4FLMA

S-formylglutathione hydrolase w197i variant containing copper
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
286
Chain Sequence
MKVVKEFSVCGGRLIKLSHNSNSTKTSMNVNIYLPKHYYAQDNKRIPTVFYLSGLTTPDNASEKAFWQFQADKYGFAIVFPDTSPRGGSWDFGQGAGFYLNATQEPYAQHYQMYDYIHKELPQTLDSHFNKNGDVKLDFLDNVAITGHMGGYGAICGYLKGYSGKRYKSCSAFAPIVNPSNVPIGQKAFKGYLGEEKAQWEAYDPCLLIKNIRHVGDDRILIHVGDSDPFLEEHLKPELLLEAVKATSWQDYVEIKKVHGFDHSYYFVSTFVPEHAEFHARNLGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A role for His-160 in peroxide inhibition of S. cerevisiae S-formylglutathione hydrolase: Evidence for an oxidation sensitive motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords S-formylglutathione hydrolase
total genus 88
structure length 286
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.1.2.12: S-formylglutathione hydrolase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4flmA00
5BWCA 3KOOA 4LXHA 1VA4A 4KEAA 4Y2JA 4N5IX 2Y6VA 5KWJA 4UHDA 3TRDA 4N5HX 1MX9A 4ZXFA 1CUSA 2OGZA 1TKRA 1UOOA 2XUPA 1H2WA 2Z3ZA 2RI6A 1NU6A 4JH0A 1DWOA 4CG1A 5EHQA 1XRMA 4B80A 1K4YA 4J7AA 4X94A 2QXUA 3QH4A 3BE8A 1CUVA 3VISA 1HLGA 1G42A 4U2CA 3PUIA 3DYIA 2XLCA 5LLSA 2J4CA 4KRYA 2X8BA 5KREA 4TGLA 4DNFA 2PM8A 2XUIA 1GT6A 4LYDA 2PSDA 1T2NA 2XLBA 4MWSA 3QVMA 3X3HA 2WHPA 3CN7A 2GYWA 5YASA 3GELA 4PSDA 1GPNA 5SYMA 3W2TA 4E46A 4MYSA 1VKHA 5JZ9A 3F96A 5JALA 1UKAA 3PUHA 2JF0A 4L0CA 4G5XA 3H0CA 3RLIA 5JATA 2O2GA 2FJ0A 5FDFA 1YS1X 4B6GA 1SOMA 2IX9A 2WFLA 2JEYA 3D3NA 3HI4A 3NWOA 4B0PA 2HFKA 4AZ0A 3WWEA 3B3QA 3TEJA 4AZ3A 2VJBA 4OB8A 3DKRA 2GZRA 4B83A 4HTAA 3FNBA 5AI4A 3M81A 1XZFA 5FP0A 3IUJA 4PF1A 4FOLA 5A7GA 2WLSA 4PQEA 2B9VA 1U8EA 4H7FA 1EDDA 2JGKA 1FJ2A 3I28A 1TQHA 1LPPA 2VQ6A 3UUFA 2RHTA 1LPOA 2HA7A 3QMMA 5BV7A 5ALXA 4IO0A 4EY5A 4EY7A 4BB0A 4X91A 5AOAA 5AIBA 4C4YA 2HA0A 4KJXA 1WHTA 2I3ZA 2R8BA 5AK5A 5K3BA 3E0XA 4GEGA 5LP1A 2WG0A 2YYSA 1ZGBA 3KXPA 4UBOA 1EK2A 5LYYA 1DT3A 1CUWA 3DJYA 2QXTA 1CUGA 4GLBA 3WWPA 3C70A 3H2GA 1F0PA 2ZJ7A 2K2QB 5ALKA 2WSLA 1B6GA 4H7DA 1BROA 1GPKA 3FVRA 2OG1A 3G02A 1MJ5A 1XQYA 1CVLA 1GXSA 2HA2A 3C6ZA 4Q05A 2H7YA 2HA3A 3C5VA 4KE8A 1CQWA 1CLEA 5FPPA 2H7XA 4IH1A 2Y2UA 3A2NA 1J2EA 1ZIXA 1H22A 5ALPA 4BP8A 2PU5A 3KD2A 4CIBA 1XZJA 4EBBA 3WKBA 2G63A 1S8OA 4XX1A 1XRLA 1VZ2A 2XQKA 4OD0A 3VVMA 5T4BA 4OU5A 4G8BA 5AOBA 4EY8A 1H23A 4K6KA 2HHAA 3ANSA 1TRHA 1W4LA 3JWEA 1QIHA 5A71A 4QZVA 1QTIA 2XMRA 1TCAA 3LS2A 3VJLA 1PFQA 1AUOA 4QLOA 3IB3A 3OTQA 5ALYA 2WJ3A 3GUUA 2D5LA 3H18A 4B9EA 1VJ5A 5ALSA 1KEZA 3PFCA 3NOXA 1O6FA 2VSQA 1QIDA 1EK1A 2XUGA 1EB9A 1CUEA 4D9JA 1IZ7A 2XQGA 3HSSA 2ZYRA 1OILA 4AO8A 4FWBA 3PE6A 2G5TA 4GBGA 3W04A 4B0OA 1CUDA 4X85A 4BVJA 1VZ3A 1ZIYA 5DTJA 2QVBA 2PPLA 5ALIA 1RYYA 3OM8A 2Q0XA 3HLKA 4W1PA 3U0VA 3R3UA 2XUOA 3WL7A 4C6HA 5I9IA 5IH7A 2J3QA 3V1MA 4X95A 1P0IA 2HA4A 4DSAA 4DTCA 4CIAA 4N8SA 3DKKA 3MUNA 4HS9A 5JARA 4H7IA 1IUNA 1RWQA 1ZD5A 3V9AA 4RGYA 3G0DA 5CXUA 3BIWA 5CXXA 1X2BA 1MX5A 3DCNA 1AKNA 4Y2XA 4HXEB 3DEAA 1UK6A 4C87A 1GQRA 2C4HA 5AKIA 2HM7A 3ESDA 2C5GA 4KAAA 1JU4A 3G9UA 1IVYA 5C7YA 4B85A 5HQ3B 4NVRA 4N8EA 2EEPA 5JASA 2ZSHA 3WZLA 4FDMA 2WU3A 4QWMA 3F67A 3CN9A 1BCRA 3C6XA 3MVEA 4K6HA 3QYJA 3L1HA 3C6YA 2H7CA 4BATA 1ODCA 1E8DA 3QPDA 1QGED 3I1IA 4JNCA 2PKYX 4UBKA 3BF7A 1E89A 3F97A 1XRQA 4INZA 4BP9A 5HF8A 3EQ9A 1N8SA 4ITVA 1CUFA 4W9RA 3R3WA 4Y9SA 4E14A 2QTBA 1BU8A 4G8CA 4LYEA 5ESRA 2OQVA 3O4IA 4FLFA 4W1SA 4P9NA 3F8SA 2ZJFA 1JU3A 2ZVDA 3VDXA 3WJ1A 4GDMA 4GXNA 5FPQA 1YASA 2R11A 4FBLA 1MNAA 1YB6A 3VXKA 1GZ7A 2WIGA 3O4HA 2OCKA 4DMKA 1XZIA 4QDXA 2JIDA 2JEZA 5HF5A 2WIDA 4BCDA 3BDIA 1J1IA 2PUHA 4KE6A 5AJHA 1ACJA 3IURA 4I4CA 4RNCA 1XZMA 3I6YA 1CUCA 3EQ7A 4FBMA 5C81A 1FFEA 5C8ZA 1H2XA 1XZDA 3QPCA 3PI6A 5ALMA 3D4LA 2H9YA 4M0FA 4U2EA 1WM1A 4Q82A 2C58A 3HXKA 4WJLA 4AO6A 1LBTA 2WG2A 2B20A 2OXEA 5K3EA 5JANA 4DNPA 1UKCA 1N5MA 4QDTA 1ZI6A 3N0TA 4BE9A 4UFOA 3BL8A 4BZZA 4C88A 2PSFA 2GBGA 3ZPXA 3IVMA 4H7JA 2OGSA 1L7RA 2RHWA 2OPHA 1X2EA 3IDAA 3H2KA 3LCRA 3ICVA 2JBWA 2HFJA 1GKKA 3FLAA 3ZWQA 4A16A 3IUNA 4DM7A 1JKMA 5ISMA 1VA5A 4DNQA 2VJAA 1AQLA 4G9EA 3ESAA 5LZ7A 1QIJA 4TVKA 4Y2VA 4A5SA 5HKAA 3WK7A 4UPDA 3WZMA 4J0KA 1ETHA 4DSZA 1BEZA 2C7BA 3IUQA 2QOEA 4BDSA 3STVA 3W06A 4F0JA 1JMYA 2C5FA 4QDOA 3PF8A 5JIBA 1VE7A 3DNMA 3D0KA 3LP5A 3DDUA 4P08A 1IZ8A 4CFSA 5LKAA 1P0MA 3FSGA 2FUKA 5FRDA 3ESCA 5JD5A 3ANTA 3HYSA 4H18A 2OCIA 2IIVA 5E4YA 1HDEA 4TPKA 1MAAA 2BAGA 4WFIA 3STUA 2I3DA 3RARA 3DOHA 3KSRA 4MEBA 4AO7A 4C89A 2PSEA 4UBIA 4WY5A 1BE0A 4WDQA 4UFPA 5EIHA 1HQDA 5CBKA 5DYYA 5CT8A 3QMVA 4BVLA 4W1QA 2I78A 4FFVA 5JD6A 3MUOA 3G9ZA 2WFZA 3G0BA 1Y7HA 4FHZA 4RE5A 1R4ZA 1QFMA 5ALTA 1Y37A 4WFKA 4G8DA 2RAUA 4ZGBA 1R1DA 1R50A 1U2EA 1YS2X 1UK9A 4H7HA 2BGNA 4G1FA 2XUQA 5AKGA 4HXGA 1ZD2P 3PF9A 5CH8A 3ED1A 1DQYA 2HA5A 4BC0A 2WQZA 1H2YA 2HADA 1WPXA 3IBTA 4QLAA 2YASA 1CR6A 5AH0A 2WU4A 4LIPD 4AX4A 2PU7A 1CEXA 2BGRA 1W52X 3BDVA 3CCCA 3MGAA 2GBIA 4B82A 3JW8A 3T52A 5AM1A 1TK3A 5SYNA 3YASA 2J4FA 4FKBA 4B84A 1C4XA 1AC5A 3G9XA 4H35A 1MU0A 1WHSA 4QNNA 4J0DA 5D6OA 1U4NA 5E2IA 4EUSA 2AJLI 1G4HA 2CKMA 4BVKA 2P8SA 1FFAA 4Y2SA 2W6CX 1EVQA 4PSCA 2PL5A 4BCCA 2ZJ6A 2G4LA 3OOSA 1QJ4A 3WMRA 4MEAA 1QO7A 2VT7A 5ALZA 4IQ4A 1K5PA 5DNUA 1QIIA 2DCMA 5CRIA 3R3ZA 4J0GA 4GW3A 5T4EA 2BUCA 4KYVA 4LXIA 2H1IA 3LLCA 3W9UA 3D5EA 1NX9A 2HRQA 4BAZA 3WK5A 1T4MA 2XUJA 3F98A 3M82A 3T4UA 4CCWA 5AP9A 3G0IA 2Z3WA 2PBLA 5E4JA 5K3AA 1CUUA 5ALDA 1BS9A 4U2FA 4RPCA 1N5RA 1YCDA 1W1IA 4P92A 1USWA 1A8UA 1ZI9A 3EBLA 2I03A 4WY8A 1X70A 5K3CA 4YK7A 2WHQA 1QLWA 4Q3LA 2XUAA 4X93A 5A2GA 4ZWNA 5EHNA 3VKFA 3F9CA 4FNMA 2WTMA 3WA7A 1WCYA 4CCYA 1MPXA 4OYLA 3E4DA 3FYUA 3Q0TA 1J07A 5D3KA 5LKRA 3FOBA 1QIKA 5K5EA 1W75A 1BN6A 1UKBA 2CB9A 2Y6UA 2BCEA 2JGFA 4J0IA 2CJPA 4G4GA 1UK8A 3I6MA 1AX9A 4HRXA 4W1RA 5JZSA 4Q3KA 1HBJA 1DWPA 4OCZA 3G9TA 4M0MA 2NW6A 3I2GA 4M0EA 2XMDA 4XVCA 3A6ZA 4F5ZA 4MQLA 4BTVA 2ES4A 1XRPA 3O95A 5D3ZA 5JAHA 1HKHA 2J3DA 3WKCA 4ZRDA 5HQ3A 4IHAA 4HXFB 4J0JA 4Q3OA 1ODSA 1WOMA 2QR5A 4MWTA 5JD4A 1GPLA 2ZYHA 4KRXA 1P0PA 3C5WP 1J06A 2DQYA 3ZLVA 4KACA 5AHXA 4G4IA 4BC1A 4HVTA 2OCGA 3D59A 4BAUA 1TIBA 4F60A 1XZGA 3B12A 2IITA 3R3VA 1XQXA 1ZGCA 2VT6A 4BCBA 3S2ZA 1CUAA 4GI1A 2DR0A 1D07A 2QT9A 4FNGA 2HU7A 5AI0A 1IUOA 2HDWA 1P0QA 1C7IA 2XMQA 5DTIA 3ILSA 2WTNA 3FVTA 1MO2A 2JGLA 1AGYA 3STXA 1PV1A 4DMCA 1CV2A 3TGLA 4IH9A 1C7JA 4JEIA 4K5QA 1BRTA 1EI9A 5CT9A 4MJ3A 5EIAA 2OGTA 2ONCA 2Z5GA 3K2IA 5AK4A 3SK0A 5FKJA 4ZREA 5AK6A 3GZJA 4HZGA 1CPYA 2CEKA 3D2AA 3I6ZA 3AIKA 2EDCA 5JAPA 4OB6A 2QZPA 3ZLUA 3ZV7A 1XZEA 4OUKX 2DHCA 1YA8A 2VJDA 1QOZA 3E1GA 4V2IA 5C8VA 1ACLA 5K3DA 1G66A 2O7VA 3R3YA 5BWBA 2PX6A 1CUIA 3OPMA 5ALLA 3G7NA 3Q8WA 1EINA 3I2FA 1DX4A 1YA4A 1ZICA 3DYVA 5IVKA 1EB8A 3STTA 4IH4A 1CUJA 1VXOA 2O2HA 3AZQA 4B9AA 1LBSA 3TJMA 3AINA 2LIPA 2VJCA 1K6EA 5HFNA 4BZWA 5AM4A 4J3JA 4ROTA 4W63A 1SCQA 3IULA 3STYA 1EX9A 1FSSA 2XDWA 4KR0A 1XQVA 1FFDA 3DOIA 1U65A 2XMCA 1VLQA 1Q0RA 5AK3A 3WK4A 2CMFA 1QIEA 3W9BA 3WYNA 5ALUA 4DMHA 4LXGA 3WKAA 5LZ9A 3WL5A 4X97A 4C01A 5AO9A 3FSGD 4X6YA 3FYTA 1UFOA 5HF6A 2V97A 1K8QA 3OC0A 5HZGA 4DNOA 3EIOA 2WUGA 3QBJA 1JT2A 1DWQA 4H77A 4ZI5A 3LIPA 2HL6A 3V48A 1G5FA 5ALRA 5LIPA 3I2KA 1LNSA 4WCVA 4CI9A 3WA6A 4MXDA 2VAXA 4QWWA 3WK9A 4U2GA 1UOPA 3WYDA 3H17A 1PJAA 3BIXA 4FTWA 5FLKA 3PICA 1LPSA 2YXPX 3HZOA 1LGYA 4NZZA 3VJKA 3BF8A 4ETWA 1QO9A 5AKHA 5JAOA 1BN7A 4EHBA 2VATA 4X6UA 1YAHA 2WHPB 2ZYSA 1CRLA 3C8HA 2O2IA 1DT5A 4K2AA 1R9MA 1XLUA 5EHXA 1XKLA 5AICA 2VAVA 1R88A 2CBGA 2G5PA 3BXPA 4ARAA 4EY6A 1Q84A 2EDAA 4UBMA 4UHFA 2AJBA 4A23A 1TCCA 5FOQA 1CUBA 3O9VA 4G9GA 3RM3A 5DNVA 4U2BA 3KWFA 5CH5A 5AKZA 2Z8XA 5AM3A 1QONA 6YASA 2C0QA 1DU4A 2WUFA 3R3XA 2XQIA 4X00A 2WFLB 2BFNA 5AKJA 1JJFA 2JGMA 4Y2QA 1JMKC 4DLNA 2OAEA 2WJ4A 1MT3A 3K6KA 1Z68A 2QM0A 4X92A 2XUHA 4NS4A 2AJDA 1QTRA 1XRRA 5C8XA 2QMQA 4B81A 4Y2YA 2Z8ZA 4GECA 1EA5A 1L7AA 2JGIA 2WKWA 1L7QA 2QUAA 3D2CA 3GA7A 3HACA 2B4KA 4I3FA 1B41A 1OCEA 3C87A 2OLEA 4LKOA 2C0PA 4WFJA 1XZKA 1OXMA 3C8DA 4J0HA 2JGJA 2XUKA 1WB6A 5ALJA 2V96A 5A7FA 2DHDA 5BOVA 2JGEA 1Q0ZA 2XE4A 2WJ6A 3H2JA 3HC7A 3EQ8A 3FAKA 1A7UA 3VVLA 2GBFA 4UUQA 2WFMA 4DGQA 4AMZA 1UWCA 2CUTA 2UZ0A 1LPNA 3O4JA 4BYMA 2ZYIA 1IMJA 1AZWA 2VTVA 4Q34A 3S8YA 2DFPA 3E3AA 3KWJA 4BDTA 2XMGA 1E8NA 4ZV9A 3AZPA 1LZLA 7YASA 1QZ3A 2FX5A 1W6RA 4UBLA 3WJ2A 1ZOIA 4O08A 3FWHA 4KAFA 3FLEA 2X76A 1UK7A 3G0CA 4MYDA 1QFSA 3C43A 5JADA 3DLTA 5IVDA 2W22A 4L72A 2PVSA 5EHZA 3WIBA 4F21A 1O6GA 3WI7A 4AB1A 5K3FB 1LPMA 1EDBA 2PSHA 2WG1A 3O9MA 1VXRA 3FLBA 1QIMA 2XI4A 1TAHA 3A70A 3AILA 3WK8A 2OCLA 4JYMA 4UHCA 2WHRA 3H1AA 1SCKA 3SX4A 3BWXA 3IUMA 1CUXA 1KU6A 4EZIA 5IVHA 3HEAA 3PDCA 4UFNA 4Q1VA 2Y1KA 3C6BA 3DQZA 2V9ZA 3QITA 2WILA 1M33A 2QJWA 5AI8A 4BAGA 3FYUC 3QZUA 3KDAA 4OU4A 1A8QA 5AM2A 3U1TA 3ZLTA 1E3QA 5HFAA 3HABA 4AN0A 3AUKA 3H2IA 5ALVA 3WWCA 1F8UA 4HRYA 2VF2A 5DNWA 4UBNA 3WLAA 4NMWA 2RIPA 1XZHA 5AI5A 4FLEA 4UHBA 2WIFA 3L1JA 4ZV7A 5EI5A 4UBJA 4H0CA 2XUDA 2QJRA 3WK6A 5LZ4A 3EF3A 5FXMA 1EVEA 5ALEA 3OG9A 2HRRA 3H19A 4X7BA 2OAGA 3HRHA 4QDZA 4BRSA 4K6GA 2ZSIA 2B61A 3R40A 2QRUA 2WUDA 2AJ8A 2YH2A 4BRZA 4YPVA 4H7EA 5HK8A 1A8SA 3PFBA 1LLFA 3AIOA 5IVIA 3JYHA 1ZD4A 3I1YA 5J3JA 2BKLA 3M3DA 4OB7A 5CURA 1EXWA 2ECFA 4DYHA 2HU5A 2WIKA 5ALNA 2PUJA 4EB0A 1JJIA 3I2IA 5CH3A 1THTA 1VE6A 2X5XA 1AMNA 5CT4A 4Z49A 5A62A 2D0DA 4AMYA 1MAHA 5AIAA 3IIIA 1QIFA 1ORWA 3UMJA 3WWDA 1CUZA 4C4XA 4P93A 2FJPA 4J03A 1MNQA 1JFRA 2HA6A 1KU0A 4OSEA 2BUAA 1XZAA 4G4JA 5ALGA 4C4ZA 5A6VA 5ALWA 2ORYA 1XZBA 3V1KA 3NUZA 3BJRA 3WQHA 2XQJA 3RK4A 1YB7A 1HL7A 2WM2A 4I19A 2BUBA 4FFWA 4DMFA 1W76A 1F6WA 1E5TA 1DTEA 1GKLA 2Y2VA 5EFZA 1HPLA 2GBCA 3A2LA 1ZJ5A 5EIEA 3G0GA 3WKDA 3WKEA 3STWA 5AKXA 4AN1A 5I8PA 1QIGA 3AJAA 2OQIA 3B5EA 4E11A 3V1LA 2GYVA 1XQWA 2GYUA 3HJUA 1N1MA 3N2ZB 5LZ5A 4DIUA 3AFIA 1THGA 4PNZA 1CQZA 3QM1A 4LHEA 2ROQA 4YX9A 3K9BA 1DQZA 1SCIA 3DL7A 3O0DA 4PV7A 5EGNA 2XMSA 5HCUA 1MTZA 1ZD3A 3H04A 1E66A 4BBZA 4RE6A 1LPAB 2ACEA 5T4FA 1BCSA 4QDUA 5FUMA 4FMPA 4OYYA 3SWWA 5D7BA 5CMLA 1RP1A 4X6XA 3LIIA 5DYWA 5IKXA 1H2ZA 1WB4A 4UHHA 3L1IA 2DSNA 3FBWA 4EY4A 3WL6A 2XMZA 3ICWA 4J0CA 1ORVA 5DJ5A 4JYPA 3AZOA 1FFBA 5KWIA 5CT5A 4CG3A 1EDEA 1JJBA 1LPBB 4QEKA 2HIHA 1MX1A 2VA9A 4BE4A 2XMBA 5ALOA 5JAUA 1DINA 1NU8A 4H7KA 1AURA 5F4ZA 2AXEA 3I2HA 5E4TA 3DD5A 3H1BA 3GBSA 3I2JA 1SC9A 2DHEA 5CW2A 3WIOA 4L3WA 1GGVA 4L9AA 3RKSA 3DL4A 1ODTC 4X3CA 5AKYA 5FV4A 5AI6A 1BEEA 4S0XA 5I7UA 4GHWA 5AKEA 4QA9A 1ZJ4A 5AOCA 4Y7DA 1XZCA 1TCBA 1CUYA 4KE7A 1XLWA 2HU8A 1VOTA 1ZI8A 2WIJA 3C45A 1WB5A 1UXOA 4Y2TA 4XIIA 1CFJA 1EH5A 5JYCA 2XUFA 3FCXA 5AKLA 2XB6A 2XQFA 1I6WA 4XWGA 5ALQA 1CIJA 2O7RA 5JZBA 2E3JA 4Y2RA 1MN6A 4KE9A 1ISPA 2RONA 4JUIA 1F0NA 2XT0A 1GQSA 3D2BA 1EHYA 1UOQA 3W05A 2QUBA 3R0VA 1XROA 1DX6A 1FFCA 3R41A 4E15A 1JI3A 3CCBA 3M83A 5HK9A 4U2DA 3GROA 4AQDA 1UZAA 5DYTA 3G8YA 5CTAA 2VEOA 5K3FA 5AM0A 4UHEA 5ALFA 1IUPA 4YASA 2V98A 3QMWA 1Y7IA 5ALHA 1UT6A 1XLVA 5DLPA 5AM5A 3SC2A 1XRNA 1YAJA 3VJMA 1E8MA 5KBYA 3CXUA 3GFFA 3FYUB 2CZQA 3V1NA 3P2MA 4XJVA 4CCYB 5T4HA 1K63A 3WWOA 4Y2PA 4PO3X 1CUHA 2GZSA 1R9NA 4MQMA 1R3DA 4EA6A 2DQZA 3A2MA 4WDRA 2AJCA 3FCYA 4QE3A 1QE3A 1XZLA 4ARBA 1LZKA 3DS8A 4FLMA 4PSUA 3QPAA 3D7RA 3WL8A 4KAJA 5AI9A 5A7HA 1WPRA 3UUEA 4CG2A 3ZI7A 3AIMA 4HAIA 5HF9A 3NGMA 4X71A 5H3HA 2QKYA 2RGUA 5AKKA 2QS9A 2ACKA 3OURA 4AXBA 4OPMA 4N8DA 4X90A 3H2HA 4B7ZA 5CT6A 5LZ2A 4BTLA 3O4GA 2BJHA 1SFRA 1YSCA 2WUEA 5HKBA 1YR2A 5DWDA 1A88A 3ESBA 2PSJA 1XKTA 3BJMA 4GWLA 1XFDA 1Q83A 5LZ8A 3IA2A 4PW0A 4Y2UA
chains in the Genus database with same CATH superfamily
1JT9A 2WMYA 1EIZA 1U4SA 4QEZA 5BWCA 1JDUA 1RD4A 3EZGA 1IK6A 4GR4A 1D03A 3KCQA 5LYJB 3WYFA 5JNRA 2I66A 4MRAA 1VA4A 4KEAA 1U0RA 2WWIA 3RO7A 4N5IX 4N48A 3NMUF 1F9AA 2BMEA 3DM9B 1XVAA 2B36A 5BT9A 4UHDA 2NO0A 3ZXYA 3CF4A 4JHLA 3GLFB 2PX4A 1F2TA 1YDMA 3CZQA 5KTRA 3CZ9A 3NHMA 4ZXFA 2NGRA 4L95C 3EMVA 3L0OA 3HFSA 1IJEA 3LF1A 1B26A 4IGAA 4M88A 4WACA 3TBKA 3ZY6A 4AMUA 4G5FA 1RZRD 4C0LA 3ECAA 3U4GA 4HMQA 4CKBB 3QLJA 1DV2A 1TZKA 5EUMA 1X7GA 2IS4A 3MHTA 1XRMA 3HU5A 4GUDA 3VO2A 1SIWA 4H6WA 2FJUA 3OZGA 1C2YA 4DQUA 2IUFA 4GMFA 2QORA 4TV9F 3UNXA 3KSUA 4YCLA 3VPBA 1YZ3A 1Q2XA 3WB2A 5LMCA 4E15A 5HWSA 2ZEJA 4M0KA 1YZKA 1FRVA 4JZYA 3D8TA 4XWKA 3DYIA 4OHUA 2XLCA 3IP8A 3IQDB 2VBCA 2NZVG 4MQUA 4LYFA 1ITZA 1WD7A 1T0HB 1C80A 1WVMA 5KREA 2CVOA 3PQFA 1TU3A 2PM8A 2X77A 3IAS6 5FT9A 3LSYA 1T8RA 4ESEA 5HUQA 2XUIA 1KORA 3WNCA 1JR6A 2DFNA 3TD9A 4GYJA 2WB2A 2D7CA 3TRJA 3CSDA 4DYVA 1QV6A 3JV7A 2X0KA 2GHIA 2OV6A 3ABRB 3RK1A 2Q5OA 1ZH8A 3Q2KA 3UYLA 3BD8A 4JB3A 2RFLA 4O59O 3GELA 2VYCA 1L5QA 1AU9A 3H9GA 4PSDA 4OIFA 1NASA 2ERXA 2Q9CA 1L8XA 3G5LA 4NWIA 3RVDA 2JIBA 3SY8A 3SYKA 3UVEA 5HZMA 3W1WA 4MSUA 3RAJA 2QN7A 3ENNA 3PUWA 4GICA 3NW9A 2LVBA 3ESRA 2R0QC 4LJYA 2ODPA 3J81A 4WVFA 2O4CA 4Q1AA 3SLKA 3HB5X 3HKEB 4CM4A 4FILA 1KY3A 3DAPA 4V39A 1Y81A 2GVZC 3Q5DA 3C3XA 2EQ5A 2JIZD 2LW7A 1E1DA 2YW2A 3QXXA 3JZDA 4HNQA 4MGZR 4OUDA 1JZQA 4CM6A 3GDOA 2FJ0A 2ZATA 2B5WA 2MSEB 1NSYA 1TQ8A 1VJTA 2GZMA 2AYZA 2IX9A 2JEYA 3FDFA 4Q6BA 5A3JA 2NO9A 1D1TA 1NR7A 4BIIA 3FAZA 4HNSA 3EDCA 3IMEA 3WWEA 5K9ZA 3DMNA 2W6IA 2ZT5A 4UZEA 5HPYB 1QQBA 1P4SA 4XH9B 1FPMA 2R5NA 3WB0A 1N8TA 4G5QA 1SHTX 4QBHA 1RYZA 4DR1B 1IE3A 4DCTA 1ZL0A 2Z9CA 4NBNA 4QYIB 3T12A 2RHLA 2HLDA 3GUHA 4YIKA 4PTZA 2Y0EA 3PS9A 1MJGM 2SICE 4AZ3A 1QQ6A 3EVFA 5F21A 3KPUA 2HTFA 2EFCB 4CF6A 2KPOA 5AI4A 4JUCA 1T2AA 1ZNZA 2FPMA 1Z62A 3PX2A 5A5FA 4PO9A 3K0SA 2LCQA 2LDXA 1WS6A 1A77A 4IVQA 2XEDA 2EXXA 3C1OA 1RPAA 3MCWA 4RIHA 1F5NA 1AV6A 2CNBA 3LCCA 5M04A 1GIAA 1O4WA 1LV8A 1RWKA 2VPTA 3ILHA 4GI2A 2ZTSA 3KDSE 4NNPA 4R8MA 1RAEA 4W7HA 1YB4A 3D1LA 4RM2A 2V3WA 2FEOA 4Q0MA 4RPJA 2JGKA 2VRBA 1FJ2A 2YS7A 3I28A 1ECPA 3ZJUA 4RJIA 4K3UA 3P2IA 1ECFA 4UXHA 4Q3NA 5J59A 2CW5A 5E1MA 2C82A 1W2WB 3LI2A 4JD5A 1YB2A 1OT5A 2CF5A 3IOCA 3L05A 4BNLA 4HQFA 1L4EA 3NRJA 3LPAA 2NU7B 4MAAA 4RIIA 5DISB 4CHTA 5BV7A 1DADA 4LNHA 2IH5A 4OFWA 3QF7A 5DGIA 2PJRA 1YHYA 4ER3A 4IO0A 4ZI7B 3PNMA 4BU0A 3OLVA 4ARIA 4JUAA 4BB0A 1D6JA 1CBUA 4WBSA 5IMBA 4D97A 3KKZA 3VYVA 1KMHA 3MXTA 5DE3A 5E7QA 3IJEB 4KWHA 4HYQA 3RVLA 4C4YA 5AIBA 2HA0A 3OIFA 3Q41A 4HH3C 3WLJA 1E5VA 1WHTA 4EGQA 2AUTA 4EPYA 5EJFA 3DNPA 4I81A 2NYUA 2IE0A 2EBFX 5ECGC 1MVNA 1ULBA 2LDBA 3AHHA 5COBA 5TEVA 1T2UA 1EJ0A 4LDJA 5L3VA 2FFHA 4Z4EA 1QOQB 2CJWB 2WF8A 3NT4A 2WG0A 1BD3A 1NVXQ 1UBLS 2YYSA 3LGXA 4MAMA 3FRJA 5FPSA 3FD8A 5EQDA 5IYZA 4UTZA 3G3EA 2GZ2A 2R60A 5JZVA 3EZ9A 4YV1A 4W9MC 3D4BA 3EPJA 1MMFB 1VP3A 2PGNA 2Q3EA 4MGHA 1DT3A 2HV9A 1CUWA 2I2CA 2IGTA 1YS4A 2QXTA 2RKBA 2X41A 3TJRA 5AD1A 5JYEA 4FU0A 4L4RA 1B8VA 1L5FA 2F3SA 4HZUA 5D01A 3M8KA 3OY7A 5DW0A 3RW9A 2K2QB 1SVOA 3PQ8A 2DPXA 4M4SA 2GPYA 3ZEAA 3GCDA 3WX0A 2GN4A 1U7OA 1CQJA 1XLTC 1E6WA 4WEQA 1OYVA 4X8OA 3ZWBA 5LQNA 4AF8A 2BCGY 4XEHA 4K05A 1YE5A 1W48A 4Q00A 2JCXA 4EI2A 4F9TA 1KYVA 3KSDO 1BROA 3RIXA 4DMUB 3FVRA 3PDJA 4R2JA 2FRDC 1E0DA 2FG5A 1NVVR 1QWOA 4LHZA 5IJZA 3VU3A 4C7MA 3O0TA 3I9V1 4M9XA 1XQYA 5C3UA 1P1HA 4EG8A 1HNNA 3UKOA 4AY4A 2XD4A 2H7YA 2HA3A 2JIQA 4RZHA 4PXAA 2E37A 1V8BA 2QV0A 2EKPA 3JRNA 2CNDA 5IAEA 1FVHA 1GPWB 2BZ1A 3A9RA 3B1KA 2PV7A 4IH1A 3EXHC 3PNYA 4PSAA 5DT9A 4QJ3A 3E58A 3HEBA 4E2FA 3DV0A 2V6GA 1PG2A 1H6DA 4YO8A 4M99A 1SVMA 4LCEA 5JRDS 1ZIXA 5AJWA 1H22A 3LY5A 3FZQA 1O95A 5ALPA 3T1NA 4BP8A 2ZBDA 1OKKA 2PU5A 3SXUB 5JHHB 1HM5A 3BSYA 4ZQBA 5C80A 1DBIA 3VTKA 2EW2A 2HU2A 4Z3OA 1ZSYA 3IV7A 6AT1A 2PXCA 1FXWA 2CLMB 2I6XA 3E18A 3LVRE 1E64A 1RKVA 4KO3S 1DIRA 4ZCSA 3WLTA 2B5VA 3ZWVA 5CX1B 4WKBA 2ZRPA 1VI5A 1L9XA 1OASA 4IZOA 4DIOA 5DMHA 2O8FA 1Z5OA 3ZEIA 1G98A 3NANA 4C0AC 3R7WA 2YWRA 1Z06A 4Z7OB 1QGYA 3DLHA 2CCJA 1Q7BA 5K0NA 4G8BA 1TCVA 2F2TA 3NM4A 3BGWA 3AR8A 3O8NA 4LC0A 3RC2A 2GVNA 4EFKA 3AK4A 2HHAA 2Y27A 4LGVA 3COPA 1TRHA 1VG8A 1W4LA 1QIHA 1XD2A 2OL4A 3E2PA 1I1NA 2FMHA 2X0DA 1KMCA 1DS6A 4OQFA 3O74A 4YDHB 3TQTA 3NALA 3NM5A 2XMRA 2XY4A 5E1BA 5HEKA 1TKBA 5B58C 5F35A 1E3WB 2VHCA 3CF2A 2LIVA 3ONEA 2NQ8A 4FGWA 4AKTA 5GWXA 4ALJA 3QNMA 1H3FA 1GRQA 2MMCA 3KYIB 1FUEA 3R7BA 3GDWA 1KWGA 4X8LA 4HX2A 3LAWA 2AG6A 3KZCA 4RH1A 3FN4A 5IZCC 5C52B 3CVVA 3SIWA 2ZG6A 4DB2A 4MPTA 1TZ2A 3WG9A 1O57A 5IKOA 4LF6B 4BN0A 4TZ6A 3M3HA 1DBVO 1G9TA 1Z7BA 2QVZX 2RJ3A 4ZJYA 5GVRA 2GPAA 4URZR 4WVLA 1DMSA 1PJLA 1X80B 1SJ9A 1QDLB 3TDKA 2JCGA 2RH4A 3RSFA 3T3GA 5LJIA 1VG9B 3FXAA 1QX4A 4WX2B 1VLLA 4BGIA 1X13A 4XIGS 1EK1A 1VHLA 1EB9A 2RGGA 3KQLA 4IIJA 4D6XA 4L5IA 1RQ2A 1R6TA 2QTMA 3F6PA 3REOA 4RH3A 1XL0A 4JL8A 2PXAA 4MWOA 5EIBC 2ZYRA 1II0A 4EJSB 1ZCBA 2YY7A 4N0MA 1ZM9A 3KV1A 4LXTA 4E5VA 4Q7MB 2Z2XA 4K2HA 3DE7X 1ZWLA 3ESZA 4A2WA 4MQEA 1TM1E 2BONA 3PIDA 4GBGA 4YPVA 4LDNA 3NIWA 2I3AA 2X14A 1VZ3A 3PCRB 1IL0A 1ZIYA 1Y1KE 1N3IA 1Q21A 4GKKB 3A27A 5DGTA 2XCSB 2GFIA 2WWGA 1ZU5A 2PPLA 1OGIA 4I4LA 4IIEA 4O5OA 5ENVA 5ARDA 4D92A 3IAXA 3DFFA 4FOSA 5ALIA 4PN3A 3I6QA 5KVSA 2ATEA 3E53A 2RAVA 3G8DA 1LQUA 1ZU4A 2HLDD 1Z8NA 1MEJA 3AESA 4PZDA 3G5AA 4GGMX 3U4QB 2B82A 2V5UA 4HVCA 4I9FA 4Y9UA 1RMQA 4MUIA 3R3UA 4WCFA 1ZGJA 3SQOA 2J3MA 1M2FA 1G3IA 4DADA 3WL7A 1ECGA 4C6HA 2SNIE 2XIJA 1CY2A 1P0FA 5DNEA 4X95A 2AMLA 3R7LA 1ZCJA 5CB8A 2GTHA 1SRRA 4HUJA 1XMIA 2NVUA 3WVNA 3ZE2B 4MITA 3PTAA 1P6UA 3D9QX 4DSAA 1ONOA 4DTCA 5IANA 4UTNA 3OKFA 2DBYA 1QF9A 2QDKA 2HTEA 4N8SA 3FFWA 3NHFA 1IVSA 2F1IA 1O54A 1QGZA 4RKRA 1K68A 5EMNA 2WTAA 4CIVA 4PCUA 3I3OA 5IJAA 1W25A 3F0TA 1SOVA 3MW8A 1M1XB 5JQGB 5DHAA 1OKKD 4HDNB 1OREA 3DUFA 3EVBA 3UYKA 1UXJA 4MHTA 4LZAA 1W35A 3I76A 1AKNA 1PBTA 2O5CA 1C2TA 4OA8A 1GD1O 1NUSA 2HJRA 3GVXA 2J9ZB 1X7ZA 3LP8A 2C4HA 3RYCB 3IILA 3Q85A 3INRA 2GRJA 1C3OB 3D3EA 5DK6A 1NJ1A 2C5GA 4NU6A 2ODAA 3BMNA 3LHIA 1W0JD 1XAIA 1XP8A 2QZZA 3MWDB 3EDRA 3QJGA 4OFBA 5C7YA 4B85A 1ZNYA 4J0EA 3DC7A 3DTVD 2XBUA 5HQ3B 4ZVPA 4CKCA 1XPOA 1ZK0A 1JYEA 2IGBA 4KHPB 5JASA 2CXPA 2ZSHA 4FDMA 3ZWOA 3A1NA 5LQSA 2CMGA 2IZ0A 1S8FA 4KN5A 2SCUB 3FZNA 4JLPA 3ZDZB 5BSUA 4HGQA 4LVOA 3EF1A 3C6XA 1BXRA 1L4LA 1GNTA 2CMHA 2AF4C 3HL0A 3DV2A 4K6HA 1J5XA 4Y3UA 2NTNA 4YREA 1N2XA 1PEDA 3CU5A 3LA6A 1O0BA 2A6PA 1V7CA 1EK5A 2ZPTX 4R1MA 4YRQA 5TVKA 4Z6KA 1X14A 1XEWY 4IRXA 1Z4NA 1GA1A 2R00C 3HO8A 3U7RA 4XI9A 3EG9B 1BOOA 1Z0SA 2UDPA 1I51A 1T1JA 2X1HA 2JGNA 2CVZA 3QPDA 4I1OA 5K3SA 3FUXA 4WFQA 4DIEA 1JBEA 4ZDIA 4EJ2A 5JXHA 4JNCA 3KYDA 3B36A 3PB3A 4IO1A 4W5TA 1Y8AA 3PUVA 5LLDA 1O03A 3A6GA 3OBIA 3LKDA 4IHQA 2FZ5A 2BLNA 1X8LA 1XRQA 5LPNA 4EM6A 2HHJA 4V3BA 4YAWA 3WGHA 4TYYA 4MUXA 1WXGA 1KETA 1LA2A 4O4LA 4BP9A 3EQ9A 1QP8A 2HJWA 3BAZA 4ITVA 1HV8A 3R09A 2W4QA 3R3WA 4DXDA 4X7PA 3EGXB 2JFQA 2O0KA 4A92A 4GC5A 3PLRA 3RBXA 4J0FA 4BLPA 4IDNA 4CHGA 2E87A 4ZGGA 3ZDXB 3CNBA 4NABA 3ED5A 1PQUA 3FNHA 3FTPA 4V3CA 2EJVA 2V65A 3HXLA 4W1SA 5H3CA 4B45A 1IXYA 2OK8A 3BMOA 3TVDA 2WMOB 4REMA 2G9UA 5C37A 4P9NA 3OEHA 4FMCF 4I50F 3CRQA 3FZYA 2ZJFA 1JU3A 3AUYA 1VHDA 3TH5A 3EEQA 1ZR4A 4EPTA 2KS6A 3G2IA 1TADA 2COUA 2FEPA 2QLJA 3G6KA 4TWJA 3E9NA 4Z3DA 3VZQA 1TYAE 1KSHA 2G76A 2E55A 3DMGA 1P4AA 3ZCXA 4KIFA 2E0IA 3IODA 3TRKA 2ZWMA 4Y8VA 4MKXA 2NYRA 5AVJA 1X19A 4UDNA 3ZVNA 1G8GA 4Q19A 2ZSUA 3A9SA 2JLRA 4N18A 2B6NA 2FH5B 2H48A 2OCAA 3EXIA 3NIBA 3OZEA 3PWSA 4PCAA 3REQB 2P2LA 4CLRA 3P71T 2IXDA 4L3VA 3KZMA 4CLHA 4DIMA 4F5YA 1JP7A 1YVEI 2GD1O 3LVBA 4IDFA 1FRNA 5HJ7A 2M32A 3BXEA 4QOFA 3OPVA 2H52A 2G82A 5HF5A 5A0VA 2QRNA 3IEUA 1TMKA 1JE0A 3N2YA 3GJZA 4BCDA 2FQXA 5K4AA 3VPFA 4ENSA 1P8JA 4HLUA 3FPFA 3GEBA 4RZIA 4RTNA 2O5EA 2ZRDA 3LUBA 1YJBA 4KE6A 4DMGA 1ACJA 3IURA 1O5IA 1FDTA 5CYOA 2ZI9A 4HTFB 1ZINA 1CUCA 3I6YA 5G1PA 1N7JA 2F1OA 2JW5A 3TDNA 3LDHA 5C81A 1U63A 3ILVA 5KMGB 1P29A 5C8ZA 2GXAA 2V3CC 4LDRA 3QPCA 2CLSA 3HJFA 3D4LA 2H9YA 3ES9A 3HADA 1UDRA 3V4PB 1B3BA 2XT6A 1P45A 2GNPA 2ZVJA 4U2EA 4Q82A 4BVAA 4I66A 4REOA 4QXMA 4B7CA 3BD9A 2UYQA 4DCNA 4AYWA 4EB6A 5FJJA 5L6MB 1XU9A 3HB7A 4DCCA 3JRXA 1JKJB 3HA2A 1YDGA 3LHKA 3M0EA 3PQ6A 4K9NA 4D5EA 3NTLA 5K3EA 1T6NA 1Z4KA 4DNPA 4DR3B 2AW5A 2N1BA 1R8SA 3SVLA 2COKA 4QDTA 1MDFA 3OF3A 5BVHB 1AUVA 4R6XA 3N0TA 3IP6A 3PFWO 1H0HA 3H05A 5TPWB 1TKAA 1KI7A 4MLCA 4CLOB 1ZGGA 1FYDA 4BNDA 3BL8A 3E3MA 5AFSA 3KJIA 2EFYA 2HLPA 2AHRA 3JAKA 4RCYA 4W5QA 3HU2A 3ZPXA 5BYAA 1JDVA 1N6NA 2R6AA 4ML3A 4BY9E 3G2KA 3ROZA 2OGSA 4OMCA 1U2RA 2CXQA 3G2OA 4NYIQ 3N76A 3O3NB 3ZY5A 3KUCA 4RHTA 1YRHA 3HUTA 3COVA 2H0QA 3OFND 5DP1A 3TM4A 3WRYC 1X2EA 2B4TO 4QUBA 3MTQA 3ZVLA 1GG8A 2JVKA 5FLXA 4RH0A 3H2KA 3CKKA 2ZJ5A 2AFIE 2V7UA 3HU3A 3LUHA 3PDHA 1XJ5A 4WZ6A 3RYFA 3I5MA 1NW5A 2OWDA 1QMGA 1IU9A 1XVVA 1E1LA 3DTTA 4QPNA 2Z57A 4XVQA 3WHIA 4PZ9A 3CV3A 1HDOA 2QIPA 5JCZA 1R5OA 4DM7A 5G40A 1JKMA 5ISMA 2FNAA 4DNQA 4GOMD 1AQLA 2FP4B 4MGEA 2GJ9A 4ZAWA 2OZKA 3QG5A 1XJCA 4A8JB 5JTUA 2I9KA 4URWR 1IZ9A 2ODBA 1ABEA 2PWBA 4WXRA 1JWLA 3OKCA 1QIJA 3NEPX 4QHYA 3TMKA 2IHKA 4TVKA 4CDRA 4J1QA 4BO7A 1JQKA 4OHBA 1RW4A 1B0PA 1EM8A 2BJVA 2NO7A 1NLYA 3I73A 3IUQA 5NULA 4JASB 4O02B 2ZS8A 2HNKA 3TBFA 4YRGA 3LYAA 1RZ3A 2FEKA 3SOPA 4D0RA 1ZGZA 3T1TA 3HO6A 1J7JA 2AH5A 2XZLA 3JR3A 5JEEA 1NMZA 2YCLA 3ZDQA 2ZXFA 2ZGVA 2WHYA 4AX8A 4LFCB 4B17A 5DM4A 4JIMA 4QDOA 3FLMA 4JDPA 5JIBA 1AMOA 3OPYB 3DNMA 3BE4A 1R0RE 3O8CA 2VTBB 1Z8FA 1NP6A 1E9SA 4IIYA 3U39A 3RRZA 3V6LA 3TZCA 3L49A 1QRAA 4L5JA 4P08A 1C30A 1N5IA 1CHNA 2O3SA 1DSSG 1ZCAA 1JLLA 2I7TA 1JLRA 3HLTA 1DUSA 1XXHE 3H2SA 4DCSA 3WGZA 4EW3A 4ZK2A 2X3FA 3OPYA 3H7AA 4JLJA 3ANTA 4DSTA 4H18A 4IY1A 2ZITA 2OCIA 1R15A 4DV7B 4KFCA 3NBAA 4TPKA 3TZLA 1RFLA 1MAAA 3L06A 3KKPA 4NDNE 1SQ6A 1E1YA 1D2RA 2RGCA 5LA6F 1Z6GA 3STUA 5MN6A 2ZRCA 5A4AA 7MHTA 2WZDA 3ABIA 3E05A 3OTWA 4MR9B 3V4SA 4AYXA 4CQJA 5CFZA 4JYAB 4G1VA 3TIFA 4P7FA 4G24A 3SNHA 3ORFA 2B37A 4I9GA 3NEAA 3P1JA 4UBIA 1XO1A 1PFYA 3JQ9A 721PA 1SD2A 3ST7A 1W6UA 1X8XA 2XWJI 4GYYA 1GNLA 2NZWA 1WUTA 2ZRIA 4TLLB 2B7CA 3FGOA 2Q27A 1WCIA 1Y6JA 1RJDA 2DSTA 4ERXA 4NCBA 4GKJB 5ES4B 2R8OA 3G2NA 4F97A 5CVDA 5CBKA 4ARVA 5H82A 3CUWA 3KHUA 5DIFA 3O8LA 3G79A 4YJGA 5CT8A 5CDFA 1NFQA 1ZVQA 2DQSA 4HUQB 4YR7A 1B0AA 2C5AA 4FFVA 5JD6A 5IWAB 4FB5A 2FDCA 4H3KB 3MUOA 3QRWA 5BYBA 3O83A 1B00A 1WO8A 5DB4A 5I7HA 4XM2A 3AETB 3KG2A 1UBUS 3QFFA 4R9VA 5T3UA 3IRUA 4MGYR 3WBKA 3OJFA 2PKEA 5T5QA 5JMWA 3WGJA 2NAFA 4GP7A 2IDJA 2GAOA 4NESA 1OSNA 1Y6GA 3D4PA 3PCXA 1XELA 1M2VB 4M8LA 3GP5A 1ZHOA 1P60A 4ZGBA 5DP2A 2YZKA 2IUUA 1EHIA 5FFFA 3RFTA 1SUWA 3IBGA 1R1DA 2QW8A 2O06A 4ZXPA 2GAIA 4D56A 2PQ2A 3NDJA 4JLDA 5D8DA 1KNXA 3BMCB 4DQ0A 4F5WA 1YS2X 2J9FB 1UK9A 2J87A 3EZ7A 4Z99A 5EIOA 4BHTA 4NDZA 3MN1A 2FFBA 3AL3A 3LOPA 1QHHB 2CFOA 1ZQ9A 3BPSA 3BILA 4QBTA 2LR0A 5AKGA 3ZCVA 1P9NA 1ZD2P 4LE0A 4DVGA 5EWJA 3RUDA 3R7NA 3GG9A 3KKLA 3OP1A 4EDFA 5AW0A 5B3JA 2HA5A 3GVHA 3GZ4A 4UU7A 4ZHQA 1PNTA 5SY4A 2WQZA 4QTYA 4HQKA 3UHAA 2IFTA 1GQQA 2R48A 2VJLA 3BAFA 4MDYA 5T6BA 5B7PA 1NI3A 1WPXA 1J2UA 4MJLA 3S2IA 3AKDA 1SU4A 3IBTA 4N6GA 5ICFA 2EFGA 5JSZA 3EMDA 2YASA 3KJGA 3N2KB 1H2AS 4DOMA 5LD2B 4AX4A 4E09A 4EPRA 3CGWA 3F8TA 2QMYA 3M1YA 5DEIA 1JKFA 2DF8A 3R6GA 4NE9A 4WKOA 4YA6A 4YACA 1A8IA 3O8OB 3KVVA 5FWYA 3VMMA 4FNAA 4L27A 5EKSA 1E2FA 1F8GA 2CHGA 4JCOA 2C03A 1E62A 3BRWD 2KBFA 5EY5B 2BGKA 4J4HA 5SYNA 3WQRA 4BUCA 2CNKA 3HR4A 3MRSA 5SYAA 3ZHQA 4KMRA 3PFNA 3ZGVA 1HK7A 2YDXA 5GADl 2HQRA 1VL0A 3LFHA 3SM3A 2ODEA 3NVMB 4J94A 4ZQGA 4GL2A 3VI4B 1CYEA 1GEGA 3CZ4A 3G9XA 4R2LA 4HSEA 2CWWA 4C4TA 4R5MA 1P4HA 4KVZA 4WBXC 3CRNA 5ENDA 4YCMA 4XD7D 4JKYA 2GBLA 4DW8A 1WHSA 3GJ7A 4ZIRA 3AEKB 2DH5A 3D3WB 4L8GA 4NDAA 4EI8A 2Q4BA 3A4IA 3KO8A 4KNYA 5JJLA 3L43A 3QU4A 4EYQA 2R4QA 2YWHA 4DVJA 1X9GA 5MHTA 4DXHA 4L5AA 1SUBA 3NNNA 3H42B 1M8FA 4D4MA 4MW0A 1QDUA 1G4HA 1QGAA 1NF2A 4BFVA 2CKMA 4BVKA 3HFRA 1FFAA 2WK1A 2RSLA 3JVUA 2VVTA 2CLHB 3KV3O 4Y2SA 3C6KA 4X1YA 4B5LA 3ER8A 3ROEA 4ALIA 3CLVA 4Y98A 4KQEA 4TMWA 3D1VA 3OOSA 4ALMA 4EHKA 2BOVA 3CWZA 1FYXA 3MTAA 4BJ1A 4R71A 5JMOA 1JTEA 2IA5A 1NN0A 1PFUA 1E2HA 3V2HA 3HRKA 1QO7A 1QHFA 5ALZA 2JIMA 4K1LA 4P0QB 2DQKA 1M6NA 1WKVA 4AZTA 4RTMA 4NCAA 4CMEA 4AN4A 2X19A 5CRIA 1SKUA 1PU2A 2JJMA 2BUCA 4O4IB 4LXIA 1DJLA 1Y3FE 3M7IA 4FZ5A 4ZI2A 2H1IA 1IM8A 1YQXA 3W6PA 1NX9A 2QRKA 1U5BA 1YOVB 2GKSA 3KYDB 4FCCA 1G7SA 1KI1A 1J9ZA 3CO0S 3WK5A 1R6VA 1T2DA 2XUJA 3M82A 9ATCA 2HW8A 3QBVA 3KX2A 4D98A 3PFIA 5JAZA 3OJWA 1PO7A 1TQ6A 2TMKA 1Y34E 3ZK7A 1UPTA 1INLA 1H0RA 3G8AA 3MMZA 2OWEA 3G0IA 4K0RA 4OOEA 3T0IA 3ZJ5A 2Z3WA 2PBLA 4P3KA 5E4JA 4F93B 2QPTA 2X9LA 3N2IA 3LT0A 1NR5A 2ZUBA 2HH9A 3EUWA 1RDFA 4YT5A 4RPCA 5ALDA 1N5RA 2J85A 4HV4A 1LVGA 3WRXC 4AT1A 3PXEA 9LDTA 3ZS8A 4QDJA 4ALLA 1NBOA 3WGUA 1JDTA 1A8UA 1DDGA 4EB3A 2D1QA 1ZI9A 2OZEA 4RIFA 4AN0A 1L7PA 1BWQA 2W11A 2JJQA 2Z04A 2GO1A 2WT8A 5K3CA 5K6AC 1ORDA 4XJSA 1BQ3A 3AOEC 5LXTB 3AKEA 5DK4A 2D06A 3BQMB 3VC2A 3ZYZA 5F5XA 2VUTA 1SXJB 4X93A 2J6CA 3O1HB 4ZWNA 3VC3A 5A2GA 2YYYA 2OHHA 5H8WA 2PGOA 5I48A 4PRKA 1XN1A 1ZS9A 3F9CA 3PQ4A 4XOIA 3OZVA 3KUDA 4PHTA 5BW5A 3HCRA 2WTMA 3A6DA 3QKWA 3S1SA 3WA7A 2C42A 3F74A 3HCBA 4PAMA 1CU1A 1PZFA 4GE0A 1Y1QA 4LJ7A 4QVGA 2D2XA 3RYTC 5SY9A 3NGXA 2YIDA 1S1MA 5DHTA 3EG5A 3FYUA 1C0IA 1J07A 4MVYA 2XADA 1E4YA 3U4AA 1T5BA 3GQBA 3UXHA 4IIFA 4ME6A 5L9AA 3FOBA 1QIKA 2G1JA 1CKEA 2WKSA 1COZA 3MOSA 4LHVA 1Z2EA 1K5DA 4Q03A 4QT4A 8LDHA 2FETA 3KB8A 4TWIA 5IEBA 5K5EA 3N3BC 1HE3A 4JP1A 2WSYB 3KL2A 4PRYA 3M34A 1N6PA 1QVVA 2GN1A 3CUVA 3PUZA 2PL1A 4NFHA 1D4ZA 5FOUA 1Z36A 1W5EA 4EG5A 1KK3A 1XE3A 3SQLA 1BMFA 1RHUA 3LE8A 2Y6UA 4RF3A 5K45A 5JR3A 5AVZA 1UPFA 2ZANA 3EQ2A 3UUGA 4RKYA 5E0KB 1JFFA 1ODKA 4BEVA 2P2SA 2O8EA 1KDTA 4RY9A 2FHPA 4FGZA 5CIWA 1E61A 3EHEA 4WA7A 1CETA 1G2QA 2X4GA 1CR1A 3I6MA 4IIVA 4B2IA 4YH1A 3ELDA 2RH5A 5FOQA 4WZZA 3I5AA 3VYWA 4DEYA 1SOUA 4GVXA 3NKFA 5AUOB 2UUCB 5TX7A 4CQNA 2GZ3A 1NV9A 2QUJA 1BRMA 2FWMX 1U7WA 1HBJA 2HHCA 3AUAA 3KYJB 3AHGA 4I9HA 5CP8A 4OJMX 5DNCA 4ZYWA 2YNMA 4M0EA 1IN6A 1I9GA 3TFWA 4JGGA 1P74A 3A6ZA 4F5ZA 4KC0A 4HDAA 2NUAB 2RHRA 3O95A 2GXSA 3BA6A 3FTFA 1UBTS 2QRVA 3G2QA 2VF8A 4UE3S 3H5IA 1EWTA 1TJ4A 4JITA 1R16A 2BN4A 4ALKA 4ZRDA 4DQXA 3M4NA 4ISCA 1T8PA 4EG0A 3ZZMA 2AOTA 4UTVA 1U3UA 5TEWA 4FQ5A 5BORA 2ZB2A 3DFMA 3TTVA 5SZJA 4MRNA 2O2SA 3MBOA 2OZVA 2WRZA 1GRVA 4UJ3A 4ZMSA 2JI9A 3RTGA 1EZZA 1NI4B 1PJQA 2PR2A 1GPLA 1NZJA 1VPDA 3FWZA 3LCMA 4MS1B 4KRXA 1VDZA 1A5AB 1G0NA 4BMZA 1RZUA 1P0PA 2FMKA 3H16A 3QVJA 4J2TA 1W0KA 4ZO8A 3U7JA 3WISA 1PGJA 1XMSA 2YV4A 4RTRA 4DMMA 1HH4A 2DQYA 2GK3A 5DCWA 5AHXA 4EKGA 3SN6A 2PQ6A 3CVWA 4TMKA 4KFTA 4MKZA 4N9QA 5CFMA 3SMQA 1ZSVA 3H1TA 3PHHA 2Y66A 3AB7A 5E2AA 3WP1B 1KQGA 2FUG1 4IIDA 1PSWA 2FY8A 3HBAA 5FNVB 1VJ0A 3LXMA 4F60A 1MG5A 3B12A 4IYRA 4KWIA 4U8GA 3RS4A 5F78A 3H2ZA 4D46A 1ZRHA 5DV9A 4EABA 3M6VA 3MC1A 1XQXA 1A7KA 3QOFA 2QLFA 4YALA 2R5FA 1SXJC 4Q9AA 4C21A 2GK4A 2QT1A 2X5JO 4P84A 3RFXA 1EXDA 1WEHA 1KC1A 4HFNA 1YFLA 5EXXA 4BLWA 2AFHA 4FJ2A 3BKWA 1E59A 2DR0A 1IJKA 4K9QA 1RPZA 1GKUB 1Y7TA 1QC5B 3KQWA 4OK3A 4XGIA 5C8YA 5IKMA 3QVXA 4EIWA 3HB4X 4ENWA 1IQUA 5AI0A 2V3VA 3HBFA 1RMTA 4WKGA 4BQPA 4DBVO 3EYAA 4QYTA 1U3CA 3RC3A 2VQ3A 1OXBB 2C61A 2QR2A 3AM1A 2XMQA 1U2PA 3QVKA 1M34B 4YDSA 5DKFA 4IQGA 1DEHA 4XEUA 3KOXA 2WAMA 3ILSA 3IGFA 5KB3A 2OVFA 4GMDA 1JR3A 2WTNA 1EU1A 2B3TA 3L0SA 4OHZA 3UJNA 2ZRKA 2QM7A 1UXHA 1K5HA 2B99A 2AI2A 1AGYA 3AMVA 3PHLA 4BLRA 3DMPA 4Z9YA 3ZGYA 1M83A 2ZIEA 5THXA 1WU7A 4IH9A 2D00A 1C7JA 3QNWA 1QGDA 3B2EA 2H1WA 2NO1A 1YOBA 2ZWVA 4LK3A 3PQ7A 5DM0A 3NYIA 2GEDA 3RPEA 3K72B 2PMWB 4LV5B 5TS2A 1BVUA 4MJ3A 2SHKA 2PMKA 5EIAA 3LP6A 4CL0A 4E94A 5KQGA 2VLIA 1GVHA 3M5DA 1UFRA 4HX9A 4ZREA 3KKOA 2UUBB 2QVXX 5K03A 5AK6A 2ZT6A 2BGGA 4JJ8A 2ZYAA 3CSUA 5C1IA 1JEEA 2QIOA 1NMXA 3WV5A 4EHHA 3AIKA 3HCFA 4YAKA 1E3MA 4DNXA 2YHAA 4PGFA 5DULA 2BKAA 2O0MA 3B85A 5JAPA 2VFAA 3RRFA 2C1XA 4J16A 1OC2A 5H68A 5F98A 3IX7A 3ZLUA 4CGYA 3GC6A 1GGKA 4E3WA 3FCOA 1N1DA 2DHCA 4QFCA 3W2HA 3ZJTA 1G18A 2FPPA 4L5YA 4QOEA 1KJYA 1XX6A 3KQOA 4P7GA 2VYFA 4TKUA 5CVTA 5C8VA 3AHEA 4BO6A 3W3ZB 4FI3F 3NFYA 3SI7A 5KTTA 1V4NA 4NJOA 1QG6A 1RHKA 4CL8A 4YT4A 1PR3A 3RR2A 1C9JA 2B83A 2O1EA 3DDSA 3MJHA 3WLEA 4UOZA 2IH4A 1XQ6A 4JQZA 1Y6QA 3FNIA 4JUFA 5JAQA 1G3UA 2Q5EA 2QAGC 3Q8WA 4M9UA 4E5SA 1DX4A 4GYWA 2FN7A 3NZEA 2NQTA 4URYR 1L3BA 3B89A 3O84A 4L6AA 5FL7D 1XNJA 2CLEB 4L51A 1FC0A 1KIMA 4J29A 3BM5A 4UZFA 1N3YA 1B42A 3N74A 3OU2A 5BUSA 1P7ZA 1NE7A 1UJNA 2JVIA 2Q49A 2W83A 1V39A 3R5FA 1T34A 2BMDA 2XGMA 3GLKA 2H65A 2ZYGA 2ZK7A 3TRIA 2FWNA 1XJ0A 3JVEA 3MM4A 3N1UA 4FD2A 1XDZA 1LBSA 2PWAA 3AINA 5IAGA 2NSHA 2IYWA 2Z4RA 3P26A 4XM0A 2VJCA 5HS6A 5HFNA 1QFJA 3V42A 4D4LA 3D4NA 1P1JA 4BZWA 1RKUA 5AM4A 5F51A 1E1CA 4J3JA 5BWMA 4UM9D 2Q3JA 4KGVA 1JIUA 3IULA 2AMYA 5FO0A 2X2EA 2EBHX 2PWPA 3I37X 3HGMA 4G0YA 3R8CA 1C3XA 3DO6A 3OBBA 4QBKA 1JA9A 4YDRA 1TT7A 2ZWIA 3LRPA 4HDSB 4ZHSA 1GGJA 1XQVA 1A4RA 1L4NA 2BHSA 4KR0A 1WY7A 3UICA 3ZWCA 1J2RA 2MMGA 3DOIA 1UPBA 3ZJVA 3LQRA 3NTOA 2AG8A 3LHFA 5EWJB 3ZE6A 1HUQA 1Q0RA 3WK4A 4ZT7A 5B1IA 2ZT8A 3G13A 1B4DA 5F5NA 3IOYA 1AK9A 2BHLA 3WO0A 3ZIAD 3MBIA 3H5AA 2I6GA 4OK6A 1FTWA 3RUPA 5IF9A 1CX9B 1P1IA 2Q7XA 3WYNA 2PZLA 3BMCA 1M1NA 1VKJA 4D8TA 1YFZA 4M54A 3ZIUA 4CR7A 3JQ8B 3WL4A 4F8JA 1P72A 1RCUA 3C3YA 5LZ9A 4MLZA 3WL5A 3JQ7B 5IFKA 5HG0A 4X97A 3VR3D 2BGWA 3E81A 4LDZA 2HRBA 1L6RA 2DQ4A 2HY7A 3M6UA 3E7WA 2NVBA 2AFHE 4EH1A 4MAFA 2QHXA 5AW8A 4OXYA 4AJKA 2DPYA 3EXAA 1NP3A 4IJWA 2X7XA 2DBZA 4QTZA 1SH7A 3DCIA 2B7LA 3AEQB 1NLFA 3Q9UA 3AETA 3OC0A 4F84A 5HZGA 1JQBA 3PPWA 1WZCA 4AZ3B 2MR5A 4PG6A 3OMWA 3ZG6A 3BA1A 4R7TA 2AW3A 4CMAA 1RQRA 4LYAA 3LYHA 2TRSB 5FR1A 4NQRA 4CF4A 1KVQA 3V48A 2VZ0A 4P54A 2YXEA 2Z09A 3CVOA 3FRIA 5ALRA 4TXMA 2HYIC 4M1SA 5F2EA 2RGDA 4M1KA 4PCLA 1WCIB 1CY7A 3H7IA 3NQ41 3K70D 1XR3A 1JDNA 1YACA 2WZQA 2P67A 5FTKA 1ECLA 2VHTA 2PYDA 2Q3FA 2OYCA 2F9MA 1GSIA 5ARBA 2GAJA 1C3EA 3K6JA 1TAQA 5J47A 1D4OA 3OSZA 1YKFA 4NNOA 4R40A 1J0BA 3KR0A 3D8HA 3PEUA 3CRVA 4QAQA 1LPSA 4BWFB 3HZOA 2ZJ1A 3QBTA 1RAHA 2H5LA 2WOOA 4EY3A 4HB2A 2GCGA 4CLDA 1VLJA 1EDOA 1N2BA 1L7BA 3L79A 1HNWB 3K96A 3QEMA 4FOOA 5AKHA 2QTGA 2ZYVX 3FYDA 1G1AA 2JFNA 4M0DA 3OWOA 3TW0A 3SJ7A 3WHLA 4NZNA 4GGOA 3NBZC 1ULHA 2VATA 3C3WA 4KYUA 1FRZA 3HR7A 2IC5A 4X1OA 4EYGA 1QPZA 3C8HA 1OPRA 2Q1WA 4ZVOA 3F49S 1C30B 3ZBPA 3A1DA 4F4JA 4MV7A 3BXHA 2O2IA 1DT5A 2R85A 4ND6A 1JL3A 2Y71A 4IX9A 3TQFA 5BOSA 7ABPA 1EJBA 1F5SA 3OLYA 4K81B 4P7JA 4F5EA 5AICA 4HB3A 4MZDA 2IHVA 4PR0A 4M22A 1ICIA 3I5YA 5JO0A 1N2EA 3KBOA 3BXPA 1YONA 3THSA 3V7FA 4M0PA 1IRXA 3KAQA 4QXRA 2EDAA 4Z3KA 2AL7A 2AJBA 5F73A 1TCCA 4F56A 2ZQ5A 4HAZA 3NM6B 3O9VA 3AERA 3PEVA 2JDIA 5CFLA 1J7KA 1E5DA 2OCYC 1V7QA 5H81A 2QEQA 5SV2A 4GQBA 2ZB4A 3OTIA 5IM4A 5A4JA 1NVVQ 4ZCPA 3R7FA 5CH5A 5A3RA 2UZ4A 4NE2A 1Y3CE 3FG9A 5AKZA 2Z98A 2NPIA 3OLWA 1KQFA 2WV9A 3KLBA 5AM3A 2O0LA 2Z5LA 1NNEA 1AH2A 3OQIB 1QV7A 2VI5A 3FPCA 2C0QA 4ZPJA 3ZY2A 1DU4A 1G5PA 2QVCA 2NACA 3DR5A 1P5FA 3GFQA 2OO7A 1FZTA 3L6UA 1A9QA 3DFIA 3A4NA 4OVKA 5C0OE 4CPDA 4EBFA 4X00A 1E7QA 1EWKA 2IYEA 2P2CA 2P9TA 3LBIA 4FKMA 4QUDA 5AKJA 1AZTA 5HCNA 5IBRA 3Q2IA 2CJXA 1WW2A 1GU7A 1KMMA 2ZYUX 4ZVLA 1N2OA 4TV9A 4NV1A 4O2AF 2VNJA 3UWMA 4N4AA 2OAEA 3DE6X 4TMYA 1I7SB 1ZWKA 4WA8A 3SE7A 4M8IA 5A0FA 3GLFA 3PX3A 4X64B 2V54A 3IHLA 2ST1A 1JNYA 2XEXA 2PD3A 1MT3A 3K6KA 4MKHA 5ECDA 1I1HA 1NVAA 2QRJA 1ZISA 2DHRA 2IEBA 2VJKA 3N5CA 1M2WA 3BRQA 2GJ8A 2O2CA 2VQDA 4OI2A 5F7OA 4JENA 4PQYA 4X92A 2XUHA 5DSXA 2KM1A 3X2SA 4IGFA 2WSSD 3PQEA 5BXQC 2YWEA 1QH1B 1XRRA 1RACA 5C8XA 1FJXA 1I7PA 1EFUA 2HJSA 3ABQB 2G7ZA 5DSZA 4DJJA 3SEFA 2EP7A 5DASA 16PKA 3LT2A 1FQOA 4UCWA 1AGPA 1KOLA 4LXQA 1DQNA 3GEPA 1ZUNB 2W8ZA 1VL6A 2CVFA 3EBPA 4B3SB 2D3TA 2FLVA 2QN8A 3NU1A 1SM4A 4WCFC 5AHWA 2R8XA 3IRVA 1UWLA 1V25A 2XWBF 4IHJA 5H16A 2VAWA 2APJA 1TPYA 1YMUA 3D2CA 3DTVA 1J25A 4FFNA 4J75A 2BP7B 1ABBA 1VIAA 4WERA 1CRPA 3SR3A 3HN6A 2W42A 4G0WA 4F2DA 2IOQA 2F43A 4N3AA 1B41A 1JB1A 2FSIA 3DDOA 5FBQB 3FDIA 3C87A 2NLOA 2PMEA 3QEBZ 2C0PA 2CYAA 2YV5A 3Q0IA 1SEVA 3P5BA 2IWRA 4UTXA 3VZBA 3S8MA 1I7LA 1R9JA 4JVOA 2DM6A 1NR1A 1T9BA 4G0ZA 3RBZA 1G5QA 2GJKA 2WWHA 3B82A 1K7FB 1ZIDA 2BW0A 1JSZA 2J4DA 3GMIA 4P31A 4PEVA 2TS1A 4RD1A 4B2PA 4BNYA 1NF3A 2FSFA 1DAPA 3O26A 2PH5A 3ZS9A 3Q9LA 4YXWD 3I6BA 4YRKA 2JGEA 3CHYA 1Q0ZA 4A03A 1Z83A 1E2DA 4RTJA 5IBCA 2C59A 5E7IA 3H2JA 1Z16A 3KL4A 2RGAA 1WD5A 1HE1C 4NIMA 3RV3A 2R97A 3SZGA 3TLZA 1SU7A 3LW7A 4CKEA 2RKWA 2CV0A 4UD2A 3ZKWB 2WWTA 2H4WA 4MVJH 1AN9A 4GPEA 4AJ4A 2HPHA 5B7GA 3AVVA 5HIIA 4YMLA 4R51A 3KTAB 3TLAA 1LPNA 3IT1A 4ZZ1A 1QK4A 1GL6A 1GG9A 2VHWA 3NP9A 2FHSA 5L53A 3IQIX 1AZWA 4NTZA 4HDKB 4C0XA 4J43A 1BGXT 1PWEA 2DFPA 3JQ6A 3FI0A 3S27A 3TIIA 3E3AA 3S8YA 1JH9A 1F14A 1E9EA 1E8NA 2F4NA 3GGSA 4Y7CA 1M75A 4OQLA 1EVKA 2DVMA 2V7BA 7AT1A 4G6ZA 2YQ5A 1KAMA 3A3KA 2XYVA 2BHTA 1LZLA 2ZSBA 4DDKA 9ABPA 3ZWAA 1IOWA 2GETA 2IDKA 3BYZA 2ZUTA 1OFVA 4WOKA 1ICEA 1J2YA 4G56A 4UKDA 4F86A 4DR5B 3BMOB 3ZWYA 4CV3A 2RHHA 1FB5A 4FFPA 2W8BA 1CR4A 3FLEA 4NLLA 3K0BA 2FGJA 3RGWS 5KKCA 1J22A 3LCJA 1EWRA 3RH0A 2XWSA 3DT9A 4NFYA 3EIEA 3QGMA 5LD2C 1MC5A 2CLFB 1JECA 1XTJA 3FNQA 1R66A 3SYRA 1XNRB 1B16A 1NVWQ 4MYDA 5K0LA 4HRVA 4ZQHA 4Z1MD 2RBEA 1NM5C 1MZVA 1JHOA 3B60A 3LL4A 1BIFA 4WD3A 2W22A 1P17A 4L72A 3RVBA 3S70A 1QRSA 3MERA 3O5AA 2I8LA 1NWHA 3H1PA 3VX3A 3WIBA 5FH9A 1P18A 5B2ZA 2DTEA 1NQUA 3O73A 4MIYA 3I01M 5ECWA 1EZ1A 3NCHA 4UNSA 1H05A 4MCIA 2P40A 1LPMA 1X42A 4L15A 4RAOA 3FA2A 1RQXA 2PSHA 5E2BA 3G2PA 2WG1A 1LY1A 3KLPX 2X1LA 3Q98A 1FX1A 1T36A 3TLMA 3VDMA 1QIMA 1SUPA 1LRLA 2WC1A 1EUDB 1ZKDA 1P81A 4YAIA 1BXRB 2A57A 3AILA 5B36A 2QW0X 2PVPA 4OIMA 4LQLA 1CJSA 2Q50A 3IKJA 4BX0A 3KTAA 4JVMA 3AXSA 2F00A 3LU1A 1K7SN 4RVHA 4UW9A 4AW9A 4QGSA 5HRAA 3CM0A 2BYTA 2GUGA 3TZBA 1OYWA 1Q1QA 1N5DA 1SCKA 3PVZA 4ZICA 3EIQA 3IUMA 2PUFA 3LA8A 1IWOA 3MGCA 3P9XA 4GOOD 1QAQA 3Q6MA 4QIHA 1SC6A 5EZYA 2NOAA 2IP2A 3KZOA 5AK0A 1O6BA 3SICE 2HUPA 5IVHA 3HEAA 1HFEL 4DLTA 4LW8A 2QNBA 4WI1A 2ZZMA 1X7ZB 4JI2B 2O3RA 4UFNA 4Q1VA 5BQPA 3DQPA 3USZA 5A1JA 4GLFA 1ZGAA 2Y1KA 4URVR 4ZCMA 5JISA 3U9SA 3Q1KA 3TF5A 3TUZC 4QSHA 1B14A 1B93A 2V9ZA 3CUYA 3PC2A 4XB6B 5JQGA 5KDDA 1CB7A 2QA5A 4LJ6A 4F72A 1LLDA 5DYIA 2CXSA 2RG1A 3KPJA 4S1OA 4BAGA 1S89A 5K99A 3EHDA 3FYUC 3KDAA 3N8GA 3QZUA 3ROTA 1G8YA 4OU4A 5A03A 1A8QA 4MYUA 2FN4A 1WE2A 5I9NA 3RVKA 1F2UA 1N9ZA 1TAUA 4TKMA 1SURA 2QTRA 3WNZA 1E3QA 2AN4A 4YRFA 2ZKLA 3DMDA 3FPGA 3OZTA 1G3MA 1MEEA 3E9QA 5CW1A 2ZI6A 1SBHA 4D96A 5ALVA 3ENQA 1SGWA 4HRYA 2OD2A 2HLNA 2YZMA 3AESB 1H2RS 1GKIA 3N7UA 2ZZNA 5JJIA 1XRJA 1VPLA 1ZDMA 3OQJA 3HCOA 4GPBA 3IIKA 1OTYA 1KQOA 4OHMA 4Z2YA 2WIAA 5KWVA 2P90A 2PL3A 1ML4A 5CA0A 3I72A 5KCMA 4J1SA 2YQ4A 3LY9A 3REGA 2AQKA 1OMOA 2DTDA 3NX4A 1WNFA 5THQA 2ZCJA 2HNBA 1MW9X 1Q0UA 2J0QA 2FWRA 2YFQA 1Z28A 1ZJJA 2J3IA 2XXJA 4P53A 3GCXA 3VDQA 1K8XB 4H0CA 1PP4A 4M7PA 1EKXA 2QJRA 3CEAA 2Z9DA 4D8XA 4LPKA 2IU3A 5K2MA 1EFRD 4FEGA 2BM9A 5B37A 3UV3A 1KFBB 2AC7A 5LZ4A 2ZI5A 4QGGA 2DETA 1GEEA 1Q7TA 1ISJA 3N8DA 4IIJB 1OX4B 2IZ1A 5B6PA 3GLFE 1K0UA 1TU0A 5IUKC 4AICA 4XIJA 1HKUA 1UT5A 3R9KA 3O7WA 4QDZA 4UU1A 5F3DA 1SQ0A 4P35A 2Y76A 3SEAA 4OF4A 3BXXA 4YCAA 2DPLA 2GEKA 3KSZO 4YS6A 1NW7A 2QRUA 1Z4MA 1NW9B 5CAEB 3L7LA 1EFVA 4BRZA 1DZ3A 3CLUC 1A8SA 5FPTA 3FDXA 4INAA 4RETA 3JYHA 2F67A 2FSVC 5IVIA 4KZPA 3GA5A 3DAGA 2HR1A 2P6RA 1PTKA 2BKLA 2ZTMA 2GZAA 5IM5A 5A5VA 4UDOA 1QGUA 4WOBA 2VBIA 2VPQA 5DLEA 4AQ7A 4ACBA 4DYHA 3Q72A 4PG8A 5L7TA 5JQWA 4I8DA 1CZNA 3NBYC 2HU5A 5ADHA 1M7BA 2WYHA 1P9RA 1M5RA 2BTQA 3W5JA 3UXEA 4QHTA 1U8YA 5EEHA 3E27A 3MD0A 2BGIA 3Q5GA 4TL8A 3RT9A 1H4VB 1J8YF 4EGFA 2X1MA 5FX2A 1MV8A 2OCXA 2WHEA 5GY7A 2JLXA 4RVOA 4BLQA 1FYVA 1FDUA 1ZOLA 1MB2A 4LJ9A 2Y1LA 4R05A 5JU6A 1JG4A 3NTRA 4X41A 3QEMB 5JXWA 4RQTA 5BSMA 3EZNA 1Z0KA 1MXFA 5CH3A 1TA0A 1YU9A 1KL7A 3O4VA 4NBWA 4BE7B 2X5XA 2OP0A 2O2JA 1KBQA 3CFYA 3IHTA 3L7MA 1FYEA 3E9EA 4O4JA 4QBIA 3DPSA 3SHTA 2ADOA 3Q7SA 4D82A 4AMYA 3TVTA 5JSQA 4MNTA 2OY0A 2K5UA 5AIAA 3UAGA 1N77A 3VR5H 3IIIA 3C24A 4HD8A 4RK0A 1KNQA 1EE2A 2A9PA 4IEIA 2OGUA 2V0CA 3AUXA 2Z3VA 5HDQA 3SXUA 3WRVA 5AUNB 2ZUFA 1JLKA 3TSAA 5JW6A 5IC5A 5LIRA 5DLDA 4JFAA 1UC9A 4PQGA 4EMUA 3KQUA 3K6RA 3TLGB 3WGOA 2IHYA 4JP2A 3NHZA 2ZS7A 5E9AA 1UODA 1UQTA 3RFFA 4QT0A 4JJGA 5EOVA 1ID8A 4JS0A 3OZRA 2Z0MA 4PLPA 4ZU3A 1FE8A 4HJRA 2IOFA 4L5BA 4TQGA 4J9UE 4OSEA 3U44B 1Y6FA 1NQWA 3L4SO 2BUAA 1SG6A 4GC9A 3HP7A 4G4JA 1YE3A 3I9OA 4UREA 1FVFA 3V1KA 4BWGA 3OCYA 5LQKA 4G1CA 3BJRA 5IUJC 5GQSA 5JFOA 1P4GA 3QIAA 2O8DA 1GA4A 1IWPB 2WM2A 4KO4S 3DC2A 1NBHA 4B3BA 3RS9A 5B7QA 4MULA 2J5RA 2QQ5A 4HGZA 3ZVMA 2FSPA 3M2PA 3NDRA 4HFRA 4EMSA 1QTNA 3D6FA 4LRUA 3JQ8A 3R9XB 4J2HA 4U2KA 1ST2A 4DTIA 3VOBA 2WNSA 1K6IA 3GGJA 4HG2A 3ROKA 1UUFA 3ANNA 2JZOA 5EJ2A 4RMNA 1SB8A 2PUWA 2ANCA 4DEVA 3PR2B 4A2QA 1PX2A 4B31A 3CO5A 3D3JA 4COKA 2XE7A 4IUBS 4X1IB 4PVDA 1SQFA 1VHQA 3WKEA 4DLUA 1D2CA 2ZU0C 3QTLA 1XD9A 2XF2A 2JLWA 4DRXB 1KP9A 2VPYA 1FYWA 1NPYA 5AKXA 1K92A 5EMKA 4AN1A 3HB9A 4PYQA 2HSDA 4IKOA 1K3UB 4ZPXA 1MO3A 1P6QA 5IYZB 3DF9A 3UOAB 2RJNA 3E1KA 3AR4A 1KI6B 3U3ZA 1M2HA 4OOFA 5I3ZA 4JB8A 3U44A 4GP6A 4RZXA 1RR6A 2V7QA 1GTMA 2OK7A 2PAFA 3BORA 4OKIA 5LZ5A 3T54A 4EJ6A 1PL8A 521PA 5T8KA 3T9FA 1Z75A 4XUGB 1UC8A 2FRVA 2A35A 1AGRA 1CQZA 1V16B 4W9NA 3VKHA 1Y33E 2IT1A 3C3DA 3WGGA 3NYQA 3EWSA 2WU8A 3QM1A 2XD9A 3HJAA 3I05A 4LHEA 3IXQA 5AXCA 4CW7A 3U26A 421PA 5LMNB 3IIMA 1SXHA 3DP9A 1CZRA 2J41A 1MH9A 3MK31 1DQZA 1SCIA 3CRZA 2JLAA 3OFNA 4CUJA 1TEXA 1QLJA 4OQMA 2CKDA 2GERA 4L0QA 4QVIA 1EXMA 2XMSA 5DRYA 1MTZA 1ND6A 2NU7A 2XNHA 1QUFA 4C2UA 1GRNA 4PR3A 1E66A 3KOWA 1C41A 2JJYA 3T7JA 4O4JB 1KPGA 4JP5A 1Z2DA 4RE6A 4GE3A 4KQFA 3SYNA 2IW1A 2Q5CA 3QE2A 3A6FA 1BE1A 1RKBA 2DUMA 4GZ3A 5KVQA 4MLDA 1KI4A 4I6EA 1J9EA 2CFSA 1IHOA 1GOTA 1VGRA 4KMSA 3P45A 2QX9A 3T3IA 4B8WA 1P80A 3A1WA 3RROA 4N3CA 4IKPA 5FLYA 1SIUA 2CZCA 3TNFA 4R1QA 3DEZA 3G2HA 3R9XA 3A3PA 2P77A 2QZ9A 4C6SA 3LRTA 4WW0A 1WB4A 3JS5A 3L1IA 2DSNA 2ZSEA 5JJCA 1VSTA 2EJWA 3CTMA 3NXSA 5IN5A 3SHOA 3FUWA 2C97A 2XMZA 4HY3A 3WL6A 1PS0A 2C5SA 4Q47A 4DANA 3A1CA 5CEFA 2AB0A 5DJ5A 1O1YA 1KAHA 1MVLA 2R84A 2GEFA 3ZGNA 2O8DB 1RBYA 3MMXA 1RE1A 1VG1A 1UEXC 5EWMA 2VHEA 3BWVA 4FC6A 3PV0A 3ROPA 4D4KA 3VO9A 3CF6R 3DDZX 4RK4A 1CEYA 2A92A 3UO8B 1HURA 3EVEA 1D1PA 2X0NA 2R8PA 2XA2A 3X44A 1JJBA 1R6XA 3OFKA 3QEKA 4JLAA 2J7KA 3IPLA 3O8BA 3RVNA 2NTJA 1L7EA 5J43A 4LSGA 1GPH1 2PH3A 3E23A 4PU0A 2HSEA 2VA9A 3D7SA 3EOZA 4JYZA 1HTWA 3LUKA 4PLZA 2HYDA 5TJ9A 1U2QA 1AK2A 4DWOA 1I7QB 3LT4A 5G4KA 1JFSA 4ZAVA 4YJHA 3QEJA 1NU8A 2W2OA 3ROFA 4C6TA 1G291 3KU1A 3V80A 2OFFA 1RM5A 3C15C 4IQ0A 4LOKA 3R5JA 3CR8A 4MI6A 5EJ9A 1EFHA 1KK1A 1K9VF 4MJXA 1JQLB 1PR0A 2WSIA 4QTUB 2GHTA 1CE8A 1M34A 4D26A 3HA7A 4M7WA 3REFA 1J1UA 1X1QA 4UDYX 2VNKA 3N05A 1P75A 5E9WA 4C0QC 1MLDA 1NW3A 4MR7B 1ZYUA 4TUYA 3KWLA 2JKVA 4L3WA 1A2KC 2Q5FA 3DL4A 2ONJA 1ODTC 1TFUA 5HGXA 3MEQA 1G2OA 2WHXA 1K7EB 4IINA 2E89A 2UXCB 2F59A 2FPUA 5C8YB 3Q8XB 4DQVA 4OJNA 3PUYA 3PITA 2IODA 2AF3C 3R0JA 4S0XA 3U13A 1ZQ1A 3DLAA 3GGOA 3H5NA 2NT3A 4KKXB 1FRFS 1FQWA 4PGHA 5AKEA 1WXHA 2GJAA 4F9GA 3HR8A 3CEJA 3ZV3A 3H8SA 2X1VA 4NMHA 1VQ1A 5C34B 2J67A 3LC2O 4QYXA 4U8HA 3EXEB 2VSNA 3V9PA 5EC8A 3ZI4A 4UVHA 4EENA 1OLXB 5GIPE 1CUYA 2IY7A 4CZ2A 2J7PD 5BMOA 1RZVA 2OGWA 2BGUA 4N5NA 4PIVA 1ZI8A 3PR3A 1JIKA 1EUQA 1WZNA 3NORA 3OFJA 1U1GA 1M76A 5F33A 1CNEA 1WB5A 4CMCA 5CAEA 1CWUA 1OD6A 4B46A 1Y5MA 4OQYA 3WLFA 3DDWA 2DUNA 5GV8A 4Y6SA 1KDZA 1KRWA 4XIIA 3FSEA 1OH8A 3PGA1 2RGWA 3ACCA 3T7TA 4MS1A 2XUFA 3PGVA 5FBZA 3RJ5A 3SSMA 3TQIA 3P4UA 5CPBA 4A1OA 2AXNA 1SNYA 3ZD8A 2GVDC 2R62A 2Q46A 4Q6WA 4IXDA 5FA8A 1FP1D 2O7RA 1JEAA 2Q6OA 5CEJA 1W9MA 2JLSA 2CD7A 3K1TA 2V59A 3I62A 4MV1A 4DAOA 4Q21A 2CT8A 1Y7LA 1DBSA 2RGEA 4Y2RA 1RPNA 4KE9A 3SJBA 2V6IA 4JLWA 2HCFA 2XT0A 3ISVA 2H63A 1GQSA 1T9AA 1SBIA 4XRRA 2VYVA 1UOQA 2ZUVA 1NYQA 4S35A 1JGTA 2A3NA 3PKIA 4CM7A 1FFCA 1P1RA 2JLZA 2HNAA 3RU3A 3BCRA 2WP0A 3AVWA 3UT5A 1M67A 1KZHA 4XR9A 1P7PA 1I14A 1VB5A 2DBVO 3EB9A 4O33A 2PWZA 1EFRA 3KU4A 1T36B 4A6DA 5HW0A 1B73A 1LVUA 3FSRA 4LV8B 4YYEA 1B15A 2Y3IA 4GBJA 2B4RO 2JA1A 2YIJA 1OWNA 5CTAA 5AW6A 4FR5A 4XUEA 4MYCA 3TXYA 4F11A 3I34X 4FT4A 5AJTA 2J0VA 5AM0A 2I29A 1Q0LA 2P9EA 3FYSA 3QG1A 4NEGA 4DLVA 4LI3X 1IUPA 1Q14A 5BUQA 1LU9A 1IN4A 4OQPA 4TS3A 5BMVB 5GZ3A 1VIDA 1XC7A 4NPCA 3ROXA 4H7PA 4OEHA 1OYOA 2RI0A 5F5LA 5CK5A 5ALHA 5EUBA 1L8AA 5G41A 3ZWPA 2VYNA 4D42A 1KI2A 1S7CA 1PKEA 2FW6A 1Q20A 3I04M 3ZHVA 1PF7E 2JHGA 1XWWA 4ZOLB 4RXTA 3SC2A 3F6SA 4H15A 1XRNA 1BAPA 2QR3A 3URMA 1KDOA 5KNLA 3VYTB 1H2EA 3DEIA 5KBYA 3ZX4A 3SJCA 2XKBA 3P9PA 2OV3A 2LKDA 3CURA 1ZKMA 5B64A 4YB8A 4JLMA 3GFFA 3FYUB 2PGAA 4HLNA 4PLTA 4QYMA 1V8ZA 4QECA 3T1VA 3W6OA 2W71A 3P2MA 4DA7A 1A8PA 2F48A 4CCYB 1E9AA 3EC2A 5T4HA 1U8XX 1E20A 2GDJA 4K28A 3CJRA 1OTHA 2ZZKA 2YJ5A 4OI4A 1M9NA 2Z2JA 3VNVA 3H99A 3QE3A 1Y3IA 4PRLA 2GTIA 1SXJA 1HF3A 2I6SA 2BGJA 2FQ1A 1PJSA 2HEGA 2PD6A 3NHBA 3IKLA 1H5NA 2O1SA 5LXTA 3TUIC 3DT8A 1E1MA 4BKPA 1SY7A 4O1MA 4OHOA 2DQZA 5EERA 4EHDA 1FMJA 4PM4A 1BZYA 1SVKA 3BICA 1F1JA 4AJEA 3QP9A 1I3CA 1A96A 3TDMA 2AJCA 3FCYA 3OO0A 3OWXA 1QE3A 1QUEA 1XZLA 6NULA 3FYHA 1W4RA 4Z0PA 3AF2A 1AO0A 1WZ2A 1LZKA 3GYGA 1EFDN 3ETEA 4HNHA 1THMA 3H9BA 4CR8A 5ULLA 1FDVA 3ZKWA 2QE7A 2YVAA 1HA3A 3OCXA 5AI9A 3C48A 1NVFA 2OHXA 3SBEA 1KIAA 5LQJA 4ER6A 4HWPA 3ZI7A 2GEVA 4CG2A 4RZQA 4CFZA 2I99A 4OBXA 4UCFA 3NT2A 4J8PA 5KIAA 1YOVA 3SZ3A 2V6BA 1P2SA 1XDUA 5J2UB 1LJLA 2ZJ4A 3COWA 5TARA 1WMAA 3PEEA 4N40A 5AKKA 5L7YA 3C7CB 3WBBA 1YVRA 2I4MA 4BBPA 1NBMA 5C7IO 4H17A 3FPJA 3LECA 1ZG3A 2FW9A 3C98A 4TT8A 4DBLC 2W43A 1NBME 3VFDA 2ONZA 1U7PA 4LMAA 4R54A 2H08A 1IFXA 1KO7A 1MGPA 2I80A 3H2HA 4K