3HCFA

Crystal structure of hpnmt in complex with 3-trifluoromethyl phenylethanolamine and adohcy
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
publication title Molecular recognition of physiological substrate noradrenaline by the adrenaline-synthesizing enzyme PNMT and factors influencing its methyltransferase activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hcfA00
2IFTA 4OBXA 3X0DA 1AQIA 5E1OA 5KS2A 1X1BA 1N2XA 3KHKA 2ZSUA 1PRYA 2VDUE 3I58A 5GP1A 2F8LA 3ME5A 5EOVA 3C3YA 4FT2A 3TM4A 2ZULA 4YUYA 1M6EX 1TW2A 2Y1XA 3DR5A 4KIGA 4PYOA 5F2KA 3LBFA 4RVDA 5EGSA 3UJ7A 1DL5A 2NP6A 3BUSA 4QVKA 4AZVA 4KDCA 4AZTA 2AZTA 4P58A 5C1IA 2FHPA 5KQRA 1QAOA 4G56A 4BLVA 1QAQA 2PKWA 4DM3A 2H1RA 1Q0SA 3GGDA 3TPZA 1MHTA 3BWBA 1Z3CA 3JWGA 3DP7A 3MCTA 1XVAA 3BGVA 2N47A 4ATNA 4RYLA 3FTCA 3NWBA 5ICCA 4C05A 5DXAA 4CTJA 3OE5A 3KR9A 3R24A 5FULA 2YQZA 4HC4A 5HIMA 4C03A 3B3JA 1DCTA 4X1OA 2B78A 3EVFA 1KYZA 4PIPA 1X1AA 2IIPA 1P91A 3ELDA 4KDRA 4BY9E 5DSTA 3EGVA 3KU1A 4GUAA 5EKXA 3OZRA 4MWZA 2BM8A 4RTPA 2AN4A 4AX8A 3HCCA 3SR4A 3P71T 1VE3A 3M6XA 3P97A 3E7PA 5GM1A 5DM2A 1R18A 3REOA 3O7WA 2EG5A 4OBWA 4FSDA 5FADA 1G8SA 1P39A 1ZGJA 2BM9A 3NVKI 3JWHA 4HRAA 1JQEA 5CCBA 2PBFA 4V0QA 3HVKA 5HOQA 1BOOA 3DTNA 4HH4A 2P40A 3AWIA 4GC5A 3PTAA 3OE4A 4P7JA 4YV0A 3LKZA 3P2EA 5CVEA 5EEHA 3TRKA 3EVBA 1KYWA 3KPUA 2GS9A 3LKDA 5EMJA 1SG9A 3HCDA 1IM8A 3OU2A 2UYOA 3O4FA 4ER5A 2PT9A 5DX0A 4R05A 3AY0A 4FP9A 4JXJA 1T43A 3EVDA 3G2PA 3PX3A 1NW5A 3NJRA 4DCMA 4AUKA 4DQ0A 3MHTA 2HV9A 2QYOA 3KR0A 5B1SA 2JJQA 2FPOA 2PGXA 4XUEA 3SM3A 2FYTA 4RSRA 4E32A 5KYGA 4LECA 2ZLBA 2IP2A 4A6DA 5DM0A 5LR6A 3NDIA 4RTRA 2AOTB 2YVLA 1AV6A 3DH0A 2UZ4A 4NECA 3T7SA 3EVEA 2YXDA 5E2AA 4DKJA 2EJUA 2VZ9A 2GLUA 3KQPA 3DXXA 3M6UA 3UJ6A 5IKMA 1RJFA 3VC2A 5K0EA 2PX2A 1SUSA 3S68A 5EHGA 3G2QA 4K6MA 3KQTA 3HCBA 1WY7A 3B5IA 3R3HA 4FS8A 2ZIFA 4POOA 1XCJA 3SSOA 5M5BA 2B9EA 5E1BA 5BP7A 3EVCA 4DZRA 1ORIA 1RI1A 1VLMA 2ERCA 3KR1A 3HCFA 1JSZA 5T6BA 4DCGA 4EKGA 3C6KA 1NE2A 1JTEA 1UIRA 4RTSA 4UOEA 2HNKA 3EGIA 3LHDA 4F86A 3KPJA 4RWZA 1KPHA 1ZGAA 1G6Q1 3D2LA 3HVIA 2C7RA 2C7PA 2AOUB 3DMHA 3TMAA 2K4MA 2Z6AA 4KRGA 4P7KA 4RTMA 3TLJA 2BZGA 4YMHA 4DA4A 1I9GA 1O9HA 3M6WA 5E1DA 3UA3A 2JG3A 1EJ6A 2WA2A 5CIYA 3VC1A 1HNNA 2JH8A 3G2OA 3EMDA 1JG3A 2WK1A 1U2ZA 1D2CA 2ZVJA 1JSXA 2PXXA 2P3QA 3QOWA 3ELUA 3DXYA 1PJZA 5E9QA 1ZHFA 3GRUA 5K0NA 1YF3A 5DTRA 1N7IA 4E2YA 4AZWA 3Q7EA 1D2HA 4KIFA 3P9IA 3PB3A 1EAMA 4E31A 2AS0A 5EHIA 1EJ0A 2O06A 5FWAA 4E2ZA 4RTOA 3THRA 3OCJA 4X63A 1SUIA 2PXAA 1JTFA 5KVAA 2VS1A 2H11A 3BT7A 3MB5A 4ISCA 2XBMA 3JWJA 1QZZA 2YTZA 1WXXA 4KWCA 3FTDA 2ZZKA 1WG8A 5BW5A 3EVZA 1I4WA 3HA5A 3SSNA 4GQBA 3CJQA 5DSXA 1RJDA 3KQMA 4LWPA 2EJTA 4MQ4A 2B25A 2FK7A 4CWAA 3SXJA 3Q87B 3HCEA 4PIMA 3V8VA 2I9KA 3OZSA 3FUUA 4RVGA 5GIOE 1M0EA 3TM5A 3GCZA 1D2GA 1WZNA 2PSSA 2VDWA 3PT9A 5DTMA 4OX9Y 3ID6C 5LQAA 1AF7A 5CUQA 2CKDA 5JUWA 4O29A 2GPYA 1SKMA 3P2IA 5DPMA 3MQ2A 1F3LA 3I64A 2ZBRA 3NDJA 4BLUA 3FTFA 1XJ5A 4GOOD 5DLYA 1VBFA 5LQRA 3UJBA 3E05A 4EMSA 4YUXA 3GXOA 2HMYB 4E2XA 4M36A 5FTWA 3P9KA 1NV8A 3GIWA 5DT2A 5T64A 3FPEA 2BR4A 1JR4A 1UFKA 2DULA 3B3FA 3P9CA 5EG5A 3PX2A 2VP3A 5K0BA 4V0RA 3KPWA 3EGEA 3GRZA 3O31A 2NXCA 5E2BA 5EQJB 3MTIA 3C0KA 3SMQA 4BP1A 2DPMA 5FCDA 4KVZA 3IEIA 3BKXA 3TKYA 4R6XA 1BC5A 4PCAA 2ZTHA 2ESRA 2E5WA 2FK8A 4U7TB 3GRYA 5GINE 2ADMA 3FZGA 3R9XB 1L3CA 1R00A 2B2CA 1EG2A 4PONA 3NW9A 4OQEA 4RTQA 1YFLA 2YX1A 2VDVE 1KHHA 2CWWA 2NXNA 3LECA 1BKYA 3P2KA 4FSXA 3CCFA 3OU6A 5K01A 1EIZA 5K09A 4MHTA 1X19A 4IWNA 3UZUA 5T67A 3G88A 5BW4A 2Y1WA 3EVGA 4QQNA 2NXJA 5F2NA 2BR5A 5CD1A 1RJGA 1JG1A 3CBGA 3LCCA 2ZFUA 5LQJA 3BKWA 3LSTA 3ELYA 3SGLA 1NKVA 2AOWA 3K6RA 3CJRA 2GAFA 3GJYA 3IHTA 4FT4A 1KPIA 2O05A 4YUWA 5MHTA 2ONZA 3GRRA 9MHTA 5D1HA 2P3LA 3LDGA 2O0LA 4M37A 3ANXA 2IPXA 4QTUB 2IDKA 5DRTA 3ER9A 2IGTA 4X61A 3LX6A 2IH4A 5FQOA 2P35A 3FUVA 3KPVA 4PYMA 4RVFA 3FPFA 1G8AA 2P41A 2IH2A 3OPNA 4XUCA 5DM4A 3KQSA 5HIIA 10MHA 7MHTA 1YB2A 3RIEA 2QRVA 4CTKA 2CL5A 2Q41A 3DLIA 4PCLA 4DMGA 3HA3A 2P7IA 3TOSA 4YUZA 1RI2A 2CMHA 5D1NA 2G1PA 4F84A 3DOUA 2ORED 5P8WA 3QOXA 2QE6A 3LDUA 4E33A 3JWIA 2B3TA 4XCXA 4EVIA 4P7GA 1L9KA 5K0GA 1G38A 5ERGB 5EC8A 2LD4A 3TFWA 2P7HA 4HG2A 5FHRA 3CVOA 3BWMA 4GOLD 5HIJA 1AQJA 5E8RA 5HEKA 3E23A 5C0OE 2ZBPA 4GOND 3CC8A 5DRYA 5E8JA 1UWVA 3MTEA 4RTJA 4PWYA 4R6WA 3LCUA 2P3OA 4OQDA 2ZZNA 3EEOA 5LQNA 4LG1A 3G89A 5FA8A 3HVJA 3SX0A 3DXZA 3TKAA 4ER3A 1O9GA 1QYRA 2JH9A 2JHAA 3SSMA 5E9JA 1EQAA 2G72A 1N7JA 5EVJA 4KW7A 5F2OA 8MHTA 5K05A 1BHJA 1Y8CA 1X1CA 3GU3A 4IV8A 3B3GA 5EMKA 3UJCA 2JHPA 3BZBA 5K0JA 2NNWB 2O57A 2YR0A 2XYVA 3BGIA 1YFJA 3ERCA 3T7TA 3OFJA 2G71A 3H2BA 1NV9A 4YV1A 2PWPA 5C9ZA 3B89A 2ZCJA 3KQYA 1KR5A 5CVUA 5K0CA 5CVDA 3IYLW 2AOXA 4CKEA 3KR2A 1FJXA 3U81A 2I6GA 1SQFA 2I7CA 3A7EA 2AR0A 3BGDA 1FP2A 3C3PA 1RI5A 3FRHA 3RW9A 2YXLA 3A4TA 3KQWA 5JR3A 5DXJA 5U4XA 2OYRA 4GC9A 3KKZA 5BXYA 4LWOA 3LBYA 1P1BA 4HTFA 1R8XA 4R8SA 5HFJA 5EIFA 4RVHA 3C6MA 5GIPE 3OU7A 3TR6A 1NW8A 5FA5A 1HMYA 5CCXA 3EMBA 4QVGA 2OY0A 3BXOA 3NTVA 3UA4A 1MJFA 2I62A 3CKKA 3FRIA 3PS9A 4FR0A 2HTEA 4H0NA 3UFBA 2WA1A 1ZQ9A 1FP1D 3GNLA 3FUXA 1V39A 2P1DA 2PX5A 4AZSA 2PY6A 1FBNA 1QANA 4IV0A 2FRXA 5EKUA 2GA9A 4E70A 4CXMA 1Q0TA 4HGYA 4PYLA 3UBTA 3UWPA 3GRVA 3OFKA 5EZSA 5LQKA 3G8BA 4WVLA 4GOMD 3UJAA 3EPPA 3M6VA 4A6EA 3OZTA 2UYCA 5DTQA 1F38A 3P9NA 3HTXA 1WXWA 3T7RA 1ZKDA 3DLCA 2OB2A 2Z6QA 4PGHA 3I5UA 1RI4A 3KQQA 1TW3A 4FGZA 4GBED 2Z6UA 4P7FA 3P8ZA 1RJEA 1SVUA 1JG2A 3PFGA 3GWZA 3HM2A 3HVHA 4PYNA 2ZWVA 4U7PB 2EFJA 3UJ8A 2YUIA 3FUTA 1KPGA 5LSAA 3K0BA 4Y30A 1X1DA 2OO3A 1JQ3A 3AJDA 1O54A 1RI3A 1XCLA 5LQCA 3G2MA 3V97A 3KQOA 3EVAA 5G02A 1JQDA 4OA8A 1OR8A 1ZG3A 3R0QA 4BLWA 3LL7A 5DWQA 2UYHA 3NMUF 5HILA 2H00A 5K03A 3LCVB 2BH2A 3CJTA 1QAMA 3I53A 4PINA 4YMGA 2G8NA 3F4KA 1XDUA 3I9FA 2PT6A 2ZIEA 3G8AA 5FWDA 4C06A 1M6YA 1VQ1A 4Z2YA 2PX4A 3QV2A 1IY9A 5FHQA 3AXSA 2XVMA 3VSEA 3T0IA 3VYWA 5DM1A 3MCZA 3R6TA 3PFHA 4RTNA 1VIDA 2GB4A 1R8YA 1WS6A 4YUVA 2QRVB 2A14A 2GH1A 1NW6A 2XYQA 2PLWA 3DMFA 3EEYA 3HCAA 3PVCA 4RTLA 3DULA 3M70A 1XTPA 4MIKA 2PV0A 5E1MA 2NXEA 3A27A 4MTLA 1VL5A 2IDJA 1YZHA 2OBFA 3A25A 4QQKA 2V74B 1IXKA 4X41A 2QY6A 3LDFA 4Y2HA 4ER0A 2AOVA 3MAGA 2PX8A 5DX8A 3KPYA 4QDJA 4QDKA 2XYRA 3UJDA 1SQGA 2OB1A 4QPPA 4B17A 2EX4A 4L7VA 4QTTB 4PYJA 3E8SA 2OXTA 4DF3A 3AXTA 1YUBA 4QPNA 4CKCA 2R3SA 4HSGA 2ZIGA 2NYUA 3GDHA 4M38A 4ER7A 5EMMA 2ONYA 2V7EA 4X60A 1NBHA 3UJ9A 3SVZA 1JG4A 1XDSA 2AVNA 3BWYA 2KW5A 5CVJA 5EEGA 5GOZA 2AVDA 2C7OA 2PXCA 2ZBQA 5CVVA 3LPMA 1I1NA 2ZZMA 2ZW9A 1G55A 1VP9A 3G5LA 3TQSA 2O07A 2P8JA 4C07A 4CKBA 4F85A 3THSA 2CMGA 1KXZA 2IBTA 3FYCA 1H1DA 1KP9A 2XVAA 3A7DA 2IBSA 2OZVA 1VP3A 2HWKA 5IH3A 2UYQA 2OPBA 5ICFA 4C08A 4EQZA 1FPQA 4HGZA 1L3IA 3WSTA 1NT2A 4PYKA 3B7PA 3ER8A 1R6AA 4RX1A 5K8VA 5LQUA 4PYIA 3FUWA 4RV9A 3G7UA 2AOTA 5GWXA 4RTKA 1KIAA 4C4AA 4FZVA 4PYQA 3GO4A 2HR1A 2AN5A 2G70A 3HNRA 4M7RA 5CM2Z 4BP3A 4GF5A 5EMLA 3HA7A 5EIWA 5HZMA 3M4XA 3FYDA 5ICEA 2QM3A 2C7QA 1P1CA 1L1EA 2JHCA 3IV6A 4HTFB 4IKPA 5K0FA 1XXLA 1INLA 3HEMA 5E9WA 3CGGA 3NVMB 1VPTA 4C04A 3MERA 2R6ZA 3DUWA 4E30A 5ICGA 3DMGA 2ZWAA 4ZTBA 3NWEA 5KQSA 2NP7A 3M33A 4OA5A 4YV2A 2FCAA 1XDZA 5FQNA 1NW7A 3HP7A 3KQVA 1L3BA 2AN3A 2OKCA 3A26A 4WXHA 1G60A 3BWCA 4GEKA 4XUDA 3RODA 3FPHA 5K0LA 4ER6A 3PLAE 3FPGA 5DX1A 4R8RA 1NW3A 3FPJA 2AOUA 1NBIA 4PGGA 3G5TA 5HIKA 2BR3A 3MGGA 4PNEA 2PWYA 4EK9A 5FUBA 1TPYA 3ORHA 5GM2A 2PVCA 4E2WA 2IH5A 5EPEA 5H02A 2YXEA 5EZQA 3ELWA 2PJDA 1YZ3A 1B42A 3LGAA 1DUSA 1R74A 3L8DA 3FTEA 4EKIA 1ORHA
chains in the Genus database with same CATH superfamily
1WE2A 5E1OA 2GK4A 2CKMA 2AMJA 2WUFA 5BQXA 1BVYF 3V4FA 2QSYA 5JATA 2Y77A 3LUGA 3A9RA 1XFAA 3SLGA 1ZGBA 2QX7A 5B1HA 4HVTA 2ZULA 5AH0A 4YUYA 1K5DA 4NEGA 1OX4B 3O26A 4IGAA 3ZDAA 4P83A 4JLDA 1JHUA 4QVKA 1WA5A 1XI2A 1NLMA 1FFAA 1T6BY 3U62A 1L7EA 1JVNA 1VIAA 2VRCD 5CAEA 1BA2A 4IW3B 1RBMA 3WQBA 1GG8A 3JWGA 2F3UA 4Z1MD 1XR3A 1JQBA 2C54A 4JJIA 3OE5A 2GJKA 3KR9A 3LUHA 2W2MA 4IP0A 1J21A 1NG1A 3SEZA 5G41A 1AIPA 1OX4A 3WJ1A 3AZPA 3HI4A 4Q6WA 1YA4A 1ZJ6A 1PF7E 3WB1A 2WWWA 3X1KA 4DB2A 1KFEB 2IEBA 1WL8A 4X8LA 2WJYA 4L6CA 3A2KA 1C0PA 1U6IA 2GWHA 4RTPA 3AUTA 2XTNA 5AKEA 4FDLA 1IMJA 4CLOA 2QVZX 1H2ZA 2AX3A 2PZGA 2OG2A 4IXWA 5G4KA 1Q6YA 4L3WA 5AK4A 1G8SA 1J25A 2P75A 1UBHS 3F2VA 4L8YA 4K9MA 2O6HA 4C43A 2QZ4A 4GQAA 4ZCLA 1AD2A 3BHNA 5EXXA 4JT2A 1R66A 4BTLA 1U9ZA 2AE2A 4P7JA 1G64A 4MR9A 4BQQA 4DV7B 2VHXA 3LKZA 4M0MA 1OJ7A 1KYWA 3V1KA 4JKOA 1YRBA 3I62A 2YZKA 3ZNOA 4MOWA 2EGGA 3UUFA 3EB9A 4TMVA 3TSYA 1KEEA 1LTHR 2OD2A 3QGMA 4O1IA 2V5UA 4RJ2A 4FP9A 5J47A 1CJBA 1QE0A 1T43A 1Z2OX 3PX3A 1FDRA 1CS0A 3ILVA 3O1JC 1P7VA 3S1SA 4HQRA 4KGDA 4WK2B 5DN6D 5FO1A 3DOFA 2PH5A 4ZVQA 1NN1A 4QJ5A 3SX4A 1ZRNA 2BCEA 3SM3A 2FSPA 2P6UA 2YQ5A 3QVMA 5ECGC 4BX3A 2PUFA 3QVWA 3IOCA 1VLJA 1NVGA 2D00A 3V7WA 4AXBA 2WTNA 3A4LA 2YVLA 5L3SB 3B6MA 4X1YA 5DISB 2GF2A 4AIRA 3OZDA 4KBFA 2DBZA 2NW6A 4HXGA 1Q3HA 2ETXA 3FVWA 1IH8A 3GUUA 2PX2A 2OAEA 3R77A 4J91A 1W4BA 1DADA 3QEKA 1Q83A 1KOFA 1RC1A 1PDOA 1Z6AA 3G2QA 1L7MA 3IQFA 3LFHA 4RMNA 2LR0A 2HRBA 1Z47A 5GMOA 3DPIA 4GPD1 4HD8A 3TRJA 1PEKE 2JFPA 4OI4A 3ZK8A 4DJAA 3QU2A 5M5BA 1V45E 1OYWA 3L43A 3LLMA 2CXUA 1Y3HA 1B43A 1U8EA 2PRKA 4B80A 4BDTA 3CKLA 3LKBA 4ZOLF 1P6QA 2J07A 3BCRA 4WZ6A 2LZ0A 3EXHA 1MQ8B 4QDZA 3RE1A 1ZOOA 1R9JA 1N5JA 4H08A 2LUOA 3HVIA 2N1MA 4XVUA 2VT7A 1RPZA 1FTWA 1G18A 4RCVA 2Z6AA 3ISJA 1RJ9A 4DA4A 1O9HA 3UA3A 3L1IA 4MB0A 3R5SA 1ONPA 2IEAA 3W1VA 1Q1EA 3VR0A 4O5OA 1V8BA 5LZ4A 1MGPA 1BMDA 3HBAA 1USKA 1P0IA 2GJ8A 2VKQA 4I14A 1N1GA 3O1LA 2P3QA 3QOWA 4JVOA 3PEFA 3RTCA 1SA0A 2ZUWA 4JBWA 4DG8A 1K5GA 2GN1A 1P1KA 3QFRA 4WA8A 5EHZA 5JNTA 1CIPA 5KNBA 5IRCD 3OTGA 2D1FA 1XMPA 4WOJA 4L1KA 1VL0A 1R12A 2AS0A 4L5YA 1NIPA 2JNWA 4K0RA 1I3LA 4E4TA 1JIUA 2JLAA 4RTOA 3EZNA 3DDSA 3OCJA 1BRMA 5IT0A 4P3NA 5LBUA 2BFNA 5EESA 3DWGA 4J7XA 1I4DD 3FCCA 3K9WA 5TY0A 1YTUA 2C95A 1HEIA 2DHEA 5EPUA 4MARA 2PEYA 1YK1A 2V0GA 1NJ5A 3T1NA 2BUCA 1LQUA 3H16A 3QLVA 3VPAA 1WG8A 1UJ6A 3LNCA 4JHXA 1I4WA 2YY5A 4GQBA 1NOJA 1A76A 4TMTA 1LNZA 3IBFA 1DFIA 4J7CA 3A1UA 1EHCA 5HE9A 3OIVA 1ZIDA 3ASUA 3SXJA 2V55B 1Z0AA 2E1PA 3O4VA 2FEMA 1WF3A 5JXWA 4OXXA 3LUJA 1KDOA 1OI3A 1YVPA 3DOJA 5DYWA 3AY7A 1XZMA 4PFKA 3VR6A 4PPNA 3GPLA 4MGIR 4MWDA 1YZTA 1LJLA 3QBJA 3B6JA 1DOZA 3ID6C 3ZK7A 1PZHA 4GPBA 4RZ2A 1AF7A 4CFZA 7REQA 5LQAA 1VG0B 2AG5A 2PLRA 2QVXX 2G4CA 3UMYA 2PZEA 2VNIA 3UV6A 1T5SA 4HNAA 4N0MA 3THWA 1E1DA 1VI5A 2ZBRA 4D0NA 2R48A 5KYXB 1RHQA 1L1QA 2P27A 3NWOA 2J46A 4TV9F 5SZHB 3WBKA 4ZQBA 1FL9A 4YK7A 4EITA 2E18A 1SU6A 4LMPA 1RYEA 2J9FB 4M36A 4ZQHA 3ROXA 2AI1A 3MMPA 3UYLA 3HH8A 3HK2A 1GL3A 2Q4EA 2VR1A 3FPEA 2AEJA 3MWEA 3QHPA 4KRYA 4PO1A 5AK3A 2GXUA 1MLDA 4EY5A 2ZREA 4NX2A 1D4AA 5B2ZA 2KHZA 1G8YA 2I22A 3HZHA 2D1TA 3LUKA 1RD4A 4JR1A 1KNQA 3IBGA 3EQ6A 5CFMA 3BKXA 3AL0C 2W98A 4RVOA 3EIWA 5J5AA 4ZZ0A 4NE2A 3WB2A 1R5OA 1E2HA 4Q4JA 1RTKA 2FNAA 1UEXC 5AK5A 1A8HA 2N9UA 5C34B 1E5TA 1AA9A 3D4OA 1ONSA 2QP9X 2XMZA 3AFHA 2VVTA 2PQ0A 2Q6VA 4QU5A 4HDQB 5EA2A 3VGPA 2WKQA 3DBIA 4QQNA 1QGED 5F9MA 3HFJA 3OO1A 4HGRA 4DJ5X 1ZSNA 2EVWX 1V96A 3CBGA 2HXSA 3PHGA 1RKQA 1WKCA 2WD9A 1EUYA 1NKVA 1A9QA 4O25A 5FUVA 1U98A 4QXOA 1T26A 2HQRA 3DLHA 4IDPA 3TNFA 1QGUA 4EO4A 4KLRA 1CZKA 3RDPA 2D2XA 4NCAA 2X2FA 1GQYA 2ASVA 1P2SA 2NYRA 3GAFA 1VJ5A 1YR9A 4YJ2A 1ZD9A 4PZUA 3U39A 2QDXA 4FINA 4KEAA 3UGQA 2BD0A 3KPVA 1WPXA 4HXYA 3RS2A 2HH9A 4M83A 1SCIA 1ZCJA 3GGCA 1KRHA 1FS4A 2QM0A 1FSFA 3HCWA 1M2NA 3PD7A 4MMYB 4OIFA 3S40A 2QAIA 1Z73A 3RK0A 2GD2A 1JU3A 5SZIA 4GM0A 1VYTA 4FIDA 2QQ0A 4WK6A 1IY8A 1URPA 2YWEA 4TTSA 1Z7YA 3GGJA 1HNWB 1NMEA 5HE8A 4AY4A 5TQVA 1TZCA 1Z5OA 5L7TA 1HFJA 5FIUA 5C4GB 3WQQA 3GLIE 1Y4AE 5KSZA 2KQUA 4YGYA 1ZR4A 4XRGA 4AQ7A 2IUYA 2YICA 4TTTS 1YU9A 4ZVOA 1UR5A 4K6KA 3MS7A 3IOMA 4QELA 2XUJA 3BREA 1KQGA 4ZVUA 1Q7CA 3COWA 4M21A 4KPFC 3PEUA 2A8YA 4IF6A 1LU9A 3RNOA 1GNVA 1TCVA 1VE1A 3N2GB 4IJUA 1X7GA 3GELA 1QVAA 5FUYA 2RJOA 1TL7C 1PT7A 4R7TA 4UTOA 3BRWA 4B4OA 4DJJA 2AJ8A 2PMKA 1R6DA 2RHRA 4A8JC 1Q6ZA 1YZFA 2ET6A 2YWXA 1IWPB 3TSWA 4TUYB 3VHXB 1J2RA 5LU8A 1YBMA 3W4JA 3K0SA 1O6ZA 2IY8A 2RGYA 3QVLA 2C5FA 4HYEA 1GGKA 2AR7A 2SICE 3CF4G 4L75A 2DRIA 1FMTA 2W2KB 2YXLA 5BSUA 2O3UA 2I2CA 3LGSA 2OYRA 4BB5A 2WHQA 4GC9A 2ENWA 4C7MA 2VUSA 2A4KA 4ZAVA 3TR5A 1GCIA 4NOJA 4HJRA 4NJEA 1ZNZA 1VPDA 3UK0A 2P6OA 1YA6A 2PT7A 4EX6A 4UNSA 2PKRA 1WW8A 1F7UA 2PL1A 3R9XA 2QL5A 3WK6A 1LI7A 4IOKA 1E5XA 3JVEA 4QYSA 3ZVLA 2QTMA 1F5NA 4AB1A 3EIXA 2AQKA 5KU1A 1IDOA 5KAMA 3EPRA 4FR0A 3BTOA 3VZDA 3STXA 2JFUA 1RWWA 5CJ2A 3H83A 3JQCA 1FBNA 3PNMA 4JI2B 5DEOA 2CUKA 3BH0A 5A71A 3ROTA 1ZXLA 3ISTA 4L8VA 1U31A 4I7EA 5K5EA 5GONA 1BXRB 1D8TA 2HHJA 3ZKAA 4F4JA 3UJAA 3H0KA 3LFUA 4OHFA 1W19A 3FSJX 4ENVA 4YT5A 5F52A 2B4YA 1XRPA 3C5CA 2AK3A 1U28A 2IYPA 3HUEA 1FTNA 4H7KA 3RTDA 1EXDA 4X85A 1UBOS 3FJOA 3CH5A 1ODJA 4KLAA 4I50F 3AKDA 4N82A 4V0OA 2H5LA 2ZWVA 4WNIA 4ACAA 3FUTA 4C5BA 2Y2VA 2YWJA 1Y34E 1X1DA 1Z7BA 2YWHA 1CIJA 1JAIA 1U63A 3RD5A 2WF5A 1CK4A 3ZCTA 2F00A 3TQHA 3MRXA 3EVAA 1YNSA 3JD2A 3L7CA 4MKGA 4W82A 2B4AA 5C7IO 1ZG3A 2YS7A 2Z0MA 4NF2A 1NVFA 3LL7A 4ZYLA 4P0PB 4ZAWA 4MGZR 3B6KA 4PINA 3VAAA 4CCWA 1JE0A 3JS5A 1W4AA 1WO8A 2B94A 1JEQA 3F4KA 3I9FA 1T35A 3L6EA 5AJWA 5IARA 4BRSA 1M6YA 1TTHA 3I28A 3WJ7A 1QYXA 3FETA 1H4VB 2HJ9A 3AXSA 3VSEA 1F4VA 1Y5LA 4NOLA 1H1LB 2RGUA 3CVJA 4RTNA 3FF4A 5AJUA 2R6CA 2REOA 1SCDA 3AOEA 3PVCA 4JUBA 1GPWB 4I9HA 5COQA 3L77A 3Q85A 2E9SA 1YACA 1HM5A 1VL5A 1C9JA 2CLHB 1SFRA 4IKOA 4M0LA 1Z68A 1EU1A 1I6KA 5DX8A 1AO3A 1ONNA 2GESA 5ALEA 4RDXA 2QTBA 3FG9A 1EWKA 2BKUA 2V4UA 2ZITA 1PBTA 3LRTA 2HF9A 4AZ3B 4E21A 2OHXA 4OHMA 1RPNA 4J1TA 3AUUA 3GDHA 4M38A 3GZJA 2HMUA 3R3YA 4OB7A 4I6GA 4W5HA 3H7AA 4L72A 5DNVA 1GPKA 1Z3IX 2FPGB 1S6YA 2KW5A 3RSGA 2GSDA 3UATA 3OD1A 2X8JA 3RJTA 3GROA 1GPYA 1EH5A 1ID8A 1UKCA 5I9TA 2AXPA 2PS3A 3W7AA 2CT8A 1NKTA 1ZP6A 3G5LA 2WG0A 4D42A 3E4DA 1GPH1 2QI9F 4BZXA 3EPLA 1TIKA 3EZFA 4FYHA 1J09A 1XXHE 2DTXA 3DHWC 2AUTA 4KN8A 4ZV9A 4ZVLA 5BV7A 2X42A 4UVHA 2FPSA 3K3PA 1VGRA 1X7XA 1D4OA 1HE4A 2GCEA 3H04A 1X80B 3A6LA 2QG9A 3HYLA 3O4GA 4YLGA 3U3KA 4ZTZB 5A0VA 3LW8A 2H6EA 4J1NA 1R0BA 1YDFA 3AB7A 4JL5A 4LNUB 1KIAA 4P4GA 3OIDA 5ECDA 5E6SA 3WC4A 3O1IC 4G85A 2AN5A 2FI1A 1NXPA 4S1OA 1W76A 2P2GA 3W79A 1KK3A 1C9YA 1CFZA 1EVJA 2UVPA 4EPWA 1JHRA 3T7JA 2RBGA 4HTFB 4I1VA 4NENB 4AULA 4BTVA 3EA0A 2MSLA 1INLA 3CA8A 2FPIA 1E2NA 1E9AA 2NUBA 2HUNA 4UVDA 3CRMA 3KOOA 2NYAA 3AUYA 2L18A 3TDMA 1WB5A 5FEMA 1E3TA 4YV2A 4IS3A 2WOJA 4DLWA 3WDMA 2O8EB 2B30A 2WTEA 1C4XA 3A26A 3F6BX 3PRKE 1G60A 1LWOA 3USCS 1AG9A 2OFXA 2PGLA 1ORDA 1RPJA 2O3QA 4JBYA 2QXYA 3R75A 2YJZA 1NW3A 2QU8A 2QM8A 3FPJA 2AA3A 1AHNA 4G3XA 4G9EA 4KWHA 5DK6A 1OC4A 4MIOA 3K5WA 5MF6A 3NTRA 1VC2A 4OYYA 5HGJA 1NUAA 2FDXA 4M9SA 4JXKA 2DQYA 2ZRFA 1SOUA 1T8PA 1XD9A 1UH5A 3DAGA 5BMVB 3T41A 5FBRB 1ZIOA 2ZRNA 4LDJA 1JHDA 5K4AA 1WABA 5AW2A 3ON5A 1D5CA 4Q3AA 2XOKD 4S0XA 2ISCA 1M75A 2QJOA 1DQNA 1K5HA 4R9RA 1B1CA 2PTGA 3TM4A 4FWTA 2HK6A 5IM4F 1COZA 2CLEB 4KIGA 2J33A 1E8DA 1KJZA 3I61A 2NP6A 3A1CA 3CF4A 2WQZA 2ZP1A 3I9MA 1JJVA 1K4MA 4A2QA 2IZ1A 1QAQA 4UUNA 4DM3A 4EUHA 2AZMA 1GUYA 2VPZA 4OLJA 3BWBA 1KP3A 3GJ5A 4DUPA 4AKGA 1JLLA 3GFGA 1JYSA 4UBIA 4KG7A 2N42A 1QQAA 2YCLA 3BJEA 3M5CA 4KXFB 3GDFA 1LPPA 3PNKA 3QKUA 1YVUA 4MRAA 1NMYA 3TSZA 3ENQA 4CLHA 4WH0A 3HB7A 3SC6A 3W3ZB 1CP3A 4DJDC 2O2SA 1SCAA 4Y7DA 2PKQP 1WAMA 1K4KA 3KNZA 5KNBH 4BY9E 3OOJA 3RK1A 4KMOA 3AETA 4RL4A 4EY7A 5J2UF 2GM4A 2BTEA 4NRDA 4NJMB 4HZGA 5JTUA 2FUKA 4AS3A 4RL6A 2Z1DA 3H2SA 2NQ2C 2I3DA 3T7CA 1USGA 2QVLA 4YHBA 2BGUA 3ZNPA 2RK4A 3NVKI 3TW8A 2CHGA 3H3XA 1RP1A 4EECA 1ABEA 1P31A 2R65A 2NU7A 4QUBA 2HN9A 3VVLA 4B6JA 4Z4CA 3DTNA 3FYUC 4V1CI 3TFOA 2WD7A 3A28A 4BRWA 3LAWA 3UMCA 4PLHA 3PL1A 4IZHA 2QBYA 1RXYA 4EGJA 1KU6A 2IVFA 3IB3A 3GLHE 1A8PA 2UVDA 3L5OA 1MX3A 4GL4A 3ZLJA 1JQKA 1RHKA 4RC9A 1R50A 2WILA 5CW2A 4GHWA 5CHYA 2OK8A 5FPTA 3K5IA 4AF6A 1LDGA 3F4LA 1I5EA 4MQBA 4DCMA 3ZV6A 1HT1E 3SC2B 5ALRA 1LLUA 2YFQA 3OOEA 1Z0UA 3QG5A 3ENZA 4N4AA 3VR6H 4CM8B 3W2IA 4U00A 1YRQA 2C00A 4ETWA 2MHCA 2F8MA 1TX4B 3NHKA 4HNGA 4PFJA 5TB5A 3BFPA 4TZTA 4OI1A 3HB9A 2NU9B 4UUAA 3R7WB 1WBBA 4E32A 3JYPA 3DKPA 3KZKA 3N2LA 4H2DA 1KDRA 5DU2A 3U3OA 4IMRA 3EBPA 5SY9A 5B2FA 2ZOSA 2EKZA 1TT5A 1YDEA 5BRNA 1CUBA 1O9BA 3K9BA 4OQFA 4XPZA 3SY8A 3GL9A 1XSEA 3GBPA 3JASA 2UZ1A 2VZ9A 4Q21A 4TL6A 4YFVA 4X3PA 3M6UA 2CL6X 3V46A 1JFSA 1N7GA 5K0EA 1DB3A 4K6MA 2VCEA 3S99A 1V5IA 3R3HA 4WN9A 1ZH4A 5LXTA 2QN3A 1QH0A 2QMQA 3KJHA 721PA 1ORIA 2ERCA 2IXFA 3C8HA 3D54D 2EW8A 2CNOA 3DSRA 4F7DA 1GRRA 3GG2A 3LVFO 4HRYA 4DLSA 4LC0A 2O2HA 1VCIA 2AR9A 3QUBA 3L4JA 2BF4A 2OQIA 3T54A 1NPYA 4ARBA 2XHEA 5TE9A 5JJBA 4UHDA 5AMXA 1P7ZA 1LSJA 1T4MA 4CUKA 1J2TA 1HZZC 1N2CB 5M29A 3RTAA 4I50A 1PNVA 1SZDA 3H2YA 3RSQA 2VDRB 3O9ZA 1Y5IA 2WK1A 2X6RA 3RVBA 1ADYA 1K0FA 3NB0A 4LXQA 3HDTA 4Q7EA 1JSCA 1QO0A 4R9NA 4RK1A 2PBLA 1PJZA 1UAYA 4W5WA 5F1KA 3QY0A 2O8BA 1UPXA 4KIJA 3EXEA 1YF3A 4GBJA 2PG3A 1YHNA 3SS9X 2BGRA 2CMDA 3UB2A 2RGDA 3OY2A 1D6NA 1EJ0A 3LHFA 5L4NA 4RPCA 2PXAA 1UCFA 3DB2A 1K97A 1Q91A 2X0NA 4BTEA 4OFBA 3ZDYB 4B83A 5L40A 1TYZA 1UKZA 1Y9AA 2JC3A 4JP1A 5JV5A 2AKAB 3GLFB 2GXAA 1QGAA 3D1VA 3JALA 1UMKA 4MPPA 1NN3A 3FCOA 3WGZA 4ZU3A 5DNWA 2C7BA 1PEAA 2M9MA 1RJDA 1TKBA 3L49A 4FKZA 1WXHA 1MB3A 4ZU1X 1YGPA 2L82A 1UFOA 2PKXA 5AOBA 2JGIA 1VBKA 3EW9A 4EG8A 2Y1FA 3ECAA 3HP1A 3BILA 3NTQA 5A6VA 3V8VA 3IDQA 2CDAA 4MKZA 3T1QA 4R1PA 3BIOA 3RYHA 1Y9JA 4MRNA 2A5JA 2VDWA 1TZJA 3W5UA 2OCIA 5DULA 4RIEA 1ZMXA 1FXUA 3GRFA 3WR5A 2QD1A 5U4QA 1GQSA 3U1VA 2DFKB 4ZEMA 2ZYSA 1M6VA 5EWLA 5HQ3B 5KTRA 1PG2A 3FNBA 1K7FB 1ZWLA 1JRLA 2B1IA 4CLEA 4B45A 3B48A 5LJLA 3CSDA 4ETMA 2QRLA 4ZC8A 3AVWA 1PW7A 2E0IA 3HDHA 1QF7A 3C14C 2HMYB 3ZBTA 3T7KA 2I7XA 3W77A 2Q7XA 2V6JA 3L8MA 3KJNA 3L4BA 1OWNA 4TYQA 3CUEF 4DCNA 1UMCB 1VMIA 1GTZA 4D4JA 4YV7A 3OQVA 1QFYA 5DCWA 5K0BA 5CA1A 4GXQA 5E2BA 3BULA 2WJAA 4KOAA 4QTZA 4RNCA 1GAXA 3AF0A 3P9RA 3K15A 4PGAA 3M6LA 3VKVA 4OFWA 4WV3A 3IEIA 3L6RA 2HK7A 1WCIA 2ZTHA 2FX2A 1KU0A 3VJRA 4UMDA 4U7TB 4OQ4A 1B3BA 2QMOA 1R00A 4HGPA 2WE8A 2XR1A 2BLLA 4QXRA 1V5FA 4JITA 3NW9A 1R37A 3SP1A 3V5NA 3FFAA 2CHEA 4OQMA 5KDLA 3W2GA 5LMCA 2C94A 2CNKA 3FM9A 4ND2A 5EIAA 2V45A 5FL7A 5T6MA 4DQXA 2JAWA 2ZRIA 3NDBB 3JQ8B 5DCLA 1VL2A 5K8CA 1S7CA 3O3MB 4KGZA 4W1RA 2ZBDA 4MA5A 5FLYA 1I94B 2Z2KA 4CR6A 4DMCA 1ZSYA 5JIBA 1XTQA 4BLQA 3BERA 3ROQA 3V1UA 4B34A 5F9HA 3P94A 1R5JA 1XTRA 3BQMB 4RZSA 4KV7A 4YLEA 3OFVA 4YHHB 2C0CA 3QIAA 2ZKLA 1RVV1 2VZLA 3A70A 4J94A 1AN0A 3P45A 5AVXA 1RQGA 3JZAA 4NOKA 4ROSA 4HDNA 5B12A 3GZ4A 1UM9B 1XTIA 3CKMA 3HCRA 3Q9UA 2GPSA 3TRFA 4BRUA 1A9SA 3X1ZA 5FQOA 1KQNA 1K06A 3RGGA 1HOTA 4DCTA 5C8DA 2F3QA 1C1YA 2DHQA 2O5RA 4IIJB 4KYVA 2CLOB 3OPNA 3TMKA 1Y7LA 2EFGA 3WZLA 3M1IA 3NUZA 4KQJA 1T4CB 4WEOA 3NO4A 1XHFA 4NBUA 2FN7A 4JHLA 4N48A 1YSCA 1FXWA 1OROA 4PLTA 2RGNA 4RHYA 2X1VA 3KSMA 4BASA 1CG6A 1HC7A 1RI2A 4JQZA 1ZRSA 3DOUA 4TL8A 3MM4A 3EDYA 4C0BA 1YCFA 3TTXA 4EFMA 1JEJA 1T8RA 1V47A 1UC9A 3FLMA 1YB7A 4BB0A 3OLYA 1QQ7A 4LOLA 3S7TA 4W4TA 2CZQA 1UL1X 4MVXA 4XJSA 5IM4A 1QP8A 1PGNA 4B8WA 1Z33A 3EF0A 1N6LA 5LYJF 2E1RA 4HDMA 2WT4A 3ZDBA 3MCAA 5DRYA 3UCXA 3DCNA 1E2JA 2FN9A 4BMYA 4BO3A 1Y6JA 2Q3FA 1TYAE 1S7GA 2NZ2A 3FHCB 3AR4A 3BHJA 4C0XA 1WUHS 2O2JA 3PQ7A 1W5TA 2WV7A 2A0KA 4PG8A 5MGBA 2CEAA 3O95A 1FUUA 3QBEA 4QBIA 4YMWA 3SS7X 2C5SA 3N6VA 3I09A 4C7XA 1S9HA 2NSDA 4KWTA 4DRZA 3GT0A 3FAKA 2WT8A 1E79A 2DPGA 2R00C 4O4IB 3SLRA 2BFCA 2XYVA 2BIFA 3OIFA 2VXYA 2ZJYA 3ZWOA 4B7CA 1QHGA 2H17A 3NRBA 5HRUA 1HLFA 3AEXA 5LDGA 1CIVA 3CUUA 2RAVA 3OX2A 5A1JA 3H2BA 2PN1A 3M5WA 1XD2A 1UPTA 4BLTA 1M34B 1TM2A 1TXGA 2UZIR 3B89A 4BX8A 1K7YA 2J3HA 2W2TA 3SMVA 4L57A 1L4NA 2GO7A 4DAEA 3EAQA 3M2TA 4INOA 2C57A 1QCYA 1ZEMA 4QWWA 4E09A 4HPWA 1MJNA 4MQMA 4TT3A 4Q9HA 1V6AA 2IXDA 1MB4A 2Z6UA 2QLJA 4F4IA 2ZWPA 2QTRA 4R1UA 4LRWA 4P1ZA 2FWNA 2EEZA 1UUFA 2DSNA 1DI0A 1J8QA 2PLAA 1PJRA 3F78A 4EGFA 2VQFB 4IDQA 5ERXA 2Y68A 5F7JA 2XEDA 4S1VA 5ARBA 1A9PA 3I5YA 1IZYA 4IBOA 2VATA 1E7RA 5ESDA 2V1UA 5C8YF 1EAYA 1Z16A 3AC0A 3BXXA 1MJHA 2H1FA 4IWXA 4MP3A 4RIIA 3U26A 3I2FA 1XTTA 2AKYA 2QB5A 3GAMA 4LXTA 4O4HF 1U2SA 5DVZA 4CM7A 2X6TA 4BIIA 3E2IA 5KC8A 1M1UA 1GITA 1YIOA 4YJ3B 3Q7PA 3DBRB 3JQAA 2ZSAA 1T3GA 4ML3A 1N0VC 2OGWA 3TTUA 2PY6A 3BRWD 4D4HA 4EFNA 1EESA 1Q74A 3INGA 4LOIA 1WBJB 5JG7A 1R10A 2FFRA 3NIFB 4CI9A 5CXQA 5IKXA 2R5NA 3CX7A 4MV6A 3NATA 4KVAA 3UWPA 4ALLA 4NV3A 4P92A 5BN5A 2YKGA 2VSNA 1P4HA 5LQKA 5IXYA 2XF2A 5LA6A 5JYBA 1U9YA 3SDSA 1DAHA 4M9CA 1WXWA 3PKZA 4Q1EA 4WERA 4I55F 1MFPA 2NZYA 3KHUA 1O03A 1Z6YA 3L9WA 1O3YA 4TTJA 4WGFA 4AZ0B 4DQLA 4NBRA 1TKCA 4GI1A 1YJ5A 1AS2A 4Z5XA 2EFJA 1J5EB 2CYBA 1J1UA 3K2QA 1RNLA 4C0AC 2GMWA 3C5EA 5KX5F 2YRXA 4Q9KA 1UMDB 2OD9A 1XCMA 2QRGA 4C22A 2KS6A 3IAFA 4OM7A 4TVBA 3W4KA 4P8RA 1ULTA 3K96A 3LCVB 3JQBC 1P8AA 4RABA 2I3BA 4C6SA 5LWHA 3HQ4O 2Q2OA 4K5QA 4Y0AA 1VSQA 4JI1B 3ZWCA 2FPUA 4YRDA 3ZY4A 3ICQB 2HA6A 4X1IA 3OZCA 5FHQA 4BVKA 4E11A 1E64A 1Z63A 1IB6A 3G85A 3Q3VA 2UXCB 1AQ6A 5EJFA 4REMA 1CYEA 5IBQA 2TSYB 5I7OA 1GARA 4KQIA 2ONCA 3RVOA 4F6RB 8ABPA 3VHRA 3PJDA 4EYEA 2DJIA 1LXCA 4FE4A 5IYZF 2V0CA 2G80A 1YZHA 2ATCA 4ND8A 4ZYZA 2W7TA 1IZ9A 4JBIA 3QWFA 5KNCA 3BMNA 1T5LA 1OFVA 2EIHA 5KZMB 5GY7A 5CCDA 1RCUA 2OB1A 3LLSA 3UXYA 4I1SA 4OB8A 1JKJA 4HNVA 3H5OA 3VTFA 3IX7A 4DCPA 3CVXA 1WQ1R 1KQOA 1JAXA 4CV2A 3SVZA 1GUAA 4TTQA 1E3DA 3LUFA 4RZ3A 2DBVO 2C7OA 4C29A 2C04A 3H2HA 1FUKA 1OH7A 2ZBGA 1DRWA 4GX1A 5CYPA 3JTMA 3T3OA 1TE2A 2BHNA 1C3JA 4KN9S 4K6OA 3WHIA 4D98A 3CWZA 3HLKA 4V24A 3NUQA 3TLAA 2F8TA 1NR1A 5BVGA 2PAFA 3ADPA 4XKJA 3OTWA 1EFVA 1WJGA 2P2DA 2SECE 2VSQA 5CTJA 3ULKA 5DNDA 3S81A 3C1TA 2HMAA 3D7RA 3V8PA 2REQA 4C9BA 4DUZB 2BEWA 5FUWA 1NFFA 1U7PA 4LBWA 4Z0TA 1A2BA 3EWSA 4F71A 3I3SR 1SKYB 4DV3B 1O6FA 2ZRBA 5JOQA 1VKOA 3MINA 1UWCA 1FX1A 1CB0A 1DS6A 1I3CA 2LGJA 3CFYA 3PWKA 4G0VA 2I6XA 4AYTA 2QSZA 1SD2A 3N0RA 1BFUA 3V55A 2HA4A 3T1HB 1B73A 1DWUA 4ETNA 1X3SA 1DBWA 1PNQA 1NU8A 4FCTA 3WL3A 3HXPA 3KP1A 4IDNA 1KEVA 4K1XA 4C30A 1GL7A 2NUPA 3T99A 5H3LA 3IV6A 4EM6A 3IEMA 2CJWB 2PUVA 4FI3C 2Q1TA 4U2BA 1PL0A 4DTIA 2VTKA 4LQDA 4XASA 3QJYA 2DY0A 2R6ZA 4HQNA 4OJTA 4OHWA 4DLNA 3AL2A 4QX6A 1KYYA 1C80A 4ZCPA 4W6QA 1FBTA 1YS2X 4B6EA 1JDBB 5L3QA 2Y1CA 3FA2A 3OH8A 1C2YA 3C3JA 4BBAA 1GTG1 4UQOA 4ER6A 1WMBA 2FFAA 1A88A 1U7WA 4QGAA 1TA4A 2H2AA 4I36A 4PGGA 5HIKA 1U80A 5ESWA 3MT0A 4TYWA 2C84A 4WCDA 4IQ4A 3RUEA 4FDUA 1PFVA 3KXIA 3TMYA 4BNLA 2QP4A 3UANA 3J80A 1TYDE 4OD0A 3EA5A 3R41A 1OIVA 3GQBA 5LBIA 2ZUSA 4LDPA 4ZOAA 1E0JA 3ZD9A 1EFLA 1Z39A 2IKSA 1FMCA 3KYDB 3LQ4A 4OCZA 3NI2A 1VSBA 3HEAA 1ZRMA 4F5ZA 5KJ6A 1GXSB 3W5DA 4JSRA 2VQEB 1UJ2A 4JL6A 5LUBA 3E5NA 4LNAA 1IONA 4MW2A 4TYNA 3PYXA 2H9YA 3IV7A 1KOGA 4C4SA 3U4CA 1MT0A 2A9RA 4D96A 4X64B 4K40A 2F8LA 4DADA 1EDZA 1Z4OA 2FPPA 4TMWA 3W5JA 1L5FA 4QOHA 4ZIRB 3I2IA 3IXMA 5ALFA 3ST7A 2GD0A 1H85A 3VSBA 5KYKA 2UU9B 4ZYWA 2O5VA 3H1AA 3V1MA 1DL5A 3U9LA 1A27A 1S8FA 3H6GA 3R9IA 5CX1A 5EFZA 3ZV5A 3SYKA 4DYHA 4BNZA 3TZLA 2NUAA 2G0TA 3PNOA 1SHTX 2XMDA 4L51A 3PCRB 3PNQA 4D6YA 5FLKA 2R11A 4AG3A 2BFWA 3HL0A 3BSWA 2OYCA 4DIBA 4L9WA 5I7AA 1OE0A 3IC5A 2AX4A 2VDQB 2D5IA 5AW4A 7ABPA 4X71A 5A9TA 1TD1A 5TJ9A 1KZ1A 2JA1A 2ZSJA 1XRLA 5DSTA 4W8HA 1U5AA 1S2GA 5LYJA 1E61A 4H0CA 4DB4A 3TLBA 4MLCA 4BKUA 1GFSA 2XPCA 2XQJA 5JNUA 1WB4A 1GRVA 3M6XA 2WWRA 3E7PA 3IVAA 3LP5A 4YAFA 3O7WA 2Y67A 4Y2YA 4FSDA 2R6FA 1HFEL 1H5NA 1MV8A 1ZGJA 4RK5A 1XTKA 2VEOA 3Q15C 5HOQA 2XNJA 5KAPA 1U2RA 1PJAA 3L07A 3A1EA 1EBUA 3OE4A 3RQIA 4YV0A 4JASB 2BTQB 2PTHA 3ASYA 3SC4A 3ADKA 3E70C 1L5HA 3WX0A 5BV2P 1HDEA 3MPUA 2X9GA 4GO1A 3WK7A 1PV1A 4HB4A 1E2FA 1QE5A 2UYOA 3ZNQA 4OL9A 5HW0A 3DAPA 2AYZA 3BMOB 4XH9B 1ACMA 5DI9A 2TECE 1UFQA 3F98A 3GLSA 4JXJA 2QX9A 3BN3A 4MWCA 3EVDA 4G5SA 3EY9A 3K6KA 5IAEA 2UZAA 4EH1A 2Z2JA 2B6NA 2QYOA 4PSKA 5B1SA 5A04A 1MGOA 2P9HA 5TPZD 1OCEA 1ZK3A 2SHKA 2ZQYA 3AESA 3D8NA 3HXQA 4BNXA 3WG9A 3ZCSA 1QNLA 4REQB 4ZI5A 4I4TF 3OC0A 5KJCA 1Y7PA 2B35A 1LTKA 4IVRA 2TMGA 4JYAB 1A7UA 3P2MA 1VKRA 3DLTA 5A7GA 2UZ4A 3OG9A 2IXBA 4TN5A 3VOAA 1U3UA 4ITRC 1X8JA 5AJTA 1XL1A 4Y2RA 4XEHA 4FMBB 4ZZIA 5C8YA 4JJKA 3E1SA 3T7EA 1PGPA 2GKOA 4YRIA 1I30A 4A0SA 5IT9A 2I4OA 3RUAA 3KOWA 1KK1A 1QYCA 2G17A 2XMGA 2CVZA 2VNAA 2YIMA 1XCJA 3A58B 1DO8A 3I39X 1NN0A 2W43A 4YA6A 1RKUA 1Q21A 2AV6A 2HF7A 4WOPA 3RUPA 2RC5A 3WLNA 4US2R 3IEPA 5KC9A 1SB9A 4W5OA 1QHXA 1U7XA 1XDDA 2IYSA 4WESA 4YMSA 4B7XA 1BFKA 1ZGAA 1HSZA 2Q4BA 3K8YA 1SHJA 1HWYA 4QO7A 3N5CA 3E18A 2AOUB 1KDPA 2W2QA 4IM7A 3ZWBA 1GFWA 1LBQA 1WX1A 2JBAB 2PH3A 4RD2A 5JHHB 2BZGA 5JW6A 1XZGA 4RTMA 3B60A 5IJAA 1IBCA 1CF9A 4Z4HA 1V7ZA 4E0BA 4TGLA 5DBIA 3OIYA 4YJGB 1D2CA 1SELA 4RMHA 4IOLA 2M6RA 1JEOA 1NRJB 1OBOA 2W58A 3TPCA 1JN0A 2P8SA 4HSEA 4L74A 3ZV4A 4WFQA 3VPXA 5JFOA 3L1VA 221PA 1TFUA 2XRYA 4UAVA 1VKHA 1XTBA 1YQ9A 3N1UA 4Q47A 4E2YA 5BRAA 5HJEA 1N6RA 1FY2A 3M49A 3G2IA 2G7ZA 3BGOS 3DF7A 4JC5A 4PO8A 4Q9IA 2W93A 1EM6A 2H7YA 4B4WA 1QKIA 2JLXA 3OKAA 4AT1A 1QCDA 3V2HA 3RAGA 3X1XA 3PU6A 2RGCA 3WFZA 4Z1OA 3PUYA 1MA0A 4BC1A 1GWNA 4M89A 4NMHA 4R0MA 3KKNA 3RIMA 3W5HA 1MD9A 4PX3A 1IL0A 5BW5A 2OK7A 4EG7A 4JAVC 3RPEA 2MSWA 1G6HA 2OHIA 2XRZA 1UJ5A 5BQ3A 5IYZA 1JDPA 2FK7A 1TCBA 3IDFA 3D4NA 3T3DA 1QMPA 4ACBA 3R0XA 4AD8A 1IZ0A 1QH1A 1OLSB 1EDEA 4FONA 2DFLA 3GVPA 3MJTA 3RBVA 4MO9A 1OU4A 4HB3A 3KOXA 2GKSA 5DOVA 3GUVA 2BKEA 4YP9A 1ODTC 3SXUB 1H5QA 1E9DA 1EX6A 2X9LA 4OFXA 3LIIA 3FHTA 2ZXEA 2CFSA 2FG6C 3ASVA 4LMRA 1QG0A 3WLMA 1HO3A 4HLQB 4J2OA 3AIMA 1SC9A 4Q34A 4FYXA 4UTNA 4HDSB 3DNPA 4QKQA 1AGXA 2VWGA 1PL7A 5TXGA 3TLEA 3QUTA 3JQ7B 5JZSA 4AG5A 1AQLA 2QT1A 3E05A 3NHMA 4YUXA 5AVSA 1RDFA 4TV8B 4DNQA 4IGKA 4CEIA 3LM8A 3DF9A 4D8WA 3KXKA 5F3RA 5BOSA 4CLRA 1XMXA 1Y4SA 2WMOB 1WHTA 1F12A 1ZM9A 2FFHA 3LG2A 3HBJA 1T1GA 3IIJA 1AGNA 3KT8A 1FQOA 4E1BA 2BGTA 3MTIA 3C0KA 1JG6A 4J0EA 3SMQA 3U31A 5E3HA 5D3MB 2X0IA 4NMXB 3WNVA 4DV1B 3A1FA 1GIAA 1SXJC 4HEA1 1JG7A 2JZOA 4IRXA 4MDHA 1R4MB 4KLZA 2FK8A 3VDMA 5KIAA 1EA5A 2UUAB 3RYCB 2HPAA 3M9WA 1D2EA 1ZMOA 4OQEA 2ZRLA 1HFKA 2A1TS 2NXNA 2PX6A 3DXFA 5JD3A 3MJHA 2Y1OA 2YYSA 3R7LA 1DGQA 3WBBA 1WMSA 4BCBA 2FN8A 2QIOA 2XYPA 4LHSA 3PGVA 5TIIA 1TLFA 1N75A 1L7AA 2Q46A 1DELA 1I0LA 3TYXA 5AVZA 4TXHA 5JWOA 3W6ZA 1VG8A 5EWMB 3G68A 5FJJA 3KSAC 3LSTA 4BNIA 3UC5A 2AUNA 1LSUA 3A6ZA 1S9DA 3DZHA 2O7NA 1R4NA 3MTGA 4JJGA 4NL4H 2YHBA 2IE0A 2O05A 4Y2TA 4WNAB 2XXJA 1QYVA 2YOGA 3GRRA 3C4QA 1Q0LA 1YZVA 2P6NA 2VYFA 5D1HA 4KWIA 3HABA 1T6ZA 4EYGA 1I7NA 4M37A 3O92A 4G0YA 1LVUA 5F77A 1DXQA 3AO0B 2IGTA 4AWAA 4EW6A 8LDHA 1ZEJA 2QN9A 3B12A 3AVYA 1JIQA 3F5SA 2BP7A 4ZREA 1OVGA 3MLBA 4MV5A 1P29A 5EJ4A 4TRMA 2ICAA 3CNNA 5E7QA 1YB2A 4EI8A 1WCYA 4WKNA 3CVUA 3UIEA 1E8MA 3QFCA 2JCVA 3I5MA 1KMHB 4QPJC 3P32A 5TJHA 2R4QA 3DBVO 2FFQA 1O2DA 1YO6A 1CEEA 4E33A 5FL7D 1VJDA 2B3TA 3N87A 1L7XA 4R3UC 3P2JA 1VLQA 4XPIB 1CVIA 4MRMB 4B5KA 1SOVA 3CX4A 1NTRA 5FHRA 2CLKB 4EFKA 5CT4A 4GXNA 3SCZA 3D3WA 3VGJA 4DY4A 2AB0A 3VC3A 2XUGA 3AOGA 1M2HA 3MTEA 3D3EA 3QNMA 5K20A 1CYDA 1T5OA 4OQDA 3E03A 4UHEA 2ZZNA 1MN6A 3EEOA 4PQFA 1P5HA 1T2EA 4P84A 4U4AA 3WLSA 4RGYA 1KVSA 4BKMA 1RIIA 2WF9A 1ZO8A 4KE7A 3DE1X 4B43A 3D7NA 3NOVA 1HTTA 2G72A 4BQEA 2ZWMA 2CHUA 4HR7A 4D8TA 1CNMA 2C83A 4AC9A 5EMKA 3C7CB 1EXMA 3PI6A 2C59A 3OT1A 5IHXA 2QAGA 2O8DA 2D3TA 3KELA 1JAZA 3L0ZA 4PRKA 5CGQB 4FOOA 4D9FA 1GQQA 2REBA 2PWPA 1XVTA 3NHFA 9GPBA 3MT8A 3MTDA 5KNCH 1KO4A 2VUHB 3IUPA 1Z8DA 2VF2A 1E2LA 1IMOA 1MCZA 2DCUA 5B3JA 3TSCA 5E6RB 2H0AA 1CUEA 4OFZA 5HBGA 4TZ0A 4DRYA 1SQFA 4ES6A 1AQYA 4BV3A 4GQIA 3RIGA 2YWDA 3C3PA 4B3DA 2AHRA 3QK7A 4CQMA 1NQXA 4TKVB 1SK9A 3SX2A 2FR8C 3D8HA 2PA0A 3ADBA 1V4BA 3SFZA 4XIFA 3FYSA 1R6TA 5E3JA 4L6IA 3ZLBA 1J56A 5K4HA 2J6IA 2JGJA 1NQAO 1B6SA 3G8DA 1US8A 4US1R 4KMRA 1IBRA 3JVVA 1EP3B 1E58A 1BS9A 4PAMA 4FUQA 3SHTA 2SCUB 1NVBA 3BXOA 5CNMA 1ZD5A 5HX7A 5LMUB 4DLVA 2GJSA 3PDWA 4CM9A 1F0NA 1TAGA 5JRZA 4I3GA 1YV9A 1RAAA 1E79D 4HPXB 1YQDA 1V0JA 4IDFA 5EKUA 2XQFA 4B3CA 3F6CA 2P9GA 1C7JA 2YCBA 3NTUA 3OKCA 2DM6A 4H3HB 1Y8AA 4LYAA 5T4BA 3ZDQA 1AB5A 2BEJA 1Q0PA 4MRPA 2GBGA 2PUJA 3K0HA 1Z13A 5B3LA 2GVDC 4PQEA 3EEIA 3NWJA 3RABA 2XKJE 3GLUA 1F38A 5DTQA 1NAHA 1T9GS 4KQGA 1Q19A 5E38A 2E4UA 4IXMA 4MPTA 4O4LB 3FROA 4ZEVA 2PL3A 4R16A 1FFCA 4XI9A 2P9QA 1MAHA 4PYNA 1ISJA 4YRFA 2XZLA 1UP6A 3N5KA 4TWRA 3ZWPA 2GX6A 2VSXA 3QEJA 3EXIB 3R2JA 1GN8A 4JI4B 4PZDA 3HHPA 2ZANA 4R8VA 4BLRA 5KOHA 5FPHA 1SJ9A 2J3KA 2OR3A 1OR8A 3ODGA 3WIOA 1QHNA 1JLRA 1DC7A 2BEUB 4TQ9A 1K3TA 4JBLA 5JS7A 3TLZA 1CZRA 4DS3A 1PJTA 3B2EA 3EGDA 1PUJA 2MSNA 1OV4A 2YXBA 2IF2A 3FE2A 2G8NA 3K92A 4D9GA 4OXIA 3QLTA 4OQYA 4G4IA 1ZIPA 2C8LA 4EA9A 3HB5X 2GTPA 3EXAA 3LT2A 3O8RA 3BORA 3IEKA 3EXIA 4ALJA 1VHTA 4RENA 3EC2A 3IURA 1P0CA 2ZB2A 5E9AA 3E9QA 1P73A 1C30A 1DPGA 3PITA 1BMFA 1SMKA 2GBIA 2GGSA 1M0SA 1B15A 2A7XA 3FXAA 3QXSA 4RPHA 4YP1A 2IU0A 4C88A 2XYQA 4RPJA 4DCOA 5KINB 3VBEA 3UMJA 1NQUA 4PY2A 3KZXA 3U4QA 3JYHA 4U3JB 2QLFA 3HY4A 4I9FA 1E4YA 4NZMA 3VKFA 1CZNA 1MB9A 5AKKA 2QY6A 1ZOLA 2AOVA 3OA0A 4LZNA 1SIOA 3AY3A 4K81B 1DAPA 3PQ8A 1S2MA 4LDZA 2XYRA 1SQGA 2ZVDA 4EB6A 5EKDA 1K88A 4QTTB 1FFDA 2DTDA 2I5PO 2QF7A 3PWZA 3VFDA 3QPVA 1G5PA 4FFDA 1ZQ1A 3NT5A 4NK5A 5FUQA 4INAA 2H3EA 4GM1A 5JJ5A 2PUBA 3HYCA 4MB6A 2GKGA 2ZTVA 1A3CA 2PLFA 1WP4A 4EQ6A 3IERA 1ULHA 2HBQA 1U04A 1IUPA 2O2EA 2R6GA 4IGFA 3TQSA 4C0HA 2GN2A 1F2TB 3H19A 5AI0A 3WJ2A 2HPHA 4D0LB 4ZICA 3DZKA 1SU8A 2Q0QA 2NTYC 3H5VA 5KJ1A 1FP4B 1JMKC 2X2OA 2XUZA 3IAM6 3ONEA 3KT0A 5LBTA 2BCJQ 2C9ZA 2V58A 1MRZA 3LHIA 5H5JA 1T3ZA 2QK4A 1SB8A 3GR6A 4C08A 1ZOSA 3LC2O 5JADA 1RE1A 3GV0A 3NH6A 4H0FA 2AQIA 1LVHA 2DKOA 5LQUA 2RJNA 2WJHA 3O3NB 4NCNA 3ENNA 5HK9A 1TPZA 2ZBVA 1EJ2A 4Y0NA 3HNRA 4KK3A 2H4FA 4EAQA 3S0JA 4UM9B 5G1OA 3CT6A 2IV2X 1RYDA 3JQDA 2VNSA 2CV0A 1AKRA 1L1EA 3WYNA 3DE6X 4DXHA 1K75A 3A05A 3ICPA 1TJ4A 1PS0A 1AK1A 2AJCA 3GJQA 2R2GA 2IYZA 3NQ41 4W9NC 1XHLA 3WIDA 2HTFA 3IXLA 4DQVA 5EIBC 4D02A 4F6LA 3NHZA 2ACVA 1CY4A 4FC7A 4IIDA 1OX6A 1QIKA 2L17A 4Y3UA 1A0OA 1ZVKA 5T4FA 5HKKA 3EFEA 5K0LA 5TARA 1ZYUA 5COAA 3MWLA 5DX1A 5THQA 2QMHA 2ANBA 1I2AA 2MR5A 2RB4A 3NETA 2CBGA 4B8ZA 1PR3A 3LY7A 2O4CA 3R7BA 4ISBA 3C5VA 1E9VA 1QGZA 1XZDA 4FCCA 3NKVA 2WUWE 3T5GA 1U2DA 1UANA 3VPGA 1UMBB 1MNQA 2JZNA 1MOSA 1T4DA 1JSRA 4D3FA 5BYAA 1M83A 1EXVA 3RR2A 4UD6A 4MUGA 1LZLA 4V0MA 1JB1A 1T2VA 4YRPA 5KS2A 3M4ZA 3ZJYA 1UPUA 2RKWA 3EPJA 4HEHA 1B2LA 2FUCA 1R4AA 2HK8A 2OORC 1NNEA 1E96A 4C4XA 4QXPA 5JXHA 2H7CA 4WZBB 2C2BA 1FW8A 3TBKA 2X9NA 2EFCB 3DR5A 3TCKA 1DIRA 5F2KA 1BFDA 4UXHA 4C7BA 5HKBA 3AVOA 4MCJA 2TYSB 2W6IA 3CZCA 5CFZA 2F7SA 1F6WA 2GRJA 5JMPA 4D43A 1LY1A 1IBSA 4PR0A 1Q17A 1QQ6A 5KQRA 1I6LA 2H5JA 2JCBA 1IK4A 2PKWA 1ZM7A 2H1RA 3FCSB 3NBZC 2WMDA 3VI3B 1B14A 5LZ2A 4AJNA 4LF5B 1ZRHA 3ADCA 2R7LA 2WTAA 1XVAA 2ODEA 2N47A 3HDVA 4WNCA 4IG4A 2DFDA 4HB2A 1TVCA 3P1JA 3Q0EA 3R24A 1BE1A 1FSZA 2I4TA 4H16A 4FFBA 2WUVA 1L5NA 4C3OB 1SUBA 2JGDB 1FYWA 5C81A 5KYNA 1JF8A 2V65A 1X0VA 3AR5A 4Y6RA 3KTDA 4DUYB 4CHGA 4AWBA 4YJFB 2ZEJA 4LRSB 4FWBA 5A6SA 4D9JA 2YN2A 3U44A 1JJIA 2DLDA 2GFIA 3AF1A 3P71T 2GEVA 4LK3A 3ROMA 4W1SA 4UHBA 1R18A 1LC0A 3QRWA 2DMRA 3GZTB 3VYTB 4FYYA 3UNXA 2FE1A 3QYJA 5CEFA 2VDNB 4PO3X 4GMHA 1RLJA 2H1LA 3NM6B 2EARA 5A02A 4RW0A 1YUMA 3AWIA 4GC5A 4M1YA 2JFXA 2HDNB 2B9VA 2O14A 4R68A 5JLJA 1JEDA 2YIVX 1CR1A 3N7TA 3NIBA 4I4CA 5EQDA 1SG9A 2Q4DA 3PC7A 1F51E 3A9WA 1SCQA 2HIMA 4KWEA 1ZI9A 2ZRQA 4LZOA 1CUGA 4M1SA 3ZKWB 5A9RA 1Q0QA 1TU3A 3SKVA 3EEQA 2HPZA 5AW5A 2HJVA 1E6LA 3AY0A 4RZHA 4MUFA 5HF9A 4JD5A 1T2FA 1OREA 3JAMA 4CKBB 1TJPB 3G2PA 4EJMA 3GP8A 2HLPA 4JBXA 4NTZA 2H1OA 4ZXPA 1JU4A 1P9NA 2EERA 2H29A 1WMDA 2VYCA 3WLIA 2D0DA 3CXRA 1FDSA 2FPOA 5D6NA 4MDYA 2B1GA 4XDZA 1DPFA 1ODIA 1B0PA 3RLIA 1SU7A 3PP8A 5ADUS 5KYYA 1T5DX 3MCWA 1HBJA 4DAOA 1Y1QA 1S4QA 2WWHA 3WKDA 5JZ9A 1TCAA 1Y82A 1H0RA 3G79A 7AT1A 5AHKA 4BN0A 2VL7A 4LY0A 2C99A 3QF7A 5B58C 4GOJA 4QLAA 3S5JA 1SUSA 4W99A 4ARZA 1XNHA 1Z26A 1NVVR 2PS9A 1H3FA 3I2JA 5C7OO 1L4HA 5I4CA 4N8SA 2HRRA 4ERXA 2VPIA 2J9XB 1XU7A 3O94A 4KR3A 1NW9B 4R2JA 2NSLA 121PA 3OZFA 2AJBA 1LW6E 3OICA 3WMXA 4RS4A 2O54A 1UIRA 4EPVA 2GUGA 4I1IA 3D1LA 4ZO4A 3V7NA 3Q2KA 4U63A 2POCA 1PKEA 1BO6A 1HXHA 3H2KA 3TMAA 1A2KC 4DBLC 5CITA 2DLCX 1V1MA 1U8TA 4HTAA 2JG3A 5IP5A 4S3MA 4EO9A 3VR2A 4UAJA 1CCWA 1K98A 1K6MA 4Q4HB 1ISIA 4CT0A 2R7MA 3HYNA 1PEDA 1G7CA 2IPLA 2E55A 4Y7CA 5KKAA 1MR3F 2X5NA 3SBEA 3V32A 5KO2A 1XVUA 2HO5A 2WZDA 2FEXA 2ZI5A 2HJRA 3MYYA 4C2AA 5KEIA 1U1EA 5L4SA 5IWAB 1NURA 3PQDA 1TB4A 1BCSA 1GA6A 2Z5VA 1SXPA 4QRHA 1V7PC 4B82A 3THRA 2I2XB 2FF5A 2MYNA 1ZK2A 1RFGE 4XD2A 2YVKA 5TMBA 1JTFA 3UV7A 2KI5A 1PYDA 1ZMBA 4E5YA 1G3QA 3IE0A 4EY4A 3SOPA 4IEEA 4R8MA 4Z49A 1O0BA 4I2VA 1JAYA 4LJ8A 2EGHA 5HNKA 3VNUA 5TQ2B 4DG9A 1NUTA 2ZYIA 3U13A 2A1UB 4IO0A 1EUDB 3TNYA 4GGPA 4F9GA 5BQFA 1RRGA 3ZWXA 4ZZ2A 2CC2A 3KEFA 1F8FA 2ZWIA 2CY0A 3UN1A 2AMFA 2J0UA 4B6OA 4ZOLB 3SQMA 1EZZA 2Y0DA 1EVLA 2NACA 1X77A 4K46A 1D2GA 5C5DA 2FF7A 3QUQA 4KXLA 5DTMA 4OX9B 1WXFA 3PVZA 2CKDA 2G4LA 4FDAA 4F5DA 3JQ6A 3FI0A 3P2IA 5BUSA 1WQ3A 5T4EA 4JLOA 1BEUB 1U8UA 2A3NA 1L5LA 3ZS8A 1EUQA 4XQEA 2JJ2D 1EIWA 3BMCA 2JIPA 5DH9A 2XD9A 3FOBA 3RRYA 3IAS1 1BEEA 5F33A 3IL2A 1I4EB 1LLQA 2YQ4A 4FFSA 1EZ4A 2Y27A 3EAFA 2JAPA 3FWYA 4HLDA 1YBHA 5T64A 3T3HA 5K7SA 5AKGA 2Z83A 2DULA 3B3FA 3P9CA 3WLEA 1IULA 1KY3A 2B8WA 2VP3A 2QW0X 3RC8A 3GK3A 1LFDB 3WA6A 2UUBB 2EJBA 3KPWA 1DJPA 3O31A 4AKEA 3A6GA 3DDHA 3K0FA 2Z4RA 1FVHA 4JCCA 4UBKA 2DOKA 2X22A 3ZE8A 2WFLA 5BYJA 2E5WA 4DDTA 1ZJWA 2NQTA 3Q1KA 5HKAA 4CIXA 4NV1A 1E2MA 1UDCA 2B2CA 4JR0A 2PEZA 1YI8A 1T4BA 5F5LA 1KMCA 2BMVA 2DCMA 4KNWA 1N3IA 1PFWA 3IPLA 1YONA 4L4ZA 4PS0A 1Z4MA 4F96A 1G7RA 2JLZA 3UOGA 2QX8A 2HFJA 4EW3A 3WSWA 2HU5A 4EKYA 4MUAA 2XLCA 3CV3A 4JOCA 4ZT2A 3JZMA 5AUNB 5J40A 1ODLA 1RZUA 1Y8RA 2OBLA 3L7DA 3WNDA 2FWPA 3OCCA 5DYYA 4CCAA 1N9KA 5JJCA 4YPFA 3K2EA 1V9SA 3CJRA 2D1YA 4INZA 3TNJA 3WXMA 1SCUA 1RPAA 1ZONA 2Z3VA 1R1DA 1N4AA 4KODA 3STTA 3UAVA 3UQYS 5K6AC 1E6KA 3GUYA 1GCGA 2GUWA 1YMQA 2PMEA 4ALIA 3ER9A 3KAJA 4JN6B 1FS5A 4Q3BA 1YGYA 4QU8A 2Q5EA 3HJRA 4RFSB 1FTSA 4TV9B 1L5SA 3AIKA 4L0MA 4YROA 1ID1A 3V8QA 3GFOA 2WAMA 1P33A 3UFXA 3GDWA 1DFHA 1E18A 2HDHA 3FHLA 1WOYA 1BE6A 3KZ1E 3GBSA 3LX4A 1C7IA 2HKIA 2XWPA 3RIEA 2F3RA 3FOCA 1O96A 4UNNA 3DLIA 4TLLB 3FJYA 2RHJA 1RQXA 1JPNA 2ZPUA 4RF4A 4WKPA 4F2DA 5HTOA 3GI1A 3UB3A 4L9RA 3ZWNA 3AERB 1C3LA 1UFVA 4DHEA 1KI9A 1ZU5A 3DQPA 3JWIA 3WLOA 1P5JA 1T5TA 4Y18A 4IIHA 3GLGE 4LJAA 2Z2ZA 1R6XA 5JY6A 1BWQA 3A6JA 3SZOA 1CVRA 4HEJA 2ZBPA 3ETEA 4I0WB 4KQ6A 3O6VA 2EW2A 3B9QA 1Q0HA 4UUQA 1OH6A 1M73E 1EUCB 1XEXA 1KIFA 5I7WA 4DCVA 3R8CA 5T8KC 3KOYA 4QRIA 3DXZA 3TKAA 3EX7C 2GEJA 3JRNA 3FHOA 3T9CA 2QZ9A 5KWVA 1SIUA 2H5IA 2JBWA 5JH7F 1Y8CA 1H9AA 1N5MA 3GU3A 2MCFA 5KREA 3BZBA 4BO1A 1NJ8A 1V7QA 4LJSA 4NULA 5JS6A 4CF7A 1TA9A 1PI3A 2E87A 2W22A 3EIQA 4QUJA 1YFJA 4JXXA 1JEYB 1U0GA 5JMOA 4L4XA 2ZR0A 4OO3A 3ZNNA 2DC1A 1E2DA 3TEJA 4YRRA 1FNDA 5TT1A 1G3MA 3IAHA 1DDGA 4FS3A 5HMMA 3P9SA 3IYLW 1WY5A 2IC5A 4K9LA 4FNOA 1CZLA 1I14A 1IAQA 1DMSA 4RANA 3SHQA 4EI7A 1XTZA 4R41A 1RWNA 1FP2A 2O8NA 2FZGA 4IQ8A 1W44A 3E3OA 4WX2B 1UDXA 5DO9A 2XA1A 3WBFA 3GLIA 3JVUA 1Z62A 2X4IA 4O2AF 3CW8X 3V4VB 1M6HA 2EU8A 1S2IA 4IDOA 4NZOA 3GJZA 2JI8A 2WMYA 1TC2A 4YXFA 3KT6A 4YRNA 5JI2E 1HMYA 2Y05A 4R98A 4W5JA 4H1TA 2O5EA 1XLTC 2J9GA 4NNJA 1Q84A 4WE3A 4P2GA 4RZXA 4MWBA 4YDRA 5D86A 5TQ0A 1Y1TA 3UFBA 1OLUA 2NU6B 2JI7A 3V2IA 4HGYA 4Q4DA 1VECA 3PUXA 4MUNA 4PYLA 1QS0B 4AXXA 4CN8A 1FFWA 1NZFA 2ZIUB 3QI2A 3GRVA 4ILKA 5LP6B 1XCPA 1MRNA 1PHPA 3MRTA 4WVLA 1V9LA 5TPWB 5CDYA 1TTTA 2WWFA 3JWPA 4N5IX 3AR9A 2VQ6A 4JR2A 1W88A 1JZQA 1QDEA 3KQQA 2HMTA 2ZS8A 4WPGA 6AT1A 1KEKA 3FNRA 3R20A 1SVUA 4CQMD 3GWZA 1YXMA 4LJKA 4MQLA 1T0UA 3LFTA 4RIFA 3TUZC 4IIXA 1KPGA 5LQSA 5E4YA 4B73A 1JQ3A 1QIFA 2DWUA 4DWVA 1PD0A 2B4TO 3KXLA 1LW7A 4MIEA 4MS1A 3RHTA 4EA6A 2XB8A 2XRMA 4FHZA 1NNUA 4V0NA 3RYFB 2JFYA 4FYMA 4J8PA 4KQ2A 4FGKA 4BLWA 4DIDA 2FPRA 1KGDA 3AV0B 3KOZA 5CXSA 3R8XA 1NMZA 3VTZA 3F1KA 2IIBA 4GW3A 4JCOA 1LQTA 3KJZA 4JLWA 1N2JA 1WHSA 2RI0A 2E82A 4PNHA 2Z30A 4RZUA 4CM9D 3WAJA 1KO1A 4COOA 3MF4A 4YAUA 1NP6A 1B3RA 2NU8B 3VYWA 3GA0A 1LPNA 4UNQA 2GB4A 3EXFB 2J0QA 4TWJA 3L4EA 4MR8B 1P17A 1B8OA 1P60A 2P9ZA 5ARCA 1T29A 3T35A 2BGIA 4BB6A 4N41A 2PV0A 2H2GA 5EPOA 1M33A 3P0RA 2UKDA 5EIFA 4F3YA 3LPAA 4WBXC 3HY6A 5K6RA 4U6SA 3B1YA 2WWYA 4Z99A 1AB6A 3QVVA 1J24A 1X7YB 2C7VA 2XCQA 3DPUA 2QVCA 3A9UA 3SR0A 2BL4A 2H1IA 2EQAA 1JIIA 4HKTA 4CT4B 4LF6B 4N03A 5HCUA 4JQSA 4QICA 4DYDA 2HBZA 3Q3CA 3QNUA 3UWDA 4RHXA 2V7EA 1VRCA 1DJMA 4BAGA 2QRNA 2A6PA 1E6MA 5KVQA 2PXCA 5CG2A 1IXSB 3ZDCA 1DBIA 4RAOA 4WLNA 2R7KA 5EYPB 4Z9FA 5EFOA 3WGNA 4ZAZA 3CLHA 3ZHSA 5EZYA 4Y1FA 5LNK1 3SZRA 3UMMA 2O7QA 3RARA 1J7JA 1XPOA 1G7TA 1NL3A 1V2GA 2FFBA 1RAGA 2HSWA 3PG5A 4YP6A 3K7EA 4G8JA 4N5DA 3THSA 3X1DA 3PICA 1JIXA 3AR8A 5AW3A 1BMFD 2VIIA 2GZMA 4BMXA 2BFFB 4RLFA 3VO9A 2J5RA 4BNDB 4L2IA 1G5QA 2X6QA 1SXJE 3CNOA 5T3UA 5HG0A 1QMGA 4HN2A 4E5NA 3TX2A 3L6CA 2P5UA 1M8GA 1EFPB 1XLUA 3GO4A 2O1EA 4KO2S 1OFHA 1G4HA 1TEXA 3E9RA 4I5EA 3WFJA 1P75A 2F9LA 3NM4A 5JXGA 2ZXUA 3KKQA 3KKKA 4WN3A 4HNSA 2XADA 4I46A 3TQCA 1ZL2A 2ZJ8A 2ZBFA 1FSPA 3GLRA 1XRQA 5K3DA 5FP0A 5TX7A 3F46A 4D80A 4ARAA 5CDFE 1LF5A 4PPQA 2VRBA 3MD9A 3JD0A 3WLAA 2GRAA 1S8AA 2XBUA 4MR7B 1KOLA 3G9TA 4DSNA 3L93A 2XXBA 4CF3A 1PFQA 3IKTA 1KDYA 2GLXA 2B8NA 2EP7A 2QVGA 4KUHA 1QKJA 2HWWA 2AZ4A 2ILTA 4R8RA 2Q3EA 3E22A 1OILA 3WL7A 4NQZA 4NMWA 3K70D 1O4VA 5LQMA 3A36A 1XMJA 1TU0A 2VJKA 3AR7A 3BIFA 1E4VA 5KOIA 4P4LA 1IUNA 1XXHA 1UKYA 2IH5A 5HFAA 4U39A 2ZI4A 3VU8A 2OV2A 3KTFA 4OOFA 3N8NA 3ND6A 4G8DA 4XFDA 5AHOA 4R7ZA 3L8DA 5IG2A 4ESVA 3EEBA 1Z4KA 4GI5A 3RAJA 1TQ4A 3PXDA 4L73A 3KLNA 2Z3ZA 1P0MA 5JSZA 2DFNA 2ANCA 2QEQA 3FIUA 5EXSA 5NLLA 3RVQA 4BVEA 2VDUE 4EW2A 1QGDA 1L5OA 2I8LA 1FUEA 4KH1A 3C70A 5DJ5A 1PN3A 1PJ4A 2QYHA 3C3YA 1M6EX 3OP1A 3BJZA 1QK4A 1H3NA 2K7ZA 2IS1A 2IPNA 2ZJFA 1Z0KA 3PSHA 1F1BA 3DW3X 3UGTA 3QE3A 3ONFA 2C0PA 2C4HA 3GGPA 4MMXB 1QGOA 4CMKA 5KOJB 3FSGA 1C14A 2RHOA 3DDCA 3GGDA 5EQTA 5CB0A 4X54A 3NBQA 4GXTA 4BQPA 3JQGA 1ZZGA 4LY3A 5HKKD 2R96A 3S1AA 2E85A 2JFHA 3MUNA 3RVKA 5AM3A 5ICCA 4HQLA 1QXSA 3WLRA 3FTCA 4ATNA 1UJCA 4AO7A 3L8YA 5DXAA 4H15A 1QC5B 5BUCA 3IAEA 1UK9A 3OHPA 4ZRDA 5BV0A 1EM8A 2G76A 4U7HA 4BGDA 5IK2D 1W35A 4Z0NA 2HCBA 4KDRA 2I34A 2J3QA 2C42A 5CEJA 4I1UA 5L51A 4GWGA 4MWZA 2CLCX 1RRPA 2PZLA 3M4JA 4Y2UA 3SR4A 1NVUQ 4M7WA 1DFGA 3AKCA 2IZ6A 3ZCRA 3O38A 5EJ7A 5B3AA 1U4SA 1HG0A 5BSKA 1BDJA 1CR4A 1OASA 1A5AB 1K2VN 1EFDN 1ATZA 1XAIA 1VA4A 1IJBA 4O2RA 3E3AA 1E63A 1JDBC 3GJ0A 4UEOA 1WSBA 5HCNA 4M8NE 2IHVA 5H59A 5HR5A 3TCNA 3SN6A 5JH7A 5BVHB 5A0TA 3ZCUA 3SDZA 2QAJA 4KE8A 1YAJA 4AM8A 3C7TA 1IATA 2PFGA 1Z0JA 3I3OA 3FMFA 4IJWA 2Q45A 2V7TA 2X8LA 4LXGA 2C78A 1QHEA 3D6VA 3GEEA 2WHPA 4K9QA 5CIWA 4ER5A 3UXEA 5JZOA 5K9ZA 1PR5A 3FCYA 1FZQA 4KPUB 5CFRA 4AG6A 1KK2A 4EDFA 4ZQIA 4F93B 2QT9A 3WDSA 2P9JA 1TC1A 1ACLA 1DRKA 3GPCA 3KKLA 4A73A 4BIMA 1HKUA 1G16A 1WDLA 2BPOA 5JS2A 4XVCA 4RDCA 4XUEA 4TZ6A 1QFXA 3P4XA 4UE6A 2JI6A 3KJEA 3RANA 3BMXA 1L5YA 2JI9A 5DM0A 3HV0A 3JRWA 4GPIB 1V25A 1EK1A 2FLVA 3TI9A 3DDWA 2GOYA 4R84A 4O2AA 4BFLA 4RTRA 1SQ0A 1K89A 4F1KA 3HXMA 4FJ1A 3VNAA 4ZCIA 2ALJA 3WWDA 4UEWA 2EJUA 4XGQA 3Q11A 1G66A 3KQPA 1GLVA 3UWMA 4ZI2A 1WXDA 5J2UB 4G63A 4ZVKA 3ZY6A 2XCSB 5D01A 4UOQA 2JFGA 3LQFA 1WY7A 4KKXB 2K2WA 4D57A 1SR8A 2FZVA 2ZIFA 2IRWA 4XVQA 2RBEA 3U7EB 1DKOA 5H82A 2XKKA 3V2UA 2XZPA 5F76A 3UWKA 3EASA 4ESHA 3EVCA 1HTWA 1L5RA 4B09A 5C1PA 1A95A 1HURA 4KXYA 4CMIB 3QX8A 4DCGA 3C6KA 1MXFA 3GLHA 3O8QA 3UJBA 3KL4A 4UOEA 1ZITA 4RWZA 4YTEA 4DIMA 4X6XA 2JVKA 4D9NA 4O33A 3AEQB 4IJ6A 2W2OA 3D5TA 3TAHA 1ZL0A 1P5RA 2J9ZB 5I7RA 2LCFA 1PT8A 3C98A 1W59A 1EB8A 4UTVA 4YPVA 2QLLA 2Q3CA 4Y1RB 4OHCA 5AXDA 5C5CA 4A8PA 2AT1A 2IOHA 3PYLA 4YX9A 5D3ZA 1G41A 1DZ3A 2A9PA 2C2OA 4L0CA 2ECFA 1DV1A 2JHGA 1PTJA 3Q6MA 4PU0A 4BE7B 3GRUA 1QP0A 1XVVA 3GPDG 4MAAA 3RC1A 3KHTA 4KQ9A 3L4SO 4WCFB 1F6BA 3DUFA 1EDOA 2CXQA 3CG0A 1GCOA 2M1ZA 4K86A 1P2DA 4WWHA 2O06A 2I6FA 2JCSA 1ZJYA 2M6SA 3L02A 5DBOA 2VOEA 1XT6A 1PFKA 4L9AA 1P7YA 3L0BA 3VR3A 1L7PA 3Q8MA 5FH9A 5CNIA 1FJ2A 2R6AA 2VA9A 1DKUA 2YFHA 2PSFA 3VMFA 2VTVA 4BC0A 3B2QA 1J33A 3CEMA 1WXXA 1M72A 1REQA 1MIHA 2D2FA 3C87A 1JU9A 4EI9A 1WB9A 5REQA 4CW7A 1NU6A 1W94A 2R5WA 4UJ5A 4W9MC 1WBDA 1SBZA 1XX6A 5DSXA 1QG6A 4JWKA 1EBFA 1TM4E 1VSUA 3ZYCA 1JQJC 1N77A 3BXFA 1VA5A 1OTYA 1E3IA 2A9JA 1XZKA 2RH8A 4O4JA 2CCJA 4A91A 1QTNA 2QPOA 1HQYE 3LYLA 4JB8A 4KVFA 4X9XA 5EJIA 3OKFA 4BMNA 5JWRA 1AKNA 1UOPA 2Z08A 4MV3A 3RT9A 4LGCA 3VR2D 2B2XA 4EHLA 5KWEA 5LMZA 5LC1A 1TKAA 1UINA 3CRQA 4OJNA 3O4JA 2Q4TA 2ZR9A 2R60A 5LMNB 4MRRA 4QEZA 1G9SA 2J30A 4J0GA 1J2YA 3AI2A 4LZWA 3ZBQA 4G5HA 2F48A 2FMKA 3VR5A 2WBLC 1XJ5A 2QJTA 3F6YA 5AW1A 3L2OB 3BRQA