3HCFA

Crystal structure of hpnmt in complex with 3-trifluoromethyl phenylethanolamine and adohcy
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Molecular recognition of physiological substrate noradrenaline by the adrenaline-synthesizing enzyme PNMT and factors influencing its methyltransferase activity.
pubmed doi rcsb
total genus 89
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hcfA00
4YUWA 3NVMB 3EVEA 2CKDA 3OCJA 2ZIEA 3AWIA 5GWXA 1VP3A 2ZZKA 1NW3A 3GJYA 2HR1A 3CC8A 4E70A 3FRHA 3HVIA 1AV6A 2P40A 5FA5A 4LG1A 1VE3A 4PCAA 3R24A 3EVDA 1JTEA 3M6VA 4A6EA 2BM8A 1NKVA 3B89A 4QTUB 3UBTA 3NMUF 3FPGA 2UYQA 3MGGA 1WG8A 3FUUA 3HCAA 4V0RA 3T7TA 5LQUA 5HFJA 1JTFA 3R0QA 2WK1A 2YTZA 4C04A 1WS6A 3DXXA 3LL7A 2NP6A 1X1BA 4LWPA 3P2IA 2AVDA 2P3LA 3DR5A 5CVJA 4DCMA 5DLYA 3R3HA 3B3GA 5DX8A 3KPWA 1XXLA 2HWKA 2IDJA 2PX4A 5EZSA 5CIYA 2IH2A 3KQPA 1RJFA 1D2CA 1X19A 3VC2A 3FTFA 2EX4A 5K0FA 5HIKA 2C7PA 2OO3A 3BWMA 4Y30A 5EPEA 1RI2A 2ADMA 3SVZA 3BKXA 3EVFA 4KDCA 2H00A 3EVGA 3G8AA 3HVKA 3LBYA 4G56A 4R8RA 2C7QA 1MJFA 4M38A 3REOA 2B25A 3BWBA 3LDFA 4FR0A 3T7RA 3C3YA 3G8BA 3HEMA 5K0LA 1NW5A 4RV9A 1B42A 3TOSA 2PKWA 2BR5A 4E30A 3KPJA 3I5UA 1KXZA 2R6ZA 3A27A 3KQSA 2ZCJA 1VQ1A 3KQVA 5F2OA 4QTTB 4HC4A 2NNWB 5E1MA 3CVOA 5M5BA 1ORHA 3KQOA 3V97A 1M6YA 2ZSUA 2AOTB 1QAQA 1KPHA 5EEGA 2OB1A 3DLIA 3MB5A 4XUEA 5EG5A 4PYIA 3EMBA 4ZTBA 3GRRA 2EJTA 4R6WA 4E32A 1RI3A 1AQJA 2IBTA 3VC1A 2O07A 8MHTA 3CCFA 5JUWA 2VDWA 1XDZA 2G71A 3TKAA 4QPNA 2ZULA 4KIFA 3HA7A 3LCVB 3I9FA 3K0BA 3GRZA 2AN5A 4RWZA 3P2EA 1NW7A 3G2MA 2AOWA 2OY0A 4GOLD 4OX9Y 1WZNA 4HTFB 5ICEA 5FWAA 1R6AA 2OZVA 2P7IA 4BP1A 2PV0A 5ERGB 1XJ5A 1F38A 3IYLW 4M7RA 3PX2A 3M6XA 4PCLA 5FQNA 2G8NA 3A4TA 3FPEA 4E2XA 4PYMA 1T43A 3H2BA 5KQSA 4AZSA 1N7IA 2AOUB 3O4FA 5DTRA 4C05A 4ER3A 3FPHA 1OR8A 2P8JA 2XVMA 3JWIA 4U7TB 3UJ9A 3EGEA 3FYDA 3L8DA 1FP1D 2C7OA 3O31A 1PRYA 1YZHA 3FTDA 3GGDA 4CKBA 2ZTHA 4F85A 1RJEA 5DSTA 3M6UA 5K0NA 3ELDA 2JHAA 4E31A 3LPMA 4Y2HA 2AVNA 3GRYA 3KPUA 4HGYA 3E7PA 1YFLA 3PT9A 1ZQ9A 1SVUA 4RVHA 1QYRA 4YV0A 3D2LA 5CCBA 4RTQA 3DOUA 4FZVA 5CVEA 3TFWA 4YUZA 3I53A 4PINA 3BGVA 3G89A 3LHDA 2IGTA 2OPBA 3KKZA 3MERA 5FULA 1VL5A 1D2HA 2QRVA 3C0KA 3GXOA 2UYHA 2B3TA 5EMKA 4CXMA 3TLJA 5D1HA 3LCCA 1YFJA 3ER9A 3BGDA 1NV8A 3OFJA 1G8SA 3PFHA 5DXAA 5K03A 5DT2A 2PX2A 4NECA 3TMAA 4YMGA 4KW7A 3EVCA 2YUIA 5U4XA 4EKGA 4RTOA 1P1BA 4LECA 2G1PA 3ANXA 4PYJA 5T67A 4DMGA 2Z6UA 3E05A 3P8ZA 3C3PA 5LQKA 1G38A 3HCBA 1F3LA 2OKCA 5ICFA 2EJUA 3P97A 3MCZA 4MIKA 4XUDA 1RI4A 3PVCA 5FADA 3AXTA 4B17A 1BKYA 5DRTA 1H1DA 4EMSA 4ER0A 4ER5A 4WXHA 2PXCA 3K6RA 3F4KA 4QQKA 1L3BA 2GB4A 3LDGA 1L9KA 4OA8A 5FA8A 4DA4A 4BLWA 2PBFA 4YV2A 4HRAA 2XBMA 4WVLA 1KYWA 2ZIGA 4V0QA 3OU2A 5HOQA 3LBFA 4AZVA 5BW5A 5HIMA 3UFBA 5K0BA 4OQEA 4CTKA 2QYOA 3PB3A 3KU1A 1WXXA 3G2QA 4FSDA 1QAMA 3M4XA 5E1OA 4A6DA 3MHTA 5LQJA 1DL5A 4IV8A 3M70A 3FZGA 4C06A 3DMFA 2JH8A 3KPYA 1ORIA 1SUSA 1Z3CA 1XCLA 3MTIA 1NBIA 3SSNA 4ISCA 2NXNA 5EMLA 1G6Q1 3P71T 5CUQA 3C6KA 4AZTA 3BT7A 2O57A 4E2ZA 4DCGA 5KVAA 3ELWA 1NE2A 3DH0A 3OPNA 4M36A 2AR0A 2PWYA 5P8WA 5GINE 4ER6A 3VSEA 1JSZA 4RVGA 3MCTA 2JJQA 1WY7A 4RTJA 3HP7A 3JWJA 3KQWA 1UWVA 5EGSA 1P1CA 3Q7EA 2AS0A 1YUBA 2A14A 4X1OA 5K0EA 3OE4A 3MTEA 3AJDA 3U81A 3OU6A 1QANA 1QAOA 2G72A 1RI1A 3BKWA 3EMDA 3CJQA 2GS9A 2ESRA 1R8YA 7MHTA 2QY6A 2WA2A 1INLA 3GDHA 3A25A 5IKMA 1JQEA 4KWCA 4GEKA 5DRYA 3CKKA 3GNLA 2BR3A 3SX0A 5G02A 4YUYA 3FYCA 1KHHA 3FUWA 3HCFA 4YUVA 3BXOA 3GIWA 3HCDA 2YXLA 1IXKA 1JR4A 3TPZA 3GU3A 5LQRA 1XTPA 1JQ3A 2Z6AA 1JG3A 3G7UA 2IH4A 3SSMA 5EMJA 4QPPA 4GBED 1RJGA 1UFKA 1NV9A 3DXZA 1M6EX 5K0JA 3EVAA 1KYZA 3UJ8A 1FBNA 2HTEA 1VPTA 2AN4A 3BUSA 5EQJB 2NYUA 1NW6A 5EOVA 2ONYA 1ZKDA 3THSA 5FUBA 2AOXA 3THRA 2JHCA 2P3QA 2B9EA 3R9XB 3LSTA 5E1DA 1HMYA 4PONA 4HSGA 1KP9A 3I58A 1TPYA 4AZWA 4CWAA 4DM3A 3LKZA 2H1RA 3DXYA 2ZWVA 4GOOD 4PIPA 4U7PB 5EZQA 3SGLA 3NWEA 3SR4A 4EK9A 5ICGA 1MHTA 4RTSA 1X1AA 4MWZA 1VBFA 3TM5A 5CCXA 5EIFA 2VZ9A 4OQDA 4EKIA 5LR6A 5T64A 1I1NA 3DMHA 3SM3A 4YV1A 3B3FA 4K6MA 1G60A 3HCEA 3BZBA 3JWGA 4PWYA 3OZRA 2VDUE 2DPMA 3P2KA 1KPIA 4DF3A 4QDKA 2AN3A 3NDJA 2PT9A 1YZ3A 4GC9A 2Q41A 2Y1XA 2B78A 2YXDA 4KVZA 1O9HA 1SQFA 2FK8A 1VLMA 3EVZA 1JG2A 2V7EA 1JG4A 5FHRA 3RW9A 5HIJA 5E1BA 3TM4A 3HNRA 2AZTA 3RODA 3QOWA 3B7PA 4BLUA 9MHTA 3TKYA 4X63A 5EHIA 1IM8A 2BH2A 2OB2A 5DM2A 5LQCA 5MHTA 2JH9A 3DUWA 3KQTA 1BHJA 3EGIA 3O7WA 4RTPA 5E8JA 2I6GA 3NVKI 2ZBPA 1AF7A 2QE6A 2PSSA 1BOOA 2PT6A 4M37A 2O0LA 4BLVA 4FP9A 2O06A 1JG1A 4RTRA 4RTNA 2PGXA 2FHPA 2YR0A 3MAGA 1L3CA 3UZUA 5K01A 2FRXA 5FCDA 2I7CA 1VIDA 1KIAA 4KRGA 5GIOE 2XYVA 5DX0A 5KYGA 5GP1A 2PXAA 1Y8CA 4JXJA 1FP2A 2ZFUA 4R6XA 3UJ6A 4AUKA 4AX8A 2JG3A 5EC8A 3HVHA 3DTNA 3UWPA 4P7GA 1G8AA 4DQ0A 3UA4A 2NP7A 4BP3A 5DX1A 5HILA 2UZ4A 1R00A 4RTLA 4PYNA 2ZVJA 5EMMA 2PJDA 4FT4A 3ER8A 3SSOA 1KR5A 2P35A 2OBFA 2P7HA 3G5TA 1FJXA 2AOTA 2XVAA 3M6WA 1DCTA 1IY9A 4E33A 2C7RA 3NWBA 1ZHFA 2ZW9A 3IV6A 4X61A 4CKCA 4FT2A 3BWCA 2HMYB 5JR3A 3ELUA 2YVLA 2E5WA 3KR1A 2IIPA 3BWYA 1X1DA 1SUIA 5DTMA 4MHTA 2BZGA 2VP3A 5E9WA 5HZMA 5CM2Z 1NW8A 2ORED 2AOUA 4ATNA 2CMHA 4C03A 3FUXA 1JQDA 2DULA 1SG9A 2GA9A 2IFTA 2NXEA 2YXEA 4C08A 3FTEA 3KR9A 1XDUA 3P9NA 4RTKA 3CBGA 5DPMA 5IH3A 3C6MA 4IKPA 5DXJA 1NBHA 4HTFA 1JSXA 5B1SA 1D2GA 3IHTA 5ICCA 1O9GA 4MTLA 2V74B 2OXTA 1EAMA 3MQ2A 5F2KA 3IEIA 1YF3A 4KDRA 4RX1A 2IBSA 3RIEA 5C1IA 3OFKA 3FPJA 2GLUA 4C07A 5T6BA 3Q87B 1RJDA 3PTAA 4DZRA 2FCAA 4PGHA 3G5LA 3G2PA 5EHGA 5E9QA 5C9ZA 3WSTA 3OE5A 1Q0TA 3KQYA 4C4AA 3UJAA 1QZZA 5LQNA 4GUAA 4HG2A 4GOND 3S68A 3DMGA 4RVDA 4RSRA 3TQSA 4XUCA 2VDVE 2PX8A 2CWWA 3ELYA 3PFGA 1R18A 2P1DA 3GRVA 3LKDA 2ONZA 1V39A 4P7FA 3KHKA 3FPFA 3HA5A 4OA5A 4QDJA 2P3OA 3X0DA 3T0IA 3P9IA 5DSXA 3OZSA 2ZLBA 4YMHA 2NXCA 1O54A 5E8RA 4P7JA 2XYQA 3HCCA 3LECA 4OBWA 2PXXA 2IP2A 3ID6C 4XCXA 1Q0SA 2HNKA 3UJCA 4DKJA 3QOXA 2PY6A 4CKEA 1ZGAA 3FTCA 3PS9A 4F86A 5DM0A 3EVBA 1M0EA 5K05A 1L1EA 3CJRA 3UA3A 4R05A 5EKUA 4RYLA 4UOEA 1XVAA 5DTQA 3EPPA 4GOMD 3PLAE 3DLCA 3NDIA 1R8XA 3LGAA 3E8SA 3TR6A 5K09A 4EQZA 2IPXA 5FWDA 3DULA 2HV9A 1N7JA 5CVUA 1EJ6A 2FPOA 2YX1A 3NTVA 2PVCA 2F8LA 1DUSA 2GPYA 2QRVB 3JWHA 3LCUA 2I62A 4YUXA 4OBXA 3UJDA 3KQMA 3GCZA 3HTXA 5HIIA 2AOVA 4L7VA 5KS2A 3NW9A 1I9GA 3PX3A 5K0GA 5LQAA 2BM9A 2ZIFA 1FPQA 3FRIA 3KR2A 5C0OE 3ORHA 1SQGA 4HH4A 4PIMA 4QVGA 2OYRA 1R74A 3G88A 2ZBQA 4QQNA 1XCJA 4PNEA 3P9CA 3R6TA 4RTMA 4R8SA 4MQ4A 3A7EA 5BXYA 4PYOA 3UJBA 4O29A 4PGGA 1VP9A 4IV0A 1X1CA 4KIGA 3CGGA 5EVJA 1AQIA 3EGVA 2GH1A 3FUVA 3GO4A 5GIPE 1NT2A 4Z2YA 4GC5A 1G55A 2K4MA 3LDUA 2EG5A 3DP7A 5LSAA 3HA3A 4E2YA 2IH5A 2WA1A 4E2WA 3ME5A 3HM2A 3OZTA 3KR0A 4FS8A 4P58A 3TRKA 5KQRA 4BY9E 3ERCA 2BR4A 5BW4A 4GF5A 1PJZA 1ZGJA 2QM3A 3VYWA 3HVJA 4PYQA 5DM1A 3QV2A 2H11A 1TW2A 3LX6A 5D1NA 5EEHA 3T7SA 3SMQA 1WXWA 2NXJA 2VS1A 1EJ0A 2CL5A 2ZWAA 3GWZA 5DM4A 4IWNA 5EIWA 5FHQA 4QVKA 3OU7A 2KW5A 3A26A 3GRUA 4ER7A 5DWQA 5E9JA 2IDKA 4X60A 2GAFA 2ZZMA 1ZG3A 3UJ7A 5CVVA 1SKMA 2B2CA 2UYOA 3P9KA 4FGZA 1UIRA 4H0NA 5HEKA 5CD1A 1RI5A 2I9KA 3V8VA 2G70A 3KPVA 3A7DA 3EEOA 4P7KA 2P41A 3NJRA 1EQAA 1N2XA 2UYCA 5FQOA 1YB2A 2PLWA 5BP7A 5K8VA 2ZBRA 4PYLA 3KQQA 4X41A 5K0CA 2LD4A 3CJTA 2CMGA 4LWOA 4PYKA 2Y1WA 2Z6QA 5F2NA 3G2OA 5E2BA 3SXJA 2XYRA 5H02A 4GQBA 3AXSA 2ERCA 1HNNA 2FK7A 3I64A 2ZZNA 1U2ZA 1I4WA 1EG2A 1KPGA 1P91A 5GOZA 4POOA 2EFJA 1EIZA 2JHPA 4FSXA 4F84A 3BGIA 4RVFA 3AY0A 2PX5A 3EEYA 3M33A 2FYTA 10MHA 4EVIA 4HGZA 5CVDA 2R3SA 2O05A 1L3IA 3E23A 3FUTA 5EKXA 5GM2A 1XDSA 1BC5A 4CTJA 5E2AA 2PWPA 1P39A 1TW3A 5GM1A 3B3JA 2YQZA 3B5IA 5FTWA 2N47A
chains in the Genus database with same CATH superfamily
2CKDA 3L6OO 4ZVQA 4R1QA 3BAFA 4R8LA 1V25A 3GGCA 1RPTA 3JXEA 3KYIB 4E5DA 3NKLA 4YCAA 2QQ0A 1R2QA 2VDLB 4FKMA 3P4XA 3TI9A 3RBAA 5AJWA 1NP6A 4LQLA 4LG1A 3RC8A 3WYFA 4KXWA 1NKVA 1E3DA 1F5NA 1UDCA 2YZKA 1EWTA 2GK3A 3T3MB 1J5EB 2QLBA 3JSAA 5A03A 2OFWA 1AUPA 3UJ3X 4UBIA 5SY6A 1VKHA 1ENPA 2PJRA 1C8VB 2VYVD 2YV3A 4R0MA 4HNSA 2O2GA 2C9OA 1H6AA 2P3LA 2QSUA 1FX0B 4I5IA 3HDQA 2Z5LA 4I1YA 2WF6A 2GKSA 2JLQA 3B3GA 3HBFA 5FR1A 4MI3A 2IDJA 2G08A 4WK0B 2FETA 2XD9A 1KDYA 5BQFA 2VXOA 3C7KA 3E7DA 3ITEA 1X19A 3G7SA 4PSVA 1WBJB 2ZTSA 3QFTA 3RSGA 2HMAA 1XQ6A 3ZXXA 3FTFA 3G8DA 3L7MA 1PFUA 2F3TA 3L84A 3O83A 4HS9A 5EYPA 1M2JA 3A3KA 4A8JA 3RUIA 1GPJA 2BFNA 2LTAA 4G56A 4KFRA 3RYIB 4R8RA 1DB3A 2B83A 3BS4A 3LO8A 4DPLA 3KSRA 1R0BA 1W5FA 5A2QA 4KAAA 3CUWA 3LRPA 4KOAA 4XGRA 4E4RA 5I8ZA 4BQQA 5DBIA 1FSFA 5GV8A 4R1LA 3LVFO 5E6RA 3LUKA 4LW8A 1M6YA 1NF3A 1L6RA 3GRKA 2HLDD 1SH7A 1XWWA 1Z06A 4WIAA 5F5XA 4YY3B 4OY3A 1V4NA 1C9KA 5F2EA 3GF4A 1BKSB 2OO7A 5EPUA 3ZHVA 1FNMA 1NY6A 3IT1A 3MILA 2EKLA 3LG2A 4GZ5A 3ZCUA 1XQWA 5DM60 1XD2B 5EY5B 1N5JA 3LOUA 1Y5IA 1W4ZA 5IPFA 5ICEA 3AUTA 2OZVA 3T6KA 4ZCIA 1GZ3A 3T35A 1OFVA 3C5WP 4AVYA 2LDXA 5EJIA 3BFKA 4M99A 5I8WA 1JDZA 1P2BA 2G8NA 3IBCA 4RPCA 3GBSA 4Z3DA 3NTQA 4CR7A 4M55A 1H0RA 2NZ2A 3O4FA 2L18A 3JY6A 3MT9A 5A9RA 1XNHA 1LPNA 3IQGX 5I48A 1Y82A 2VT3A 4M8IA 1ULUA 3QLTA 4JT2A 4TQUS 2Q2NA 2QUJA 4XWGA 5DNCA 3NGMA 1P9WA 3P5BA 1VSQA 3NEYA 4OSEA 4HLUA 3S27A 4QATA 1RJEA 2C4HA 3LGSA 4YASA 1GNPA 5CBKA 2AVNA 3PJFA 2RH5A 4NWIA 4LTDA 2WHPB 1BS2A 1SEPA 2PL9A 2DM6A 3NHBA 5ITWA 1QYRA 2QJOA 3IC5A 1OBFO 3JWPA 1M67A 1WXQA 4JYCA 1E8MA 2G4VA 4RLHA 4RTQA 5J4LA 4N49A 3G1WA 3AIOA 5JSFA 4OHPA 2XYGA 2H9AA 1EJBA 5FYDA 1QV7A 1WZUA 2QT0A 2VPIA 4PZCA 5SY4A 2VJPA 3ECCA 1G8HA 2VSYA 1PTJC 4PVCA 4RHEA 2MSEB 4YX9A 2E89A 3GMTA 3ZGZA 2G5PA 3O4JA 2RGNA 5L3SA 1GZ7A 1XZIA 3ZHTA 1HEYA 4Z5XA 2BFOA 3M49A 5DTIA 4M4SA 4J6FA 1IZ7A 1KYXA 3WK9A 2GASA 1U3GA 3PUZA 4H31A 1L7BA 3THOA 2NV6A 1D1TA 1WUHS 1SG6A 1HK7A 2Q9UA 1W0KD 2O8FA 3Q2KA 3QPUA 2OD2A 2VF5X 2Q9CA 3CUSA 4WXHA 1C50A 1KKUA 1HDGO 4LQDA 4QQKA 5D51S 3OTQA 5CK5A 4DSOA 4OA8A 1RWXA 2RGWA 2JI4A 1FJGB 5ECDA 1SQ5A 3DV0B 2VSQA 4V0QA 1OSNA 2OM6A 5F52A 4YWHA 3RM3A 5C8DA 2VRBA 3OU2A 5HOQA 5BW5A 2QN3A 2G5TA 4X0EA 7REQB 1YVUA 1ZS9A 1K5GA 3C3XA 4K9MA 2D2EA 4IIJF 3TD6A 4JOCA 3CZ9A 3DJFA 4YRFA 1L4GA 4A03A 2ZR0A 2OYCA 2FW6A 2HJVA 3M70A 3DWGA 2JGFA 1SQSA 1UK6A 3JZAA 1Z3CA 3BTSA 1W2GA 3F6CA 3Q3CA 1PT9A 3TX2A 1UL1X 1ZR4A 4NBKA 3UXYA 2HA0A 2FHSA 2P78A 1CNMA 1DKRA 2FW8A 3IE0A 3OZUA 3VQTA 1NE2A 1A4RA 3DH0A 4L6CA 5EIBD 3HXMA 4RVGA 3L7CA 3MCTA 4YP0A 5J63A 4KR6A 2VZ0A 4O08A 4AYTA 1T0HB 1NJGA 4OQZA 4HUJA 1TDJA 3TQRA 2Q6LA 1Y4SA 4R2IA 1DU4A 3MTEA 1WSAA 2JIMA 4J1SA 4QFDA 4BQEA 6AT1A 2PPLA 1E77A 1G8MA 4MCJA 4YJGA 2X4LA 3N86A 4J1QA 3M7IA 3VZCA 3WWYA 3D64A 2WV7A 4ZJPA 2C4MA 2O19A 3KQNA 1DIAA 3UAGA 3ZVNA 3DONA 2CXRA 1GA4A 1L5RA 1SOMA 2CW5A 4KK3A 4ETIA 2OZLA 5IVKA 3GNLA 1DCKA 3IAEA 4FZRA 3QELB 4DCTA 1XZAA 1KHHA 3KHUA 1XD8A 3IDOA 4BGVA 2JFHA 5JZSA 4GUDA 3UCXA 1P9LA 1XV5A 4I3HA 1QF7A 2GCOA 3RKUA 4CLRA 3PQ8A 1EB8A 3E5RA 5JY6A 3MFYA 1T9GS 1V11A 2QTRA 4FYIA 2D5AA 1UFKA 2GTIA 2YYZA 2PBZA 2YV1A 3KZMA 4RFLA 4DUGD 3T5AA 4MV9A 3ZWAA 2OO5C 3OEHA 2VPTA 1RXEA 3N0WA 3LNTA 3K1AB 2WD7A 3U9SA 4JI2B 4DTIA 1L4HA 3WISA 4NBSA 1CF4A 2ZRIA 1J07A 1VCOA 4WKBA 2XWJI 5TMPA 1L8LA 1NBEA 1LBTA 2X9LA 3EY4A 2WHQA 3ZI7A 4EQ6A 2KS6A 1TZBA 2R6R1 4YRTA 1X7YA 1KP9A 5HIAA 1MX1A 1KP3A 2YJ5A 1KNXA 3M0EA 1JILA 3U9TA 4BLSA 4EOGA 5E38A 2CL0X 3GUHA 4PLWA 1VBFA 3TM5A 4ENQA 2ZUEA 1BVYF 3L8MA 1WV1A 3PYMA 3S2UA 4EG6A 1SCUB 1JHMA 1YZVA 1DSSG 2PKQO 2JRCA 2JW5A 4ZWNA 4BC1A 2CE7A 3LL4A 3FIUA 5ALIA 2GZ2A 3DEZA 4KKXB 2VDUE 2QYTA 1O5IA 4PWYA 4Q7LA 1KPIA 1XQ9A 2ZI9A 4MWTA 4GGOA 3UWSA 5LMCA 2JDIA 2YWJA 4S0ZA 4ZOLA 1NRIA 4KVZA 2H9YA 3EVZA 1FP4B 1A9TA 1Q57A 1D1QA 2HXYA 4PFKA 4S1OA 3RW9A 2IXGA 3RYHA 1E59A 5DB4A 5E1BA 5L3RA 1RLTA 4JNKA 4PGMA 4W8OA 1OF1A 4DJDC 2JASA 1PR3A 3NT4A 1EFRD 5ADUS 4TXHA 4B5LA 2XCTB 5FUVA 1BD3A 1H8EA 4C20A 1RJ9A 4EECA 3RSQA 5KHOC 3EPJA 3I2FA 1BHJA 4RJIA 2C4NA 2E37A 1MOSA 4BV2A 4I9NA 1AF7A 2VSFA 2PT6A 2ZIUB 3IOCA 4OLHA 2O06A 1AY0A 3PTLA 4UEJA 3KKLA 1MV5A 3O5AA 1GGJA 4R2WA 4ZRMA 2RHHA 3NFYA 5ELLA 2G77B 3NRCA 4EZBA 4D79A 2QW8A 1GR0A 4NCAA 1QQ7A 4JJKA 5FCDA 1HYQA 2P0AA 4OOEA 4EDFA 2N42A 3N0XA 5GTDA 3ZLJA 5B2EA 2VHQA 1SKBA 4YAFA 5DX0A 5LYYA 1MZVA 3WLIA 1C29B 1VMDA 1U7PA 2WG2A 3CVXA 2HJ9A 1QGYA 2C4VA 2DWUA 2QTMA 1RE1A 2QL5A 2WSYB 2XDAA 1JXOA 3FJOA 1T9GR 3LQKA 3T5DA 3UA4A 4PSDA 4AFNA 2QLJA 4E88A 1N1DA 1UZMA 1NVMB 1VHJA 4LTMA 5HKKD 2YHIA 1RC8A 1RWPA 4BZWA 2IZOA 1L7DA 1MB3A 3KLNA 4JODA 1FP7A 4LTNA 3AP1A 1BVUA 2XUFA 4N8DA 3A9TA 4GRAA 1CJCA 4EL5A 1W48A 4MITA 4XVRA 5CA0A 1PK8A 3K0EA 3VZBA 3K0KA 1CZLA 3NHAA 3WGOA 2BM1A 1QFZA 2B4KA 2IYLD 4X61A 4ZMSA 3PR3A 2W22A 4IDCA 2EQAA 4D92A 4AT1A 2MIIA 4U3JA 3BMQB 1KERA 4UU0A 2YVLA 4ZIRA 3FGZA 4IYRA 5U1PA 5L6MB 5GADl 1X1DA 5ALRA 4YJ3F 3CY6A 3ZCVA 2VP3A 4MHTA 1KSHA 5ALYA 1VRVA 1DBQA 2ZSJA 3EXIB 1D9ZA 3QUAA 2C99A 4A15A 4I9GA 3QV1A 5THQA 3ESYA 1U2GC 3ONVA 1AG9A 1ZC3A 1L7MA 3K96A 3R75A 5B4TA 5K99A 5DPMA 1VJCA 5LNK6 1HMPA 4M1SA 5C46F 2CUKA 4NZNA 1PT5A 2FKAA 2FWPA 3DMNA 3IHTA 3KOWA 4X66B 3V4SA 2HJRA 4MJ7A 4L4ZA 4ZQGA 1DX9A 1BZYA 2R1UA 1Z0UA 3NM6B 4EP1A 3F78A 3HH8A 2V6GA 1ODFA 1RJDA 1UQRA 1RYYA 4FFSA 1AH2A 2A9PA 2R00C 3EQ8A 3KQYA 4BTLA 5D87A 4GUAA 1W49A 1I32A 4AULA 5IK2A 4BCDA 3QX7A 3R8FA 1CS0B 4KQJA 5SZIA 4L2IA 5CLQA 5K2OA 5C32A 1C2TA 1X77A 4FDAA 1TXGA 3PRHA 4P7FA 4QZVA 3IKTA 1G7SA 4OA5A 3PJEA 3X1DA 3HKBB 3ZE7A 2NG1A 3OKFA 5JE8A 2JAQA 2I6QA 2CSUA 5AICA 2R8YA 1RYNA 2NXCA 3UK0A 1SXJE 3PFKA 2YCLA 1M75A 1VHDA 1YNSA 2VYFA 3G0OA 2X9QA 3ID6C 4Q4HB 3JRWA 5CXQA 1YGYA 1ZPDA 2PY6A 4MARA 3JVIA 2J5XA 3NOQA 3M83A 1U11A 1A50B 4TXLA 5CJ2A 1OFIA 4S24A 2AZMA 1W1UA 3O26A 4N12A 3DEKA 3PQEA 5ALTA 1HDIA 1ZINA 2CXQA 2OCAA 2NTEA 1E3LA 1JN0A 3LXMA 2QN6A 3SNHA 2M1ZA 1F0PA 1W8DA 4N0EA 5FO1A 5FP0A 3UATA 3A70A 3ZTTA 3ZD6A 5K09A 5LKRA 1Y7HA 1QYCA 4P92A 1GA6A 1ESCA 1MX5A 3MIZA 4HYQA 2EG9A 3MGCA 1AUVA 3B1FA 2O54A 1HDEA 4NNOA 3PUJA 5IYZB 3OHPA 4PM4A 3EOBI 1U5CA 3GCZA 3U3XA 3NVDA 3O4IA 1G1MA 3BIJA 3AEZA 5HK8A 3ZNNA 1KYYA 3P9ZA 1TEHA 1N9KA 1U2SA 3KVOA 2WE8A 2SNIE 3ZOKA 4CMCA 2CNBA 4IDAA 2ZBQA 5B55A 1XCJA 5EWJA 1N7HA 2Q0HA 1JDUA 2EEZA 4YC7A 1QDEA 1EK2A 4NDAA 3D6NB 2X40A 2YRXA 4IV0A 1A27A 3N28A 4DM7A 3F9IA 1E58A 3N0RA 4C4TA 3OAAA 3HHEA 4BMVA 4CI0B 1DEAA 1UODA 1VJ1A 2QVZX 3GO4A 4DY4A 2P6RA 1P62B 3JSXA 4KO8A 5KYXA 5LSAA 2ODTX 3W5AA 2Q5OA 4AQYB 2QPOA 3WP0A 4I1PA 2MOKA 1G20B 2JJ1D 1EGMB 4L5AA 3PXAA 2Z09A 4ZEOA 3ZEIA 1GPAA 2H11A 3GEHA 1K3TA 1SBZA 1EGVB 3SMQA 1D8AA 1BWSA 2AW3A 3OH8A 1EJ0A 1RHMA 2I71A 1Q12A 3F2VA 3FSEA 3PUHA 4I50F 1PYGA 4ZAZA 1KSFX 2FSFA 2I76A 3WB1A 3HKCA 3OBIA 4M1QA 2GN1A 4M0FA 3VO2A 4FDVA 3BRSA 3UGTA 4DEVA 3UIEA 2GCGA 2ILVA 1X7WB 1M2VA 4XVCA 1MCZA 2Q5JA 3U19A 4P84A 2BGUA 3SEFA 5FQOA 3CRMA 2UYCA 4OI2A 3ZLUA 2J4CA 1YA6A 2NU7B 1FJHA 4Y6GB 1IRXA 2BFMA 2PFSA 5HF6A 2HRQA 3FX2A 3G17A 3HYCA 1L8XA 4R7ZA 4RF3A 4MQEB 3ZS8A 4GQBA 4E1AA 4UHBA 3NBUA 5JXGA 4H0CA 2XADA 4MPDA 1I2CA 5CG1A 3I30X 2ZZNA 1EG2A 3HO6A 2TMGA 3GZ4A 3VAAA 4DR6B 3O6VA 4ZTZB 2H29A 1GXSB 2IPOA 4IJUA 3WKCA 2PX5A 1V8FA 5C7YA 1I2MA 4DILA 2OXFA 1ZEJA 3W05A 1Y1SA 2QE7A 4FC6A 1KFCB 4QOFA 1XDSA 1BC5A 4WN9A 2QJWA 2UXCB 3AKEA 3OA0A 3QRWA 1GPH1 2ZJ6A 1UXIA 4IDQA 1Y3IA 3YASA 3NVMB 4PZDA 5T41A 1DKUA 3BXFA 4I8DA 1VP3A 1Z3IX 2PO5A 1OA1A 2ZZKA 1M1YB 3AEXA 3H5IA 1YL6A 3RHFA 4PN7A 3I12A 5JATA 2FEXA 2XGGA 3NC4A 2ORWA 4MX8A 2BGGA 2QM8A 3FH0A 4R2LA 1KMNA 2AT1A 3EVDA 1JTEA 2QP3A 3T1YB 1UQTA 2Y8EA 4MPJA 2NSHA 3WI7A 1RYHA 3NXKA 2G25A 4M1EA 4QFBA 5JFGA 3WWEA 3BK1A 1FRVA 3RJ5A 3NKFA 1JHXA 3KT8A 1H6BA 1UFOA 2NP6A 3VU0A 4TMVA 4GZMA 3IIMA 4B4OA 5L95A 2CFCA 2IZ7A 2X0IA 2TMDA 3OTWA 3VSBA 4OG2A 2P65A 4PQYA 1E7YA 3S55A 2B69A 4ZI5A 5CNKA 4JYZA 1QC5B 1LK0A 3ED1A 4QXMA 1AKQA 4BKQA 2WM8A 5HFAA 3CO5A 4OTZA 3N3AC 2DQYA 1QG6A 1RMQA 3M6FA 3M5CA 1K7YA 2RCYA 3BWMA 5AOCA 3FWPA 8ATCA 4UQLA 1U0RA 1ZIXA 4YJ2A 3RWOA 3W3ZB 3OKPA 1N0UA 2BEUB 5AKHA 1HETA 3A1NA 4BNZA 4DXDA 3GLFB 3PRYA 2Q1XA 2RBEA 2YBEA 1M74A 5K0LA 1S9HA 1FNDA 4C0KA 5B3JA 4OI4A 1EA7A 1B42A 2CUTA 3TTVA 5EIAA 3OURA 1XQVA 2PJZA 1JYSA 2X8AA 1GA1A 5B3AA 2JI6A 2FQ1A 3FJ1A 1JHPA 1E6MA 3HI6A 4GAEA 4N7MA 3ROKA 3TW8B 3IBFA 2B6HA 1S1MA 3MWYW 3ZBQA 3HFJA 4HBZA 1Y8AA 1ORHA 2QMEA 4MRSA 1UANA 1YAHA 4UE6A 2C03A 5E95A 3V97A 1G8JA 1I6KA 3PVSA 4D9MA 1EXVA 1CY0A 2JFVA 1YE5A 4MVXA 2YFQA 1YR3A 1VPDA 1J06A 3DLPX 3K20A 3CNEA 3M5DA 1LD3A 1YNOA 3DZHA 2YHSA 4MDFA 2OCBA 2PYZA 2O07A 1H4VB 3PFWO 4D80A 2IBTA 2CK3D 3B1VA 2BWJA 1FDSA 1GEEA 4V0KA 3F2IA 2I34A 1V5EA 4PO8A 1ZK0A 3GT0A 1B93A 4MQUA 1NW7A 4RWZA 1R4MA 2ACVA 4RY2A 2D7DA 1M54A 2AQ8A 2OY0A 4AKGA 3N53A 1W19A 4OKSA 3SXPA 2ETVA 3HC7A 2I22A 3A14A 1V7ZA 1VE9A 3N2LA 4R2KA 3DVRX 2AZDA 3JQAA 4KFTA 1Z25A 1O57A 2R60A 3LIIA 1E2KA 2AD1A 4OFWA 2ZRMA 4WZBB 1NXVA 1T43A 1MQAA 5A7HA 1XXHB 3UXHA 2X2EA 1MENA 1WABA 4LCJA 5HRUA 1ENZA 1SVIA 3AVOA 5DTRA 4LCBA 4ER3A 1D7OA 4MS3B 3UENA 3UJ9A 1L7EA 4WX2B 1HKUA 4HN4B 2WIAA 1V16A 4JEMA 4O2BB 4XXHA 4X95A 2YS7A 1WP9A 3REFA 1U6KA 2C98A 5JH7F 3V4VB 1SXGA 3HO8A 3MBIA 1UPUA 3H3FA 4J8PA 3ZY4A 5AM3A 3BJMA 3TLCA 2WWIA 5T5QA 1H42A 2ECPA 3UK6A 2CHFA 4UTRA 2VNAA 3LQYA 1C9NA 1ZNYA 4O5AA 4YP5A 3IEKA 1ZXXA 4OHZA 1M6NA 4TV9A 1KL7A 2GYUA 1NFFA 2I7TA 3BHNA 1P45A 1OKKA 4B3IA 1XZBA 1OVGA 1C9MA 3IXMA 1DAGA 4OUDA 4F4CA 2ZJ1A 3HKBA 1ESNA 3Q9LA 1NV8A 1UPCA 3CRRA 1JPJA 2P9YA 1NQXA 3KKEA 2XMBA 2ZQ5A 1VCIA 2HXGA 3EZ2A 3KZ1E 5F21A 2Q5QA 1RZRD 2FZGA 4F5YA 2BDTA 4G5HA 2WP0A 1GUFA 5T67A 5G3YA 3FB1A 5TQ2B 1B6GA 1ODTC 1UC5B 1DIHA 1YV9A 3PDJA 5ICFA 2M6LA 3TR0A 3RYIA 1A8SA 4IJQA 4ZYWA 1KIMA 3REGA 2FSPA 1ND5A 5FADA 4ER0A 4EMSA 3O8CA 4IHQA 2ZDQA 1GOTA 4S35A 3E7XA 2EKBA 4U5QA 1E0KA 1L3BA 5EWJB 2J85A 1SURA 4RVOA 4MRVA 4IIEA 2HDNB 1P60A 4X6UA 3ICCA 3W79A 1Q3TA 1OTYA 4JBIA 3N2IA 1JFFA 4J3FA 4MR8B 1NZDA 2ZB4A 1Q14A 3G2QA 3F6YA 4KQFA 1ZD4A 3EZLA 5EUQB 3K5PA 4TV9F 3TOCA 3KV1A 1S2MA 2Z08A 3HWWA 2A4KA 5LQJA 2Q7OE 4CQLB 3UH1A 1HOXA 4QYWA 1SUSA 5TT0A 5F3WB 3FKSD 5B1DA 1CY2A 4ZI7B 3WRYA 3S4YA 3DMTC 1Q7GA 1S8NA 3ZGOA 1EM8A 2NUPA 3IPLA 4HXGA 4A8HA 4TL6A 5K20A 4INOA 1IN6A 3H9JA 1UP4A 3L0YA 2DFPA 4CDMA 4UOZA 2RKWA 4HVAA 4AYXA 5EE3A 4BO9A 2PH5A 5B6IA 2JZOA 2L42A 5CDSA 4UM5A 6REQB 1QWOA 1MGPA 4ZZIA 2BZSA 1E2MA 4IMRA 1KVQA 3ASVA 3VKFA 2B37A 2ZYIA 3AW9A 3GLRA 1NI3A 2BTQA 3IPCA 4HDNB 4IIXA 4F9GA 2IS2A 3PQ3A 2W2LD 1P18A 3V9AA 5LDGA 4CLEA 1ODCA 2XB4A 1M10A 3P5SA 1K86A 2QY6A 4JJ4A 4QRHA 4XUGB 5CX4A 4YT5A 4DJFC 4ZYTA 5I7VA 3SE0A 2X9VA 3JQGB 1AO0A 2E1RA 2RK3A 4R2MA 4BVJA 4RMJA 1E2BA 4MINA 1KXJA 2PLRA 1KGDA 3FBWA 1B7GO 4YUVA 1QS0B 4BGUA 1XAJA 1KMIY 1JR4A 1QHHB 2G7ZA 4DLUA 5CHYA 2RONA 1GRRA 2C4UA 3F4LA 4R0VA 1KZ1A 5GJWC 3MJ4A 4CBVA 1FMJA 1OHHA 2W2KB 4QPPA 2HAEA 4E5UA 1EWQA 1T91A 2FPPB 1F06A 2XB8A 3LWZA 1XK6A 5G4LA 4Z7NB 3G59A 1RWMA 2BEVB 4LY0A 2G09A 5HOEA 1AMNA 2FVYA 1U99A 2VCEA 4RPJA 2QR2A 3SYRA 4JT9A 3EOZA 4WHMA 3KYCB 3DF9A 1NF8A 4N5NA 3AZOA 5KDLA 5C80A 3LSTA 1C3XA 3GT3A 1W75A 1T2NA 2KX7A 3KSAC 4B33A 2H1RA 4GLLA 1PCXA 2PL3A 1H9AA 3FWYA 3NWEA 3PSHA 2HK8A 2B98A 5KTTA 2VSXA 5CCXA 1WF6A 4MWZA 3TLXA 3QF4A 4OQDA 1OQAA 5LR6A 1EE9A 2GD6A 3SM3A 1S0UA 2Q5HA 4YV1A 1LFDB 1TCBA 2C92A 3HXQA 2ZJ0A 1KVRA 4OQFA 3LLSA 4TVSA 1MEOA 2HSEA 2IHKA 3JU3A 1EFLA 1SHTX 4FEYA 3VU1A 5IARA 4U3JB 1PDVA 1I3KA 1QCDA 1NVEA 2VWQA 2ZVPX 4IY1A 3N2KB 1O9BA 4GLOA 5FTNA 1RC0A 5JVDB 1Y4UA 1OH6A 1CEEA 2V0GA 5FHRA 3DKRA 1P0IA 2HRBA 3DE7X 3IUYA 4RH0A 4UATA 4TLMB 3TX6A 1TYZA 2FZEA 4DZTA 5LXTF 2JGDA 3WKEA 1A0OA 1IM8A 4IF6A 2BH2A 1ZMTA 1JAHA 2QF7A 2C5LA 3WA7A 3LOQA 4J7UA 1WY5A 3N8NA 2GBCA 3MB8A 1QIGA 3B6MA 1QC5A 2W93A 1SQ6A 4HVLA 5JD4A 4OK3A 5BYAA 4UASA 3O75A 1FP6A 1XZFA 3W0LB 4GMGA 5L51A 3WMEA 1LLCA 1XC7A 2CXNA 2W0SA 3MAGA 4KNWA 1GN8A 4HAXA 4ZCSA 5JCOA 5JDCA 2FLWA 3O38A 1ZUHA 4JC5A 5LUBA 2ECKA 3K70C 1GTRA 3L93A 2RJ3A 2WMYA 3RBXA 3V7NA 3ZHXA 2CCKA 3N8IA 1TVKB 3IJPA 7REQA 2PXAA 2Q7DA 1E3SA 1EK6A 1KKLA 1Q21A 1XKTA 5ALLA 1QCZA 4BLTA 3DTNA 1XZKA 2BDUA 2E49A 4JYPA 3CH5A 3OCCA 2OEPA 2LXNA 4JBYA 2VDRB 2X9GA 3IELA 3FI9A 3KUCA 4P35A 4PLHA 4ALMA 1USIA 5LCXA 4BMCA 4OHMA 4E03A 4YDRA 1V9CA 4U2GA 2VBIA 3MAJA 4QU8A 4TUYB 5DTEA 5K8IA 3BMNA 4GH5A 3TVTA 1M34A 4B82A 4DXAA 4F1KA 1KZ9A 5FJJA 5CB6A 1EP9A 2AOTA 3CG0A 4Q48A 3VDNB 4GOJA 1AK9A 2ZJ8A 2H1WA 1ZM7A 3L9XA 1K3FA 1ZHFA 2QUIA 1DPFA 2GBLC 1F2UB 3TDMA 4M53A 4M6WB 1YQGA 5EJ9A 2PYIA 5LYJA 4HHEA 1ZGHA 1OXXK 3VPBA 4IWYA 2IHTA 3N70A 2C82A 2DCUA 2FQQA 3B1YA 3FLBA 3S6JA 3TQCA 4BKUA 5IG2A 1JEYB 1C4WA 1E5TA 2A1UA 3OICA 1U4OA 3P9RA 2IYSA 3WWOA 3PGXA 4EHJA 1P7VA 4G4SO 3P20A 5AHKA 1YTUA 1I6LA 1ZM2A 2I99A 2NXEA 3C3KA 1UPTA 3Q2OA 4GGPA 2BH9A 3OQ6A 5MDHA 3FTEA 2IYUA 4ZU6X 3I9V6 1X7XB 4PANA 2V6JA 4TRMA 5F76A 1D2MA 4PU0A 4KO3S 5B1SA 4C89A 2JAUA 4J91A 2JCYA 4KXNA 4UAJA 5EWLA 4UPEA 5ICCA 1CXZA 1HQDA 3ZKAA 2QN7A 4RDCA 1F0YA 2OXTA 4J03A 3PCXA 4J7AA 3GL9A 5ALJA 4E5YA 2C5AA 5AOBA 1QGDA 2PIDA 4B75A 2VF8A 5K0TA 2G07A 4GSKA 3ZE9A 1EESA 1YL7A 4K05A 5HDBB 4X62B 3KOXA 2QRNA 3E9EA 3JD0A 4N3GA 3G5LA 4N5LA 4WXMA 2QU7A 1E9BA 5DIZA 5DYIA 5BVGA 3BCRA 1Q0TA 2GYYA 4WFJA 1WKBA 4BZXA 2P3SA 4PO1A 4DBVO 4B3SB 4ZOAA 2PX8A 5SYMA 3HEBA 3DBHA 4WOKA 1AC5A 1I10A 4BFXA 4JOSA 1KVUA 2FWJA 3WK7A 4MQMA 4UUMA 1Y1RA 1Z2CA 3P9IA 3TJMA 2XNKA 3NO4A 1GZ5A 4JGBA 1M72A 1U2DC 3M2PA 1GL7A 1QLHA 2PXXA 1X94A 4F4UA 1W96A 1TC2A 3DLTA 4MTCA 5THXA 1TOAA 3OLYA 4K6OA 1IEQA 4JUDX 4OYYA 4E51A 4OVKA 1DIBA 1RQNA 3V3TA 4C4YA 4J7CA 1GU7A 4HI0E 4NU5A 5DN9A 4RKQA 3EVBA 1AB5A 3FCXA 5JSYA 4Q4AA 3PGMA 1L1EA 4J0JA 2HXSA 3GB9A 1ESEA 2FN8A 2W6CX 2WF9A 1LLFA 3ND7A 5D01A 4A0HA 4UOEA 4EKEA 3TZEA 4X71A 3PLAE 1NMSA 4HGRA 2QRJA 2AXPA 1A2BA 3VPGA 3AB3A 3ZKWB 1COWD 5PNTA 2G63A 3RLFA 5KNBD 4RBNA 5T4HA 4S05A 4IVNA 2X8JA 3PXCX 3V6LA 4AJNA 1ZVVA 4I9HA 3ZDAA 2HU2A 2YJ4A 3BYZA 2FSVA 3ETLA 4WADA 4Z9YA 1Q3HA 3UTDA 1TO6A 2IHUA 4HEA6 1E2DA 2IKSA 1NN0A 1PNVA 2JFBA 5DLPA 3JQPA 3WYBA 4BBZA 3UANA 4EFNA 2VO1A 5LQAA 3ZDCA 1XJQA 3UT0A 3IOMA 3MC1A 3DOCA 1UUFA 1DV1A 1D2EA 4N82A 4WA7A 4WXYB 5LP6A 1XD2A 1OAOC 2A94A 4GXQA 5BN4A 3VKHA 4FMBB 3AB8A 2X1MA 3GFQA 1FRQA 5JAQA 2BRUA 1KDRA 1XX6A 1EZ1A 4E07A 1L1FA 2XVYA 3U0VA 1VP9A 1GNRA 2VP4A 2K5UA 4I1OA 4CMKA 1MO6A 2Q45A 2QUBA 1KOJA 1MJGA 3IP9A 1T2VA 3HRKA 3KL4A 5LLDA 4GC5A 4F2WA 1G55A 1KMMA 3KYDB 3R4VA 2ZETA 2PRYA 2D1QA 4ND6A 5KNDD 5HQ3B 3L1VA 1IFXA 3C4QA 4Q3NA 3KR0A 1RYBA 4JI6B 2JVJA 1YZUA 3T9FA 3ERCA 1JEEA 3A6JA 4LHVA 1Q0LA 3H6KA 1A9XB 2H4FA 3WMFA 1A5ZA 2BF7A 5LBTA 4EF4A 2CL5A 2H5EA 1XRRA 5ICMA 5I9TA 2XCLA 2R96A 3PDIA 2F3RA 3H6HA 1ORRA 4EYKA 4BKMA 2XRZA 3NTRA 3NWPA 4GWKA 3TPFA 4Q4CA 3CPEA 3KB8A 1HG1A 4MVJF 4QUKA 3TD2A 3I6ZA 2ZT8A 2BKEA 3HV0A 5CFNA 3UHOA 1JKXA 1UKCA 4MP8A 3I1YA 3IDSA 3PC7A 3AOEC 1H8HD 1E6UA 5BYKA 4NZ9A 5CA0F 4KAXA 3PL1A 5JYCA 3KXPA 1UDXA 1Q92A 2QL7A 3RSSA 1GAJA 2JIPA 4PV7A 5BQPA 2G1KA 3WO1A 4V1CI 5LXTB 4UAUA 1ADFA 2ID8A 3I8XA 1OH5A 4J29A 1OX4A 5C5EA 2Y9MB 3KIPA 5SZKB 1IYZA 3LQFA 1KEZA 2G5CA 1W1IA 1ADGA 2QD5A 1H2FA 1NF2A 2A1IA 1IJKA 2JHPA 5HX7A 1WETA 1THMA 3AY0A 3Q7TA 1R88A 2W71A 1E1RD 5IJ9B 2QLMA 1E92A 1KMHB 2H85A 1YL5A 4HGOA 2QR3A 1C0LA 2R84A 2VDNB 3K05A 1VPEA 4FBLA 1VDZA 3JQCA 5FTWA 2IE0A 4TYYA 1R6BX 2VJYA 2DCMA 2FPRA 2YWEA 1E1RA 2H4YA 3AWIA 5KDOA 4I4TA 4G5FA 5DXFA 3BXHA 4NENA 3ADBA 2ZRNA 4CQNA 3BE5A 2HC9A 1E62A 5LXTA 1AV6A 4B83A 2AQKA 1VE3A 3IDAA 4HQRA 4ZPJA 3OLZA 2CNKA 2XTZA 1LDYA 1WQ3A 5BSGA 5DBOA 2UYQA 4J6EA 3U3OA 2JVKA 3T7TA 3K8OE 4YRCA 3B6JA 2QG9A 4XW2A 3SZUA 1P9RA 1HV8A 3VFDA 4HRVA 3KJFA 4C04A 4ZVRA 1EVQA 1TTTA 1PJ8A 3PEVA 5I4IA 2CN1A 3HFSA 3FPBA 3Q6NA 4ZRDA 1W7AA 1ELOA 4A8JB 1YE3A 2IYOA 4Z3OA 1PS0A 5JECA 5DN6D 3VR4A 5LM3A 3WA6A 2PSEA 3G6WA 4ZEXA 1HFEL 3IJ5A 3GAFA 3C8HA 1VL6A 2EWMA 3V8NA 3P0EA 1JL3A 3EAGA 3WL4A 1TNDA 2W6IA 4U8HA 5K0ZA 5A06A 2NU8B 1TECE 4QSMA 2F67A 1RWQA 2Z5FA 3E81A 4BX2A 1AQUA 5D5PA 3U17A 4JJ7A 4DIEA 2GEBA 1EPUA 3SKXA 4ARCA 5JMOA 1JSCA 1KHTA 5FTLA 2YKGA 2HDWA 4H4EA 3RNOA 4ZJYA 1V5GA 2HUNA 5B7PA 5JDIA 4QXAA 5IEJA 1GG9A 2AWNA 2HBQA 3CVOA 3DFIA 3SZGA 4WCVA 4P31A 2PE5A 1PWEA 1TJ3A 2XGJA 5HF5A 5IDWA 1H9CA 2VIIA 3HKDA 2OL4A 4ZTBA 3GRRA 3L7BA 3PQCA 1JIVA 2CY0A 3GFPA 4GECA 1GRVA 1M0WA 3AVXA 2IS1A 1VPVA 3TYXA 4TVBA 2I1QA 4PHCA 1G5PA 2ZULA 3WKBA 3GRZA 5MGNA 2ZG6A 4ABTA 3FIJA 3Q3IA 4TL7A 4Y6QA 1X3SA 1L5QA 1Z6AA 2ZI6A 3FYUA 1PQYA 1J7JA 2WC1A 2SBTA 3ZBUA 4HATA 1JA9A 3M6XA 2ZYAA 4CE6A 4P9NA 3W2FA 2IWRA 1OPXA 2I6XA 3ILYA 2DH6A 4F2HA 4YJFA 2CSXA 2HDHA 1O97C 2C83A 3LQRA 2YMPA 2RKOA 1FP1D 1ZOIA 1BE1A 2V4UA 5KJCA 3KK0A 3AI7A 1R9JA 2RCNA 3OFNA 1YHYA 4PQEA 1YZHA 3DVQX 3LX4A 3LPAA 1ABEA 4V0MA 1JZTA 1DOAA 1KMQA 1QSGA 1XVTA 2X3FA 3HXKA 5AK6A 1F2VA 3LPMA 4G4JA 4KWIA 4F4JA 2DTEA 2I3DA 3VR2A 1HSOA 4AJ4A 1Q84A 1VL0A 1SIWA 4B79A 5ITZB 1WR8A 4HUQB 4MDEA 4FHDA 4TXNA 3UGQA 4HYYA 1N6LA 5FRDA 4TTPA 5J1TB 3VDMA 1FSGA 2X5NA 4J2OA 1OZ0A 1U6JA 4JLVA 4QAQA 5C1OA 2G1PA 1FNNA 4YP1A 1QH8A 4LC9A 2E9SA 1DIRA 1RRFA 5D1HA 4HNRA 4TS9A 3AI2A 3SF0A 2IUTA 3IODA 2XW6A 4G23A 4DKXA 1CLUA 2UYYA 4REQB 5FBQB 5DOZA 3EODA 4PPYA 3ND5A 2VHZA 4H7FA 3WZ2A 3AUXA 2C2GA 2PN1A 5AJVB 4KAJA 4AB1A 5BSVA 4ED9A 3PIRA 2VJBA 3CHYA 3GOQA 2IXFA 3KLBA 4F6RA 4LX8A 1QX4A 1P81A 4JBHA 4MVJP 1RRGA 1W34A 3E9CA 2EJUA 1P4SA 3Q2IA 4KITB 3CMCO 4NABA 3W5UA 1OKKD 2ST1A 3IKLA 5T4BA 2WJ4A 1F20A 2FPKA 1FDIA 3ESRA 2QGZA 4CVNA 1AK1A 4IO0A 2JLUA 2VFAA 4LHSA 1XJWA 2ZPUA 4RK0A 4CQMA 2KYRA 4K0RA 4N40A 1IXZA 2GJ4A 3B9BA 1XDGA 2GRUA 1BRMA 4N01A 2JCBA 1H8ED 4B1FA 4HRAA 2WTBA 4TMFA 2ARKA 4WVLA 1AKYA 2EKZA 4YNBA 3U4CA 4CM4B 3HACA 1GGFA 5JPIA 1FVOA 3UFBA 3ZZMA 5EIEA 2GPSA 1MZPA 2V0NA 4LYDA 4BLRA 1I1OA 1SR8A 1IDOA 1Q91A 1TI7A 1SD2A 1USVA 4DJAA 4A6DA 1P7YA 1I7QB 1XWIA 1DL5A 3EDCA 5UKDA 2PRJA 1ZJJA 3K30A 1A77A 3OJLA 4WNYA 5CLFA 4O2AF 2YRWA 3S7TA 1YB5A 3B8HA 2J6HA 1NDHA 4ISCA 3R3ZA 3LPLA 2QS9A 4FC7A 4M22A 2Y1LA 4E5MA 3L6BA 1D2NA 2GCIA 3F7OA 4GWGA 3RS7A 5ICSA 1AX9A 1K75A 4TZ6A 1TVEA 3CZ4A 2QRKA 4M1ZA 3WMXA 4M36A 1RAIA 2PLNA 3KJHA 2R751 4YIKA 2GERA 4EAQA 1H1LA 1K5DA 2ZRDA 3WNCA 1A9RA 2IODA 1YCFA 3EASA 2O23A 5CCEA 1NT4A 3AR5A 4JB3A 3WRXA 1G4UR 2NVOA 2X4GA 1XZCA 1P73A 3KZVA 4GPTA 2WQ7A 2ESRA 4C7JA 5KOYA 4RIGA 2WM3A 4D9CA 1U28C 2GAOA 1ZUIA 3GDHA 2O7NA 4GOKA 5TPWA 4CV0A 4EKDA 1GARA 5IKMA 1O0CA 5IEBA 4BFSA 4N6GA 3A04A 2W2TA 3LHIA 4F1JA 4IHJB 2ZE5A 2PGAA 4YPFA 4BNVA 1EXMA 4LVCA 3DC2A 1JG3A 1P1JA 4DW8A 1AKNA 1QORA 3QVUA 2G80A 4CL2A 1AUQA 4KXXA 1I4DD 3ITDA 2C7VA 2H65A 5D85A 3NHLA 1Q77A 1PSWA 2CJWA 1KYZA 4FYXA 3UWDA 4B87A 2I55A 3IO5A 3FROA 3OT1B 3DTTA 5DGHA 5EQJB 2JGEA 2WYWA 1FUKA 2A1TS 1M73E 2ZUBA 4ZT6A 3W4JA 3PX7A 2P30A 2AOXA 2JHCA 4YRGA 1P19A 1CR2A 1E1QA 4K6HA 3QVKA 4Z1MD 1MVNA 3O8OA 4QU0A 1IMOA 3UWKA 4S1WA 2P2NA 2CFSA 3L7IA 1P5RA 1TQ6A 1XRNA 5B5SA 1DJLA 2G9UA 2A88A 4ND8B 3R6GA 5CT9A 1VZ2A 5T64A 1CU1A 4G36A 1N2JA 4UUOA 2OK7A 4B2IA 4HV4A 4YPVA 2XOEA 1RQLA 3JAWB 3KJGA 3W5BA 1MAHA 4H35A 5A5FA 5L8VA 1XFAA 4DR3B 3L5OA 5KAPA 2QENA 2ZRPA 1YBHA 3GWGA 2B78A 3DDSA 5K8UA 3INRA 2EU8A 4D82A 2RAVA 4X45A 2W6PA 3RODA 3DVLA 1XMJA 2DLNA 5F77A 2FLKA 3KKMA 2WZQA 1CQJA 3DBIA 2J08A 3MUEA 4DG9A 3E2PA 4XD7D 5KNCD 1QDLB 1CIJA 3KKNA 1RWKA 2RDMA 3PA6A 3VI4B 3QOYA 4L0MA 4TKZA 5IZCA 2IU3A 4YCJA 4YJDA 4RMNA 1JDTA 1RMYA 4NG4A 3QMPA 5F5LA 3V8QA 3M4ZA 1B8VA 3BD6A 2FW9A 4H17A 4FP9A 1P77A 2WTNA 1GPMA 1T9BA 4HNUA 2QAJA 5I7RA 1DIGA 2PGXA 3K73O 4C4ZA 4QTYA 4QXOA 1GNQA 4B6QA 1LY1A 2PUJA 2I7CA 4X3OA 5CFRA 2EFGA 3M5PA 3WLOA 1SK8A 2VA9A 4Y9RA 1OW3B 1KORA 4UW9A 2HCTA 5KOHB 2IGBA 2EP5A 1QIDA 1GTVA 2OOSA 4PAOA 3RYTC 3OQOA 3LRXA 3IKJA 4P7GA 3PQDA 4HVTA 2AI2A 3DS8A 3QXCA 4A73A 4BEWA 1LWNA 4YFYA 4ZO9A 3CIFA 3OPYA 4WAUA 3I9LA 2ACWA 5HILA 1DG3A 4Q1AA 1Y80A 1N34B 4LF4B 2JA2A 1NSYA 3FUCA 4JBLA 5ALGA 1UM9A 2P4UA 1J09A 1SEVA 5IU6A 1OY1A 1FJXA 2NU6B 4NPHA 1CRZA 3GUZA 4GLBA 3MOGA 5ER9A 2IS6A 3L7LA 1N75A 3K1ZA 4MVJG 3IDQA 4MDHA 4TT3A 1UBSB 3H5AA 4YCBA 1DTWB 4C2TA 2B9VA 3DO5A 5HGJA 4E2FA 2E5WA 4UXIA 1ZIPA 2IIPA 3BWYA 3NOXA 1E1MA 1XEFA 3N7UA 3NUZA 3QFHA 1UFQA 4TMXA 3WFJA 4MGEA 2A1UB 5EHXA 1AA6A 2HT1A 4ZO6A 1UJ2A 2AOUA 4ATNA 1Z5VA 2WFAA 4B3HA 4IAOA 1U28A 4EG3A 1U1IA 4XYBA 1FTYA 2FZWA 3COYA 3P9NA 2O0MA 4IVPA 4R7TA 5H4GA 4II3A 4DDHA 4HTFA 2ZU0C 2WU1A 3QBTA 4UHDA 2IELA 3H5LA 4A3SA 2IY8A 2RAFA 4N6NA 5JANA 1FXSA 2HHCA 3C3MA 1DAKA 3D0OA 1CQJB 3MLEA 4JLNA 4MP6A 4UM7A 5BWOA 1IEWA 3GJRA 4G9GA 4DG5A 3IEIA 4PG6A 4IHJF 4DCUA 4RGBA 1H0SA 2GLUA 3DHEA 1C3EA 4AMUA 2BI8A 3L01A 3OLVA 1MQ9A 4B2LA 1PFQA 2YQ4A 1CP2A 1T9CA 2FCAA 2EZ8A 3ROXA 2LIPA 2PGNA 4BNMA 5LB2A 5FEUA 1BYUA 3UT5A 1BE6A 2E48A 3G3EA 1WBDA 3ET5A 1DBRA 1VMIA 2AKEA 2XCIA 2AR7A 1BEEA 1Z8DA 1JA1A 3WGIA 2EIHA 3ZWOA 1CR1A 1Q7RA 2NT3A 4XUCA 2CWWA 2VKQA 3JX9A 5AVTA 1Y6FA 1N5RA 1WOYA 3ONNA 4LVOA 5ED4A 4YONB 5LU8A 4IIUA 4GXNA 5EFZA 2XMZA 2DFNA 4WLVA 4NV1A 4C0WA 4HYEA 5KB3A 3CH4B 2NGRA 3CB4A 1P3JA 1HQKA 1H94A 1Z26A 4ZQHA 5HMMA 1IUOA 1QHIA 4ZI3A 2HNKA 1ICEA 1RYMA 3VSCA 2DSNA 4L5CA 4M8SA 4E14A 3FFAA 1Z5PA 2CNDA 3BL8A 4OXQA 1USWA 2DWQA 3CEMA 3EZYA 2PTHA 4O2BA 1OTXA 2ZK7A 4UNNA 4D56A 1U2DA 2QK4A 1DZ3A 4WW0A 1T4CA 2ZBDA 5AJZA 4X64B 4C5AA 1Y1LA 3AIKA 2TMKA 1R50A 3PQ5A 3NHKA 3SIRA 5CXSA 3DMDA 1KAOA 4MW1A 3BRCA 2QJFA 1ODKA 1TADA 1NPTO 3JQAB 3VHRA 1FK8A 2XGMA 4DSTA 5KYXB 5BSKA 2IX3A 3EWSA 1D7AA 1G7TA 1I7LA 5AVSA 4NCBA 1R4MB 2GPYA 2QRVB 4GR4A 4K8RB 1UF9A 4OBXA 2QD1A 5JQWA 1T3SA 4G85A 3PHBE 2Z43A 4KPUA 5HIIA 3S0JA 3T3EA 1JU9A 1X1RA 2ANCA 3SFZA 1NDUA 3AU9A 2P9CA 2JFYA 3QU2A 1R0ZA 4YAOA 3V7FA 5FV7A 3WTBA 3T0GA 2O8BB 3HZOA 3IVMA 4YK7A 3WAGA 1I8TA 3I6BA 2HF9A 4CZ2A 4IFBA 4CMBA 3DT8A 3SHVA 1K98A 2J6IA 3JALB 4M54A 3C1AA 4BN5A 1G2QA 1S6YA 5BUQA 5D7NA 4Z2YA 4ZP1A 1PUXA 2VJLA 4DMCA 3GJ0A 4U7WA 3COJA 1QHGA 1A7AA 1MDFA 1SKQA 4ZICA 4H3HB 1DEHA 3SR3A 3ME5A 4ZC8A 2GXSA 4FS8A 1GQFA 3UAXA 3L8HA 1DKQA 3DE3X 3A10A 4CM1A 3CEJA 3AK4A 1TTHA 3UUFA 4DE5A 5BXQC 3JCZA 3SK0A 4V1CB 5JG7A 4ITVA 1XBTA 4IZHA 2A0UA 5AVKA 2XB2A 3LX6A 3U49A 3UC5A 4N5HX 1YJBA 4LDPA 1G7CA 2ZWAA 3I9NA 4IWNA 1RC1A 4UHJA 4C0QC 3GRUA 4U6QA 3KUDA 3ZD9A 1IJEA 5SZHB 3CNQS 1G0OA 2EL7A 4P4UA 5TS2A 2IOHA 1WDTA 1H2XA 2QD3A 3IVGA 3NONA 5AO9A 3U3DA 2UYOA 4I9UA 3CRW1 4G01B 1TKRA 4RW0A 4CQMB 1SKMA 3W7AA 4E0BA 5CD1A 1QG2A 1RI5A 1ZIOA 3IKMB 3O9MA 4JB0A 5CT4A 5IT0A 5EL0A 1P3DA 1U31A 3D3NA 3DOIA 2RI1A 3GGOA 4ZCMA 4RQUA 1P4AA 4JROA 1UADA 4MS1B 5AESA 1JR3E 1M6WA 3U4QB 4ZZ1A 4I4IA 3VPCA 4ZOBA 2G06A 3A28A 1PQPA 4WEQA 2V9PA 4BVGA 2CZQA 2JIQA 2QUZA 2EBHX 4TYWA 1GEGA 3DO6A 4D3SA 4DDWA 2IC5A 1EIZA 3KVRA 1USUA 2O5EA 3E2IA 3ROFA 2HH9A 2BKAA 4G26A 3ZUPA 3EEYA 1WDLA 2FG7C 1ISSA 2J3DA 3FGOA 1JS1X 1ZK2A 1UEIA 3KQUA 2PM8A 4TWAA 4EA9A 4AX4A 1XZLA 3GH3A 3DKVA 3HU5A 3TQQA 3TG8A 4YRAA 2JLZA 5G41A 2QMYA 5EPOA 5GONA 4YUWA 2CKMA 4YBRA 1JI3A 2PDAA 4EX6A 2OFFA 1NBMD 2VR1A 1A97A 2DUNA 3DB1A 5FXMA 3G68A 4A10A 1KC1A 4G0ZA 3QVMA 3ILHA 4G37A 1U3TA 1ZDMA 1COWA 2OV3A 4DAOA 2GF9A 1OX5A 2BM8A 5AJUA 2AN1A 5EKTA 3RYFA 3ZNOA 4BO8A 1E4EB 4B7CA 2L69A 1HLFA 3UBTA 1T0JB 2J3MA 4MW0A 2XTJA 1WSWA 2A9JA 3QYJA 5AI5A 1E7SA 4Q4LA 4V0RA 3GUVA 4OI1A 1T9ZA 3R0QA 3BMCA 3K16A 3EQZA 1TA4A 4OHFA 1RACA 1Q0RA 3AFIA 3LUJA 5J4KA 4LF9B 1M5TA 1JFVA 1FFDA 5CLIA 3RRFA 4J2HA 1NMEA 3NAZA 1M1NA 3S2SA 1XXLA 4RY9A 4C0BA 5HE9A 3FA2A 1V1MB 2B0JA 1RJFA 4MH0R 1RM0A 3D0KA 1XQYA 3HU1A 3IEUA 2VEDA 2IUSA 1TJ4A 1ENYA 2ZM6B 3H19A 4DNQA 4PC7A 4EX7A 3OCWA 4B3FX 4R1PA 3P2YA 3GGGA 5JDIC 3OIDA 3W2HA 2IVFA 5FOTA 3WYDA 4FHCA 1NVXQ 1U8AA 4FR0A 3JWEA 4G89A 3HEMA 4JJFA 3RDPA 3URKA 1NW5A 4MW6A 2V59A 3WGZA 1K92A 3X2SA 4XD2A 4F9FA 4RD0A 7ADHA 3E1SA 4UD2A 4ZDKA 3AOGA 4CMIB 4O1MA 2BTOA 3ZWWA 2Z4RA 2F3UA 1NU8A 3BHJA 4G1VA 4GI2A 2I2DA 2WTEA 3FNBA 4QFCA 5FTMA 1A9QA 3CG4A 4DIMA 3CYFA 5EEGA 4KR3A 3QNMA 4OJKA 1PD0A 3WLQA 3NIGB 3NYQA 1QG0A 5EP4A 4MWDA 3RC3A 3MJRA 3FETA 3ESCA 1AQJA 3FMPB 1ZBQA 3WGKA 1JFSA 3AQ4A 5AW8A 3VI3B 2CEKA 4D4LA 3MWEB 2JD2A 3DZFA 4JBWA 1SG0A 3EGCA 1PJAA 2FPXA 3UMCA 3M34A 3BD7A 1SOWA 3H3XA 2NMVA 1C80A 3GA0A 5DT9A 4HTFB 3WL8A 2AKYA 2R65A 3HB7A 3I4FA 2QV7A 4EPXA 2B6NA 1Y1TA 2QSYA 4K2HA 2HMUA 2HTFA 4EYOA 1GRNA 2XJ4A 1QIEA 1GGMA 2A0YA 2JFQA 3BICA 3H2BA 3KT0A 1PR0A 5AJHA 2AOUB 4YLGA 4Q03A 1YRQA 1O87A 3K1JA 1TAGA 5IDQA 1NSTA 1Y34E 1RAAA 2Y77A 4JYMA 4QREA 3EDRA 1NATA 1JXMA 4GPBA 4LE1A 3BEOA 1ZM4A 1XPOA 4QJIA 1JDBC 3B6KA 2I4RA 1PWZA 3H84A 3CE9A 3EDYA 5J5VA 1I6MA 3R7NA 1LU9A 2W70A 4DR1B 3OZCA 4QFMA 2GCNA 5AVYA 1R6XA 4B4KA 1L8QA 1ZQ9A 5C4IA 1SVUA 4Z99A 1T4MA 4BB6A 4QBHA 4LZZA 2C31A 4R1MA 4CCSA 1N6RA 1R8JA 3AESB 4HDMB 5TT1A 4A1FA 4YRSA 3GJ6A 4HNTA 1CUZA 1WDMA 2IYVA 4JA2A 4ND2A 3O7MA 3QEMB 3MERA 1VL5A 1ZXLA 4P33A 1T6YA 1YJQA 2DF8A 3QY9A 3AHIA 4NS4A 3PTZA 3U31A 3ULKA 4LNHA 4O3FA 3FNFA 4FDLA 1P2UA 3DFMA 4L3OA 5DV9A 5HCNA 2BZ0A 1SXJD 2NPIA 3GELA 1ZSNA 3AR7A 3N1UA 2WJPA 1P1BA 4LBZA 5JWHA 3SLRA 3ZHRA 5TQVA 2BF4A 2C5FA 2OUIA 1XG5A 1YQEA 3FCYA 3L49A 3T0FA 4ZDJA 1WXHA 9ATCA 5C7OO 2OKCA 4UOQA 3VU3A 1I7SB 5AW5A 1SHLA 2PQ6A 1XVIA 3P97A 4IH1A 4QUIA 3KZOA 4I81A 4R16A 2RMKA 4ZVVA 2M32A 1XEWX 5F12A 1N9GB 3G1TA 1LW7A 1P2FA 2IDMA 4COOA 4EW6A 3P94A 2FCRA 5CYGA 2QLTA 1PUJA 1YR7A 4ZEMA 1CR0A 4LJ9A 4JLMA 3RG8A 2P0EA 5AW3A 2QROA 3TQFA 2VJCA 3C2QA 2JK1A 5JD6A 4BFZA 2WHYA 2YIMA 3IX7A 4OHBA 1F17A 3VVMA 1H4QA 2FMIA 2XXAB 3C5EA 5GMOA 2UZ1B 3BD8A 4X8OA 3BGSA 2DUWA 1PN3A 3TOZA 1IG0A 3HY4A 3TINA 3FZGA 5GGYA 3L6DA 5BWMA 1C1HA 2GRAA 3G9QA 1N2SA 2QG4A 3V9PA 3JAWA 3V2GA 2P8SA 1WD7A 3UXMA 5LQMA 1M6VB 4BX3A 2R86A 2VRCD 2Y67A 4ND8A 3ELWA 2J32A 1XIVA 3OUZA 4XH9B 4ER6A 4CEJA 2OT3B 6REQA 3C5CA 3B85A 4O1HA 1N2HA 4QUDA 1GIAA 2VRWA 2IK8A 1KEPA 4URUR 1QAOA 3B7WA 5FPHA 4R2XA 3Q5GA 2AX4A 3E9NA 3PNVA 4JVMA 2FMTA 1GQ2A 2CLSA 2H2DA 5F4BA 5J43A 4HGQA 1CFZA 1F8FA 3J7AC 4GI5A 3DDWA 3D9QX 1CJKC 2GHTA 3GPDG 2BKLA 3KQLA 3QMMA 1XELA 3QX3A 2SCUB 4J9UE 2GX6A 3GIWA 3UKDA 4CKWA 3ICVA 4I1IA 5F7JA 2A2ZA 1G59A 2AFIA 3GZNA 4QNRA 4JI5B 4C30A 2X8JB 1G8GA 2ZCUA 4O25A 3SKVA 4V1CA 5FJIA 1WVMA 1BFUA 4ME6A 4WOCA 3M1IA 1C7QA 5ULLA 5HZHA 3DSRA 2GK4A 5IWAB 3JPWA 2B20A 4EW2A 5ALZA 2ZM5A 1OH8A 1HKHA 4P3XA 1FBNA 2HTEA 5EQTA 2AN4A 4R3NA 4F38A 2R5NA 3MUOA 2FW7A 5IBQA 1PNOA 4JJIA 4YCDA 2ZYWX 5FOWA 2HKIA 3KCQA 1GYRA 2ZJAA 3EAFA 4EFKA 3QKWA 4IIGA 2HGSA 1TPYA 3GFOA 3HDYA 4FHGA 1J0AA 3KX2A 2XTMA 4GYWA 2C20A 4GP9A 4LJ5A 3EG5A 4WVFA 5DGCA 4QOGA 5ICGA 3H4IA 1SCIA 2V8OA 3IEVA 1ZN2A 2DFTA 4EKIA 1Z5GA 2QX9A 2RH4A 2JAHA 3B3FA 2V9CA 1VGRA 5JDCC 5KNDA 4KACA 5FB3A 2YWHA 5KNBH 4L16A 3QI7A 2WNHA 2F3SA 1S2DA 2AQHA 2QDKA 3BZBA 2C2KA 1X7YB 1KRHA 3BREA 2DPMA 3HXTA 3QQPA 4HKTA 1PX0A 2AN3A 2RGXA 1QK4A 3O2JA 2D2VA 4DF3A 3L02A 2PT9A 2VAPA 3KOYA 4EHBA 1QIFA 4OXIA 3HJCA 5EWMB 1LEHA 1O9HA 2PBRA 1MAWA 4X5OA 3AHGA 1T9DA 3LX8A 1ZJ5A 2DX7A 4JOQA 4KQMA 4CT0A 2O50A 4GLJA 1CB7A 4IP0A 1PFVA 1R6DA 4INZA 1IWPB 4J07A 3UAZA 1OYOA 3HWX1 4Y2VA 1QGZA 2X0RA 3CRQA 4RL4A 2DR3A 4ZT2A 1CEYA 5HM8A 1I5RA 2YJ3A 2B1GA 3HBLA 2QQEA 3G82C 1BKDR 4IFIA 4REMA 4EB6B 3OLWA 4BASA 3T94A 4CLRB 2IHJA 2DPLA 3DL7A 4HWTA 2TECE 2YZ7A 1QONA 3W5JA 3QWHA 2AE2A 4IXMA 2QL9A 4Z9FA 1K3UB 2HIMA 2H16A 1KMCA 1CS0A 2Q5CA 4S2UA 4F1WA 2ZTLA 1E3EA 1TLFA 3SHTA 4UVIA 2KBFA 3RVPA 5C8VA 4OQQA 5C35A 2WUWE 1LSSA 1SXJA 4K1XA 4QICA 3I8SA 5JYDA 3B12A 1K7CA 1WDKA 1Z4OA 2L2QA 4HGPA 4Z9XA 3PE4A 3VAZA 1UWKA 2EZ9A 3MM4A 1I4TD 1P0FA 4FJ2A 5E4TA 2I1LA 4CKEB 3P26A 4HQKA 4MK4A 3WK8A 3BMNB 1I3CA 3SSOA 2P35A 2I65A 5LZ7A 4DIUA 1FQKA 3WC4A 1SKUA 2Q5EA 3FDFA 3QEJA 5AUPB 1QJCA 1XZ8A 3OCUA 4YUAA 5AI4A 2J7KA 1M8GA 3ROTA 1GYPA 3IV6A 1FYVA 4OXNA 2A5GA 3NBFA 3OJEA 1KDPA 3KHTA 1T8SA 5HUJA 3LS2A 1WCIA 1D07A 3NFRA 3AJ9A 4XM1A 3JYLA 3QBEA 3UN1A 3VZDA 2PRIA 3L07A 3T5TA 1PJSA 4X1KB 2Q2QA 3CMMA 2EGUA 4L8VA 4DR5B 1ADJA 1R6UA 4CN8A 3U4DA 4NK5A 1SRQA 3WMGA 1U98A 3BXPA 4C9BA 2O2XA 3AHHA 1FLAA 4D2IA 2NU6A 2CB0A 1CZOA 1KH3A 4G67A 3CLTD 5CTJA 4ZO7A 1ZMBA 3EDMA 3H0EA 3O8QB 1F6BA 3DHWC 5BORA 5KPDA 2FPGB 3EW9A 1DFHA 3PENA 4TWZA 3AR3A 3UY4A 3MPOA 5AUQA 5EP1A 3H7IA 1GNTA 3G7NA 1EAMA 3LUDA 5AOVA 3EC7A 1JFTA 2VDWB 1EINA 5ADWA 1GRQA 3IUPA 2VYVA 2VH5R 3K0FA 1CHNA 5U4QA 1Q3KA 4MLCA 4KGVA 3VTZA 1OIWA 5CT5A 5F5NA 1P5FA 3MMXA 5H7XA 3R76A 2FR0A 3OHSX 3OPYB 4GE0A 5CDYA 3GPIA 3W06A 4D0NA 4NLLA 4XCQA 4KG7A 4FDUA 1R64A 3S68A 3U4AA 5ALSA 4UFOA 1S3IA 3LVRE 5K51A 5REQB 1XA3A 4BBJA 1ENOA 2VF7A 1HF3A 4Y9DA 1MVOA 4F3KA 2B8WA 2GA8A 4ZZ3A 1M6VA 3MT8A 3ZIAD 1KA9H 4JXZA 1KRXA 2ODAA 2NU8A 4FYKA 2WTMA 3LWBA 3MUFA 2V6MA 1UKVY 1PR2A 4MQFA 4MUKA 2DZDA 4Z86A 2BGLA 2LZ0A 3DT9A 1LF5A 1ZWKA 4LMPA 1CLEA 4AZ3B 2DYKA 2ZOSA 4EYSA 1W47A 3LC1O 5CR9A 2O4UX 4WJZA 4UUAA 3KYCA 4JDPA 5KTOA 3FTCA 1ZONA 2WDZA 4MR7A 4C87A 3V00A 2F17A 3LXXA 1Y37A 1ZIYA 2BGKA 4O2RA 5FPQA 4ETWA 2BEVA 3VTFA 1HLPA 3DE4X 4O2BF 4KE8A 1SHUX 2C95A 4LNUB 5KTPA 3ASYA 1TEZA 4DUGA 5KO2A 4OIMA 5LL6P 1IN8A 3AEQA 5ALHA 4B8WA 3V4FA 1U81A 1X8LA 3MJTA 4H3SA 1MABB 3U4HA 2B30A 2FY8A 2VHEA 4LJ6A 3VNQA 1OXSC 3NHYA 5JWOA 4K26A 4QXPA 1HC7A 5LP1A 1T5IA 1IJBA 1TUGA 4UREA 2IXBA 1M2HA 4IIHA 1UBCA 3WK4A 5JISA 3VOAA 1SC3A 1C9EA 2X2OA 3WYNA 4B2PA 1I9GA 1PR9A 1NW4A 3OIFA 4LDNA 3WLMA 3ZY5A 1VBNA 2KLHA 2C1ZA 4JEHA 4QUBA 3U7FB 4DWOA 1MD9A 2ZAIA 3OZEA 2F1JA 1RFGE 1LC0A 2BFEA 2RAPA 1Z18A 3QIVA 4PZAA 5KMGA 4FIZA 1W76A 1U9CA 3ZU4A 1PR6A 5I9LA 2IVZA 3UJBA 4PGGA 1CE8A 2X14A 5AHOA 5BV0A 1FFBA 1OGIA 3O8QA 1K7XB 2XQVA 3EXAA 2X3YA 2XAAA 3TTSA 1COZA 4D99A 1TUBB 3O8RA 4OUKX 3GEDA 2WT4A 3LLUA 5AK0A 4DNPA 5A3QA 3HA3A 2JNWA 4IHAA 3RHSA 4E2YA 3DZDA 1UP7A 5D7BA 5CDFE 5I5EA 1FFXB 1Q1AA 3G2HA 3LC2O 4JSRA 3D8NA 1GFWA 2J31A 5DVZA 4OHWA 2ZSDA 4R69A 1NBME 1GZVA 3PUYA 3QV2A 1A4IA 4ZALA 2WG1A 1O6BA 3CWQA 2DOKA 3W3AA 4KFUA 1EEHA 3KVNA 3N59A 1T35A 2D0IA 3NB0A 3PJGA 4MQ5A 2J4FA 4LSGA 1M34E 5DM4A 3T34A 4DLAA 4EPVA 3UFXA 3U16A 1QIHA 1QTIA 2O1XA 4LCEA 2Z57A 5D3MB 1VKNA 3TCKA 4LOLA 2PZJA 3UJ7A 3WIBA 2J45A 1RYEA 2JLBA 3ZVKA 1UMCB 3HQ4O 1LI5A 4UVDA 1AMUA 1P33A 1U5BA 2FDXA 2G9QA 1XK7A 4OJMX 4BAUA 4EI8A 1CDDA 2ZSHA 4MKFA 3KS9A 3MS7A 2FE1A 3GGSA 3OKCA 2IYNA 1D2AA 2V6BA 3PJDA 4X41A 4K86A 4MI1A 3V1YA 4C78A 3D7KA 4OK6A 1JEOA 1ZJ6A 3TRFA 1CUFA 1XU7A 2Q9AA 4WERA 5EIHA 2DQ4A 2NUAA 2Q8NA 2UZ0A 2D1RA 2XA1A 3H2JA 2CBGA 4KIJA 4YRLA 3T15A 3HLTA 4FSHA 3I64A 3ADOA 2IY9A 5BV8A 4KVAA 3QPCA 3DBVO 4G81A 3A4VA 4ID3A 1Z7WA 3I3SR 1OJ7A 3H2HA 3NIWA 2JFZA 4DRYA 1Q6ZA 1X7ZA 2OGZA 2WF7A 3C48A 3QXHA 4MGIR 2EJWA 3TXAA 10MHA 2XMDA 1GVHA 2PIAA 3FUTA 1M1YE 2O3RA 4Q01A 2ZB7A 3UV3A 1AS2A 5ESWA 4YAJA 5FUXA 3DBLA 1PSDA 4LSZA 3B5IA 1NASA 1CS4C 1JVSA 2PTGA 3CEPB 1Y4ZA 2YHBA 2JPDA 3GK3A 3Q3JB 3QF7A 2R79A 4WESA 4KI7A 4RSGA 1V1JA 4X24A 5ALVA 1R1DA 3PFCA 1NJ5A 4HDKA 3ZWCA 4Z49A 2ZIZA 5HS4A 2O8NA 4LRTB 3NHFA 2I4IA 5FA5A 3BRQA 3ZE0B 2H59A 4B32A 1R16A 2I66A 2B7LA 4HT3B 5CIQA 4QGBA 2EYQA 1FDRA 3EA0A 3LWNA 1SVKA 5K3FB 1JYEA 2FB9A 4EY5A 4TPKA 5IC5A 3FHJA 5KVCA 5LQUA 2WWVD 5GONB 3LL7A 2PWAA 3MINA 4EB3A 3PQ4A 4NXMB 1NURA 4OP3A 4AO8A 2JJMA 4JU9A 1J00A 3DR5A 5CVJA 1I24A 1LBIA 1NA5A 2AYYA 4FFLA 4MW2A 1JHDA 2RHMA 4RO0A 4DRXA 1GUZA 1Q19A 4RD2A 4J76A 5JCJD 4BAGA 3FNQA 3P9XA 1Z22A 3L79A 5IKEA 3ZUGA 1BNCA 4P3OA 4BX9A 3N5CA 1MB4A 3OKAA 3ORRA 5IKPA 1ZH2A 2ZUFA 1HRKA 4HDSB 4DL9A 3BKXA 3EVFA 3ISVA 4O4HA 2GKOA 5C5DA 1Z0AA 4LISA 3UO8B 5CDFA 3N6VA 1R0XA 2GJAA 4LAFA 3PWTA 4C4OA 1VC2A 1YB7A 2Q3JA 3GH1A 4IFEA 4K3UA 4KXYA 3G8BA 3DDUA 2VYCA 4F9TA 2FLVA 3TW8A 2CDRA 3UHFA 3BMQA 4H60A 5AKIA 3ND6A 4FS3A 4ALNA 1DKNA 5F2OA 2OHOA 1QP4A 3P2MA 5D3QA 1KDZA 5E1MA 2F43B 1TM4E 3V1LA 5M5BA 2ZSUA 1K2VN 5FBRB 1UOQA 5GOTA 2GEKA 1J99A 1NMYA 4PYIA 4D3ZA 3VR2D 5I4KA 2C3PA 1PV1A 2J48A 3U80A 3W04A 1KI6B 5HMLA 4K9KA 4JELA 3DBLB 2W6ZA 5JUWA 2W37A 1QBKC 2JLSA 1SBYA 5EE0A 5F3RA 4XGQA 1SRRA 3AMVA 4AP9A 3LCVB 2AXNA 3H99A 3X1XA 1UZNA 1MAVA 2JGAA 1FB5A 2ZBGA 2CHQA 4PX2A 5AVZA 3AQIA 4IIDA 3B8EA 2P7IA 3EZGA 3O73A 2H7YA 1KO7A 3ICEA 1E2LA 5DP2A 4HAVA 3LT0A 4A5OA 3CUEF 5IM4F 1TZCA 4DVJA 5KTKA 4PYMA 1ZOOA 5A9TA 2Y1GA 1GDTA 1FDUA 1Y48E 1U9ZA 4RZ3A 3TJZA 5JMWA 1AU9A 3HA2A 2VKTA 3NV9A 3JWIA 5ERYA 4A0FA 2QNIA 4M0MA 2VJMA 1F8YA 2G67A 4IUBS 2XHEA 1G17A 3JALA 4B9EA 4B34A 1HEUA 2ET6A 3NTLA 4MJ3A 4B3RB 1E9FA 1PRYA 4NY1A 1VE7A 4GP7A 3GGDA 3FN4A 2A1TR 3ANTA 2J09A 5K0NA 4K1LA 1P31A 1R3UA 2EWWA 3KPUA 1UMBA 1YTLA 1RAHA 2PUVA 3F8SA 1CC1S 4WY2A 5HKKA 1FQJA 1I2ZA 2YWRA 4LJAA 2F1HA 5DCUA 4ZQEA 4JXKA 4WN9B 1USGA 4AXBA 4YV0A 1SA0A 2R97A 3TDNA 3ZZ0A 1IXYA 2IP1A 1FRNA 2C2HA 2QRVA 1BMQA 3QE0A 4Q39A 5JMPA 2PUCA 3GZJA 2HPAA 1R0KA 1RBQA 4UBNA 3S2FA 5BN1A 1Q2UA 1IBKB 2IEBA 2NLOA 5DXAA 4LV5B 4PR0A 4KC0A 1RM5A 5DWVA 3DM9B 3HWSA 1LV7A 4C7BA 3UF0A 3PNSA 2DG2A 3ETGA 2P5TB 1V7QA 4L8FA 3EXG2 5DNYB 4Q3LA 2XX3A 4ZJUA 3E05A 1XNQB 1KEEA 4LRSB 1XF9A 5H82A 4IDFA 3RRNA 3VR1A 2F4NA 1SB8A 3ZZ1A 1KH2A 3V3KA 1GADO 3IQWA 3K0HA 1J4AA 6YASA 3NMUF 16PKA 2POQX 2HHAA 3DCJA 1FW8A 1YDEA 4KLNA 4LDRA 4TTVA 2N9UA 5DRTA 1XYGA 3HEAA 3K6RA 3L6UA 5ER6A 3X1WA 5CB4B 5IKXA 1CULC 4CIBA 4JJGA 2WD7B 2VH1A 3ST7A 4JC4A 4II2A 4TKLA 1B0PA 1JHRA 3IP7A 3PYXA 4BLWA 2XBMA 3IMKA 4R1OA 4Q4DA 3FVTA 2JH3A 3R0ZA 1V11B 2DKOA 1A96A 2B8EA 3G2IA 5G40A 5C4MA 3D2CA 3PWZA 1UWLA 4DB4A 3S2ZA 4I7EA 1M1ZA 3M4XA 3BZWA 4L4YA 3ZBPA 4RS3A 3DTVB 4IV8A 4MVJE 2RI6A 2G5GX 5EJ7A 1KAEA 4RHTA