4FLMA

S-formylglutathione hydrolase w197i variant containing copper
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
286
Chain Sequence
MKVVKEFSVCGGRLIKLSHNSNSTKTSMNVNIYLPKHYYAQDNKRIPTVFYLSGLTTPDNASEKAFWQFQADKYGFAIVFPDTSPRGGSWDFGQGAGFYLNATQEPYAQHYQMYDYIHKELPQTLDSHFNKNGDVKLDFLDNVAITGHMGGYGAICGYLKGYSGKRYKSCSAFAPIVNPSNVPIGQKAFKGYLGEEKAQWEAYDPCLLIKNIRHVGDDRILIHVGDSDPFLEEHLKPELLLEAVKATSWQDYVEIKKVHGFDHSYYFVSTFVPEHAEFHARNLGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-formylglutathione hydrolase
publication title A role for His-160 in peroxide inhibition of S. cerevisiae S-formylglutathione hydrolase: Evidence for an oxidation sensitive motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
total genus 88
structure length 286
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.1.2.12: S-formylglutathione hydrolase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4flmA00
4EZIA 2Z3ZA 3WL5A 4WJLA 1LPPA 5HF6A 5T4EA 3O4IA 3HJUA 4UHBA 5AM4A 4UHDA 1NU8A 4AMZA 4HAIA 1WPRA 3W9UA 3RM3A 2XE4A 1DTEA 3OC0A 3RLIA 5CTAA 2VAXA 4U2CA 3KXPA 2Z3WA 2GBGA 5C8ZA 4H7IA 4DLNA 4KAJA 5BWBA 3RK4A 1EK1A 1XRQA 1ZD2P 1W4LA 4G4JA 1UXOA 4L3WA 3G9ZA 2YYSA 5ISMA 3FOBA 5FLKA 4P9NA 1GPNA 3EF3A 1LBTA 3SK0A 4HS9A 3LIIA 5AOCA 5HZGA 1GQSA 5CT8A 4X6XA 5DYWA 4W1SA 4OB7A 2FUKA 5F4ZA 2DR0A 4NMWA 2GYUA 3O9VA 2ZJ6A 4N8DA 1CLEA 4HXGA 4X90A 3G02A 1Y7IA 1P0IA 2DQYA 1HLGA 3FLAA 4MWTA 3UUFA 3KDAA 5FRDA 2OGSA 5K3FB 2WTNA 3QH4A 4HZGA 3F96A 4HXFB 5AI6A 5JD6A 2I3ZA 3F67A 1EH5A 5C8XA 4HVTA 3R3ZA 4E14A 3FYTA 2H7XA 3QPDA 2CKMA 2HA7A 2YH2A 4OUKX 4J0JA 5ALLA 1EDEA 4X85A 1CUVA 2C58A 5K5EA 3IUNA 3RARA 3U0VA 1QIHA 4TVKA 3P2MA 1H2XA 1DQYA 3CN9A 4G9EA 4C87A 4ZV7A 5ALMA 1EK2A 1AKNA 1XZFA 3HXKA 5ALXA 1XLUA 4WY5A 2QUAA 5HFNA 2X8BA 1ODSA 1QIJA 4OB6A 3IVMA 1QTRA 1XZHA 1L7AA 4CFSA 5ALYA 2I03A 3BIXA 1FSSA 3HABA 3QMWA 4BCCA 4W1RA 4UHHA 1LZKA 3A70A 1XZMA 3PFCA 1C7IA 4QDXA 4Q3KA 4F5ZA 5AI0A 4UUQA 2XMQA 1XZBA 4BZZA 2DCMA 5AI4A 1NU6A 4FNMA 3TRDA 1XRMA 4A16A 2HA3A 3BJMA 3T52A 2GYWA 4WFJA 4BATA 2OGTA 2JEZA 3EQ8A 1B6GA 3FWHA 1BE0A 1DT3A 1X2EA 1G4HA 2WHQA 1GGVA 1K4YA 1CUJA 5AICA 3FYUB 2HA0A 4J0HA 3O4HA 3V48A 2J4FA 5CH3A 5JANA 2RI6A 1XZGA 2WUGA 2WFMA 3AJAA 2GYVA 1H22A 5DNWA 3I28A 1WB5A 4UFPA 2WG1A 1QZ3A 3HI4A 4IH1A 4CCYA 3WK4A 2BGNA 2R8BA 5JADA 1QTIA 2C5GA 1JJBA 4M0EA 4ITVA 4YASA 2V9ZA 3D2AA 4X6UA 3AZOA 1ODCA 2WU4A 2ACEA 5ALDA 1XZDA 2DSNA 3PI6A 3CXUA 3FSGA 2DHCA 2GBFA 4AXBA 4BB0A 1K8QA 1ISPA 5JD5A 2ORYA 2RHWA 4I4CA 5AKEA 2CB9A 2Y6VA 1G66A 2XB6A 1AZWA 1UFOA 1FFCA 4BBZA 1XKTA 1F0NA 3PF8A 3V1MA 3WI7A 3L1IA 3PDCA 5LZ2A 5T4BA 4WDQA 1VXRA 4BVJA 4KRYA 1JI3A 3ZI7A 3ZPXA 3OURA 3DEAA 4G4GA 4BTVA 2WM2A 1GQRA 1MTZA 1ZGBA 1SOMA 3G8YA 1N8SA 1VXOA 1GKKA 4WCVA 2QOEA 4BYMA 4Q3OA 3TGLA 4ZXFA 3BDIA 1K5PA 1K63A 3W05A 7YASA 4BRSA 3LLCA 3EQ7A 3H19A 3VJMA 1XZIA 3NUZA 4XJVA 1EX9A 2XT0A 2QJRA 1ZJ4A 5AKJA 4GWLA 4B7ZA 5K3CA 2VJCA 4Y7DA 3WWPA 1X2BA 4H7FA 1ZI6A 3DYIA 4GECA 1B41A 4O08A 4AN0A 4X6YA 2DHDA 2HA6A 4QDOA 1VJ5A 3WKEA 4H18A 5D3KA 2EDCA 3WJ1A 2Z8XA 1CUGA 2V96A 4BCDA 3EQ9A 5E4JA 1A7UA 1QFSA 3QM1A 2WKWA 1SCIA 5ALKA 4QLOA 3AILA 3FLEA 3M3DA 3C6ZA 4L9AA 5AIBA 4Q82A 4PSDA 3WK5A 1Z68A 3QITA 5FOQA 3DD5A 1EB8A 1UK9A 2J3DA 5JAUA 4RE6A 3DYVA 5CH5A 4EB0A 4K5QA 5C7YA 5CT4A 5ALUA 3OTQA 3N0TA 1KU6A 1U8EA 4J3JA 5ALGA 4EY6A 2RONA 2XUAA 2XUDA 1C4XA 5ALJA 1UK6A 4F60A 5JARA 4OCZA 4UBNA 5HFAA 3FLBA 5AK4A 1LPSA 5ALZA 4W1PA 2IX9A 3GROA 4CI9A 2O7VA 2V97A 3QMMA 1UWCA 1ZD3A 3H04A 4G5XA 3TJMA 1XZCA 2WG2A 3G9TA 4FLEA 4QDZA 4H7DA 4GHWA 3R3YA 4X95A 4BRZA 1YSCA 2PX6A 1ACLA 3C70A 2XQFA 1AC5A 4X00A 4BCBA 2G63A 3L1HA 2GZSA 2JIDA 4B0OA 2XDWA 3BIWA 3LP5A 4KEAA 1ETHA 4D9JA 1J1IA 4JUIA 1JU4A 2JGMA 4DSZA 4EBBA 3D3NA 4ZWNA 2PSJA 3AFIA 1MX1A 1A88A 2FJPA 1TAHA 1UKCA 4A5SA 5A7GA 3C87A 2PUJA 1TKRA 1W52X 3C8DA 2JGKA 2O7RA 5EI5A 4OU4A 4RPCA 3ZLUA 4BAGA 3HRHA 1AURA 1VE7A 1Q84A 5ALFA 5A7HA 4CG3A 1UOQA 1YB7A 1FFBA 2XMBA 4C6HA 2GBIA 3A2MA 1YASA 1EB9A 1U4NA 1E8NA 3E0XA 5JAOA 2ONCA 3V1LA 5CBKA 4OB8A 4PQEA 1XQYA 3O9MA 2QXTA 3K6KA 1JFRA 3WKBA 1XRRA 2RHTA 1R88A 5K3FA 3B3QA 1LPNA 3ESAA 4J03A 4KAFA 2YXPX 2YASA 2OQIA 2ECFA 3AZPA 5D6OA 3WWOA 1IUNA 4CG2A 3RKSA 3QPCA 4E15A 5DNUA 5FUMA 3FSGD 1RP1A 1BRTA 4BP9A 2Z8ZA 1M33A 3G0IA 2PU5A 5AO9A 2G5PA 4HRYA 1J07A 3WLAA 3ED1A 1JKMA 1IZ8A 4B6GA 1LBSA 5CT9A 4PF1A 1WB4A 3AIMA 5IH7A 2JGIA 5FPPA 5H3HA 4C89A 3SC2A 2B4KA 2WIJA 3STTA 1W6RA 3QPAA 5HKAA 4N8SA 3LS2A 4Y2VA 2WQZA 4WFKA 4MEAA 4C4ZA 5ALNA 5ALHA 3R3XA 5YASA 4X97A 1CUBA 4MEBA 2HU8A 2WTMA 4GI1A 5LKRA 2OAEA 1U65A 3STXA 2JBWA 5C8VA 2HA5A 3F97A 1IZ7A 1F8UA 4FBLA 1EINA 2HRQA 3NWOA 4MXDA 5DLPA 2HDWA 4N5HX 3WKCA 3FCYA 3OG9A 1EXWA 4FLFA 4Y2YA 3WMRA 1ACJA 1CIJA 4IH9A 3DS8A 5DWDA 3FNBA 3KOOA 5AM2A 3IUQA 4ARBA 4EHBA 5K3BA 1THGA 1JMYA 3FYUA 2RIPA 2XUHA 4BP8A 4N5IX 5AHXA 2PKYX 3ANSA 4HXEB 2VQ6A 4Q05A 1AGYA 4IH4A 1O6GA 3JWEA 3V1NA 2FJ0A 3WL7A 2J3QA 4NS4A 5AJHA 2XMDA 4E46A 3R41A 3A6ZA 3H1BA 5IVKA 1HKHA 3QVMA 3WZMA 3W06A 4K6HA 1MX5A 3M81A 4RE5A 4B9EA 5CT6A 3Q8WA 4QEKA 1VZ2A 1CQWA 3D0KA 5FXMA 3WZLA 3PE6A 1CUAA 4HRXA 4FLMA 1QIGA 2W6CX 4V2IA 4FWBA 5LYYA 3GELA 4KAAA 1OILA 1LLFA 5ALWA 1SC9A 3G7NA 1F0PA 5JAHA 2XMGA 3I6MA 4BE4A 5ALQA 3BWXA 4YPVA 5IVHA 2AJ8A 2QVBA 5ESRA 4Q3LA 1CUYA 4IHAA 1TIBA 5KBYA 3CCBA 2WIFA 1ZGCA 3WL6A 1BU8A 4AO8A 5E4TA 1WPXA 4UFOA 2ZYHA 4MYDA 4J0CA 4QDUA 4G8BA 5AK3A 1JJFA 3AIKA 4F21A 3ESDA 3HEAA 3IULA 1TRHA 3UUEA 4Y2JA 2OCIA 3C45A 2OCLA 4QNNA 4J0IA 1MU0A 5JALA 4DNOA 1EI9A 4FMPA 4BAZA 2OCGA 4FDMA 5HK8A 1P0QA 1UT6A 3WQHA 5ALPA 2OGZA 1EHYA 2ACKA 2PPLA 5LZ9A 1TK3A 1Y37A 3ICWA 3GA7A 2BJHA 3GBSA 3K2IA 3PF9A 3WIBA 3R0VA 2DFPA 1R3DA 3H17A 5LKAA 1XZJA 5CW2A 4B80A 1TCBA 4C88A 3BJRA 4QLAA 5JATA 1CUCA 3GZJA 5CXUA 3OPMA 1XLWA 4BDTA 4PSCA 2P8SA 2WUEA 3VDXA 3STYA 5A62A 3BXPA 5AKYA 2G4LA 5AKGA 3WL8A 4BDSA 5ALTA 3H2HA 2CEKA 2VT7A 1UZAA 4P93A 1N5RA 3C43A 3HC7A 1H2WA 4X93A 5D7BA 5DYYA 1UOOA 4B81A 2WLSA 3MUOA 3KD2A 3G9XA 4P92A 4DYHA 2WHPB 3KWJA 5EHXA 1JMKC 3G0DA 4P08A 1WB6A 3HLKA 5CRIA 2JGLA 2WFZA 1W76A 1QONA 3U1TA 4EY7A 5LZ7A 3WK8A 4IO0A 4KE7A 1YA8A 5DYTA 1EVQA 2QJWA 5AP9A 4GXNA 4UBOA 1QIDA 4G4IA 5JAPA 1CQZA 3FVTA 1N1MA 3DL4A 1D07A 1DU4A 2XI4A 2Y2VA 1ZIXA 3IA2A 3ESBA 4BC1A 5E4YA 3A2LA 1CUHA 4H7JA 4ROTA 5AM3A 4H7HA 5EHZA 1H2ZA 4C4YA 3PFBA 1ZD5A 4G8CA 1W1IA 5I8PA 1CEXA 3PUIA 3DCNA 4B84A 4WDRA 2VTVA 4Z49A 1THTA 2XQGA 3I1YA 2XMSA 4PSUA 1AMNA 4UHEA 1VA5A 2H9YA 2DHEA 2ZYIA 5JIBA 2XMRA 3UMJA 5JYCA 4LXIA 3QYJA 4GDMA 3R3UA 3G0BA 3DL7A 2WUFA 3WK6A 3IBTA 3F98A 2BGRA 4C01A 3STWA 2ZYSA 3K9BA 4Q34A 1KU0A 2Y6UA 1XRNA 5ALSA 3D7RA 1GPLA 1ZJ5A 1H23A 1XZEA 3C6BA 1CUDA 4JH0A 5BOVA 2FX5A 1QOZA 3I1IA 4DMCA 1MAAA 4TGLA 2XQIA 1Q83A 5A6VA 2HU5A 5T4HA 1HDEA 4AO6A 1JJIA 2EEPA 3GUUA 1BS9A 2QRUA 4UFNA 5ALIA 4X71A 1XROA 3DJYA 1SCQA 5HF5A 5AOBA 2X76A 2ZJFA 2ZSIA 2I3DA 2C0PA 3I2IA 5AIAA 3W9BA 4MYSA 1U2EA 1DWOA 3STUA 1Y7HA 5K3AA 4DMHA 2HHAA 3ILSA 4Q1VA 2E3JA 5HQ3B 4KE9A 1QFMA 1FFAA 5EHQA 3MGAA 3LCRA 1TCAA 4JNCA 1QIEA 4U2GA 1XRLA 5JZBA 3G0GA 1NX9A 3OM8A 1XKLA 4J0KA 5AM0A 2WU3A 1P0MA 1TQHA 5BV7A 1RYYA 2XUIA 1BN7A 2XMCA 1YA4A 1UOPA 3DOIA 4PV7A 4UBJA 2OLEA 3HACA 3I2FA 2WIKA 3E1GA 3PICA 4GLBA 2XUJA 2R11A 4LIPD 2CUTA 2B20A 3SX4A 2VSQA 4H7KA 3DKRA 3M83A 4FFWA 2C5FA 3WYDA 3STVA 4DMKA 2HL6A 2AJCA 1UK7A 2OPHA 2WHRA 3I2HA 5DNVA 1CUSA 3F8SA 1R4ZA 4QDTA 2H7CA 4X94A 2WIDA 2VJBA 3H1AA 2OCKA 5LZ5A 1YS1X 5CXXA 2H1IA 1VA4A 3N2ZB 3C5WP 1LPBB 5DTIA 4Y2UA 2O2GA 4UPDA 3FCXA 3MUNA 2ES4A 3QMVA 4XWGA 3V9AA 4G1FA 5AI8A 5KWJA 5E2IA 3DDUA 2XLCA 1BROA 2PSDA 1BCSA 1OXMA 4KR0A 3HZOA 1E8DA 3CCCA 4AZ3A 4XVCA 2RGUA 4KYVA 2WFLB 4M0MA 5T4FA 4FKBA 5HF9A 2PUHA 1AUOA 4OU5A 3O95A 4CIAA 3E4DA 1E89A 2QUBA 2VJDA 5AKXA 4UHFA 1XFDA 1A8SA 2HU7A 4AQDA 3I2JA 3QBJA 2HRRA 2EDAA 1JU3A 6YASA 3WA6A 4BE9A 2PSFA 2BFNA 2OAGA 3R3VA 2XUPA 4QZVA 5JD4A 2VT6A 1K6EA 4AN1A 3WA7A 1GZ7A 4CIBA 4ZRDA 1UKBA 2JGJA 2WJ6A 2VJAA 5JASA 5D3ZA 2VATA 2OQVA 4AB1A 1DWQA 3FYUC 4FTWA 4RGYA 3WK9A 4BC0A 3FAKA 2QM0A 2WJ4A 1UK8A 1IMJA 4TPKA 2UZ0A 4FBMA 3WWEA 5HKBA 5AKIA 4F0JA 1G42A 2QZPA 5K3DA 4ZV9A 1L7QA 1DT5A 4FOLA 2JF0A 5FKJA 3IUJA 3ICVA 1H2YA 4J0GA 3VXKA 1DQZA 3I6YA 3H2KA 1S8OA 1QIMA 5C81A 3DNMA 3C8HA 4H35A 1G5FA 3V1KA 2GBCA 1KEZA 2VF2A 4WY8A 3LIPA 3H0CA 4MWSA 5EIAA 5EGNA 4FFVA 3PUHA 5LZ8A 3S8YA 1XRPA 4LKOA 4MJ3A 4E11A 1YAJA 1CUUA 4X3CA 3WJ2A 4X91A 5ALEA 1VOTA 1DX6A 3OOSA 1XZAA 3R3WA 3ZV7A 4S0XA 3IB3A 2WHPA 2QR5A 4UBKA 5EFZA 3WWCA 4LYDA 1EVEA 2Q0XA 2ZJ7A 1MAHA 2X5XA 1PJAA 3SWWA 1GPKA 1LNSA 1J2EA 3X3HA 3VVLA 2BCEA 3WWDA 3G9UA 4DGQA 3VISA 5EIHA 2Z5GA 4MQLA 1CUEA 3ZWQA 1CPYA 4Y2RA 3H2GA 1WOMA 1CRLA 2AJBA 4AX4A 3ESCA 2HADA 2QXUA 2V98A 4PW0A 2JEYA 4GW3A 5FP0A 3IIIA 4BZWA 4DTCA 4H0CA 3D4LA 1EA5A 1FFDA 3AINA 3AUKA 1O6FA 3W04A 5FDFA 4OYYA 3I2KA 2XUOA 2XUGA 4NZZA 5CURA 4Y2XA 2ZYRA 3ANTA 2B61A 1LPMA 5JZSA 3W2TA 4EY4A 4DNFA 3M82A 4FNGA 1YCDA 1MN6A 2PL5A 2XUKA 1PV1A 3DQZA 3HYSA 5A71A 1FJ2A 2HA2A 1QE3A 5AK6A 5AM5A 2QKYA 5SYNA 5I9IA 5LP1A 1CUWA 2RAUA 1E5TA 1XLVA 2XMZA 1TCCA 3Q0TA 4DNPA 3AIOA 3WK7A 3D2BA 4J0DA 4XIIA 1USWA 3H2IA 3NGMA 5LIPA 3EBLA 2I78A 4HTAA 4I19A 3L1JA 1MNAA 4LXGA 4BTLA 5HK9A 3O4JA 1ODTC 5HCUA 4LHEA 3DOHA 4G9GA 5AOAA 1QIFA 1R9NA 1IUOA 4K6GA 1QLWA 5DJ5A 5LZ4A 2OXEA 3B12A 3KSRA 5AI9A 4H77A 1L7RA 5FPQA 3DKKA 5HF8A 2C4HA 5BWCA 5KWIA 1CUIA 2H7YA 3NOXA 3H2JA 4Y9SA 1IUPA 1GKLA 2QTBA 4KJXA 1VLQA 4DSAA 4QWMA 1CUFA 5HQ3A 4M0FA 4QWWA 1Q0ZA 3T4UA 4INZA 1BEZA 2PM8A 2BUAA 5AKLA 5CT5A 3MVEA 1MJ5A 3WYNA 1IVYA 4EA6A 4H7EA 2QS9A 1CR6A 3B5EA 1W75A 1MNQA 4ARAA 5IVDA 4ETWA 4XX1A 1XQVA 4ZI5A 2AXEA 2HIHA 1OCEA 4Y2TA 5JZ9A 5DTJA 2BUCA 4DMFA 2ZSHA 1QO9A 3D2CA 1YS2X 3WIOA 3H18A 3EIOA 5I7UA 4DIUA 1DINA 4IQ4A 1Q0RA 3KWFA 3A2NA 1R9MA 4GBGA 3O0DA 4U2EA 1GXSA 5ALVA 1VZ3A 2W22A 1WHTA 1AQLA 4Y2SA 2D5LA 4ZREA 5ALOA 1FFEA 3I2GA 2BKLA 2O2HA 1EDDA 2VAVA 2WG0A 1E8MA 3FBWA 3O4GA 1J06A 4KRXA 1ZI8A 1CUZA 4B83A 1DWPA 5AKZA 3BDVA 1QIKA 3BE8A 5J3JA 3CN7A 2CJPA 4DNQA 2J4CA 4U2DA 2XUFA 1A8UA 2XLBA 1QIIA 4Y2PA 4AMYA 4X92A 2CMFA 1PFQA 2BUBA 2C7BA 4B0PA 2HM7A 4PNZA 4I3FA 1QGED 2LIPA 5AKKA 1WCYA 4OYLA 4BVLA 1CV2A 5IVIA 2WFLA 1HQDA 1YAHA 1LGYA 4L0CA 2O2IA 1XQWA 4QA9A 3F9CA 2WUDA 4Y2QA 5AH0A 4UHCA 1I6WA 1VKHA 2WIGA 3WKDA 2B9VA 4JEIA 2D0DA 3FVRA 1MPXA 1N5MA 1E3QA 4G8DA 1ZOIA 1SFRA 1ZIYA 3ZLTA 4FHZA 2VA9A 2CZQA 1BEEA 5CH8A 1VE6A 4OPMA 1JT2A 4CCYB 2AJDA 1UKAA 5AK5A 3VJLA 3VKFA 1E66A 2HFJA 2XQKA 2OG1A 1XZKA 3JW8A 1ORVA 4AO7A 1HBJA 3D5EA 5K3EA 2QMQA 4OSEA 1MX9A 1CUXA 1AX9A 1T4MA 2GZRA 2JGEA 2HFKA 4EUSA 2PBLA 1CVLA 2WILA 4KE6A 3BL8A 4LXHA 4DM7A 4JYPA 1BCRA 3BF8A 4BVKA 3DLTA 1F6WA 1P0PA 3AZQA 4WFIA 3HSSA 3IUMA 5CMLA 1MO2A 2WJ3A 3D59A 4OD0A 4UBIA 2Y2UA 1EDBA 2WSLA 4AZ0A 1QJ4A 4J7AA 3C5VA 4CCWA 4W1QA 3R40A 3E3AA 2HA4A 1C7JA 2BAGA 5AKHA 2Y1KA 4B9AA 1LPOA 1XQXA 3JYHA 5EHNA 4K6KA 5AM1A 2IIVA 5SYMA 1DX4A 3VJKA 3C6XA 2PSEA 1QO7A 3S2ZA 2IITA 5A2GA 3TEJA 2ZVDA 1WHSA 4W9RA 4MQMA 4B85A 3G0CA 1BN6A 3IURA 1ORWA 1A8QA 3YASA 5AI5A 3GFFA 2DQZA 1ZD4A 1HPLA 1YB6A 1LPAB 3QZUA 3WKAA 5KREA 3C6YA 2PSHA 4YX9A 4ZGBA 2XQJA 1T2NA 5ALRA 4KACA 1MT3A 4KE8A 4QE3A 4U2FA 1ZI9A 3I6ZA 4B82A 5EIEA 5A7FA 1LZLA 5FV4A 5IKXA 4W63A 3VVMA 1R1DA 4A23A 2QT9A 2PU7A 1SCKA 5LLSA 4UBMA 2ROQA 3BF7A 4EY8A 4N8EA 3ZLVA 1ZICA 1X70A 4C4XA 4NVRA 4LYEA 4K2AA 4BAUA 4GEGA 4CG1A 1HL7A 2NW6A 4EY5A 4X7BA 2K2QB 2C0QA 2XUQA 4JYMA 4RNCA 1XZLA 2JGFA 2PVSA 4L72A 1GT6A 2AJLI 4PO3X 1WM1A 4U2BA 3IDAA 1CFJA 2G5TA 4UBLA 2VEOA 2CBGA 1YR2A 1R50A 1RWQA 4YK7A
chains in the Genus database with same CATH superfamily
4F2DA 1ZISA 2QD4A 3DMGA 4WJLA 1DEXA 5T4EA 1WCXA 3L1VA 2V9CA 3O4IA 1F2TA 1IQPA 3HJUA 4UHBA 5KOHB 1KIFA 4GQBA 4JELA 4UHDA 2TS1A 3HJAA 4ARUA 1Q22A 2A78A 3L40A 1SC4A 4V0NA 5REQB 4HAIA 1B2RA 1Z5OA 3J81k 3E9YA 1E99A 3LCVB 2EHDA 3C3BA 1RAEA 2O3QA 4KI7A 2XE4A 5DTMA 3RM3A 3DBHB 4MICA 4BU1A 3IMFA 3CUTA 3A6FA 4U7GA 1VI2A 3ONWA 2AKAB 4OREX 4HY3A 4CT0A 1GTG1 4LYYA 4BO2A 2IBTA 1V1MB 2PZMA 4URZR 2GBGA 3HCCA 3ZCSA 5KTYA 1BQ4A 1T0BA 4OHMA 4EG4A 2C29D 4KAJA 2WFAA 3WGIA 4DWOA 1QNLA 1P4AA 3IVXA 1O5TA 3Q3VA 5BWBA 1EK1A 5KU1A 3Q3CA 1KHHA 2QROA 1KWKA 1W4LA 4G4JA 4BUZA 4R9NA 5EJ5A 4KLRA 1JDPA 1U7OA 4C20A 5M04A 1I2ZA 1XU9A 1KQFA 4IDDA 1NPDA 1Q0QA 1Y33E 3FOBA 4XKJA 3AG6A 2C59A 4FSDA 1IOZA 1ECCA 1HM5A 1UBJS 2FETA 4DC9A 1FXSA 3C5CA 3TBKA 1M2KA 2OLKA 1LBTA 2QRNA 1ECGA 3HVJA 3ZU2A 3SK0A 4HS9A 3LIIA 4FX5A 2RKOA 1T15A 4IFIA 4AFNA 3CWCA 4DJJA 3REGA 1N34B 2AW3A 5E9WA 3TZ6A 4IUCS 5KHOC 3GARA 2J9FB 5DYWA 2CDAA 2ZGVA 5JRDS 1NAIA 1NJGA 1DKUA 4HQ6A 4OB7A 3EARA 2WLTA 3I01A 2A4KA 4HEHA 2G9ZA 4DCJA 3TECE 4G0PA 2IQIA 1GG2A 4RXUA 2L69A 5BV1A 3P32A 5DHTA 4NMWA 3A2KA 1T8SA 1VL8A 1OYOA 1VCNA 1VMKA 2E4AA 4OBEA 3FTEA 4G0MA 2IWHA 4P2BA 3B1KA 2JCVA 5FBVB 3BRWD 1CLEA 3D5QA 2DZDA 4X90A 3BMXA 4FILA 3HB4X 2RC5A 3WS7A 5DHAA 2GUWA 2WF9A 3GGJA 2YW2A 3KZMA 3L7OA 3W3AA 4NBTA 3RRZA 4F4FA 1FNCA 3FLAA 4AUEA 4MWTA 5C31A 5IZCA 5SZKB 3UUFA 1MB0A 4JUBA 3V8RA 3IXQA 4WJKB 2AJTA 1KOLA 3UXHA 4E21A 2WICA 2J9XB 4MVCA 1NVDA 1VKJA 2PZEA 5JHGB 4HVAA 4MR8B 1F8FA 3F67A 4H1VA 1TC2A 3G13A 1YDWA 4IO1A 4XUCA 5DBOA 3HO1A 1F51E 5C8XA 2PYDA 3PQ5A 4WOKA 4U6SA 2MR5A 1SXPA 5L45A 3S1SA 2BBTA 4MKGA 2HCBA 1UFRA 1U2GC 4F5DA 2MYPA 4QPPA 4K0RA 4JP3A 1C41A 1FNDA 2FSHA 2IIQA 1ISJA 3T41A 1T1EA 3K0FA 3L0ZA 4RIFA 4JI3B 4LQ4A 5C1PA 1H1TA 3WRYC 1E6LA 5C4MA 1N1EA 3E3MA 1YUNA 1Y81A 1YZNA 3BD8A 4O2LA 2AKEA 1IJBA 2FG7C 3FTNA 3S3TA 1KNQA 1X15A 3QW2A 4A2WA 1Y3FE 2C58A 2OM6A 2YX1A 5B2EA 2CL6X 3UWPA 1EX6A 5DP2A 5AW3A 2BFEB 1Q91A 2K87A 1XTIA 4HWGA 4QBGB 5D3MB 2VUIB 3DCIA 3HUDA 3P2MA 1R0WA 3BL5A 4XPZA 1XC7A 2B3DA 1ECJA 2FN4A 1H2XA 5IAGA 4ZK6A 1DEKA 1OH5A 3Q1KA 2J07A 2B3TA 1X80A 4ZCQA 3S81A 1JDUA 4GX5A 4NX2A 1DGQA 4L3OA 4DQVA 1DXYA 3I1JA 5CLJA 1E2QA 1WF6A 2QTWB 2N1MA 1P2DA 5ALMA 1C3OB 2D5CA 2P6NA 3BXZA 1SH7A 1AKNA 4MVJP 4UULA 1U1CA 2NZUG 3KALA 3HXKA 2CDNA 1IJFA 1H94A 1R5BA 3PXEA 5ALXA 3EUWA 4WY5A 1T5IA 2DPGA 4TXJA 3FPLA 4XB6B 1SC1A 4C1BA 5LBUA 4DIKA 1K6IA 2BFPA 2GEFA 1FQJA 1QIJA 2X8BA 4Q4JA 2JJ2D 3LC7O 2IF0A 1CERA 1TVCA 1ZXBA 1Y48E 2YR0A 2UZIR 2I33A 4YRCA 3A1NA 4OHUA 3T15A 4D97A 3EVAA 4ZMSA 5P21A 2BFMA 5BPHA 1DBSA 3Q9SA 1OIXA 3R23A 4NCXA 3UJ7A 1I4LD 1YH3A 5K09A 4YAWA 4PNEA 3P9XA 2I03A 3CJQA 4J90A 2NP7A 2EJUA 2G7MC 4ZMRA 4RF3A 1EESA 3I3OA 3KJXA 3R7DA 1R5OA 1I33A 3HABA 3QMWA 3U4QB 1RABA 1B76A 4W1RA 2O2JA 4UHHA 1EBFA 1LZKA 4W5JA 2WJWA 3LPAA 2G80A 3IIEA 1W2GA 1HZZA 4R84A 5COQA 3F46A 4HF7A 7REQA 1T8PA 4ZOLF 3R75A 1JBEA 4X3OA 1T5SA 4IIBA 3B38A 4R7TA 4K88A 5I7HA 4N3BA 1F9AA 4URYR 1N7JA 1MEJA 2JFZA 2XGMA 2FZEA 2WE7A 3O8NA 2C4UA 2I62A 4LBWA 5IEBA 4CMEC 1XZBA 2B1RA 2GD0A 2PJZA 2ZRNA 3F7NA 1GGHA 2X0DA 2DCMA 5CHEA 1Q7CA 1W5AA 5L3RA 4BZZA 3WHIA 1FJXA 3JU3A 4PM4A 5EJGA 1P8JA 1TMYA 1X8LA 3CINA 5K0NA 3GEGA 4I50A 5SZJA 5EXPA 4A7PA 2HA3A 4NC9A 5LLDA 2Y1OA 3L7CA 2GYWA 1LBIA 1U0SY 2OGTA 2I1LA 3N8DA 5M34A 1Y8RA 4Z1OA 5AVSA 2VZ0A 4ZI7F 2X58A 5JRZA 3G68A 2P1DA 5KU7A 2X77A 4PE5B 1KJWA 1Q1EA 1QDLB 2IRWA 4AWXA 1CQJB 3SD7A 1TIKA 1G4HA 3H0EA 1G6Q1 1Z6TA 3PE4A 4P35A 4BASA 1U8YA 1FDRA 1I1NA 2ZI9A 4FPXA 3OIVA 5BN4A 4W9NC 4FEYA 2DP4E 4OL0A 3FYUB 1VGRA 4D6YA 5A9SB 3T5BA 1B42A 2WDPA 3UYKA 1WE2A 1ZU4A 2IDKA 4DOMA 1KY4A 2YVAA 4BPRA 1HQKA 4UU8A 3EXAA 2WFMA 3N5KA 2RIRA 2PUTA 3AJAA 4ON9A 3ACCA 3IUEA 1H22A 3GRFA 4W82A 2Q4TA 3A4VA 3RS2A 3OU7A 4UFPA 3MMPA 5BURA 1E62A 4B75A 1R9JA 3HI4A 2YC2C 3G7SA 3BA6A 4TMVA 4RS4A 2BGNA 3WK4A 4GL2A 3HJNA 3TWOA 2I7DA 4W7IA 2ZP1A 1QTIA 2GBLA 3M6UA 4H9GA 1KK1A 1VP9A 4GYWA 4X6UA 3VV2A 1A7JA 3V42A 3GJSA 2YYAA 3I62A 1SKUA 3UGKA 1Y4SA 4L8WB 4Q48A 3CXUA 2VF7A 3HGQA 4NK5A 2WA1A 2DHCA 1F9EA 5J4HA 1V8OA 2O2SA 4AXBA 5K51A 3ONVA 1I0ZA 1MDBA 3DYBA 3I52A 4KZPA 2Z6UA 1EK0A 3NVKI 4OIFA 5IN4A 4GKVA 4R40A 3IE1A 2YV2A 2QGZA 3PGLA 1MZVA 1Y1KE 4S2UA 2I3GA 2ORYA 2QY6A 3OCXA 2PFSA 4N03A 4G1UC 3L6RA 5T41A 2F2TA 2V7XA 5AKEA 1K5HA 4J2HA 4G8JA 1RHJA 2PD6A 2HUNA 5JEEA 1OREA 3T99A 3GWZA 1E9CA 1FFCA 1YZTA 5K0BA 3VZSA 4F45A 1W88A 1F0NA 3RAPR 2VHCA 4N4AA 3ZJVA 4LJ7A 3WI7A 2IXAA 4WXMA 3PDCA 4L74A 2HC9A 5C0OE 2HK6A 5LZ2A 4UNIA 1VG0B 1XK7A 3BK2A 2V7BA 1BOFA 5ES3A 1SQGA 3EPPA 4Y1RA 1ZGHA 4KXWA 5F2KA 1TYDE 1YULA 4QOSA 3ZPXA 3OURA 3B3AA 4IOLA 5M29A 2GF2A 2O8DA 2NSYA 3UMYA 2FSIA 2B5WA 3KDPA 4DPLA 5J2UF 2PZGA 1EHIA 3T5DA 2ZTHA 4CFZA 5ECDA 2C5SA 4JSTA 3G8YA 4B2PA 1RS0A 2EYUA 1GKKA 3E82A 2QYSA 5K6RA 4B3GA 1FDIA 3GDGA 2XUZA 4Q3OA 1NZFA 4L2IA 1BGWA 5FIUA 2C82A 5COBA 2ZBFA 1NUTA 4BMSA 1CE8A 2G9RA 1H2BA 1Y5NA 2D1SA 3BDIA 3FUVA 4ZXFA 7YASA 2OSBA 4U5QA 4B6OA 3QX9A 1CQIA 2I3AA 1IM2A 3TL3A 3EMVA 3ZNOA 1KVRA 4DR4B 4J07A 5F1PA 1U7DA 3OO0A 2X0JA 3BGSA 3HWRA 4A0SA 2J87A 4C6TB 2XDAA 2LTAA 1EX9A 4LXXA 1FQKA 4P7FA 2HWKA 3QJ5A 2HO4A 4QGFA 4IDHA 4K9QA 3CW8X 3PEVA 1NJ2A 3NFRA 3MCUA 2RGXA 1UBOS 5GZ6A 4I5GA 5LXTF 2A1UA 1ZH4A 2FV8A 4HATA 5ADWA 1EQAA 1PVVA 3NCTA 4JXZA 3TLEA 1VJCA 1SG6A 3NRJA 4HAYA 1GZVA 4BJHB 3PGMA 3TAXA 2HBRA 4NJMA 4D45A 1OV6A 1B41A 1WUYA 2BMJA 2JAPA 4RGBA 4WINA 4L9WA 5ER9A 1FTGA 3DL2A 3F3SA 4Z5XA 5ICSA 5FNVF 1ORHA 2PLRA 3DQPA 2GKGA 2FMTA 1KPHA 4W6QA 3T1YB 2ZQYA 4QDOA 1VJ5A 4R8RA 5DF1A 4BP3A 4HNUA 4PINA 3B85A 1GWNA 2H1WA 2WWTA 3COSA 4B3FX 2Z8XA 2QTAA 1JE0A 2WABA 1CUGA 3L43A 2XTJA 3W5JA 3U26A 4ACAA 2QLBA 3TVTA 4ZVTA 4YBZA 1E1QD 4Q6BA 2X6RA 3RU3A 5CGQB 1MXHA 3HVKA 2WKWA 3CRRA 3T1QA 3T0GA 3OWHA 1G55A 1KAEA 2EF1A 3KZXA 2QRQA 2XJ4A 1ZK3A 4MGYR 1L4MA 4QLOA 4QUHA 2CMDA 4MRVA 3FLEA 2P9TA 3K15A 3MIZA 1L7DA 3C6ZA 3PENA 4U9IS 5BXYA 1G2IA 3DZ8A 3V2IA 4L9AA 5JXJA 2O3UA 4O4LB 1WO8A 2BDTA 1IHOA 2C00A 3LL7A 5I01A 5B4UA 2NZ8A 4TRJA 3PXCX 1Z68A 4CL0A 1MR3F 1EFRA 2VG8A 3D1VA 3JQGB 2HLDD 1ULTA 4B4KA 4DCPA 5HXAA 4P84A 4ARVA 1SZCA 2NU7A 2MOKA 1FXUA 3EMDA 3PFKA 4JVLA 4P4SA 1Q21A 1TM7E 5JAUA 3DR5A 2O7NA 2YHSA 1MJNA 1Q0PA 3C3AA 4J4BA 1PNTA 3S8EA 1UMBB 3GNTA 1EXVA 1T2AA 2FB9A 3PGA1 4MKFA 2ZB4A 1C9KA 2ORVA 3FIJA 3FMVA 3L0CA 5K05A 1CY2A 1WQ4A 5ALUA 3OTQA 5KQPA 2YFQA 4RHCA 7MDHA 3OLQA 1EXMA 1C3XA 5BW5A 1FS4A 1II0A 1CY4A 3IQFA 4RADA 1X7ZA 3E7PA 5EGSA 1PR3A 4DUGA 2VWPA 1T35A 4HFJA 2E49A 1ZA2A 1TF2A 3G79A 4PZYA 1G291 1PGNA 2XUAA 4KP7A 4LMPA 2CDRA 2QRVA 2VHXA 2XUDA 2YMMA 4GD3Q 2EERA 2BM8A 4HDNB 1M8GA 5ALJA 3ZZMA 1PR1A 1VE3A 1XCOA 2HNBA 2QL5A 3H8VA 4RL6A 2R44A 4TKMA 3K9NA 3IBSA 3IYLW 5JYDA 4KZKA 3KQKA 3UHPA 2DBVO 3QFFA 4M99A 5JO9A 4F60A 3ZQ4A 5JARA 1RJ9A 1N32B 3ADPA 3VHRA 3JY6A 2VBGA 5DIZA 5HFAA 3NONA 4QRHA 2RGWA 3TM4A 1H0KA 1XDGA 3C14C 4W1PA 4GLFA 5HZMA 4HNAB 3OCWA 3ZS8A 3P9PA 1QAOA 1GPAA 2VZEA 3QK7A 4LYJA 1VDZA 4EPTA 3HKDA 5AVKA 5KYUB 2IS2A 1HX7A 1I3LA 1N3YA 5IC5A 3GLKA 2XGSA 1NP7A 2O0HA 2B4TO 3QMMA 5A5FA 4C21A 3H04A 4G5XA 1UWVA 3GAMA 4QHTA 4Q1FA 3NDPA 4LUCA 1E1RD 5KTMA 3CZCA 1D2HA 3N07A 1SUWA 3ND6A 3N2KB 3GLHA 2ZFUA 3MTDA 4OX9Y 3HXLA 621PA 1NGSA 2BM1A 1HNWB 2OBFA 3GLVA 3W9YA 3AV0B 2O59A 1US8B 3VU8A 4LHXA 1W6UA 2PX6A 3K09C 1UANA 4FEEA 3RYCB 3LVRE 2GTIA 2ZVPX 1AGXA 2FWPA 3DTNA 3GVCA 3QOWA 4A8JA 2Z2YA 2FW8A 2O2XA 5FYQA 4QBTA 1A4XA 1WTAA 4OMUA 4BCBA 3MRSA 1H65A 3I72A 1NIJA 5A3VA 1F4VA 1TPYA 3Q7TA 2PN1A 2VJNA 1USUA 3BGDA 4Y2HA 3VSBA 2C04A 2Q5CA 2AEFA 4JYCA 4YONB 3EFEA 5KOHA 4CV1A 4TMWA 2BKUA 4IL5A 4YT4A 3BIWA 3JASB 4KEAA 4PLYA 5REQA 5LC1A 4FC6A 4NRDA 3LQRA 5FPYA 3RANA 4AF6A 1W7AA 1FYVA 3MTAA 3GPLA 1XJ0A 3DBHA 2ZIGA 4EBBA 1VSTA 1C7FA 3CW9A 3N05A 3U3OA 1TZ2A 5IAEA 2F4VB 3U9SA 4JDPA 1A04A 5CVUA 4A2QA 1CDZA 4A5SA 1Z0JA 1V1MA 2FN7A 3S0JA 4FYPA 2EVWX 4R71A 1KAGA 5IJXA 4RY9A 4IIHA 3F74A 4KBGA 2Y99A 4B2IA 4XRRA 5TSDA 3KVYA 3C8DA 2JGKA 5DV9A 3RSOA 4NP6A 4ACBA 2IYLD 2JD0A 3JVIA 1CSEE 1KI1A 3FSRA 4CDRA 2MTBA 4OU4A 4RPCA 3MBIA 4WBXC 3AV3A 1QBKC 2VP3A 5AW4A 4TZ6A 1PW7A 3HRHA 3KPVA 4C4AA 4TMFA 2QB5A 4F1JA 5CIWA 1Q84A 5ALFA 1HTBA 1M10A 2BBOA 2GAIA 1AUXA 3HN2A 1ZK2A 4AKSA 4C6HA 4UEOA 2IHNA 3MCWA 2OV1A 2PUFA 1OBVA 3BTSA 1MO6A 5SZHB 1D6MA 1YJAA 4RJJA 2VYCA 1YASA 2R6JA 4LA4A 2B7CA 1WU8A 4TWRA 4KDRA 5AXBA 4DJAA 3T3DA 2MSEB 3BIFA 1ULBA 3OU6A 5HMLA 3V1LA 3DLHA 1X1RA 1OWPA 3VPHA 2F67A 3GT3A 5CBKA 1XTRA 1VB5A 4E2YA 1GZ3A 4E30A 3B3FA 1N33B 4AG6A 1VL1A 2X3UA 5TC4A 4URWR 3UV7A 5KNCA 4CM7A 2DF8A 1YCFA 3BN3A 4Q3BA 3ZEAA 2C4NA 1Z6YA 3V4VB 1FL9A 3AH8A 5HUHA 3QE9Y 4LSGA 3JATB 3NI2A 1PL0A 1WLYA 3BHNA 4I55F 4YBRA 4R3NA 5A4DA 4CQMB 1D8AA 3VPDA 3LHKA 4E03A 4DRYA 4HPWA 5AUPB 1MGPA 1RM0A 1DFGA 4V38A 3NM6B 4OG2A 4ZAXA 1XAGA 3PNSA 1P5RA 5T3YA 3ESAA 1C9MA 1B00A 5EUBA 4MR8A 5CFPA 2PK3A 5FTMA 3RS0A 1U4OA 1K97A 5B7PA 5JDIA 4XJXA 2YASA 2F90A 2DKOA 4YACA 3HA3A 5KYGA 1H8ED 1T8TA 2ECFA 4WFQA 3W34A 4MMZB 1I8TA 2IE8A 2H2GA 4XR9A 1QVZA 3NS7A 3WWOA 4F84A 3OTOB 4DV6B 3OF5A 4YRRA 3RKSA 4HNHA 4H3VA 4JL8A 3ZUPA 4E1VA 2XYGA 4E15A 1ZZGA 3LG2A 3B52X 3I9LA 1PN3A 3ABIA 2E4XA 2YRXA 2C9MA 3B8HA 3R20A 1YS7A 3X43A 5FUMA 1CFZA 2PZFA 5KYXB 1Z45A 3OX3A 4Q93A 5CNIA 4RZSA 1EP3B 2FP3A 4XRGA 5JJCA 1EWTA 4EW6A 4ZT6A 1M33A 2D54A 4GOKA 4JOQA 4PGHA 1ATZA 1PCXA 3F49S 1JECA 1Q1AA 1XYGA 1NN0A 1J07A 2VYND 3K8OE 1L7VC 2P27A 4KQKA 4MR7B 4XD2A 2BFEA 4KQWA 5GONB 2C42A 6ADHA 4B17A 1RMYA 1FUIA 3ED1A 1YR8A 1YHYA 2AYYA 2FRDC 2IOHA 2YOGA 3E2MA 4MH0R 5DX8A 4B6GA 3EXHC 1U3VA 2CK3D 5CVVA 1KI6B 3PPWA 1REQB 2DT8A 3T54A 3HZZA 4NSNA 3FYCA 4N65A 3T7SA 2LZ0A 4X41A 4GLJA 1C3OA 4BN0A 5EL0A 2IXGA 4UM7A 1ABFA 2JGIA 4M4SA 4DCTA 2B4KA 1JVBA 1S2NA 5A5EA 1YE3A 1XTBA 4UQPA 4KI0A 4MUXA 4W99A 4DS3A 3KSBC 4ABTA 1XNJA 1EKXA 3F4KA 5EZSA 3RPEA 1V5FA 1ZRSA 1K3UB 3TLKA 4QXMA 2ZB3A 4LRTB 4C0HA 3K9QO 4ZVUA 1AQIA 5DCUA 2WQZA 4YP0A 4BLRA 4KIJA 5KTRA 4HAWA 3K2EA 4ERXA 1EVKA 4M1OA 2B7LA 2G5CA 1UDRA 4YRLA 3VR5A 3R3XA 4XVUA 1AO0A 2OORA 3FOFC 4ZU3A 1WXQA 2DFTA 3N28A 1WEHA 3T0FA 1ZGZA 1SBZA 3FZNA 4DN6A 4YRDA 2IW3A 3QVXA 4GI1A 3BFXA 4PXAA 1M2NA 1ZGGA 3WNQA 4BRWA 1ZIOA 3LUFA 3BGVA 2GAAA 4B5KA 4R2HA 3U4QA 3NIGB 1YRAA 3MTEA 3T3MB 1CRZA 3BMOB 3KB1A 1RE0A 1U65A 4CQNA 4K6MA 2JAWA 4Y9UA 2OVFA 5C8VA 1GYPA 3RT7A 3ZTTA 5B5SA 1K66A 1VG8A 2ECPA 5JNRA 3ZGZA 4CCSA 4F8EA 3HJFA 4O5OA 3MBKA 1IZ7A 2WYVA 4FBLA 2VPYA 4JBLA 4TLBA 1M8PA 3U1VA 1T5LA 1JHQA 1VSUA 5T8KA 5F1KA 2IJGX 5IXSA 2Q9CA 4IG4A 2B8WA 3PNMA 2H9IA 3RGGA 2A0UA 4ZO4A 4M87A 1Z88A 1K1EA 3W78A 4EKNB 1ZUHA 2V3CC 4MDEA 4KR6A 2HEGA 3WKCA 5IM4A 1Q1NA 3OG9A 2P2ZA 4GUDA 4JT2A 1PJ4A 4KFTA 3OZCA 5E7QA 3N9IA 4Y2YA 5J63A 3KBOA 3WMRA 4Z6KA 5L53A 4KGVA 3BB3A 3VYVA 1F3LA 2WD7A 3FPFA 2XSZD 3OPVA 1BE1A 3QKSA 2NU6B 4V39A 1IHYA 3VGPA 4GXQA 4E7OA 4HVCA 1CQJA 3QWFA 2FPRA 3GAAA 3KOOA 4FSHA 4HEJA 4KBYA 4PRZA 3CV3A 1Q7TA 2ZXUA 3V8VA 1DAGA 1DKNA 3BTUA 5EMMA 1OGJA 4L5BA 1NKSA 1N6OA 4EHBA 3FW1A 5DHFA 2FPGB 3K6JA 5K3BA 2ZWIA 1CP2A 4ZU6X 3FYUA 2XUHA 3HBAA 4WA8A 2O50A 3RVDA 3M5CA 1VBNA 2R48A 1LK7A 4NOKA 5BT9A 1YI1A 2YWRA 5IT5A 1FSZA 1UC4B 2ZSAA 4X44A 3PL5A 4HXEB 3NAQA 3R9IA 5EE3A 5FPKA 2FQQA 4RZUA 4G07A 5EZQA 3T9BA 4JP5A 5JR3A 4IH4A 1IY2A 3HEMA 2M9MA 2VDLB 3A9UA 4D8UA 1F60A 4YUWA 2WZCA 5H9WA 3GHYA 2FWIA 3P9QA 3QBTA 1PBTA 2NUTA 4QG3A 3A3KA 1NRXA 4WGGA 4D57A 1KYYA 2XMDA 3F6YA 1Y3DE 1HOXA 4FE3A 4JI2B 5H59A 4E46A 3IV6A 4F6LA 4FFLA 3R41A 2AF4C 1KZ4A 3EN0A 2ZSJA 4IIXA 5BSRA 3H1BA 5IVKA 1Q5PA 1TE2A 3JVVA 1M5RA 4XQCA 3QVMA 5ELMA 1E3IA 2Q45A 2Y9MB 3WZMA 1RMQA 3W06A 3JSAA 1EFVB 2VHWA 4MQFA 5GVRA 2P77A 3I9FA 4TTTS 1W59A 1KH3A 3H9UA 4FOOA 2E87A 1NDUA 3OESA 4EL5A 1SXGA 3M81A 1GITA 2VJMB 1QF7A 5CT6A 2YWBA 4F72A 5BSVA 2RBGA 3SKYA 5IX8A 1H4TA 2WF5A 4F1WA 3OEHD 1BCSB 4J7CA 4UU1A 2PJRA 4OQLA 4Y6GB 1D2AA 2VSXA 1QTQA 2OLJA 3KXKA 1SQSA 2VBFA 3WZLA 5FOSA 1XI2A 3IDZA 1RM5A 4NENB 1CUAA 3W6ZA 3JQEA 4E88A 4M1MA 2NO9A 3WADA 1OLXB 1A1SA 2FOLA 1SVKA 2SICE 3ULKA 2W6CX 4PQRA 3EULA 2JRCA 4PAMA 5LQRA 3CNNA 2HREA 3SMVA 3M1AA 2YVQA 5JLJA 4YCCA 2PXCA 3PGVA 1GAWA 1Z34A 2LW7A 5L7WA 4BO9A 2WKQA 1BEUB 3VZDA 3H84A 1TF7A 1P4JA 3UKJA 5I51A 3IHKA 1CS0A 5JAHA 4RWEA 5FBRB 2XMGA 5JNTA 2D5AA 5JNUA 5C52B 1FY2A 4Z4HA 3I6MA 1AKUA 1PL6A 5LMNB 1JG2A 1R8SA 1G8SA 3FCSB 3RAJA 5JE8A 2CNKA 3VU3A 1AO3A 4TS4A 3VR2A 3GPBA 2UYGA 1A9OA 1CUYA 4LFCB 3R44A 4ID9A 4TS3A 4F3YA 1YACA 1HE4A 2ETVA 4EPWA 2OCDA 2UZAA 5BWOA 3UAWA 4IG9A 1VHDA 1VQ1A 1K06A 2IYEA 4GSYA 4CHTA 1T5DX 3GRKA 2XA9A 4MB0A 3T38A 2X13A 3HCRA 2Q5LA 4FR0A 5DNYB 1TJ4A 1U0JA 3Q8LA 1CULC 1SVLA 3MWGA 1F8GA 4C6TA 4PYJA 4CM1A 4K3VA 1RYDA 2F1RA 2VNHA 4QDUA 3D0RA 4LV8B 3T7TA 3VZPA 2JANA 3MLAA 2VZ8A 3U1BA 3ESDA 1T26A 3GXOA 1U2QA 3GRPA 1F6BA 1P31A 3G82C 2CXPA 2R47A 4RD3A 1C30B 1E96A 2R1ZA 3IT1A 3G2PA 4NECA 5DXFA 4B3CA 2JLCA 5DNEA 3SICE 1R0KA 1U8FO 4MW4A 3T8YA 2GFHA 3G88A 3DLPX 3AHDA 1YHNA 4HLDA 1BVHA 1DOAA 1BMTA 1EI9A 1GFZA 5EJIA 5GQSA 5EA2A 4OY3A 4BAZA 4FDMA 4F4UA 3TFQA 2R2GA 1UT6A 4E94A 5JG7A 1JDTA 2FPKA 3UC9A 4DA4A 1QH0A 2BJHA 3GBSA 4PLFA 3PF9A 2UZ1B 2C03A 1Q0LA 1WMDA 4FGSA 5CGZA 3OWOA 3WIBA 5B3LA 3UPUA 2P78A 3CPEA 3RU2A 1M2EA 1JQAA 2YMQA 2BMWA 3P2IA 3INYA 3A9RA 3RC3A 2G40A 1DFHA 3R0VA 5FJIA 4DBZA 2QN8A 3SXJA 3EC1A 1RWVA 3PBKA 1R3DA 4O4LA 5LKAA 5PNTA 5HS6A 4CTJA 3LCCA 2G8LA 4B80A 1TCBA 1XYVA 4A2PA 3NBAA 2QN3A 1YR9A 3JQGA 2CHGA 4IUDS 4NWIA 3D7LA 5CLLA 1E4YA 2P9EA 4EY3A 1CUCA 3R9KA 3WX0A 3GZJA 4NU6A 4E4YA 1GYQA 1KY3A 1UMBA 3P9ZA 2H5EA 4UNSA 4BDTA 2VRCD 3BWMA 2XD4A 1G9XA 4MTLA 4BN4A 4X8MA 4GUAA 5DLDA 2E4UA 4BMZA 4UJ3A 2PXHA 1EG7A 1DNPA 1RW4A 4EPRA 1H2AS 1Q57A 1ZN7A 5LB2A 3WYBA 3T7IA 3P4YA 2ZOSA 3OT5A 2G4LA 4I6JA 1NMYA 2P0AA 4PCAA 5AKGA 5FL7D 4Q7KA 1UL1X 4DLLA 2TMKA 4JJZA 4IDFA 4JLUA 5IW8A 1EFKA 1JIJA 3H2HA 5DEIA 2D1QA 3ZHCA 4EFKA 4HSGA 1YKGA 1HDCA 4HDNA 4QYIB 1XYYA 4U7JA 2V3VA 4XARA 5HVNA 1YIOA 1ZVQA 1V96A 4D56A 3BJEA 2F3PA 1ZC3A 3PCRB 4KL8S 2WAMA 3KPYA 5DRYA 3ST7A 2RK6A 4MW7A 5HR5A 5AVWA 1CWUA 2PGXA 3Q8KA 1X74A 4AUNA 2J0SA 1XQ6A 3SKXA 3IHWA 4QPNA 3W8EA 3EEQA 2FWRA 1NVEA 3A31A 3ENQA 4YPFA 5C4GB 3V7UA 5KUTA 1JWLA 2POCA 1KIAA 4LSMA 4IINA 2ZAOA 5EN4A 4DSNA 1GCUA 1I4OA 4QFMA 2GVNA 1KO1A 4MHSA 5KYUA 1XVUA 1LS6A 3KU1A 2K6GA 2SKEA 5ADVA 4DILA 1YRWA 1YQUA 2C2HA 2E6UX 3JD2A 3PDWA 1K86A 5L95A 2W6OA 1QONA 3DD1A 1TUEA 4MVJE 5LZ7A 3VYSB 1SUCA 4EARA 3FWZA 3M2PA 3DA8A 1UCFA 4IO0A 1KI3A 1GLGA 1DMSA 2VLBA 3K5HA 1H0SA 1US8A 2ZJYA 3QXCA 4L6CA 1QG4A 5KVQA 3C97A 5KMGB 1UOEA 3QV2A 1KDVA 2HYDA 4GXNA 5IH3A 3DE3X 3RYCA 4G4IA 1M0WA 1V16B 1ONPA 3QMPA 2BELA 4OHRA 3FPBA 3TXXA 1M2WA 3L8ZA 1QRSA 5LD2C 3E0QA 5CDHA 2W6NA 5JT1A 1NLMA 4EG7A 5LOVF 4QRDA 1JDBC 4W5HA 5CEJA 1O2DA 6YASA 4ZPJA 2OFOA 4LZJA 4JBHA 5I3ZA 1BQEA 2XI4A 3HRIA 4N54A 3LVBA 4CLOA 1QHGA 2XF8A 2UV8A 5BQXA 2ZXEA 5HM6A 5C1DA 3JASA 4QT4A 4JVSB 2P9JA 2Z6AA 2OZKA 1JKJB 3GT4A 3ESBA 4LF7B 1FZTA 3L77A 4HN9A 3GVPA 4PO9A 3ER9A 1K7SN 2OCPA 4WGFA 3WGTA 2PKQP 4PRKA 4E1AA 2CDCA 2CFIA 5FJJA 5IUJC 4UTOA 1E18A 2PRKA 4DCUA 1XALA 4Q3NA 2NO6A 2H1OA 3IXMA 1V8FA 4JP2A 3IODA 1GCIA 5EHZA 1AGNA 3LUHA 4PBRA 1P3JA 2ZWAA 5CVEA 1IXYA 1X39A 1AZLA 1P29A 3CR7A 3T3HA 2F1HA 1CJTC 2J67A 2V7EA 5DI3B 3OCJA 2DERA 3GG2A 3PJFA 1UC5B 5HIIA 2NIPA 1OB2A 1YRBA 3KYCB 3GGCA 4G8CA 2II6A 1V0JA 1UDXA 4BO0A 4ENSA 1QANA 4TSRA 2JAHA 5B64A 4CTKA 4EWLA 3RJ5A 3R9XB 3GRVA 2YN4A 3QX7A 1L7OA 5K03A 1RNLA 5DE3A 4B84A 1B73A 1Y1SA 4KXVA 1THTA 4JLNA 1NVUQ 1JL3A 2HF7A 2VF8A 2NVUB 4PSUA 4E5PA 2UXCB 3UK0A 3FOWA 3BK1A 2OZEA 3AVYA 1JQDA 3CW2A 4TM7A 4UHEA 1XWIA 4IJUA 3OD1A 1VA5A 5AXAA 1XHLA 1EWKA 2G08A 1SOUA 3HCOA 5LP6A 2R6GA 1NXTA 4FFNA 4LVOA 3OFVA 3ZQJA 1RZRA 1B8VA 5JIBA 5BQ5A 2SHKA 1Q0TA 3IBFA 1A4IA 2F4NA 4QAQA 4U0JA 1U8AA 3G0BA 2WUFA 2W70A 2VNIA 3PDUA 3F98A 3JATA 2UXDB 1YB1A 5D5PA 3PT5A 4BLQA 2C1ZA 3STWA 4RD2A 4DBLC 4DANA 4ZK2A 2JVJA 3FMPB 3R09A 3T7EA 4EYQA 3OHSX 2J5BA 3DKIA 3ZV5A 3ZWXA 3ANYB 1Y1LA 4GM0A 3AYXB 3OLVA 5CAEB 4RAOA 1R3UA 3SSNA 2AV6A 1RPAA 3NQ41 4QUAA 5C3UA 4D79A 1H23A 3EISA 1OGYA 1XZEA 5CCBA 4O1HA 4JH0A 5DGCA 3X2EA 1WMBA 2IPNA 2XWBF 5BOVA 2MMGA 3Q41A 2ENWA 3VC2A 4E31A 1N5DA 1EE9A 3QEMB 4CLEA 4J1QA 1Q1ZA 4BQPA 5AVQA 1RWWA 2AG1A 1AUVA 2QE7D 5KYXA 1W36D 1CNFA 4XQGA 4LTMA 1BS9A 3X1MA 1BDMA 2F00A 2ZBDA 3QW4B 4IQ8A 4C07A 4A1OA 3K31A 4J8PA 4MI6A 4ZOLB 4X71A 5F77A 1PL8A 2KBEA 1KARA 5FI5A 3FOAA 3CT4A 4RBNA 1N4AA 1U2DC 2J33A 2FCRA 4MR7A 1JG1A 1N25A 3DJYA 3P2KA 10MHA 1G8PA 5DM0A 5GONA 1C3LA 4IIDA 1W85B 1J2RA 3PQDA 1RFGE 3F6RA 1BIFA 2ZUTA 3PQCA 4R9VA 2I3DA 4GSLA 5AVZA 3Q7SA 1Q11A 4QSHA 1KI6A 1ZGAA 1REQA 3S28A 2WU8A 4BWGA 1P9OA 4XIJA 1QR2A 3JRXA 3UZUA 1WZUA 4M9QA 3ZBPA 2G1UA 5E1BA 1VCOA 4AYWA 3GMDA 5A6SB 1CZRA 3UAGA 3IPAA 3STUA 3P9RA 3SCZA 1AN9A 2NQTA 2VYVD 3KB2A 5JSQA 1PV4A 1R9GA 4P3KA 2C3MA 4YS6A 4O8ZA 3B48A 4FFDA 2NZXA 1CZHA 4K9MA 4Q1VA 2E3JA 3AP1A 3FUTA 3CJRA 4DKXA 4I1RA 4OAPA 1KF0A 3LCRA 1VPDA 3VV3A 3ZLBA 2RGCA 2A0XA 4Q16A 1W73A 3NBMA 1QIEA 1RI4A 2JLBA 1YDFA 3AF4A 4RH3A 1G2QA 2WJZB 3UQZA 5KSWB 1OFTA 1FVFA 4YROA 1J8YF 4BLSA 4XM2A 1T5TA 3IKVA 2PR7A 5AM0A 1XN4A 2I6SA 4Z4FA 2ECOA 3PB3A 2G28A 1BFKA 2RGGA 1TDJA 5BV7A 1UP6A 3ZG6A 2PKRA 3G2KA 3IAEA 3SEZA 1QVRA 2XUIA 3BMOA 2XVYA 3EMBA 1BA2A 2XMCA 3KHTA 1OV4A 1YE5A 5T64A 5HTOA 2Q8NA 2IY9A 3TIXB 2PDAA 1M67A 4ISCA 2MU1A 4JS0A 5AMXA 3V2HA 4B48A 3HV0A 2DH6A 3V8EA 4UBJA 3I4FA 1YQTA 2B69A 4JBYA 4XEHA 2WIKA 4ROSA 1OI3A 5HRAA 2V6MA 3NKFA 3HVRA 2H5JA 4JI1B 3WAGA 4LIPD 1XPUA 3EZGA 4N6NA 1OTXA 3SX4A 3AR2A 1Y5LA 3OSUA 2REQB 1KQNA 2BW0A 4HDCA 3LD9A 5EKSA 3ZY4A 4OOFA 4CMCA 5K0ZA 4N7MA 3LTNC 5DT2A 1V7QA 4QU0A 2EZTA 1DG3A 2HSGA 2NP6A 1ELOA 1IZ9A 4M1QA 2BGMA 3CLSC 2NU6A 2BWJA 6PFKA 2B7BA 2QT1A 1FX1A 4XGIA 2BE7A 5FUYA 5ELXA 1M3SA 3F78A 3H86A 1P45A 3OLWA 4PXSA 1NUPA 5DN9A 3AUYA 3I2HA 4M60A 2WYOA 3SLGA 1Y9ZA 5JJ5A 2N75A 1NV8A 4INPA 3ZHTA 2FPGA 3AQ4A 4ETMA 4DMLA 1UXGA 3L79A 4CR6A 3V8NA 3OOEA 1G18A 2XBLA 3I61A 4J2OA 4CU5A 3SJBA 1TNDA 1E69A 1T8RA 1OZAA 4MRMB 4X94A 2WIDA 2BJWA 5DGTA 3RO7A 2VJBA 4LCJA 2RBKA 4F9FA 1DV1A 1CKEA 3K5IA 4P7KA 3DNFA 4AKTA 5J2UB 4P4TA 1OW3B 2NV2B 2P4EA 3B89A 5ITVA 3AR9A 2A9VA 4DADA 4O2AF 2O20A 1VA4A 5JAQA 1XE3A 1LPBB 1HYGA 2JARA 2FZ4A 4UQLA 4EUHA 1Z4PX 4P4NA 1W0KD 2XB2A 4B32A 3FCXA 3V4RA 4G41A 1UJCA 4AURA 4DAEA 4QFDA 1I9GA 5IUKC 4GKJB 2DBRA 3CNEA 2AQHA 1DZIA 1ZX1A 3TNYA 3QMVA 4O2RA 1EFVA 1UDBA 2RI0A 3DM9B 4R5MA 4RJKA 3RU7A 1TEXA 3AFOA 3OICA 3SYKA 1C1DB 2PLNA 2Y93A 1EE2A 3L7NA 4ETNA 1RWMA 2BKXA 3B51X 1BZYA 3ECCA 3HP7A 3HXTA 2VJMA 2JLSA 3KHUA 4M9SA 3HA2A 5E2IA 4LF8B 4QD3A 3WGUA 4YWJA 3ZCTA 2BFDB 2QN6A 3H16A 1NDQA 4IV8A 3A6HA 2PSDA 3HBMA 4PQGA 4DEYA 1KO8A 4EYOA 1BCSA 2EFJA 1LC0A 1PX0A 2Y9PB 5FFFA 3ZGOA 4L51A 3WO0A 4EPVA 1D0SA 2IXDA 3C39A 4KR0A 4O4HF 1CJCA 3CCCA 1BX0A 4NZYA 2ZXFA 1G5HA 1GY8A 5LXTB 4Y6RA 4NENA 1JR3E 2WFLB 4BO8A 1ZIDA 1ZMOA 1JLMA 1LF0A 2AQIA 4HQ0A 4DUPA 5HF9A 1G3QA 1OLXA 4TV8B 1AUOA 2BR3A 3H3FA 4OU5A 5K7SA 4ESOA 4CIAA 4AXXA 2GCEA 3NJ8A 2I34A 3LT5A 4WBSA 5FNVB 3RHFA 3CVVA 2AH5A 4Z4QA 3ZVKA 4CKEB 1P1JA 2J30A 5AKXA 1QPZA 4OX9B 3MT0A 1NI3A 1NYQA 4WA7A 5BY2A 3TX6A 4ZEVA 1NBWB 1RZ3A 4UTVA 5DM70 3ZDBA 3CVYA 3I2JA 1NUHA 4ZC8A 3QOFA 1S8NA 1NKTA 4KIFA 2GHRA 3HDTA 3M6IA 1NI4B 1NZJA 1W29A 3CCFA 4B4VA 3WNCA 3A1FA 4P31A 5C35A 1T2VA 2COKA 3N8NA 1A50B 2GK4A 2ZIVB 4BO5A 1GAEO 1YR3A 1DZ3A 2FLKA 2HLNA 3L6DA 3N6RA 2GRJA 3QPBA 4IIJA 1RWXA 3ZE9A 2OO3A 4BQIA 4E2FA 4Y2SA 3ZC3A 1VSBA 3PPVA 4RIGA 2F3UA 2MSKA 1FUEA 3HP4A 3BZUA 5DGXA 1UKBA 1N6PA 2JGJA 1ZHHA 1LEHA 3SC3A 4R1MA 2AFIE 4CEIB 5E9QA 1JHRA 1QE5A 1X8JA 1TC1A 3QU9A 3ANMA 4QBIA 1T0HB 4MLCA 1BO6A 3AJRA 2OQVA 4M83A 2I67A 4AZSA 2CHUA 4L4ZA 1FVOA 4YMWA 2FHPA 5GIOE 4IEIA 4H6PA 4XUDA 1O96A 3CEJA 4RGYA 4CM9D 3WK9A 1LX6A 3EWAA 2FW1A 2FY8A 1TW3A 2IT1A 4IRMA 1C30A 5EMHA 3REQB 4WTOA 1UK8A 4CM6A 4TPKA 2UZ0A 1E3JA 3WWEA 4F0JA 1TEVA 1KEEB 3LT0A 1L8AA 1SQ0A 2WDZA 4EKIA 4Y67A 2ZJOA 5C5DA 1WU7A 4LK2A 3FDZB 1W5EA 3KK0A 4G0NA 4RAQA 4B5LA 3HZRA 1Q0SA 3QLEA 4ZV9A 3FKQA 2CVZA 3OLZA 2I2WA 4XDYA 4WCFC 5BUQA 4MW6A 4N3AA 1L7QA 3PGJA 4F91B 3OHPA 3I04M 2YVLA 5DCLA 3EIEA 1XF1A 2GJKA 2GT1A 2JVIA 1ILWA 2QN1A 2C2OA 2V0CA 3EIXA 3IUJA 4J0GA 5HBGA 1TLLA 1KYQA 3NATA 3VXKA 4BZPA 3U6KA 4QXQA 1DQZA 2HLPA 5IZCC 3FN4A 3TZQA 1TYAE 2UZ1A 3UJ9A 1GTSA 3EGEA 3I8OA 1QIMA 1ZITA 5C81A 1Z6GA 2M2IA 4PFJA 4BJ3A 3HYLA 2IPOA 4PZCA 4H35A 1TW2A 1KH1A 1J6UA 4JA2A 4JLJA 2PV7A 3A3YA 1KMIY 4LF6B 1W5TA 4CLHA 2PS0A 3KYBA 2HWWA 3OM0A 2W2XA 4M6WB 4BRUA 3UA3A 4DR7B 2ZWMA 1PGPA 3OQBA 3JAKA 3TYXA 4BNGA 3IDSA 4B4OA 1KDYA 3DHWC 4AQ7A 2BVNA 3H5TA 3NT4A 4KVGA 4BBPA 2N0SA 5AFSA 3CS3A 2XHZA 3T4EA 3NH9A 4LZWA 4KNYA 2AUMA 1Y3BE 3B8EA 4WE3A 2J5KA 1WW8A 1AJEA 4UM9D 3ZH2A 1VGQA 3LUAA 2JB9A 5AJVB 1AK9A 1NMXA 3C0KA 3DT9A 1Z2CA 2GPAA 4L9SA 4HDQB 1S9DA 2HQOA 3AR6A 2OXIA 2FZGA 4RQTA 4OHOA 3LC1O 2ZM6B 4N76A 2BFOA 4MWSA 1GPUA 1KYWA 2FWAA 3VPCA 3IOEA 5EIAA 3RS5A 1RQGA 2R3SA 3OQ1A 5EGNA 1Z5VA 1WY7A 4ZEOA 2KLHA 1B14A 2WTXA 2NZJA 2EZ8A 2X86A 3DEYX 4N0EA 3HH8A 1S1CA 2YXLA 3GCZA 1OA0A 5LZ8A 4PSVA 1RPTA 3PUVA 3VHQA 5KO2A 4ARIA 1S3IA 3VU1A 5ELLA 4P3XA 5HM8A 3Q8XB 3G6KA 5DGIA 3H11B 4ENUA 5JY6A 4NCNA 3WJ2A 1PDOA 1Y6QA 1LRKA 4IY1A 2EWMA 4A91A 3ZS9A 5FWXB 2YWCA 1C4OA 1XEAA 4ARSA 4YHHB 1BMFA 1GGEA 2HT6A 5FBLB 5G0TA 3WSTA 1IE3A 2DMRA 3CVOA 4I99A 1LQUA 2B21A 4LY9A 2JLXA 3V80A 1CBUA 1HYQA 4H6XA 5A0FA 4F6RB 3N70A 3S1AB 4E7PA 1FTWA 4KYIB 2EIHA 1MHPA 2VRBA 1TRKA 4G1CA 4K26A 3ZBTA 1E3DA 2AX4A 1PJAA 2CXHA 3I09A 3MNFA 1LNSA 4M0LA 2IYRA 3TL2A 3FUWA 4DLZA 1J2EA 2WVHA 3BE6A 3X3HA 3RCBA 2BCEA 5I7FA 5JCJD 4RV5A 3T9DA 2ID7A 1L9XA 2JFUA 3JYLA 5FUWA 3RODA 1VL5A 3KQNA 2D13A 4F46A 5DM60 4YRTA 1EM6A 1FVXA 5KMGA 2I71A 4ALJA 4QVIA 5CB6A 1HZZC 4L7VA 2EG5A 2GR9A 2Z5GA 1P4HA 2CNNA 1V16A 2Q9AA 2XNDD 2W4IA 1FFWA 3ISTA 3JARB 3ZWQA 2DJ5A 4BU0A 2RCNA 1CPYA 1T8WA 5J2TF 1EFAA 2HDOA 4B2YA 1PWZA 2B4RO 4J4TA 2H65A 4O4IB 3H2GA 4O25A 4D9MA 1WOMA 1ZBDA 3C3CA 2Q5JA 2CN1A 1CRLA 3IAFA 3TGWA 2AJBA 4WAUA 4DGSA 2VTEA 5IUNC 3ESCA 3OFSA 3SJZA 1XZQA 3TJRA 3JQFA 1T8UA 4G5HA 2QXUA 1DC3A 1RFLA 1X0XA 3N6XA 4B3DA 4INAA 5F5LA 2CJFA 3LO8A 3QLUA 3LKVA 1JE1A 1JKJA 4PW0A 1KOFA 3RWMB 4QDJA 3WDLA 1T1GA 1LDYA 4GW3A 4I55B 4P54A 2JFVA 3MJDA 4FGJA 5DHRA 5FP0A 3SBXA 4LDPA 1EU1A 4OXNA 4C0XA 1SQ6A 2XCIA 3CRW1 5KNDA 4NOMA 3MELA 4X45A 3JCZA 2UUBB 1SCNE 1RXIA 3A04A 3NG1A 4HRAA 4AI6A 4KU4A 4EW1A 3AUKA 1L5NA 3RFCA 2IS1A 3W04A 1SPBS 2GVZC 3C24A 2Z1MA 4OYYA 4F3TA 2BCJQ 2QW0X 4MAMA 4D7AA 1PTKA 5CURA 1FBNA 4N3NA 3FZEA 3P19A 2H57A 4OP3A 1JVSA 4EG6A 1I01A 5CB0A 3VR6A 1BMDA 3JZAA 3PFWO 5ED0A 2GMWA 3N1UA 1G5RA 1SU4A 1ID8A 1RVDA 1CNEA 5JZSA 4TYWA 3KYCA 5U4XA 3W5BA 1QK5A 4D4GA 1G9SA 4BQQA 4ZCLA 4DNFA 2FEAA 1A9XB 3R9XA 3DXYA 2IZ0A 3ELUA 3M82A 1RQNA 4MWBA 5LUBA 4CKBB 1EUQA 2YWFA 2ZZKA 1NM5C 3A37A 1V3QE 2HZ7A 1Z06A 2PQ6A 3OJOA 2BGGA 2NVOA 3CE9A 2NVUA 3TPZA 3DFFA 4EA8A 4GP7A 5IDVA 2C1XA 3DCYA 3F3KA 4YAGA 3U4MA 5AVYA 2B2CA 1V11A 3WYFA 1W2WB 1SNYA 1CR0A 2J5QA 2NV6A 1PV1A 2GBLC 2OV4A 2GPJA 1I6KA 3GIWA 3LRTA 1PUJA 3J80A 1L8QA 2WPDA 2F6RA 2CE7A 2ZPAA 3KC2A 3OCUA 5AK6A 2HF8A 4AJLA 1G41A 1YRYE 4C5CA 1MABA 1UT8A 2CF5A 3E48A 3OCVA 4HGNA 5I9IA 1P33A 1CUWA 1F1JA 1QYCA 2O1SA 4A0FA 2A1TR 5J47A 3ODPA 1DRUA 5BSWA 1YF3A 3ZU3A 4NMMA 3WISA 2MWMA 2ZRCA 3DE0X 4BKPA 4C5BA 5ENDA 2A0YA 1P1RA 3L6CA 1RXCA 4C6RA 2DHRA 5JI2E 3CT6A 3N6VA 2HRCA 3PVSA 3CX6A 3LNTA 3NWEA 2QQGA 3UHJA 5CAEA 2BP7B 2F9FA 1PJRA 2ABWA 2FZLA 2HBYA 1YS9A 2QUIA 3K1YA 1YKFA 3MQ2A 2PWYA 3NGMA 3T95A 2ZBRA 1EGAA 3CE6A 4R98A 5HOEA 5KDOA 2GXUA 3C3WA 4QECA 3Q11A 3NHKA 5H80A 3HPRA 4DDMA 5EIFA 1E5VA 4L4SA 3VR4D 3NP7A 2VIIA 4EI9A 2RBEA 3QEMA 3O8CA 4PLVA 2G4VA 5HCUA 1G8GA 5DBEX 5GVSA 4GI3A 1SK8A 4U7TB 1RE1A 4IIUA 3CWQA 4O3MA 1W96A 1M74A 2NPOA 2PS1A 4F4HA 5HX7A 1FSGA 5BQPA 1LI5A 1I7PA 2H92A 3IOBA 1IUOA 2C8KA 3KZ1E 4Z0TA 2R87A 3O26A 4Q3EA 4Q47A 2Q3HA 3WNZA 4ZOLA 3VKUA 4YMHA 1QLWA 1TKAA 1A2QA 3FVQA 1Z4KA 2FUG6 2HDHA 2BHTA 2IVFA 1FS6A 1A2KC 2YZKA 3IH5A 2QPLA 3LDHA 4OI4A 4OXRA 5LZ4A 4ITRC 5CM9C 1U0GA 2OXEA 4N01A 3UAYA 2WYWA 2C2YA 1W85A 3BCSA 4YRIA 4MWGA 1AQNA 5F3RA 1JHOA 5C80A 4NK4A 1P5JA 5EINA 1VI5A 4AP6A 5JO0A 2CNDA 1LLCA 4U7FA 3IP6A 2AZTA 1JTVA 1L5YA 2Q49A 4PS0A 4ENTA 5KWIA 4I4TF 4IBOA 4DV2B 3MFYA 1VIVA 5A6SA 3IX7A 4D8WA 4GQIA 4TMTA 2D8MA 1SCUA 1V9CA 2FDXA 4LDAA 1IUPA 4ZI7A 3LU1A 3GLGB 1S3FA 1VLQA 2QUJA 2X41A 1AQ6A 4UDOA 4E5YA 2D7DA 3ZXYA 4XTCS 1AV6A 1CUFA 3Q8MA 3QVGB 2QMOA 3GLIB 2Q5OA 1EBUA 1ZIPA 4FYYA 4M0FA 1VJRA 2EF0A 2QDKA 2P9HA 3COVA 4EZBA 3OZXA 1BHQ1 4INZA 1R74A 1X9HA 1BEZA 5JHHB 3PUYA 5KKCA 3ZDZB 3FY4A 4CUZA 5KOIA 2WWWA 2JLQA 2V7WA 3KFVA 4EB8A 1T1SA 2GK3A 4RVCA 3PZBA 3QLVA 1O5IA 3AM5A 2X0FA 4EA6A 1EG2A 2PRIA 3QY9A 4M2LA 1EZZA 4FINA 4S1PA 2VHZA 1CR6A 2GXQA 5KTPA 3DZCA 3MTGA 1NJ5A 2EKZA 4UUAA 3W2GA 5K4HA 2GKSA 4JMLA 4XX1A 1VRVA 3B13B 3BBLA 3WO1A 2HIHA 3LHSA 1OCEA 1MEOA 1UAYA 1HC7A 3HCDA 2PGLA 1VE5A 3MS2A 4QPDA 4Y2TA 1BKDR 3CO0S 5JC8A 2W83A 1IY9A 3AHJA 2FSUA 2O52A 3PC8C 1GUDA 3QIAA 4N9WA 3TXYA 1TQDA 3UJHA 4DLBA 2VT3A 2PFKA 2VPWA 1U4SA 1CR2A 1H2HA 2ZSHA 3D2CA 4HN2A 3AB8A 3ZD6A 2EYQA 2B37A 2G70A 3EODA 4Y0VA 4TXHA 3RRFA 2GHTA 2HJVA 4OHKA 1MORA 3H18A 2R5WA 1N5IA 2REQA 2AMYA 4JBGA 4AWBA 4MV4A 1L7NA 4DJDC 4ZVNA 5FHRA 5LBTA 3FRIA 4GDFA 4IFEA 1RWNA 5LSAA 1TAQA 3ADDA 1ORTA 2ZI7A 4IQ4A 1YK1A 2OZVA 1Q0RA 2WA2A 4ZICA 3W90A 3DMFA 1JQKA 1R9MA 4Z0NA 3L06A 4ZKDA 1ODJA 1YGYA 3QUCA 5CNJA 4BZQA 1Y1PA 5GV7A 2FE1A 4U2EA 1PT5A 2H1RA 3N3AC 5F51A 2UUCB 4Q02A 1EIZA 1RRKA 1LLQA 1VZ3A 1KVSA 3BHIA 5A05A 1V8PA 3PKZA 2NM0A 2VK1A 3TW8B 2W22A 2EFCB 2J45A 1AQLA 1T6BY 1JWBB 3X0DA 1LNZA 3KHSA 3ZXUB 3SE0A 4OXKA 2CLDX 3QRWA 4ZT5A 4K0KB 1NQOA 3CRMA 3CZQA 1XMOB 4MRMA 2YHIB 3GCWA 1FMJA 4P5EA 2VAVA 2A3RA 3O21A 4GKKB 3SVLA 3UKOA 5FQNA 4BUJA 2P4UA 1N2CB 4O8CA 5DLYA 5J2UA 4DLUA 2VP4A 3SQOA 1DC6A 4O33A 3TUJC 4A92A 2HHCA 5HPYB 2L0XA 2F1IA 4WXEA 3PEFA 3NHMA 2REBA 5J43A 5AKZA 5HSGA 4EQ6B 4Z4EA 5B7GA 5HFJA 3PDIB 1PQWA 1SOVA 3CPSA 4J3FA 1QIKA 4XUEA 3HUEA 4U2DA 3EQ6A 4Q9NA 3T7JA 2G9VA 3QFSA 1JHUA 1A8UA 3W77A 5JH7F 1C1DA 1BFDA 3BIOA 4ZGGA 4PZAA 1E0SA 3CRQA 2LV8A 4I4NA 4JGIA 5HKKA 3C4JA 1FCJA 4JUAA 3HBJA 2LP4Y 4RY0A 3SXUB 2DR3A 3QHAA 2BFDA 2AL7A 1DRWA 2L2QA 5DMXA 4IQ0A 5EP4A 4JYZA 2MSWA 4DDVA 2DXIA 3VH4A 2IHBA 2JA2A 5IN5A 2XE7A 3D02A 2DGDA 3FG9A 1R6TA 3I6BA 1QHFA 1E59A 1GSAA 4WLUA 2N42A 5LXTA 2EJVA 3DOFA 2XJ9A 4FFBB 2A9QA 2WFLA 3U4HA 1YAHA 1THMA 2H54A 1IB0A 1NWHA 4FDAA 3UJ6A 4TV8A 4A8JC 2O2IA 3SIXA 3UW3A 3U7EB 3L4SO 4BX9A 5LWHA 4QM7A 2QK4A 1WZNA 4GIBA 5FNVA 1V26A 4LBYA 2OY0A 3I0NA 2WUDA 2X6TA 1Q0HA 4CKEA 1N6HA 4RCVA 1N8NA 1D4FA 3BRWA 2FP4B 4RH0A 3WLOA 1O54A 1YL5A 4RKEA 3F90A 1T91A 4E2XA 2CLSA 5GADl 3CLUD 4IQGA 2XZPA 3HB5X 2Q6IA 4TOIA 2C5HA 1P4GA 2FQXA 4GG1A 2PGAA 2WAAA 3M6MD 2DH5A 3OF3A 1SFRA 1ZIYA 3I83A 1Q7RA 2BMVA 2DBYA 2VA9A 4FHZA 1PS8A 1XEWX 2CZQA 4A6DA 5CH8A 2WQ7A 1FJHA 3FTDA 4OPMA 4JI5B 3RBVA 4ZAZA 3RVJA 1BJKA 3E9NA 2X4LA 3C7TA 3O2JA 3G2QA 1Y9JA 2CJWB 5AK5A 3PV0A 4B33A 5FTLA 5LLTA 2ISQA 1M75A 4HXYA 5BSHA 4O3FA 1CG6A 2O0LA 4M1TA 1JA0A 2OG1A 3JW8A 4OFWA 4V0RA 4CEIA 1DC4A 1DV2A 1DSSG 3EB9A 4HQOA 2O7SA 2PL3A 1M34B 1OYVA 3T9AA 5AWFC 1G20B 4PRYA 1CY0A 1KJ8A 1MX9A 2WP8J 1IEVA 1ZW6A 4JR0A 3ZCRA 1M9NA 5T57A 5IJ0B 4DR3B 1J23A 4F9TA 4YT8A 3LUKA 3DHEA 5F7XA 3CPJB 1T4MA 4MS1B 4WV3A 4KV7A 4Y30A 3REQA 3SMQA 4G84A 4W7SA 4FHCA 1RKUA 1E2JA 2Q46A 4BECA 2XHEA 4NBKA 4YV2A 3NUQA 2Q8QA 1ADCA 2RB5A 1C1YA 1FVHA 2E5LB 4P0QB 3THXB 2O8BA 1JPUA 3ND9A 3E1SA 4KE6A 2NSLA 3O9ZA 4FS3A 1Z9BA 1KK3A 4KKVA 1PQ4A 1MJHA 4IW3B 3U9TA 5E0KB 5CA0B 3HVIA 3KAJA 4G36A 2FPPB 4YFYA 3JTEA 1S01A 5TR9A 3ORYA 2B83A 1SC3A 3NALA 1U7ZA 3MJTA 4UVEA 3DLTA 1F6WA 1C3JA 2B1GA 4NIMA 3EZ9A 3Q98A 1HH4A 1H6AA 2Z9CA 3QPWA 4YMIA 2P9GA 1HURA 2JJ2A 3FPHA 3IUMA 1MO2A 1FRFS 2P9QA 5CMLA 4E4RA 5EJ6A 2QQEA 2JZCA 3T1OA 1E2KA 2VP5A 3A1TA 1PFUA 3HBLA 2WP0A 1P5FA 3PDHA 1NOJA 1U1EA 1QGYA 4UBIA 2DBZA 3MMSA 1L5KA 4AIIA 5L4SA 4BNFA 2AG5A 3O4RA 4HMQA 1YCHA 2A6PA 4JVOA 1U0RA 4O1MA 2WWGA 3PFIA 1GRNA 1KXZA 3NORA 4M6WA 5ECYA 4AY5A 5BOSB 3J7TA 3E03A 3L8CA 3HMQA 4MV3A 4KDCA 2BM9A 4B74A 3QXGA 2GEUA 1EUYA 4R3WA 1C5KA 1KSJA 2QZJA 5FULA 4X24A 4DC0A 4CIWA 4W1QA 4ATNA 5JZOA 1T0PA 2HA4A 2QRKA 3DW3X 2HCRA 5JXWA 3SQWA 3I05A 2ZYDA 2XXBA 3LPCA 2BAGA 4U7PB 3C3XA 4ZVVA 4WLOA 5AKHA 2PUCA 4P7JA 2HB6A 3SLKA 3PX2A 2OBYA 2JBHA 1NVVR 3KQPA 2MSCB 3JYHA 3PD7A 5CJ2A 3PLRA 4AD8A 3E2PA 1J09A 4GM4A 1X1QA 1WUHS 1XWWA 1ZG3A 4UW9A 1AD2A 3U09A 5LOVB 3VBCA 2NMVA 1YMQA 5AM1A 4P36A 3WIEA 5SYMA 3DR3A 2ATCA 4BUCA 1PAUA 1DIAA 4RZQA 1JKIA 1TLFA 3VJKA 2FWBA 5TARA 1ONBA 1RM3A 3H8WA 3IPYA 2IITA 4X54A 5LQUA 4C2BA 2LKCA 4ZQEA 3BGOS 1NOIA 1M2HA 1SHKA 2GEVA 4GMKA 1YJ8A 4OBBA 1G8FA 5E6SB 3TEJA 1A97A 4B6SA 1KI8A 4KQ9A 4W9RA 1DHTA 4MQMA 3VOTA 3G0CA 1KOJA 1A27A 5FWXA 2VBIA 5BNTA 3VNUA 1HT0A 4DQKA 4X20B 1F8YA 1P1KA 1A8QA 1ORWA 2B0CA 1KFBB 3OUUA 4PAGA 3DV0A 5AI5A 4AYXA 4GAEA 4F2GA 3PJRA 2FUCA 2J8ZA 2JH9A 2DQZA 3L7JA 4BLTA 4R8MA 2Q7DA 1FNBA 5K0SA 1TA4A 2B30A 2JI9A 4EVSA 1HPLA 4I9NA 1U0HC 3S1AA 2VEDA 3HUUA 3RNOA 3KO8A 4UOEA 1JB9A 3QZUA 2AKYA 1IXKA 4XWTA 3RSSA 4FXOA 2N47A 5HRCA 1N92A 1RAIA 4P7BA 1W9MA 1DIRA 2VBCA 1U99A 1YQEA 2HHLA 3KDSE 4PR0A 3IQDB 4EHAA 1RXWA 1LW7A 1VPTA 1KSHA 2JK1A 2RB4A 3KR9A 4FMCB 4ZGBA 1IY1A 2QNRA 4L7QA 4POOA 4L15A 5DCYA 2AS0A 2FR8A 1BD3A 4FQ5A 1KTVA 2QP4A 1X7DA 2WF6A 3LVQE 3CBGA 5DI9A 3NBKA 2WIBA 3QSGA 3ZI0A 1XBTA 4RCZA 3OF2A 1UBFA 1VIYA 5DGDA 4YFVA 1K7XB 1ZOLA 5A7FA 1LZLA 4JZKA 3JARA 4QUDA 1RJGA 4O4IA 1IRXA 4NFHA 2P2YA 3KT6A 5I9TA 3VVMA 4P1ZA 3ZWVA 3JWPA 2FGJA 2CNBA 4OSOA 4JGBA 1MVOA 3ZBUA 4A23A 4BNWA 2OD7A 1SCKA 3BK7A 5G3ZA 5LLSA 3A14A 1WBBA 4TM8A 4AZVA 3KJHA 2ZZNA 2F59A 2F62A 3IRVA 4RU1A 2O2ZA 2YOFA 4RORA 3U13A 3DH0A 1PWYE 3CLHA 4I55A 5F2NA 4G5SA 3A4MA 2VRWA 2EX4A 3CH4B 3VPBA 2VP2A 1RWBA 4MIKA 3ZLVA 3ER8A