4JT2A

Structure of clostridium thermocellum polynucleotide kinase bound to ctp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
b'SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
molecule tags Transferase
source organism Clostridium thermocellum
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jt2A00
3K0AA 3I4LA 3WMEA 3OE7D 4PPNA 5LB2A 4MA4A 1ZD1A 5BXQC 2W6JA 1UM8A 2BKEA 2XGJA 1QHIA 3CUEF 2VHUA 5DI3A 3NWJA 4PC6A 3PFIA 4WVFA 5C46F 2ZEJA 2QG6A 2WOOA 2IA5A 1NKSA 2PH1A 2OAP1 5FR1A 2ZS7A 1Z6XA 1Z0JA 5KDLA 3VNVA 4OJQA 5BN4A 4GBMA 4MH0R 1HQCA 3CM0A 4MDFA 4B2LA 5TB5A 4PO8A 3QPVA 2GXAA 2GAOA 5A5GA 1YR8A 3FHTA 3EARA 1RYHA 2EFCB 3EIHA 4Q4HB 5GJBA 2GJ9A 4LBYA 4DDWA 1B23P 4TYPA 4XIGS 1T3SA 4L5BA 4UKDA 4ZDWA 4UXHA 2IF2A 2QRZA 3LLMA 2Z5FA 4QL3A 1D6JA 3RS3A 4Y0VA 1NLFA 2OHFA 4PX9A 1MO6A 5JBQA 1ZC3A 2FGKA 3I62A 1SXJC 1BMFD 5LB4A 2KJQA 2FA9A 2FSFA 3CLVA 2OM2A 2YC4C 3DO6A 4TMKA 5EXXA 5KTYA 1BYIA 2GF0A 2WPDA 1M2OB 1W0KA 2GK6A 3UMFA 1F48A 1YRAA 3DOFA 3HPRA 4RCYA 2F9LA 4KFUA 4DRZA 2Q9AA 2DHRA 3CWQA 3GEEA 4QRHA 1W2HA 5SZIA 4A6PA 3AQ4A 3SOPA 4EFMA 3U60B 5F3WB 4OK6A 1NRJB 1W47A 4BFWA 1IOZA 1DAFA 4JLNA 5FL7A 3WHKA 1OJLA 1LF0A 4B32A 3EX7C 4HAVA 2OAQ1 5EP2A 1UBFA 3FHCB 2NIPA 3SYLA 2WPDD 1N6HA 1G6OA 1XCPA 5DN6D 2QTFA 4LV5B 2CL6X 2Z0MA 4JL8A 4HLUC 4YMTA 4D4MA 2QPOA 4AYXA 4IVPA 3ZYCA 3BB4A 2A5YB 5EXPA 1MRNA 2RGGA 3LRPA 3KTAB 3QXXA 2ORVA 4J0QA 2FFAA 1WCV1 4LJYA 4PR0A 1G8PA 4UXIA 1XZPA 4BEBA 4A92A 2FPMA 3U44A 1M1YE 2HYIC 2IXFA 1NVXQ 1S96A 2O8EB 1IN8A 4TLAA 1IAQA 2ZI7A 2GZAA 4DEXA 4RKEA 4B3BA 3EPHA 5JLJA 1QHHA 2OV2A 3AF0A 3UMRA 2VP0A 4CYMA 5IRCD 5LDDC 4B3GA 4D4JA 1FZQA 2AWOA 2BKUA 3W8NA 1JR3D 2J45A 4D2IA 1YZQA 2LCFA 4KBFA 3UWOA 2O0KA 4U7DA 4TLDA 3RS4A 4L9WA 4EIWA 5CLQA 1YR7A 2ZE7A 621PA 2GCNA 1E9SA 3BRWD 2B92A 1M7BA 3OEHD 1G3IA 2OEPA 2IYWA 3D3QA 2CEAA 4TMXA 1AGPA 2ZYUX 3LBIA 2Q3HA 3CR8A 3RABA 1Z0AA 1U98A 2PX0A 4W9MC 2ZPTX 4F38A 5JRZA 3GLFA 5TY0A 5EE9A 1G5PA 2B6HA 1Z63A 2ECKA 4HDOB 1UBCA 4OK3A 1G19A 2W6ID 5K8TA 3QF4A 4LUCA 3KFXA 1E9EA 2QY9A 2YOFA 2OG2A 3MJRA 1UKYA 3IIKA 1KK2A 4JLPA 4LX0A 2JIZA 5AWFC 2ZS8A 3PJRA 5E7IA 2RHDA 1GL9B 2IYQA 5DO9A 5EE3A 5FBWB 2O5VA 2YYZA 3QOFA 1P72A 1QF9A 2CLCX 1VCIA 3ETLA 2IYRA 1NIPA 2X8AA 2ZQ5A 1I2MA 4QBIA 3EZ6A 4DDUA 4NONA 4GSYA 2BMEA 4LZZA 2R6DA 4RSGA 3K0EA 4D4KA 2ZJAA 3KUDA 3EZ2A 1NN5A 4RVCA 2ZYWX 3UG6A 1M7HA 2RMKA 3CIOA 4HAUA 4XWKA 2IYLD 1WF3A 3I8XA 5EZ6B 1NMYA 2O8FA 2WWYA 1Q44A 1P61B 4TL7A 4Q1FA 2IHYA 1X3SA 1HYQA 3SQXA 5CDFE 2A30A 4Q4HA 2VP4A 4UNNA 3U2QA 2LKDA 4KHZA 3SEAA 2BM0A 2WIBA 2X2FA 1KSFX 4LV6A 1Q20A 1TEXA 1MO5A 3DMNA 5F2EA 3PEYA 2A2ZA 4WXRA 2JJ1D 3QG1A 4Q48A 3GJXC 1IN5A 4M0LA 4RD2A 1RFLA 3CWZA 1VIYA 1XD8A 4CT5A 1ZUNB 3QVVA 2IYYA 1CRPA 3THYA 3BK7A 2MMGA 1HA3A 3RSLA 2VH5R 3PUZA 3TVTA 1ZUIA 1AQUA 2DFKB 1GKIA 1JXOA 4IJMA 1XTJA 4RFVA 1KI7A 3M6AA 4X8MA 2AN9A 4R7ZA 1P2SA 3G82C 3VQTA 1OB5A 3U7GA 1XEFA 1XZQA 1JBKA 5L3RA 3U5ZB 3T1TA 1CJTC 4BWYA 4IOKA 5GJWC 4YQFA 4ZCLA 1I4DD 3QG5A 2GJKA 4N0DA 2QL6A 2Z43A 5CJ2A 1JXMA 3RS7A 2NO9A 4JS0A 1FX0B 4IKEA 2JAQA 4MRNA 2QT0A 1DG3A 5CJPA 5IF9A 2IS4A 2QSYA 4V0KA 3W8RA 2D7DA 2QP4A 4C0HA 4LBVA 1R0WA 2ZJ2A 4HYYA 4EPTA 2OO7A 3BB3A 3R9XA 3EIQA 4FMDF 2O52A 3AF1A 2IWRA 3B82A 4P4UA 5CIWA 4AD8A 2GHIA 4LJ7A 4DIDA 1G8FA 1G6HA 1GITA 3W3ZB 4B43A 3GJ0A 5BYKA 4KODA 1YZKA 1E0AA 2Y8EA 2N1BA 1XMJA 2WM9B 3KTAA 3QNUA 1IXRC 3P32A 4UJ3A 1G64A 1DAMA 1IJFA 2A3RA 4N0EA 3T34A 2JLUA 5FOVA 3BORA 3SE0A 1OFTA 4HB2A 4P32A 1N25A 5C2JB 3AVOA 5JHHB 1Q22A 3FMOB 3CRVA 4IEEA 1KAOA 2ZI6A 5SZJA 5AUNB 2JLRA 2GCPA 1KMHA 2QMEA 3PENA 4C0BA 1XPRA 1Y3AA 1XCGB 4TTPA 5C4GB 3B9QA 2ZSBA 3RRZA 1PJRA 2G88A 2HT1A 3ICQB 2G1KA 1DVRA 4YMSA 1KZGB 1BS1A 3DOEA 4AC9A 4DJTA 2R6CA 3CW2A 3TR5A 5EE5B 3P4YA 1TF7A 4KSCA 3K0CA 2BEKA 4TL9A 4DWJA 1R4AA 4K81B 4B34A 3E5HA 3MFYA 4QHYA 1CULC 1U99A 4HZIA 1KJYA 1OW3B 2IT1A 2VSXA 3KKPA 4NH0A 4BZXA 3IBGA 2UVQA 3FB4A 4DDVA 2RCNA 4RKFA 3ZS8A 2CK3A 4A0GA 2IBMA 1VG0B 2X19A 5K8UA 2WWFA 4V02A 2WJGA 4AKHA 2ZXUA 3FFAA 3K70C 2QP3A 5CLLA 1Z06A 4NYJR 1P75A 1IM2A 1WP9A 2OLJA 4XWOA 3I72A 1G4UR 2RH5A 2PMDA 4Q1AA 1KI1A 1TMKA 3U7FB 3QUSA 1OH6A 4FXPA 5KUTA 1XTKA 3GFOA 1Z22A 2C8VA 2QEQA 2J0UB 1G21E 2YINC 2FH5B 3AP2A 4FMCF 2GTPA 5CK4A 1X1SA 2BV3A 4L4UA 3QKRA 4WIAA 4C2TA 4P31A 3W5JA 5HZHA 1W44A 3TRFA 2V9PA 4LJ4A 2EWWA 2H57A 1NN0A 1HTWA 3PUXA 2AXNA 4US0R 5HKKA 1NN1A 3QKSA 4GL2A 5TXGA 2E1RA 2XSZD 2DY1A 4H1VA 1HT2E 2GVZC 4M2LA 4NBSA 3JVVA 3SJAA 3U7EB 1QHYA 4NMMA 1US8A 1XXHA 2QN6A 3CF0A 4C0QC 2IXEA 5HR5A 3EZ9A 4WAUA 4NYIR 4CRWB 4LOAA 5D3MB 1KTVA 4JVMA 1E2PA 1DAKA 4BZPA 5C1BA 1COWD 2HF9A 3GLGA 2G9NA 3EIEA 4M22A 4QFMA 2J0UA 4JL5A 3DL0A 3SI7A 4AYWA 3OIWA 1XNJA 1CEEA 3ZVNA 4RD3A 2G77B 3LVRE 2GXSA 2ZRJA 3TUZC 3CNLA 2CK3D 2RB4A 2P5TB 2CL0X 1IXZA 3C8UA 1YQTA 4E22A 3B8HA 4MKHA 1B0UA 1GDDA 2CHQA 4B74A 3T1VA 3ZD6A 2OSBA 1Q3TA 1KJWA 1TAGA 4OQMA 1E4VA 2WWIA 4ACAA 821PA 3SNHA 4HLUA 3TIFA 1VHTA 1QHHB 4RZ2A 1EX6A 2NPIA 2ZSDA 3LLUA 4B2IA 4Q1EA 3KXKA 3AVUA 2REOA 2AWNA 1ONBA 4R71A 4FMCB 1XBTA 4O3MA 3A4NA 3AKYA 3BOSA 4ARZB 5E3HA 1E4YA 3CRRA 4CEJB 2GF9A 2V7QD 2FFBA 2KSQA 4TLCA 4DSNA 2CJWB 2A5FA 2NZJA 1MR3F 3REGA 1Z0IA 1K5GA 2OT3B 4LC0A 1LNZA 4EPYA 2PCJA 3OE7A 5B58C 1NVVQ 4C2UA 1DG1G 1JJVA 4V0LA 1M6NA 2ATXA 1H8HD 3GJ7A 4IFEA 4Y0AA 5IK2D 1VYVA 2JCSA 3DPUA 2FOLA 1YZGA 2NG1A 2VSFA 1WDTA 2CMKA 3EZ7A 1RW4A 3M0EA 3RWOA 4BQSA 5KHOC 2F3RA 5KYKA 2FE4A 2G0TA 4KXFB 4YC7A 4CZ2A 4JIMA 4A6XA 2JASA 4PC7A 1Z08A 5FI0B 2AL7A 4Q9LA 3F3YA 4PO9A 2BM1A 2VF8A 1KY2A 5BYJA 3ZVRA 1Q3HA 1NG9A 3IKJA 3EW9A 3KB1A 1E1RA 1GTVA 2ZRPA 3WNCA 3QJYA 3FFBA 2WJHA 4TLEA 2VSOA 5LPNA 3PITA 1NJFA 1G41A 3A4MA 2OFXA 4ERNA 1EFTA 3B78A 4GRAA 2QE7A 1GFIA 5FUWA 1P9NA 4TQUS 2ZJOA 4KI0A 3DHWC 3NTUA 1CP2A 4EPRA 3EPJA 1TPZA 1F60A 3A1UA 4B6EA 2FEOA 1N6IA 3FGNA 5JWHA 1ZW6A 1NBME 4AG6A 3CF2A 3HYTA 2ORIA 4DB4A 5C18A 3O47A 1G1MA 3QPUA 1CR1A 3K70B 1D2EA 1Q12A 4Q1CA 2W83A 5E7MA 3ZS9A 4PHFA 2RGBA 4IEIA 3GLIE 4JLVA 4BFSA 5FTJA 3GLIA 2OXCA 3A36A 1J70A 2ZTSA 1TUIA 3CX8A 3HR7A 4W5HA 4DLYA 2QRNA 3RC3A 4QKQA 2H92A 2AX4A 1FNNA 3I1FA 2JATA 3VKHA 1HV8A 2C03A 3IHWA 5EXTA 3KQKA 1X8KA 2RGDA 4DEYA 1E2FA 2Q9BA 3HU3A 4KO8A 1VCNA 2VL7A 5JI3E 3MWYW 1KI6A 3L82B 1YVDA 3NBFA 3A1VA 2LWIA 4Q66C 4CW7A 3O8CA 1VYTA 1G8GA 4EJSB 3KQHA 4D4LA 1VG1A 4QHTA 3VFDA 3ZH9B 1SVMA 4GNKA 2GCOA 2GBLA 3LH5A 4YDHB 5M04A 1GRQA 1R0ZA 5EZ5A 1NLYA 3U4QB 3RS0A 3ND8A 1N6NA 3B1XA 1OFUX 2MSCB 3CNOA 4RD0A 3HPQA 1R5BA 3PV0A 4JZKA 3UKDA 2ZETA 1T0JB 1XEWX 4X8LA 5FOWA 3AUYA 3CO5A 1L4UA 1H8EA 3BBPA 4MGIR 2VBCA 5A0FA 4KLNA 4AWXA 3I92A 5KSOA 3E2IA 4Q9IA 3CPHA 2G3YA 2C9OA 1E2NA 1OKKD 1SXJA 1LY1A 4I1VA 2GKSA 4FI3C 3WYFA 3QXJA 4PPQA 3PQCA 4CIDA 4IVQA 1KSHA 1KMQA 3IDQA 4Q4AB 1AGRA 1JALA 4GMXA 4UNSA 4B35A 1F2TA 1W4RA 1UDWA 1II8A 1ZNYA 2Q3MA 2Z4RA 3TNFA 4QJ3A 4IOMA 4AYTA 5F98A 2CE2X 4FINA 1OH5A 1Z28A 1G3RA 3J81k 2G0NA 1XPUA 2FNAA 2ZIAA 4NYIQ 4EPWA 1O87A 2H7VA 3OEHA 3WBJA 4A8JC 3GLGB 3HR8A 3SBEA 3TSZA 1KI8A 2NO1A 1X8JA 3SU8A 5G53C 1CJVC 1N5LA 4LHZA 4OI2A 1TNDA 2BVNA 4GMDA 4HUQA 5DI3B 4OJKA 1E2IA 4NZYA 4QGHA 4OHZA 1S3SA 3D8BA 2GXUA 4RD6A 4DLZA 3AVXA 4GZLA 2CHVA 3GD7A 3QF4B 3OFNA 221PA 1G8HA 5SZHB 3WMFA 4ZIRA 3EPKA 1M7GA 1UBEA 1NSFA 1J90A 4LK2A 4NCIA 3K1JA 5CITA 5AR1A 2PLFA 2YOGA 3ONWA 1XDBA 3TUIC 4A9AA 2IYXA 3B7GA 4JLKA 1P2UA 3VX4A 5DSZA 2XNDA 1S9DA 5DHFA 3L0PA 2RGCA 3CPJB 2Q0HA 4TWZA 4JLMA 3GLHB 5FOSA 2CNWA 2R2AA 1PVOA 4BFYA 3IQWA 1VCOA 5KDDA 2WJYA 2F1HA 2P6UA 4XD7A 3SQWA 2J0VA 3SC3A 2P3SA 3WBKA 4LY6A 4MRVA 2XB2A 1YE8A 4TZ0A 3OZXA 2CCGA 2HF8A 3RRMA 1F2TB 4JVLA 1EFRD 2OCAA 1RKBA 1S0UA 2BDTA 4UNPA 3ICEA 1ESMA 5J4VA 1AJEA 5FPHA 2FF7A 3CX7A 3NHAA 1W4BA 2IK8A 4IDPA 1J2JA 3D6TB 1II9A 1LTQA 2LKCA 3DVLA 4OI4A 3VNUA 3TJZA 3THXA 4OYHA 1D9ZA 1UFQA 4MKIA 1C4OA 3VR2A 5G40A 2ZJ5A 3MD0A 2BBSA 4JLOA 2C5LA 4Q4JA 3HDTA 1R10A 4NE2A 4OI1A 2QP9X 2AFHE 4JYBA 1QHNA 3FWYA 2CBZA 3VAAA 1E0JA 4B2PA 2XNSA 4LCBA 3EASA 2A78A 1QZXA 1T3HA 4Q4AA 1F2UA 3FDIA 1H65A 3L0IB 1NVWQ 2J7PA 2ZE6A 2ZRMA 2H17A 1ETUA 3FVQA 5TV2A 5H70A 1Q1BA 2C77A 4HDQB 3W6OA 1IBRA 4BRUA 1U2RA 4B48A 4OKSA 1CKEA 1DS6A 2ZRFA 1XTQA 3ZZTA 2GA8A 2A5JA 1AQYA 4YXWA 1U9IA 2QUZA 3OFND 3CPEA 4OQNA 1A82A 1EFCA 2ZE8A 3SYNA 4DSOA 2P2LA 2B7CA 1PLKA 1OB2A 1DO0A 4I81A 4TYQA 2KBFA 4CEHA 2JEOA 2ZRIA 1KK1A 5FBVB 3SZRA 4C0AC 3Q72A 3H4MA 1UADA 1NMZA 5FI1B 1EXMA 4XTRA 4ABYA 5HE8A 1G5TA 2KI5A 1P3JA 1D5CA 1TF2A 3AVVA 2XOKD 5E95A 2OUKA 2XZLA 2ODEA 4BFXA 3U4QA 4CGZA 3TAUA 2BC9A 2IL1A 2NMVA 1L2TA 4EUNA 2D74A 1HE1C 2QU8A 3IO5A 4NCNA 3T5GA 1D9XA 5JWRA 2IYTA 1YR6A 2HLDD 4Q9JA 3DEFA 4TT3A 1OKKA 2C04A 1OE0A 3GJ6A 3VMFA 2VP2A 1SHKA 3QBTA 3WP0A 1CU1A 1ODFA 4YMUA 2WVJA 2KBEA 2QQEA 2DBYA 3RNLA 4DSUA 1VCMA 4WZ6A 5JWOA 2JLWA 3IEUA 2EU8A 4A1FA 5ELXA 4B44A 3CZQA 1XD9A 1KK0A 3TK1A 3DZ8A 1N5JA 5CB6A 2HLDA 1FQKA 2IXGA 2C2HA 2FFHA 2PX3A 1IONA 1E1QA 2GCOB 4PSKA 4DCNA 4PQYA 2QQ0A 2F1RA 4NPHA 2V1UA 1S9HA 3VR6A 4YMVA 2EWVA 5DE3A 3RS5A 3CRQA 5GJVC 3B1ZA 4BZQA 3THWB 1OF1A 1LW7A 2ATVA 3OAAA 1JJ7A 4ON9A 3ZVLA 1IN6A 1GAJA 2RHMA 4IHQA 3T06B 1NVVR 3ZQ6A 5CDFA 4D81A 4A2QA 5LBIA 3THXB 4RCZA 3LXXA 1G17A 3KKOA 4UNRA 1MT0A 4M1OA 4HLCA 2ONJA 1ZAKA 4KITB 4CT4B 1U8AA 1XMSA 2BBOA 3Q7PA 5D3QA 1GWNA 4JLDA 2WICA 4KU4A 2VTKA 2OZEA 4WOPA 2I4IA 3T61A 2VIIA 5G3ZA 4BFUA 4DIEA 1TUEA 3A1WA 2GEDA 1XF9A 3KKMA 3NVAA 4LBWA 1Z0KA 4FCWA 5DYIA 5KPDA 2GJSA 2F1IA 2XTMA 3L0OA 3X1WA 5G3YA 1OSNA 4JMPA 4MGKR 2AR7A 3KJEA 1EFHA 1KHTA 1RC8A 2QBYA 2PJRA 1OXTA 2YWHA 4JVNA 4OQFA 4I1OA 1OHHD 3RLFA 2BJVA 4KFTA 3PEUA 1GVNB 3K9GA 2GK7A 4EAQA 1NN3A 1H8ED 1RRFA 1WMSA 3GFTA 4DLVA 5L3VA 4C7OB 3CH4B 3LVQE 2YWEA 2GDJA 3OEEA 4JL6A 4NKRA 4TTRA 1IHUA 3KXLA 2R44A 1E2LA 4RZUA 4XH9B 4JLJA 3KQNA 1FNMA 3FKSD 3NH6A 1A2BA 3EG5A 3THYB 1G4AE 3ZZUA 1AZSC 1CXZA 1W4CA 3X1XA 2CCJA 1KI4A 2W00A 2XSZA 2YV5A 5AUOB 3QF7A 4QXAA 4NCKA 4E09A 1DEKA 2GXQA 5J4LA 3BAFA 2D62A 2ZVPX 5AJZA 2CJWA 3CONA 4TTQA 4DUGD 4BE7B 5JS7A 2CLDX 3NHBA 3X1YA 2ERYA 3BH7A 3C14C 5B30A 4UJ5A 2B7BA 4ESVA 3ZLJA 1MABA 2ONKA 2XNDD 3AUXA 3L8ZA 3I3SR 3LQQA 4HUTA 1ZD9A 2OCPA 2FZ4A 5DYGA 4Q01A 2IUUA 2R9VA 3MWKA 3LBNA 4ACBA 2R6AA 2FPLA 2JA1A 1N2CE 1II8B 4LI0A 4QBHA 4A0RA 4C0KA 2X2EA 4QM7A 4HAXA 2HCBA 4E07A 1JPNA 2J1LA 3AGPA 3AVWA 2O8CB 1XPOA 4U00A 2CCKA 2QBYB 2FZLA 5AJWA 1DE0A 2IC5A 4OI0A 1HURA 2W2VA 1T0HB 4UNQA 2W0MA 4M1KA 4KSBA 2HV8A 3GJ8A 1E2DA 4LJ6A 3REFA 4M8NE 5G41A 1W4AA 5TARA 3UWKA 3HP1A 4M53A 4P33A 2FSHA 2H16A 4Q02A 4ZCMA 1E9RA 4PC3A 3N2EA 2GILA 5FH9A 4ZI3A 3FMPB 2OILA 4ILEA 3AKEA 1E2HA 4PAOA 4RZ3A 3U3KA 2XX3A 3H2YA 2JDID 3KKQA 4LHVA 2K5UA 1DAEA 2Z4SA 5HKKD 4QBFA 1VIAA 5HTKA 2OCYC 1AK2A 4KFSA 3N2IA 3Q7QA 4PSVA 1ZMXA 4LJAA 3I5YA 4D26A 1T8TA 3B13B 3ZIAD 4KBGA 4JT4A 2WOJA 3AVYA 1Z8FA 1FFHA 2XAUA 4PAQA 1P2VA 2H8KA 4BECA 5GVRA 2RGNC 1J99A 4WBSA 1G7CA 4V0ME 2ZUDA 1BMFA 4KVGA 4DHEA 3BERA 2OFOA 1CBUA 3Q5EA 2CNWD 3BFVA 5EJEA 1M34E 3NDBB 1OXXK 1W1WA 5DLQC 3TQCA 2N42A 1G5RA 1W7AA 3LAWA 1TX4B 2W2XA 2QGZA 1MRSA 2OXRA 3EXAA 2IWHA 2ZITA 4Z1MA 3TMKA 4Z1MD 4BRWA 3KQUA 2OFWA 4PPGA 3SJBA 2JLYA 2J87A 3QENA 3G0HA 1VYUA 3VU9A 1SZPA 5K8LA 4DLUA 1TF5A 2BBTA 2JLQA 1R0XA 2YWGA 4LSGA 3G5UA 1AS3A 1UEJA 3P26A 4P4TA 1OIVA 2JJ2A 4P0TA 2CE7A 3MJHA 4TSFA 5AJXA 2QNRA 3R20A 4XVRA 2EYUA 1CJUC 2IS6A 2IF0A 1YZNA 3OIVA 4XVUA 2QT1A 3QSYA 3LWNA 2FJUA 1U9IC 2KE5A 5EE0A 3SJZA 1BKDR 3K09A 3T1QA 3N5CA 4HAZA 4BFTA 1E2EA 3P4XA 1E9CA 2ZUCA 3H1TA 4G3XA 3WHLA 1W0JA 1NKTA 1S3GA 4G0NA 5FUVA 1LV7A 5F9HA 4LYJA 2BOVA 1DAIA 1IN7A 3I8SA 1RRGA 4Q03A 3B85A 1WBBA 1XB2A 1E1RD 3DDCA 2WWHA 1ZM9A 1XRJA 2I1QA 3GLFE 1RRCA 1V43A 4WW0A 4CF7A 1HE8B 2PZGA 1AKYA 1N3BA 1LVGA 4MUAA 1FP6A 1JAHA 4GT1A 3C5HA 4G01B 1XJCA 1ZINA 2V3CC 1YU9A 1TADA 2QROA 1XU4A 1OXVA 4BEJA 3C4JA 4NYMR 4Q1DA 3SHWA 4YONB 4EQ6A 2BCGY 2DB3A 1R6BX 1T4GA 1XCMA 1KI2A 3WMGA 3AP1A 2XJ4A 5FTLA 3F8TA 2H1LA 3RVBA 2XEXA 4GP7A 2VHTA 5FL3A 2F7SA 1XJQA 1FTNA 4QM6A 1KOFA 4YDSA 4DXAA 5AJVB 2O8FB 3IUYA 3Q5DA 5EQTA 3EWAA 2PEYA 1XEWY 4B6FA 4KAXA 3FMIA 2ZJZA 4D6PA 1KSJA 3F5FA 5KSYA 1E94E 4WZAE 4Z8YA 5A4JA 2J41A 2O8CA 2C9YA 2J59A 1KO7A 1NNEA 1ZM4A 4G5OA 5FBRB 1RZ3A 4Q9HA 1ZC4A 1KDOA 1G16A 4GPTA 5DI9A 4EQ6B 1E6CA 4MKGA 4PC1A 4I4LA 2ZVQX 1T3LA 2ASEA 1X6VA 2RAPA 2VHJA 1HUQA 3U3MA 1Z6TA 2YJTD 5CM9C 3EZFA 2FMXA 5JHGB 3PIRA 2D3WA 3IO3A 3VHLB 121PA 3B9PA 1U8ZA 2CL7X 3SJCA 3A37A 1XTIA 4OL0A 4BGDA 3GEIA 4BLPA 1P2TA 4KFRA 5CK5A 4IDNA 2WWGA 1M8PA 3BE4A 2CLSA 3I61A 1KAGA 1Y63A 4NHOA 2ZS9A 1BH2A 3EPLA 2JLSA 1A1VA 4EDHA 4F4CA 1EESA 1N6RA 4HB0A 4ASUA 1S1CA 3RSOA 2AXPA 3B1WA 3JZMA 1E99A 1T6NA 2QENA 3VKGA 3KJIA 5AJYA 4JKYA 4M1YA 1XEXB 2EFDB 3B5JA 4IDQA 5JCZA 1KJZA 1Z29A 4OQXA 3V4FA 1IN4A 3TSOA 2R6FA 1N5IA 1PUIA 2GRJA 2MSDB 1J8MF 1PLLA 2PL3A 4DBLC 4R9UC 2B21A 2VEDA 2W6JD 3D7MA 2QMHA 4KVAA 2XZOA 2IX3A 2XB4A 3BGWA 4RY2A 3K53A 3JVUA 1TU3A 2HJVA 2DFNA 1K5DA 4Z8XA 2VO1A 3HJNA 1QVAA 4QG7A 1VG9B 3KZ1E 1YRBA 4PQRA 2L0XA 1G18A 4JBYA 1LS1A 2O8BA 1IQPA 2QZ4A 3SYKA 4AKEA 4MDEA 3K9HA 2P5SA 3UG7A 4GDFA 4BASA 1G3QA 1Q1ZA 2Q21A 1SVSA 2V7QA 4ZPXA 1JQJC 3AKCA 1MO4A 3I32A 2QMOA 4F93B 3NEYA 4NP6A 4K8OA 5FOUA 3TBKA 1AS0A 2D4HA 3W34A 1Z6GA 1NIJA 5BW8A 2ZRDA 1JR3E 4BLOA 4JLAA 1MO3A 4A82A 4LPKA 3W9YA 4R2HA 4FIDA 1GIAA 3QE0A 3U3JA 1P60A 2JIZD 2PLRA 1YZLA 2C95A 3IPYA 5FBLB 4AKGA 1OLOA 4IXNA 3HU1A 5FPKA 3TE6A 1TQ4A 4NCHA 2F1JA 2WSSD 6Q21A 1S2MA 1E69A 1R0YA 1JAIA 1R8QA 1ZVQA 2KB0A 3VR3A 1SVLA 4DB2A 3R8FA 1DOAA 2BBWA 3GEHA 5J47A 1OIWA 2B8TA 2DWPA 3OESA 3QKSB 4RJLA 2REXB 3RANA 2WWXA 3SN6A 1P9RA 1F6BA 2OCBA 1BOFA 2GNOA 3TGPA 3NC1C 2ZSAA 4QGGA 1KO4A 4KJZA 4DUGA 4M9SA 1SXJE 1WBDA 4BLTA 4DVGA 1JPJA 1GRNA 1J8YF 5AUQA 1VDZA 4IDOA 1IXSB 1M74A 3OAAD 5D3MA 5BN5A 1QHXA 4FW9A 3CNNA 2NQ2C 2F3TA 1ZBDA 1AKEA 3GFPA 3NDPA 2F55A 5KNBA 3OIYA 1DO2A 1I4LD 3ADDA 4DLTA 3CBQA 4TT3D 4NU0A 3EA0A 3FKSA 3L8YA 4BLRA 1RPZA 3H0KA 2Q6TA 1E1QD 1R7RA 2HCJB 1EWRA 3LA6A 2DPXA 1ZM7A 4PHHA 4PZYA 3EA5A 4AKIA 3RRNA 5EUQB 1OXSC 4Z54A 1YKSA 3QY0A 4NYJQ 3K8YA 2R65A 1RVDA 1BO6A 4Q7MB 4Q4LA 2QTHA 4RD4A 2FDCA 3JZAA 2BWJA 2QGNA 2ZAMA 1E9AA 4LHWA 4HB3A 2CVHA 4Z51A 2W58A 2G83A 4HLQB 5DN6A 3X1ZA 2ZRKA 3THWA 1I2DA 1ZCBA 5FUXA 1AN0A 4PXAA 2J46A 4A15A 3N70A 3IQXA 2OESA 1P4SA 2AD1A 2W6IA 1E9FA 3UMSA 3CZPA 3LDAA 5JSZB 1EFRA 2VLIA 1E2MA 1P9WA 1KDPA 3C15C 2ZRLA 1W48A 1Z0FA 4EJSA 2ZR9A 3QVUA 1FUUA 2AK2A 5DH9A 1NY5A 4LV8B 1X86B 2A5GA 4GP6A 5TMPA 2GETA 2NO7A 4Q7JB 2J7PD 2YHSA 1WQ1R 3A58B 2PT7A 2TMKA 3DKPA 3LX5A 4HDCA 4YXWD 4IVRA 2UZ3A 2XTZA 5JFGA 3ZGXA 3KXIA 1WXQA 4C9BA 1A4RA 1W49A 2IEYA 3SBDA 3AGQA 2I3BA 2QMUA 3CH5A 4LC1A 5B57C 1UKEA 2DR3A 5C4MA 3VR4A 4HEJA 3K70D 1RJ9B 1E79D 1U0HC 2GAAA 3EWSA 1Q1QA 2DWQA 2O8DA 1LF5A 2NO6A 2FWRA 2IYZA 4YMWA 4V03A 2ZR0A 3K9LA 5IHPA 4A36A 1ESNA 2HT6A 2ZRGA 4ZDKA 1RIFA 4URVR 4JSTA 1KO8A 4L8GA 4TQ9A 4Q7KA 5HCIA 4M9QA 1VECA 1T8UA 4AY2A 2ZE5A 4HATA 1QVRA 3IEVA 2C99A 1COWA 3AF2A 3KDSE 4JVSB 2ERXA 1P73A 4B3XA 4ZKDA 5JZVA 4C0LA 2IUTA 4JT2A 3SR0A 2VF7A 2YNMA 4CEJA 4PTLA 2OLKA 1XTRA 5FTNA 1E2JA 1NY6A 1SXJD 2VRWA 3QBVA 3M4YA 5HCNA 1AZTA 4B3FX 2A7QA 1BIFA 1W2GA 1EG7A 3NBZC 4KV9A 4BFVA 5EP4A 4DLXA 2QPTA 5KU1A 1MKYA 3OF5A 4EFLA 2WHXA 5SZKB 4XD7D 3NBYC 2V8OA 4JSYA 4I1UA 5E7JA 2V55B 1F3OA 3QXCA 3SHFA 1XXHE 4XVQA 5J4YA 2IW3A 2WJIA 2WMOB 3CF6R 4N3NA 5LD2B 1CJMA 8OHMA 4FD2A 1KI9A 4M21A 1TL7C 1KGDA 1PZNA 5DGXA 2JLVA 1GP2A 4X8HA 2PCLA 3GMTA 3RAPR 5KDOA 3Q8XB 3AM1A 4MYCA 1OH7A 4M1SA 2R6GA 1GKUB 2DWOA 3UK6A 3WRXC 4UQOA 3X1DA 1E2KA 4Q47A 1ZRHA 2J5XA 1YR9A 3E70C 1LFDB 3UATA 1CIPA 1U0JA 3MGCA 4ITRC 2D2FA 1E2GA 1NVUQ 2KWIA 5FPYA 3ND9A 2WKQA 3MWLA 1FTSA 3GQBA 1FOEB 4Q21A 3L2OB 2WSSA 1YJ5A 3A8TA 1N6OA 2O0HA 3NBXX 2WIAA 5DIFA 3RC8A 4TMWA 2GEUA 2ZU0C 1RE0A 4FCTA 4TYWA 1DARA 1PUJA 3ASYA 4PANA 4IOJA 3BH0A 1HT1E 4B76A 2ZANA 1VPLA 1GILA 3GLGE 3P1JA 2OBLA 1CS4C 4B33A 1DTSA 2CXXA 3K0FA 1OIXA 1G9XA 5EE1A 5CB8A 5JSZA 1QG4A 3ADKA 5CIQA 4H9GA 4C0JA 3A6PC 2ZUBA 2HEIA 1ZNWA 1SGWA 1G8YA 1XP8A 1OYYA 4TMVA 2D7CA 3QKRB 2GVDC 5IDVA 2RGNA 4S35A 3ZQJA 3GLFB 5H1YA 2QAGB 3BD9A 3S1AB 3LD9A 3V4RA 1GNPA 2AKAB 3DZDA 4LDJA 3EC2A 4MYTA 3C41J 3WNBA 2JLZA 1DAHA 1MOZA 4K46A 4QJ5A 3W90A 2VQSA 4LHYA 3QXSA 4HB4A 2NO0A 2C96A 1XWIA 4V0MA 1IY2A 2X1VA 1TQ2A 3CR7A 1OYWA 4KYIB 4JBXA 1Z6YA 4OHWA 4EPVA 5J4KA 2VA8A 2ZJYA 4DCSA 3AF4A 3LFUA 3ZDQA 4MRRA 3VHXA 3X2SA 4C7OA 1QDEA 1G3MA 4F4JA 1GNQA 1SKQA 4A8JB 4HI0E 4IXMA 5AUPB 1Z6AA 3S1AA 2GEVA 3RRYA 3W6NA 4M1TA 4C0SA 1GKYA 4TZ6A 4M1MA 1NLZA 5K8IA 3UXMA 1K8RA 4DLSA 4DLRA 4ZIRB 2AK3A 4Q00A 4U5XA 3WP1B 3RYTC 1HY3A 2EFGA 1GL7A 2O0JA 4W5WA 4DCVA 2A5DA 2GJ8A 2WAYA 1U90A 3FE2A 4DDTA 3DKVA 3MSXA 3KQLA 1TU4A 2F43B 4IW3B 1ZYUA 3WRYC 1CR2A 4I99A 4QGFA 4R2IA 4OHYA 1NI3A 4TMZA 3TUJC 4CDGA 5JECA 3CKLA 4AK9A 3AF3A 1N0UA 1QBKC 2CVFA 1Q1EA 4PFSA 2WZQA 1R8SA 3LV8A 2EVWX 3R7WB 4IDHA 4B3DA 1KSGA 4ESHA 5L8VA 1CLUA 5JRJA 1UEIA 1J7KA 4V0NA 3ZZ0A 4JJZA 2QE7D 4MKFA 1ZU5A 1U8YA 4PC2A 4D25A 1OPXA 2EFEB 1ZIOA 2P6NA 3MUFA 4URUR 4L16A 4RZXA 4JKIA 1SULA 1TTTA 3QKTA 3PUYA 4D0NA 1ZNXA 1Z3IX 1OT3A 1KK3A 5J4HA 3BC1A 1JI0A 3NKVA 4FWTA 2FV8A 2XJ9A 1PLJA 3C5CA 1QRAA 1UBGA 4CEIA 2F9MA 3L0SA 4ZDIA 4G5QA 2IUSA 2VP6A 3U61B 3HU2A 2FEMA 2EQBA 4Q5IA 3MRSA 4IOLA 4BPBA 2ZRCA 3ADCA 4YLGA 3LBHA 4Q19A 3DM5A 1FL9A 4PZLA 3B1VA 2QAJA 4LYAA 1JR6A 1SVKA 4PHTA 4MYHA 3NG1A 2ODWA 5UKDA 4FN5A 4XJXA 4D80A 2J0SA 4ZV4A 4KCGA 5KNCA 1GUAA 1JQLB 3DM9B 2JJ8A 1KO1A 3SDZA 2C78A 2WJJA 4O2LA 5L3SA 2VHCA 1OXUA 3UANA 2XTNA 5L3QB 5EXSA 2XXAB 4C30A 3VKWA 2ZRAA 1JB1A 1XJ0A 3RWMB 3T12A 3WXMA 3QEJA 4M9ZA 2BIFA 1DAGA 4DKXA 1KYIA 1KI6B 3IIMA 5DHAA 2JDIA 2VYFA 3TAHA 2RGAA 3WY9A 2J0QA 4E03A 1DELA 1RYFA 3LW7A 2XZPA 4DC9A 1GSIA 3FKQA 4AURA 1MH1A 5EUMA 4N1AA 5F9FA 3BXZA 3WYGA 5HPYB 2CHGA 4HZUB 3PEVA 1XFAA 3I73A 3E1SA 5FTMA 1OH8A 1UPTA 5BQ5A 1VKJA 3PR1A 1UKZA 2WSMA 4LWZA 4DSTA 3FOZA 2QA5A 4US2R 4G5GA 3GLIB 3IIJA 3MAAC 1Q57A 1IY1A 3QKUA 4PZZA 1SQ5A 1XMIA 2YC2C 4LBZA 4G5RA 3LXRA 4MGZR 1P5ZB 1DADA 2XITA 2JGNA 3K0FB 1NBMD 4TL8A 4A0HA 3KFVA 4TYYA 1G3UA 1X1RA 1CTQA 1SXJB 2ZJBA 3K09C 521PA 3RHFA 4F4IA 2H18A 4OK5A 2IYSA 1VTKA 5TDHA 3WNDA 1N0WA 3KJGA 2R8RA 1NBMA 1TQ6A 3C7KA 2F6RA 1YHNA 5GJCA 2VPPA 2D2EA 2V1XA 2YOHA 2FN4A 3B60A 2JLXA 1EK0A 3ZIAA 1OV4A 2FSGA 1SHZA 2PZEA 3VTKA 1ZJ6A 5JJIA 1KNQA 5EP3A 4Q7LA 3K0AB 4II7A 3K0SA 1NSTA 2DFLA 2XXAA 4A2PA 3T1OA 2IS2A 4XSGA 3AVPA 1MV5A 3MCAA 2P6RA 2BMDA 3ZVMA 1NL3A 3LW8A 1L7VC 1ZM3A 1UJ2A 3EAQA 5JJLA 3GCGA 3PUWA 1EX7A 1ZUHA 3I5XA 2CDNA 2DCUA 1JEEA 2GWHA 3GLHE 2VP5A 3R8CA 1FMLA 4FWIB 1N6PA 3VU9B 1G7SA 4WA7A 1IY0A 1P6XA 1W5SA 1W0JD 4W7SA 2ZRHA 1ZIPA 4BLQA 2QI9C 4Q9KA 3UIEA 1TQDA 4ZCIA 3QEOA 2JJ1A 2W0SA 4B3CA 2GESA 2P67A 5GVSA 4MUBA 4XSHA 3RS2A 2F43A 4WZBE 3UPUA 2Q9CA 3H86A 2ZYVX 2ZREA 3W5IA 4C3ZA 1WB9A 3T35A 4LJ9A 2PEZA 1VG8A 2MSEB 1ZCAA 2V54A 1QHGA 1KKLA 1MABB 2ZROA 3U3RA 2QM8A 2ZI5A 3EC1A 2BMFA 1NF3A 3CB4A 4FMDB 5JMTA 4FMBB 1GG2A 1KY3A 2ZI9A 2ZR7A 5H8WA 1E3MA 4AI6A 2FFQA 1Z47A 1P62B 1HEIA 1DBSA 3FMFA 4GI7A 3LO5A 1JEDA 5KO2A 2IYUA 4GOJA 4POAA 3Q9LA 4URYR 5CYPA 5AK0A 5KSZA 4HZUA 2QTVB 2WV9A 1E32A 4DCUA 3B2EA 4GOXA 3PEWA 4XTCS 2WBLC 2FSIA 5DNYB 5BWMA 1XMVA 1OFIA 4GZMA 2GZHA 2W2TA 3NC0C 4QJ4A 4DT1A 2ANCA 4MRSA 4LHXA 2BEJA 3IBYA 3U6KA 4LYHA 2J7KA 3CRMA 3KB2A 2QORA 3TR0A 1W36B 4G1UC 1R5NA 2WWWA 2O8DB 3K0CC 1E79A 1KI3A 3F0TA 5HZKA 1YZTA 1XEXA 1N6LA 1Z2AA 4HAWA 3FPAA 4QNRA 1GOTA 5FOXA 3LQRA 2ZSFA 1ZNZA 4RFSA 4AIIA 1D2NA 3AP3A 1YZUA 1CR4A 3KJHA 3FHOA 1L8QA 3MG9A 4LJ8A 4XOIA 4TN1A 4LJ5A 4URWR 4NCJA 5HE9A 4B73A 4DCTA 3D31A 4JJKA 3SFZA 3GJ5A 2Z6VA 4DZZA 2B8WA 2YKGA 1QHSA 4EJSC 3P27A 5FTKA 4OHXA 4OBEA 2I1VB 2IYVA 5J40A 3AEZA 1KDRA 1EGAA 4ARZA 4BUJA 1KO5A 1GNRA 1NP6A 2HXSA 2ZI3A 3AVQA 3PVSA 4V0OA 3V00A 1JNYA 3AV0B 5L3QA 1VHLA 1S8FA 2DYKA 1SKYB 4QNMA 3BFKA 2MMCA 2V6JA 4ZO4A 4EKDA 5B64A 4F91B 5KOYA 2AFIE 1E98A 1A2KC 1UF9A 1XTSA 3TW4A 2ZJ8A 1ZM2A 4PO1A 2OBNA 2JJ2D 3U44B 4UXJA 1XD2B 721PA 1IJEA 3PXGA 2QPAA 2FX3A 4HLDA 4URZR 5DISB 1EFUA 1PV4A 1T91A 1U94A 2FU5C 2HXYA 4GFDA 3T5DA 3NEJA 2YWFA 1N5KA 3O8RA 1FW6A 3BB1A 3BIFA 2WAXA 1Z07A 4D82A 4H1UA 4QHSA 1HQYE 2AD5A 1GRRA 1GL6A 3QPWA 3V9PA 1DPFA 4NTZA 1OFHA 1P7CA 5P21A 1L4YA 1GM5A 4GOKA 2ZAOA 4O0MA 5FBQB 5TVKA 1LB1B 3IPXA 3QI2A 1CJKC 3W6PA 3TH5A 2V4ZA 4LPSA 5CM8B 2G1JA 1FX0A 3OIUA 2ANBA 3QIAA 4W5JA 3Q85A 1U81A 1ZP6A 4PQFA 2O8EA 2NPFA 3B1YA 3NIBA 4RFSB 5JJKA 3BFXA 3MLEA 5KNDA 4TQAA 4M9XA 4D0LB 5CYOA 5IK2A 1H8HA 2AHOA 2OE2A 1E9BA 3PUVA 4TLBA 2WTUA 1AIPA 2N46A 4TYNA 1ELOA 1I4TD 2FG5A 4KYUA 2Z83A 3IHLA 4MGYR 3NXSA 2P65A 5FOTA 4MQBA 4HSEA 4M4SA 3RDPA 3A1TA 1UKVY 2RKOA 3OEED 4JBWA 3AB3A 1JECA 1E96A 1II0A 2ODBA 2ZRNA 5FUYA 4PPFA 4Q1BA 5J5CA 1Z2CA 2EW1A 3KL4A 4IFBA 4DT1B 2O8BB 4RD1A 1W36D 1FMJA 1UAAA 2J9RA 4TMTA 3R9IA 4F7WA 3A1SA 3K9NA 4LGMA 4ZKEA 1CF4A 4E5UA 3ASZA 4U02A 3FYHA 1OHHA 2Q3FA 4BFZA 1S4QA 3QXHA 3VR5A 2PBRA 3DMDA 5H68A 1FP7A 2ZRBA 2ZU6A 1AA9A 3H84A 4DLWA 5IT5A 3ZD7A 1ZD8A 1F2UB 4AG5A 4HAYA 3THOA 4D0GA 5JEEA 5EP1A 1KMHB 3BS4A 4MYUA 4TSFD 3HWSA 2RGXA 4IRUB 1G20E 2GJAA 1JR3A 2HUPA 2ODNA 4B71A 1W5TA 4EPXA 1C9KA 1BYUA 4S2EA 4A0FA 3ADBA 2E9SA 1WE2A 3NH9A 4ZDJA 1KKMA 3AH8A 3TSWA 2WJVA 3MWJA 2IEZA 3B6EA 2BJWA 2PMKA 2G6BA 1KIMA 4P4SA 1NJGA 2REBA 3U6BA 2ZI4A 2A9KA 2RGEA 2QAGA 4OHVA 1AM4D 4TL6A 3QQ5A 1F5NA 1GZSA 3BH6A 2YZ2A 4EFNA 2HYDA 3TLXA 1E9DA 4G5SA 4O25A 3TW8B 2ZM5A 3ZJYA 4LYFA 3U3OA 5GADl 2SHKA 4L15A 3IILA 3KKNA 1ANKA 2ZSEA 1RRPA 2HJGA 3TQFA 5L3SB 1XX6A 5FL7D 2BMJA 3GPLA 4CEIB 3KUCA 4NYMQ 2WKPA 3O8BA 1S1MA 1EWQA 1G291 1R5OA 4R98A 3VR1A 4C4PA 3TKLA 2R62A 3AKDA 1Z83A 2XOKA 3BJIC 3GLHA 3MMPA 4MRPA 5BN3A 1C1YA 2NZ8A 5LD2C 3A4LA 2PT5A 3M1IA 4QGAA 5FPSA 4M1WA 2NTYC 3C16C 4CEHB 2V6IA 2C98A 2VHQA 1HH4A 421PA 5JI2E 5JS8A 4PAMA 2UZIR 4X8OA 3SFVA 3IGFA 2IHBA 4ASUD 1D8TA 1KDTA 3WYAA 1NMXA 5FR2A 5E4FA 1T5IA 2BHRA 3L43A 2DFTA 1SVWA 5KSPA 1FPMA 5JEDA 3W3AA 2AKYA 1KZ7B 4B75A 1FUKA 2NGRA 3VX3A 2WMNB 1AS2A 1W46A 4PSAA 1CRQA 5B2ZA 4QC2A 4URXR 1KNXA 1SVOA 3PCRB 2OBMA 2FGJA 1O3YA 2EFHB 3SS8A 2NOAA 3OHMA 4LRWA 5FFMA 1WA5A 2IS1A 2P0EA 2YVUA 2QM7A 3GJ3A 3R9WA 1ZU4A 3KX2A 3T15A 3AVTA 3CX6A 4HUQB 1G7RA 4US1R 1QG2A 3CRW1 4NL4H 2ZYTX 1U0LA 3P20A 3GP8A 1T9HA 3R7WA 4B47A 1UDXA 2BCJQ 1XD2A 4A2WA 4O2RA 1K6MA 1W36C 4OQLA 3LY5A 4QBGB 1FQJA 2VP9A 4BLSA 2J3EA 1X8LA 4PHGA 3GJ4A 1VMAA 3HYRA 3O8DA 4KLZA 1XXHB 2PZFA 1US8B 1A7JA 1E0KA 1TEVA 1WRBA 1Z0DA 4XWAA 1A5TA 4A4DA 2FPKA 1T5LA 2C9CA 2PJZA 3LNCA 4Q18A 1SVIA 2QAGC 2WKRA 1RJ9A 2D06A 3TVDA 3PG5A 4Q4JB 2QSZA 1SKYE 4MITA 1E0SA 1NG1A 2EYQA 2HDNB 4L9SA 4WXPA 1W0KD 5FPTA 5KPJA 4CVNA 1Q0UA 3FTQA 4FCVA 2E87A 1V5WA 3ECCA 1N6KA 4F92B 1G7TA 1R2QA 1LS6A 4P4SB 2UKDA 2GZDA 3BWDD 4P3YA 5JCPA 4JYCA 4A8JA 1Z5ZA 2ORWA 3U7HB 5ANRB 3LX8A 3Q3JB 2H5EA 4QOSA 4I1SA 4NDZA 1D2MA 1Q21A 1CR0A 2X77A 1E2QA 4JLBA 4ZI2A 1N0VC 2GBLC
chains in the Genus database with same CATH superfamily
4A10A 3KB8A 5C8DA 2JGEA 1F9AA 3DJFA 2X0KA 1BHJA 2AYXA 3WMEA 3ENZA 1AQLA 3OE7D 4MVXA 4IV5A 3RRFA 1EEXB 1SBYA 2FWMX 2FMIA 1UM8A 2ZCUA 3OTQA 4PRLA 4YECA 5KTTA 4I6GA 1WW3A 4JIGA 2PPLA 3BA6A 3PFIA 4QBTA 5C46F 1UZLA 5TQ2B 5CB4F 2ZJ0A 4PYQA 1E1MA 4LNHA 4JB0A 1PQPA 3FGPA 5BNIA 1AHIA 5IT4A 2MSLA 3GFGA 4EKGA 1Z6XA 3WYNA 1TMYA 3NASA 1HYGA 4B9AA 1GTSA 1KFEB 3CN7A 4MH0R 4WOCA 1HQCA 4B84A 3FHTA 5AQ1A 4ZVMA 1YR8A 3E48A 2NU9B 3GJYA 1RYHA 4BCCA 3EIHA 1Z8HA 3C7CB 2IP1A 4Q4HB 2PPVA 1B23P 4F45A 2CYBA 3RPEA 3NC4A 4ZDWA 1P1CA 2V6MA 1WSBA 3E03A 5AM3A 3VZCA 3LLMA 3BGIA 3MN1A 4JVOA 2Z8XA 4X62B 2Z5FA 2PAAA 1L5WA 5DX8A 2PR7A 4F1JA 5JBQA 2Z1NA 3PHBE 1C9MA 3VH4A 3WB1A 1WXEA 4ARBA 4ESEA 1N8NA 1SXJC 3LPDA 1TKRA 2P2CA 1BMDA 2GNPA 2FSFA 2H07A 3CLVA 2OM2A 3KZOA 3Q2OA 3IV6A 5AKIA 5EXXA 4F11A 1N33B 3HNPA 4DE5A 3AY0A 1M2OB 2GK6A 3UMFA 3IFSA 1F48A 4IDFA 3DOFA 4TTIA 4XWTA 4YRDA 4AWAA 5KB3A 1BE1A 1FNSA 1K8QA 3GEEA 4MV4A 2G25A 3GRYA 2E6UX 2MDTA 3HADA 4J0CA 3WKCA 5EJ9A 1NRJB 1PT7A 4V3CA 2Q7OE 4BFWA 3N07A 1IOZA 5JXIA 3EYWA 3TGLA 3DYBA 1DAFA 2O2IA 1EJ6A 1HM5A 3O2QB 4N5DA 4BJ1A 3W5DA 3H5OA 1D6SA 4YRBA 1OJLA 3EX7C 4B32A 3IX7A 4HAVA 1UBSB 2OAQ1 3UYKA 5JASA 1FYVA 1UBFA 3H3FA 3SYLA 2YS6A 4J07A 2EJVA 4ZJUA 3IEXA 2Z56A 3WLIA 5LP6B 1L5QA 3UM9A 3L1JA 3GCDA 1ISFA 1F20A 1M8JA 4AYXA 3UMYA 1ECLA 1UM9B 4RPCA 3ZYCA 3ABOB 3CLRC 3LCJA 4P81A 4UNIA 3LRPA 3QXXA 5EXPA 5EKTA 3TJRA 1RXWA 4MA5A 2EF0A 1YS7A 2GN8A 4RK5A 4NULA 1CY7A 4Y9UA 3UBMA 1JQDA 2GYYA 2P4SA 1G5QA 2FPMA 3PNKA 4A92A 4DPKA 3U44A 2HYIC 1NVXQ 2LDBA 3ABZA 3A11A 1NP3A 4FLFA 5EA2A 1EUCB 1IN8A 3VYVA 4IEFB 1V11A 5K2MA 4DJ5X 4PCUA 1ONSA 5JPCA 3ZE1B 1EPUA 2GM3A 4B3BA 3LNTA 4Y9SA 1QHHA 3UMRA 5HK9A 3EYAA 2VP0A 4ZO8A 4RUKA 1KBQA 4P3XA 1PFKA 1F3LA 1JR3D 1H4VB 2HXGA 3SM3A 4FDAA 2P2NA 4D99A 4EECA 5C1OA 1QHEA 4ZP1A 1EUQA 1VMKA 2A1UB 4GX2A 1NYQA 2O0KA 2I87A 2J30A 4N8EA 4QULA 2N3ZA 4TLDA 4EIWA 5CLQA 1YR7A 3UUGA 1FFWA 1RBMA 2CGEA 1M7BA 1IIRA 1B0AA 1G3IA 1R12A 3D3QA 3ICWA 3JSAA 3OEHD 3PSHA 4B3HA 4RW0A 4HZGA 2W6CX 3GN2A 1VQ1A 1ESDA 2YICA 2XCTB 4MDYA 2PX0A 1Z4NA 2GPJA 2XGOA 3MTGA 1Z25A 4EGFA 4F3CA 2ZWPA 4OF4A 4M8LA 2B6HA 3MOGA 1Z63A 4FEGA 4HDOB 4OK3A 4FYIA 1Z8NA 3GG2A 3QF4A 2J33A 3KFXA 1T0IA 3DW3X 3FLAA 2QY9A 2ZPAA 2ATIA 2OG2A 3H2GA 3IIKA 1KK2A 4YPOA 5KYYA 2F4NA 3BMNB 2JIZA 4IF4A 5AWFC 4Q3OA 4MINA 1DXYA 4DJFC 5E7IA 1OTHA 2RHDA 2IYQA 4MWEA 5DO9A 5FBWB 2DHQA 1J2YA 1QE5A 5HUHA 1CUGA 5ALTA 2YYZA 3PYXA 4IXTA 4J1NA 4WK4B 2CC2A 3PC8A 3NS7A 4YWHA 3ETLA 3UAGA 2IYRA 4L2IB 3DOHA 3OI7A 3IBCA 2ZQ5A 4HQFA 4KQCA 4QBIA 2QAIA 5HKAA 1E3SA 4Q4DA 2BMEA 2YXEA 3LBAA 4LKOA 1GARA 4CIYA 1CZUA 4H7KA 4X0EA 4F4UA 5LUAA 2ZYWX 5KMGA 1M7HA 2HU5A 5DLYA 2H48A 3NDRA 1N3LA 2AJTA 2IYLD 4N5LA 3I8XA 2YZMA 1NMYA 5BYAA 3DDSA 1EGHA 1RS0A 1X3SA 3TG8A 1RSZA 3DLTA 3NLLA 4EYKA 2AXEA 3LHKA 1QO9A 2F3SA 1EJ2A 1X7XA 2VP4A 4UNNA 4QUGA 1U3DA 3SHOA 3GXOA 2LKDA 3N75A 4RM3A 3RW9A 5CVDA 4XYEA 1ECBA 4RADA 2H63A 4PCAA 4IDAA 2ZRQA 1TZMA 4X91A 3QRWA 3BXEA 1RVV1 2FP4B 1KAMA 4M55A 1A8UA 1OBVA 5HOQA 1FYEA 3DMNA 4K5QA 4ARIA 3PEYA 1DJQA 2JJ1D 2QU7A 4QIHA 3SK0A 3ZHBA 3GJXC 5B1DA 5TQVA 2JI8A 3T3EA 3U31A 2CVZA 4TV8B 1O4VA 3S1LA 5BSVA 4W7HA 4YTEA 1XD8A 3V8EA 4CT5A 4M88A 4G81A 1ZVJA 1CRPA 2F9FA 3A9RA 4PQEA 2O2HA 2VDPB 2ZBPA 3O4RA 2M6SA 1XVTA 4GUDA 4NFSA 4UM9D 2OHXA 3ZBUA 5A2GA 3IIEA 2FE1A 4IPTA 3MC1A 1DBWA 2QRKA 1E63A 2PT6A 3HKDA 3OUTA 4P7GA 4ALIA 2MYUA 4FCCA 3K6KA 3OG9A 1D1QA 5ALQA 4ZOAA 4BJ3A 4YRNA 4X45A 2YIJA 3VR5D 3W0LB 3VQTA 1EG2A 3FZYA 3G82C 2SECE 4ZCQA 3ZLBA 4B4KA 1OB5A 3U7GA 4NRDA 1DZ3A 1XEFA 4W8OA 5DYWA 3NMUF 5L3RA 3VR6H 4YROA 1P4JA 3SR3A 3QJGA 4KTTE 1CJTC 4N5HX 1WHSA 3SY8A 4QVIA 1DXOA 3GNSA 4YCBA 3R7BA 4EA7A 2W6QA 2OXIA 4JQSA 4ZCLA 3AFIA 2XD9A 1V7ZA 3WNQA 3AB8A 1NNI1 4C22A 4IKEA 3D81A 3FTDA 4MRNA 3IJRA 3H4VA 1U04A 2NSHA 3DLPX 5CJPA 2IS4A 2QSYA 4KL8S 3S55A 2WLTA 3QPBA 4MCJA 3DTVD 1W59A 2QP4A 2EP7A 3LIPA 3ITKA 1JFTA 4FIZA 2C94A 3BB3A 1QXSA 2PGJA 3DTVB 5I6DA 1SIUA 3R9XA 4HV4A 3AINA 3EIQA 2O52A 3N6VA 4WK2B 1FJHA 4REQB 2QRUA 4LYGA 4URHA 4KMRA 5G02A 4DWWA 1RR6A 1DBIA 4GGPA 3HYSA 1SPBS 2CLIB 1LBIA 1RWOA 3IEKA 3HBAA 2AZDA 1O9HA 2GHIA 4EKNB 4TUYF 1N7HA 1G6HA 3QIVA 2I6TA 1GITA 3PGMA 5CR9A 1ZIDA 2EW2A 1BWPA 3KOWA 4M38A 3RKRA 4UW9A 5JCOA 5AD1A 4HFJA 1N4DA 3A6ZA 1UKCA 1ZI6A 3VSCA 1XMJA 1MB0A 3CUVA 3KTAA 5I8ZA 5KTRA 1L7OA 2Q5CA 4KQHA 3SZLA 1ZR2A 2GPAA 2EC5A 2O0MA 2X8WA 4OG2A 4EVRA 3OCXA 1HORA 3BMOB 1QQ7A 4OOFA 2EWMA 3RKUA 3T34A 3K30A 4C6TB 2B34A 2ZTUA 2JLUA 2Z6UA 3BORA 3ID6C 4V39A 1OFTA 3K15A 3SE0A 3V4LA 1FFGA 1XK6A 3V8RA 3HO8A 4FFMA 1EAYA 4X1IA 3EPPA 5JHHB 3VC7A 1V0JA 2AR9A 3G2KA 4IEEA 1V1MB 3E7DA 3QZUA 3RAJA 4YAIA 4KPFC 1AMNA 2QW8A 1YZVA 5ERYA 4HQLA 1KMHA 1HDGO 2PXHA 2XZDA 4UD6A 5KOIA 3WYCA 1XCGB 1IH8A 2B1IA 4TTPA 5FJJA 5KYVA 5TX7A 3HVRA 3RRZA 1PJRA 1WQ3A 2I66A 2G88A 2Y0DA 4LS3A 1AGYA 1GZUA 3D59A 3N2NA 2G1KA 4D26A 3DFKA 3ICQB 1SCUB 1PL7A 3CXRA 4ZVVA 2BGIA 1Y3FE 2YFQA 5BNTA 5HQJA 2PZJA 1TF7A 4KSCA 3IQFA 3OP1A 4X7MA 1R4AA 2JHPA 3VC3A 1S4MA 2NTEA 3E9QA 5EVCA 1OX6A 5CFOA 1QOPB 4KQMA 1K1EA 1U99A 4HZIA 1KJYA 1GCGA 1UEXC 2GZ3A 3KKPA 3LWBA 4I1RA 4JDUA 3LY8A 3GVIA 1NXTA 1M2VB 4GW3A 1JG6A 3QUCA 2F1OA 3VGPA 2WLSA 4CTNA 2X8JA 3EIUA 2CK3A 3ZS8A 2P0YA 4A0GA 1FJXA 4V02A 2G5CA 4E1VA 1UJ4A 2VDRB 4NAHA 1Q1AA 1H2ZA 5HF5A 4A0SA 2UUPA 4GMFA 4Z6KA 2DE0X 2PUHA 2YRFA 4UTZA 4K1LA 4NG4A 3FFAA 4XASA 2OXEA 3RTDA 2B8JA 2ZPUA 1KVSA 1IDOA 1RJEA 4NQZA 3DC2A 1WP9A 2A0UA 2VNIA 2OK8A 2CN1A 4J9VA 5B36A 4GLFA 1VBNA 4N18A 3SQNA 3R0VA 2HI0A 2GZSA 2G0AA 2OLJA 3BTSA 2W2QA 3JQ9C 4XWOA 1U02A 4W7IA 1C7ZA 2OUIA 1G4UR 2Z2KA 2Z57A 3WLRA 4CL3A 4UHBA 3T38A 3LF1A 1EWYA 1QONA 1XTKA 1Q6ZA 1ZPDA 3FNRA 3GFOA 7YASA 4WA8A 3AP2A 4LW8A 2L18A 4FMCF 2V45A 4EZBA 3D8NA 5ALUA 2BV3A 4ZTZB 3O26A 1C41A 1U8EA 4LNUA 2XMDA 4PAGA 2YY6A 2EWWA 2H57A 4V24A 1R4NA 5ALXA 1QP8A 3HS3A 4KRYA 3L79A 5F76A 4MV5A 4ZZ1A 1KJIA 4WN3A 2E1RA 2WZBA 4B6SA 1CWUA 1PJ4A 3AKZA 3PSAA 3WRWA 2W37A 1VI6A 3U7EB 4IWYA 1LTHR 4FSDA 5LQCA 2IP4A 4PNPA 5K3OA 1B15A 1L4GA 1XCBA 1XXHA 2JAHA 3CF0A 3QMPA 3TZEA 1T1EA 5T6BA 1VLJA 1QQ6A 4ND1A 1C1DA 1GU0A 1EP1B 1JRLA 1KTVA 1E2PA 1CY6A 1DAKA 1ZVMA 4WT7A 5C1BA 5K01A 3SSAA 4O4IA 3BUSA 1FFDA 2PDAA 3EIEA 2J0UA 4FOLA 4M6WB 3FRHA 2E4WA 2YH2A 3SI7A 2VPWA 4L22A 3ZVNA 1CEEA 3BXXA 2G77B 1R4MB 1T5BA 1O96B 3W9SA 3NOXA 2QUHA 2RB4A 3PJEA 2HCFA 3QXGA 4I9UA 4I8DA 4BY9E 3ZNNA 2CZCA 1GTRA 1XZMA 2PWBA 3B8HA 4ZRNA 2XKAA 2AV6A 2CHQA 3UCXA 4TTSA 1OLUB 4DABA 5FUBA 2OSBA 2X14A 4DPMA 1QH8B 1I0ZA 4ITUA 1IHXA 4OQMA 1U8FO 4HLUA 1VHTA 2TECE 3HYNA 1EX6A 3L3BA 3NHFA 3ELDA 4Q1EA 1M6VB 4BMZA 3ZK7A 4FFSA 1ODJA 2HDOA 1UBJS 2REOA 2ODAA 2AWNA 1ONBA 4XW2A 4P3OA 4O3MA 1X77A 5JZBA 1WSDA 2EL9A 5DGHA 2XV1A 5K7SA 5CCXA 2IU0A 1A98A 4GYJA 5AVRA 2GF9A 2HBQA 4TLCA 2BFPA 4RHFA 3VYTB 2NZJA 1JEAA 1MR3F 2PSHA 3D4IA 4Q05A 5F4BA 2J3DA 4B7ZA 4LC0A 4EPYA 2PCJA 2H7CA 4LY3A 4BGEA 4C2UA 3TQRA 1JJVA 1SHLA 4H1HA 3W77A 4Y0AA 2W4QA 2NG1A 1TOAA 2VSFA 5KHOC 2CMKA 1I3NA 3E9MA 4QREA 3IR7A 5C3UA 4BQSA 4DFDA 1E3WB 2I4OA 4K3VA 3QX9A 4LOKA 4OJNA 4CZ2A 3DL2A 1L0BA 1SZJG 3ZCUA 1A3CA 2I6SA 2WFLB 4LDNA 4PC7A 1NJSA 2VJQA 4Q9LA 5CB4B 3F3YA 2BM1A 2JRLA 5E4YA 1PZGA 2I2DA 4CHTA 1KY2A 2WU1A 4DLKA 3KR9A 3OOSA 1HFEL 3KVRA 4XQ0A 3SBOA 4KQ1A 4GBJA 1UBHS 2XNCA 2YMPA 3F7TA 1NG9A 1PFWA 1SCNE 4BUZA 1TJ3A 1GTVA 4J6EA 3M2TA 1W88B 2WJHA 3AXTA 2LDXA 5FA6A 2VSOA 4R8KA 1G41A 5HRCA 3OE1A 3A4MA 4WD3A 3UOWA 2YQ4A 3O3MB 1X7GA 2XRYA 2XXJA 2JI6A 2ZJ3A 1CS0A 2EKZA 3E3AA 3OM0A 4GRAA 4QUHA 2PX2A 4TS4A 4YREA 3VBCA 3PNSA 4PS1A 1GQRA 1GSAA 3L92A 2EW8A 3M7IA 2GK4A 1PKEA 3GRUA 3I4CA 5CXXA 3M1LA 1T9BA 1UOEA 4OX9Y 3ISJA 3GJTA 4QO7A 1IZ7A 1B8OA 3K4PA 3RVLA 2FEOA 2Y0BA 5I3CA 3FGNA 4RK0A 3WR5A 1NXVA 1ZW6A 3NAMA 3CF2A 4X60A 3WFJA 5AESA 3WQBA 1G1MA 1CR1A 1MD9A 2HQSA 4Q1CA 4MVJD 3I1IA 7REQA 3ZS9A 2RAUA 2O3JA 4DL9A 2UZ0A 3IKMB 4JLVA 4YI3A 1HO3A 5EXEA 4BFSA 1ZSNA 3A36A 2ZM6B 1FRVA 2BY4A 2ENWA 5LA6F 1L7NA 1YNSA 3N0RA 3I1FA 2JATA 4ZI7B 4QG3A 5J2TB 1MA0A 1V8BA 2EFJA 3PHGA 5EXTA 2I7CA 1X8KA 4O4HB 3W3AH 4LWPA 1UM9A 5LOVA 3BIOA 4WDRA 3QV1A 3HU3A 4KO8A 1ZQ1A 5JI3E 1EU1A 4G8DA 4OO3A 3L82B 3A1VA 2LWIA 4PLGA 2BGMA 2QRLA 3M4ZA 4DMHA 1RYYA 2C7QA 1L4KA 3ZHZA 4G5YA 1JXAA 4OXNA 4QHTA 4RVDA 1KY4A 5AM0A 1QFSA 1K92A 5M5BA 4YP6A 2GBLA 3HA3A 4Q7EA 1V4VA 2R8BA 5JAHA 1L3BA 3RG2A 1E2BA 5BPHA 2QLMA 3RIYA 3ND8A 4CL8A 4JI7B 3B1XA 5CAEB 4QBKA 4UASA 3ZWNA 3FX2A 1U4OA 4RENA 4QSMA 5AVJA 3T9CA 4I3FA 1JLMA 2VJPA 3PNPA 4UZSA 3TOCA 1C81A 5FOWA 5FUQA 3QWAA 1FSZA 1TAUA 1L4UA 4ECAA 3BBPA 4MGIR 2VBCA 1JU3A 3L7NA 4GSLA 2ID4A 3I92A 3G2JA 3K1AB 4WZZA 4CE6A 5FAKA 5KSOA 3KV3O 4F8EA 1TA9A 1E2NA 4J91A 3LT4A 4RGQA 2VYND 4FI3C 2XUZA 4RIGA 1XNQB 3JRWA 4JQYA 2AVNA 3D6MA 3G2LA 1KMQA 1KJNA 3AIKA 3FA2A 2AEFA 2Y1LA 4FOSA 4V0QA 4HTFA 4GMXA 2C5AA 2FPWA 1P0MA 3OQPA 5EJFA 1TAHA 1UDWA 1II8A 1QLJA 3FYSA 2HCRA 3GLVA 3NAGA 2J48A 1PVVA 3PKIA 4H15A 3MTQA 1Z7YA 2KW5A 3NJ4A 3L7YA 3T5CA 5F98A 5HX7A 4U0JA 2B3DA 4UBKA 1UK7A 4CPDA 5B1EA 3J81k 1CUUA 3A28A 5LNK1 2MYNA 4H1TA 4GVPA 3VDRA 2FNAA 3Q87B 4EPWA 1Q0PA 1QC5A 1PDOA 1O87A 2H7VA 5TF4A 3WBJA 3GLGB 3HR8A 3J81A 2E18A 3M81A 1A9RA 2NO1A 4BAUA 1DL5A 3DBVO 4MB2A 3SU8A 4F9GA 3N0WA 3EA4A 5J23A 1CJVC 1R6VA 2AMVA 5AM2A 1GGKA 1VL6A 2FR8A 3HV2A 2B2NA 1P8JA 3MT8A 5SY4A 4OJKA 4XYLA 3CKMA 3ZJ4A 4MW4A 5KTMA 2EJCA 4RF3A 1DUSA 5EHXA 4OHZA 4BWFB 1XXLA 3BKWA 3JWPA 4DLZA 5IJ0B 1GRVA 3AVXA 2RGWA 4FHEA 5KOJA 3WAGA 3DEIA 3ZE7A 2B0JA 2QXUA 4I50B 2ZWOA 1JSXA 1G2IA 3BRWA 4KNWA 4DA6A 221PA 2W90A 3D0QA 1FU8A 4UOEA 2D5LA 4CLOB 4K6MA 5DBGA 2W70A 2CVQA 4F72A 1NSFA 1J90A 4HGRA 4NCIA 5LDHA 3REQB 1IOLA 2OPHA 1MAHA 1UJ6A 5AR1A 2PLFA 3ONWA 3TUIC 3NYQA 3EFHA 1L7EA 2CXNA 2QL9A 4A9AA 3B7GA 4AJLA 1OI2A 2H1CA 4JLKA 3DBIA 4MGHA 1H2EA 2XNDA 5DSZA 2GHTA 2NUTB 2ZXEA 1NU6A 4PYJA 5KIAA 4TWRA 1P1FA 3HUDA 1RCUA 3BYZA 3P9SA 4QUAA 4R9NA 3VJMA 2JAPA 3N2GA 4QX6A 2XKKA 4EJFA 4YFYA 4KDEA 3COYA 4JGIA 4UU1A 2QTRA 1OLXB 4G25A 3TLBA 4OHRA 3SQWA 1O57A 1EB8A 1CF9A 3SC3A 4BVEA 3WGNA 1DWQA 4LDRA 4LY6A 2XB2A 1YE8A 3S44A 4E14A 3H7AA 3OZXA 2B1RA 1GDTA 1INLA 4Q3BA 3LGAA 3IP5A 4XX0B 4RY8A 1LI5A 2I54A 1CNFA 2Y9PB 1PW5A 5A7HA 8GPBA 1VL5A 3B36A 1ZJWA 1V8PA 2XQVA 3CX7A 3NHAA 4II3A 4DCJA 1YL7A 2Z09A 2ORED 3NBQA 1JA9A 1J2JA 2C00A 4I2NA 2D5AA 1T0BA 3M6XA 3PFKA 2A4MA 3WGJA 4RORA 5I47A 3ITNA 4EVIA 3VNUA 1FRNA 1YRHA 1LPOA 2PSJA 3HCEA 3PZRA 3VR2A 1N9GA 1P0QA 3IMCA 2O5EA 2ZJ5A 2FW8A 1R9MA 5FXMA 3RASA 3R1IA 2BBSA 3KHKA 2PU7A 1EE9A 3H75A 5DTMA 2H9AA 2TS1A 2YZKA 1NM5C 4NE2A 4D8UA 1MC5A 3W5VA 4ESOA 4PBTA 4LCBA 2HBRA 1M1ZA 3L01A 1ZZEA 1Z4PX 3GBPA 1P39A 1QZXA 5JNWA 2ZKLA 4EENA 4RJKA 4BN5A 5K4HA 3G9XA 2O14A 2BI8A 3L0IB 5CXUA 2D5BA 3C74A 2ZRMA 2H17A 3OZSA 5LC1A 1BSVA 2Q5EA 4FNGA 1V8ZA 3CINA 3W6OA 3BWBA 4ZTBA 1IBRA 3EEIA 1VPWA 1AXGA 2A9JA 2FOIA 2WNIA 1Y6ZA 1CZKA 3HWRA 5AKJA 1VXRA 4ZD6A 4OU4A 5IHXA 1SG9A 3QJ5A 4CV0A 1E6EA 3K6JA 2QLFA 3WGOA 5A1JA 4Z0HO 1XTQA 2GA8A 1QC5B 2O6LA 3SX2A 3WLLA 5FV7A 4B0PA 1VSUA 2L42A 2O59A 2QUZA 2RKBA 4OQNA 1A82A 2ZE8A 3EGOA 1YZYA 4GU5A 3VUFA 4EHDA 4LRTB 4DQUA 2EEZA 4RPJA 4KWCA 5CVEA 5F7XA 4CEHA 4EMSA 1AC5A 2JEOA 1CQXA 3WX0A 3FY4A 5IN5A 3KEMA 3F47A 4PNZA 3SXUB 4C0AC 3WI7A 3Q72A 3R7FA 1UADA 4HO1X 1EXMA 5CHEA 4ABYA 4OGGA 5HE8A 5BVHA 1P3JA 2P5UA 3E53A 4ZAFA 1TF2A 2WPNA 1TIBA 2XOKD 1Z17A 2OUKA 1KMNA 2BFDB 4O1MA 5CIYA 2XZLA 1MRZA 4AJJA 5ADWA 1OVMA 2YMLA 1VHQA 3HABA 1H5UA 5DM0A 4CGZA 2IL1A 4W1SA 5DNVA 2NMVA 3G6WA 1HZZC 1HE1C 2D74A 3IO5A 4NCNA 4NJOA 5ER6A 3S29A 3IBTA 3T5GA 1AV6A 3DFIA 4JP3A 4N5MA 3EWIA 5JD3A 3LHFA 3M34A 3WK5A 5DM60 5JYDA 1RNLA 3DEFA 2X7HA 2JW5A 3H2KA 3ZXXA 5JC8A 1OE0A 2IKSA 2VP2A 4FB4A 4RV4A 1PZEA 3KSZO 3WP0A 3O8NA 3AUSA 1YD7A 2GZMA 1C29B 2AI2A 3VU8A 4B44A 1L7PA 4QYIB 2GR9A 3DZ8A 1RXIA 2HLDA 1FQKA 4K6CA 4LYEA 4E5NA 1Y3DE 1X94A 4OMUA 1S7GA 2C2HA 3EODA 4YVFA 2C8JA 4LG1A 4M1EA 2VHXA 1H9BA 1YJAA 4U7JA 3F71A 2V1UA 4J0EA 4MUNA 3HFGA 5FHRA 3VR6A 2CVOA 5AHOA 1ZJZA 5I8PA 4DQDA 3OQNA 4L28A 1K3FA 1KZHA 2YZNA 3AF5A 1OF1A 1NFRA 3OAAA 4CMHA 3I52A 1NMEA 2PSFA 3GH1A 3KJNA 4S1NA 1XZGA 3D4BA 4IHQA 3MGGA 4X3OA 4GM4A 4Y1RB 3QVMA 3FFTA 4DS3A 5JMWA 4F1KA 1V95A 1EHIA 3A0RB 2EGUA 4P53A 3UGQA 1COZA 2VPXA 3GA5A 3LXXA 1K2VN 3UMCA 4BNNA 5DRYA 4UNRA 3E5RA 1MT0A 4LJLA 5BWLA 5DW3A 1FPQA 1P29A 5T6MA 3HLYA 1U8AA 2BBOA 3DWGA 3Q7PA 2PUJA 3QWBA 4U6QA 5D3QA 3GU3A 3RYFA 3NWBA 1YRLA 4IJKA 3PYMA 1TYAE 1ULAA 2JFVA 2DF8A 5J2TF 3T61A 1ZN8A 3HP4A 3PQ8A 4UBIA 3DBRA 4DIEA 2QPLA 2GEDA 3COSA 5HIIA 1JDJA 1T5SA 3LIIA 4LBWA 5CEEA 1PT9A 4RQUA 1BX3A 1ADCA 1UWLA 2F1IA 1PEKE 3PK0A 3RNOA 3T7AA 2BZ0A 2QTVA 4J49A 3MLAA 5DASA 2FRDA 3TCKA 1IJBA 3WK9A 1RC8A 1KHTA 3D64A 2W6MA 5I7AA 3IT3A 1SCAA 4JVNA 3M3DA 3MTBA 3P0EA 4BNJA 2DKOA 4I1OA 1CZLA 1WCWA 3SKVA 4AJ4A 2OQIA 1JJIA 1BFUA 3P0JA 4O4IB 1Y5MA 3HNRA 1N2HA 1PFQA 1RYDA 3G89A 2Q3LA 3IPCA 1YUBA 4OH1A 4R68A 3G1TA 4W1PA 2W2MA 3EOZA 3PRHA 1S6YA 3CH4B 3LVQE 5D8DA 2PQ2A 1J0CA 2EGGA 2GDJA 2YWEA 3O75A 3OEEA 1MIOB 4JL6A 4NKRA 5EGSA 4ZO6A 4ARCA 4DC0A 2VHVA 2QM3A 4PVDA 2I3GA 2NUPB 3BZUA 4TLMB 1NE2A 3NH6A 4G0XA 2XCUA 1JKXA 1UDRA 3Q0IA 4R8VA 3JALA 1NPTO 2W00A 3GT7A 2YV5A 1MZVA 5AUOB 3QF7A 1OBOA 1UMBA 1ZLXA 4NABA 1YUMA 4E09A 2DWCA 3BULA 1Z56C 2YRXA 1UBLS 1XKTA 3BAFA 4LK3A 4PO3X 1MDBA 4PF1A 4S0XA 5AJZA 4TTQA 3V7WA 1Z5UA 1CDEA 1NI5A 2A5LA 5CGZA 3TL6A 4BE7B 2CLDX 2FUG1 1ISRA 4KLCA 3X1YA 5FDFA 2DJIA 4GYKA 1E58A 4JZYA 1RXSA 3HR4A 2QKYA 3PLRA 4JEMA 2B7BA 2NADA 2QRGA 5MN4A 3LZDA 1IB0A 4FDLA 1DHRA 1BA3A 1G4HA 1GGFA 1YMUA 2O4CA 3L8ZA 3LQQA 4IO0A 2OCPA 5DYGA 4I1IA 1X42A 3LBNA 1YVUA 5FIUA 2X0DA 1AOXA 3NOQA 3UY4A 1T3TA 2HZ7A 2IHZA 4QBHA 4X95A 1OLUA 4G89A 5F9MA 3T9BA 2BFEB 2X2EA 2CFCA 2WAOA 3A0UA 4B87A 2IIPA 3WIUA 2BE9A 2IOFA 4CTKA 3OX1A 1DJOA 2IX9A 2IH2A 1JQAA 4MUEA 2J1LA 3IA7A 2HJSA 3AGPA 5JBIA 1XPOA 4U00A 4LSWA 1G8SA 2FZLA 4FGSA 4OIMA 5AJWA 3C8DA 5AK3A 4ZAZA 3WLOA 3NU1A 2IC5A 3NWPA 5KNCH 4ZEOA 1MX5A 1KIFA 1EK6A 4UNQA 6AT1A 2FOXA 3ZCPA 2OCKA 2WTEA 5B7PA 5CFLA 2CNDA 1PJQA 3EDMA 5I51A 1O0SA 3F73A 4M8NE 3UWKA 1LRJA 2QX4A 3HP1A 3K9BA 2H16A 4Z3DA 4PC3A 3N2EA 3NVDA 1SQ6A 1FFBA 5D6NA 4XRGA 4BQRA 2OILA 4NFYA 1ID1A 3AKEA 4ILEA 4N8DA 4RZ3A 5YASA 3TW0A 3U3KA 3UKJA 4H1WA 2VHWA 5DNCA 4ZJPA 4OFZA 2ZB8A 2O6HA 4AF6A 1DAEA 1I9GA 3CX4A 5HKKD 2H0AA 2JIQA 4JBIA 1UQUA 4QBFA 1E3DA 2W8BA 4O4LB 4FYMA 1EVYA 3N2IA 3RVJA 3UC5A 2FY8A 4A2CA 2VRNA 3B13B 1FQOA 2WOJA 2AJ8A 4D46A 2Y77A 3UJ7A 5IJZA 1D2AA 3FR8A 4ISCA 1P2VA 2VSQA 1M8FA 2LCQA 4WBSA 4RELA 3TIVA 1G7CA 2ZUDA 4IUBS 1MF7A 4KVGA 4IJ6A 2C8LA 4R01A 2CNWD 4WNAA 2RK3A 3VOBA 2QVCA 3NDBB 1HK7A 1OXXK 4N7JA 5DLQC 3ANYB 3G8DA 4NZNA 3TQCA 1NMSA 2N42A 1HZJA 3D6FA 3W5BA 1DRKA 3OCJA 4RV5A 4UHKA 2VDUE 4RTMA 2W2XA 4AQ7A 2OXRA 2CB0A 1XTUA 5L45A 4Z1MA 3T3NA 4BRWA 3EBPA 1MJGA 2CFSA 2BGUA 2CLKB 3CLTC 3SJBA 1CY2A 1XYGA 3CJTA 3O4JA 4BVLA 1CIVA 2RGYA 3PXCX 3VU9A 3ZKAA 5C1PA 3RRJA 1DFGA 4HNVA 3Q3GE 2BBTA 3QMWA 1VJ0A 3Q40A 2YWGA 4LSGA 2W2KA 3ZYZA 2D2VA 2BFAA 4D4IA 2C2OA 4P4TA 4E1AA 5K4GA 1XRMA 5LOVF 3NB0A 5EGNA 5IW8A 4F9FA 2Y67A 3OLQA 2PLAA 3D8UA 5AKEA 2EYUA 4WEOA 3L7JA 2IS6A 3L7AA 3MCWA 3OIVA 2PRJA 2QT1A 1RKUA 4UVHA 1UK6A 4XVUA 3OPNA 1UPCA 2VFAA 1KAQA 2FJUA 2AG8A 4ENRA 4AMVA 1TM3E 1RP1A 2CLMB 1F8GA 3KPUA 3BWEA 1KFKB 3HCNA 1DAPA 1WB5A 4W6ZA 5L3ZA 1JW9B 1BGXT 1NQOA 3IMGA 5AI0A 4YJDA 5K3EA 3EXIB 5LP6C 3WRXA 1NPYA 4MWSA 5LU8A 1S3GA 3GMIA 4G0NA 5FUVA 3ZE6A 1HMYA 3M4XA 1LV7A 1WMBA 3QKWA 3R3HA 4PYRA 2YXNA 4C7MA 1R8YA 1DAIA 1PWXA 1TMOA 3ODPA 5JOQA 1WBBA 5G1PA 1BDMA 3N2LA 1RTKA 3DDCA 4IDCA 2ZIVB 3AEYA 4N6GA 4G84A 4RLQA 2OXTA 1ZH6A 2DT8A 4ZOLA 3RYIB 4DA0A 3EB9A 1CRLA 3HP7A 4Q93A 1HDOA 3HH8A 1VLMA 1AKYA 1N3BA 3DCJA 4DR7B 3U16A 2COKA 2I1WA 2V3CC 1EP9A 2XMPA 3TPFA 3CVVA 4YPVA 1G5IA 3UB2A 5KEIA 3QW4B 1GUYA 5DBIA 1WX1A 3ZUPA 1Z12A 2R96A 3T95A 4AF7A 2H59A 2QV7A 3PA8A 1D0VA 4YONB 2BCGY 2OO5C 5JXWA 1T4GA 5L6MB 3O9ZA 2G82A 1AK9A 1JHYA 5JCXA 3OZEA 1ZSVA 4HUJA 3AP1A 2XJ4A 5FTLA 2H1LA 3EN0A 1M0SA 5FL3A 1ZI9A 1XJQA 1FTNA 3W8FA 4QM6A 1W5EA 2WWVD 1Z16A 2CXOA 5IXSA 1O4WA 2C2MA 4UHJA 1XSEA 2FMKA 3MBKA 1UODA 2C92A 1VGVA 2YFHA 4JK3A 4IHKA 1JQEA 2P69A 3F5FA 5FYQA 3QU4A 4WOBA 5ITZA 5EYPA 1EFVB 3MLBA 5C5EA 5JTTA 1G42A 4FZJA 2HL6A 3I30X 3IP3A 3GK3A 4MXDA 4P34A 4P6VF 3K5IA 1T6XA 3ISTA 4M87A 5HQTA 1G98A 5FBRB 2HNAA 3EZYA 1ZC4A 4QXMA 1KDOA 1G16A 2OVFA 3ZI7A 1H4TA 3I8OA 4M0MA 1DWPA 1K7YA 2FPRA 1C2YA 4I4LA 3SIWA 2WTNA 1HFJA 2PS3A 2XMSA 1X6VA 3SPXA 1BNCA 3KSUA 3UEOA 1IULA 5FI5A 4RTKA 3NM4A 4WFKA 2D3WA 2QTTA 3LK7A 4D96A 5F35A 1YJCA 2VHYA 3DO5A 1LBEA 4L6IA 4Q4CA 1P1HA 2CL7X 3SJCA 2A33A 3DFFA 4OL0A 5U4XA 4KFRA 1T5TA 4BLPA 4PLTA 4JDPA 4D1YA 5BR8B 2PMWB 3GT4A 1M8PA 4MP3A 4CKWB 1LKZA 2H5LA 2IHJA 2QLLA 3FNHA 4J7AA 4EO4A 4C6RA 2ZS9A 2RFLA 4JX9A 1M2KA 2ZJ7A 2JLSA 3CCBA 5FAXA 4EDHA 1U3WA 5BMOA 1ISGA 1N6RA 5DW0A 4AZ0B 1A9QA 2C4WA 5INTA 4ASUA 2MT9A 2PRYA 3KOXA 4Z7NB 1K6IA 2X5KO 1QNFA 3QVLA 4EDFA 5HKOA 4CM4A 2C29D 3IUEA 2VCEA 4PX3A 2PX5A 3JZMA 1K4MA 1FMFA 1A7AA 1CRZA 1ZMOA 2CXSA 1ZGZA 1EBUA 3HHEA 3KJIA 4MCAA 5AJYA 1WZIA 2C9MA 4M1YA 3W7BA 2EFDB 4IDQA 3NOVA 3RVSA 1FDOA 1L5YA 2YWDA 3DZGA 3V4FA 3TSOA 5LN1A 2R6FA 5F21A 5G4KA 2ZTLA 2GRJA 2FWBA 4PWYA 1J8MF 1OZ0A 1PLLA 1OC4A 3AI7A 1DLJA 3EXHA 1YIDA 4R9UC 4WE3A 4BV3A 2QTZA 5T41A 2DGDA 3T7TA 3D7MA 4KX5A 3ZV4A 4DMFA 2XZOA 2C1EA 3IXQA 3PNMA 2Z9BA 1ZZGA 1DQPA 2IX3A 4P58A 5CD9A 3ZD8A 3HN7A 4CLRB 4RIHA 1Z7BA 1TU3A 3JVUA 4OP3A 1H2FA 1FLAA 3KUXA 1EAMA 2XCLA 3UWPA 3W78A 4ZV7A 4FQ5A 2VO1A 3P0IA 4UPDA 3WL4A 3CLSC 5EZYF 3QY9A 1VG9B 1YRBA 3F5DA 3ONFA 4HS4A 1GUFA 3AEKB 1YZ3A 2J67A 4PQRA 4JBYA 4RXTA 1O77A 1Z73A 4GXNA 2WKWA 4HKTA 4MCIA 5F5XA 3RARA 3W9UA 4DVJA 2O8BA 1IQPA 5HWSA 5DM4A 4YBRA 1RWNA 1PWEA 1Y3HA 5EAIA 3SYKA 4MI1A 3U62A 3WLFA 5HVNA 3SQMA 2UZ4A 2P5SA 1U11A 2GWRA 4IY1A 1MVOA 3UG7A 4EO9A 1Q1ZA 4ZPXA 3NRJA 3AKCA 3VSEA 1ONNA 1HZZA 4Y2HA 2R7LA 3I32A 1Y7PA 4CM4B 1UBKS 4C7BA 2QN1A 1AS0A 3E05A 3MUNA 1KP3A