4JT2A

Structure of clostridium thermocellum polynucleotide kinase bound to ctp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jt2A00
2EWVA 2IT1A 1SULA 3AVVA 1F2TB 2GETA 2GKSA 4JLDA 3SYLA 1NF3A 5JHGB 3H0KA 1MO5A 1E9CA 1VYVA 5JLJA 2IXEA 5AJWA 1T4GA 4GPTA 1FMJA 1RPZA 4V0MA 2VP9A 5M04A 3GEIA 1O3YA 1BO6A 2G9NA 3FKQA 2Q6TA 2QA5A 3D6TB 1K5DA 1Q12A 2FZ4A 4MYCA 3NDPA 5DO9A 3F3YA 1FPMA 2CLCX 3CNNA 1KK0A 1XMSA 4R2HA 1KNQA 2IUTA 2ZRGA 3CRRA 3PEUA 4JVMA 3RHFA 1W2GA 3IUYA 2YWHA 2QQEA 3GJ8A 2FA9A 2H1LA 2ZSEA 2BCJQ 2ZSAA 1J7KA 3DM9B 3EG5A 4L15A 2Y8EA 4YXWD 1E0KA 1G6HA 1U8AA 3TVTA 1XF9A 4B43A 2W00A 2IS2A 3HPRA 5EE0A 2AWNA 3R9IA 1SXJC 2J7PA 4JL6A 4QBGB 3TMKA 1G3UA 2W0SA 3CKLA 2W2TA 3LX8A 3LVQE 1GKYA 2DWOA 1RW4A 3KXLA 5TVKA 1MR3F 4PHTA 1S1MA 2FFQA 2F7SA 1EWRA 3IO5A 4TSFA 3AUXA 3F5FA 4W5HA 2I3BA 5JECA 1E3MA 4RCZA 2IK8A 4ABYA 3W5IA 4QHTA 4ZKEA 5GADl 1G6OA 1MT0A 1KI6A 1SVIA 2AHOA 4D0LB 4K81B 2OAQ1 1NVWQ 3IO3A 2GEUA 4C0LA 1P3JA 1QHGA 4Q1CA 3W3ZB 2ZYUX 2CL0X 1CRPA 3IIKA 1G7RA 4C0SA 3ZZTA 4M9SA 4MA4A 1E99A 3NBYC 1BKDR 3RS3A 1G5PA 2GHIA 4TLBA 3BK7A 4FMDB 3LBNA 4IFBA 5KHOC 2NOAA 5EZ6B 3A6PC 3AP2A 3I3SR 1E9AA 2ZS9A 5FBLB 3TR0A 3MMPA 1P5ZB 1HV8A 4M1WA 2V54A 5HR5A 1BIFA 1N25A 1S0UA 4BZXA 5CITA 1CLUA 4EKDA 5AUNB 1ZUIA 2WWIA 1QHHB 4MRVA 1OFIA 1FL9A 4BFUA 3BERA 4IEIA 4LZZA 2FX3A 5F3WB 1Z2AA 1Q1BA 3SN6A 3ADCA 5HKKA 3KFVA 4DVGA 1XFAA 3QQ5A 1P61B 4WW0A 5SZIA 2L0XA 5A5GA 3BIFA 1YQTA 1E2HA 4QBHA 4YONB 2VHUA 2XOKA 3MJHA 4HATA 3EIHA 2H17A 4HLCA 2OM2A 1EESA 2O8DA 1WB9A 1G16A 3AUYA 2JA1A 3RLFA 3KTAB 5A0FA 1VHLA 3C7KA 2IW3A 3G0HA 3QE0A 3EWSA 5FBRB 4DDUA 3U7HB 1UF9A 2RGAA 4L8GA 3ZIAD 2ODNA 2K5UA 1U94A 4N3NA 1XDBA 2X1VA 3PFIA 4L16A 5CLQA 5D3MA 3BE4A 4JL5A 1MO3A 2A5GA 2ERXA 2HEIA 2V6JA 4LV6A 2EWWA 2OBNA 1XCGB 4Q4JB 1YR7A 4FXPA 4Q1AA 2FFBA 2HYDA 1IN6A 3DPUA 4HLDA 4B48A 1IOZA 4D81A 5DYIA 3VR3A 4DCNA 2ODBA 3B9QA 1JECA 2MSEB 3QPWA 4EPVA 1EFUA 4TN1A 4LJ8A 4QNRA 1U81A 2YHSA 4US1R 5AUQA 1UBFA 4BFTA 4PO8A 4IEEA 4H1UA 4C4PA 1PUJA 4A2WA 4PZYA 4X8MA 1M2OB 1TU4A 3A36A 4DWJA 1G3RA 2BKUA 1PZNA 5FL7D 4Q48A 1Z0KA 2JLZA 1N0VC 4TYWA 1KK3A 3G5UA 2OXCA 3GLIA 1II8A 4URWR 3MJRA 3KFXA 4OK3A 1ZD9A 2XB2A 4AYWA 3WMEA 3NBZC 3NEJA 1CJUC 4XWKA 2OSBA 1WF3A 2FZLA 2VP0A 4QJ5A 3WXMA 1Z0JA 4PHGA 2G6BA 3OFNA 5G40A 1UBGA 4EUNA 1E1QA 1VMAA 2FSGA 5EP1A 4DDVA 1OYYA 3GLGB 3DM5A 3ADKA 3BGWA 3IDQA 4IVPA 2WJIA 1G17A 1UM8A 2AFHE 2F43B 5KOYA 2X2EA 5LD2B 2A30A 3U5ZB 2PZGA 4R9UC 4XVRA 2BM1A 1R8QA 3K0EA 1GL9B 1N2CE 4AYTA 2O8BB 5H1YA 1HY3A 3CPEA 4UNNA 3AGQA 2W58A 3FTQA 4LHVA 4Z8YA 2XNDA 3EPHA 3EARA 2ZRKA 2ZR9A 4GP7A 1UAAA 3K70B 3CRQA 3CH4B 3O8DA 4IW3B 3LXRA 2XXAA 3KQLA 2QAGB 3HP1A 1GWNA 3KXIA 1SVMA 3FB4A 2GK6A 3MGCA 5FTLA 2IEZA 2QU8A 1NVXQ 1A2BA 2A5DA 4JJZA 3L2OB 1CIPA 3AQ4A 1JEEA 3ZVRA 4B44A 3WP0A 1SXJA 2IF0A 2YWGA 5KYKA 3P27A 1FTNA 2CEAA 3THYB 4LBWA 1U90A 1FNMA 3AVTA 1VECA 3FKSA 4ZDWA 4DC9A 1WRBA 1XJQA 4Q7LA 4WBSA 3ZD6A 3FMOB 3LNCA 4N0DA 4O0MA 4OI4A 5C2JB 2B6HA 4LOAA 3QY0A 4NYJR 3DO6A 2JJ1A 4XVUA 5EXTA 1Z0FA 4BASA 5FI1B 3OEED 2FMXA 4BQSA 3V4FA 2DB3A 3D31A 2VP5A 1QHYA 2IS4A 2WJHA 3W6PA 2O8CB 2N1BA 2ZITA 1OFTA 5KSZA 1FUKA 5KSPA 5KO2A 1YR9A 4EFNA 2J0QA 3VKHA 3N5CA 4Q9JA 2FPLA 2GJ9A 4HAUA 5TB5A 2VO1A 4PHHA 3TRFA 4C7OA 2P6NA 4NBSA 2ZETA 1PLJA 2G1JA 2Q21A 2ZYWX 2FGKA 2ZI3A 4GNKA 2CHVA 2N46A 1UDWA 4XSGA 3GCGA 4LC1A 3BOSA 3EASA 1E94E 5EE9A 3GLFE 3V4RA 1QHSA 1UEIA 1GNQA 1OPXA 4JS0A 2R2AA 3F0TA 1TL7C 2ASEA 5JI2E 2F1RA 1P62B 3GFOA 2WIAA 5BW8A 2HDNB 4MRRA 3ZD7A 5EUQB 4DIDA 5AJXA 2IYQA 5DHAA 2Z5FA 4Z51A 4KFTA 2G83A 4NTZA 2NO0A 3UXMA 1KI1A 2QGZA 2PEZA 5FOSA 3WHKA 1JR3A 5HCNA 2CL6X 3QIAA 2RGXA 5FUVA 4CEHB 5GVSA 4ZKDA 3NG1A 4FMCB 2YOGA 3U3JA 2QPAA 1XP8A 2Q0HA 5CB8A 4Z8XA 1BYUA 4DSTA 5BN5A 4NZYA 4LJ6A 1YZGA 1KZ7B 5JEEA 1Y3AA 3HU3A 3U61B 2YZ2A 1AKYA 2ZRIA 1WQ1R 5DI3B 4QRHA 3TE6A 4DT1B 4EQ6B 2XOKD 4GRAA 1XX6A 4A15A 3HDTA 3ASZA 2CL7X 4M1SA 2QGNA 4HZUA 1LF5A 2LCFA 3U44B 2Z0MA 3CX8A 4NHOA 2OBLA 2ZEJA 1HTWA 2PMDA 3PR1A 5EP4A 1UKEA 4OJQA 2XNSA 1RIFA 1T0JB 2C8VA 1KDOA 1JJ7A 2QE7D 1CR4A 3L8YA 2QI9C 4N1AA 1Q1QA 4ESHA 1XBTA 1SGWA 1F60A 4WXRA 3RS5A 1RVDA 4MYHA 4TL6A 2FGJA 2D2FA 4OI0A 1FX0B 1OFHA 1OHHA 4HDOB 3QPUA 1KHTA 3I1FA 2CJWB 1AA9A 3KXKA 4MGIR 4M1MA 4TWZA 1LNZA 1PJRA 1U0JA 1YE8A 1B23P 1AK2A 4KXFB 1E2FA 2HF8A 5JHHB 4S2EA 4IRUB 1R5NA 3CX6A 1EFRD 2BOVA 3I62A 1T0HB 1F2TA 1MABB 2AN9A 5CDFA 2QNRA 1OF1A 4I1OA 3PV0A 2IUSA 2OCPA 2VA8A 3TW4A 4UJ5A 2ODWA 3SDZA 3KKNA 2DR3A 1XXHA 3HYTA 3JVVA 4Q47A 8OHMA 3KQHA 1VPLA 2Z4SA 2QRZA 4MKHA 3AVPA 2P0EA 2V6IA 4F38A 3OFND 3K70C 4MUAA 2IYUA 1KAOA 1P9NA 2AXPA 4MQBA 4NCJA 4LYJA 2QAGC 4X8LA 1ZVQA 4U02A 4UKDA 3U7EB 3NC0C 3TUZC 1N6LA 4CEJA 3TNFA 4TYPA 2G88A 4JT4A 2JGNA 5TMPA 1ZJ6A 4PSVA 4TMTA 4GL2A 2P2LA 3AKCA 1WA5A 3WBKA 1U0LA 1YZQA 2OG2A 2XTNA 3AF0A 3DZ8A 2FNAA 2A3RA 1JQLB 3RRMA 4DXAA 2C04A 1P73A 2OO7A 5EE1A 1ODFA 4WXPA 3T35A 4PANA 5L8VA 1Z22A 4QC2A 2YINC 1NJGA 4MKIA 1AJEA 4HUQA 3T1QA 4BWYA 1I4TD 1W7AA 1DAHA 1NP6A 2IC5A 2OXRA 4A6XA 2O8EB 2XTMA 5KDOA 5LDDC 3QKRB 1IJEA 2ZJOA 4GOJA 3HU2A 1US8B 3FFAA 5FBQB 4C30A 2C9OA 2FSFA 3AF4A 1AIPA 1WXQA 2VLIA 1A5TA 1UKVY 1T8TA 1EGAA 3VKGA 2PCLA 4IDOA 4MYUA 3OIYA 5F2EA 2GJKA 2JJ1D 3R8FA 2YV5A 4EFLA 4DLSA 5L3SB 2RHMA 2ZJ2A 2H18A 2VHQA 4HLUC 3EPLA 2JJ2A 1QBKC 1YVDA 721PA 1W0JA 1XTRA 5C18A 2WWHA 2ZE8A 2JLUA 3LAWA 5E95A 3DZDA 4GI7A 1XNJA 1QHHA 4RZ2A 5CIQA 1TQ2A 2GXQA 4TMWA 3PEYA 1TQDA 4X8OA 1HQCA 2H92A 2OFOA 3RSLA 3RS0A 4M9QA 2ZRNA 2ANBA 2J9RA 4TQAA 4Q9IA 2NO7A 1M74A 1OSNA 1VCOA 4I1VA 4RD6A 4FW9A 4HAYA 2CDNA 5E7IA 1MOZA 3T1OA 1CR2A 1SHKA 2PT5A 3FGNA 3VX4A 1H8ED 4UNSA 3JVUA 1XEWY 4C9BA 1IM2A 1E2LA 2ZU6A 1KO4A 2OLKA 1RRPA 3ZS8A 4QGAA 4KI0A 3CRVA 4DLZA 1KTVA 4IOKA 2AK2A 2WJYA 4HSEA 1ZNWA 2F1IA 2ATVA 2J5XA 1H65A 1OXXK 4P4SB 2IYRA 1OIVA 4JZKA 1CKEA 2G77B 1PVOA 4EDHA 2RGCA 3BS4A 4QHYA 4B3DA 1U8YA 4HDQB 3B6EA 1A2KC 3I61A 3GD7A 4A8JB 3BD9A 1N6IA 2QBYA 1R0YA 3RC3A 4Q21A 1T3LA 3UPUA 5B2ZA 4OL0A 4G0NA 3CIOA 4E03A 4L9WA 2OHFA 4M2LA 1KKMA 4A0RA 4PPQA 4MDFA 4B75A 4KITB 5FTMA 1R5OA 2OUKA 2WPDD 4QXAA 1RFLA 2YNMA 2WHXA 3EZ7A 2YJTD 1VIAA 1E2NA 1U9IC 4JMPA 2WWXA 3PUZA 2IUUA 4PQRA 4WA7A 2CVFA 1Z0AA 1G41A 4P32A 1HEIA 4IXMA 821PA 2X2FA 1XTIA 4HB3A 3GLGA 4TL7A 4M8NE 1OLOA 2YVUA 3L82B 5AJYA 3SBDA 1KO8A 3UANA 1KIMA 2IYLD 3RWOA 1J8YF 3L0OA 2NGRA 3KKPA 1ZM9A 1W36D 3TW8B 1WDTA 4WOPA 1VHTA 2C2HA 4ZV4A 2JIZD 2OCAA 3LDAA 2CCKA 2GXSA 2BDTA 1NSTA 2CNWA 4KAXA 4ZPXA 3QJYA 121PA 2JDID 4JYCA 2QAGA 3TBKA 2JEOA 1UADA 1QF9A 3PUYA 3Q72A 2FE4A 5FUYA 4U00A 5HE9A 2W0MA 3AVXA 1T3HA 5JJIA 1X8LA 3EW9A 1JAIA 4E5UA 4W9MC 2D7CA 3LVRE 3OEHD 5JCZA 3SOPA 3AVOA 1ZC3A 1ELOA 2ZVPX 3B7GA 3I8SA 1NMYA 1W5TA 3KUDA 4P4TA 3VU9A 3BB1A 2IYTA 3W6NA 4DJTA 2GZHA 2ZR7A 3SJCA 5P21A 4LY6A 2IYXA 3EPJA 2GEDA 4G5RA 2WVJA 3THYA 4C0AC 3C14C 1OE0A 2GNOA 2R6CA 3EWAA 2PL3A 4LHWA 5KSYA 4PPNA 2XJ4A 3I73A 4Q1FA 3U3MA 1QRAA 3K9LA 4PAOA 3IQXA 5CIWA 2FSIA 1T5IA 1GL7A 2AK3A 2FN4A 4MKGA 3ZH9B 1DAEA 1N6PA 4O2LA 4G3XA 2EFGA 4ARZA 2I4IA 3P26A 4M9ZA 1UDXA 2IYYA 2GJ8A 4B2PA 2AR7A 4ASUD 2RGEA 5ANRB 4JLKA 4NYMQ 4IDNA 4O2RA 4NP6A 3X1YA 3HR7A 1Z06A 3AVWA 3CPJB 2BEKA 3AKYA 2FEOA 5TV2A 5E4FA 1R7RA 3R20A 2HCJB 2R6AA 4WIAA 3VAAA 3IQWA 3VQTA 3OF5A 2O8FB 2WWWA 3LXXA 2ZTSA 1GTVA 1LY1A 3DOFA 3QUSA 4JLPA 4JT2A 4JVNA 2ZAMA 4UXHA 4HLUA 4UNQA 4PC3A 1LVGA 3QG1A 1D5CA 3SFZA 1QG2A 3Q8XB 4TQUS 1RC8A 4QHSA 4B6EA 2HXYA 2YOHA 2GA8A 4RZUA 2XZOA 4EJSB 1GUAA 2GVDC 2P6RA 2C78A 5KNBA 5DH9A 1W49A 5H70A 1RJ9A 2BMDA 4NL4H 2VF8A 3U6KA 5FPHA 1KDPA 2J1LA 5IK2A 3X1XA 2CVHA 2Q3FA 4CEHA 4Q66C 1E4VA 2CLSA 4OHVA 3L0SA 4LPKA 2DPXA 1TUEA 4D80A 4F4CA 1CU1A 4N0EA 5KDDA 4PQYA 3P4YA 2HT6A 4XTRA 2ZRFA 5EJEA 3REGA 3U60B 1FZQA 1D2EA 4JKYA 5DI3A 5KDLA 3VHXA 1N6OA 4EQ6A 3J81k 3LQRA 2FFHA 3T06B 4KJZA 2A78A 5CYPA 2B8TA 3OAAA 3M0EA 4I81A 1FP7A 1G3MA 2JASA 1KMHA 4PQFA 1P4SA 2CK3D 4UNPA 1TEVA 4A8JC 3KB1A 2V4ZA 5CDFE 3C41J 5CB6A 3FMPB 1XJCA 2YWEA 4LHXA 1AS2A 2Q9AA 4EFMA 5L3QB 4X8HA 1XXHE 2DYKA 1KK2A 1Q1EA 2F3TA 3A58B 3SYNA 1RRGA 2UZ3A 2ZU0C 3H4MA 1XZPA 1XMJA 2WSMA 1W0KD 1A4RA 3AP3A 3FWYA 4OQXA 1FX0A 5FUWA 2ORIA 3WP1B 2O5VA 1KSHA 1BYIA 2A5FA 2CCGA 2CJWA 3VR5A 2DFNA 4LBYA 1E79A 3EAQA 4RD0A 1S96A 5B57C 1Z0DA 2W6IA 4JVLA 4DBLC 1ZBDA 2VRWA 2ZI9A 1G8HA 2H57A 4MDEA 2F1HA 4Z54A 3EIEA 1U9IA 3TKLA 1FMLA 1A7JA 4TTQA 1MRNA 4YMUA 3TSWA 2VSOA 5EXXA 1OKKA 3DVLA 2P6UA 1QVRA 2EYUA 1N3BA 4GZLA 4Q4AA 1GAJA 4ZI2A 2KI5A 2R44A 4Q4HB 6Q21A 5DIFA 1Z83A 4YDHB 2ZSDA 2GCOB 5FOWA 3THXB 4U5XA 2QP4A 2KWIA 3KKMA 3CF6R 3R7WB 1IN5A 2REXB 3BC1A 4BFWA 4V03A 1EG7A 5JJKA 3UATA 4Q02A 2BEJA 1XD2A 3OZXA 1I4LD 2FG5A 4LHYA 1JPNA 1ZCAA 2NPIA 2I1VB 3VR2A 1YKSA 1NY6A 3ONWA 3PIRA 1CRQA 4BUJA 2WTUA 2ZRJA 3DKVA 5TY0A 4GT1A 4LV8B 3ZLJA 3I4LA 3EZ9A 2FPMA 4FMDF 4GOKA 4D26A 3AVUA 2WSSD 2HLDA 2QL6A 3K9HA 3NWJA 3TAHA 2OLJA 4JLVA 5BWMA 2HUPA 1OB2A 1CR1A 5LBIA 4XTCS 2ZQ5A 2QN6A 4CDGA 4PO1A 3TUJC 1LF0A 1FOEB 3DEFA 421PA 2AKAB 3EZ6A 1LS1A 2AD5A 4Q1EA 1GL6A 4BLPA 3PXGA 4NMMA 4M1KA 2ZRHA 2C9CA 2ZRAA 2C99A 2AKYA 4DRZA 4CEIB 3LW7A 4PXAA 3BORA 1VDZA 4LYFA 2O8EA 1FQKA 2PLFA 3QKRA 4HLQB 4KV9A 2QMOA 1N0WA 1G7TA 5G53C 5JWOA 1FUUA 3LRPA 1ESNA 1CULC 1J99A 1Z2CA 1QHXA 2ANCA 5TDHA 1TUIA 4AWXA 5AJVB 2QQ0A 2CLDX 3B5JA 1ZP6A 4DB2A 2QTFA 1NL3A 4R98A 4EPYA 1P72A 3CZPA 3W8NA 2C5LA 2FH5B 3B2EA 3UK6A 5L3SA 2JLXA 3THWB 3QSYA 3FDIA 1KSJA 4PAMA 5L3RA 3BRWD 3BBPA 3UIEA 2V9PA 1K6MA 1LFDB 1P6XA 3K0AA 1W4BA 3P4XA 1KKLA 1YRAA 4DLYA 4E07A 4B6FA 4BFVA 5C1BA 2J0SA 3IEUA 2IL1A 3ICEA 5KNCA 3V00A 4KBGA 4BLSA 1VKJA 4JKIA 4AG5A 1S4QA 3QKSA 4Y0VA 3QEJA 4ZCIA 2BVNA 4NYMR 3K8YA 4QKQA 2ZRBA 5FR2A 4A0FA 4OQLA 5J4HA 2EQBA 4A36A 2PX3A 4TMZA 4OHWA 1TF5A 4DDTA 2D2EA 2DFKB 3GEHA 4BEBA 1CJKC 4A6PA 3NIBA 2RAPA 4Q01A 4QBFA 5TARA 4QM6A 4HB4A 2WWGA 5G3YA 2ZM5A 3E2IA 3KB2A 1RZ3A 4I1SA 2F55A 3AKDA 4E22A 1HQYE 2ZJAA 2ZI4A 1F5NA 1TF2A 4NCIA 5J4VA 4HUTA 4W7SA 2VQSA 5IK2D 1GNRA 5EZ5A 3I8XA 1P2UA 3QPVA 2MMGA 4QFMA 4B33A 2DY1A 5EQTA 5BXQC 1AKEA 1U98A 4M1YA 3SJZA 2F1JA 2ZUBA 3X1WA 4A8JA 1VCIA 5IT5A 3RABA 3Q5DA 1HYQA 5IHPA 3WMFA 1P75A 3FYHA 2YWFA 1J90A 3CR8A 1KI4A 2ZJ5A 4QGGA 1SKYE 3OAAD 1KI8A 2BMFA 3SQXA 2V8OA 3E1SA 4KBFA 4M1TA 3BJIC 1YRBA 2AFIE 4JBYA 4BLOA 1ZIPA 4DUGA 2YKGA 4OI2A 1CJTC 3CRW1 2F9LA 1Y63A 1M7HA 3RVBA 4F91B 3K1JA 2YC4C 3FHCB 1G1MA 3NHAA 3VMFA 3R9XA 2NO9A 3WY9A 3GJ6A 4GMDA 5C4MA 2J7PD 4JLOA 3V9PA 4FWIB 2W2XA 1Z0IA 4TL9A 2WJGA 2OCYC 5CM9C 3GEEA 2CE2X 4XVQA 3LLMA 1N5LA 5UKDA 4AY2A 4DSOA 3NTUA 4IVQA 5KPDA 3RAPR 1M6NA 1R5BA 3LY5A 4DCUA 1CJVC 4ZIRB 2JAQA 4TSFD 1OKKD 2ZRPA 3ICQB 4BFYA 4RZ3A 4BFXA 3OESA 4OHYA 1DOAA 2RGGA 4OK6A 2GXUA 1NN5A 1FQJA 3TR5A 1DE0A 1P2VA 2C77A 3TK1A 4JLMA 5TXGA 1EX7A 3GJ5A 2IYZA 1CS4C 1XEXB 1P9WA 3GLFB 5FR1A 3IBGA 4URUR 1G5RA 2C03A 4MUBA 3LX5A 1TQ6A 5HZKA 3ADDA 4JSTA 1HT1E 4KYIB 1ZUHA 3E70C 4WVFA 1YZLA 3SQWA 4B76A 1F2UB 1FTSA 1X1SA 4QGFA 3VNUA 3GLHE 5HPYB 3LFUA 3BAFA 4RD3A 3CR7A 2XX3A 3MRSA 3SI7A 1OIXA 1HH4A 2O0HA 3CM0A 3CPHA 3WRYC 5DGXA 3U7GA 4QJ4A 1R2QA 5HKKD 3ECCA 3W8RA 2ZAOA 5L3VA 2H7VA 4MH0R 3VFDA 3T61A 2WV9A 1Z28A 1K5GA 1W48A 5JZVA 5H8WA 4NCHA 2RHDA 1OH5A 4L9SA 1GRRA 1OW3B 4G5OA 1N6KA 2B7CA 2R9VA 3EZ2A 2KSQA 2P5SA 4RZXA 5B58C 1H8HA 2CCJA 2ZE6A 2ZYTX 4Q7KA 1NI3A 2WJJA 2WOOA 1UBCA 3CONA 4OQFA 1DARA 4H1VA 4A2QA 4MRNA 4FCTA 4UXIA 2WAYA 4JYBA 2X77A 4V0ME 2R65A 1M8PA 4RKFA 1UPTA 4TMVA 2QROA 1J70A 1S9DA 2GJSA 4D2IA 2PZFA 3I72A 4F4IA 1KOFA 4YLGA 1G21E 1VG0B 2PX0A 3NKVA 4PC7A 1W47A 4RD1A 1X86B 2BHRA 3JZMA 2VL7A 2AXNA 3Q3JB 3IKJA 4OQMA 4DLRA 4AKEA 3QXSA 4OKSA 1P9RA 1YR6A 2QTHA 3AM1A 1KGDA 2ORVA 1U2RA 2H5EA 2REOA 2QAJA 4YMSA 1NJFA 3LW8A 5LD2C 3AVYA 4EPXA 2W2VA 2QRNA 1NKTA 1JQJC 5H68A 2ZSBA 3ZDQA 4V0NA 4OK5A 1COWA 1QG4A 1AS3A 3L8ZA 1DEKA 3CH5A 5FBWB 1NMXA 3K9GA 1TPZA 4OHZA 2ZUCA 5DSZA 4P31A 4IOJA 1E1QD 1TTTA 1ESMA 5JRJA 4NPHA 1VG9B 3GFTA 2XEXA 4LUCA 1JEDA 2GRJA 2EFDB 3QEOA 3SJAA 5L3QA 1VIYA 3MD0A 3QVUA 4B71A 1JB1A 1JXOA 1EK0A 3B13B 2R6FA 2XZPA 2WMNB 2EFCB 4NCNA 4YMTA 3M1IA 3IHLA 1CEEA 1D8TA 2XNDD 1YHNA 4FMBB 5KUTA 1XB2A 2GZDA 1GRNA 2IXFA 2IYVA 4CZ2A 5KU1A 1JAHA 3B1YA 4UXJA 2QM7A 2PLRA 2J41A 2V7QA 4JJKA 1CP2A 2WWFA 4DCSA 1GSIA 2VP6A 4B3FX 2FPKA 3PUXA 2XSZA 1P2TA 1P7CA 1ZU4A 2H16A 3UG7A 1R0WA 1XTSA 3Q7PA 4BPBA 1SXJD 4BZQA 1OXSC 3QF7A 3GMTA 3MUFA 1E0SA 2P3SA 2GWHA 3W34A 2XGJA 1WMSA 4B73A 1BOFA 1OB5A 1G3QA 2RMKA 1VCMA 3FKSD 4Q4HA 3SBEA 4NE2A 1GFIA 3W5JA 3KJEA 3AEZA 3L0IB 4Q9HA 3THXA 1TU3A 1ZNZA 4H9GA 3SHWA 3EC1A 4JLNA 1Q20A 2WZQA 4TLEA 1R10A 4B3XA 1E9BA 3BB4A 4DSNA 3KJGA 3FHOA 2DBYA 5G41A 1IHUA 4LJAA 1VYTA 2QMHA 2GDJA 2ECKA 1Z6AA 1BS1A 1QDEA 3DMDA 4TL8A 2IHBA 1BMFA 1Q22A 2JLVA 2UVQA 4R2IA 4YQFA 2ZRCA 2VIIA 3PENA 3VTKA 4IDQA 5AUOB 1MO6A 1SQ5A 3QXXA 2XB4A 4LJ4A 1ANKA 4OI1A 1HE8B 4URYR 2VSFA 2W6JA 4YC7A 3WMGA 4ERNA 2G0NA 4QJ3A 4D4KA 3NBXX 4BLRA 4XH9B 2R62A 4TT3A 2O0JA 1E2PA 3DL0A 1IN7A 2QP9X 3OIUA 5CJ2A 4GSYA 3RANA 3I5XA 3IIJA 2NZ8A 3QVVA 1N5IA 4C0QC 1N5JA 2GCNA 2FF7A 1AS0A 3KTAA 1G9XA 1Z6GA 2Z83A 3CB4A 3CUEF 4Q03A 2PBRA 2E1RA 1PV4A 4OYHA 2VHCA 1Q44A 4P4UA 4PAQA 3QF4B 5CJPA 5EE5B 5J47A 1VCNA 1XCMA 4XJXA 1AQYA 4LBVA 3SYKA 1XJ0A 2D62A 3IGFA 4JLBA 3GLIE 1JR3D 3B1ZA 2CMKA 2RB4A 4Q4JA 1YJ5A 4M21A 5HTKA 5JI3E 1F48A 1S9HA 4EAQA 4I99A 2J0UB 4A4DA 3KJIA 1DELA 1DS6A 3LBHA 2BBSA 4F4JA 3HYRA 3THWA 221PA 2VSXA 3QI2A 3I92A 4DLUA 3K9NA 2OZEA 4LYAA 1Z29A 3P32A 2IHYA 4PPGA 1OFUX 3DHWC 3QXJA 5FOTA 2OE2A 4DDWA 2REBA 4G5GA 3GJ7A 1Q21A 4KSBA 2ORWA 4YXWA 5JCPA 1SKQA 5JWRA 4LDJA 1N6HA 4RY2A 2Z4RA 3KDSE 5FTJA 3VR1A 3AF3A 3CNLA 3AF2A 3DOEA 5E7JA 5GJWC 3RS7A 4JLAA 4D6PA 4ZI3A 1DAMA 2FSHA 3P1JA 4I4LA 2Q9CA 4F93B 4A1FA 1OHHD 2PZEA 4KLZA 1EFHA 3O8CA 1MH1A 3PCRB 2G0TA 4LC0A 4C0BA 4C0JA 2BIFA 1SXJE 3KZ1E 1KI2A 2J7KA 2XJ9A 2JCSA 4Q18A 2F43A 1YZUA 3P20A 3NH6A 1E9EA 2IYSA 2YC2C 4MYTA 1NLYA 1JR6A 2XZLA 2O8BA 3MSXA 1WP9A 5DHFA 3GPLA 2HJVA 3T5GA 2QM8A 2QSZA 1EWQA 3TQFA 3GJ3A 1WCV1 4TYNA 2VYFA 1OIWA 1L7VC 3MAAC 2OT3B 1ZD1A 2A5YB 1YZKA 1IXSB 4ZDJA 3A4MA 3SJBA 2VP4A 2RGNC 1XTKA 1UFQA 4GBMA 4FCVA 3IBYA 3VR4A 4BLQA 2GESA 2D3WA 2YOFA 3TUIC 2ZJYA 2NO6A 1LV7A 4PC1A 2ZI6A 4ZO4A 3B85A 1OV4A 1LB1B 1NMZA 2HYIC 4PZZA 2BC9A 3SEAA 4BRWA 3VR6A 2C98A 4B3GA 4B74A 4RFVA 4D25A 4DB4A 1S1CA 4Q4LA 5CK4A 2FEMA 3KKOA 2HXSA 1SHZA 2AWOA 4LJYA 4TYYA 3BH0A 4TZ6A 4WZ6A 4YMWA 1II0A 3AVQA 3UWKA 3H2YA 5CM8B 2J59A 5IF9A 3A37A 1NRJB 1IJFA 4OJKA 3PUVA 3FVQA 3MLEA 4GFDA 2EW1A 2HF9A 2V7QD 3SC3A 3ZIAA 1G4UR 1L4UA 2NQ2C 3B8HA 2O8CA 2P67A 3BFXA 3M6AA 3ND9A 1II9A 4ZIRA 2GBLC 3ND8A 5K8IA 5HZHA 2XSZD 1CTQA 3FE2A 1JR3E 2VF7A 3EC2A 1EXMA 1Z63A 4CIDA 1E9SA 3MWKA 4HAWA 2EU8A 2VHJA 4US0R 3T12A 2GILA 2ZPTX 1OXVA 4M9XA 4OBEA 3FFBA 3EIQA 4G5SA 5JFGA 5C46F 1IN8A 4GOXA 1XEXA 1DPFA 1PUIA 1I2MA 2PH1A 3GFPA 3IILA 4PPFA 1DO2A 4BZPA 4LCBA 5LB2A 3GLFA 3L0PA 4HDCA 4U7DA 1ZW6A 4C2TA 3GJ0A 5K8UA 1Z3IX 2RGBA 3GJ4A 4B35A 4B34A 3REFA 3CNOA 1NLZA 2IEYA 1UEJA 3RSOA 1R6BX 1Z6TA 3NH9A 4D4JA 3B60A 4F92B 2DFTA 2BCGY 1X6VA 1NVUQ 4I1UA 4QBIA 1CJMA 1HA3A 2JJ2D 4LJ7A 4RD4A 1W0JD 1TQ4A 2Z43A 1F2UA 1XEWX 2GTPA 3JZAA 5JJLA 1G8PA 4MGKR 3A1TA 1GITA 1XZQA 4LSGA 1X1RA 2I1QA 1ZM2A 3OIVA 521PA 4DLTA 2A5JA 1GP2A 1WBDA 3BB3A 1VG1A 1YR8A 1N6RA 5LB4A 4CVNA 4FWTA 4XD7A 4DEXA 1GG2A 3BXZA 5IRCD 1TAGA 4DT1A 3FPAA 1E9FA 3WRXC 1T8UA 1MRSA 2BKEA 1X8JA 2XAUA 3U44A 3NDBB 3D7MA 5HCIA 1KYIA 2J87A 4NKRA 5FOUA 3T15A 3ZYCA 1W36B 4ZCMA 2FFAA 2FOLA 1ZUNB 1M7GA 2PT7A 2O0KA 2RKOA 3K09C 1RYFA 2ODEA 2FWRA 4YDSA 2VBCA 1XXHB 3THOA 2MSCB 2FDCA 2ERYA 2OFWA 3AP1A 5SZKB 3CX7A 3F8TA 4JVSB 4PFSA 1C4OA 3B1VA 5JMTA 4AD8A 2ZROA 1QHIA 5D3QA 1A82A 3N2IA 4AI6A 4NYJQ 4B2IA 1ZMXA 2QTVB 2R6GA 2VPPA 4R7ZA 5DI9A 3ZVLA 3HR8A 3LO5A 3QENA 1FNNA 1MABA 2ONKA 1KY2A 3PVSA 4B2LA 3O8RA 4CEJB 2FJUA 3D8BA 4TLDA 3OHMA 1EFCA 5DNYB 2GF0A 2ZXUA 2IYWA 2QZ4A 2V1XA 3A1VA 1L8QA 1S3GA 3DMNA 5DISB 1D9XA 1KI3A 4LBZA 4TZ0A 3HPQA 4XSHA 3B82A 3OEEA 4Q00A 2PJRA 5LPNA 4P33A 3M4YA 1K8RA 4YMVA 2GXAA 4M53A 1E2DA 3CWQA 5BYKA 3U7FB 1GKIA 2WIBA 1XWIA 5AUPB 4HUQB 1LW7A 1YZTA 3AV0B 1ZYUA 2IF2A 3R8CA 1IAQA 2IWHA 2VP2A 3TSZA 4G01B 3T1VA 5JS7A 1E2JA 2D4HA 5F9FA 2A9KA 3T5DA 5C4GB 1OJLA 1QHNA 1R0ZA 1FP6A 2ZRDA 2R6DA 2RGNA 2CHQA 4QL3A 5K8TA 3U4QB 3C5CA 4IOMA 4K46A 4IKEA 1DVRA 3K70D 2CNWD 3D3QA 4G5QA 4DLWA 1IQPA 1GIAA 4ZDKA 3H1TA 3SNHA 3O8BA 4PR0A 1VTKA 2X19A 4AKGA 3AGPA 3OIWA 4ACAA 3WYFA 2XITA 4V0OA 4Q7JB 1E6CA 1UBEA 2B7BA 1JI0A 1M7BA 1R0XA 2JLSA 1JBKA 3SU8A 1IY1A 1L4YA 1G19A 4GZMA 5JBQA 4CW7A 1E98A 4PTLA 4F7WA 2IS6A 3PITA 3K53A 5FPKA 1RRCA 2OV2A 2AX4A 2JATA 4HAXA 3X1DA 4DZZA 1US8A 2ZUDA 3CW2A 2BBWA 3RRYA 2CHGA 1KJWA 1TADA 4B3CA 1Z6XA 3N70A 3IEVA 1JXMA 1AQUA 4URZR 5JEDA 4DKXA 2GBLA 1ZD8A 1P2SA 4JLJA 2EVWX 2GZAA 1NIPA 4L5BA 3TIFA 2NG1A 1SVOA 4E09A 1GRQA 4RJLA 2ATXA 4AG6A 1W44A 3RS4A 5GJVC 2ZI7A 1Z8FA 2QE7A 3SFVA 4PSAA 5CYOA 1DTSA 4EJSC 3SHFA 1HUQA 3KJHA 2F9MA 5EP2A 2LKCA 5DYGA 2OEPA 1D6JA 3EA0A 1KO7A 4RFSB 2KB0A 4BFZA 4DLVA 5BYJA 3U6BA 3RWMB 1AGPA 3IIMA 1GVNB 4RSGA 2QSYA 2QBYB 3A8TA 1TF7A 1G7CA 2VTKA 2QEQA 4G1UC 1EFRA 3CRMA 2KJQA 3PUWA 5EP3A 3LBIA 1DO0A 2KBEA 1D9ZA 1ZC4A 3QF4A 1E1RA 3KKQA 2TMKA 1F6BA 4PX9A 3TLXA 1KO1A 4HZIA 2WAXA 4P4SA 4QM7A 4TTPA 1SZPA 3UMRA 1AM4D 3EPKA 1W36C 3MWYW 3LLUA 3I5YA 2J0UA 4CF7A 1UKZA 1MO4A 1O87A 3CF2A 1XEFA 2NO1A 4XD7D 2C9YA 4PO9A 3K09A 1E0JA 4L4UA 1W2HA 4A9AA 3GLGE 5EE3A 3A4LA 2NMVA 5G3ZA 4XWAA 3X2SA 3LA6A 2HV8A 4KHZA 3K0FB 1SKYB 2QENA 1XTJA 2CBZA 4KSCA 3TGPA 2B92A 4KVGA 4LX0A 2IA5A 5KPJA 1Z07A 1IBRA 3ETLA 1XPOA 2OAP1 3SE0A 3S1AB 3A1UA 2J0VA 1XRJA 4Z1MA 3MCAA 1N5KA 4KFUA 4CRWB 2DFLA 4LRWA 4IXNA 1ZNYA 1GZSA 4FINA 1Z08A 3T1TA 5AR1A 3U2QA 1DBSA 4JIMA 3QBVA 1JPJA 4KYUA 1E4YA 1ZRHA 2N42A 1MV5A 1E79D 3C16C 4MITA 4Q1BA 4ACBA 1YU9A 4ILEA 3VU9B 2W6ID 4D0GA 3KQUA 3EA5A 2AL7A 3E5HA 4RCYA 3NC1C 1ZNXA 2BBOA 1DADA 4KFSA 2W83A 1AZSC 2V3CC 3ADBA 4JL8A 4TMXA 3C4JA 5KTYA 4A0GA 5KNDA 2DHRA 3O47A 1XD8A 4D0NA 1X3SA 4LGMA 2GAOA 2ZANA 2BM0A 2J46A 3SS8A 5FPTA 2SHKA 1I2DA 3BFKA 1NKSA 2A2ZA 3HWSA 4KODA 5FI0B 4ARZB 1NBMA 3RNLA 4D4LA 5J40A 1E2GA 3AKEA 3KX2A 5FPSA 4IFEA 3UG6A 4AYXA 3FMFA 1KDRA 1JNYA 3U3RA 1NSFA 2NTYC 3RRNA 4DCTA 5AJZA 4A2PA 3ASYA 3PG5A 4LWZA 1ZM3A 1ZM4A 1W46A 1JALA 2QPTA 4NU0A 3U3KA 4KFRA 5JSZB 1Q3TA 2IS1A 2WOJA 3UMFA 1CXZA 1UJ2A 5EXSA 3WYGA 5DLQC 1F3OA 1LS6A 5FOVA 1E96A 5K8LA 4IVRA 1XCPA 2A7QA 3QKTA 3GLHB 5J4KA 2QG6A 1H8EA 4WZBE 1X8KA 1KSFX 4UNRA 2Q3HA 1DAIA 1XMIA 2HLDD 4DCVA 3CO5A 3QKUA 4AC9A 3FHTA 1KI9A 5IDVA 4B32A 4JBWA 2BV3A 2IBMA 2HCBA 2RH5A 5E7MA 1KSGA 4NDZA 3WNCA 5EUMA 1RJ9B 1GOTA 5CLLA 3WYAA 2PCJA 3IPXA 3RRZA 3AF1A 1E2QA 4FMCF 1Z5ZA 4XWOA 5FUXA 5GJCA 3RDPA 1L2TA 3ZQJA 4KU4A 1TNDA 2XTZA 4V0KA 2E87A 3TQCA 1E2EA 3WNBA 2O8FA 1G5TA 3L43A 4PC2A 3CF0A 3K0CC 5FH9A 1DAFA 2QPOA 2OFXA 3B1WA 3QXCA 1T9HA 1HT2E 1T91A 1V5WA 4TLAA 2V1UA 1B0UA 4NYIQ 1SVWA 2JLQA 3QG5A 4EPRA 1OT3A 4EJSA 1KAGA 5BN3A 3BWDD 4DSUA 1KMHB 1E9RA 2JJ8A 4LHZA 4US2R 1SVLA 4AIIA 4HYYA 3WBJA 4BGDA 1CR0A 2WPDA 1AGRA 1ETUA 2ZR0A 1C9KA 3BFVA 4CGZA 2C96A 3FOZA 1E2KA 3A1WA 4Q5IA 1GILA 3CWZA 3Q9LA 4PZLA 4QGHA 1EX6A 2QT0A 3QNUA 1BH2A 3EXAA 1YZNA 3BH6A 1R4AA 2PJZA 1IY2A 3EX7C 5DN6A 4LPSA 4QNMA 4A82A 1VYUA 1XD9A 1S8FA 3X1ZA 1Q0UA 1ZINA 2GF9A 1KJYA 2X8AA 4KVAA 2BBTA 1OH8A 2ZJBA 4LYHA 2BMJA 4MGYR 1NN0A 1NN1A 1E1RD 2JIZA 3VNVA 1G8GA 1KI6B 3TAUA 1GKUB 4M22A 4Q4AB 4ZDIA 1Z47A 2ZJ8A 2JDIA 2C95A 1GNPA 3AB3A 4JBXA 5AK0A 1OH7A 3TSOA 3KUCA 2E9SA 2OBMA 4LV5B 3PQCA 1NVVQ 3KQNA 4GDFA 5BQ5A 4HI0E 4TMKA 3OEHA 3VHLB 1EFTA 1J8MF 3IHWA 5F9HA 3C8UA 4M0LA 1G8YA 4NONA 4D4MA 3MWLA 3CLVA 2IWRA 3R9WA 3Q7QA 1XD2B 2G1KA 4CT5A 3I32A 3PEVA 5J5CA 3QXHA 4RVCA 2FV8A 2ZS8A 5EXPA 4POAA 2Z6VA 4TYQA 4XOIA 3GJXC 3PJRA 2GEVA 2GK7A 3DDCA 4FN5A 1RRFA 4Q1DA 1E69A 4CT4B 1VG8A 3OE7A 5JWHA 3ZQ6A 4DUGD 2Q9BA 2LWIA 3K0SA 4C2UA 3N2EA 4R71A 1ZIOA 4Z1MD 2NPFA 1AZTA 1G7SA 4ASUA 1KMQA 4FD2A 3ZGXA 2GCOA 3CBQA 2WJVA 1G8FA 1T3SA 3DKPA 1XPUA 3R7WA 2ZI5A 1CBUA 4URXR 4O3MA 2ZVQX 4TTRA 1G4AE 2O8DB 1ONBA 2IXGA 1KJZA 2QMEA 1S2MA 2WBLC 5A4JA 2UKDA 2CE7A 5ELXA 1HURA 1NG1A 5GVRA 1W4RA 1RYHA 1XU4A 1Q1ZA 2LKDA 2EYQA 5D3MB 3U4QA 2NZJA 3SZRA 2HT1A 5BN4A 2O52A 4HB0A 3QOFA 1CF4A 1U8ZA 2P65A 4AK9A 2DCUA 1E2IA 4M1OA 4OQNA 3MG9A 2ZS7A 3W90A 1E2MA 3FMIA 4EPWA 1NBMD 4A92A 2ZREA 3A1SA 1SVKA 4EIWA 2MMCA 4B3BA 3K0AB 3B78A 3Q85A 4CEIA 4BFSA 1KO5A 2RCNA 1N6NA 2B21A 2QMUA 2R8RA 4O25A 1ZCBA 2WKQA 4AKHA 2D06A 4DHEA 5CK5A 1W1WA 4PC6A 2B8WA 3QKSB 3H86A 4WZAE 3GLIB 1II8B 2VHTA 2ZSFA 3ZVNA 1A1VA 1RE0A 2VH5R 3RC8A 2GJAA 1M34E 4CYMA 2NIPA 3ZZUA 4IDPA 3IPYA 2D74A 5FTKA 1OH6A 2WKPA 1DG3A 3GP8A 4P0TA 4FCWA 5J4LA 2PMKA 3B9PA 2J3EA 1GDDA 4ZCLA 3UWOA 1NY5A 2CK3A 2EFHB 4AKIA 1RKBA 3W9YA 5E3HA 1JJVA 3C15C 1KNXA 4UJ3A 1G64A 1Q3HA 3K0CA 4FIDA 3BH7A 5DE3A 1TX4B 1QVAA 3LQQA 2D7DA 4RD2A 3EZFA 1D2NA 1V43A 1NN3A 4LJ5A 3T34A 1WBBA 1W0KA 5FOXA 1H8HD 4MRSA 4MGZR 4RFSA 2G3YA 2QORA 2DWPA 2WICA 2VEDA 1ZM7A 2XXAB 4K8OA 4S35A 4TLCA 2ONJA 2OILA 4LK2A 4ESVA 2BMEA 5J4YA 1IN4A 4HAZA 1IY0A 3CZQA 1LTQA 1IXZA 4NCKA 1I4DD 1U99A 2Q3MA 2WKRA 2BWJA 4B47A 1GM5A 1SXJB 2F6RA 3HJNA 1E9DA 1W4AA 2ZIAA 1WE2A 4NH0A 5JS8A 3C5HA 5HE8A 2HJGA 1T6NA 1FFHA 2KE5A 2ZYVX 4NYIR 4MRPA 3W3AA 1PLLA 2DWQA 1XTQA 5AWFC 1TMKA 1ZAKA 3LWNA 1DAKA 1G291 1TEXA 1N0UA 4FI3C 4BECA 1NG9A 4DEYA 5SZJA 1FW6A 1KK1A 4BRUA 5DN6D 4PHFA 2YYZA 5FL3A 3NXSA 1COWD 1NLFA 3K0FA 3AH8A 2OCBA 2ZJZA 4KLNA 4P3YA 4A0HA 4URVR 3A4NA 1T5LA 5B30A 4XIGS 1IXRC 1NNEA 3S1AA 4HAVA 2ZRMA 1KY3A 3KL4A 1OXTA 1M1YE 2WSSA 2ZE5A 3PEWA 3Q5EA 4C7OB 4M4SA 1U0HC 4RKEA 3HU1A 5FTNA 3W6OA 4BLTA 2JLYA 1DG1G 5B64A 3GQBA 2BJWA 1NBME 4IJMA 4TQ9A 2ZRLA 4V02A 3ZVMA 1G18A 1AN0A 1KI7A 3SR0A 3RYTC 4UQOA 4II7A 4QOSA 1E32A 2PEYA 2GAAA 2V55B 2WM9B 3WHLA 4AURA 4IHQA 1G20E 1Z6YA 1UKYA 1DAGA 2UZIR 3TH5A 3G82C 4J0QA 3ZJYA 2IX3A 3TVDA 3TJZA 4ON9A 4DLXA 1NVVR 1Q57A 5GJBA 4IOLA 1R8SA 3LD9A 3ZZ0A 4LJ9A 1KZGB 4KCGA 4W5JA 3MFYA 3NBFA 1NIJA 5F98A 2WWYA 2QY9A 2MSDB 4Q9LA 1W4CA 3OE7D 4C0HA 1OYWA 2GCPA 1QZXA 2FU5C 4DIEA 4IDHA 4C0KA 4PSKA 1XPRA 4GMXA 4OHXA 4QG7A 2GVZC 3NEYA 3NVAA 4V0LA 2AD1A 2BJVA 3VKWA 2EFEB 3KQKA 2RGDA 5FBVB 3QBTA 4WAUA 4HZUB 5FFMA 2CXXA 5FL7A 1E0AA 5KSOA 1SVSA 3U3OA 4JSYA 4ITRC 5JSZA 3WNDA 1IONA 1P60A 2JLRA 1G3IA 1BMFD 2WMOB 3H84A 4MKFA 2ZE7A 4BEJA 4KO8A 4D82A 4HB2A 1S3SA 2QUZA 4HEJA 2F3RA 3GLHA 4LI0A 3NHBA 1J2JA 4GP6A 5JRZA 1HE1C 2H8KA 4Y0AA 3UMSA 2JLWA 2J45A 2P5TB 3VX3A 4W5WA 5FPYA 1OXUA 2W6JD 2QP3A 3B1XA 1KDTA 3MWJA 1ZU5A 4TT3D 4BE7B 1C1YA 4Q19A 2KBFA 5SZHB 4EPTA 3LV8A 4C3ZA 1MKYA 1XMVA 2OESA 2QT1A 3LH5A 4Q7MB 4Q9KA 3RS2A 3UKDA 3ZS9A 1W5SA 1PLKA 621PA 1D2MA
chains in the Genus database with same CATH superfamily
4L8YA 1LX6A 4PQEA 1QH0A 3COYA 1WEHA 5JHGB 4IJ6A 3ESAA 1NF3A 4BMZA 3VZDA 2GYYA 1CUBA 1MFPA 4X97A 2IXEA 1J2TA 2IEBA 1RYNA 1K4MA 2QX8A 2Z1DA 3QV1A 3GEDA 5AJTA 3DEZA 4YMGA 1RPZA 4V0MA 5M04A 1VLQA 4YCNA 3GEIA 1MJGA 5B7QA 4U5QA 2QA5A 3D6TB 3IAEA 4WY5A 1N77A 4HSGA 5KB3A 4G25A 4OM8A 4MCIA 1KK0A 1ZK4A 3C3KA 4JVMA 2PR7A 1GGMA 3UJCA 1XV5A 2EKLA 2ONZA 3KB8A 4G6ZA 4LXIA 1XMPA 4CR6A 2I76A 5D2CA 5EEHA 1I36A 1VIVA 2Z4TA 3AFMA 2ZSAA 1J7KA 1FS5A 3EG5A 4L15A 2I9KA 3W5DA 2Y8EA 2XCQA 1E0KA 1G6HA 3FROA 3GMIA 1XF9A 1FBNA 4FYMA 4WOKA 4BBPA 4JI2B 2W4QA 3HPRA 2YHIA 3G2PA 1SXJC 1EPUA 3IDOA 2X9QA 2Q3BA 5DHQA 1OBHA 1T2DA 4JL6A 3Q2OA 4G0ZA 3FIJA 4JROA 4BJ1A 3UV7A 1I0ZA 3F9CA 3PXAA 4G1MB 1I1QB 1T9GR 2W0SA 3CKLA 3LVQE 4NJMB 4TRNA 1GKYA 1NWCA 2BY4A 3KXLA 1MR3F 1T26A 5MGNA 3OTWA 2BUAA 5ICFA 4OATA 2PMFA 1TLFA 4DC0A 2C0QA 3I9V1 3SY8A 5IM4A 1FTYA 2F7SA 1SOMA 1YACA 1Y5LA 2NAFA 5MFPA 1JE1A 3IVXA 4AM8A 2B25A 3E58A 4M6WB 3AR9A 4ABYA 4ZKEA 2XUHA 4ZICA 5LYJB 3N0XA 4X85A 1QS0B 5KI6A 1NVWQ 1T9GS 4DRYA 2GN0A 2ZKLA 3ETGA 1QHGA 4Q1CA 2O20A 1V9CA 3IIKA 4Z3DA 3A9WA 3ZGVA 1CRPA 1DINA 4KPUB 4BP8A 1CJCA 2CXSA 4M9SA 2BFAA 3RS3A 1G5PA 2Q49A 1JU3A 3EGIA 3KV1A 2GHIA 4TLBA 4CWAA 3CVXA 1RMTA 3B2NA 3GGSA 5A4AA 1EVIA 3N1UA 1A8IA 4WASA 1QHEA 2VP3A 4DMRA 1VE7A 3AP2A 4JI6B 5KQRA 1E9AA 2ZS9A 5FBLB 5KTSA 3N0WA 5B3LA 1PWEA 3PQFA 3R0JA 4ZMRA 1S0UA 3EXFB 5DU2A 1T0UA 4IJUA 2YIMA 3R5KA 4KBYA 5AUNB 1JIUA 2GYUA 1FL9A 3FPJA 2FX5A 5B3AA 3GGCA 5F3WB 1HLGA 2C3MA 3ADCA 2Z9CA 5HKKA 4C4OA 2B0JA 3KFVA 1P1BA 4EKGA 1MORA 2PDAA 1WB4A 2CUKA 4WW0A 2L0XA 3OLWA 3W78A 3EW7A 2L18A 3EMKA 4YONB 4G0QA 3RIEA 4DVJA 3MJHA 4ENWA 1PQYA 4R68A 3RVPA 3EIHA 2DPGA 2PZMA 1LKZA 2OM2A 2WJAA 2AOVA 2HMWA 2ZIXB 3H2JA 5F3DA 1G16A 2BZSA 2KLBA 2P6MA 3KTAB 3M4XA 1W5BA 3TCXB 5BMVB 2QRGA 3G0HA 3QE0A 2XA1A 4IIFA 3OU2A 3O4RA 5ALVA 1UF9A 1XQVA 2Y0BA 1CX9B 5TQ0A 2RGAA 1BQEA 2VJLA 3VSEA 4NFLA 4G8CA 5GV8A 2ODNA 4F86A 1R4NA 3KR2A 3T3PB 4C1NA 4TRJA 3WDLA 5A9SA 1XAJA 2ZT5A 2JHPA 4N3NA 1D4AA 3EUAA 4AJNA 3PFIA 1RMYA 2O3RA 4RMIA 2FHPA 2GUWA 2HEIA 2ERXA 3CUSA 5IBRA 1XCGB 3LLCA 4Q1AA 4HLDA 4KAFA 4MUIA 3REQB 4GHWA 1CY0A 1RLJA 3PQEA 3VR3A 2ODBA 3B9QA 1JECA 2MSEB 3QPWA 3TR6A 1EFUA 4QTXA 1U4OA 1Z36A 4TN1A 4LJ8A 1XZBA 2YHSA 3PXDA 3QX8A 3C2QA 5JAPA 4B84A 3GWGA 1H5UA 1EBFA 4A2WA 3UM9A 4X8MA 4YX9A 2R8PA 1XNGA 2GN2A 3NR2A 4RTLA 2GBCA 2QYHA 5FL7D 3WOVA 2BAGA 5CTAA 3ZY5A 2YRXA 5IX8A 3FGOA 3K16A 3RNOA 5LZ2A 1NF8A 1LSSA 1N0VC 3ZW8A 4O33A 1L7DA 1NVEA 4GXNA 3BZWA 2I0FA 5LQCA 3LQ4A 4FSDA 1BN6A 4I5FA 4MUYA 3GLIA 4YQZA 5ECWA 3MTBA 3RT1A 3MJRA 1ST3A 4TKVA 2HD4A 3AESA 2XB2A 5IFKA 1Y4SA 2PUCA 1W6UA 4WDQA 5M5BA 5AXAA 4ARAA 4XWKA 4DM4A 1FDWA 1TCVA 1P0PA 2YXBA 3E53A 3NI2A 2RH9B 1WVGA 2WJ3A 4D3YA 2AI1A 1RU3A 2G6BA 1VMAA 2FSGA 2J3HA 2V7GA 1WV1A 2NNWB 3BMCB 1WXHA 1FFCA 4HTFA 4KXQA 3TNDA 4E1VA 1BDHA 3JD3A 4OAQA 4JELA 2OGUA 4DDVA 5ICEA 2ZSIA 4UD6A 5FULA 3WK9A 2CHUA 2W2KA 5AVVA 1JFSA 2YIVX 4XZ3A 1ZD5A 2WJIA 1TO2E 3IEXA 4UU1A 5KOYA 2H4FA 2X3UA 1ZHHA 5TF4A 5LD2B 2A30A 1EZZA 1XLTA 5BNWA 1PR9A 1I5RA 1KMCA 1Z74A 1N2CE 2ZATA 2NUAA 4AYTA 5T7BA 3E3OA 3A2NA 1HY3A 1Z4MA 1PQUA 4LHVA 2AXQA 3FLMA 2ATCA 2FPPB 1GNLA 1C3VA 1L4GA 2J33A 2GARA 3EARA 3LO8A 4RBNA 4CQLA 4R01A 1WZIA 3CH4B 3DLAA 2PMCA 2QAGB 3ZJUA 1E3TA 5CT8A 3T5CA 1F3LA 1BZYA 2NVUA 3DB1A 3MWDB 4L22A 4URFA 3MGCA 4B8WA 2IEZA 3GEBA 3K8ZA 3WZ2A 4MNTA 4EUFA 4BJ5A 1CIPA 1K1EA 3R76A 3KQYA 3JQBA 4OHFA 1SC1A 3OLXA 5FD8A 2B78A 5H16A 1FP4B 1WNTA 3WSTA 1VKZA 4DYVA 1AK1A 2C31A 5C37A 3FTEA 3RTAA 1VECA 1JSXA 2PGXA 2VJNA 3FKSA 1WRBA 4NK5A 4U6QA 5DLEA 4MI6A 1LXCA 2P91A 2RBKA 4AO8A 1UBHS 2BE7A 1JH8A 3M70A 3NAZA 4OPMA 4N54A 4KN6A 5AXBA 2XUZA 3EZNA 3C7AA 3OLVA 4DG5A 1CFJA 1JKJB 3DO6A 1PL0A 3QY0A 1EU1A 4XVUA 1NTOA 1IHXA 1Z0FA 5LP6C 1SQGA 1L4KA 3PC3A 3OEED 1ZJJA 4B09A 3B20A 3RM3A 2DB3A 1T8WA 2PFKA 3FFTA 4Y9RA 1WG8A 1CLEA 1ZI9A 3H2IA 4TXJA 2N1BA 4R5MA 1OFTA 2AC2A 4CF3A 3BSSA 5KSZA 5KO2A 3QI7A 1VRVA 3VKHA 1I4OA 1X0XA 3SYTA 4LZAA 1U2PA 3PKZA 1ZN2A 4HZGA 4NEGA 3ZCTA 3QMMA 6ADHA 3ZE0B 1IU9A 2ZETA 2OO3A 3LHSA 4UDOA 3CRZA 1ND6A 2CHVA 3PICA 1U2GA 1UDWA 4XSGA 4DIKA 3GCGA 3CEHA 3AHDA 4LC1A 4F2HA 4GOMD 1E94E 5EE9A 3V4RA 5GOTA 1QHSA 1UEIA 2QRHA 1X14A 1TL7C 3ENVA 4Q9AA 2F1RA 5EZYA 3VNBA 4KQ6A 1SBHA 2FETA 5BW8A 3ZD7A 1RAGA 5EUQB 3VNSA 3PQ8A 3UMYA 2HMSA 5CH8A 4FM9A 1JG1A 1HL7A 3FUCA 2NO0A 2PUWA 4NTZA 1P8AA 2FR1A 2HPZA 1KI1A 1L7QA 3EIUA 3EUFA 3ZDRA 5DF1A 3TG2A 2CW5A 2IXDA 1IH8A 2KMLA 1DAOA 1FK8A 1JR3A 1L4MA 1LLFA 1N2EA 2R5NA 4PS1A 5HCNA 5BW6B 4G8JA 4FMCB 1J6UA 5CXSA 4BE4A 3R7AA 1QIKA 3NGMA 5TPZD 3AF5A 5CCBA 5I7FA 1LBSA 3IE1A 1QR2A 2Q4OA 2JCXA 3FN4A 3G17A 2D0OB 4JKOA 4V1CI 2I6XA 5DI3B 5I9TA 1WQ1R 3RVJA 4XUDA 4QBKA 4DT1B 1NRWA 1K7SN 2R7AA 3HDTA 3ASZA 1IFXA 1LV8A 4EHBA 4KVZA 2B1IA 4P34A 4M1SA 5A3QA 4CODB 4MCJA 3LHKA 1HSOA 5KTRA 2JBAB 4MPPA 4N0PA 1KQOA 3PR1A 4RV5A 5EP4A 1I7QB 1KBQA 4OJQA 2HIMA 2C4TA 3KG2A 5BSHA 4OAOA 1JJ7A 2HX1A 1AHHA 3LKDA 1ACJA 2QI9C 4M54A 4N1AA 3OE4A 5F77A 1XBTA 3MXOA 1YT5A 1WNFA 4K1LA 5BSMA 1RVDA 2Z98A 3U0VA 3UV3A 1GTSA 3IA2A 1EWTA 3Q7SA 1KWKA 2WFZA 2RI0A 3MIIA 1XNQB 3DW3X 4YDRA 1J5PA 2JK1A 3QVGA 3VR3D 4KDEA 1KHTA 1Y8QA 3PA8A 4GD3Q 5LDGA 3T9AA 4ALKA 4BWFB 2O0LA 4JJ8A 4LDQA 5AOVA 1M66A 4RLFA 2E4VA 4FZ3A 4KXFB 3T54A 4EVSA 2QNBA 1CZOA 3LVFO 3MZ0A 4U1RA 4WFKA 2VS1A 3PR3A 3RQIA 3MJEA 3BBLA 4CL0A 4B8ZA 3GPCA 1X92A 2WD7A 5DGDA 1T0HB 4OMFG 4RPGA 1FF9A 3BQMB 4YJ3A 3TQQA 3PV0A 2OCPA 4R05A 3BDAA 3KCNA 3H3FA 3TOVA 2O23A 3SDZA 2XYQA 2CMDA 3JWPA 1FB5A 4CM6A 2MSKA 4GYKA 4J4HA 3SLRA 4ZARA 3ZWCA 2JHGA 1HOXA 4DQ0A 3NOVA 4MVJP 4J1TC 1U3TA 3G2QA 3NYWA 6NULA 3IALA 1A5BB 2PS1A 3AVPA 2DSTA 2P0EA 4F38A 3OWXA 2M9MA 1RACA 3G85A 4L02A 2ACKA 3WLQA 2ZUTA 3T3NA 5CVUA 2HBRA 2IYUA 1OXKB 2QM0A 2O9JA 2VNKA 2MSNA 3K5WA 4YRDA 4L7VA 1ZVQA 1XE3A 4YECA 4YJHA 4OMUA 3U7EB 3I04A 4RK5A 2YXPX 2A0FA 3W7AA 2ZPUA 4K1XA 4CEJA 2W48A 4DYHA 1A9YA 1OWOA 2CXQA 1Z0UA 1JWBB 3L0ZA 5E8RA 5A4MS 3NIFB 2ZAGA 1SO8A 5MN6A 1YL7A 4XB1A 3U80A 4EB6A 1JEOA 1Q0HA 1RBZA 2JI6A 4PSVA 4JWKA 4GL2A 3DBIA 1EZ1A 1U0LA 1YZQA 3HM9A 2XTNA 1P2GA 3UB2A 3WGNA 2FNAA 3GUZA 1TQHA 1AKQA 2C04A 1LPAB 3D2AA 1WPXA 2O1WA 2OO7A 3HJAA 1E8NA 3SC2B 4BO2A 3A6GA 4IIXA 5EE1A 1ODFA 2B5VA 5L8VA 4MWDA 1FFYA 2YINC 2WHYA 5M29A 3S2UA 1W73A 1ECFA 4J7AA 4MKIA 3T1QA 4BWYA 1L7NA 1YQUA 4PNZA 5ALQA 3DE7X 2W42A 4MPJA 3BRQA 4DMKA 4A6XA 4Z7OB 3TZQA 2P4EA 1XTVA 1JGTA 3GT7A 5KDOA 5E3IA 2O3SA 3WR5A 4EMTA 4UBMA 4D4GA 4XUCA 1RIIA 1R9MA 4JAVC 4C30A 2ZYAA 3ZXYA 5DV9A 1AIPA 1LW6E 2Y4OA 3BZBA 3DZKA 1ML3A 3QTBA 4G1CA 2V0NA 4LRUA 3L4BC 4M38A 4CIAA 1T8TA 3DWIA 4IDOA 3IJPA 3JD2A 3OIYA 1PKEA 4PCLA 3ZLTA 4IV5A 2X76A 1SUCA 1U5BA 2AB0A 3HKDB 4PZEA 3QUTA 4B7CA 4DMGA 5AKJA 3FNIA 2JIDA 5EHQA 2RHMA 3C0KA 2PGAA 3FM9A 3RV4A 4EFLA 4HLUC 1D04A 1DEOA 3VR6H 2JJ2A 1QBKC 1MJHA 721PA 1HM5A 5JATA 1XTRA 1CY4A 1E3WA 1T2AA 2I4TA 3Q9UA 1UM9A 3HWX1 3V4LA 4RVHA 4LF7B 2H08A 4QU0A 1FNCA 4MV8A 5BV8A 3V7FA 5JOQA 2XMGA 4W5TA 1OLUA 3PNBA 1M0SA 1TQ2A 1JLKA 1TQDA 4X8OA 1I1NA 3COJA 1HDYA 2H92A 5GOZA 3RSLA 3MYYA 4ZD6A 1O96A 3RS0A 2OY0A 2CNBA 1LBQA 2W2LD 3GT4A 2H65A 4F9TA 4H6XA 4WZAB 5E7IA 3R9KA 5KOHA 4FW9A 2CDNA 4X3CA 1CUSA 1XQ6A 1CR2A 3TQRA 3EOBI 2I2AA 2AYYA 3I6MA 4ZCSA 3SZMA 4GLFA 3L46A 4MX8A 3VZBA 4ZK6A 1IY8A 1QIGA 3E3LA 2H1SA 3S70A 2PUJA 3LWBA 2OLKA 3WK6A 2JA2A 3GDOA 3I34X 4QGAA 4KI0A 1L5KA 1AQ6A 1SUSA 1KTVA 3GP5A 4IOKA 2WJYA 5K01A 2QV7A 3K6KA 1J7JA 5EHGA 3KK0A 3Q1KA 1ARZA 5J2UB 2FY8A 2I6FA 3FA2A 3PPYA 1OXXK 2JFXA 2JKZA 2VJDA 2WF5A 3VR0A 3AR6A 3D6UA 2KHZA 3BS4A 3GEPA 4C4RA 4B3DA 2AJCA 4EG3A 3GA5A 5A02A 2ZRQA 5ITZB 4KRFA 4HDQB 3B6EA 4D3FA 1ZOOA 3K2QA 4WNCA 4HV4A 1N33B 1NBEA 2V5UA 3FG9A 1HR0B 4MQFB 2PGLA 3BD9A 3ESCA 3KWFA 4XPIA 4MWGA 1P7PA 2I3AA 1AGNA 1NX9A 1V9LA 2EERA 2XKBA 4RETA 5EIFA 2I1WA 2JK0A 3ASUA 1RNLA 5AIAA 3ZEAA 4KSYA 1YONA 1D0IA 1WO8A 1CDZA 3UPUA 2I22A 4X9XA 4RTSA 2P4QA 2XUFA 4P38A 2B94A 2XLBA 4L9WA 3VPBA 1GZ3A 2BONA 1GADO 2O2DA 4M2LA 1YMQA 2PPLA 1ODKA 5F52A 4G8BA 3AFHA 5FTMA 4QXAA 2GZ2A 4P3KA 1WXXA 5IDQA 1RWOA 4HFRA 4IJQA 2ZTHA 4E4TA 2ZGVA 4JMPA 1XZGA 1YKFA 2IUUA 1NXXA 4PQRA 4J07A 4UBKA 3DYVA 5FOQA 3T8YA 1NZFA 3E0XA 4GM0A 4GUAA 1HEIA 5C5DA 3NLLA 2X2FA 2VQDA 1RMQA 2NUBA 3QLVA 4ROTA 1UMBA 1V37A 4HB3A 4QPZA 3GLGA 4LF6B 3EY9A 1ZISA 4LNHA 3V46A 4F11A 4MVJA 1EP1B 1KO8A 1RWKA 2VRBA 3C43A 5CXUA 3L0OA 3NC4A 4G09A 4Y6SA 1LK0A 1VJ5A 3KKPA 3OECA 2VBFA 4M88A 3TW8B 3N53A 4EMUA 1SWWA 2W2OA 3RT9A 2C2HA 4FC6A 4NV3A 2OCAA 4AO7A 3KOYA 1MV8A 4Q6BA 4ZV4A 2GXSA 2BDTA 1NSTA 1DZ3A 3AUJB 1OUMA 2GJ4A 3QJYA 4G1BA 3GVHA 121PA 4RV9A 3MQ2A 4U7HA 2ALJA 2W8ZA 1I30A 5FUYA 1UADA 1DC3A 1JSLA 1PIWA 3IVAA 3PUYA 3Q72A 4M36A 1RPTA 4NBKA 1KVSA 1IPHA 1X8LA 3T7CA 3EW9A 1JAIA 1QSGA 4E5MA 4W9MC 3LVRE 3M89A 2B9EA 3SOPA 2OP1A 1GZ7A 1TTPB 5K4AA 3S2GA 2BLNA 1NMYA 1W5TA 2OV8A 2X0KA 1UMCB 3BB1A 3F6SA 3M4ZA 4HCJA 2GZHA 1G20B 3OFKA 4GDMA 4R2KA 3SJCA 2GEDA 3BD8A 3VBCA 3THYA 2Y2UA 4MV1A 5BOSB 3CLTD 3QA3E 1T6XA 1ORDA 1P2FA 2R6CA 3ZPXA 2PL3A 1OWMA 1HE3A 3DFUA 1B0PA 1DIRA 2F3SA 1I3OA 2XYPA 5KSYA 4PPNA 2XJ4A 4TTAA 4E14A 3I73A 1GAWA 1U0GA 4Q1FA 3EEFA 4FGSA 3DWEX 5CIWA 2YWDA 1GL7A 2E5LB 2BGRA 1GA1A 2B8JA 1JXQA 1V3UA 2QTLA 3M33A 4KQMA 3WISA 4DNQA 2JHCA 3CS3A 3WNVA 3QFHA 1WHTA 4DMHA 1Z5UA 4ALNA 1YJXA 3BRWA 1FMCA 4PYMA 2GN9A 3HVRA 5DFAA 1K63A 4JLKA 3VH3A 4IDNA 1O54A 2FK7A 3L1KA 4UW9A 5LQJA 2HNAA 2JHFA 2EBWA 1FS4A 1USIA 2AN1A 2PX6A 4JODA 4EAAA 2Y67A 5E4FA 2HMAA 3SQDA 2R6AA 4WIAA 4C4AA 2MYNA 3OF5A 4PICA 3FCSB 4GP9A 1KE1A 1UT6A 4JLPA 4JT2A 2NLOA 2O3QA 2ZAMA 5E6UB 5CX1B 1T2VA 3SJ7A 4L28A 5I7AA 1YJQA 2H54A 4DIUA 3TOZA 1SURA 2H31A 2J0EA 1QG2A 2O4UX 1RQGA 3ELDA 3HKEB 4BNYA 5CX4A 4XJVA 1DAPA 2HHJA 2YOHA 4N0QA 4XDZA 5IJXA 1D4ZA 2DCMA 2Z2KA 4EJSB 2EZ4A 5CRIA 2GVDC 4ENSA 3F5DA 2IV3A 1WABA 5DH9A 1N2HA 2HWYA 5H70A 2C4WA 1MGOA 5FPHA 3OM1A 3WAKA 4DLLA 1E62A 4L76A 2CVHA 3NGXA 3OZIA 5EKDA 5LA6B 4CEHA 1FSPA 4NY1A 1E4VA 2CLSA 3HN2A 4OHVA 4ZOEA 5FF9A 2C7RA 4OX9Y 1Y1QA 4TTSA 1TCBA 1EA5A 1UJ6A 3GGOA 3OT1A 1SHJA 2O4CA 2JPDA 2HT6A 4QOJA 3UPTA 1KR5A 1VFPA 4OU4A 3HJBA 2YFKA 1YRHA 4OHPA 1D2EA 2GCGA 2JZNA 2J07A 3DGEC 1C2YA 1KQ3A 3F6BX 3PX3A 4EQ6A 1PEAA 3LQRA 2OD9A 1YO6A 2NU8B 2BISA 4I1YA 4XGNA 5IK2D 2OGSA 1Y48E 4DMFA 1SC9A 2G80A 1L5HA 4I8IA 4PAGA 4UNPA 4XGIA 4WGFA 1AE1A 2X7JA 4F6LA 2JLBA 1VL2A 2RCYA 3FMPB 2GF2A 4I55B 4A3SA 4LHXA 1ZX1A 2Q9AA 3C74A 4EFMA 2FZ5A 1MTOA 1XXHE 2WF6A 4UTPA 3WAGA 3IUMA 3A58B 3EXIB 2ZU0C 2DGDA 5K3AA 4DV5B 1MNQA 5K0SA 5KU7A 1Q77A 2VDMB 5FUWA 1R8JA 4MVJG 2O5VA 3VR5A 1Y8CA 2WSLA 2DFNA 3W04A 1E79A 3EAQA 3KHTA 3C8MA 3J7AC 2PUTA 4JVLA 3UF0A 3ZUGA 1ZBDA 1O4WA 4OQZA 4I3HA 4F6RA 4MDEA 1XAHA 3TZEA 4YB8A 2PG3A 1QH1A 2WY2D 3MEQA 1FMLA 1JLMA 1L4HA 3HZHA 3PYLA 1FS6A 5HMLA 2YCBA 3IQIX 1JX6A 4YMUA 4NESA 2QOEA 4MS1A 4F9GA 5JBNA 1O9GA 4GWLA 3DVLA 1TYBE 2P6UA 3ENWA 4GVPA 2EYUA 4PQGA 1RZVA 1GQQA 4G0OA 1N3BA 1OZGA 2RK3A 4Q4AA 3JX9A 1JFRA 3FSGA 4GO1A 3GB9A 2R48A 4E70A 1A9PA 3M6LA 1P6UA 1Z6QA 1NFRA 1YRQA 1U3UA 4LNUB 1CZUA 2KI5A 2R44A 2C07A 4NMXB 5EOVA 5DIFA 3I04M 2XKKA 1O1YA 1Z83A 1Q0PA 4YDHB 4IIJF 1J0AA 1SNYA 2GCOB 4QDUA 1ESZA 4UHHA 1L4NA 8LDHA 3THXB 4K40A 4JVOA 5T4BA 4BFWA 2A9VA 2HNKA 1JG6A 4X20A 4UVGA 3ZZMA 1P17A 3V1NA 1XD2A 4E1AA 3KZMA 2OYCA 4BP3A 4ND8A 2JEYA 1CVIA 1SD1A 3LUAA 1UXJA 4LHYA 1QIDA 5K3FA 3VPXA 3U62A 5IANA 2WABA 3MS2A 5BURA 3V55A 3HDVA 3DQQA 4L3OA 1ML4A 3QX7A 1N9GB 3N07A 1NBHA 2HLHA 4ID3A 1RM0A 1CRQA 1GPH1 1NMSA 1P19A 2EARA 2XUPA 1WVMA 4INZA 2QNIA 4UREA 5TY0A 3RI3A 4C4TA 3WWPA 3OG9A 3Q98A 3ZLJA 4GOKA 1DJOA 1E77A 3P9YA 2QL6A 5C8XA 3HO8A 2HUPA 3HU5A 3SR4A 5LBIA 3D2LA 2QN6A 3MLBA 2ZWAA 2I4RA 2HNBA 4MW6A 1VLJA 3TUJC 2GT1A 3W8DA 1X2BA 5KNDH 3GLVA 1OR8A 5C32A 3AX6A 4HFMA 1K0FA 1RXSA 5CAEB 5A0VA 1ABFA 2EHJA 2HR1A 5JCOC 3LW7A 2O1EA 1VDZA 4BTVA 2NM0A 4YI3A 4XKJA 5F3RA 1P0IA 2FWPA 1GAEO 2VZ9A 1S5PA 4MR9A 4UAJA 2IYPA 4YJFA 1VMKA 3GJZA 3I6YA 4QXOA 2GGSA 1RT9A 1FUUA 3DBHA 5TS3A 1J99A 3I0MA 3E27A 2CFSA 4HMQA 4BX0A 2JG3A 1Q17A 2QQ0A 4C7MA 2XMPA 4DB2A 2ZCVA 1FXWA 2QTFA 3DDUA 1H1DA 2C84A 1DHTA 3U48A 3W8NA 3P9PA 1IWBB 1IEWA 2BCEA 2FH5B 3A1DA 3UK6A 3GN1A 3ZHRA 4BBZA 3FDIA 2JLXA 1KSJA 1JIQA 1ZH2A 4X0EA 1G6KA 2N1MA 5J63A 5L3RA 3BRWD 4ZI7B 3O3CA 1LFDB 3K0AA 2P79A 3OWHA 1EM8B 1YRAA 5D7NA 1L1EA 4E07A 3EMVA 4JDPA 1ODIA 3WK8A 1EXVA 2J0SA 2IL1A 3ICEA 3PFFA 5AOBA 2VYVD 1OFUA 3LY8A 4DCPA 2PQ6A 1VKJA 2RI6A 3WWOA 2PJDA 2OPBA 4DQXA 2OV3A 3QEJA 3KT0A 5REQA 3L7KA 5DXFA 2H11A 3LCRA 4ZGBA 3CLUC 3K8YA 1KYWA 2O48X 3JQAB 1G42A 4A0FA 4FFBA 3R6WA 4OQLA 1N3IA 4YUWA 5J4HA 1ADBA 5I45A 1JU4A 4DA0A 4OHWA 4KW7A 1CFZA 1NM5C 4IHKA 5I9SA 1I94B 1T9ZA 5JVDA 1Q84A 3CZCA 3NPMA 2P2YA 2QJOA 2WSIA 1CS0A 4UAVA 1C7QA 3N05A 4PM4A 4B7XA 5TARA 5AK5A 2M6LA 4ZRDA 4HB4A 2VDVE 2WWGA 4LNAA 5G3YA 5CG1A 4QM6A 1FEZA 3W2IA 1JRLA 3LUJA 4E22A 3QUBA 4X91A 3OSUA 1F5NA 1TF2A 3ZKWA 4KNWA 4HUTA 5J4VA 3Q0IA 1GNRA 4E94A 5DWVA 2VSYA 1SUWA 5CUQA 4J2OA 3I8XA 2Y27A 3ZWMA 3PEEA 1ZDMA 2MMGA 2B20A 2G4LA 4QFMA 4XJSA 4JUAA 4KR6A 1KOGA 5BXQC 3PLNA 4DRXB 1AKEA 5ALKA 5T64A 2IPOA 3QBEA 2F1JA 4ER5A 1VGRA 4PSCA 2RHTA 3DPSA 4DV4B 5ED0A 4A8JA 1BGWA 3FPBA 4RS4A 1HYQA 1K6JA 2ZBPA 5IHPA 3O2SB 2NP6A 5LZ8A 4IIYA 2XGGA 3G0CA 3WHPA 3D7SA 4DCMA 3PHCA 3R8XA 1J90A 1U7XA 2I80A 3CR8A 3GLKA 4FUTA 1KI4A 4GAEA 2P1ZA 2ZJ5A 3BTUA 4QGGA 1PR1A 2JANA 5LKAA 3HFSA 2BMFA 5ED4A 4FFDA 6GPBA 1YL6A 2QTAA 4DV6B 4M0DA 1L5WA 1AUOA 4AUMA 2G5GX 1RYZA 2P9HA 3ML1A 1VBKA 3F96A 4WI1A 3TD6A 4JBYA 5IYZA 3ET5A 2R8BA 4DPMA 2AI2A 4IIVA 3CA8A 2VAMA 2LUOA 2X8BA 3QFFA 2EEPA 4P98A 3IP9A 5H3HA 4DUGA 2YKGA 3LUKA 3CRW1 4IGIA 4A10A 4YI5A 3C3YA 3RVBA 1JEQB 5CD9A 4ABTA 1EXDA 4H0CA 4MVJM 3AHGA 4MUNA 4WCFB 3JS5A 2W6OA 2Q4BA 3FHCB 4R1NA 2XUIA 1XCLA 3ILHA 3WY9A 3GJ6A 1J39A 5C4MA 4NBTA 2J7PD 3VO1A 1PYGA 3BMOA 2W2XA 4PN3A 2EZTA 1RFGE 2AE2A 2WJGA 1BGXT 2ESRA 5CM9C 1XYVA 2CE2X 1XTUA 3LKVA 4XVQA 2NU9A 4DIMA 1N5LA 1THGA 3ZZNA 3GPDG 3HXKA 1SUPA 3H5IA 1RADA 4P58A 1DEAA 1Y37A 4DSOA 3HO6A 3F1KA 4IVQA 4CKEB 3WDSA 1M6NA 3O8OA 1MN6A 5KOJB 4J2TA 1CJVC 4X6UA 2JAQA 1VL5A 1FDIA 1K8ZB 2XY4A 3QZUA 4NIMA 4RZ3A 4BFXA 1H1LB 4XSVA 3OO1A 1TVKB 2ZUEA 2JFGA 2O7QA 5EXDA 3TR5A 3ZCSA 1DE0A 3ETJA 4RUKA 1UMDB 3DDWA 1UXKA 2JFUA 3M6MD 4ZPJA 4PG8A 1KJQA 5IASA 5K6AA 1YB2A 1YCGA 1CS4C 1U1FA 2B2XA 3UAXA 1P9WA 3GLFB 5F4BA 4GL4A 1FTQA 1E9VA 2AF4C 3F8WA 2CFTA 3T99A 1K86A 3QTLA 4XM2A 1WZEA 2AE1A 3CEJA 3ILSA 3LI2A 2ORED 1HYEA 2AN4A 4L8WB 3TNYA 2FPGA 2ISQA 3JQ9C 4I4TA 2BF4A 4JP2A 1PQWA 1ZMRA 2ZIUB 1QWOA 3G7UA 3DC7A 2O2ZA 2Q8PA 1NUHA 3SQWA 2F1KA 1HLFA 3E70C 1QYXA 1L8LA 3HXOA 1LBHA 3OKAA 3UWMA 1FFWA 4AJ1A 1A9SA 1L1RA 3VNUA 4HDKB 3AONB 4Y9DA 4RD3A 4TUYA 2H1CA 4DJAA 2YN2A 3MRSA 5HIIA 5JXJA 2NWQA 3NNDA 3CPHA 3PDWA 1XF1A 4F06A 2CYBA 1EFVB 2J09A 4R54A 2Q1UA 3LX6A 4QJ4A 1P7ZA 2CB0A 3ECCA 1Y3HA 3L7NA 2ZAOA 3N86A 3NETA 3QWIA 3HEBA 2WRZA 3T61A 5E1OA 5JSQA 2WV9A 4H08A 4D96A 5JNVA 2B35A 2IKQA 3NT5A 4H18A 5JZVA 1E7RA 3AHFA 1K7EB 5LR6A 1KZ1A 4OVKA 3EFOB 3OIFA 3A06A 3C6BA 4KWIA 4FFNA 4LISA 3X1JA 5IVHA 1GDTA 4PLGA 2HFJA 2WJ6A 4F46A 4V0QA 4H1WA 5CA1B 3SICE 2ZYTX 4HNQA 4Q7KA 4S1WA 2WOOA 1R6TA 3LZ6A 3B3JA 4IIDA 1DARA 2GSDA 4A2QA 1CD5A 4MRNA 1ILWA 5DN9A 3SHQA 3SK0A 3WGMA 2WAYA 4YK7A 1IDOA 4UTXA 2VAVA 4MZXA 1RLTA 1V5GA 2G0AA 2R65A 2HTFA 3FOWA 1WQ4A 4TMVA 5L45A 3ORFA 4F2PA 1S9DA 2NZYA 4D2IA 3ZXIA 4JT8A 4BVKA 4HX2A 2P7HA 3NKVA 1FVXA 1PE0A 1ONOA 1U28C 4C08A 4ECEA 1JR2A 4Q3OA 1HORA 4R2XA 1G0NA 3I0NA 2HV9A 5AW9A 1TIBA 4GZ5A 4JYMA 4PX3A 2BHRA 2G67A 1XRRA 3IMKA 4HN9A 3RIMA 3T7JA 4D74A 2GZSA 3IKJA 2VK2A 4OUDA 2FWNA 1V7PC 3OOEA 1C1DB 1SK8A 1X7ZA 1B43A 4OKIA 3DJFA 4RM2A 1P9RA 2BP7A 1O95A 1SCQA 3Q12A 4AMVA 2ORVA 3UMBA 2H5EA 2PIAA 4YMSA 2QAJA 3T7KA 3WGQA 3LW8A 5JS6A 5LD2C 4UDNA 4NZ9A 4DCJA 2ZVJA 1HF3A 2W2VA 4Q3AA 4B81A 1Z18A 2UZ1B 4JNKA 4B4WA 2P9QA 1FY2A 1OWLA 1COWA 4OK5A 4GM4A 1URPA 4OYLA 4AF8A 5KTPA 5CFNA 3CH5A 1NMXA 2DWCA 3CUUA 3K9GA 4OHZA 2ZUCA 4QFDA 2QN2A 3ECSA 5DSZA 4CL2A 4IQFA 3QE4A 4IOJA 3U09A 1TTTA 3AYZB 2HRQA 5FQOA 3E61A 1C1XB 3NTXA 4R1SA 3S2EA 2LPMA 2XEXA 4EFDA 4ZRNA 3SJAA 2VJYA 1VIYA 3HBAA 3QVUA 4BB6A 3WK7A 4LIPD 2FW0A 3HVUA 2PRZA 4PLFA 1I0LA 3JTMA 4OD0A 1ODCA 4I1IA 3UCFA 4L07A 5ALNA 2Z5LA 3JW8A 1H4VB 1V41E 3RRJA 1D8TA 4CUJA 1VHJA 2JD1A 1QC5A 5A6VA 4HXGA 5KUTA 1P1HA 9ATCA 5JPCA 4CZ2A 4Q12A 2G9QA 4KV7A 4UXJA 5D01A 1TKRA 3W79A 2V7QA 1U9JA 4U2DA 4XE5A 2K2QB 3Q7EA 4DMCA 2NZVG 1E0DA 3E4CA 4ETMA 3IPRA 2FPKA 3PUXA 4ZAZA 2QUJA 4PLHA 4HS9A 2CF6A 3HL4A 3KUUA 4F96A 1EJ0A 1RWMA 1AV7A 4L50A 2RAFA 3T7SA 4F60A 1DQRA 1E0SA 2P3SA 2GWHA 3MERA 4N82A 2QR2A 1C9YA 2QV0A 2HIHA 2X6TA 2JFYA 3M6UA 4CN8A 1X15A 2D5LA 3DEKA 3HKCA 1BOFA 3K9BA 3PXEA 4C89A 2KPOA 1OB5A 2RMKA 1VCMA 2JFQA 3L8HA 5DNUA 1UPXA 1XTBA 3L0IB 1BCSB 5AESA 3T4PA 2M6RA 1TU3A 5FADA 3ZNPA 5A2GA 2BR3A 2CLLB 3I4CA 5EJ7A 5KC9A 4CPDA 4JLNA 1Q20A 1PJAA 4RVSA 1E9BA 2IV7A 3QEAZ 1WU8A 4DSNA 3MPUA 2WFLA 2BRUC 2JJQA 1H93A 2B4RO 2DBYA 3DTNA 3FHOA 1E66A 1IHUA 1Y7HA 4FQ8A 3N58A 1VYTA 4GWGA 1QZUA 2QMHA 4LJAA 4U8GA 3UTCA 5BNIA 4UTVA 2GDJA 1Z6AA 3M5WA 4R51A 2IHBA 3N6VA 4I4IA 4LOJA 3P2EA 4Y6LA 2P68A 4DWVA 1J49A 1RXWA 2ZRCA 1S2GA 4QUBA 2GK3A 4A03A 1N3YA 3PENA 1W4LA 4E2ZA 3PNQA 3QXXA 4LS3A 4NBVA 2XNCA 3DZFA 4ER0A 2WU1A 5CNIA 5FFNA 2JH8A 5LWHA 4OYRA 4EBFA 5M34A 4EW2A 2DT8A 3R0IA 3ZCXA 4LCJA 4BLRA 3WGGA 4TT3A 2O0JA 5J2TA 4RTPA 1IN7A 2C88A 2QP9X 4LJLA 4GSYA 4XX1A 3GOQA 1ICIA 3UKJA 5HW0A 5LZ5A 4BNDA 3HUFA 4IDBA 4YUZA 4GLBA 4MQUA 1N5JA 1QP7A 4GXTA 4O4IA 4ARIA 1AS0A 1YXMA 4I4CA 4Q03A 4EUHA 3ZLVA 2E1RA 2AG8A 5DYTA 4OYHA 3NHFA 1Y4UA 4TTTS 4P4UA 4B40A 3QF4B 4XLLA 2HTEA 3NHZA 4JQCA 2G7ZA 1VCNA 2PVPA 2Q28A 4KH0A 4UEQA 4AY4A 5J47A 3OU7A 4HP8A 5ICMA 1AQYA 3P8ZA 2IRWA 1U3CA 4LXXA 3RVOA 1JAXA 3WO1A 2W2QA 4RVUA 3B1ZA 1EJBA 4YUXA 4DCOA 4HDMA 4NV1A 3KU4A 2ILTA 1HT3A 4TVBA 2UAGA 5HTKA 2JARA 2NVOA 4WKOA 1E3JA 3O5AA 4CF5A 1S9HA 3OTQA 3ZWYA 1C41A 4EAQA 1RQNA 2QW1A 1TUGA <