4JT2A

Structure of clostridium thermocellum polynucleotide kinase bound to ctp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
b'SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
molecule keywords Metallophosphoesterase
source organism Clostridium thermocellum
molecule tags Transferase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jt2A00
1R4AA 1EWRA 1YR7A 2ORVA 4MKGA 1FFHA 4LWZA 3SEAA 2GBLA 1V43A 3B1ZA 4LHWA 4JLNA 1EFRD 3IIKA 1SVSA 3DZ8A 4A15A 3PXGA 4I4LA 4NONA 1JEDA 2O8EA 2VA8A 4D0GA 3RNLA 3CRQA 1EXMA 1UKEA 2WWGA 3GFTA 1IN5A 2O8CA 2ATVA 2B6HA 4M21A 5KNCA 1LY1A 1N6LA 4KBFA 2XOKD 3V4RA 1OPXA 1L4YA 3X1DA 2GILA 2QL6A 2RGDA 2HT1A 3U61B 2H92A 1E9CA 3RHFA 1AQUA 2BVNA 3SC3A 1P6XA 2BHRA 2OLJA 3EZ2A 4NCKA 4NCHA 4OJKA 4OI0A 3ADDA 4KHZA 4HUTA 2DFLA 5FUVA 2P6UA 4H1UA 4CDGA 4U5XA 3QI2A 3TVTA 1G6OA 1R5OA 1RYFA 2NG1A 3OE7A 4N0DA 5AJVB 4DJTA 4DRZA 1BO6A 1KSJA 4HAWA 2XZPA 4QNRA 5JRZA 2WWXA 3GLHB 4LHXA 1FTNA 3C41J 1EG7A 3GEHA 2QPOA 4DLYA 5K8IA 2DWPA 3LLMA 3KL4A 4XD7A 3IO5A 1XXHB 4N0EA 1Z22A 4F7WA 3IUYA 2P5SA 4MH0R 4QHTA 2FJUA 4A2QA 1GL9B 3AVVA 1IHUA 1NMYA 3GLIB 1TUIA 2QQEA 3BB3A 4TL8A 1R0WA 1JNYA 1XEXA 2IYWA 4HSEA 4XSHA 4PHFA 5LD2B 2IUTA 1Z07A 1W44A 5TARA 1UPTA 2QZ4A 4I99A 2B7BA 2GJ8A 2ORWA 4K8OA 5JS7A 3RS3A 2PL3A 1PLKA 4OQLA 1HV8A 1II9A 4HLUC 2RGGA 1UKVY 2GWHA 3CO5A 3QE0A 2QNRA 3UWKA 2BBTA 2PCLA 1NKSA 3SYNA 3K70D 4B3CA 5FPSA 3F0TA 3Q85A 1YZLA 1CP2A 1IXSB 2AXPA 1IBRA 2VIIA 4BZXA 4ACAA 5FOWA 1S9HA 1VG0B 3H0KA 4LYAA 4ZDWA 4EPXA 5FPHA 1JXOA 2ZRDA 3A1SA 1E2IA 4QHYA 4C7OA 1A5TA 3K70B 2ZJBA 2QENA 1GILA 4HAUA 4Z8YA 4B48A 3B1VA 1ZRHA 4A1FA 4GMDA 2WJHA 3CWQA 5JSZA 1G7CA 1G3RA 1CJTC 4F91B 3TVDA 3SBDA 2O8FA 4RKFA 2V6IA 2F7SA 4PANA 1NI3A 3R7WA 3I8XA 1TADA 1COWA 2JASA 3JVVA 1E9BA 1QHXA 3T5DA 3B2EA 3A4NA 2VSXA 1X8LA 1IN6A 2RGAA 1XEWX 4RD2A 2ASEA 1E2MA 3RAPR 2E9SA 3GFOA 1JR6A 3KKQA 2DBYA 2W00A 5KDLA 2J1LA 3IQWA 3ZQJA 1FW6A 1EWQA 4AYTA 1T91A 1SXJB 1D2MA 1R0XA 5C18A 3KX2A 4NYIR 5GVRA 2XJ9A 4IOJA 4MA4A 2F9MA 2ZE6A 3PG5A 2GCPA 4GOKA 3EW9A 4I1SA 4OQMA 3EZFA 4PFSA 1O3YA 4JVNA 3FTQA 2X2FA 3GPLA 5CDFA 3U7FB 4MUBA 2JLXA 3CUEF 3L8YA 4EDHA 4ZKEA 3DZDA 4X8MA 4GZMA 2RH5A 4LOAA 3S1AA 1XEWY 5A5GA 1KI2A 5K8LA 5CM9C 3KTAB 3W8RA 2FSGA 4X8LA 3GJ4A 2ZEJA 1A2KC 2CNWD 3CIOA 3U3MA 1JECA 2XTMA 1Z08A 3PR1A 1KMHB 4B76A 2CLSA 1E9FA 3P32A 2WWHA 4DLXA 1GNRA 1ZIOA 4G5RA 3AF1A 1VCOA 3BE4A 2FFHA 2IUSA 4A2WA 3QJYA 1IN8A 3CLVA 4TN1A 1KK0A 2VHTA 4HB0A 4BFZA 5L3QA 2H8KA 3CRMA 2J7PA 4XJXA 3LD9A 1SGWA 5AWFC 3X1ZA 3PUZA 3NC0C 5IRCD 4OHYA 1PLJA 4DDVA 2EYQA 3AVWA 1NRJB 3QXJA 2OV2A 1GP2A 5JWOA 4R98A 5F98A 1XCMA 2CK3D 1YZQA 3AUYA 4HAZA 3UIEA 2ZSEA 1XJQA 4P32A 4DHEA 3FOZA 1T4GA 1Z47A 3PEVA 4KFUA 1Z0JA 1OE0A 4QG7A 4WAUA 3EZ9A 1Z6TA 1DELA 2J0UA 2GVDC 2FNAA 1V5WA 2J87A 2XITA 4B2PA 4LYHA 1N6OA 2PCJA 2R8RA 3REGA 1NVXQ 3OEED 3A1VA 2DHRA 2IT1A 6Q21A 2JIZA 4QC2A 1D9XA 5DLQC 3RLFA 2X19A 1LF0A 3GFPA 3NIBA 2D62A 1ONBA 3LWNA 3U5ZB 1BYIA 3LVRE 1ZC4A 2XSZA 2I3BA 5CIWA 1AS0A 4RSGA 5DE3A 1ZM3A 3WHLA 5EE1A 1ZYUA 2ZI4A 1WP9A 1ZUNB 2EFGA 2QAGC 4HAXA 5IF9A 3AF2A 4DEYA 4LBVA 3BC1A 3V9PA 4EPVA 2OCYC 3H84A 2QGZA 2ZI3A 1P5ZB 1GRQA 2A5DA 2C9OA 1JR3D 3QVVA 3EA5A 4CYMA 2KE5A 2GETA 4EFNA 2V3CC 3ZVMA 2WAXA 4KODA 5EXSA 1MABA 3TAUA 4QKQA 1NY5A 2IHYA 3BH0A 1QHHA 3IO3A 3C5HA 1WBBA 3QQ5A 1CJKC 4ZI2A 4Q18A 3EPHA 4G01B 4AWXA 1IXZA 5AUNB 2ZI5A 2LKCA 1FP7A 2BDTA 1E0AA 1G7SA 4KAXA 4TTQA 3A4LA 3GLGE 2BBSA 1KI8A 1L8QA 3OIYA 1DO2A 5AJYA 5KSYA 4EPTA 3CNLA 2WMNB 2YJTD 3FKSD 4BLOA 1RYHA 1P4SA 1QVRA 5GJCA 4HB3A 3K0AA 2BEKA 1VG9B 2W6JA 3DKVA 1HYQA 1LB1B 2ZSBA 3I32A 3VU9A 1XTSA 2HYDA 1FNNA 4JJZA 2Q3FA 3TUIC 3AKCA 3E1SA 4IFBA 1ZVQA 2G6BA 1P75A 5FL7A 3P4YA 5JCZA 3AV0B 3QPUA 2VHUA 1XU4A 3W3AA 2FMXA 2P0EA 3A1UA 2FN4A 2C8VA 1E0SA 2JDIA 4AURA 2D06A 4MRNA 4AKGA 2VP6A 1VHTA 3L0IB 1WCV1 1B23P 3T35A 1R7RA 1F2UA 1E9SA 1QHNA 4N3NA 3LQRA 1CTQA 4YMUA 1P2SA 1QHGA 4JT2A 2QP9X 1MO3A 1KI7A 2HDNB 3C15C 3B60A 2MSCB 2GEVA 2ZRGA 3Q5EA 4TT3A 2C9CA 1LTQA 4ZCMA 2QMEA 1OB2A 1BMFA 1NLFA 2I4IA 2JAQA 2R6FA 5K8UA 3B13B 5JFGA 1W49A 3CRVA 4MYTA 3I5XA 2QSYA 3I92A 1JXMA 4M9SA 3UMFA 2VP2A 1RJ9B 1P7CA 3ZD6A 2O8DB 4HUQB 2BC9A 4WA7A 1E2KA 3VR5A 1E9RA 1ZM4A 2VRWA 1G21E 3CZQA 4BZPA 2J45A 4JLJA 1LF5A 1HY3A 1KNQA 2JJ8A 4KV9A 3TKLA 3AF0A 3D31A 5EE3A 2RKOA 4PSKA 4Q19A 3BRWD 3FKQA 2ZRKA 1N6NA 2ZTSA 4EQ6A 2FPLA 5KSZA 521PA 1XD2A 2BCGY 3O47A 4HLCA 5G3YA 2A5YB 4D2IA 5M04A 1LVGA 2RAPA 4E5UA 1PUJA 1RIFA 3EZ7A 3OIVA 1LW7A 4KFRA 4AY2A 3GJ5A 2NO6A 1OYYA 1EX7A 2YWGA 1NN3A 1MOZA 4HATA 1E79D 5JI2E 3C14C 1YR6A 5FOTA 2VYFA 3K9LA 3CNOA 2DYKA 2QA5A 2ZS8A 1C1YA 3RS5A 2ZRPA 5TY0A 2BMFA 2QE7A 1TTTA 4PC2A 4V0MA 4FW9A 5JI3E 2OFWA 4ZPXA 2CEAA 5DISB 2QPTA 5C4MA 1E9EA 5KYKA 1MV5A 1D6JA 1HE1C 1E1RA 5HKKD 2ZR0A 5D3MB 4ZCIA 4GP6A 1IONA 2KJQA 2Z0MA 4URYR 2G0TA 1GG2A 3MD0A 4C0HA 1XFAA 2PX3A 1GL6A 1KO7A 3TR0A 4A8JC 4Q7JB 4YMVA 1YZTA 4DLVA 1A2BA 3THXA 3THYB 4FMDF 5LDDC 4OHXA 4TL9A 1AKEA 1KI9A 2NIPA 1AQYA 3LQQA 3WYFA 1J99A 1M7BA 2ZE5A 5L3VA 2HYIC 1M8PA 2ERYA 1OXTA 1YJ5A 2X1VA 1Z28A 1O87A 4ESVA 4BFTA 1PLLA 2OFOA 3QXHA 4M1OA 4URUR 2WSSA 4AKHA 1G16A 3VKHA 1UF9A 3FHTA 1W0JA 4NCIA 3WP0A 1T3SA 3W34A 3M0EA 1M6NA 2FX3A 1P9WA 5EJEA 2XZOA 4RZ2A 121PA 1GITA 1W0KA 4G1UC 3TMKA 2D2FA 2QM7A 4B33A 2W2XA 5BWMA 1XD9A 1N5LA 4CEIA 3LDAA 3UKDA 2IW3A 2BM0A 4XIGS 1NVUQ 2RGNA 5GADl 2V7QA 3ECCA 3DEFA 4B3DA 3QPVA 3OESA 4KI0A 1ZCBA 3TW8B 4Z51A 1EK0A 2B7CA 3A4MA 4IVPA 5GVSA 4DCSA 1ZC3A 3SJZA 3WYAA 3ZS8A 1Q1QA 2OAQ1 5AUQA 3VX3A 2AXNA 1OKKA 3CX6A 3F5FA 1JAIA 4LJ6A 2V9PA 3DMNA 3KQLA 3CF2A 3CF6R 3KFXA 4PSVA 3UATA 3M4YA 3U3RA 4ASUD 4UNRA 2NMVA 2RCNA 2NO9A 1G19A 1JALA 2ZITA 4AYWA 3TJZA 3WNDA 4A0HA 2QGNA 2J59A 4EKDA 4TMWA 2QMOA 3ZH9B 5F2EA 3P1JA 1SKYE 1KNXA 4W5HA 4X8OA 2VF7A 4ZKDA 1VMAA 4LC0A 1DAEA 4JLKA 4YONB 1OIXA 2PT5A 4B3BA 3HU1A 4Q5IA 4B6EA 2NO0A 4QRHA 3K0SA 1UFQA 3VNUA 3U60B 3GJ3A 5FH9A 5B30A 4CEHB 2FFBA 3R8CA 1M34E 3LNCA 4B44A 4Q01A 1CR1A 2AR7A 3Q5DA 4ERNA 2XTZA 4PC6A 5FI1B 4RCYA 2GHIA 4YMSA 1KI4A 3EPJA 3WMFA 1CEEA 1RRFA 5EXTA 2ANBA 5SZKB 2IXEA 4OI2A 2ZRCA 2PBRA 3ZS9A 4EAQA 3RDPA 2ZRAA 4II7A 3LW8A 1OXUA 3NEJA 1E99A 1IY0A 4G3XA 5F3WB 4LUCA 2NGRA 1KI6A 3U7HB 2ZVPX 5FBWB 3U2QA 3TR5A 1KDTA 2Q9AA 5CK4A 2FFAA 2ZR9A 1HQYE 3NG1A 3NDBB 3FMIA 1SULA 1OH8A 1Z8FA 4Q47A 3D3QA 1HT2E 3Q7QA 4HB2A 4JLVA 2I1QA 2GA8A 1DAIA 3QKRB 1G8FA 3TAHA 4F4IA 1U2RA 3BFXA 3I5YA 1GRRA 2R9VA 4FCVA 2GF0A 3AF3A 4EJSA 2XXAB 3QBTA 4TZ6A 2PMKA 4TMTA 3TH5A 1HA3A 1NF3A 3CH5A 1SVIA 2FE4A 2J46A 5JEEA 5E7JA 1IM2A 2XZLA 2V54A 1T8TA 3IHWA 3OFND 3PCRB 4M22A 1G3MA 1GL7A 2C2HA 4XOIA 5J4LA 1BOFA 3L2OB 2F43B 2GEDA 1NVWQ 1NN1A 1KZGB 3MSXA 4RD1A 4MRSA 1LNZA 2WIAA 3Q8XB 3VX4A 2CL0X 2P3SA 1G8PA 5FTNA 2VHQA 3WNCA 2WWYA 3QG5A 2V1UA 3T5GA 2DPXA 4IVRA 4HAVA 4Q4JB 1CBUA 1WF3A 5TVKA 3ICEA 2H57A 3PEUA 1TF5A 3MRSA 4P0TA 2JLYA 3KQHA 1W36C 3I1FA 2F1RA 4IJMA 1UM8A 4GFDA 5HZHA 5FUXA 3KFVA 3OAAA 1W4CA 2EFHB 2QTVB 2YC4C 3NTUA 2GJKA 3K53A 1VKJA 3NH6A 4DIDA 4YQFA 5KHOC 2ANCA 1NIPA 2FEOA 4UJ5A 3MLEA 2G88A 1QHSA 1RZ3A 2GNOA 1VCIA 3BIFA 1ZNZA 5FFMA 5JZVA 4OBEA 3QOFA 3WBKA 4LPKA 3REFA 1E4VA 2V4ZA 2FA9A 4UNSA 1VCNA 4GT1A 5CLQA 1T9HA 1ZM2A 3U7EB 5TB5A 3R9IA 221PA 1JJVA 1VG1A 3BH6A 1SVWA 1KY2A 2H16A 1WBDA 2JJ2D 1D5CA 1NVVQ 2VLIA 4Q9JA 4ZIRB 1GKUB 2GAAA 4QGGA 3BBPA 1FQJA 3Q3JB 2ZE7A 1W5SA 4JLDA 2IF2A 1YHNA 4P4SA 4MKHA 4Q9IA 3OF5A 3BOSA 4PHGA 1S3SA 1JI0A 3VR6A 3SHFA 4KITB 1T3LA 3QEOA 2GZDA 2I1VB 4HZIA 4A82A 2RHDA 2LWIA 3P20A 4DLZA 5J4HA 3IILA 2CVHA 4LJ7A 1E1QD 3GLFB 3FFAA 3AB3A 1TF2A 2IS2A 2NPFA 2BJVA 4MUAA 4D81A 4WIAA 1U94A 2ZJAA 1MRNA 4JSTA 5JJKA 4GDFA 1A1VA 4LJ4A 4QJ4A 2E87A 5EXXA 3UPUA 2V6JA 4LSGA 4US0R 2GCNA 1KDOA 1YZGA 3QXCA 2QP3A 3GP8A 4JBYA 2CE7A 2ODWA 3Q9LA 3OEHD 4CT5A 3KJGA 1KKMA 4Q4LA 4W9MC 3LBNA 2OM2A 3BS4A 4TYNA 1DO0A 3TRFA 1TUEA 3LH5A 4UXHA 2VPPA 3AGPA 1B0UA 4YMTA 1AJEA 4WZ6A 4FXPA 2ZXUA 2XOKA 1P62B 2IYXA 5HE8A 4ARZB 4Q00A 5SZIA 2AHOA 2WPDA 4D4JA 1E6CA 1UDWA 3W3ZB 5F9FA 3EASA 1E4YA 4BE7B 2QP4A 3ZVRA 1NSTA 2Q3HA 2ZI6A 1F2TA 3AH8A 3AF4A 1EESA 4M1MA 3T12A 4IDQA 2GCOB 3GLHA 4AKIA 1GNQA 1FZQA 3AVOA 3ASYA 4KLNA 5GJWC 4F93B 3UMSA 4GNKA 1XXHA 3FE2A 1Q57A 3L0PA 2QROA 4W5JA 1U0HC 3O8BA 2Q6TA 4KCGA 1WRBA 1SHKA 1E2QA 2EW1A 2KSQA 2G3YA 1JB1A 4MRVA 3HWSA 3RRNA 3L43A 3ZIAA 3GLIA 3TW4A 2REOA 3PV0A 2QG6A 2IYSA 1HURA 2OBLA 2VSOA 1RFLA 1VYVA 1F5NA 1TMKA 2ZU6A 2AX4A 3PUWA 3EPLA 3E5HA 1R2QA 1RKBA 4IXMA 4HAYA 1DAMA 2L0XA 1Q1BA 4Z1MA 1G8YA 1H8HA 1NBMD 2WM9B 1OIWA 4AG6A 4A0RA 4NBSA 2R6CA 3KDSE 5TDHA 4M53A 1GIAA 4M1WA 2C99A 3KXIA 2NO1A 1PJRA 2YV5A 1AN0A 1N3BA 4XD7D 3I72A 4A0GA 1WE2A 2NQ2C 3DM9B 1US8B 2BM1A 3X1XA 1UEIA 4QBIA 4MGZR 4TQAA 4LJAA 5D3QA 4PZZA 4UJ3A 2KBFA 1XTKA 1TEVA 1G5PA 4MGKR 2FPMA 2R6DA 1W46A 2JLRA 2WHXA 4DUGA 2DWOA 1HUQA 5BN3A 1H65A 2PX0A 4M1KA 1HQCA 2GF9A 4JYCA 4TMZA 2N1BA 1KYIA 3RC8A 4KYIB 2J0VA 2W6IA 1JAHA 1ELOA 1YR9A 2OCPA 2WAYA 1TNDA 2F9LA 2QMHA 5J4YA 4W5WA 3DO6A 3E2IA 1E2HA 4H9GA 5KU1A 2YWEA 1NLZA 4Q9HA 5AUOB 3CBQA 4DB4A 1U0JA 1A82A 4G5QA 1SXJA 2OSBA 2QI9C 4BPBA 4Q7LA 3A6PC 3KUDA 2LCFA 4BECA 4QGAA 3VMFA 1R5BA 1MT0A 4OQFA 3TGPA 1FX0B 2BMJA 4Y0VA 2KB0A 3BFKA 3SOPA 3SDZA 4F38A 4GL2A 3SFZA 4V0KA 4B34A 2GJ9A 4A8JB 1C9KA 1N6PA 3SYLA 2WICA 3H86A 5CB6A 2PJRA 1CRPA 4FWIB 4AD8A 2Z5FA 1ZIPA 5KSOA 4GZLA 1F60A 4L16A 5CJ2A 2BCJQ 1PZNA 1CR2A 1KMQA 5TXGA 4C7OB 5KDOA 3KTAA 3BB1A 5BQ5A 4KFTA 2CL7X 2PT7A 4HDQB 4RD6A 5EQTA 1COWD 1NG9A 1EX6A 1KMHA 2C98A 5JSZB 3ND8A 3LFUA 5CYPA 4Z8XA 3THOA 3H2YA 4PAMA 5JLJA 3EC1A 3G82C 4LCBA 4NL4H 1DAKA 2JGNA 4B2IA 5TV2A 3CB4A 1T0HB 3LO5A 1Q12A 3K0FB 3NHBA 3Q7PA 1RVDA 2XNDA 4Z54A 2VSFA 4UNPA 3R7WB 2V55B 3QEJA 2IBMA 5E3HA 3CM0A 2CNWA 4E09A 821PA 3KXLA 2EVWX 4LPSA 4FD2A 1FMJA 2DR3A 1D2NA 1SVLA 2FH5B 4OI4A 3SU8A 2ZUDA 1UJ2A 4RFSB 1J7KA 2FV8A 2XB4A 2OT3B 1DG1G 1P2VA 3K1JA 4I1VA 3A1WA 4B6FA 3JVUA 1N25A 3VNVA 2FG5A 4IDOA 4C2UA 3HR8A 4PAQA 1G64A 3N5CA 2EQBA 4A92A 1FP6A 4EPWA 3D8BA 4C4PA 2ZROA 4XWOA 3RS4A 3LVQE 2QBYB 4RZUA 4NHOA 5DYIA 1CIPA 3QKTA 1OB5A 2LKDA 4YXWA 1D2EA 4XWKA 1E9DA 1G3QA 3AVXA 4B75A 2R2AA 1IY1A 3RRYA 3KKMA 5EP2A 3U6BA 2IYVA 1SVOA 3W8NA 4M1YA 4GBMA 2IEZA 1X8JA 2DCUA 2QT0A 1ZU4A 4MYUA 2J7PD 1AA9A 1DAHA 4EJSC 4HLDA 3GEEA 3MWYW 4OHWA 4QJ3A 4YDSA 4JIMA 2CJWB 2ZRIA 2GZAA 5DI3B 5KNBA 1E69A 3CWZA 3KJIA 5FR1A 2EU8A 3B1YA 4LBYA 1P2UA 3ZZTA 2CBZA 2FU5C 4IDPA 4PO9A 4QM6A 5L3QB 1YRAA 3KJHA 3AQ4A 4V0ME 1ZINA 3C16C 3T34A 2IUUA 1P3JA 2ZS9A 1QBKC 4G5GA 4L9WA 4PQRA 4X8HA 3SNHA 2F55A 5HTKA 4A2PA 2C95A 5JCPA 4C0KA 4RD3A 2PZGA 1VTKA 1ZNYA 4XH9B 3HJNA 3LBHA 1E2GA 1E2NA 4DC9A 4LK2A 4BLRA 4Q4HB 1U81A 3HYRA 4JS0A 4EUNA 2QU8A 4LJ9A 1G4AE 2IYZA 2YINC 1KO8A 4LHVA 2GZHA 5JWHA 5B57C 1KOFA 1S9DA 3QENA 5JBQA 1JR3A 3EWAA 4TLAA 2ODBA 5J5CA 1EFCA 4EPYA 3T1QA 4A6XA 3UWOA 3LA6A 2JLSA 1T5LA 2VP4A 1K8RA 4EFMA 4Y0AA 1TQDA 1Z0KA 1G17A 5LB4A 4R71A 3LRPA 1S1MA 3VR4A 4HB4A 3IQXA 3IEUA 3EWSA 1I4LD 4YLGA 5KNDA 4M1SA 4TL6A 1K5DA 1W5TA 1W36D 2B21A 1FOEB 1KKLA 3RWOA 1I4TD 2MSEB 1GOTA 2BMDA 2O8BB 4DVGA 3FKSA 1H8ED 4OYHA 1T5IA 4AG5A 1N6RA 2ZRJA 4OKSA 5JHHB 1GSIA 2NO7A 5TMPA 4ACBA 1P60A 5ELXA 4DLTA 2O0KA 1UADA 4GI7A 3QY0A 3X2SA 3CX7A 2ODNA 1ZNXA 2ZRMA 3DOEA 3IGFA 4OK5A 5CJPA 2X8AA 4QM7A 2E1RA 1GAJA 4PR0A 4URXR 2NPIA 3IEVA 1MABB 5HPYB 4S35A 4M4SA 4NE2A 1XMVA 2FPKA 5AK0A 2HLDA 2F1JA 4CEJB 5FPKA 5B58C 1W4BA 1X6VA 1FQKA 2GBLC 2WJGA 3I3SR 4Q1AA 4FINA 4C9BA 1UBEA 5JRJA 1RJ9A 5EE9A 4GSYA 1BS1A 2IYTA 2RMKA 4HUQA 2OFXA 2PJZA 5FL7D 5FL3A 1XMJA 3KB1A 3SJAA 2H18A 2QEQA 4PX9A 3NHAA 4DSUA 2IX3A 4PSAA 4PPFA 1IQPA 2OG2A 5A4JA 3L0OA 1II8B 1Q21A 3ZLJA 1NLYA 4HDOB 1OFUX 4JKIA 3U4QB 1BH2A 1OXSC 2JDID 2O52A 4BFWA 4TYWA 1CR4A 2WJYA 1NP6A 3PUXA 1FNMA 2JEOA 4UQOA 3V00A 2D7DA 1PVOA 4IVQA 4GPTA 1CJVC 4AK9A 4B3GA 1DAFA 2CHGA 3LW7A 2YOHA 5FUYA 2QAJA 5FTLA 1GWNA 2WWFA 3FHCB 4LHYA 1PV4A 2GVZC 2ZANA 4WVFA 1DVRA 2N42A 2YYZA 3TIFA 1Q44A 3EPKA 4TYYA 1MO5A 4JYBA 2CE2X 2OEPA 1LS1A 2X2EA 5CITA 3EZ6A 4DT1B 2XGJA 2QT1A 1NNEA 4E07A 3K9HA 2PH1A 1D8TA 3T06B 3WMEA 2RGBA 3K0EA 3PUYA 4DDUA 1OH7A 2Q3MA 3C4JA 4A6PA 1JPJA 2ZRNA 2Z83A 1GVNB 3U7GA 5LD2C 1GKYA 4B3XA 4KSBA 4F92B 4BZQA 3GJ6A 4KO8A 3TE6A 2Z4RA 2BKUA 4D25A 1KZ7B 2WKPA 1Z3IX 3QPWA 5EE5B 3LAWA 2ZUBA 3C8UA 3TSOA 3QUSA 3D7MA 5LBIA 5EP3A 3ND9A 3EC2A 4POAA 4LHZA 1W48A 3PVSA 1XPUA 5D3MA 4TZ0A 1Q1EA 2ZRHA 1MO4A 3NBYC 4D80A 1EFHA 2J3EA 4ZO4A 1AS3A 1T6NA 1DADA 1XDBA 2GXQA 5JMTA 3SFVA 3NBFA 3VAAA 1X1SA 5BN4A 5B64A 2ZJOA 3AGQA 4JT4A 3THYA 2FSIA 1OFTA 2GESA 4P31A 4PZLA 2IS4A 2ZR7A 3GJ8A 421PA 4D6PA 5A0FA 1RRPA 3B1XA 3A36A 2AK3A 2ZSAA 1CJMA 1QG2A 3NBZC 4Q7KA 3SS8A 3D6TB 1PUIA 1JJ7A 1MR3F 3O8RA 1UBGA 2RGXA 2R44A 3DOFA 5G53C 1XNJA 3EG5A 1YQTA 5BYKA 1XPRA 1HTWA 2QE7D 2ZYWX 4LC1A 4TMXA 2ZI7A 2CCGA 1VCMA 5JWRA 3MAAC 2A30A 1E2LA 2DFTA 2EYUA 5E4FA 2JLWA 4HLUA 4PTLA 4NKRA 4QNMA 3LX5A 1XMIA 4BFUA 4GOJA 4AI6A 5GJVC 4DCUA 4ZCLA 1C4OA 4FMCB 5DYGA 4NCNA 2JLUA 2CXXA 1S1CA 4M2LA 3TBKA 1KHTA 1J8MF 1XCGB 3MJHA 1R0YA 1YU9A 4UNNA 2KWIA 3QNUA 3GCGA 1JBKA 4HZUB 1CJUC 1GKIA 1SXJC 3RYTC 5IT5A 5P21A 5C2JB 1XB2A 2EFEB 3VQTA 1G3UA 5LPNA 2VP0A 4Q1BA 5SZJA 3HP1A 3KKPA 4IOMA 5DH9A 4BUJA 4MDEA 2YWFA 3A8TA 2J0SA 1UAAA 3C7KA 4DSNA 2UZIR 1W4AA 2IWRA 1U8YA 1OHHD 4L5BA 4B35A 3HDTA 3VKWA 3RRMA 1XTQA 5L3SA 4TSFD 4A4DA 3EIQA 3NH9A 3THXB 1LV7A 4IOLA 2XX3A 2WSSD 3LBIA 1P73A 4Q03A 1OV4A 4ASUA 1W0JD 1X86B 4BLQA 1W2HA 2F6RA 4ITRC 2ZRLA 3IPXA 4R9UC 1ZM7A 1W0KD 1KJZA 3QF4B 1KO5A 1FUUA 2NZ8A 4CEHA 4A9AA 4BEBA 2AK2A 2FSFA 1W47A 2AKYA 2HXYA 4KFSA 2V7QD 3OIUA 3THWB 3KJEA 2W2TA 2OCBA 1RPZA 4E22A 4XVUA 3DPUA 3GLGB 4C30A 4KYUA 1UEJA 2YC2C 4S2EA 4V0LA 2DY1A 2VHCA 2JA1A 3SN6A 4LI0A 3KXKA 2VP5A 4US2R 1NVVR 1GNPA 4XVRA 1G291 4AIIA 2HCBA 4PC7A 2BBWA 4I1OA 4OL0A 1J2JA 1QG4A 4AC9A 4XTRA 4PPNA 2G0NA 1RRCA 2MMGA 1N6HA 2X77A 3FMFA 3LXRA 4XTCS 2ZI9A 2JLVA 3GLHE 2OUKA 3AEZA 5JJLA 1UBCA 1DPFA 3R8FA 2YZ2A 1E32A 3QKRA 3U44B 1MKYA 4PPGA 1XXHE 2BV3A 2BMEA 4M9ZA 4LV8B 2AN9A 3QXSA 4NU0A 3GLIE 3MGCA 4NZYA 4KXFB 4RZXA 3H4MA 5J47A 1OSNA 3RRZA 3U3KA 3ZZ0A 3UXMA 2F43A 3HR7A 2IYRA 4KSCA 2NZJA 2J5XA 3AUXA 3AP3A 4UNQA 3W9YA 2QQ0A 3PEYA 1TPZA 1KK1A 3GJ0A 3QKSB 5DN6A 3PUVA 2J7KA 3AVPA 4Q4JA 1Z0FA 1GUAA 1NSFA 4Q21A 1DARA 1OJLA 4D0LB 2YVUA 4FWTA 5KO2A 2SHKA 1JPNA 4JLBA 3DL0A 2FDCA 4DLWA 2C78A 3DVLA 1A4RA 1VIYA 1WXQA 3FGNA 1SVKA 2REXB 2QN6A 4Q4AA 2MMCA 2G9NA 1P61B 4WBSA 1UKZA 4URWR 4B47A 4H1VA 4L15A 3I4LA 2WJJA 2IYLD 4V03A 1Q3HA 3FFBA 1G8GA 4BQSA 1OT3A 2A5JA 1YZNA 1M7HA 1CLUA 3B9QA 2G83A 5J4VA 5FTKA 1MRSA 1XJCA 3O8DA 2HEIA 3B85A 4DBLC 1I2MA 3EARA 4US1R 3GD7A 3ZYCA 2XJ4A 1XTJA 3FMOB 2A3RA 3ZD7A 2AWNA 3PENA 3VTKA 1D9ZA 1KDPA 3QXXA 2QPAA 3FMPB 1QHIA 2FGJA 4XVQA 5IK2D 5HCNA 4P4UA 4ZIRA 1ZNWA 1KO1A 1ZP6A 2EFDB 4EPRA 3BAFA 4BASA 3RABA 4QBHA 1R8QA 1SXJE 1BIFA 4IDNA 4JVMA 4EFLA 2OAP1 3MCAA 2A2ZA 1Z0DA 4TLEA 4LX0A 3K09A 4Q48A 4BRUA 5GJBA 3OAAD 2BIFA 2QRNA 3N70A 2HCJB 4LDJA 1Z5ZA 4RVCA 1U9IA 2ZSDA 5FPTA 3PITA 2JJ2A 4FN5A 1KK3A 2W58A 1J70A 4F4CA 3GLFA 2QAGB 3WNBA 5LB2A 5BW8A 2YWHA 1TQ4A 3K0CA 4MGYR 1OLOA 2ZYVX 1TQ6A 5FPYA 1ODFA 1E2DA 1Q3TA 4YDHB 1AZTA 1N6IA 4FMBB 1CU1A 2R6GA 2C77A 1XMSA 2PLFA 3CR7A 1ESMA 3TK1A 4C0QC 3UANA 4RD0A 1VIAA 4MGIR 4PC1A 3CR8A 2RB4A 1G9XA 2ZYTX 2R65A 2IYUA 2BBOA 3IBGA 4FI3C 1KTVA 3G5UA 1IY2A 3JZMA 2JJ1D 1G3IA 2JCSA 2ZETA 3AKEA 5HCIA 4B43A 5C4GB 1RC8A 1EFRA 2ZUCA 2F1HA 1DTSA 1VYTA 3O8CA 1KDRA 3SR0A 4ARZA 1IJEA 2JLQA 3HU3A 3IBYA 4C0SA 2WWWA 4K46A 4GMXA 1IAQA 1YZKA 2CMKA 4JKYA 5FBRB 2H5EA 3GMTA 2GCOA 3B5JA 4Q1FA 2UZ3A 4J0QA 2WZQA 2QUZA 3NVAA 4O2LA 1RW4A 4GRAA 3L82B 2F1IA 4TL7A 1N0VC 3NKVA 4Q1DA 4P4SB 1X8KA 3NBXX 3QSYA 1DAGA 4HYYA 4JVSB 621PA 3T1TA 2IC5A 3CNNA 3PFIA 5HR5A 1JQLB 2OZEA 1F48A 3BB4A 2WKQA 4PC3A 4DCVA 1U0LA 3BWDD 3M1IA 3OIWA 2YOFA 2ZPTX 4M9XA 1II0A 2H1LA 4PO1A 3BH7A 4WW0A 1SKYB 1HE8B 1E98A 2WOJA 3WY9A 1GRNA 5KTYA 4FCTA 4LJ5A 2WPDD 1AKYA 1E2EA 2HUPA 4JLAA 4TMKA 3TNFA 4D4KA 3CH4B 4M1TA 4TQ9A 3ZQ6A 2O8EB 1ZW6A 4BLTA 5DSZA 1ZMXA 1SKQA 5EUMA 4IRUB 1ZUHA 1AGRA 2O8CB 3IPYA 3PQCA 4NP6A 4HDCA 5EE0A 4L4UA 4RD4A 4Q9KA 4PO8A 1L2TA 1TQ2A 1WQ1R 1E2JA 4CZ2A 2R62A 1DEKA 4MKFA 5L3RA 1US8A 1CXZA 4I81A 2VEDA 3OE7D 1NBMA 2ZYUX 4JZKA 5DIFA 3RS7A 3ZIAD 1F2TB 2QORA 1KSFX 4NYJQ 3FYHA 4D4LA 3VFDA 1CF4A 4P33A 5DNYB 1XD8A 4B2LA 1Y63A 1YE8A 3QIAA 1XZPA 1N0UA 2C96A 2XB2A 2RGCA 3MMPA 1Q1ZA 3HPQA 4C0JA 1WB9A 2F3RA 5JEDA 3TQCA 4ZV4A 1WA5A 3K9NA 1JR3E 2PMDA 2A78A 3AVTA 3DDCA 1XP8A 1OFIA 1OXVA 2WV9A 1H8HD 5AR1A 3T15A 2C9YA 2IF0A 1I4DD 2AL7A 1G20E 4DCTA 3RS0A 5UKDA 2A5GA 4NTZA 4MITA 4B32A 3RSLA 1OIVA 2IYQA 2Q9CA 4UKDA 3NWJA 4ILEA 5FOUA 1YZUA 2F3TA 1G18A 1XEXB 1FX0A 3J81k 1QZXA 2GK7A 4U7DA 2IXFA 2G77B 4HLQB 2ZIAA 5KPJA 4OK3A 4A8JA 4D4MA 1ZD9A 2ATXA 3VHXA 2ZQ5A 4LBWA 4DUGD 2ONJA 1AS2A 1NG1A 4CVNA 2B8WA 2YNMA 1XBTA 1NJGA 3DMDA 1DG3A 5CK5A 3R9XA 2IXGA 4JL5A 2BEJA 2HJVA 3AKYA 4C0AC 2RGNC 4DXAA 4C2TA 1OF1A 5DGXA 2W6ID 4LRWA 4UXJA 3I61A 1HH4A 1KI3A 4P4TA 1P2TA 1G4UR 1U99A 2PLRA 4DSTA 3R9WA 1Z63A 2FOLA 2W83A 3K0FA 5SZHB 1SXJD 5BXQC 1VHLA 5EP4A 1E96A 3SBEA 4B73A 2ZVQX 4KU4A 5JECA 1Y3AA 4IXNA 4A0FA 2IYYA 4RFSA 1XJ0A 5KPDA 4O2RA 2RHMA 2QTFA 4JBWA 2ZJ8A 1N0WA 2CDNA 3E70C 1FUKA 3RVBA 3ZVNA 2WTUA 1W2GA 2PZFA 2O8FB 4URVR 3U3JA 1U98A 1Z06A 1RE0A 5DHFA 2PEYA 2BKEA 1Z83A 3RS2A 3JZAA 4BLPA 1KAGA 3DKPA 2P5TB 4DLUA 3KQUA 2WSMA 3A58B 4BLSA 2OLKA 3KUCA 2QBYA 2OBNA 5AJZA 2GJAA 3CONA 2C03A 4MDFA 5H8WA 3NXSA 3QVUA 1F3OA 5CM8B 3CRRA 4CW7A 1W1WA 1SZPA 1XEFA 2O0HA 5HZKA 1L7VC 1GTVA 5AUPB 3FPAA 1XRJA 3A1TA 4DDWA 4PZYA 4MYHA 4WZBE 3NEYA 1QDEA 2GRJA 2XNDD 5KSPA 3CKLA 1VECA 2ERXA 3FWYA 3RWMB 1M7GA 5J40A 2OHFA 3HU2A 2KI5A 1F6BA 2AD5A 2CJWA 1KSGA 3WXMA 5ANRB 1XX6A 5DI3A 2FFQA 2VBCA 3K8YA 1TL7C 2CK3A 4QHSA 3EIEA 3S1AB 5K8TA 2ORIA 1I2DA 2ZM5A 1KAOA 2K5UA 2ZU0C 4NPHA 2IK8A 4MKIA 3TQFA 4DIEA 1S2MA 4OK6A 2B8TA 3IIMA 2W0SA 1KJYA 3BK7A 4BRWA 3AP1A 1ZUIA 2GEUA 4WXPA 2P67A 2QM8A 4M0LA 5AJWA 4G0NA 4YXWD 2UKDA 3ZDQA 4MRRA 2BJWA 3P27A 5L8VA 3OEEA 1WDTA 3VHLB 4XSGA 2Z4SA 3VR3A 3CZPA 2D2EA 2Z43A 2EFCB 3F8TA 3CPEA 4NYMR 4Q4HA 4QGFA 3K9GA 3SZRA 1XTIA 3RANA 4TQUS 1T0JB 1NMZA 4JVLA 4WZAE 3V4FA 1Z2CA 4B74A 4CF7A 2W0MA 2GAOA 2WBLC 3QBVA 5KUTA 4FIDA 4RJLA 2DB3A 2WOOA 3AP2A 1QRAA 5FUWA 3GQBA 3A37A 2J0QA 4JJKA 4AKEA 4G5SA 1E2FA 4LV6A 8OHMA 4PHHA 4Q1CA 1AK2A 1Q20A 4WXRA 4IOKA 2JIZD 1SVMA 2GXUA 3C5CA 2AKAB 2N46A 1G41A 1FPMA 4IEEA 3WBJA 4DZZA 2ZRBA 2ZSFA 2O8BA 2J0UB 2XSZD 2OE2A 2VL7A 4Z1MD 1RRGA 1YRBA 2ZAOA 3HPRA 3P4XA 3SE0A 1G7RA 3PIRA 5E7IA 4QBGB 1XZQA 1S96A 4TLBA 2CLDX 4F4JA 4E03A 4AYXA 1R10A 1ZM9A 3L0SA 2D7CA 4C0LA 1TU3A 4LZZA 1Z0IA 3CPHA 4NYIQ 3K09C 2GDJA 1H8EA 4FMDB 4LYJA 3WMGA 3M6AA 2G1JA 4A36A 1OH6A 1JQJC 3WHKA 3VKGA 4DCNA 1U9IC 2OXCA 3ZGXA 1LS6A 1Z6XA 1FMLA 3KZ1E 5DHAA 2CHQA 2ONKA 3HYTA 4I1UA 3KKNA 4R7ZA 1U8ZA 2VQSA 4PXAA 4U02A 4LGMA 1W36B 3BJIC 4CEJA 3K0CC 4GOXA 4BEJA 3WYGA 1LFDB 4PQYA 1VDZA 1E94E 1R6BX 2GKSA 3FVQA 4QBFA 5E7MA 5FOXA 2TMKA 4V0OA 2P6NA 2HF8A 3KKOA 5FR2A 1N5IA 1KSHA 2GJSA 2QTHA 3TLXA 1QHHB 2NOAA 2DFNA 1ESNA 1G8HA 1S4QA 5J4KA 4Q66C 1II8A 1GZSA 2W6JD 4IW3B 5FI0B 2P6RA 1G6HA 1CS4C 2P2LA 3SJBA 3U4QA 3F3YA 4JMPA 3X1YA 5FBQB 4HEJA 1K5GA 3LXXA 4JSYA 4MRPA 4U00A 5H68A 2O8DA 5EZ6B 2D3WA 1KGDA 1XTRA 4QFMA 1KI1A 4C0BA 4TYPA 4LV5B 1GFIA 2A7QA 1N5JA 1R8SA 1NL3A 2WWIA 4Q1EA 3KB2A 1JEEA 4NH0A 4IFEA 1MH1A 3K0AB 1AZSC 1DOAA 3VU9B 2J9RA 1E2PA 2ZREA 4M9QA 2VO1A 3AVUA 2HLDD 2WVJA 2XNSA 1YKSA 3GEIA 4JL8A 1GDDA 1NKTA 4MYCA 4PPQA 4OI1A 1BKDR 4DT1A 4ZI3A 2CCKA 1P72A 3U6KA 2ZJYA 1KY3A 3U3OA 3IKJA 2ZJ5A 2WKRA 4NYMQ 3TUZC 2IS1A 4W7SA 1ZAKA 1KK2A 2IWHA 2JLZA 2ODEA 4TT3D 1Z29A 2MSDB 2HT6A 3UK6A 1BMFD 721PA 4GP7A 4BFVA 1MO6A 1QVAA 1F2UB 4IDHA 1S0UA 3EX7C 1SHZA 1OH5A 3ETLA 1E0JA 5CYOA 3FHOA 5G41A 3KQKA 1U90A 1IN4A 3I8SA 5IDVA 5FBLB 2QRZA 3L8ZA 5EZ5A 3W5JA 1E0KA 5G40A 3G0HA 1WMSA 2VF8A 1ZD1A 4P3YA 1E79A 3AKDA 3UG7A 3PEWA 5BN5A 1AM4D 2P65A 1W7AA 2V8OA 2DWQA 2RGEA 1E3MA 4CT4B 1X1RA 4R2HA 5JJIA 2C04A 2WIBA 4OQNA 3N2IA 4O3MA 3X1WA 2HV8A 3MFYA 3I73A 3P26A 1IOZA 1K6MA 2BWJA 3SJCA 2OILA 4EQ6B 4FCWA 1IXRC 4Q7MB 1XD2B 2FEMA 5HKKA 3RC3A 3K70C 3IHLA 4HI0E 4KBGA 4O0MA 1EFTA 3B78A 4DDTA 3EA0A 3B1WA 1R5NA 2BOVA 3ADCA 2DFKB 3QKUA 3N2EA 4LYFA 1NN0A 3UG6A 2GXAA 5E95A 3B7GA 3AVQA 2EWWA 4ABYA 3SQXA 1XWIA 2IS6A 3QG1A 4HZUA 2FSHA 1IN7A 4KLZA 2FF7A 4M8NE 3CX8A 4JLMA 4RY2A 1KO4A 1E1RD 1X3SA 4K81B 2IA5A 1UBFA 2GTPA 4PAOA 2XEXA 2ZRFA 4D82A 4LJ8A 5DO9A 1KIMA 3ZZUA 4DLSA 1ZJ6A 4IEIA 2EWVA 5DI9A 1Z6YA 5FOSA 2VTKA 1NJFA 1AGPA 5KOYA 1Z0AA 1BYUA 2CVFA 4N1AA 3MG9A 2O0JA 4EIWA 2OCAA 1HT1E 3GLFE 3B82A 1SQ5A 3QF4A 1YR8A 4C3ZA 1OHHA 4MQBA 3BGWA 4UXIA 5EXPA 2AD1A 3MJRA 4TSFA 3IIJA 4DLRA 5FOVA 2HF9A 4RKEA 3MUFA 1M1YE 3THWA 4TLDA 3BFVA 2CHVA 2UVQA 3GLGA 2IL1A 4OJQA 4IKEA 4G5OA 2A9KA 4OHZA 3NDPA 4TMVA 3KQNA 3EAQA 2GK6A 4JBXA 3NC1C 3T1VA 3CF0A 1CULC 4QJ5A 2XAUA 3VR1A 5JS8A 2H7VA 4DWJA 3SHWA 1XCPA 4D0NA 1N6KA 3T61A 4CGZA 4TYQA 3WRXC 3MWJA 1IJFA 1UDXA 3OHMA 2YHSA 3Q72A 3W6NA 2V1XA 2IEYA 5H1YA 5CIQA 1GM5A 1OFHA 1OKKD 3SYKA 4OQXA 2B92A 4CEIB 2CL6X 2OESA 3AM1A 3U44A 1M74A 2ZJ2A 5B2ZA 5EUQB 4BFXA 2FZ4A 2PZEA 5L3SB 3BD9A 1S3GA 1VPLA 4NDZA 2AWOA 2YOGA 2A5FA 4NMMA 1FTSA 4B3FX 3ASZA 2VP9A 5C1BA 1G1MA 3ONWA 2WJIA 3LLUA 4KVGA 2AFIE 4V02A 4Q9LA 2XXAA 3ZJYA 3LY5A 3BORA 2WJVA 1ZBDA 4QOSA 2CCJA 3ADKA 5HE9A 3QKSA 3TUJC 2Q9BA 3B6EA 1J8YF 1KJWA 5BYJA 2Y8EA 4IHQA 1OYWA 5JHGB 2ZJZA 3EIHA 4BFSA 1CRQA 3ICQB 1OXXK 2ECKA 1L4UA 1VYUA 3W6PA 1TEXA 2IHBA 2YKGA 4TWZA 3B9PA 2GXSA 2NTYC 4CIDA 3SQWA 3LV8A 1HEIA 1ANKA 4QGHA 5G3ZA 3R20A 4DSOA 3RSOA 3OFNA 1EGAA 5IHPA 1OW3B 4ON9A 1NY6A 4RFVA 2WMOB 2FWRA 4WOPA 1NBME 4V0NA 4BFYA 2C5LA 2D4HA 2J41A 1TAGA 4RZ3A 1R0ZA 1YVDA 2Q21A 4RCZA 2JATA 5C46F 4TTRA 3UMRA 2ZE8A 2HJGA 1KI6B 3W6OA 1TX4B 2W2VA 4PQFA 5CB8A 3PJRA 2ZS7A 1W4RA 4ESHA 1VG8A 3T1OA 4JLOA 3ZVLA 3DM5A 2G1KA 3LX8A 5DN6D 4R2IA 3VR2A 3I62A 4URZR 5AJXA 4KJZA 4B71A 5FTMA 2HXSA 4JL6A 4L8GA 1N2CE 3SI7A 4EJSB 4JLPA 3AVYA 2QSZA 2FZLA 4CRWB 1Z6AA 2Z6VA 5KDDA 4DEXA 1ZCAA 2D74A 1Q22A 3DHWC 1Z6GA 3TSZA 3WP1B 4LBZA 4NCJA 1G7TA 2OXRA 1CKEA 1M2OB 1UKYA 2QY9A 4OHVA 4FMCF 3FDIA 1DE0A 3MWKA 2OO7A 2REBA 2R6AA 5IK2A 1QF9A 1A7JA 5FBVB 2QAGA 3EXAA 2CLCX 1Q0UA 3FB4A 4ZDJA 5EP1A 1TU4A 4NYJR 4QL3A 1CR0A 4BWYA 1NIJA 4ZDKA 4Q4AB 1G5TA 1FL9A 2AFHE 1ZU5A 1QHYA 1TF7A 3H1TA 3IDQA 4TTPA 1NN5A 1T3HA 2Q0HA 2PEZA 4QXAA 4KVAA 4LJYA 4TLCA 3W90A 3CPJB 2VH5R 4ZDIA 1J90A 1ETUA 1P9NA 2QMUA 2KBEA 1P9RA 1N5KA 5H70A 5F9HA 1U8AA 4L9SA 1E1QA 3BERA 3CW2A 3OZXA 3B8HA 1XPOA 1EFUA 3WRYC 1S8FA 3QF7A 4Q02A 2JJ1A 2H17A 4O25A 3CRW1 1T8UA 2FGKA 2O5VA 5CLLA 2OBMA 4D26A 1AIPA 1DBSA 1NMXA 1ZD8A 2VHJA 3MWLA 3OEHA 3GJ7A 4YC7A 2XTNA 4XWAA 4LY6A 4DKXA 3BXZA 1XF9A 1Z2AA 3TSWA 4YMWA 1E9AA 3ADBA 5FTJA 4PHTA 5CDFE 3GJXC 4BGDA 1DS6A 2ZAMA 4DB2A 1G5RA 3W5IA
chains in the Genus database with same CATH superfamily
4F46A 2OKCA 2OB2A 2OV4A 3SEAA 2PGLA 4QYWA 2OC4A 3M1YA 1HNNA 4JLNA 4CTNA 5GY7A 2VSYA 1QQBA 3FB1A 1LZLA 5EA2A 1Z12A 3GPCA 5AW5A 4HDMA 4I1PA 3LWDA 1T2UA 3C1OA 3INRA 1IWOA 3PXGA 5T67A 1JHZA 4BLVA 4HDRA 2YJNA 1V1MB 5BSGA 1EPUA 2AV6A 3RVDA 3CX3A 2VA8A 5CFOA 5JT1A 2AFIA 3RNLA 4CHGA 1B8UA 3ICOA 1JDSA 4E7OA 1M34A 1KFEB 2X3UA 2ATVA 2B6HA 2OCXA 3F71A 1EVIA 1F0PA 4H17A 3EY9A 1AXRA 2IH5A 2XOKD 1PT8A 2Q1XA 3BEOA 3GRVA 4YRSA 3U09A 2H1SA 2IV2X 2BFEB 2V7VA 5HRCA 3U61B 1Z5GA 1U7PA 2BFWA 2Z1MA 5C81A 2H92A 3OCCA 1TJPB 3STWA 3SC3A 1PJ3A 1YK0A 3RJ9A 4B6SA 4MUGA 3SS7X 1JHDA 5SYMA 3FPFA 5KAPA 1MA0A 1NT4A 4Y2QA 4QFCA 4H7IA 1LBEA 3HA7A 4PZCA 5LXTB 4NLLA 2OAEA 4EJMA 2YVKA 2RONA 4HUTA 1BS9A 2DFLA 3L1UA 1BEUB 4GP9A 5ALTA 2ASVA 2P6UA 1H1DA 4H1UA 2OXIA 5CA0A 1RXYA 1RYFA 2NG1A 4DRZA 1L7DA 1YCGA 4MRMB 3WX0A 1E58A 3OUTA 1KSJA 3WJ1A 4FDTA 3S8EA 3FCXA 3G0IA 1AVTA 3E7WA 3TCNA 2IBSA 1JWBB 1M2WA 3C6XA 5B4VA 2PH5A 2WSBA 5K8IA 4EM6A 2BMAA 3D1VA 3IO5A 1T26A 2NV6A 3CZRA 4QSMA 3EVFA 4F7WA 1MOSA 4HWRA 3IEIA 4QELA 2OCLA 2GK4A 2XMGA 1R8YA 2CWDA 2VJNA 3DDNA 4MH0R 3S7TA 5AI5A 4W82A 4J43A 1XKXA 4G97A 3SBXA 1MX1A 3SM3A 3DLAA 3AVVA 3BB3A 4TL8A 2CYAA 1XEXA 1UBMS 4PHFA 1CX9B 4IGKA 4B82A 1A7KA 2BZ0A 2IUTA 3L9WA 1UPTA 1XL0A 1OAOA 4PTYA 3WA7A 1YTLA 5FBZA 4BMZA 1E7YA 2G09A 3HP4A 5JS7A 1SBNE 4E2XA 1DHTA 4OQLA 1HV8A 1II9A 1O5OA 2VC2B 2RGGA 4HLUC 4P82A 2ZOSA 3ETEA 2GWHA 3C7TA 1PJSA 3CO5A 3E3OA 1Y1SA 2QNRA 3FOBA 3HDVA 3L7YA 1FLAA 3P9RA 3UWKA 5HJEA 5IT4A 2QYOA 2W11A 1I94B 1NKSA 2ZWVA 1ICIA 3H8WA 1ZVMA 3SYNA 3TLBA 5HNKA 2FR1A 3Q85A 4EUKA 1YZLA 3CURA 1CP2A 4UATA 1BZYA 1ZH4A 2NXNA 1YZHA 1DUSA 2AMJA 4GF5A 1YASA 4HDNB 3PC6A 1CWUA 5JS1A 1R5JA 4AMGA 2Q3LA 4GE0A 3H0KA 1VG0B 1SU8A 3GFQA 1H2FA 4LSWA 5FPHA 1PV2A 1E2IA 5THKA 1DEHA 1YFJA 3VYWA 1A5TA 4XARA 2NXCA 4M87A 1IOVA 2AW3A 2Y1DA 5CD9A 1U5AA 1U0FA 4B48A 1TYEB 2ZIWB 4FYKA 2QYSA 4B9EA 3ID6C 4YRJA 4RTKA 3MUOA 3ONEA 2WJHA 3CWQA 5ALJA 3ZHBA 3NM5A 3WKCA 5JSZA 1J0CA 1CJTC 3TVDA 3H9BA 4MV1A 3VKFA 2O8FA 1PJZA 4L4XA 5BN3B 4NS4A 1C9NA 2V6IA 1GGEA 4PANA 3I8XA 5JZSA 1QJ4A 1UXHA 5DNYB 1E9BA 4BNFA 8GPBA 3A4NA 2JFNA 4GXQA 4X95A 1SEPA 4IIJA 3ZU5A 2NUAA 4W1PA 2ASEA 6ADHA 2R8OA 2ZTVA 5EJ6A 2E9SA 4JP8A 1D2HA 2I3DA 3GFOA 3ZHZA 2X8LA 3KKQA 2W00A 5KDLA 2J1LA 4RX1A 3TRJA 3ZQJA 3FJ1A 5B7NA 3H4VA 3HJTA 4ENWA 2NUTA 1D2MA 1V37A 3KELA 3KX2A 4WBNF 2QVLA 2PJUA 4R8RA 5HBRA 3HSSA 4D8YA 1S02A 2CWWA 4IOJA 4YR7A 1A9YA 1NBHA 3P2KA 5G0TA 1WZCA 2F9MA 2Q4RA 2ZE6A 3OJ0A 4P7GA 3EW9A 4I1SA 3GPLA 2QIPA 1IM8A 3G6WA 3DR5A 2ZB7A 5SICE 2MSLA 1P0FA 3ZZNA 2JLXA 4U7FA 1XNRB 5L4NA 4EDHA 2NYVA 5CTAA 1RQRA 1JIVA 1UUFA 4GZMA 4R8KA 1IMOA 1LX6A 1MPXA 5IAJA 1KI2A 4YECA 3KTAB 2FSGA 2EFJA 2POCA 3Q0TA 5JSHA 1Q95A 1IVSA 1A2KC 2CNWD 2HJ9A 3IAXA 3Q7SA 1KH1A 1R0CA 5KB3A 1AKUA 1Z08A 1DO8A 4IHJA 3JYHA 4WBXC 3ANXA 3P32A 4O8ZA 4QZVA 1O2DA 4F4DA 1QYXA 5AH0A 1DKNA 4DLXA 1XMQB 3T7AA 4GICA 3WLFA 4PYRA 3BE4A 4L7QA 4N0PA 2QLFA 3RTAA 4A2WA 3N39C 1KR5A 2JHCA 5T4FA 3TD6A 2H8KA 2IDJA 3JYLA 2WUFA 4OFWA 2J7PA 1SZCA 4YMGA 3WB9A 2NSHA 2WJZB 4PLZA 2JFXA 3MCWA 3STYA 3TDNA 1T36B 5JMWA 1Z2PX 1BOOA 4MMXB 4PWZA 1SGWA 4JHXA 5AWFC 3T38A 4BFCA 4OLHA 4XEHA 4OLAA 4WEOA 2OXTA 2CJFA 1WY7A 4B3TB 1L5KA 3GGOA 4AQ7A 4X62B 2YHBA 3FYUC 4IJVA 5CVDA 3DPSA 2VYVD 4X1OA 4P5PA 3USZA 4ZOQI 1MXFA 2EYQA 2Q5HA 3JQBA 4QLOA 2CNNA 2AJCA 3W2HA 4U0JA 4IUYA 4CKYA 3NHLA 4DMKA 1TC1A 5JWOA 1XCMA 1U3GA 5ETJA 1OV6A 1YZQA 1VJTA 3VOAA 2B83A 5K9ZA 3W5BA 3HJFA 4J7CA 1HLDA 2ZSEA 2X22A 3DBHA 3LWZA 3I58A 4HWPA 3N59A 4P32A 2PLNA 4O29A 4A16A 3I53A 2DAPA 2XMZA 5IZCC 4JAVC 2V7UA 5K6AA 1NDHA 2I0FA 3KL2A 3ZXIA 5AO9A 3K6JA 5IVHA 1Z0JA 2WMYA 1A77A 1J9EA 1QIDA 4D92A 4C88A 4MHOA 1GCGA 4B2PA 3QEMB 4ZU3A 3TX6A 3AWDA 3GHYA 1PN3A 2IIVA 5BV1A 2VNHA 4OQEA 2DHRA 6Q21A 5FA8A 2JIZA 5DLQC 2WF6A 4ZTUB 1Q0SA 3ZCSA 1XCJA 3NIBA 2D62A 4JQZA 2RHTA 1DQRA 1O08A 4RVGA 1RACA 4TN5A 1HTTA 2XSZA 3BIJA 4OGLA 4XYLA 4GU5A 1ZM3A 2OD2A 2Z6UA 3WHLA 2B4QA 1W19A 3A25A 3JSAA 3RASA 2EFGA 5EINA 4IIXA 4LBVA 1B73A 3BC1A 1GQOA 4O59O 3MHPA 4FYJA 4MWDA 4Q93A 4XCXA 1MP0A 5AVUA 1JA1A 3RAEC 2YZKA 3MAGA 2C5HA 2Z3WA 5HQTA 5E1BA 3UY4A 1Z38A 1GRQA 3Q2KA 4YUVA 2E4ZA 1JR3D 2HK8A 3IJEB 2CBXA 3DE1X 4CYMA 4Z0TA 2KE5A 1NMSA 2GETA 1DOZA 2UUAB 1IZ8A 4QYIA 3S1SA 3TFQA 2PAFA 3QOYA 1YVPA 3TIXB 4JYZA 3IP8A 1QHHA 1I4WA 2P0AA 4IIUA 4UEKA 2OZLB 2WYHA 2Y3IA 4TRJA 1CJKC 1U80A 4ER0A 1Z5UA 1EKXA 2J5BA 2NU9B 4CKEA 5FWXB 1ZX1A 2JS7A 4G01B 1IXZA 4UEQA 2ZI5A 2LKCA 4AWXA 4FDUA 5AUNB 5K3EA 3C1UA 4TTQA 1W75A 3SE7A 2BBSA 4ZARA 1ABEA 1KPHA 3BXOA 1DO2A 1RAAA 4HRVA 5AT1A 4ZVPA 4BN0A 3C3JA 3RADC 1KPIA 1PVVA 3DAGA 3LVBA 4BLOA 4ETWA 3FKSD 5LL6P 4GAEA 1DKOA 3BGSA 1RYHA 3VH3A 3I2YX 4M0FA 4ZPJA 3QPDA 3SIRA 2X7HA 3IAEA 1HYQA 2ZSBA 1ES9A 1XTSA 2YHIB 5J59A 4EI7A 1DEXA 1XYGA 1NW3A 3IB3A 3TUIC 4R16A 3E1SA 1QYWA 1DI0A 2OV8A 2Q5QA 2PUWA 3IMEA 4FHEA 4GE3A 3FSGD 3BTOA 1RHKA 3QPUA 1MQSA 1U1CA 2VHUA 5EZYF 1G98A 5LA6A 1NQVA 4J9UE 4NBKA 4L3WA 3CFYA 2QSJA 2YTZA 3A1UA 1C9MA 2X9QA 2XDAA 3DT8A 3HSKA 1S8AA 3LQ1A 3RJ5A 1ZMBA 3OOJA 4R69A 4DV2B 4LJLA 4AP5A 3V9AA 7ABPA 3SXUB 4BQPA 3T41A 2GYVA 1PQUA 2O3SA 4IDFA 2XQKA 5U4XA 3L0IB 4UQLA 3W3AH 1QP8A 2PDAA 1E1CB 1JU9A 1I6LA 1Z2EA 3MERA 2WFZA 1RQXA 4OHMA 1QHGA 1CQJB 1FDRA 4JT2A 1MO3A 1E6LA 4KE8A 1S2DA 5BVGB 3NYWA 3HCWA 2OY0A 5I6DA 1XHLA 5JYEA 1N2IA 1VI5A 3D7NA 3I9LA 2C9CA 3N6XA 2AJ8A 4TT3A 1OB2A 1NLFA 1P4GA 2I4IA 5DLYA 2EIHA 1Q77A 3B13B 2HQRA 4RSHA 5K8UA 4JYAB 1OBOA 1W49A 3KB6A 4JUIA 2O3QA 3GH1A 2X40A 5D8DA 4M9SA 4CMCA 6AT1A 1QWSA 3FCAA 4HUQB 1YUNA 4WLNA 4C03A 1E9RA 2FP4A 1G21E 2OV6A 5TX7A 3R09A 1NM5A 2J45A 1KNQA 2A9RA 3DKIA 3KZXA 3PIIA 4JLJA 4KV9A 3TKLA 3D31A 4GHWA 5EE3A 2G07A 1KYZA 3LIPA 5I9TA 5D51S 3FKQA 4RV9A 1TDJA 1U04A 4EQ6A 3LYHA 2FPLA 3PHBE 1UBJS 2CMGA 3CPSA 1PKXA 4Q39A 2I3GA 5HW0A 4CKCB 2VXBA 3CT6A 3VPAA 4CTMA 2O1WA 4GWGA 3NZEA 5C7LO 5JANA 1LVGA 4E5UA 5BY2A 4NEQA 3OQ6A 1XVAA 1L4LA 2HRDA 1T9GS 1KOLA 5G2OA 1JTFA 4YRZA 1LW7A 4GIBA 2QK4A 2NO6A 3OFVA 3HYCA 3WI7A 3R4VA 4I9GA 5KHLB 5JXJA 4HS9A 3WGQA 3RTEA 2RD2A 5JTUA 3EEOA 1E79D 2FEKA 3GBSA 2P3OA 4O2AF 4D3XA 5FOTA 3MTAA 3QITA 2VYFA 3RHTA 1N2OA 2DZDA 4FYPA 2OENG 3RS5A 3AESA 5B55A 1WEKA 4CTJA 3G9UA 4M0DA 5TY0A 1NPTO 3O5AA 4QRIA 2QE7A 4PC2A 4TUYB 1A8HA 5AW7A 1GG9A 4FW9A 3EH1A 4D9FA 1KARA 1TTPB 3FDJA 2OFWA 4ZPXA 5DTRA 3G8DA 1E89A 4PHCA 5DISB 5C4MA 1K2VN 4IIYA 5C3UA 5KYKA 4RK5A 1HE1C 2ON6A 4BNHA 4C7KA 3E3LA 3E53A 5DRTA 5HKKD 4M37A 4IMIB 3KPJA 3H7IA 2BP7A 5CVCA 3P52A 3QK7A 3SX0A 1IONA 2KJQA 4MP3A 4URYR 2BGWA 3PGA1 1GL6A 2BZ1A 4LVUA 2GPTA 3N28A 4S2UA 2A86A 3ORSA 4G37A 1CUSA 4KXLA 3UK2A 4YMVA 1YS2X 3ELYA 1C9YA 4LZLA 4RMHA 3T7EA 3THXA 3DAFA 4H6VA 1HC7A 2BLLA 2D1RA 1ZRNA 1I10A 4WZAB 1A76A 2O4CA 1TD1A 4JOBA 1JQEA 5L95A 4XW2A 4NENA 2SECE 4R1LA 3ZW7A 2EKLA 4C0XA 4PG6A 4XPIA 1YJ5A 4Y6GB 2JFZA 1Y1KE 3OE4A 4ESVA 3BE8A 3PHLA 3AHCA 4H0NA 3CW9A 2F90A 3H65A 3I09A 3SIPA 1PLLA 1UQTA 4URUR 1SBIA 2ZAYA 5EI5A 1JEYB 4GYWA 3HP7A 4Q0MA 3M4JA 1XZHA 3HI4A 5IVKA 3PPYA 3W34A 1M6NA 3GBPA 4UU1A 4ZJYA 2PSDA 3T7TA 121PA 1GITA 1LX7A 4F84A 3C6MA 4IV5A 2PX8A 3KUXA 2QL9A 2FMKA 4ND3A 1XZDA 5TGZA 4JI6B 4GQAA 4ARVA 1ZICA 4TZKA 2H4JA 4XOUA 3PNYA 2PSHA 4DA6A 3DAPA 2FHSA 5EJIA 5EWJB 3R3HA 4E2ZA 5HKBA 1Q16A 2GMWA 4KRXA 2P4UA 3GPIA 1I30A 1DRVA 4IF6A 2PWYA 1RWBA 2Q1SA 4GL4A 4Z51A 1YQ9A 4L28A 3UT5B 2C5BA 4FUQA 3SJZA 3VNAA 3Q9UA 3VX3A 1N36B 2DE0X 4IX1A 3IDAA 1QSGA 1EK1A 3CF6R 3UATA 4UNRA 3U3RA 2FUG1 1UPBA 2BEUB 2C59A 2RCNA 4DM7A 3O8LA 2NMVA 1YKFA 1NT2A 2ZITA 3TZCA 4D4GA 2FYTA 3Q7IA 5FA6A 4HVLA 3MINB 4A0HA 3GUUA 2QGNA 1DKPA 4JYMA 3EEFA 5JC8A 4EKDA 4TMWA 1WLYA 3DXYA 3L7DA 4RC9A 5F2EA 3P1JA 3QVMA 3TLKA 4F3KA 3BMCB 4EHFA 1N7JA 4R54A 3RT1A 3U49A 2A9QA 4EVRA 1PKEA 2HPAA 4NCBA 2NO0A 1FTGA 1KMIY 4I6EA 3TLGB 2O0MA 3IOCA 3OM8A 3K0SA 4CI0B 1L5MA 5FH9A 3AIOA 1ICEA 5B30A 3F98A 1M34E 3LNCA 3FF4A 3OT1B 2JGLA 3ZWYA 4DLNA 1X14A 4Q01A 2AR7A 2VBGA 1S3IA 3GRKA 1BKSB 3RU2A 2JFUA 3LKBA 1PJQA 3LDGA 4RCYA 3R3VA 1GSOA 3CINA 1KVUA 3S2FA 1RP1A 1I1OA 2FVYA 1YHYA 3D1JA 3ON5A 5IDYA 1GR0A 2O57A 1B00A 1G5QA 3H5WA 3N8GA 4EZBA 6PFKA 2PMWB 3NEJA 1OXUA 2XE6A 1U6IA 3GRRA 4FGJA 4MQEB 4RSRA 3TZEA 1L5WA 2D2VA 3U7HB 3VU8A 3GGGA 1A8SA 2BW0A 1JFSA 5HZGA 1GA1A 3F6PA 4RIFA 2ZR9A 2EQAA 3NG1A 1W35A 1YS6A 1CCWA 3GNTA 4LN1A 2RC6A 2NUPA 4Q47A 4BO8A 4C0WA 4Q7QA 2XD9A 1OH8A 2B3TA 1R66A 3D3QA 5A3RA 1HT2E 3EG9B 3NBMA 1G60A 1JIJA 2P6PA 4LEIA 4Z4QA 2NYRA 4HB2A 3STVA 3FH0A 2EERA 2JCYA 4F4IA 3I5YA 3H3JA 3LE8A 1GRRA 3OCJA 3OZBA 3AF3A 4B17A 2YZMA 2QV0A 4J3NA 5CB4A 4NFHA 1UKCA 1OLUA 1MUUA 4UU8A 5KYUB 1SXGA 5E7JA 1IM2A 2YBEA 1C30B 3L4BA 1T8TA 3NR2A 2G76A 4W9NC 1WDLA 1YRQA 2YQZA 3A14A 3KWLA 2ZXEA 3N6RA 3W77A 1S89A 4S1PA 5J4LA 1JL3A 2YIVX 3OO1A 3G0CA 3L2OB 1QF7A 1L6IA 3FZQA 3TL3A 3OT5A 1NN1A 3QYJA 3CZAA 3G0DA 1KJQA 3DVAA 2GT1A 3M6FA 1JMKC 3LF1A 2CL0X 1ZN8A 4U3JA 3IKTA 1ULUA 2X4GA 3EIUA 2XI4A 1PK9A 1DDIA 3VYSB 4AJ9A 3QG5A 3U9TA 4MWEA 4HAVA 3CUUA 4Q4JB 3SMQA 2NTEA 1GPMA 1TTHA 3PQ5A 1JQ5A 1O54A 1K3FA 1WF3A 2GM3A 2WYWA 5IM5A 4BVEA 2D3TA 2C5EA 2ECQA 3ICEA 2H57A 1BVRA 2J6HA 3UQZA 3I6YA 5CNIA 3RUDA 4EG0A 2PD3A 3FA2A 3KQHA 2V58A 3CISA 1VSUA 1ZWKA 4DREA 3N0XA 5IARA 1UM8A 1FTYA 1JRLA 2X41A 4RV5A 4U1RA 5HZHA 2RSLA 3KFVA 1W4CA 4AU1A 2PKQP 2QTVB 3O9ZA 1MRZA 2CB0A 1PQYA 2Q4OA 2WJPA 5EFOA 3ESCA 3H83A 1XDUA 3T1YB 3NT5A 2ANCA 1NIPA 4R31A 4U7JA 2EGUA 3DMFA 4QQNA 2HC9A 4RK0A 5HGJA 3C98A 3SIXA 5E7QA 1TU0A 5JZVA 1T9KA 3AHHA 3TOZA 1U9YA 2ZIGA 4RH3A 1OXBB 1E3LA 3QFCA 3QKIA 5BQXA 3RFTA 1DB3A 3AETA 4AUEA 3GL9A 1FXWF 3B89A 4I5IA 5CLQA 1T9HA 1XQXA 5H5JA 3U7EB 2QN2A 3PXAA 4WBNA 2BN4A 3NHFA 5C1IA 1J06A 3RR2A 1CFZA 5L3ZA 2JJ2D 4O2BF 1Y98A 1S8NA 1UAYA 4HNAA 4WN9B 3QLVC 4QDTA 3H9QA 1SD1A 1GKUB 1F4VA 4CETA 4PYMA 3BBPA 1FQJA 2B8JA 1X1DA 2IU4A 1W5SA 2OHVA 5ALUA 2DXIA 3AW9A 4MKHA 4BJHB 1I3KA 2YWCA 2D5IA 4P2BA 4BNWA 1TVMA 1XOIA 3VR6A 2AQ8A 2X3FA 3T9DA 3JQ6A 1J0DA 4J16C 4AG3A 3VDXA 1C2YA 1JBQA 3WNQA 2CVHA 1Q14A 3W5UA 1AUVA 3W2TA 2NPFA 1YRWA 1EGMB 5IC5A 4D81A 1MRNA 1XO1A 2AN4A 4YJ3B 3HCRA 1A1VA 4LJ4A 3X3HA 1OA0A 3DHVA 2FKNA 4RVOA 4TXMA 2I33A 4QU0A 4DMLA 4LXYA 4OPMA 5FNVA 1KDOA 1YZGA 3OMXA 5TIIA 4YJGB 2ZTMA 2ODWA 3OEHD 3KJGA 1GJRA 3VPCA 3LBNA 5LZ5A 4PEVA 1V11A 4TS4A 4O0LA 4X6UA 1JLLA 5EMLA 3KR0A 3SM9A 3W79A 2VPPA 3ERCA 2JFOA 2VPIA 5AD1A 1SQGA 2JBAA 3N2YA 4HVCA 1VDMA 2TMGA 4Q00A 3E05A 1C5KA 1UCFA 3NVMB 1B7GO 3RYIA 1CZNA 3Q10A 2F9FA 4D4JA 1RTKA 5F9FA 1ADBA 1DLJA 3O91A 3OQVA 1M1ZA 2ZI6A 3HVHA 1DIGA 1LSUA 4UMFA 1ZNQO 5CCDA 3GLHA 4HQNA 3TRKA 3MGBA 4CDMA 1GNQA 2WU0A 3AVOA 4BNKA 5GJWC 3SZ3A 3T3GA 4D44A 2ROQA 3UMSA 3AIKA 4Q3BA 1A9OA 1Q57A 1SB8A 4LC9A 2E5WA 1PL0A 1GTMA 3QLUA 4QULA 1Q19A 5DTQA 3VAYA 4Z2AA 2XYPA 1SHKA 4WDQA 1E2QA 5HKOA 1SR8A 1FRZA 3V1LA 3RRNA 3L43A 3GLIA 3MWGA 3NAZA 3TW4A 1V7CA 3PPXA 1PX0A 2WAOA 4MWSA 1D3AA 2QG6A 2EX1A 2IYSA 4EKNB 1WZUA 3S55A 2BONA 1ILWA 1RFLA 1U28A 1TMKA 2R48A 1JAZA 1L5QA 3EQ6A 3FMVA 3LT2A 4UM5A 5B58T 2XCSB 1I3CA 1R16A 4CKWB 1FNBA 1RKBA 4WNIA 3OQHA 3X1JA 1DAMA 1O94C 2QN7A 1QFXA 1MORA 4GZ5A 4ZYXA 3CLRC 3U7IA 1K6IA 2XEDA 2RIPA 1G8YA 1NBMD 1V9LA 2FK7A 3WLIA 3OIGA 1E7WA 1H2YA 1N7HA 1P0CA 2VYQA 3KDSE 4KX5A 4OXQA 4M53A 5TDHA 4A0RA 1GIAA 3R76A 3ZJVA 5C7IO 1JUDA 1X7YA 4M1WA 3HSYA 2Q50A 1MXHA 2YV5A 2C7VA 4C4RA 5MDHA 3DZKA 4R7TA 5TPWB 4BPRA 4LXTA 4P3KA 2DU8A 1A4XA 2AOVA 1QV6A 1TYZA 4AMBA 3TRHA 4NMHA 4UJ3A 1HDEA 4MGKR 4DBZA 2FPMA 3N6VA 2Z9CA 4P2GA 4AJEA 1J0AA 3DV2A 2I6FA 3DULA 2HIHA 3UAOA 4LF5B 1OYOA 1VKRA 4N7RA 4YCMA 3LQ4A 1JG6A 4EWLA 5DHRA 2IDKA 1HQCA 4LNUB 3PJGA 2D1YA 2GF9A 5LQSA 4JYCA 3NTLA 3HU5A 4QEKA 4RPLA 4P0PB 4KYIB 3UJNA 2G70A 2J0VA 3OZUA 3R8XA 2OCPA 2VSNA 2XWQA 3M81A 3QVLA 4DV5B 4AO6A 2VWGA 4QASA 3IEKA 1P4AA 4F12A 5J4YA 5JVDF 2HGZA 2QVXX 2B30A 4I9UA 1U4NA 1E2HA 2BTQA 2GN6A 2JZNA 2X7XA 4PONA 4BMCA 2X0IA 4X1YB 4GPBA 1YHZA 5EQJB 2PN1A 2DLDA 3GIWA 5EZYA 1FFCA 4Q7LA 5KOIA 3ND7A 1W87A 2LCFA 2JJQA 3PJFA 3VMFA 4A27A 1MT0A 2FY8A 2F8LA 2BMJA 3P9NA 4Y0VA 4Z4IA 1KEPA 2W6OA 1QH0A 2HY7A 3D43A 3GAFA 4GL2A 4MKXA 4UCQA 4B34A 2GJ9A 3E48A 4Y3UA 1ZXBA 2UVPB 3OPVA 4YDRA 1C9KA 1JDNA 2XWPA 3OTGA 2Q6OA 4PN3A 5TQ2B 4KQJA 1P4RA 4NNPA 3U81A 3R9XB 1CR2A 2XMQA 1KMQA 3ZWWA 4F5EA 2ISCA 2QMQA 1ZCJA 2YDXA 3BB1A 3NU1A 2WFLB 3PC4A 1QNLA 4KFTA 2CL7X 5CX1B 4DDKA 4RD6A 1NQTA 3CA8A 1EX6A 1KMHA 4K9PA 1UKBA 1M2HA 4LQDA 2WWVD 4BV2A 3AI7A 5JSZB 2WUGA 3ND8A 3QBJA 3THOA 4EABA 3V48A 1UMBA 5ADHA 1H05A 3GMSA 2WD8A 3G82C 4NL4H 4YK7A 1DAKA 1VC2A 2N75A 3MT7A 1AF7A 1T0HB 3JSXA 1Q12A 3DD1A 4HFJA 3TB6A 1A9XA 1RVDA 2Z2YA 1H42A 2QVGA 1TM5E 1RXUA 1E5QA 2Z09A 3WDMA 1C9DB 4LPSA 4YLYA 4HH3C 4FD2A 4YIHA 1D2NA 4OI4A 2HDOA 3SU8A 2XH8A 4RFSB 4QQRA 3HWRA 3MMZA 1J7KA 3FUVA 3KOZA 4UCXA 3MOGA 2NUAB 5FV4A 3FI0A 2D6FA 3JZIA 2YW2A 1NASA 4I1VA 4B6FA 3WGVA 4XA8A 2Q1WA 4ZVLA 1POXA 4B7CA 3VNVA 4A10A 1U9ZA 2C54A 2PSEA 5HTOA 4CMGA 4A92A 5FYDA 2OGZA 4C4PA 2V97A 3WWEA 3RS4A 3ZWAA 2ADMA 1H22A 2HSGA 3HHPA 4DNPA 3LUGA 4IS3A 5HIKA 3F5QA 4QTTB 1CIPA 3QKTA 4FIZA 1OB5A 1D2EA 1PQWA 2QD4A 1E9DA 1WM1A 3MJ4A 4FDVA 4L4ZA 4ZAXA 3AVXA 2NSJA 3OJOA 1SVUA 4R05A 5JCJD 5EP2A 1QU3A 1C9JA 1SCKA 2H1RA 1SVOA 3NI2A 4RJIA 4QO8A 4D96A 1U2GA 4BNTA 4GBMA 2ZR8A 4TWJA 2IEZA 4OJTA 1Q0HA 1RNLA 3LUJA 4RDXA 3NXKA 4O8CA 3FNHA 3F7OA 2W8BB 5EKSA 2HA3A 1RPNA 2J7PD 2V7TA 1DAHA 3ZE0B 4BN5A 2ZUFA 1C7IA 1K8ZB 3PWKA 3QIVA 4OHWA 4QJ3A 5TS3A 4JIMA 2CJWB 4O08A 2G71A 2ZRIA 3BA1A 2E0IA 5KNBA 3CWZA 5E1DA 1JDZA 4WLUA 3H16A 1OFVA 4LBYA 3STUA 4EY8A 2BT4A 4D8WA 5BOSB 2FXIA 2YCBA 3AM4A 3NGLA 1JW9B 1MJGA 3O95A 3D02A 3IIEA 1JDUA 3C16C 3VC3A 4J7AA 1S7CA 1P3JA 2VK1A 4V24A 4G5GA 1E8NA 5J23A 4X8HA 1LXCA 4UD2A 1W94A 2FUKA 4WOJA 1DIRA 1V8PA 2JJMA 3N1UA 5EY5B 4JP2A 2Z57A 4XH9B 1J39A 4D8TA 1E3DA 1E7RA 5EMKA 3VI4B 1NP3A 5IUKC 3S99A 4ZEVA 3JAMA 3T9EA 1ID1A 4Q4HB 3HYRA 4G09A 1NFQA 5IPFA 4BJ3A 5JWHA 5G0VA 4AUNA 2GZHA 2HU2A 1S9DA 2Y1EA 5LOVA 5JBQA 1QQ7A 4TLAA 1MC4A 5ADWA 1EFCA 4ZEXA 2JEZA 3Q40A 4X97A 3ITEA 4OP2A 3DQZA 4GW3A 1V8FA 1DV2A 3ZLTA 3UWOA 1KRHA 4DR4B 5HYVA 3EGCA 2WFMA 2RHOA 3TZKA 3JU3A 5AOVA 1Z0KA 4IIVA 3UTDA 3K96A 2UYGA 3VR4A 1H2RS 1T0IA 4BNUA 1YRYE 4HL6A 5E1OA 5KNDA 4M1SA 2VDMB 1W5TA 3UT0A 2B21A 5EEHA 1W36D 1ADGA 1I7QB 1LBTA 1KKLA 1QYCA 1OZAA 5G4KA 8ABPA 4JY7A 4AP9A 3OECA 5LNK6 1KA9H 4IDGA 3D6FA 2O8BB 4AG5A 4OYHA 4D4HA 3MT0A 5CR9A 4G0WA 1YONA 2ZRJA 4OKSA 4ETMA 2XHZA 4OHRA 1KAEA 3EW7A 4ACBA 3JQRA 2VHXA 4XQGA 5B12A 1AGXA 1P60A 4U5QA 1AX9A 1HDGO 5FKJA 4E5VA 1EVQA 1V4VA 2IPLA 4IQFA 1QU2A 4IBOA 3CX7A 1PU2A 1ZNXA 3HKDB 5EWMA 4RK7A 2GOYA 1NUSA 1X7WB 1CQIB 4HJXA 2EZ4A 3KYBA 3C39A 3G23A 1GAJA 3OZIA 5B3LA 2JIPA 4UUAA 3PXEA 1BE8A 3WGOA 1STOA 1ND5A 1XMVA 4NE2A 2AVDA 4OJMX 3TTWA 5MN4A 2HLDA 4JWTA 1O0BA 4BJ6A 5JZBA 3HHEA 4CEJB 3KS9A 4MV7A 5B58C 3GPDG 4CKEB 1XRRA 3UC5A 4C9BA 2XVAA 4ZQEA 4MW2A 4DWVA 5JRJA 5EE9A 3DMTA 1KS2A 1ZR2A 2RMKA 2B7LA 3IR5A 4NMWA 1IE3A 2NXEA 4F5ZA 1WCIA 3E1KA 2PS0A 4CWAA 2XUDA 1XAHA 4E4YA 1ZLXA 4R6XA 2H18A 2Y9MB 1J2RA 3NB0A 3I8OA 1Q7TA 2IX3A 1CF2O 5EPEA 2QRGA 5K3FB 3ZLJA 5E2BA 4TYWA 4P98A 3QXJA 2O52A 4JGGA 4EMUA 3VTZA 3ANMA 5K0ZA 3G8BA 2OMEA 3PUXA 5KWVA 3LXMA 4R68A 2Y0EA 1YBHA 2ONYA 2PL9A 1UR5A 2VPWA 4IVQA 4AROA 4AZVA 3R0ZA 1CJVC 2FZVA 4L72A 4B3GA 5HBGA 2CHGA 3O1IC 3RARA 1GG5A 1TYCA 2FCAA 2J07A 4KQFA 4MVJF 1PF7E 4QUBA 5FTLA 1BROA 3FHCB 4MUJA 5DSTA 2GVZC 4GUDA 5BSMA 1P4HA 5E6SB 3EPKA 1E2UA 3SSAA 4JYBA 2CE2X 2ZJ4A 2FR0A 4F4HA 2X58A 4HYQA 3FUXA 4NNJA 4CLOA 1RBMA 3SC2B 2P3LA 2QD2A 4E07A 3F1KA 3STHA 3WMEA 3EQ2A 5EQDA 5H83A 3AR7A 3K0EA 3PUYA 4RQUA 4K1XA 1OH7A 2Q3MA 3C4JA 3PJEA 1T0PA 4M76B 1C1HA 2HB6A 2XQGA 3TX2A 3BZWA 5AM3A 3U7GA 3U0VA 3UHOA 1KAHA 1U3UA 4HOYA 4BZQA 3O4HA 2RHWA 1F2VA 1X2EA 2RB5A 2BKUA 1S3FA 1QQ5A 3TTTA 3MTDA 3KVYA 3P0EA 3QPWA 3IQZA 4RPJA 3RVSA 4F96A 4D0SA 1MW8X 3K4QA 2EP8A 4F06A 5LBIA 5EP3A 3T3PB 4POAA 3Q15C 3PX2A 3WTCA 1XVUA 1W48A 4TZ0A 3ICVA 2G4CA 1Q1EA 1F8GA 4U2EA 3C3MA 3MXTA 1WL8A 5AM1A 4D80A 9GPBA 2J3EA 1ZVVA 4YACA 1LDNA 1XDBA 4E2WA 1O9HA 3F3KA 1UQRA 3GLSA 5B1DA 1WZ2A 2OR3A 1L8OA 2BR4A 3AGQA 3HB5X 3LY7A 2GESA 5LP6F 2J3IA 1QFJA 4IO0A 2ZR7A 4ND8B 1O1YA 1QPZA 4FHZA 421PA 3OZ7A 4D6PA 5A0FA 4JI0B 3HKBA 5BRJA 1DQSA 2AK3A 4MLDA 4Q7KA 1CW2B 4MJ7A 2HJRA 4OV6B 1Y8QB 2FQ1A 2GUGA 4E30A 1CUAA 1RJEA 4TV9F 3RFXA 5DBGA 5KINB 2GDZA 3FJYA 5ALLA 5BYKA 1BNCA 1L4KA 1WR8A 2QE7D 2CDBA 2OA0A 1USWA 5LU8A 4DV1B 4KRFA 4KXXA 1M8KA 2UXCB 1VCMA 4MV6A 2J9ZB 3EEYA 3MAAC 3WLNA 3R5HA 5E4FA 3BXFA 1Z45A 3EVAA 4HLUA 3EDYA 3SDBA 2JLWA 4NKRA 1ZD5A 3B9BA 3EC7A 1PR9A 4AI6A 1MQ9A 2VZ0A 5GJVC 5LBTA 1B1AA 1GQFA 2J3HA 3LCCA 4QDJA 2LVBA 4ZCLA 3VR0A 4BFUA 1RT9A 3AFGA 3IAAA 2NTJA 5CYGA 1H9CA 4NCNA 3IAS6 4M2LA 4IMRA 4JX8A 5HDQA 3T7CA 3TBKA 3ORFA 1YRLA 4F45A 1XCGB 1TCVA 2DUWA 4KMSA 2V7GA 1R0YA 3RK4A 3TW8A 3N2LA 3QNUA 1HDXA 3WK7A 3UJCA 1E6MA 3RYTC 4F11A 5IJ0A 4PIVA 1JT9A 1GPLA 2H2WA 1CYDA 1G3UA 5LPNA 2VP0A 3OY2A 1V16B 5FWAA 5DH9A 4IOMA 2X0NA 4BNYA 2YWFA 4XWGA 2PKQO 3HJRA 5ITVA 2N47A 4RH0A 5DYYA 4DSNA 1CVIA 2UZIR 4ERXA 4L5BA 1FIUA 4F3CA 3I2GA 4H3KB 3RRMA 4IQGA 4TSFD 4ANFA 3THXB 1ZMOA 3O3MB 4ER5A 4Z53A 3MZ0A 5I7VA 3NHWA 3FNGA 4PYJA 1P73A 4ASUA 3G0OA 1CUCA 2Q29A 3AFOA 3PGLA 4ZD6A 3ZE1B 1E3SA 2F6RA 4ITRC 4XB2A 2X8WA 3KRTA 1KJZA 2FLWA 3H3FA 3AEUB 5B37A 1FUUA 4X64B 2ALJA 3DR3A 4GVLA 1MFZA 2AK2A 2QV7A 2FSFA 3B1JA 4G63A 1X1AA 2XUKA 5CPFA 1IZ0A 4GR5A 5CEFA 4WA8A 2W2TA 2W6ZA 1JIKA 1VM6A 5A9TA 3OP4A 4BGUA 1XZ8A 4Y2GA 1UEJA 1Q1AA 4U7WA 2AC4A 4FI3F 4NIMA 1K7YA 4QG3A 2XNHA 2B0JA 2C3OA 2IHUA 3WQQA 2CLFB 3ND6A 1OY1A 5BSFA 3BJZA 3HVIA 5D1NA 3VRHA 3A9SA 1TIPA 1ORVA 4DV7B 4Y1EA 4XEUA 1G291 1FU8A 4CM8A 2C4WA 5C8XA 4I1OA 1RRCA 1J2JA 1QG4A 4R40A 3MTQA 2EJWA 2G0NA 1SK8A 2V96A 1VE7A 3G3EA 3ZDXB 4K9RA 4UOZA 5L9AA 1LCIA 2X77A 1TM7E 1K86A 2JCVA 4C06A 4ISBA 1YR2A 1IYZA 2I2XB 4OM7A 3RYHA 2JLVA 2V0CA 3GLHE 4UMVA 1R12A 4P08A 1WDWB 3R8FA 3ZDZB 1ODKA 2YZ2A 3AR2A 3QKRA 3SG0A 1MKYA 3ZX5A 3U44B</