA 1K2VN 2MIIA 3KHKA 3R7SA 3NNSA 1A95A 1ICEA 4I36A 2VHXA 4PNEA 4G6ZA 5IJWA 1NF3A 3RS7A 5JLAA 3ONNA 1Z15A 1NLYA 1OJ7A 2PCJA 4K9SA 1G2OA 4NL4H 1N9ZA 1Y1KE 1LJUA 1JQKA 3DL7A 4GM4A 2DFPA 3BWYA 5L4SA 1W0KD 1PGOA 2J9YB 3H2YA 3PNLA 1J2UA 2TS1A 1VG0B 5EJ4A 1QE0A 4ZOLF 5HQTA 4TS9A 3DB1A 3USZA 3IP3A 3L5OA 2W90A 1NLZA 1V5EA 2BTOA 4GXNA 4M9CA 2O1SA 2Z08A 4QBTA 3QNWA 4EPVA 5ALMA 1TNDA 4FDUA 2Z6VA 1DPFA 3R3WA 5EIFA 1KDTA 3UT6A 3VNUA 3NT5A 3W9YA 3H6HA 4EA7A 2IPNA 4RLFA 3TL2A 4NPHA 2ORWA 3TLZA 2IS1A 4W1PA 1KJ9A 3DBOB 1WKCA 4FGZA 5SZHB 2XAUA 1V9SA 3LA8A 3PVZA 1QX4A 1T1SA 5F4BA 1JILA 4LY9A 5KO2A 5K8LA 1B0ZA 1X94A 2QS9A 1BW9B 3U1TA 5EGNA 1YASA 2AUTA 2RJOA 5BOSB 4JT8A 1WZCA 1WL8A 1OFGA 1E58A 1MA3A 2HLHA 4IYJA 4EB0A 2GKSA 4WESA 2C59A 4YJ3A 4MV9A 2V6GA 1P77A 2NZYA 2YVLA 4CLOB 5BW8A 5KKNB 2HWYA 5B4VA 5KTRA 3FTFA 5JJKA 4TN1A 5CDUA 4QYSA 2W8BB 1J2JA 4R8LA 3A9UA 1CR0A 4N18A 2AC4A 2GF0A 3HLKA 5CTJA 5FR2A 1CUDA 3E48A 4EEKA 4HSEA 1CB0A 2QW0X 2C8VA 3N0RA 2CL6X 2QSJA 4GWKA 4JT4A 4NICA 1IY8A 3DHVA 4WNAA 2LVBA 5AI6A 1VHWA 4DRYA 3AF0A 4M6WB 3N7AA 4JT9A 3G68A 2I7CA 2VEDA 2YIDA 3IVGA 4KIWA 5KYUA 4IIGA 2H57A 3NOOA 4C4ZA 1O9HA 3C16C 2G80A 4YUWA 3PQ5A 2VDWB 3UXHA 2JD2A 3G9ZA 1QPZA 5F98A 4WOPA 2Z58A 1JR3D 2OV8A 3BHMA 1KOLA 1OA1A 1C2YA 1P4AA 2NNWB 3LDUA 3N2IA 1P2TA 4IGAA 2NUPA 5CFZA 3ZBPA 3FTEA 3A2KA 1JAYA 1XZIA 2IIVA 2BM8A 3CNEA 3NOVA 4RTPA 1DKNA 3RC3A 4X41A 1L4FA 3G0GA 3W7VA 1YTLA 3KK0A 4Z2YA 4HNGA 1ADBA 1H5NA 2Q6IA 2OV4A 5EKXA 3N76A 4X8LA 5G0TA 3CX6A 3TTVA 3ESZA 1U8EA 4QPPA 5DK4A 2IX3A 3KB6A 1VI6A 1F3LA 1K2WA 4N0DA 1T36B 1RHRA 4H3SA 4PLGA 4X64B 4B3JA 1OH6A 4ABYA 1BNCA 5KVAA 4PN3A 2A86A 5CJJA 3D3JA 3EVFA 2HEIA 1WLSA 4V38A 2C4WA 2XYHA 4MVWA 3NTVA 1ORHA 2I7TA 5AHRA 3IKJA 1G98A 3K2IA 2PX3A 4C7OB 4LF9B 1J2TA 3TLBA 2ZJBA 2YYSA 1M6NA 4L8VA 3PLNA 4MSUA 1JEYA 2GN2A 3U5TA 4V0NA 1C8VB 2I9PA 1XWWA 3UFBA 1UQUA 1X7YB 3KKZA 2VPZA 2G40A 2I4TA 3UCEA 4A26A 1X86B 1WXWA 3AHHA 3P8ZA 4XSHA 5CA0B 3FSGD 3NMUF 5ADVA 2VUIB 3BXXA 2JKZA 3BMNB 4KO1S 1UOEA 1RXCA 1AZLA 2BMVA 4WKPA 1PI3A 4AZ3A 1PU2A 1I1OA 1Y6QA 2VT6A 3RS4A 1U6IA 2H3HA 1FMTA 5EZQA 4Z2AA 1U0HC 1KMHA 3LI2A 4ECEA 2YJNA 3GFGA 5A3SA 2P6PA 3BH7A 2CNLA 1CR4A 1OXTA 1Q1GA 2VSXA 4H27A 4L9WA 4PYIA 5IC5A 4YASA 3PNOA 3D0OA 3RK4A 3UJ3X 4EVSA 4F60A 5EEHA 1R5NA 3WLHA 4PZZA 8ABPA 3D1VA 5LNK6 5ILGA 2DQZA 1BDMA 2EKBA 2YL2A 3MQ4A 4U63A 2Q21A 4D4LA 2QYOA 1T0UA 1IMOA 1PR9A 1QZZA 2GERA 1NTRA 5K3BA 1C1YA 2AKYA 4FGJA 1X2EA 4WLVA 4PHCA 4E46A 2JI6A 3GN2A 4QXMA 1ACMA 4N82A 1DT3A 4MW0A 4PV7A 3IJEB 5KQMA 3DFZA 2Y99A 2QRPA 1BJKA 3F98A 4NV1A 1M2NA 3DHEA 3HWSA 4KLZA 4BFVA 3EQ7A 5AVUA 5JZMA 1YUNA 2OB2A 4HAZA 4NARA 8MHTA 1A1VA 1GU1A 1SFRA 4W1SA 4C7MA 1T5LA 1RYZA 5INTA 4QM6A 2VN8A 2Y0DA 5DN6D 1IBLB 1A4XA 5KAMA 4IF6A 3A6EA 2NO7A 2VBGA 1DDGA 2VF2A 4HGYA 3DCYA 4JLKA 3JQ9A 3VTKA 3OTGA 4CLRA 3TRHA 1JA9A 1PZEA 5PNTA 4JLPA 2C8JA 4I99A 2VP2A 3D2BA 2A5DA 3LX5A 4FR0A 2OM2A 4YP0A 1PR1A 2ZIZA 2CMDA 2I3GA 2IOHA 2QM7A 2DMRA 5HIMA 1GZUA 2XQGA 4RTKA 2XNSA 4D4HA 3GA5A 1P7WA 1W1WA 3NBXX 1VZ2A 4G85A 1C81A 2YJ4A 3FHCB 5EE9A 1NL3A 1L5HA 4GLBA 2ZJ5A 3HBAA 3JWGA 4Z4IA 1FUUA 1TA9A 4P83A 1RHQA 5FBLB 1G8KA 1KBZA 2ZJYA 2VUUA 5FPPA 2LDBA 4XQGA 4LJKA 3H65A 1N7JA 2PFKA 2X9VA 5IKOA 2A3NA 4GMXA 4KNVA 2B78A 1MC4A 2V03A 3AILA 3DTVD 2IBMA 3TBHA 1BDJA 3PNYA 4HGOA 3RRYA 3ZKWB 3O94A 1ZJ6A 2AEJA 4LQ4A 4YAIA 1A2OA 4QYXA 1P17A 4ZCTA 3DR5A 1MJHA 2RGUA 1YB2A 4JOCA 2DTDA 1JSXA 3REFA 1EFCA 4N76A 2R6R1 4F4JA 1FYWA 1PWYE 3DC2A 4N0PA 1TEHA 2ZWOA 1K8XB 4Z9XA 1KZHA 1WSAA 1ZXXA 1G7TA 1JW9B 2VDPB 3PHHA 2VDJA 3BF8A 5AHKA 5I8PA 2FZWA 5K8TA 4S2EA 1JU9A 1QIHA 1ZHOA 3U4QB 4C0QC 1DKPA 4GLJA 1GGEA 4GOMD 1X8XA 3PGVA 3A4IA 1IN4A 3L8EA 3EW7A 4MHOA 4OLHA 3SJCA 4FNGA 4FYMA 3KQKA 4MPRA 1H2ZA 2JFUA 4IDCA 3NPAA 1U2GA 1JJ7A 3UEOA 1FU7A 1KZ6A 4MWDA 3I30X 2RHJA 3ICQB 1HYGA 1ZH0A 2FMXA 4LWOA 3ESCA 1NFRA 3C3PA 4IDAA 2OA0A 5DTRA 5E7IA 5K03A 1OZHA 4RY9A 3TRIA 2PSDA 2ZUBA 3Q15C 1SULA 1ZMBA 5AQEA 1KC1A 4RYLA 3AFIA 3BL5A 4CU2A 4TWIA 1UJ6A 4LQCA 1OX5A 1A76A 3QUBA 4QJBA 4CCYB 3DQQA 5LQNA 1TUGA 4Q7LA 2E4AA 5A1JA 1V35A 3QKRB 5ICCA 2CMKA 2E7ZA 5F23A 1DIHA 3CNHA 3EEQA 4NBKA 3O4VA 2FFQA 1CHNA 2P4HX 2UXCB 1TL7C 3PJFA 3HN7A 1OLSA 1VI2A 3LBFA 4N7RA 1LF5A 1WBJB 3F1LA 4X7PA 3T1NA 4Z1OA 5ICGA 4Y0AA 5HRAA 5F3DA 4QM7A 3VTFA 3I9NA 1EGQA 1GO2A 4RJTA 4LFAB 2E3JA 4RSGA 2D7CA 2HSGA 3FF4A 3K9FC 5A04A 5HJEA 3R2JA 2QVCA 4HZUB 1RLMA 9LDTA 2WHEA 3OURA 4BZQA 1QVWA 2P7HA 1BYUA 3EIQA 1IYZA 3EFOB 1NVFA 1ULAA 2F1RA 4I55F 3ZUGA 4GPD1 1XDSA 4G65A 4RF3A 4CTJA 4IHAA 2DHCA 5I4IA 3PHCA 1KOGA 1XNRB 4IIJF 2DQYA 1OTHA 4JI0B 3FTPA 1PBNA 1XDZA 4YMVA 5DDIP 821PA 3PNVA 2X8LA 2PGAA 1O94C 3QVKA 3I1IA 3Q2IA 4YAUA 2IELA 3BK2A 5BN4B 1P73A 1T9GR 3P2IA 3WK8A 3EBOA 3SBOA 5A9SB 5FTWA 1P4GA 1GUAA 4MUHA 4Q7EA 1E96A 1HLGA 1R50A 2VAVA 3H1PA 4BLRA 2OZEA 1OIVA 1VSBA 4RAQA 3TZKA 1OFVA 1ULUA 1NUSA 1MGOA 3UAVA 3RHZA 2ZDHA 3QU2A 1JG7A 1UZNA 1P1BA 4UTXA 3PJDA 2BUBA 1BS1A 2DFLA 1T29A 2I4RA 3FKSD 3PK0A 4OKSA 4PO9A 6PFKA 1JL3A 3I09A 5HIIA 5IDVA 3VYTB 2V8BA 1SXJA 3LC2O 4DEVA 1LWNA 3IRUA 4N5LA 3RS0A 3PZRA 4QTUB 4BAUA 1LQ2A 4ZT4A 1KC3A 3SCZA 4DDHA 3EMVA 4KN9S 5FOXA 5BVGB 4KXUA 1SKYE 3CRMA 5ERYA 4F3TA 3RJ9A 1YS2X 2FX3A 3AIKA 4JB0A 3B70A 5JNLA 1GFWA 1ZY2A 2ETXA 4KIFA 4WEOA 4B79A 4G0VA 3K8QA 2KI5A 5HCNA 4L07A 4NDZA 3RHTA 4RK5A 2X6RA 3IBCA 4H6XA 2G08A 2NVBA 1UMBA 1XLWA 1RAIA 1N2ZA 3W7BA 4ACAA 4DBVO 4Z53A 1XD8A 3H11B 4LV5B 2ZVPX 4QIHA 5F4ZA 4QUBA 4I66A 2GVZC 5JXHA 4CIBA 2AR7A 3L1HA 3A3PA 5LR6A 2OEPA 3EQ2A 1ISSA 1XOIA 1XF9A 2J9XB 2JJQA 1YJXA 3AOEC 3FIUA 4I81A 4XASA 5EE5B 3ETCA 4ZANA 3WLTA 4UKDA 3D02A 3KFVA 4BV9A 5C80A 3IESA 4O29A 2V9ZA 1PWEA 2GS9A 2RDMA 4HDOB 1BQEA 3SS8A 1SZCA 2VF5X 1D2GA 1F2VA 1O95A 3OA2A 2VAXA 7ADHA 4HUQA 1P44A 3DE2X 3RC1A 2FFBA 3C70A 3N6RA 3UT0A 1P5RA 1RAFA 3VH3A 4GI2A 2B3TA 4JLMA 1WMDA 4BGUA 1M7GA 2VTBA 2GXAA 2AZXA 2C4HA 5LBTA 3IQZA 4GBJA 5EP2A 1REQA 2R2GA 4G63A 1X0XA 4E2FA 5K20A 2Q6VA 4FFWA 2VJBA 1BXGB 1MXHA 3H04A 5HR5A 5JSZA 1RLOA 1NLFA 2X9GA 5EIHA 5C37A 2B35A 3A58B 1AQYA 2WT8A 3H4MA 4AWXA 1TM5E 2Q4DA 4UBJA 4WH0A 3CX4A 5IJXA 2WHPA 2Q3EA 1X42A 4H15A 5AW7A 4YQFA 2FWPA 1JTFA 3ZW9A 3I6QA 3BXZA 3MUOA 4Q4LA 4E4TA 4OV6B 4D46A 4TYNA 1Z18A 1I3MA 3UA4A 1MAVA 2C99A 3H9EO 4IHJA 3I9KA 4MUGA 1O1YA 3ER9A 4YO7A 2ODPA 1R9MA 3FGNA 1GCIA 3S28A 2JLBA 4A2WA 3ZHTA 4C7BA 3P4UA 4Z4HA 5L51A 1CJVC 3A6HA 1DAMA 3M4YA 4XUDA 1Q1ZA 1X38A 2QN1A 1Y3DE 2NTYC 4AM8A 5CIQA 3SFTA 5EIXA 3BMXA 1PGJA 3ZD8A 3TLCA 5LIPA 1ZU5A 5J58A 2CVFA 3QELA 3LZ6A 4FONA 4O1HA 4DZZA 2AJCA 3U4GA 3UWOA 1VECA 1IQUA 3TNDA 8LDHA 4KNYA 4ZYXA 1Z07A 2XUHA 1IY1A 3G49A 3AR8A 3HRKA 10MHA 1YKFA 5KYNA 1U80A 1NUUA 3CNBA 3PFIA 1VL0A 5AESA 1NW7A 5A6VA 5B1EA 2XB2A 4MV4A 1PZMA 1U8AA 1R0CA 4TYMA 3N8GA 3VI3B 1NBAA 3FDZA 2OR3A 4HAYA 3N39C 3RFXA 3T94A 3A9TA 4MB0A 3T3EA 3WO0A 4UHFA 3KJZA 2W4MA 4AL4A 2BKXA 3LJKA 2VIIA 1ZH4A 7REQA 4U8HA 4XM1A 2FE4A 5KDDA 3I2FA 4MZDA 4ZVMA 4H18A 3I32A 2XE8A 3BFVA 4AB1A 1MJFA 3M6AA 4ISBA 3JARB 3O0DA 1E79D 5DYWA 5CCBA 3AI2A 2D5CA 3I73A 4LQLA 3W5VA 2B94A 1VSTA 1ACLA 4YXWA 3OX3A 1COZA 1M8FA 5FOTA 2D1TA 5AVTA 1XLTA 1HORA 4XEHA 3E7XA 3CXRA 1W36C 3QE9Y 3FF1A 5FO0A 1XRJA 4IXDA 2MR5A 5IT0A 4NMHA 4AK9A 3ZDDA 2IHBA 1Y9JA 4I9NA 1DAEA 4WXPA 3WMWA 1BKSB 3QX7A 4CF7A 3GA7A 1M75A 1NT2A 2VWGA 3BGIA 4BNKA 2O2IA 5EJ5A 4HAOA 5I7WA 2C9BA 4IOKA 5J1SB 2FJUA 3TW0A 1VIVA 5JAPA 2G9ZA 3L7AA 3A6ZA 3BRQA 5LC1A 1E7WA 1LVGA 3LXUX 3AETB 1I2DA 4Y1RA 3U4AA 4BNUA 1M34A 4QKQA 1ZKDA 2QAGA 5JE8A 3IB6A 3CTMA 4OM8A 5FI1B 2PYIA 4M0UA 4JXKA 3VZCA 2OGUA 2Q5HA 4M9QA 4EHLA 1S2OA 1C1XB 2JJ1D 1FSGA 3L3BA 4YRDA 1P45A 1NVWQ 3PCTA 1BXRA 4M1ZA 2B9EA 3QA3E 4O4HB 3ZWWA 4EKNB 2GTHA 3UKDA 4IP0A 5ELXA 1P61B 3UAOA 2I3DA 3VKWA 1QK3A 2XE4A 4LXYA 3SKXA 3ZQ6A 3S2SA 1OU4A 2ZZMA 2O4CA 3O93A 2VUHB 1E9DA 1KFCB 2FGKA 1SKMA 2HCRA 1FMLA 5D84A 3AHEA 1SOAA 1TJNA 3KALA 1Z2DA 5KWIA 1HNXB 3X1MA 2GSWA 1NUHA 2PLNA 4U02A 1KK3A 4IEFB 4YRKA 1NY6A 4GRDA 5MF6A 3RQSA 2FCRA 2IP1A 4O33A 3EOBI 3K9GA 1QKIA 4G89A 4HLUA 2QI9C 5G4KA 2F43A 2BH9A 1XWFA 2PWAA 3I4FA 5IM5A 2GAOA 2GJ4A 2J4FA 3B5JA 3ZR4B 4LBZA 4BNLA 1X3LA 1BQ4A 2O48X 2FWBA 3DUFA 4OGFA 2Z6QA 3DVAA 2JGDB 4CIYA 2RAUA 1YZLA 2Z98A 1LK5A 5DGCA 3A14A 1QGED 4PX5A 3UYLA 3H8SA 4NH4A 1UZMA 2COEA 2HXYA 3GHHA 3OZIA 4P80A 4ZOEA 4RTQA 5KVSA 2ZROA 5LQMA 4EI7A 2BMFA 3JQAA 4MZXA 4TS4A 4RGBA 3RRFA 3STTA 2WIFA 3PX3A 4PANA 3R44A 4XQ0A 1QHEA 4BMNA 2CXTA 4QQNA 4Y2UA 3G3EA 4AG3A 2HBZA 3THXB 2CB9A 4AY4A 5LL6P 4OSOA 2OD7A 1EWRA 1V1RA 1QH9A 2HF2A 3WKAA 5FXMA 4RYDA 1TQHA 1QDLB 3AZOA 3BXPA 2C7QA 1IPEA 1NIJA 1EWTA 3CKYA 2NXEA 1TYEB 5TX7A 2D1QA 5CA0F 3Q3HA 3IP7A 1YS6A 1GZ4A 3WYFA 5ALVA 2D00A 3SSAA 3HKEB 5TIIA 3NBMA 4UFOA 3NIFB 1YR8A 1MQ9A 1QOQB 1DFHA 1U1GA 4LJLA 4OP2A 3WIBA 1L7BA 2KB0A 2CNBA 2WZQA 4AECA 1OT3A 2XDYA 4UDOA 3JQ7A 4A4DA 5IAAA 2HHLA 2ZRCA 1DWUA 2I0FA 4QDTA 5KDLA 3IEVA 3PA8A 1Y9DA 4FOTA 2JFPA 3C48A 4HQLA 2ZWPA 4JB8A 1JU3A 1S6YA 3OKAA 1AV7A 4RA9B 5CNIA 1E7QA 4URVR 1QRUA 1DAIA 1YFZA 4AP6A 2XMPA 1YHZA 2CT8A 4EA9A 1N3IA 1HPLA 1UBHS 4NDAA 3AXSA 1D09A 1JJVA 2EF1A 3BS4A 3QLVC 1W76A 4EQZA 3LK7A 1C9MA 5I9TA 1L4YA 3HUUA 1RWXA 3FXAA 1BWRA 4CM7A 1QIKA 2BMWA 2SECE 4L16A 1NV9A 3C1TA 4Y2HA 4DRXB 5JS8A 1KFKB 2V96A 4OXIA 1PQ4A 1W2WB 1UBLS 2GUWA 4I3GA 4KGZA 3F6BX 1ST2A 3DPSA 5J43A 3ZJUA 3VDRA 2WMNB 1EX9A 1AKRA 1FVOA 1S8FA 5C81A 5EJEA 3VHLB 1T13A 1MX9A 1EKXA 2H06A 3HKDA 4MUFA 3D5TA 5DTMA 1MO2A 3T9DA 3B85A 2CNWA 4JU8A 2QGZA 5CB4A 1EXWA 1GA6A 3LPCA 1BOFA 1C8LA 1OD6A 3R8CA 4HNAA 1E1RA 1I8TA 3LGSA 2WTMA 4D80A 2XCQA 5L8VA 3RYTC 2B1QA 2VRCD 3G2MA 4AZ0B 3EMDA 3H17A 1L5WA 3IOBA 4G8BA 4E70A 5HGXA 4Z8YA 2X0RA 3L0OA 3UCFA 1FRFS 4PZCA 5EKTA 5EWMA 3LHKA 4RIIA 1GL7A 5JVDA 2D7JA 3OX2A 2E4ZA 4F11A 2BE7A 2B99A 5ER9A 4JI7B 4EUEA 1ELOA 4W99A 4EHFA 4RORA 5K09A 3VR1A 4H7JA 1BDBA 3SMVA 1PNRA 4P81A 2IHTA 1PNOA 1U0SY 3IT1A 4BX0A 4HNQA 1PS8A 1ENZA 5LYJF 4J3NA 1HX7A 1Y8AA 5JS7A 1V8FA 1F38A 3B1XA 3OTWA 4GL4A 3GXOA 1GKIA 2E18A 5FOUA 2P62A 1P6QA 4QULA 5C8ZA 2BKVA 3KQPA 4NZOA 5GY7A 1ZC3A 2FTKE 3DE5X 4AJIA 3ODGA 4CV2A 4WNYA 4MQEB 5DBFA 1M1YA 3WGMA 1KY2A 4CMEC 2GBLC 2REXB 4YV0A 1Z68A 1NJ8A 4OQQA 2HQOA 5D87A 2FWRA 5COQA 2CF6A 3V42A 4LOHA 2ZB4A 3KKMA 1CDOA 4H6PA 4HGPA 4C5AA 1DP4A 1A1SA 1K7SN 3FGPA 1E6LA 2PUWA 3OH8A 3B1YA 3ZY2A 2NWQA 2C8LA 2O52A 3EZFA 2LW7A 3B5EA 3S40A 1AK1A 1XK7A 4MRRA 3KNZA 1HFKA 4OB6A 3C3AA 1F7VA 2HF7A 2NSYA 1FZTA 3DEFA 2I9KA 4WECA 2QUJA 2WSSD 4G1VA 5LUBA 4N47A 3SBEA 2WOJA 2R25B 4K9KA 2CLSA 4MARA 5K3DA 5I7EA 1N3LA 1JA0A 2XA1A 3DDSA 4UNPA 5C7OO 5BQPA 3SVLA 2XRZA 1MJ5A 2X15A 4IGEA 4D3FA 2AXQA 2F1OA 5DM60 1K5DA 1WNTA 2CXQA 1I24A 3WB0A 4JYPA 1G0NA 4P7BA 1UKVY 4IG4A 2JHCA 3VJKA 3GLIB 4EW2A 5JW6A 1UBFA 2WMDA 3KYDA 3QJGA 2AYXA 3PXBA 3MT7A 2G28A 3CB2A 3DO8A 1ODLA 5DP1A 1S3IA 3VSBA 3OEEA 4KYUA 1EK2A 2PRKA 1NVVR 1XKXA 2XX3A 4OAQA 5DTJA 4ARSA 2ZOSA 5K99A 5KTSA 3L46A 4MQ4A 1R6UA 5EHZA 2ZJOA 4RPJA 5EE0A 3RO7A 3W5AA 1V4NA 2H16A 3LCVB 1ZOOA 3JQFA 2HNKA 3HXKA 3HH8A 1K7EB 1FFXB 3RK0A 3QU9A 3WAKA 4IXWA 3WLNA 3BAZA 1ECCA 1G20A 1HQKA 2COKA 3IAS1 3FLMA 5MGNA 2IY9A 1UEIA 5BYKA 1CX9B 2XODA 3M6MD 1E2KA 1N6PA 4DQXA 4ZQGA 1RWPA 2HLNA 3W34A 4D8VA 4D96A 1W36B 5DBHX 2WF7A 4L85A 1YJQA 3UV6A 1ZUD1 4UPVA 1M2HA 1TUBB 3C7KA 3T9EA 5JQWA 3ME5A 2JZCA 3BAFA 1NX9A 4V03A 2OE2A 2CF5A 5DNAA 2FW7A 3ESAA 3OHMA 1O87A 3BCSA 5AUNB 2ZIEA 4AUKA 1CZLA 1T1GA 3RQIA 2O2JA 1T91A 3INYA 3NXSA 4U9IS 3OP1A 1HETA 4PTZA 3TS1A 5GINE 1R5JA 2PZGA 3GFFA 2ZDQA 4JYAB 4P35A 4AJ1A 2VHQA 4NBSA 1PHRA 2OCIA 3GJ4A 1AHHA 2G3YA 2ZYTX 2XB6A 1Q0UA 1R6DA 3PBKA 1H1DA 3ROPA 4IEIA 4Y2JA 1FIUA 3TZLA 4J6EA 4V3CA 3JQ8A 3LRPA 3OIGA 2PBFA 2IJGX 2ZT7A 3RS9A 5A4JA 2ZXFA 3I01M 1NA5A 2ZI7A 1QWSA 4S1TA 1AKVA 3EQ9A 3KUDA 1VE5A 2R6CA 2ZS7A 1YQ9A 1E66A 2OV1A 1AMNA 2G0NA 4GH5A 2VT3A 1S3GA 4GOXA 1KVUA 1X7WB 1NLMA 3AJRA 2J6IA 2LZ0A 3ZZMA 2ZZNA 2QG4A 1U2DA 1JU4A 4M37A 5CPFA 2O2DA 2DKNA 4S0ZA 2HRCA 3B53X 5C8YA 3HNRA 4XIYA 3S29A 3G6WA 3H19A 4ZJZA 1CUFA 2JARA 4KN5A 1N33B 2Z9BA 1YBHA 2P0YA 4ZI3A 1RXYA 2ZRAA 1U9JA 1VBFA 1CBUA 2CW5A 3KLPX 3P9SA 4FT2A 4JQOA 3DMRA 3TNLA 3PSHA 4G86A 2QR3A 3H7AA 3E05A 4FFRA 2CL0X 4UQLA 1YV9A 3UATA 3LVQE 2ICAA 4INOA 3GNQA 5ALEA 3OMLA 1YK1A 2CFRA 2OL4A 2HQ1A 1AM4D 2Q9AA 4DLLA 5EJ6A 3HJGA 5GONB 1P8JA 2HB6A 1T8SA 4NJOA 5TQ0B 1U02A 4EG3A 3QE3A 3X3HA 2ZJZA 2C7GA 5E7QA 4ZRDA 1T8WA 1AKMA 1DADA 1DAFA 5LZ4A 5J2UA 5K0BA 1TOAA 1RRCA 4WZ6A 1ZR4A 1UM9A 1W29A 1YB1A 4J0EA 3DMFA 1K0UA 1VYVA 3VO2A 3SQOA 4GE3A 1EBBA 4B6EA 4CCWA 3NIWA 1IFXA 3ETGA 3GRVA 1LK7A 4RETA 4HQKA 4XOIA 1PZGA 2J31A 1G4UR 1D0IA 4G56A 4ARZB 4B76A 4EG8A 3Q4GA 4OU5A 2CHQA 1BJTA 1ZOIA 4NE7A 3RT7A 4EMTA 4YO8A 4BJHB 5JSYA 3DFMA 4QFCA 1DG3A 3T52A 5CRIA 5K8UA 2DWUA 1RPTA 1SR8A 4PS1A 1YBVA 2R4QA 3FPEA 2ACEA 2BD0A 4Q4JA 3ICEA 4MVCA 4YCMA 1X39A 4RK4A 1ZJ5A 3SQWA 1OBFO 2OHVA 2Y76A 3D8SA 3L0SA 4WZZA 5DX8A 3OE4A 3OIVA 4DCTA 3JD3A 4DVGA 2IZOA 1K3UB 2OGTA 4G26A 1X19A 4YJ2B 4H31A 3BWXA 1L1FA 5REQB 1CQPA 1G21E 1U3FA 3AG6A 5EEGA 3VKFA 3RU9A 4ZP1A 1H5QA 3BMCA 1VG8A 1TUIA 3KVOA 5KSOA 1W5FA 1PWZA 3TLYA 1X7GA 3IIIA 2OZKA 4D8WA 4RDCA 1KI8A 3FFTA 3U81A 1LV7A 1LA2A 5JZOA 2DETA 2BLNA 1BE6A 2P3OA 2XVZA 2DSTA 3E15A 5BWMA 1R00A 1Y80A 2D13A 2ZSFA 1I80A 4XVQA 4WXYB 1E5QA 5B3AA 3RJTA 1ZA1A 4MIOA 3R7FA 2Y0CA 2ETVA 3CINA 3O1IC 4K2AA 5FWNA 4GP7A 2VJOA 3UMFA 1QRDA 1UXGA 3CIFA 5EPEA 1NQTA 4BB0A 5B6PA 1JJIA 4DHWA 5JNUA 1WS6A 3P27A 1KXZA 2NVUA 4H3KB 1ISFA 3PX2A 1CY6A 1Y34E 1JLMA 1BFUA 4U2KA 4CKWB 4ENUA 2P1DA 2HW8A 2JF0A 4H6VA 4BVLA 2HXSA 5FF9A 4ER3A 1M83A 2JGMA 2ACKA 1H23A 3OLCX 3SEZA 4EH1A 3I76A 1HSZA 1E7RA 4PSCA 3ZEIA 3I83A 1GAQA 1OY1A 1ZRNA 1WXEA 2P40A 5KTYA 2OVFA 1XMVA 3TDNA 2EU8A 1C0LA 1SA0A 4BZPA 3W1VA 2EOAA 2XUJA 3KU4A 4NG5A 5AJHA 2FPOA 2R6FA 3SQNA 2GN9A 4GDFA 3U80A 2VKTA 4L0CA 5AVYA 5KYVA 1Q7EA 2HSJA 4TXHA 4KLRA 1D1TA 4QBIA 3GRCA 4MQUA 1JZTA 1GDDA 3JD0A 3OQHA 3OZXA 4GVXA 2QX4A 4Z3KA 4A1FA 1E59A 1FTQA 2H85A 1YQWA 2RHOA 3T5MA 4QASA 2XQIA 2E4VA 3OQIA 3S68A 1JECA 3KPWA 1ZNZA 4OHRA 4Q03A 1E94E 3MWDB 3VAYA 1WRBA 5AJWA 2IYFA 1U7ZA 2J9GA 3CBQA 4PPQA 4FYVA 3WYCA 3PLRA 4LIPD 8ATCA 1HE1C 1V1JA 2J4DA 2VOEA 3WGTA 2HLPA 1NQWA 1DAKA 5ULLA 2GF9A 3NVKI 2CL5A 3WXMA 4DTIA 2ZYIA 1E1NA 3BIWA 1L5VA 1IWPB 2PZFA 2EG9A 4J8PA 4IOMA 4LMPA 5ALWA 3RVNA 2O7QA 4J2HA 4B48A 1UFVA 3IAAA 3TLXA 4WJLA 4V1CB 4TVKA 2YHSA 2NN3C 4GQBA 6ABPA 1YVDA 4FFPA 2YOFA 1J0DA 1SOWA 3AF2A 3CCBA 3MELA 4WK4B 1LWOA 1GZ6A 3FMFA 4HZGA 4LHVA 1IJBA 5CFMA 1WD7A 1Y5NA 3FSGA 1ZCJA 3M4JA 3HJRA 3OEHD 1R5BA 4NQRA 5J4YA 2HL6A 1R4MB 2ZK7A 3WGIA