4JT2A

Structure of clostridium thermocellum polynucleotide kinase bound to ctp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jt2A00
2ZE7A 2DFTA 1HE8B 1M1YE 1XFAA 5AJXA 3CB4A 5FOWA 4BGDA 1EWQA 2RB4A 1E2KA 4Q7LA 4B3BA 1R0WA 1LNZA 4EPYA 3CZPA 2Q9BA 4L9SA 4QJ4A 2R6FA 5GJWC 4OI0A 2QT0A 3FHTA 5D3MB 1A2KC 1ZCAA 4F91B 4TMWA 3THXA 1RVDA 4F4JA 4M0LA 1G3RA 2VEDA 2VP4A 2WBLC 2XB2A 2BEKA 1U0LA 3LBNA 4HB3A 1FOEB 3PR1A 3HJNA 2IYWA 2FF7A 1AKEA 4B3CA 3CF2A 5J4HA 2C78A 1CJVC 4LJYA 3TR5A 2W2XA 3HR8A 1DG3A 5HTKA 2VP6A 1E2QA 3A58B 3CX7A 1G8YA 3SN6A 1ZIOA 1ZUNB 1AQUA 1SVKA 4QJ3A 3GLHA 4P4SA 1ZUHA 2ZE6A 3NHAA 4N0EA 1CLUA 1OW3B 2QNRA 1XTJA 3TMKA 1JNYA 2O8CB 1SVIA 4GRAA 2YWGA 1R8QA 2WKQA 4KFSA 2GEVA 4LRWA 4YMTA 1UAAA 3HYRA 2Q0HA 1P75A 4EPWA 1JBKA 5L3QA 2HJGA 2GJSA 2GETA 4LPKA 3G0HA 2GF0A 3T5GA 4TSFD 4KYUA 4P4UA 3IQWA 3UXMA 2CL6X 5H1YA 2ZS9A 1WBDA 3MD0A 2D4HA 3LX8A 3AV0B 5TXGA 2WWYA 1WRBA 4LC0A 2DR3A 1P5ZB 3IQXA 1XEFA 4XWAA 3ZGXA 4AC9A 3GJ3A 1E79A 4CW7A 3I92A 4NHOA 3B78A 4A36A 1BO6A 1HQCA 2XJ9A 3LDAA 4L9WA 5AR1A 5JRJA 1E94E 2G9NA 3GFPA 3AQ4A 1JPJA 2G88A 2EQBA 2PBRA 3CX6A 3GEEA 1OIWA 1K5DA 1HTWA 2ZRGA 4EPRA 1DE0A 3LXXA 1UM8A 2BKUA 4B48A 1CIPA 5KSOA 3EC1A 4X8LA 5BYKA 2JEOA 4GZLA 3K0FB 1OB2A 2ZUDA 4Q66C 1S0UA 3FWYA 2UZ3A 2QA5A 4DLRA 5JCZA 2J7KA 3CRMA 1KIMA 3QXHA 721PA 1DTSA 2ZJ8A 4BFWA 1KOFA 3EPLA 4XJXA 1KI4A 4PZZA 5DIFA 1IM2A 1X86B 1Z07A 3QEJA 2RHMA 4CGZA 5JEDA 3BIFA 3B1WA 4QFMA 1OIVA 1EGAA 1YZNA 1IHUA 2AD5A 2H92A 2D7DA 5FI0B 4YDHB 1SULA 4Q9LA 4IOMA 3B1ZA 3WP0A 2O8EB 5FL7D 5FPHA 4B34A 2D2FA 2O8DB 4Q47A 1GNQA 1NVVQ 1C9KA 3FTQA 4PPQA 2A5GA 3LLMA 4M9SA 2WICA 4A9AA 1G19A 5IHPA 1R0YA 1G5TA 1KHTA 1F2UB 1RE0A 4P0TA 4ZDKA 1VIAA 1Z22A 4JJZA 2CLCX 5CJPA 2OCBA 2IK8A 1IN7A 2MMGA 4I81A 4QGFA 3KXLA 1E98A 2E87A 5C4MA 1AS0A 2ZJBA 2CCGA 3CRVA 3DZ8A 1L8QA 4URWR 1GRNA 1B0UA 4DCSA 3RS5A 1T9HA 5ELXA 2BVNA 4A4DA 3H2YA 1NLZA 2ZSAA 3KTAB 4QBIA 2FE4A 1G8PA 4DLTA 3F0TA 3QBTA 1QVRA 4F4CA 2MSDB 1ZYUA 4BLSA 4KODA 4LSGA 1VECA 3LV8A 3P27A 3F8TA 5EQTA 2YWHA 3SFZA 3AVQA 4LJ5A 4X8HA 1E2EA 5LB2A 1XWIA 4LBWA 3UMRA 1RRGA 4JIMA 4KV9A 4JT4A 2R9VA 2OEPA 4DB2A 4GOXA 2DBYA 4L8GA 1TNDA 1RYHA 1UPTA 4LOAA 2WWGA 3THXB 1P9RA 3X1DA 5G3ZA 4GMDA 1WCV1 1NN0A 1Z08A 2ZXUA 4D25A 2PEYA 3LX5A 4KBFA 4ZPXA 2JLWA 3RWOA 1HYQA 3EASA 3AP3A 2WMOB 1FUKA 4Q4HA 3C14C 421PA 2JLRA 4JLAA 3QKUA 2KBEA 1E9FA 2CXXA 1DO2A 1NIPA 4BLPA 2C98A 3GLHB 4P4SB 1T3LA 5EUQB 3D8BA 1EFCA 2BJVA 5B57C 5KDLA 1KI9A 2D06A 3O8RA 2C5LA 2ZRFA 4PO9A 3GJ4A 5EP3A 2IS4A 4D0LB 4Q1EA 1WF3A 1JR3A 3Q85A 2CHQA 3KQUA 4MKIA 3OIUA 5L3QB 3I3SR 1CJTC 2PMDA 2WWXA 3ETLA 1W36C 3GCGA 3QF4B 5AJYA 2F1RA 2FNAA 2F3TA 1EFRA 3CLVA 3JZAA 4TQUS 1NMXA 2V55B 1CBUA 2CE2X 3VX4A 4CEHA 1G7RA 2ZSBA 1P4SA 4TTRA 1OT3A 1KSHA 3QKRA 3TAHA 4PO8A 3TGPA 2C2HA 1Z2AA 1NLYA 1XTRA 3V4RA 1XB2A 2O8FA 3TLXA 3AB3A 2D2EA 1FTSA 3GLFA 4FMBB 1MO6A 5FBLB 4W9MC 4K46A 2AXNA 1TF5A 2IF0A 1D5CA 5JEEA 2KJQA 2B21A 3OEEA 4PSKA 1DAHA 1L4YA 1Z0IA 1JB1A 3M4YA 3PENA 4Q7KA 4XTRA 3ND9A 4PQRA 3TH5A 2JJ1D 3A37A 4ABYA 3NVAA 1C4OA 4H1UA 4BASA 4BFXA 2ATXA 4XVQA 1D8TA 4EPVA 3E2IA 3OE7A 2X77A 4ZCIA 2OLKA 1P9NA 1U2RA 3FGNA 5IRCD 2YKGA 4NYJR 5K8TA 4OQFA 1YZGA 3TUIC 1GM5A 1EFUA 3FKQA 3KXKA 2PH1A 3IHLA 1ESMA 3QQ5A 1N5IA 3WRYC 2HLDA 1MKYA 2ANBA 5FPYA 5K8IA 4ASUA 2IS1A 4DLVA 1DAKA 1VCIA 2IYLD 2QI9C 2AK2A 3P20A 4RCYA 5JSZA 4G01B 4FMDF 4C4PA 2BBSA 1Q12A 2RHDA 4PC3A 2QPAA 4Q21A 2Q6TA 3A4LA 5HE9A 4B2LA 1E9RA 1XTSA 4O2LA 1G8FA 2WJYA 4JLOA 3TKLA 5JLJA 2P67A 5AWFC 4RD2A 2IEYA 1MRNA 4OK5A 2QMUA 4BZQA 3ZS8A 2FPLA 3T35A 1MRSA 2I1QA 3BRWD 1N6PA 4UNPA 3ZVRA 4V03A 2JASA 1P72A 3GJ6A 4B33A 1W1WA 1NG9A 1JR3E 2GAAA 3KJGA 2XZPA 4Q00A 2WM9B 3O8BA 3KUCA 1Z8FA 3N2IA 2VF8A 2MSCB 3WBKA 1AKYA 1CR2A 1RJ9A 1T6NA 3FMFA 2WVJA 3I73A 3LQRA 4MQBA 4HDQB 3U3MA 1E4VA 1P9WA 2BWJA 3ZIAA 1KK0A 2CK3D 2ATVA 3MWLA 4BFVA 1U9IC 4LBZA 4PSVA 4DLYA 4F7WA 1EESA 1ODFA 4M1OA 1JR3D 1KMQA 3A1SA 1KSGA 4XWOA 2QTFA 3C16C 1M6NA 1TQ4A 2QZ4A 5CIWA 2O0HA 4P31A 2GZDA 1UBCA 3BFKA 2EYUA 4URZR 2ZS8A 3C41J 3KXIA 1RRPA 5HZKA 4NONA 2C9CA 3Q5DA 4JVMA 3OESA 1EFRD 1I4DD 1NBMA 3TK1A 5DI3A 5HCNA 2TMKA 3CH4B 1G17A 2CEAA 3FFBA 3I1FA 3NBXX 4J0QA 3GLFE 1VYVA 5KSPA 5TY0A 4Q4HB 3ZZ0A 4B6EA 2GVDC 2IL1A 1FW6A 1E9BA 2BV3A 2VSFA 1II0A 2ASEA 3FMOB 3CO5A 3SJBA 1VYTA 2V54A 3B5JA 2V8OA 2QP9X 1J8MF 2HXSA 2P5SA 1LF0A 3AGPA 1GRQA 1U9IA 2IUSA 3X1WA 2AD1A 1RKBA 2QE7A 4JLPA 5H70A 1P60A 2AR7A 3BJIC 4B3GA 4E5UA 5JI3E 2RGNA 3EA0A 3VQTA 3MJHA 2QN6A 2QY9A 1U0HC 2CJWB 2ZJYA 2FSHA 3UIEA 4TTQA 1XEXA 3QENA 2BBWA 3SQWA 3IILA 1MH1A 2Z5FA 4LYHA 1KJWA 4MDFA 2VLIA 2BMFA 2BCJQ 2FEOA 1OV4A 4CEHB 2J0QA 2ZU6A 1VCMA 3QXXA 5B64A 1W44A 2XSZA 1LTQA 3AF1A 4UXIA 4KLNA 3KQLA 2WIAA 3IIMA 3NHBA 3HP1A 1Y3AA 2KBFA 2O8FB 2RGEA 2QTHA 4PPGA 2HLDD 2GILA 4A0GA 3KKNA 1X6VA 4PC7A 1WMSA 4ASUD 2FFBA 4G5RA 2Q3HA 3AP2A 2F1IA 4TMVA 1DPFA 4DCTA 1E96A 3SOPA 3WHLA 4MRRA 3KL4A 1NP6A 4EKDA 3UPUA 4C30A 3MRSA 4G5QA 1W36B 3GLIA 3AF3A 4WXRA 4EFLA 2OT3B 5L3VA 2J0SA 4Q02A 3NEJA 3W3AA 4TWZA 3ZH9B 1TU3A 2FSFA 2P0EA 4A6XA 3H0KA 3U3OA 4PC6A 1G16A 1JEEA 4WVFA 3KKQA 3QKTA 5FOUA 2FFHA 5HKKA 2V7QD 1G8HA 2ZR9A 1R0XA 1E2PA 4IDOA 2A2ZA 4DDWA 1QG4A 5CIQA 2J87A 4KSCA 2QM8A 4LYAA 1HQYE 1G4UR 5D3QA 1IY1A 3QG5A 4A82A 3VR2A 521PA 2GDJA 1ZP6A 2Q9CA 1Z29A 2W0MA 3M6AA 5CLQA 5JSZB 2DHRA 2QSZA 2ERXA 1NBME 2PMKA 2J0UA 1ZUIA 3ZZTA 3EA5A 4G3XA 3SNHA 1GAJA 2OBNA 4LCBA 3AF4A 1P2SA 4NTZA 1PUIA 2JLQA 2IYTA 5KSZA 4Y0AA 4C0LA 2ZYTX 1GKYA 4FMCB 3N70A 2ZR0A 1YR8A 1XD8A 2C04A 2OBLA 4BZPA 4ZI3A 1NBMD 4XD7A 3THYA 3BH0A 3ZVLA 2QMEA 4Q5IA 5P21A 1UF9A 3QEOA 3TR0A 3ZJYA 2NO1A 1LV7A 2BBTA 2JJ8A 1FFHA 3CNOA 5JJKA 1Q44A 3EIEA 3FVQA 1ZW6A 4MKHA 1YZUA 1SHKA 3SHFA 1S3GA 2GZAA 1V5WA 1N6RA 2QE7D 4E03A 1RJ9B 3LH5A 2ZI9A 3WYAA 4OQNA 4UNSA 3WMEA 3AVTA 2RKOA 4N1AA 5ANRB 2DCUA 4D0GA 2PLFA 1JAIA 3BOSA 4P32A 2ODBA 2J7PD 3D7MA 4V0ME 3AKYA 4I4LA 4F38A 1KNQA 5C18A 4F93B 1W47A 1J2JA 1VG0B 5JFGA 4HYYA 4QHTA 5DH9A 2CDNA 3W5IA 5E7MA 5IK2D 3SJAA 1G3QA 3W6OA 3BGWA 5C2JB 2ZRCA 5EJEA 1ZM3A 2BC9A 2DWQA 5DI3B 4CIDA 3HYTA 3BWDD 1XZPA 1J7KA 4JVSB 2BMEA 4CF7A 1HT2E 4HLQB 4DUGA 3SYKA 4FMCF 4QGHA 3GLIE 3TBKA 4ZDIA 1UKYA 2F1HA 4AG6A 1XD2B 2I4IA 1NNEA 2J41A 1KJYA 1E0AA 5GADl 4ILEA 4BE7B 3HPQA 3T15A 5DNYB 4M4SA 3PUXA 2VTKA 1AN0A 2PJZA 5FPKA 1TMKA 4OL0A 3KFXA 1G64A 4RZUA 4O25A 5EXPA 1WXQA 5JCPA 5E7JA 5JJIA 4U5XA 4DB4A 2C77A 2QPTA 5DGXA 1A2BA 5TMPA 1D9ZA 3CIOA 5EZ6B 4IOKA 4BLTA 2ZETA 5TVKA 1FQKA 3QXCA 5FBQB 2CMKA 2N46A 3K53A 2IF2A 2PX3A 3GLGE 1N3BA 3BB3A 5J40A 1OXTA 1MO3A 4GOJA 3AGQA 3S1AA 4BQSA 2IHBA 1DAEA 4RSGA 1IN8A 5F9HA 3Q9LA 1L2TA 5A0FA 2A7QA 4FI3C 1JI0A 1EXMA 3CWQA 2OXCA 2REBA 2W2VA 3G5UA 3W3ZB 5AUPB 1DAMA 3QUSA 3T06B 3IPXA 1K6MA 4Z8XA 1F6BA 4AWXA 4PPNA 1KYIA 1OXUA 4OHWA 2ZYUX 1E2FA 1C1YA 2DWOA 2REXB 2WPDA 2XJ4A 2XEXA 4DCUA 1YRBA 1IXZA 4XSGA 3WNDA 3GLFB 3GLIB 4UQOA 2V1UA 2G83A 2RGXA 1PZNA 3A1TA 3HR7A 4M8NE 4LYFA 1ZM2A 3LW8A 3K0CA 5FR1A 3SI7A 1E9SA 2DFKB 2JLXA 2PZEA 4LJ6A 1L7VC 2A3RA 4MYHA 3JZMA 4M9ZA 1KZ7B 3TSZA 3ZQJA 1KO7A 3ICQB 2QBYA 1GIAA 4IDNA 4DJTA 4ZDWA 3J81k 2N42A 4L16A 4Q19A 1LVGA 4PXAA 3VMFA 1PJRA 1VMAA 3DZDA 4IDQA 4KCGA 3RS3A 5F98A 1ZAKA 3KQKA 1XXHA 2C9YA 1NJFA 3GJ5A 3EX7C 2NIPA 3MMPA 1ZINA 2QP3A 1YQTA 4X8OA 2PZFA 2ZVPX 2VSOA 3K9GA 1US8A 4PR0A 1FQJA 1UEJA 5FBRB 3W6PA 5DHAA 2J0UB 3OFNA 1E1QD 2IUUA 1IJEA 1H8EA 4D4MA 4OK6A 4EFNA 2ZAOA 2ZYVX 4AD8A 3H1TA 1EX6A 1G3MA 3R7WA 1NKSA 4GMXA 2HXYA 4WZBE 4RD3A 4ZKDA 4OHYA 1YHNA 3Q5EA 1FP6A 2ODNA 3THYB 4G0NA 4C2UA 3CPHA 4LV6A 1U98A 3BAFA 4MH0R 3VU9B 3QVVA 2QUZA 2WAYA 4DUGD 4B74A 2X1VA 3AH8A 4JMPA 1KSFX 2OUKA 1DADA 4MKGA 2Q9AA 4Q1AA 4TMKA 1G5RA 2CHVA 4DLXA 1M8PA 5L8VA 2WSSD 5EXSA 3RC8A 4ZO4A 2VHQA 1UFQA 3PXGA 3U5ZB 1CULC 2HF8A 4IJMA 1KAGA 2D7CA 1AZTA 3TW8B 1MO4A 2ORIA 3QE0A 4B2PA 2OFOA 4Z1MD 5TB5A 3UG6A 5C46F 1VTKA 4G5GA 4ON9A 5FTNA 1ZM9A 1XPOA 1GITA 2CVFA 4TLEA 5CLLA 5B2ZA 1RYFA 2Q3MA 1T8TA 5KPJA 2G3YA 3EC2A 4LBYA 1W0KA 4NYIQ 1CR0A 2O8BA 1GVNB 2ZSEA 5GJBA 1TF7A 3CPJB 1AGRA 3O8DA 5AJVB 1SKQA 3PFIA 5KDOA 2JIZA 1NL3A 3T1QA 3RS7A 5B30A 1UBEA 5BWMA 2IYUA 1N6OA 2GK7A 3VR6A 4EFMA 1P6XA 1HUQA 4HAZA 4JLNA 1ANKA 5CM8B 2PX0A 3QPWA 4LDJA 1GG2A 2QMOA 3BFVA 4JT2A 2E9SA 1DARA 3ZS9A 1XMVA 1H65A 4RFVA 3IPYA 2ERYA 4RKEA 4RD1A 2XZOA 3QF4A 4C0JA 1S1MA 1H8HA 3FYHA 3LW7A 1P2TA 3H84A 3LVRE 5LDDC 3EWAA 4I99A 4EQ6A 5LPNA 4HB4A 2I1VB 2ZYWX 1LY1A 3LLUA 3SYLA 4DVGA 1T5LA 1IQPA 3REFA 2JCSA 1M34E 3CKLA 3S1AB 2NO9A 1X8JA 2ZVQX 1FMJA 1G21E 3CPEA 3CZQA 1VCNA 6Q21A 1DAIA 4OJKA 4B3XA 1ZM4A 1U8YA 3IDQA 4LK2A 2VBCA 1E9CA 4YC7A 3DOEA 3CNLA 1I2MA 4IOLA 3THWA 3PUZA 4L15A 3KJHA 1FNNA 1Q22A 3FMPB 4G5SA 1QBKC 1LW7A 3NDPA 1H8ED 4DIEA 4GBMA 2BM1A 3L0SA 4D82A 1K8RA 2XITA 3E70C 4K81B 2LWIA 4WZ6A 1IXSB 1KTVA 1Q3HA 2VO1A 5JHGB 5HE8A 3B6EA 3HWSA 3P26A 4JYBA 1ZBDA 2ZRBA 4LV5B 4BECA 2QBYB 3IGFA 4ACAA 4FCWA 3GMTA 4TQAA 2FSGA 1OLOA 1CR1A 5J5CA 4DZZA 3AVWA 4RY2A 5KOYA 3P32A 1Q1EA 4KVGA 4WZAE 1YRAA 1XXHB 4A2WA 3X1XA 1CP2A 1KI3A 2WKPA 4NKRA 1HURA 4BRUA 3QVUA 5CB8A 1ZNWA 1XCPA 4V0LA 3RABA 2WJHA 1US8B 1ZU4A 4Q4JA 1WQ1R 1VIYA 5DHFA 4H9GA 4FN5A 2QQEA 3LBHA 1ZVQA 4DLWA 8OHMA 5L3SA 2WOOA 1MABA 1GUAA 4M21A 3I4LA 3GLHE 1EK0A 2EVWX 3R7WB 2A5DA 1Z0JA 2HT1A 2FFQA 4OHVA 3DKPA 1XJ0A 1N6LA 4QKQA 4PANA 2R6AA 1M7BA 1UKEA 2EFHB 1KI1A 2XTNA 3LBIA 3CF6R 1XMSA 1J8YF 4I1VA 1U0JA 3RC3A 3B2EA 3BH7A 2JIZD 4NYIR 5CK4A 5TV2A 3SQXA 2VHUA 3I5YA 1OB5A 4UJ5A 1N5JA 4M1WA 1G9XA 5H8WA 3UWKA 1Z0DA 2FGJA 2XB4A 4Y0VA 3ADDA 5FTKA 1OIXA 1CTQA 3MAAC 4LJAA 1W4BA 4N3NA 2WJGA 4TYQA 4RD4A 4BFSA 4TYWA 3T34A 5SZJA 4A0HA 4OI2A 1PVOA 5E7IA 3Q7QA 4GT1A 3KQHA 4WIAA 3U7HB 3T1TA 5K8UA 5J4VA 1GP2A 1WA5A 1E79D 1Z06A 4BUJA 2H5EA 1TPZA 2O8BB 3MFYA 4MYUA 5BXQC 1HT1E 3NIBA 4UNNA 4UXHA 2J45A 1S96A 3BERA 4A92A 4HDOB 3UMSA 3IUYA 3PVSA 3VHLB 1NMZA 2FDCA 1UADA 2YYZA 4O2RA 3PIRA 1IONA 3ZD6A 1XF9A 2WHXA 2DWPA 1YVDA 1GKIA 2N1BA 3AF2A 2NO0A 3K70B 2CJWA 2IX3A 4YDSA 1E69A 1G1MA 2WWHA 2C9OA 3DPUA 3TAUA 1QF9A 1X1RA 4DLSA 5CB6A 4OQMA 1BIFA 2OXRA 4DXAA 5KU1A 2KI5A 4EQ6B 4GZMA 1BMFA 5JBQA 1NJGA 1M7GA 3QOFA 1XMJA 4KI0A 2L0XA 1O87A 4HUQA 1AS2A 2EW1A 1E2NA 2VHJA 2DYKA 4FMDB 1G8GA 4M22A 4DWJA 3OF5A 3K0SA 4BFTA 3R20A 2Y8EA 3P4YA 3EZ7A 1AA9A 5J47A 4R71A 4UXJA 3TRFA 1KK2A 2VF7A 4QOSA 1NI3A 2RGBA 3KQNA 3IEUA 1S4QA 1ZNXA 2JJ2A 3THWB 1EWRA 1AM4D 1M74A 1QHIA 1O3YA 3NDBB 2BCGY 2ZRPA 1KI6A 3AVUA 1KSJA 2H8KA 1XJQA 3RRMA 2F7SA 2VRWA 1NVVR 1DVRA 4NMMA 4B32A 4BEBA 1FZQA 4NCJA 2CBZA 3GFOA 1KI2A 4EIWA 1RRCA 2VSXA 4V0KA 2AXPA 1NKTA 3RS4A 3SJCA 2UZIR 2VYFA 2F3RA 4PAOA 3TVTA 1JXMA 5F3WB 4FCTA 3ZYCA 4U02A 4MYTA 3L2OB 4GDFA 4Q7MB 4B73A 1RIFA 3LO5A 1VKJA 1P61B 4OHXA 3BB1A 3SFVA 2FEMA 4LPSA 3TIFA 4B75A 1LFDB 3GJ7A 4ZIRA 4QBFA 3SU8A 3TNFA 3X1ZA 4P3YA 2WJJA 2IHYA 4B2IA 1AZSC 2G6BA 2XNDA 3IEVA 2IXGA 2GJKA 3F5FA 3TSWA 3T1VA 3T5DA 4DLUA 3RS0A 4Q4JB 1QHHA 3MWJA 4HLDA 5FOXA 1P7CA 1GL6A 3P4XA 1G7SA 4A2QA 5L3SB 4C0AC 1MABB 1WBBA 1N6HA 4CZ2A 3PEVA 3RRZA 2P6NA 4IFEA 2P6UA 4LHVA 3U44A 1IN5A 4HDCA 3B82A 1NN1A 3WY9A 4ESHA 1OH8A 4I1OA 4A15A 3VR1A 2SHKA 2JGNA 3V00A 2GJ8A 2G0TA 3QG1A 2RGCA 1OHHA 4MA4A 3SJZA 3GEHA 1GOTA 2FWRA 5FFMA 2P65A 3ZD7A 1E4YA 1YKSA 2O5VA 1DELA 3E1SA 4ZCMA 5FTLA 3BC1A 1TU4A 1R4AA 3GQBA 4HZIA 4JS0A 2EFGA 2Z6VA 4DCVA 3B9PA 3BB4A 4TMTA 1E1RA 5SZKB 1SXJC 3IIJA 4IVQA 2GKSA 4Q9JA 4JL5A 3X2SA 2RGNC 3HPRA 4JLJA 5FUXA 3NBZC 4YQFA 1G3UA 1OXXK 3T12A 4E22A 1WP9A 3QXSA 3PEWA 1BMFD 3NEYA 1E0SA 4JKIA 4MKFA 4YONB 4C0KA 3K09C 1CS4C 1VHLA 2ZITA 3WBJA 3A4MA 4E09A 4B6FA 1XD2A 1JR6A 1UJ2A 3W34A 3R8CA 2CVHA 2ANCA 2IYRA 2OCPA 1AQYA 1UDWA 3BK7A 3D31A 2ZE8A 1SXJA 4MGYR 4EJSC 3ADBA 4M1MA 1BYUA 1W36D 4M1TA 3CX8A 1R10A 1NVUQ 1KO4A 3A1UA 3B8HA 4PHFA 5FL3A 3WNCA 2IYSA 5IF9A 2GWHA 3OEED 4D4LA 4LZZA 1KI7A 3A1WA 1D2EA 4TL7A 4Q9HA 2BIFA 2XOKA 2VH5R 2WMNB 4H1VA 4MRPA 1SGWA 4OBEA 3K09A 3Q8XB 5DN6A 1P3JA 4HAWA 1E2JA 4B71A 3OE7D 3L43A 3IHWA 4EPTA 1A82A 1YR7A 1SVLA 4NL4H 5JWRA 3TVDA 4HUQB 1DBSA 2IYYA 3EZ9A 1UKZA 2BDTA 3OEHA 2AK3A 1XPUA 4LI0A 4EJSA 2RGGA 3KKMA 4ZKEA 3U7GA 4RZ3A 2QG6A 3K0EA 5GJVC 2ZI4A 2NOAA 4QHYA 4HSEA 4QJ5A 2ZRMA 1N2CE 4AKHA 2NPFA 4BLRA 1Q20A 5K8LA 2R62A 4LJ7A 4OQLA 2NO7A 4C0BA 2WJIA 2OV2A 3L8ZA 3CONA 5EP2A 1KI6B 1X3SA 1N5LA 3K9LA 2FPMA 1J70A 1E2GA 4HAXA 4OK3A 3BXZA 4IKEA 2CLSA 1XBTA 2GESA 4US0R 5BN5A 5CDFA 1SVOA 2YZ2A 4N0DA 1W0JA 2HF9A 2ZI6A 4KO8A 3QNUA 2ZEJA 3QKSA 4D0NA 2F43B 5G53C 1GFIA 4M9QA 3SHWA 1OHHD 4TQ9A 5BN4A 1JEDA 4ZIRB 3OIYA 3I8SA 4AK9A 1KGDA 3B13B 3ZIAD 1ZC3A 5EE3A 3UG7A 1SVWA 2OILA 4LHZA 1QHXA 3VHXA 1N0WA 3EZ2A 2G77B 1QHHB 2F55A 1S2MA 3RRYA 2ZI7A 3KFVA 3K0AB 3W90A 1KDPA 3CUEF 4M9XA 3MUFA 4KSBA 4LJ9A 3Q72A 3ZDQA 2FZ4A 3LNCA 2J59A 5M04A 2J1LA 1NVWQ 4JLKA 2VP0A 3CH5A 1J99A 3TE6A 2KWIA 2HEIA 3U44B 4FIDA 1COWA 5EE9A 1G3IA 3QF7A 3VU9A 1TTTA 1GKUB 1CJMA 4FWTA 2YJTD 4KLZA 3DM9B 5KTYA 4DEYA 2YVUA 3VKHA 1E0JA 3L8YA 2G0NA 3WYFA 2W2TA 4DSNA 4KJZA 3U60B 2HJVA 1W2HA 4LHYA 1SZPA 4OKSA 3SBEA 3AM1A 2NG1A 3CNNA 1OYWA 2EFCB 4PHHA 1N6KA 3OAAA 3HU1A 1ZMXA 1HE1C 3GP8A 2W6IA 1F48A 3FMIA 3QY0A 3AKDA 3AVXA 1U90A 2KB0A 2G1KA 5L3RA 5JZVA 2IW3A 3T1OA 3LQQA 3NH6A 4LJ8A 4Z51A 4W7SA 3NH9A 4S35A 4B3FX 1CF4A 5EXTA 2GCNA 1KMHA 1II9A 3CWZA 1Z83A 4FXPA 4NDZA 1KJZA 1QHYA 2C95A 4DDUA 5DN6D 4KHZA 2DPXA 4R2HA 2WAXA 5CYOA 4RZ2A 4HAYA 2GCPA 2XSZD 1GL9B 4IRUB 5FOVA 1W5SA 1NF3A 1E99A 3GJ8A 5EE1A 2I3BA 1LB1B 3IO3A 4ERNA 1ZD9A 3OEHD 2W0SA 4LC1A 3VNUA 3O8CA 1VHTA 4FWIB 3RANA 4DDVA 3I61A 2RGDA 2JLYA 1XU4A 1ZNYA 4XIGS 1S9DA 3ZVNA 4POAA 1NN5A 1YZTA 4BEJA 1SXJB 4TT3A 2IWHA 1DAGA 4NPHA 4V0OA 2WSMA 4LV8B 4D6PA 3IO5A 5CDFE 4HB0A 2FG5A 4OHZA 1MO5A 2NQ2C 1TQ2A 2GBLC 4PHTA 3KZ1E 4XVUA 2FFAA 2HUPA 3KUDA 2W6JA 4XTCS 1QHNA 2OM2A 1PUJA 2CL7X 3K0CC 3UWOA 5HKKD 2GEDA 2WWWA 1VG1A 5EUMA 2IS2A 3U7EB 1AJEA 4HEJA 1W0JD 4U7DA 2OG2A 2ORWA 5KUTA 4CEJA 3H4MA 2AFHE 1IY2A 2FN4A 1R2QA 3ECCA 4EJSB 1R6BX 3NXSA 5IT5A 4FINA 2VL7A 3D6TB 1GL7A 1I2DA 3VTKA 5BQ5A 1BS1A 2QORA 3E5HA 1KKMA 4JJKA 5FBWB 5JHHB 2KE5A 2GBLA 1Z0FA 4IXMA 1XTIA 2VP9A 4BFYA 4MDEA 3A6PC 3EARA 4KFUA 4AIIA 2ODEA 3AEZA 4QM7A 2JA1A 5CM9C 4D4JA 3UKDA 4IEEA 4QXAA 1ZD1A 1N0VC 2QSYA 3KB1A 3BFXA 2GCOA 4C0HA 4LUCA 4DSUA 2O0KA 1KY2A 1R8SA 1TUEA 2BMDA 2IYXA 4XD7D 3LXRA 3MCAA 1TQ6A 5KNDA 5LBIA 1QHSA 2VHCA 3QKSB 2QL6A 2WWFA 5FUYA 1N5KA 2WJVA 4RFSA 3BORA 4BLOA 1ZRHA 1VCOA 4TSFA 1IOZA 2W58A 1CXZA 5DSZA 4KFRA 5CJ2A 1II8A 3PUVA 3ICEA 3WYGA 3I5XA 2PEZA 4MGKR 2QRZA 1JQJC 3EXAA 4A1FA 4ZDJA 1JALA 4JL6A 3VR5A 1Q21A 3AVOA 4E07A 4W5HA 4ITRC 3M1IA 1XP8A 4PHGA 5LD2C 5AUQA 2RMKA 2UKDA 1DS6A 1CJKC 2IA5A 3ASYA 3F3YA 5TARA 4Q7JB 3RS2A 5BYJA 2GZHA 4L4UA 3QPUA 2C03A 1DOAA 3ZZUA 1VG8A 4C0SA 2F1JA 5HZHA 2B8TA 3EAQA 5E3HA 4S2EA 1TL7C 4IHQA 2ZJ2A 3LD9A 3ASZA 3PQCA 3FDIA 4PQFA 4RZXA 3VFDA 3LA6A 2A5YB 5JJLA 3SR0A 5FUVA 2F9MA 3EWSA 5FBVB 3NC0C 2IUTA 1FP7A 2ZE5A 2RCNA 2QAGC 4US1R 1F60A 4HUTA 5HPYB 4TT3D 2VP5A 2J0VA 2VQSA 3LY5A 1WB9A 4QNMA 1G18A 3VAAA 5DLQC 1VPLA 4R2IA 4O3MA 4M53A 2NO6A 4DSOA 3NC1C 5FTJA 4A0RA 2QENA 2QRNA 1KDRA 1QVAA 2O52A 1BOFA 3K70C 1MT0A 1VYUA 3CR8A 4EDHA 1YR6A 2IEZA 1KMHB 1DO0A 1TQDA 2OHFA 2QMHA 2W6JD 4HZUA 3WMGA 2J3EA 4Q4AA 5FL7A 3MSXA 1BKDR 4Q48A 3K8YA 1UEIA 3MWYW 2REOA 3U6KA 4HAUA 3ZQ6A 4GP6A 4UJ3A 2Z4RA 4D2IA 1DG1G 4JSTA 3RAPR 1F2TA 3AVVA 2X2FA 4NE2A 121PA 2EFDB 2QAGA 3KKPA 5G40A 4TLBA 2WWIA 1PV4A 2A9KA 4CEIA 2IT1A 2GRJA 2VIIA 2B7BA 4I1UA 2XGJA 3VNVA 4WOPA 3PJRA 2WPDD 2A5JA 4II7A 1Q1BA 2R6DA 5CK5A 2BKEA 3VX3A 1NY5A 1W7AA 1R7RA 3EZFA 2H16A 3AUYA 2ZRAA 1Q0UA 1G291 1YZKA 4A8JC 1K5GA 4AKEA 5KYKA 4NCIA 2NZJA 2Z43A 3D3QA 4PTLA 3R8FA 5FPSA 1XXHE 4TTPA 4HATA 1Z5ZA 2IBMA 1IJFA 4QL3A 3UK6A 5A5GA 4QBGB 3A4NA 4P4TA 1TADA 3KJEA 1OFTA 1XEWX 4JLDA 5FOTA 3KX2A 2YINC 2CNWA 4MGIR 2H7VA 4HAVA 2G1JA 2QM7A 821PA 3OZXA 4CEJB 3DKVA 2WV9A 2CHGA 2IXEA 4BPBA 1ZNZA 2AL7A 3QJYA 3Q3JB 2OCYC 4KVAA 4BRWA 4NBSA 2UVQA 1EFHA 1KY3A 4R98A 2XNSA 4M1KA 5A4JA 2BEJA 4HLCA 1IXRC 1GDDA 1ZCBA 4A8JA 4DT1A 4QHSA 4JLVA 3OFND 4BZXA 1G7TA 4DSTA 1N25A 4QM6A 2RH5A 1KAOA 3VKGA 2FU5C 2OAP1 1CJUC 1CKEA 1F3OA 1P62B 1XTKA 3C4JA 1V43A 4PQYA 4X8MA 2BOVA 2OFWA 2AKYA 1MR3F 2YV5A 4BFZA 4DRZA 2H18A 5JMTA 1OH5A 1QG2A 1BYIA 3L82B 2JATA 1X1SA 2GCOB 3UATA 5KDDA 4JL8A 2HDNB 3SYNA 4DIDA 2HCJB 3CR7A 2D74A 2BJWA 4IXNA 1UDXA 3REGA 3T61A 2LKDA 4CVNA 4ESVA 4C7OA 2GXUA 4NCHA 1GTVA 2OSBA 4RFSB 3NTUA 4LY6A 1A7JA 1NIJA 2V6IA 3WRXC 2QROA 1E2DA 2AWOA 1JECA 5GVRA 1JJVA 2EWVA 2VP2A 2XTZA 4JBWA 1II8B 4YMWA 3AF0A 1E32A 3PUWA 2IYVA 4QBHA 3DMDA 3V9PA 3RWMB 3X1YA 1OKKA 3BE4A 2P2LA 1D2MA 2ZRIA 3RSLA 4Q1BA 5J4LA 4JVNA 4V02A 1E9EA 1SVMA 2FX3A 1FX0A 3ND8A 1Q1QA 3KDSE 4F92B 3NBYC 4V0NA 1GNRA 2QGZA 2OAQ1 3U4QB 1S3SA 2XAUA 4AURA 3EZ6A 4CT5A 2D3WA 3C8UA 5AUOB 3VKWA 2GF9A 4LHXA 3CBQA 2PT5A 1PLLA 1W0KD 2OFXA 4B76A 5J4YA 2ZJOA 2OZEA 4QRHA 1Z6AA 3WP1B 4TYPA 2IC5A 1XTQA 1GNPA 3JVVA 3RRNA 4CYMA 4RCZA 4LBVA 1N6IA 1ETUA 2JJ1A 3A8TA 3I32A 1ZD8A 4NYJQ 3ZVMA 5LD2B 1NMYA 1U8ZA 2ZAMA 5J4KA 2ZM5A 3K70D 1T8UA 3IKJA 3BBPA 4US2R 1IN6A 2JDIA 3EIQA 4IOJA 5DYIA 2W83A 1QRAA 4GL2A 3DMNA 1H8HD 1Z0KA 4PZYA 621PA 3RSOA 5AK0A 4TMXA 4GOKA 1W48A 4HZUB 4G1UC 5B58C 1XNJA 1W46A 4PZLA 2GXSA 2KSQA 3K9HA 4Q4AB 3TUZC 1FL9A 1Z63A 1HY3A 2Z83A 2GJ9A 2NZ8A 4FD2A 1KK3A 4GFDA 2CNWD 2XXAA 2EWWA 4GI7A 4PC1A 3BD9A 1S9HA 1A1VA 1XEWY 1F2TB 4JLMA 4PX9A 2QAGB 4AYWA 4QGGA 2ZPTX 3KB2A 4CEIB 1M2OB 2V1XA 3FE2A 4M2LA 4JBXA 1KZGB 2WOJA 4AI6A 3HU3A 1G5PA 2MSEB 1A4RA 1U94A 2NGRA 3G82C 1ELOA 2E1RA 1ZJ6A 1G41A 4Q01A 2C8VA 4URYR 3UANA 1QZXA 2WIBA 4URVR 5KNCA 4UNRA 1YE8A 2ZRDA 4OJQA 2X19A 3SZRA 3ONWA 3IIKA 3QPVA 4YXWA 1I4LD 221PA 2GA8A 1XZQA 2XZLA 5JWOA 4U00A 3ADKA 2HT6A 3AKEA 3K1JA 4EAQA 2CK3A 3GD7A 2A78A 2ZROA 3R9WA 1ESNA 2O0JA 2V4ZA 4D80A 4NH0A 1RC8A 1E3MA 4M1YA 3ZLJA 4MYCA 1BH2A 5EP4A 3SEAA 4BWYA 5GJCA 3TUJC 2NMVA 1XMIA 4WAUA 4YMVA 5EE0A 3RHFA 2J9RA 4UKDA 1T4GA 1JAHA 2ZANA 3QBVA 2VA8A 4DT1B 4EUNA 4A8JB 2P6RA 1VDZA 5C4GB 1OKKD 3MGCA 2ZS7A 1KO8A 2YOHA 1XJCA 4K8OA 1T91A 2ECKA 3DHWC 4B47A 3RLFA 2YC2C 4DLZA 1XDBA 3R9XA 4BLQA 3SBDA 4XSHA 1GZSA 3PG5A 4GSYA 5FTMA 1G4AE 2EU8A 2RGAA 3FKSA 3DOFA 2QGNA 2F43A 1T0HB 1Z3IX 4KBGA 1PLKA 5F2EA 4C7OB 2EYQA 4QGAA 5EE5B 2PCJA 3I8XA 4TL6A 4MITA 2B92A 4MUAA 4LYJA 4OI4A 4B35A 1SVSA 2FOLA 2ZTSA 4AYXA 1QDEA 3TQFA 5CYPA 3EPJA 2ZUCA 1NY6A 1P2VA 3LRPA 2WTUA 2BHRA 3B1YA 3TW4A 4PC2A 4CRWB 2J5XA 2BM0A 3SS8A 4AKIA 2P3SA 3K0AA 4TYNA 5SZIA 1T3HA 2JDID 4TMZA 1HH4A 3THOA 1D9XA 1FX0B 1GILA 4LGMA 1OPXA 1W4AA 4NU0A 2ZJZA 3GPLA 4R9UC 3EIHA 2AWNA 3B85A 1XRJA 2AX4A 2XX3A 4DEXA 3A1VA 4PPFA 5HR5A 2A30A 4IW3B 3C5HA 3PITA 4C0QC 1RW4A 3PUYA 3W5JA 3CM0A 4LX0A 3VR4A 1HV8A 2B7CA 3EG5A 4ACBA 3W8RA 1TEXA 1XCMA 2ZRLA 1XX6A 1OYYA 1AS3A 1IY0A 1IN4A 1G6HA 4OQXA 3QSYA 1CR4A 3MWKA 5E4FA 5KO2A 4Z54A 1Q57A 5DE3A 2V9PA 3TJZA 2FJUA 3MJRA 2V7QA 3DEFA 2F6RA 2J46A 2WKRA 2YOFA 1IAQA 2GJAA 3C5CA 2FH5B 1HEIA 5JI2E 2ODWA 4MRSA 2DB3A 2EFEB 1X8KA 1M7HA 4YMUA 5G41A 3C7KA 3W8NA 4XVRA 1RZ3A 1YR9A 3AUXA 5FUWA 1TF2A 2Q21A 3U7FB 1B23P 4YXWD 3A36A 3CF0A 2FV8A 2X8AA 2IS6A 1XPRA 2R8RA 1DEKA 1FMLA 5EZ5A 1WE2A 4R7ZA 1TX4B 4Q1DA 2GVZC 2PZGA 2WZQA 1NG1A 2V6JA 2VHTA 4D4KA 1G20E 2XXAB 1AGPA 1FNMA 5DO9A 3SDZA 2FSIA 3OIVA 1XD9A 2IXFA 3B1XA 3SC3A 1KO1A 4NYMQ 4KU4A 1OFUX 1E9DA 2CE7A 1R5BA 2JJ2D 2CLDX 2P5TB 2ONKA 5AJWA 1N6NA 2ZIAA 4OI1A 4ARZA 3KKOA 1FUUA 2Q3FA 4PAMA 4Q9KA 1IBRA 4YLGA 1Z6GA 4W5WA 2FMXA 2JAQA 3V4FA 1WDTA 1Q3TA 2AKAB 1OF1A 1JJ7A 4B44A 1S1CA 1R5NA 2GXQA 4Q9IA 3NKVA 1T3SA 4TL8A 4TZ0A 1J90A 2QU8A 4QG7A 2QQ0A 4P33A 1NN3A 3FKSD 2LKCA 2Z4SA 4HLUC 2FGKA 1KDOA 1YU9A 4JZKA 4ZCLA 1MOZA 2QT1A 1OJLA 2ZJ5A 5H68A 1KDTA 3UMFA 2JLVA 2YHSA 2J7PA 1N0UA 1TUIA 5FH9A 1CRPA 4Q1FA 1CRQA 1JPNA 4IEIA 3PV0A 1EFTA 4Q18A 5JWHA 4BFUA 3EPKA 4Q1CA 4XOIA 1MV5A 3LFUA 3NWJA 3DVLA 5IK2A 2XNDD 5JS7A 4NZYA 4AYTA 3PEYA 5C1BA 2NPIA 1DAFA 4RJLA 1KKLA 2HYIC 3QKRB 2DY1A 4V0MA 4DHEA 1AK2A 1TAGA 5JECA 1I4TD 1OH7A 3IBGA 4RKFA 4DCNA 3JVUA 4HLUA 5E95A 3WXMA 1SKYE 4D81A 2YOGA 1FTNA 1Z6YA 3ADCA 1E2LA 4HI0E 4JLBA 1OH6A 3U3JA 5BN3A 2R44A 3L0OA 2VPPA 3CRW1 3B9QA 4MRVA 4YMSA 3FHCB 5KNBA 1YZLA 2C96A 1RFLA 4KAXA 5KPDA 3C15C 2QAJA 3GEIA 3N5CA 2B6HA 2H17A 3FFAA 4JKYA 1D2NA 3U6BA 2ZR7A 4LWZA 1XCGB 2YNMA 4URXR 1G6OA 1E0KA 4ZV4A 2ZRHA 5FR2A 3AP1A 5BW8A 4KYIB 1E1RD 3FOZA 1UBGA 3K9NA 1U81A 3H86A 2D62A 5AUNB 3HU2A 1SHZA 4W5JA 1X8LA 1AIPA 5EP1A 1OXSC 4DKXA 3CW2A 3FB4A 2OO7A 4I1SA 3GLGA 1W49A 1SXJE 1ZM7A 1ZU5A 3RVBA 4CDGA 2H1LA 3PEUA 3DL0A 2NTYC 3WHKA 3U3KA 1KNXA 2F9LA 1SQ5A 2HV8A 1OE0A 1SKYB 4TLDA 4Z8YA 2FZLA 2QEQA 2GTPA 4KXFB 1SXJD 3NBFA 2IWRA 2ONJA 4L5BA 3M0EA 2H57A 4NYMR 4QNRA 4PO1A 2PJRA 2IYQA 3I72A 4HB2A 2XOKD 2CL0X 1GWNA 1OXVA 1Z6TA 2JLSA 2CCJA 4PSAA 1GSIA 1E6CA 4FW9A 1LF5A 5UKDA 4AKGA 3LWNA 5TDHA 2JLUA 1OSNA 4JBYA 1OFIA 1E2IA 1T5IA 2HCBA 1R0ZA 1Z28A 3MLEA 4RVCA 1T0JB 1NLFA 2OCAA 2ZU0C 3B60A 3AVYA 5FI1B 2QTVB 4RD0A 4DC9A 2W00A 1E1QA 3B7GA 4MGZR 4QC2A 5D3MA 4B3DA 1Z0AA 3AVPA 3L0IB 3L0PA 3WMFA 5DISB 2ZREA 2V3CC 3KJIA 4RD6A 5FOSA 1Z6XA 2ZRNA 4LJ4A 2AFIE 2OE2A 4ZI2A 1P2UA 2GK6A 4AG5A 4IVRA 3I62A 2PT7A 3GFTA 1VG9B 4GNKA 3RYTC 4ARZB 3TQCA 3AKCA 4A2PA 4A0FA 1W5TA 4KITB 3P1JA 4LHWA 1JXOA 2GNOA 2O8CA 4F4IA 3QXJA 2DFLA 2WSSA 1NVXQ 4JVLA 4C9BA 4FCVA 2BBOA 1NSFA 5LB4A 3WNBA 5IDVA 4AY2A 1R5OA 2RAPA 2A5FA 2YWEA 1A5TA 5FPTA 4B43A 1U99A 2OBMA 4JYCA 3U2QA 1HA3A 3R9IA 4DDTA 2LCFA 2QP4A 4Z1MA 1GRRA 2XTMA 2R65A 2AN9A 1XEXB 4UNQA 4WXPA 4IDPA 2AHOA 2ZJAA 3DO6A 1ZIPA 2R6CA 4WBSA 3BH6A 2MMCA 4XWKA 3OIWA 2ZRJA 3FPAA 4EPXA 2GXAA 1NRJB 1EX7A 1Q1ZA 1G7CA 4TN1A 1TEVA 4JSYA 4C2TA 3OHMA 1F5NA 2GEUA 4IVPA 3B1VA 5DI9A 4CT4B 2ZSFA 4WW0A 3U3RA 3W6NA 2GHIA 1YJ5A 4TL9A 2ZRKA 2IYZA 2R2AA 3TSOA 2ZSDA 1FPMA 3LVQE 1COWD 2ZQ5A 4IFBA 3QI2A 3SE0A 2X2EA 1W4RA 3MG9A 2QPOA 4URUR 3RDPA 5HCIA 4A6PA 1U8AA 5GVSA 3QIAA 2ORVA 1S8FA 1Z2CA 5CITA 4TZ6A 2OESA 2Z0MA 3W9YA 5G3YA 5DYGA 1EG7A 3GJXC 2JLZA 2OLJA 2GAOA 3K0FA 4Q03A 4PFSA 4Q4LA 4WA7A 4TLAA 1KK1A 2YC4C 1RRFA 1PLJA 1UBFA 1CU1A 1CEEA 2B8WA 1JQLB 2ZI3A 3OAAD 3CRRA 2PL3A 3DDCA 3GJ0A 3PCRB 1UKVY 2W6ID 5AJZA 3LAWA 5KHOC 1OFHA 5JRZA 4DBLC 4O0MA 3U61B 4OYHA 2C99A 2ZUBA 2YWFA 3FHOA 5F9FA 1P73A 2PLRA 1YZQA 3U4QA 3NG1A 4D26A 2ZI5A 2O8EA 1W2GA 4TYYA 4KFTA 3O47A 3GLGB 3CRQA 2O8DA 2DFNA 1E9AA 3DM5A 3EPHA 1D6JA 1KO5A 3Q7PA 2CCKA 1F2UA 1E2MA 2R6GA 4NP6A 1RPZA 4G5OA 1ZC4A 4XH9B 3RNLA 1KI8A 1LS1A 1QHGA 2FPKA 2HYDA 4GPTA 4NCKA 2PCLA 1Y63A 3VR3A 5KSYA 4IDHA 4MRNA 5SZHB 4M1SA 2FA9A 1LS6A 3IBYA 1ONBA 3BS4A 4GP7A 2BMJA 5JS8A 1L4UA 1Z47A 1W4CA 2K5UA 3HDTA 1NSTA 4NCNA 4PAQA 3KTAA 4C3ZA 4TLCA 3N2EA 5EXXA 3EW9A 4MUBA 1E2HA
chains in the Genus database with same CATH superfamily
3AW9A 4E5SA 3SVZA 4YAKA 5CFMA 2BFCB 3AERB 2WJ6A 3QKIA 4OSOA 4EJMA 4Q7LA 4EPYA 1LNZA 1QS0A 1E1DA 3CZPA 3NHWA 4HPJB 4R6XA 4TUYF 1IRXA 1VJRA 4EB6A 2ODPA 4WCDA 3N59A 2JGDA 4L9SA 3BXPA 5JH7A 2R6FA 2YV4A 4Q9NA 2NYRA 4NPAA 4QQ8A 4RJTA 5BRAA 4NVRA 1R0RE 3B1KA 5KC9A 1GPBA 2NUTA 2V98A 1QX4A 1R15A 5FXMA 4C3OB 2BEKA 1KEKA 2QJFA 5GOZA 5LJIA 3HXQA 1WHSB 1JEQA 1ZD4A 3HJNA 1T24A 2IYWA 4XJVA 1AKEA 4YWJA 1VCHA 2ID4A 5FWAA 2DH6A 1I3OA 2C78A 4LJYA 3TR5A 2OK7A 3HR8A 1VKHA 1DG3A 3K5WA 5DRTA 2VP6A 1E2QA 1ZUNB 1SVKA 4J4BA 1VXRA 2GZ1A 4ZREA 1SELA 1ZUHA 2F3UA 2JGMA 3I2IA 1NUTA 4LOJA 3EVGA 4FFBA 5I47A 1AZLA 1DWQA 4INJA 4BNGA 3ZCPA 2O8CB 1IOVA 1QO7A 4R2LA 4NU5A 4BMXA 4WCFC 1E3IA 2GEVA 4KFSA 4AJOA 5I3ZA 4UQLA 3MMZA 3GZJA 1UAAA 2JLCA 2BYTA 1IDOA 1P75A 1HGXA 2GYUA 5DK6A 2VUHB 3MIIA 4EPWA 3QJGA 5L3QA 4CWAA 1Z0SA 3BIJA 3GLSA 5AVVA 4AX8A 4ZU3A 2YUTA 2WFMA 2VBFA 1INLA 2BFNA 3P19A 4J9VA 5H1YA 1VSQA 1YAJA 1WBDA 1OVMA 4XM2A 2JIBA 4FTWA 2DKOA 5JNLA 3GYBA 3IPAA 2IYOA 4B4VA 2WWYA 1WRBA 4LC0A 4BNLA 2I3GA 3IQXA 4GAEA 4P54A 4XWAA 3ZWAA 4CIXA 5AVRA 4UHHA 1NV8A 3B78A 4A36A 1DAPA 2C58A 1BVHA 2XRYA 1PQUA 2J9YB 2R1UA 1E94E 1Z7BA 3GFPA 3EYWA 1N8TA 2G9NA 3I9FA 1JPJA 4QPDA 2ETXA 4QOHA 3GQVA 3U17A 3ENKA 5CRIA 1MQ9A 3GEEA 4GKKB 4EF6A 1OIWA 2N9UA 2HBYA 1VPDA 1KVSA 2ZRGA 2GM9A 2AJBA 3ICOA 4HH0A 4I4IA 1TJPB 5HBRA 4TPKA 1XMOB 3LXXA 2FG6C 1JAZA 3CLKA 1UM8A 3F3MA 1LJLA 3EC1A 1IEXA 2CFTA 3C2QA 2PKRA 2VA9A 3H04A 1U65A 3ITKA 1RBQA 4K1LA 5BYKA 2DR2A 1PJLA 2JEOA 1TT5A 3K0FB 2AGVA 2ZUDA 4GZLA 3NBAA 5ER6A 4HWGA 1S0UA 3P9CA 3OPYB 1BCSA 4Q66C 2UZ3A 2QA5A 5H82A 3WO1A 4DLRA 2PKQP 2HRQA 5JCZA 2ECPA 3CRMA 2VJDA 1KIMA 1PX2A 1GFZA 3I2YX 3QXHA 1RADA 1U8UA 3NGXA 2ZJ8A 5B1DA 4UVGA 3B5EA 4YV1A 2PUTA 2V5UA 4RY9A 1JA1A 3ANXA 5KYYA 1JA9A 3B1WA 1OIVA 1EGAA 4YRDA 4ZQBA 3CEHA 3B6IA 5COAA 4D9KA 3CCBA 4MCJA 2WPNA 4J2HA 1ZZGA 2WHPA 2O8EB 3NANA 1RT9A 5FL7D 1K2WA 5U4QA 2O8DB 7MDHA 2UXCB 3MCTA 1H1LB 5CVEA 5I7FA 1FDWA 3HB7A 3VJLA 1GNQA 5PGMA 4N3BA 4PPQA 5CD1A 2WE7A 5IHPA 3ROPA 5JCOA 1G5TA 3Q8MA 3OKPA 2MWMA 3NIDB 4JJZA 1UXGA 2CLCX 5CJPA 2OCBA 4GX1A 3QX7A 1IN7A 4IBOA 4QGFA 3ZWWA 3GU3A 3D81A 4W7IA 4NARA 3KWJA 3O26A 2JFBA 5C4MA 1KQ3A 3DZ8A 1UANA 3EVFA 3MTQA 3FUUA 1GRNA 3D43A 4DCSA 4OOFA 3F47A 1AZWA 3H9BA 3RS5A 2D0OB 4YP0A 3AR9A 2VDMB 4MJXA 4AJ2A 1XNQB 4KO3S 1UEXC 3H2YA 5G4LA 3L1VA 3DEIA 1NUSA 1DEHA 2JJQA 1XOIA 2O50A 2C3OA 3GXBA 3OCCA 5F5XA 3W0LB 3WHPA 5DB4A 2J5RA 3F0TA 4R1SA 5DM70 2WSBA 4D4IA 4UBOA 3C43A 4F4CA 3ZKWB 2CY0A 2MSDB 2HSJA 1Z35A 4L2IB 4R05A 1BEUB 5DX8A 4DJEC 3TF5A 3P27A 2Z3ZA 5EQTA 1NYRA 2FVXA 3AVQA 2JGKA 2ZYRA 4R40A 3QLUC 1XWIA 4LBWA 4X8HA 4KV9A 4LI3X 3UJ8A 4AAYA 4DB2A 4GOXA 4L8GA 1HKUA 3OZFA 4H7KA 3RK0A 2WWGA 4QOJA 2A94A 3HBNA 2ZXUA 3QYAA 3KAPA 3SEZA 3BCSA 3MELA 1UPBA 1WV0A 4KMMA 5LYJA 5LUAA 1BE8A 4WQMA 2WMOB 4ROTA 2PH3A 421PA 3HJGA 1TVCA 1CCWA 2KBEA 3RUAA 4AWBA 4OL9A 1DKOA 1NIPA 3NHPA 1QQ6A 1RACA 3W4KA 3E81A 2V59A 1T3LA 3ZH2A 3D8BA 4B3JA 3UAOA 5CBKA 1NFFA 1QZUA 2FKAA 2PS1A 3JQCA 1M5TA 3JV7A 4BKUA 3P2YA 3HMQA 1JPUA 1S2NA 2QPLA 4KQCA 2QLLA 1KI9A 4YMLA 2ZRFA 4FE7A 4JUFA 1J5PA 4CR7A 1WF3A 4GM4A 1SURA 2CHQA 4LECA 4IIYA 2IV7A 4CF6A 3S99A 2GM5A 1QGED 3TKAA 4PYMA 1OLXB 2GPSA 3I3SR 4X1IB 2WWXA 2NVBA 4N65A 5BVGA 4PGAA 2RK3A 1UXIA 4FDMA 3QF4B 5IN5A 4CMBA 2LE0A 3RGGA 1CVRA 1EFRA 3CLVA 1TYZA 2FZEA 4HAZA 5CDTA 2V55B 2YRFA 1NWCA 3HKDA 3KOUA 3F73A 1UWVA 2I22A 1YQ9A 4ND7A 1IZYA 3NGMA 1SUDA 2ZSBA 3BWVA 1E1YA 1UK9A 5EN4A 1SBNE 2AJTA 3KQPA 4PO8A 5DNUA 5LCXA 4BBJA 2HWXA 1FSPA 4URFA 1EJ6A 1EUCA 1UKBA 3BEDA 3CV3A 1PJTA 3L7IA 4YJFB 4H4EA 3Q3IA 3RQIA 2ONYA 1C0PA 1T9KA 4MR9A 1FXWF 5BNZA 2UUCB 3F6SA 4H4DA 3ASVA 1M72A 3KR1A 4NH4A 2J9GA 2JVKA 3QITA 3RJMA 3MYYA 2I6TA 3CF4G 5EUCA 5BV8A 3TZ6A 1KORA 2UYCA 1PL7A 1SHTX 3ZDYB 4K46A 3RV3A 4BV3A 4FDLA 2AXNA 3EODA 2IF0A 4DCPA 1SIWA 2VTDA 1DXQA 1NJ1A 4UVIA 2AS0A 5EXEA 5JEEA 1E3DA 2B21A 3CFYA 1R6TA 1X1QA 1L4YA 4FHGA 1FTWA 2RARA 3PENA 2PUFA 1T36B 1MD9A 2ZJFA 4PQRA 1ZD5A 3ZZNA 2HLPA 2PV7A 3RKSA 3NVAA 1N8SA 2VAXA 2ATXA 4KEAA 3TEFA 3F6YA 1NR1A 3TOVA 1VFPA 5KTKA 1KR5A 3OE7A 4EELA 5IJ9B 3IXLA 1NU8A 2ZT6A 5CU7A 1T26A 3W1EA 4DJ5X 3M3DA 2I4MA 1LEHA 4WN3A 5LVAA 3C7TA 3NT2A 3NLLA 3W4IA 1GFSA 4YN3A 3LFHA 4GKBA 1MKYA 1H94A 1VPTA 2JFXA 4AICA 4EI2A 4D92A 5A7GA 1XZGA 1DAKA 4FQ8A 1VCIA 3CMMA 3DB1A 3ESRA 1M8KA 3P20A 2QN1A 4KGDA 5FBZA 1Y9AA 1KIFA 4GXTA 2X6TA 4G01B 1ZS9A 3IQZA 4FMDF 3JVEA 2BBSA 3ZNNA 2ZXEA 4LA4A 3ANSA 4MJ7A 1PHRA 5DEOA 1NM5C 2DH5A 4RE5A 3A4LA 2FXIA 4QSHA 1E9RA 4B2LA 1PIWA 2Z8ZA 4O2LA 1LX7A 1J21A 4I55F 1F5SA 1PJBA 2J6BA 3IV7A 5JLJA 4II2A 3AV3A 4RD2A 2YWBA 1DKNA 2GBIA 5CNJA 3KEQA 2VTBA 2W2PA 1NXVA 4DA0A 2CJYA 2YYAA 1LU9A 4M6WB 3ZS8A 2KHZA 2I1QA 3BRWD 2X14A 3H2GA 4K03A 4TSKA 4U7FA 3GGPA 3DJFA 4UMEA 1A9XB 4PLTA 2DMRA 2JASA 1I8TA 2XBLA 3GJ6A 3LMKA 2O1XA 3MWFA 4KQFA 3KJGA 3IMFA 4LZLA 3T9AA 4F11A 2WM9B 5JU6A 4NK4A 1T29A 4DDKA 1HDGO 4H3HB 1EZ4A 2VF8A 5LSAA 5KNBH 5ALEA 1N8NA 4Y2XA 1W29A 3FHLA 3FMFA 3O21A 3E7WA 1FFGA 2WVJA 3ZU2A 3A2LA 1RYBA 2BHTA 1P9WA 3DQQA 4HDQB 1KK0A 3WK7A 2CJFA 4G4SO 2YWJA 1U9IC 4F7WA 1WNFA 4WACA 1IUOA 2IHKA 4RDIA 4Q24A 4ENPA 2P3OA 2MTBA 3LYHA 1T2VA 5A02A 5LQKA 4Y30A 4I1IA 3KSZO 3IEKA 2CFIA 1WUHS 2ZS8A 5FADA 4FBGA 3DT9A 2C4WA 4JVMA 4YJ2F 1UAGA 4DV6B 2HWKA 3TB4A 3KZXA 1MA0A 4KXWA 5K3FB 2BH9A 1G17A 2CEAA 2YR0A 3FFBA 4TQGA 4ZT6A 4UTOA 5IU6A 5IWAB 2FPSA 1AD2A 1STOA 4BWVA 4F2DA 4B6EA 1XLTC 2O2EA 1B0ZA 1QM5A 2ASEA 2VJYA 3F6BX 1X42A 4FQ7A 2F17A 5K9ZA 1VYTA 3TD2A 4YQEA 1N4AA 4AUMA 1X94A 2IUSA 3X1WA 1F9AA 2AD1A 3O8OB 3KCNA 4L1KA 3P2JA 1LLCA 3WLTA 4JLPA 4NFYA 4UHFA 1WU7A 1Y4SA 1EDZA 3KVRA 5AI5A 3LUBA 1YQUA 3BJIC 2X2OA 5E1BA 4E5UA 1JJBA 3DE2X 3NM5A 6PFKA 1GPNA 1RCUA 3UBMA 2RGNA 3EA0A 4V24A 3VQTA 3MJHA 4AZSA 2QN6A 1U0HC 1EU1A 2NP7A 2FSHA 1JMVA 4Y2RA 4KJXA 2BGJA 1XEXA 4RIGA 2VNIA 4CT0A 2IDMA 4QDUA 2EBWA 4LYHA 2XE7A 3V8VA 5K4GA 1KEWA 2BE7A 4S3MA 1O6FA 1NX6A 1R4MA 2B2XA 2CDAA 2XMQA 3NM4A 3DTVA 2ZU6A 3LL7A 4REQA 4BZWA 4ZOLB 4G26A 3QQPA 1W44A 3AF1A 3RI3A 1PL8A 4ER6A 5CHYA 2J6HA 5KOHB 1C9MA 1DIOB 1O54A 2J3KA 4MW0A 3RAFC 1EFKA 3GR6A 4YEDA 4FNOA 4RQTA 3IQHX 3MMSA 3PSHA 4HWPA 4IFIA 4K9MA 1SBYA 4Q4CA 1G98A 1X6VA 2VYVA 2Q3HA 3NNNA 4G5RA 3GLFB 1YNSA 3SOPA 1UDRA 1Q0TA 2H2DA 1QZTA 4EKDA 3D7SA 1W36B 4HNUA 2I2BA 2QDXA 2WV7A 3RT7A 2ZUTA 3ZHVA 3O7WA 4QOFA 2J0SA 1H4VB 3HJBA 2J85A 5EZYF 3AESB 1N2BA 3NEJA 2FMHA 2JC3A 3LOQA 4JA0A 3M6WA 1MIOA 2P0EA 3SDBA 1GU7A 4A6XA 3H0KA 5AVJA 3U3OA 2VJCA 4HVTA 4BNZA 4BO6A 1WWKA 1JEEA 3DDNA 1ITZA 5CT9A 3C3BA 4EUEA 3A6HA 1X7GA 1G8HA 1T2FA 3OQ6A 2A35A 1LPAB 3G49A 3G5TA 2K4MA 2OHXA 4OMDA 1NGSA 4EH1A 5B2EA 2DFPA 1JHQA 2OB2A 3WL7A 3OECA 3RR2A 2WUDA 4EHHA 2AQKA 2J87A 3WYDA 3MW8A 1SBHA 5ALQA 3WAJA 5C7LO 1T0UA 5FWDA 1G4UR 5AVTA 2LGJA 3IAXA 1APBA 5HJ2A 1MRZA 4QU8A 1ZP6A 4DDTA 1SWWA 2AOTA 4JBIA 1Z29A 4E32A 5BV0A 1N5DA 4Y3UA 4C29A 5FYDA 1MH9A 4GMKA 5EJ6A 4BQIA 3HYSA 1SIUA 3EA5A 4M60A 3IS3A 4G1MB 3AF4A 4NULA 3GEDA 1KIAA 1TOAA 2C3YA 2ZAYA 1HX7A 1DC6A 1DEAA 3WGKA 5F9MA 2QWXA 4N39A 3A27A 3R4CA 5T4BA 2ZR0A 1UQRA 3QBDA 1QOZA 2EGGA 4KRYA 1XD8A 1YD7A 3T95A 2PO5A 3THYA 3BH0A 3IP6A 1EP2B 3T0IA 1UF9A 5BQOA 4FFLA 2V96A 3TR0A 3W79A 3ZJYA 2ZBEA 2IHNA 3G59A 4E6PA 3VUEA 2ZCUA 1Q44A 4QT0A 4XDYA 2CFCA 2WYIA 3H16A 4MKHA 4QEZA 1PEAA 4RCVA 1SHKA 3SHFA 4MAAA 3M4NA 1V5WA 3NC4A 3N6XA 3ED1A 2QE7D 1RJ9B 1UMDA 2M2IA 3QPAA 1KP2A 3K5HA 4OQNA 1UM9B 3I9KA 4S24A 4UNSA 3WMEA 1Z33A 2VRNA 4JDPA 2ZOSA 3D4BA 4Y1EA 5ANRB 4I9HA 2PLFA 2UYGA 5BOVA 1G59A 2ODBA 2A92A 2J7PD 4UD6A 4BAGA 1T9ZA 1IMOA 2QZZA 3HUUA 2C0QA 4F38A 3VPDA 2RKBA 1VG0B 3ECSA 4MV9A 3IEXA 1I7QB 3I2FA 1V8DA 5DH9A 1BXRB 1VA5A 3V46A 1XA4A 2Q1WA 3F8SA 3KZOA 5DBEX 1ZVKA 3SZMA 5KOJB 1OVGA 2Q8QA 5EJEA 4MWEA 4P82A 1F6WA 2HRDA 3E9CA 4C3UA 4R2WA 1F0KA 1TB4A 1XZPA 5JNVA 3WK6A 1DQNA 2Y92A 3A7DA 4DUGA 3GAZA 2ECQA 4FMCF 4UEWA 3UB4A 4OHCA 3UKOA 1AU9A 1T1IA 3BQNB 4AG6A 2I4IA 1WSWA 1MAHA 3E4CA 4EYKA 3I01A 4G0XA 4ZT4A 3C8MA 4O3FA 1O96B 4HF7A 4OQEA 3HPQA 3ER8A 3T15A 2XT9A 2Y0EA 3CQ9A 5B3KA 3PUXA 5DNYB 3FZNA 4R5HA 4PW0A 3CSSA 2Q7XA 3KFXA 2C4KA 2E4ZA 3AIMA 3PYMA 1HFWA 3OJOA 4RPIA 4AN4A 4D9MA 4LZPA 5KCMA 2PWAA 4E14A 3QBJA 3JQBA 3L6OO 3W3AD 1YB7A 3PA8A 4U5XA 4DB4A 2AR9A 3F6CA 4KPFC 1CETA 1O94A 2BI4A 2PS3A 4OUKX 5EIWA 3W8EA 2AN3A 3CIOA 3CT4A 2ZWIA 4GRIA 4IOKA 3ZHQA 4BLTA 3QXCA 4EMBA 3DGEC 4YT8A 4IGEA 5CDUA 2CMKA 4RVOA 3I3OA 2F9FA 4WRRA 5DGCA 2WYOA 3GRPA 5J40A 3S1AA 1LDBA 2CMGA 1IN8A 2CXHA 5LMNB 2IIVA 4WESB 4YRFA 4PLHA 3FBTA 3V2UA 2FX5A 3NWEA 1RXWA 4YP6A 1BWPA 2REBA 3OTIA 3W3ZB 2RD2A 2B5OA 1ZIDA 4JI5B 4IY1A 4MI3A 2UVPA 5ESXA 3HR4A 4EW2A 3VR2D 3ZWOA 1P7ZA 4PPNA 3TXAA 2ZUFA 4IJVA 1KYIA 3ZQ4A 1SCDA 1UK6A 2DWOA 4MVXA 4ALKA 4UM9B 3TDNA 4DR2B 1B2RA 1IXZA 2QMQA 4LNAA 4YMGA 2X4IA 4FKZA 3LDFA 2QVLA 2V1UA 2CEKA 3A1TA 4YAFA 3EUWA 5DLYA 3IFSA 3WL5A 1E9SA 2H4HA 2YN0A 2B8NA 5IJZA 4LJ6A 3L1JA 1IZ7A 3LK6A 1ESZA 2MU1A 4IYJA 4DYDA 1SBCA 4UHCA 1UJCA 2XVZA 3CUUA 4M9ZA 3EH2A 4PRYA 3ZQJA 4NECA 3ICQB 1GIAA 3DE3X 2GPYA 4ZVPA 5HYVA 3AY6A 3HFSA 3R2JA 3OCZA 1LVGA 2AEMA 3L8FA 3OJLA 4JODA 4MI6A 4PXAA 4REMA 1OD6A 4UVDA 5HQ3A 5F98A 1T25A 1XT6A 1A9TA 1N57A 3GMSA 3K9QO 3EX7C 3P94A 2NIPA 2R5FA 5G4KB 1LKZA 1X38A 2QP3A 4RW0A 2Z6AA 2G5PA 2JKYA 2PZFA 2W6ZA 3K9GA 1AMUA 2VJAA 1JIIA 1XRRA 1FQJA 3W6PA 4BQEA 3OZVA 3Q8KA 2OQRA 4MR8B 3ZNQA 3UMYA 1GQQA 4LF4B 1DOHA 5A6SB 1NQ5A 4IXTA 1IJEA 1H8EA 2RHHA 1RU3A 2E4WA 3C3KA 3FPFA 4EFNA 5DOZA 3NV7A 4AD8A 2WM3A 1IUKA 2NN3C 3MK31 1G3MA 1RM3A 4CDNA 1ORIA 4GMXA 2QN2A 2V7XA 4RJJA 3A9SA 1GG8A 4WKOA 4OIMA 4RIFA 4B82A 1G6Q1 4CL3A 1OT5A 2ODNA 4G0NA 3WIVA 1E1LA 4LV6A 3BAFA 3C3JA 4KIGA 5ALRA 3TZKA 1X80B 2WAYA 1T43A 2CYAA 1VRVA 4B74A 3MOGA 4RYDA 3X1KA 1YUBA 5CDSA 2CUKA 4YB8A 3NJ8A 1B6RA 1PZFA 2JGFA 1G5IA 3HVKA 1D0IA 5CFRA 1G5RA 3A3PA 2WSSD 5EXSA 1KS9A 4L4XA 3R0IA 1OI3A 2YXNA 2GSWA 3KUUA 3QVOA 1U7PA 1BJRE 4PU0A 4O2BA 4DVJA 4EGAA 1NZDA 2VHQA 2J6CA 1Y89A 2PYZA 5DSXA 1EB8A 1RWMA 4DIUA 2D7CA 1KYVA 2FI1A 4WZAA 2ORIA 1PTJA 2OFOA 4FHCA 1XQ9A 1SZCA 1VTKA 4B4OA 4AW9A 1WPGA 4K88A 1ZM9A 2DVMA 4HUJA 1GITA 1RHKA 3WO0A 1P0CA 5HIJA 1RYFA 2P4UA 5L45A 4ZAWA 1N33B 5K8VA 4Y7CA 3R1IA 1MLDA 2DC1A 3IC5A 4B1FA 4LBYA 3PQ6A 4HFNA 4Q82A 3WGTA 2DPGA 1W0KA 3DD1A 1H2HA 5TPWA 5TSDA 5CVTA 2O8BA 5CCBA 1SCNE 3CPJB 1AGRA 3O8DA 4Z9BA 1SKQA 1WKBA 2ZP1A 3PFIA 4GYKA 4UHDA 2VK2A 3T1QA 3SYMA 1A8HA 3HVUA 1AOXA 1NFQA 3DR3A 1E92A 2IYUA 2VATA 1K8QA 3D5QA 2GK7A 3QPCA 5DYNA 5SY6A 1PWHA 5I5GA 1OJ7A 2GAIA 3VR6A 3DXZA 2PX0A 2WU3A 2I3ZA 2HU2A 2A1UB 2E9SA 3KPUA 2IPOA 3F98A 1PJSA 4PLZA 5EPUA 5KYVA 1S2GA 3IPYA 3NATA 4RD1A 4RH0A 1WETA 2GD6A 1LJUA 3IBTA 3LW7A 1JVBA 3H84A 4YJGA 1E3QA 5KX5F 3EQ2A 3GVIA 3L6CA 4XKJA 5LZ5A 3TW6A 1JKJB 2I1VB 2C4NA 3FYCA 2CZQA 3LUGA 4J8PA 3ZE0B 1J4AA 4TTIA 2FPIB 1TKCA 2E1PA 3CKLA 5A3SA 1DDGA 1JG3A 3QFTA 4O2AF 1OROA 4ZEWA 3VMMA 2CZGA 3A70A 1FMJA 3NHZA 3NUZA 3ZK9A 4IEFB 3K94A 4RMIA 2PXCA 3KBBA 1AXRA 1KXZA 3HY4A 4OJKA 3SMVA 4GLFA 4FFOA 5ALNA 1RJGA 5JADA 1ZM4A 1HE5A 4HADA 1B3BA 4S12A 3G1TA 3IDQA 3S8YA 1E6LA 2VBCA 5F76A 1JIVA 3UGTA 4CG2A 3HCCA 4DBLE 4IOLA 1ZJYA 2B8EA 1N2GA 2P0YA 3GPIA 1NOIA 1FNNA 4JITA 1FQWA 3GCDA 1ZVVA 1LW7A 3NDPA 1ZRMA 4TTVA 5CG1A 1HORA 4RBNA 4G0UA 4MO9A 3AZQA 1KTVA 4AULA 2YFQA 5IS2A 1TM7E 2ZB2A 5HE8A 1I13A 4L5YA 4JA2A 4ALIA 2EX4A 3P26A 4O4JF 4OHMA 3S29A 2M1XA 5LXTA 5ADUS 1ZBDA 2PGNA 3OKCA 4BECA 1X2EA 2QIPA 4D8YA 1TQHA 3DZGA 9MHTA 1CT9A 3VU1A 2Y9PB 1ZI9A 1GLVA 4WADA 4WJKB 2XLBA 1KU0A 4B0OA 3LKBA 3AVWA 2A67A 1P6UA 1Q1EA 2C59A 1T15A 1XXHB 5HZGA 3X1XA 1KYTA 2MSLA 2WLTA 1XN4A 1VJ0A 1KI3A 4CE6A 1Z8HA 1JILA 1EE1A 3KSMA 1XCPA 3NDIA 2PRJA 3NGLA 4JOSA 4MVCA 4Q3DA 1LC3A 4ZVTA 4C4SA 1H2YA 3R6GA 2IXTA 1CVLA 1ZU4A 1AURA 2FG7C 2NTEA 1WQ1R 2WHQA 3CF4A 1VIYA 4YCCA 5CLFA 2R7AA 3IDAA 4BBPA 1Y6FA 1IG3A 1L5VA 2I67A 5L3SA 2AW5A 3TLJA 1MABA 4EGQA 3D3WA 5FNZA 3NUGA 3FTCA 1FFWA 4LYEA 1M2JA 1RHRA 2C3PA 5EINA 2LP4Y 3WIBA 4ZMBA 1XHEA 2MSKA 3AJEA 5DCUA 1H4SA 3WRVA 4CV3A 2RI6A 4K87A 2R6AA 1DB3A 5F2OA 1D8AA 1UKEA 4YV7A 4J1NA 1IBCA 1R00A 4BATA 4ZK2A 3CF6R 4I1VA 2A1TS 1CJBA 3KXDA 2H7YA 3PGJA 4QPNA 2JIZD 2V97A 2WTMA 3LBYA 1EFAA 3GPBA 3SQXA 1FU4A 1PFVA 5AJTA 5CAEA 2CXNA 3QRWA 4QTTB 5FNVF 3EVNA 1OMOA 1PR5A 2CDBA 3TRHA 3VPHA 2AMJA 1RQRA 1SHJA 3TLCA 2E49A 5H8WA 1P3DA 1Z0DA 1YB6A 2I29A 1JU4A 2XB4A 2GPTA 3EF3A 3H1EA 3H83A 5EJ5A 4Z4FA 1OIXA 3IOYA 4LJAA 1W4BA 4XQEA 1LI7A 4RYLA 3S2YA 2JGLA 2VDUE 4N3NA 4RD4A 4BFSA 4F1JA 1NULA 1W2WB 4IRXA 3SLKA 1KYQA 3OIDA 1QR6A 5F3RA 1J09A 3Q7QA 3G2HA 3KQHA 2RE8A 3RSGA 1NASA 4JNKA 4NBUA 3PI7A 4R1OA 5K8UA 5HUHA 1GP2A 1VZ3A 2PO7A 2BEUB 1TPZA 2WJAA 4GS5A 1WSAA 2VYCA 3O83A 3UAWA 2EX1A 2KM1A 2Q50A 1UODA 1TIKA 3KALA 5BXQC 2OO3A 1IMJA 3BA6A 5YASA 4LJRA 5JAQA 2OORA 3IUYA 1DI0A 2Z2JA 4TKMA 4XI9A 4JASB 1UADA 2YYZA 2PL9A 2XQVA 1KEEA 3PIRA 1QTNA 3R3YA 2BL4A 3ZXSA 2AQIA 4ZPJA 3ZHOA 1C3VA 3M4XA 1DRUA 2P9GA 4MS3A 1GGVA 1SOAA 4JR0A 2HEGA 4X7MA 1UBOS 3JR7A 5G0VA 4ZZ3A 3B9BA 3GRRA 1HFJA 5CCDA 4AY3A 2DHCA 5BOSA 1N9GB 4KXVA 4P92A 3TAUA 1ZO8A 3S8EA 1QNFA 1QF9A 3R3SA 1G2IA 1WX1A 3NAQA 3PPXA 2PM8A 3SBXA 2IPMA 1XEAA 5KU1A 2B1GA 1CUBA 3DL2A 4D44A 2WG1A 1E6KA 1LPMA 1XR3A 3CT6A 3GRFA 4XGIA 4BYGA 3Q7EA 4RDCA 4KI0A 2L0XA 5ALUA 1O87A 1SG9A 1BHSA 4R83A 3DOHA 3R5SA 1H0SA 1UT8A 2VHJA 2OOKA 1EBBA 1EP1B 3OF5A 4HQOA 1HOXA 5DJ5A 5I3CA 1FDIA 1KEZA 1BCRA 5FFFA 5CA0B 1CRLA 3HVIA 3U31A 3LCMA 2VHYA 1N2JA 3C3XA 4UXJA 4EWLA 2NSJA 3T7AA 4YCMA 2JFHA 4CXMA 1NW4A 1HO3A 3CKKA 3T5BA 3IEUA 5K01A 4L72A 4DNOA 3TTWA 3RREA 1G20A 1QHIA 5KAMA 1ORDA 3LLCA 3NDBB 4HP8A 1JB9A 3AVUA 1B8NA 1NVVR 1DVRA 2I6QA 2PUWA 4CM6A 3DT8A 3P9YA 3TSCA 2ENUA 3GJQA 1RRCA 1HDYA 1EWVA 2VSXA 3W2IA 4V0KA 3CR3C 4KIWA 1XZNA 3CUWA 4YWHA 5IVHA 4JUCA 3E6AA 3RS4A 3SJCA 5J2UA 1NDQA 2B78A 2F3RA 4DMHA 3HS3A 2BN4A 4IG9A 8ATCA 1GCUA 1K4YA 2XCIA 5A4FS 3IERA 2IODA 3SWWA 1M2NA 3GFSA 2Q2QA 2SECE 4MYTA 4GDFA 1L5HA 4ARIA 1RJFA 2O20A 1Z7EA 3A10A 3ZCVA 3EVAA 1P61B 4KSYA 3BB1A 3STUA 1A7AA 1LFDB 1VJDA 5KOIA 4U7PB 4OQZA 4QBFA 5TQ0B 3HXOA 1D2GA 2IHYA 3NYRA 1AZSC 1I1HA 2PPLA 2G6BA 2XNDA 3DEAA 3I9OA 4FR0A 2IXGA 2GJKA 3IAUA 4J4HA 4RS4A 3T1VA 4BVJA 2CBXA 1ODSA 2O14A 3SCZA 1QLHA 1QHHA 4Q4JB 4YUZA 5AVZA 5DT2A 4XUEA 3ZNPA 5KB3A 1XGKA 1P7CA 1KHHA 3OTGA 4X6YA 2O0LA 1QO0D 4C0AC 4JJ8A 2P2NA 3CG0A 1T0BA 3IPLA 4J0CA 4CQLB 1GPLA 3THXA 4RK4A 4ZZ0A 3GV0A 4Z0TA 5EIFA 1ZISA 1JFVA 2DQZA 3HDJA 3IR7A 3TR6A 4ESHA 2PUDA 5ADHA 1T2EA 4A15A 4WERA 2JGNA 2GJ8A 4WNYA 3KC2A 4C5BA 1XTPA 3JQAD 3KAJA 3LUDA 5BYAA 5FFMA 2FWRA 2GVNA 4NXNB 3BXEA 4L9AA 4ZMSA 4IIVA 1ORWA 4O5OA 1YKSA 5A5VA 3VNAA 3KQMA 5TC4A 1R4AA 3GQBA 4UPDA 2Q3EA 4M86A 5JO0A 4PE5B 3KXPA 1NJ2A 3A9UA 4DCVA 4TMTA 2ZDGA 1E1RA 5E6SB 4NG4A 3IIJA 1MTZA 5KJEA 3LPLA 1KFEB 1U7UA 3H99A 3DW1X 3K0BA 4GVPA 4JL5A 3ETNA 1JZQA 4RNCA 1Y8CA 2XIJA 4ZAFA 2JI7A 2NUPB 4N82A 2NWQA 2Q3JA 3D8RA 1LSOA 5KVVA 3DL7A 1JDSA 3T12A 3GA5A 4MW9A 3U4CA 1Q7RA 1P18A 1MC5A 3H11B 3L4SO 1GUZA 3PEWA 2WYVA 3T3NA 3GH3A 1Y1KE 2G04A 3IP1A 2Q2NA 4JKIA 4CLXA 4CMAA 4J7UA 3AWIA 4C0KA 3K09C 5CFNA 3U16A 1U1GA 3EDOA 1C2YA 3TPZA 4ZQGA 2Q4EA 4IHJA 4UE3S 2VNKA 1CDOA 3A4MA 5BSMA 2YJ6A 5DNEA 4E21A 1UJ2A 4KQ9A 1JR6A 2RC5A 3W34A 3V7NA 3T54A 2CYCA 2E48A 4EHBA 2IYRA 1AQYA 2XOEA 3QTBA 2JD1A 3D31A 4UTPA 1JRLA 3VSDA 3ADBA 4EJSC 4V39A 2XDAA 1Y1RA 4PX3A 4QUIA 3VC2A 5B1YA 1W36D 3M2TA 3M81A 4M1TA 1WV1A 1R10A 2WJWA 4F0JA 1FNSA 2OGTA 5FL3A 3ST7A 1GQSA 1H6DA 3G23A 3AEYA 4F45A 3MJTA 2WW8A 4TL7A 4YUYA 2QTBA 2I6SA 1Z5OA 2VDVE 1I2AA 3JVDA 3WIOA 3DTTA 1VZ2A 2PQMA 3TD9A 4IHAA 4RV5A 1TCVA 3T4XA 3WFJA 1NDUA 3P52A 3INTA 2O8VA 4RF5A 1LPPA 3EFHA 5HKBA 5J63A 2GN8A 1E2JA 1PR3A 3HMKA 3IHWA 4EPTA 5HM8A 4PCUA 3HBJA 4J0HA 3DQPA 2Z56A 4UVHA 5K0LA 1DBSA 2IYYA 2UZ1A 3EZ9A 2Z6QA 3UUGA 2NZ2A 2ZBFA 3ZGOA 3OEHA 2N47A 3H75A 3E27A 2O7NA 2O7VA 4LX8A 2Q1XA 1RJWA 1SUEA 5CVVA 6NULA 1X3LA 3LC1O 3K0EA 3OZWA 4RZ3A 5GJVC 1OFGA 4B3SB 3I09A 2WF6A 1CQIB 4V38A 2NPFA 4WI1A 4NR0A 2GR9A 5CW1A 1YONA 4D9EA 1HNWB 3ZR4B 5ARBA 4KN6A 3DBOB 1MX5A 3G68A 3O4GA 4OB6A 1UBUS 1E8MA 1TK2A 2OV2A 3CONA 5EP2A 1KI6B 5JG7A 1A9OA 1Y8QB 4KBYA 4LMBA 4PICA 1J70A 4HAXA 4OK3A 1XYGA 2OO5C 3ZW8A 3BXZA 1G8MA 4Y2GA 1FP4B 2CLSA 1ZRSA 2DHQA 3KYCA 3U80A 5I7OA 2GESA 1QO9A 5A0VA 1NJ6A 1SVOA 2YZ2A 3C24A 3H42B 3KV3O 3FPEA 4EYSA 2PHZA 1ND6A 4HWTA 1ENZA 1GYPA 4X1KA 2WIFA 3O6VA 4KO8A 2FXVA 3QNUA 1UAYA 4G2NA 5J9FA 4R4JA 3ULKA 5SICE 3PEEA 1GFIA 1MJGA 3HCRA 3P2EA 1NVAA 4CL8A 5CDYA 1QTIA 3OZIA 4RAOA 4NU6A 4ZIRB 2JGAA 2M6RA 3OIYA 4R1UA 5ES4B 4M8IA 3ZCXA 4F12A 5MFZA 1X7WA 3K5IA 1KGDA 1E6EA 4PZPA 1MFZA 2ALJA 1GN9A 1MJGM 1QHXA 5C8YA 4X7RA 3QLEA 1CX9B 2AFHA 2CDRA 4NPCA 1N0WA 3AOGA 4N49A 4WLFA 3T5CA 1E8NA 3RRYA 1XAJA 1YA6A 3W90A 3G85A 1GGFA 3MUFA 4NEQA 3EIWA 3QU2A 2J1LA 1N75A 2R1VB 2XUIA 4JLKA 3Q0TA 3CH5A 3JQ8B 1N2CB 4PYJA 3TE6A 2Y1DA 3R0VA 4EKIA 1CRWG 4Y9RA 2WR8A 3RQSA 4DDHA 1OC4A 4I6GA 2DPYA 1PZGA 3G88A 5EE9A 1FRZA 3MQ4A 2REQA 3ILSA 3WNVA 3ETDA 1U2ZA 4ESEA 2O3QA 3CIFA 5KTYA 4DEYA 3VKHA 2JH8A 2C3UA 1E0JA 1SMKA 4K05A 4RF3A 4O4HF 4RPJA 3I34X 1VFNA 1IIBA 1RKUA 2J5QA 3PFKA 3U60B 2HJVA 1P8JA 5CYGA 4I8XA 4LHYA 4HOYA 4OKSA 4WL0A 1M33A 3VPCA 2ZTLA 2NG1A 4LE1A 5I9LA 1KFCB 2EFCB 4PHHA 5EJ8A 4M7OA 3EXEB 3OAAA 3HU1A 3T3DA 5ESDA 1RMYA 3N8GA 3QY0A 1T5OA 3AVXA 2JRLA 4L4SA 2G1KA 3KQSA 1YR1A 5JZVA 2X1HA 2R7MA 5EEHA 3TCNA 1XQYA 5F1OA 3HWRA 3LQQA 3NH6A 2RHGB 4JU9A 4ZO6A 4Z51A 4B6PA 2JFVA 1CQPA 1CF4A 4FXPA 1KMHA 3CWZA 2AVDA 4GI3A 1E5XA 4GYJA 1QHYA 2R8OA 1YRYE 4R2HA 2WAXA 3MTIA 5CYOA 4WY2A 2R7KA 3WOVA 3KG2A 2FTKE 3HYNA 2QN7A 5IJAA 1W5SA 1NF3A 1YDFA 2OZVA 4MQUA 2GFIA 5EE1A 1ISPA 4RGQA 3UAXA 4BUZA 3ZXXA 1QNLA 4D4HA 4LC1A 2G06A 3O8CA 3R3WA 3TTSA 1NSYA 3BMCA 5FWXA 2AN1A 1ZNYA 3H9UA 3BJEA 2FSVA 3QFFA 4XIGS 1S9DA 4U4AA 3ZVNA 3CWCA 3AIIA 1YZTA 2Z9DA 1SXJB 3GFFA 3D0RA 4UM9D 5LQUA 4PX2A 1S89A 2PZLA 3DC2A 4NV0A 5EG5A 2I1WA 2IITA 3KPYA 3IO5A 4HRYA 4PYKA 3NWBA 4E31A 2OXTA 2P9HA 1RPAA