4FLMA

S-formylglutathione hydrolase w197i variant containing copper
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
286
Chain Sequence
MKVVKEFSVCGGRLIKLSHNSNSTKTSMNVNIYLPKHYYAQDNKRIPTVFYLSGLTTPDNASEKAFWQFQADKYGFAIVFPDTSPRGGSWDFGQGAGFYLNATQEPYAQHYQMYDYIHKELPQTLDSHFNKNGDVKLDFLDNVAITGHMGGYGAICGYLKGYSGKRYKSCSAFAPIVNPSNVPIGQKAFKGYLGEEKAQWEAYDPCLLIKNIRHVGDDRILIHVGDSDPFLEEHLKPELLLEAVKATSWQDYVEIKKVHGFDHSYYFVSTFVPEHAEFHARNLGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A role for His-160 in peroxide inhibition of S. cerevisiae S-formylglutathione hydrolase: Evidence for an oxidation sensitive motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords S-formylglutathione hydrolase
total genus 88
structure length 286
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.1.2.12: S-formylglutathione hydrolase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4flmA00
5CT8A 1LPSA 1BS9A 4MEBA 1ZJ5A 3MGAA 2JGEA 2ROQA 3HZOA 5JANA 4HRYA 2XUPA 4L3WA 1WHTA 4K6GA 4MQMA 1VE6A 4BTLA 1EDBA 1FFCA 3MUNA 1QIHA 3V1KA 3SX4A 1YB7A 3FCXA 3NUZA 5C8ZA 3IUQA 1E3QA 3WYDA 4RPCA 2QUAA 4WFKA 4ZV7A 1GPLA 4Y2SA 2H7XA 2HFKA 3HEAA 4W63A 2QUBA 4B83A 2QTBA 5IKXA 2CKMA 1JU3A 1CEXA 1G4HA 2OAEA 5DTJA 1ISPA 1ZGCA 5EIHA 1BN6A 3DQZA 1QLWA 4TVKA 5EHXA 1Y7IA 1IUNA 1YS1X 4H7DA 3NOXA 2B4KA 3G0DA 1DQYA 1VZ3A 2WHRA 1AMNA 2XUIA 1O6FA 1C4XA 2I3ZA 1ZD2P 2Z5GA 3D59A 5EHQA 3G9XA 2VJDA 1SCKA 1EK2A 1EK1A 2BGNA 4Y2YA 2JEZA 1UT6A 4N5IX 1JJFA 1UKCA 3WL8A 2WJ6A 4G9EA 3FYUC 4CIBA 2BJHA 3LCRA 4XIIA 1W1IA 1KU0A 5LP1A 4G8DA 2HL6A 3M82A 1NU8A 2XMBA 1MAAA 2DR0A 3WJ2A 3OURA 5K3BA 4EBBA 4DIUA 4HXFB 4ZV9A 2RGUA 1ZD3A 4IH4A 3ZLTA 4NZZA 1SFRA 2JGJA 1AC5A 3OM8A 1ZIYA 3E0XA 2BUBA 3A2NA 1OILA 4IH9A 2P8SA 4YPVA 1Y37A 2BFNA 3I2JA 1CUJA 1S8OA 4EY4A 4DTCA 1MX5A 4KRYA 1Y7HA 3GA7A 3I2KA 3OOSA 3ZWQA 4KE7A 1WOMA 4IO0A 1P0MA 3RKSA 3WKAA 5ALIA 4WFJA 1LPMA 1MNAA 5C7YA 4JUIA 3W9BA 4WFIA 1ORVA 4KAAA 2HU8A 4F21A 3ICVA 3DNMA 5ISMA 1IMJA 3FLAA 2WJ3A 2HA0A 2JBWA 4MQLA 5T4EA 2PX6A 3WA7A 5BV7A 3H1BA 1PFQA 1QIDA 1EX9A 3O4HA 4CG1A 4XVCA 1A8QA 4YK7A 5CH8A 4X95A 1XKTA 5ALKA 4OYYA 1F8UA 5AICA 2QT9A 1J07A 5ALGA 3L1HA 4DMHA 2K2QB 1Q84A 4Q34A 2XE4A 4IHAA 1W52X 2AJLI 2AJCA 1H2WA 1WM1A 3F98A 1XLWA 2ZSHA 3PDCA 5HK8A 2IX9A 1BROA 3WKBA 4DMKA 5EI5A 1DWOA 2HA5A 4ZI5A 1LZKA 1U8EA 1H23A 1G42A 3DYIA 1YCDA 4BE4A 5IH7A 2OCLA 1CUSA 3G0IA 4WY8A 3IDAA 2XMQA 4U2GA 2HA2A 3WL5A 2AJBA 5EHNA 1YAJA 1JU4A 5DNVA 1O6GA 1QFSA 1BN7A 3O4JA 5JALA 3HACA 3IUNA 1U65A 4EA6A 5A6VA 4FBMA 3FVRA 3SK0A 3KDAA 1R3DA 2ZYIA 3H19A 4FFVA 1WB5A 2PBLA 1CUXA 4QA9A 3H04A 4OCZA 2V96A 3OC0A 1K8QA 2XUGA 3AILA 3AINA 3A70A 5HF6A 2BUCA 1DWQA 4X7BA 3PUIA 4FLMA 2XLCA 1M33A 2BGRA 4BDSA 2PU7A 2O2IA 3STVA 3B3QA 4G5XA 5F4ZA 5ALNA 5D3KA 1A7UA 5HF5A 4GI1A 3BIXA 3GBSA 4G1FA 3C6YA 3HXKA 1ZD5A 3EQ7A 1XZIA 2VATA 1KU6A 3I6ZA 5A7HA 2YASA 1QTRA 4X90A 3AJAA 1E8MA 1OCEA 3FSGD 5AH0A 3ILSA 3AUKA 1SOMA 3D3NA 4FFWA 4BZZA 4BC0A 4DSZA 4EY8A 2OPHA 2X76A 3HC7A 5HQ3A 3ZLVA 1OXMA 5AKZA 4Y2JA 2Y2VA 4FTWA 5CXUA 2XUOA 4WY5A 4HXGA 4E14A 2Z3WA 4U2FA 1DU4A 4BZWA 4DYHA 4I19A 4AB1A 3I1IA 2DQYA 3DS8A 3EQ9A 5KREA 2ACKA 3G9TA 2VJCA 5AOBA 1UOOA 1CPYA 2J4CA 4BP9A 4ROTA 1H2ZA 4QWMA 5D6OA 5EFZA 2PVSA 2QKYA 5J3JA 1VKHA 1BEEA 4KE9A 2ACEA 2WFLB 2WUDA 2QMQA 3HSSA 4EY6A 2QXTA 2V98A 4X91A 3PUHA 4OSEA 5BOVA 3PFBA 5A7FA 5D3ZA 1X2EA 5ALQA 5HZGA 1N1MA 2OCGA 3HRHA 2FJ0A 1XQWA 5LKAA 3F67A 1LGYA 4FHZA 2PPLA 5AI8A 1J06A 1WHSA 1VXRA 1C7JA 4UFNA 1KEZA 3T52A 1EVQA 2WG2A 1JI3A 1YASA 4GWLA 5AKIA 3AZPA 5CT9A 5K3CA 2WU4A 5ALHA 4GLBA 4N8DA 4Y2PA 5EIEA 5JAOA 3PF8A 5FKJA 3ANSA 4B82A 1DT3A 2D5LA 3C6ZA 5HCUA 2I03A 1UOQA 4ZGBA 1DQZA 2G5TA 4HAIA 2PUJA 3CCBA 1MTZA 2NW6A 2Z8ZA 5AKYA 1ZOIA 3KWJA 3IUJA 3QMMA 4G8BA 3X3HA 2QOEA 2RHTA 1XZBA 4CCYB 4UPDA 4HS9A 5T4FA 4ZXFA 3WK4A 3FVTA 5IVHA 4G4IA 5JZSA 4J3JA 5CMLA 1XZKA 3R41A 2C58A 1TIBA 3STYA 4IQ4A 4X85A 4H0CA 3B5EA 4B80A 1J2EA 2I78A 4OB7A 1GT6A 3WJ1A 3STXA 1EA5A 1CRLA 2WFZA 3S8YA 1BCRA 5ALDA 1A88A 3FYUB 5AK5A 3D5EA 4C4XA 3MUOA 3R3VA 4ARAA 4O08A 4L72A 5K3FB 1JFRA 1ZGBA 4B9EA 1ZIXA 1LZLA 2GBGA 1CUBA 5AM4A 4EHBA 4KACA 3KOOA 4AO6A 3C8DA 1ZICA 1JJIA 4LIPD 3WK8A 4X6UA 3WZMA 1N5RA 4C89A 1QIJA 3G8YA 2OGSA 2EDCA 4Q82A 3LP5A 1QJ4A 1LPOA 2C7BA 5CXXA 1CUUA 1JKMA 3NGMA 4LYEA 2OAGA 1JJBA 3VJLA 2WKWA 3W9UA 5AIBA 2QR5A 1HL7A 1XLVA 1XQVA 2ES4A 4C87A 1DWPA 1F0PA 3A6ZA 4A16A 4ARBA 3I28A 2R11A 1UKAA 5AJHA 1CUIA 4RNCA 1Q0RA 1CR6A 2BKLA 1W76A 1VA4A 1QO9A 5AOCA 1J1IA 1UZAA 4A23A 4X6XA 4A5SA 3I2GA 3AFIA 5CT6A 4BC1A 2QXUA 4PNZA 2DHCA 2OQIA 5K5EA 3BE8A 1WPXA 2XUHA 4LYDA 1TCCA 4M0FA 1EB8A 5LIPA 4EY7A 4QDUA 3STTA 4F60A 1SC9A 4IH1A 3C5VA 3D2BA 2XQJA 2HDWA 2XMZA 5ALZA 4UHDA 2CBGA 3ESAA 2XDWA 2WG0A 3K6KA 2B20A 4X97A 4DGQA 1FFDA 4UBLA 1R4ZA 1H2YA 3A2LA 5HFNA 5HF9A 2WIJA 4EUSA 2Z3ZA 3V1MA 3KSRA 1VA5A 2JGLA 3DLTA 4X92A 2XMCA 3FBWA 4E11A 1YSCA 2QVBA 4BB0A 5C8VA 5SYMA 4UHCA 1XZAA 3RARA 5AM2A 3QPDA 2XLBA 4OYLA 2XMDA 1UXOA 1VZ2A 1MU0A 4BAZA 3M83A 3WMRA 4AX4A 1MJ5A 3WKEA 4BATA 5JADA 4PV7A 5CRIA 2JGMA 5DYYA 5E4JA 4ETWA 1E89A 1BEZA 1GZ7A 3I6YA 4PW0A 3V1LA 3AZOA 5D7BA 4B9AA 3SC2A 1YA4A 1CLEA 1XQYA 3AZQA 3FLEA 3QMVA 5AM1A 1H2XA 4BTVA 2FX5A 2ORYA 4KEAA 3FLBA 1R50A 4GEGA 3BJRA 3FCYA 2VT6A 3H0CA 1CQWA 2HRRA 3HJUA 1P0PA 1XRQA 4C4ZA 3QPAA 2CEKA 3K9BA 2ZSIA 4RGYA 5ALPA 3W05A 3Q0TA 4DNQA 1XRPA 5FDFA 4HTAA 4GW3A 3R3WA 5AKXA 3IIIA 3VJMA 4K6HA 4WJLA 4BP8A 4G4GA 2XMSA 5JD5A 4J0GA 3CN9A 3ED1A 1QIIA 4I4CA 1LBSA 2PSFA 5JYCA 3V1NA 3WWDA 3FSGA 4FWBA 2VA9A 3ESDA 5C81A 1ZI9A 4LXGA 3U1TA 5AI5A 3HLKA 2VT7A 5HFAA 4G4JA 4H18A 4UHHA 5AKKA 5CH5A 4BVKA 4BE9A 5FLKA 4RE6A 2GZSA 2C0QA 5AK6A 4N8EA 4KJXA 3TGLA 4OB6A 3VDXA 4OU4A 4EY5A 2DSNA 1UK6A 2YH2A 5LYYA 2DHEA 3N0TA 2Z8XA 1JMKC 1HLGA 1XLUA 2XQFA 1XZLA 2HFJA 3D4LA 4BDTA 4QLOA 2WM2A 3WWOA 4FOLA 1BU8A 2GBIA 3CXUA 4P92A 3I2FA 3UMJA 4JH0A 4CCYA 1EI9A 3QMWA 5AO9A 4KAFA 1FJ2A 2CZQA 1QONA 5AKJA 2HHAA 3BF7A 3I1YA 3I6MA 2QM0A 5ALEA 2ECFA 4FMPA 2WIFA 5JZBA 1MAHA 4MXDA 4Y2QA 2WUGA 1TCBA 1XKLA 2RI6A 2VJBA 4L0CA 4F5ZA 2ZYRA 3DOHA 2OG1A 3H18A 4HZGA 4BAUA 5JARA 2IIVA 3WL6A 1GPNA 4BCDA 1CUZA 3WIOA 2C0PA 5ALWA 1DX6A 3IVMA 1WB4A 4XJVA 1MO2A 3WK5A 4J0JA 1AZWA 3M81A 1UK7A 4ZRDA 1BE0A 3TJMA 4QNNA 1YAHA 2PSEA 2XUDA 1CUWA 1R9NA 1VLQA 3AIMA 1E5TA 1Q0ZA 4J0IA 4H7HA 4P08A 5AI6A 5AP9A 3H2HA 1CV2A 4Q3KA 3S2ZA 3WA6A 4UFOA 3R3YA 4OB8A 5DNWA 4XX1A 3C70A 2Q0XA 4PO3X 5LZ4A 3U0VA 1EDEA 4H35A 4W1RA 1CUCA 5AIAA 5AM3A 3QH4A 3EF3A 1IZ7A 2QZPA 2G4LA 5E4TA 5E4YA 4WCVA 1XZJA 3L1IA 3LIPA 3DCNA 2XUKA 4NVRA 4U2CA 4UHBA 5ALMA 3BDVA 2XI4A 4RE5A 3D0KA 4UBNA 3FWHA 3DOIA 3O4GA 2R8BA 2OCKA 1CUEA 4BCCA 3OTQA 4X6YA 2RAUA 3F8SA 1MT3A 5DJ5A 3WWPA 5IVKA 1XZHA 1F0NA 3ESBA 5AKHA 2XB6A 4QZVA 2CUTA 3HABA 2C5GA 5E2IA 4AO8A 2PL5A 3OPMA 4WDQA 2WSLA 2XQIA 1CUYA 2ZJFA 4FNGA 2XMGA 4J0HA 4X71A 4U2BA 1EB9A 1G66A 4OUKX 3ESCA 1DTEA 1A8UA 3V48A 3FNBA 4CG2A 3C45A 3TEJA 2O7VA 4EZIA 3OG9A 1CFJA 4H7EA 4BYMA 4GDMA 2GYVA 1K6EA 3GUUA 2VF2A 2AJ8A 5K3DA 3RLIA 5CBKA 4X93A 1VJ5A 5A2GA 1ZJ4A 2B9VA 3SWWA 5FUMA 3DL4A 1NX9A 4K5QA 3DKRA 3BL8A 4M0MA 2XUFA 4OU5A 4W9RA 2VAXA 1ZD4A 4DLNA 1P0QA 2WTMA 1CUFA 3YASA 3QVMA 3BIWA 2WUEA 3GFFA 3UUFA 1XZMA 3N2ZB 2WIDA 3FOBA 4MEAA 3C5WP 5K3FA 4HVTA 5I8PA 4J0DA 2OCIA 2Y6UA 1LPAB 3AIOA 3VVMA 4UFPA 2HM7A 4B6GA 4DNFA 4JNCA 2WILA 2WTNA 1LPBB 3WK6A 1CUGA 1QIGA 1XQXA 3FAKA 2G63A 3V9AA 3IB3A 4CFSA 3KWFA 2V97A 5A71A 4L9AA 4X94A 1UKBA 2YXPX 3ANTA 4G8CA 1GGVA 1CIJA 1QFMA 2PU5A 2WLSA 3IBTA 5CT4A 5BWBA 3QZUA 3JW8A 1QOZA 1B6GA 1W6RA 4X3CA 1XZFA 4AZ3A 3VKFA 3GZJA 4B81A 4DMFA 2GYWA 3PICA 2ZJ7A 4W1SA 1C7IA 2WFLA 3QYJA 4U2EA 2YYSA 4N5HX 4MYDA 5ALVA 3DL7A 3DJYA 1AX9A 2J4FA 4JYPA 4TPKA 5AK3A 1QIKA 2DQZA 3VXKA 4X00A 1FFEA 1XFDA 3KD2A 4DMCA 1L7RA 1XZGA 4B0PA 4I3FA 1GXSA 1AKNA 2QJRA 2ONCA 2W6CX 3K2IA 1K5PA 2V9ZA 3QITA 3WLAA 4KE8A 1TCAA 2WU3A 1TQHA 3ZI7A 3IURA 4B85A 2AJDA 3CCCA 2WFMA 4Q3LA 1RP1A 3F9CA 1LNSA 3FYTA 2JGFA 2C5FA 4J03A 1WB6A 1THTA 3WZLA 1EDDA 1WPRA 4KAJA 1E66A 5HK9A 4Y2VA 3WKDA 2EEPA 1F6WA 4E15A 4H7FA 1IVYA 1W4LA 4D9JA 2HA4A 1IUOA 4Y9SA 1CUDA 1SCQA 1R1DA 4BAGA 4GHWA 1RYYA 2J3QA 1AUOA 5CTAA 7YASA 1AGYA 1XZCA 1ZI6A 2D0DA 1DINA 1TKRA 1QIEA 1XROA 1H22A 3W06A 2LIPA 4C4YA 3ZPXA 1QZ3A 5CT5A 3F96A 4K6KA 2ZYHA 4LHEA 1GQRA 3GELA 1GKKA 2HRQA 1HBJA 1TAHA 3E4DA 3BDIA 4JYMA 2OGZA 3E1GA 1FSSA 1PV1A 2ZJ6A 5I9IA 3P2MA 5K3AA 1CVLA 2VTVA 4FBLA 5JAHA 1MNQA 4P93A 4AXBA 1EVEA 3HI4A 1HQDA 2I3DA 3L1JA 3QM1A 3T4UA 3PFCA 5FPPA 5JD6A 3FYUA 3LLCA 4QDTA 2VJAA 1HDEA 5IVIA 3ZLUA 2DCMA 4K2AA 6YASA 1FFAA 2CJPA 4MYSA 2OXEA 5EHZA 3BWXA 1XRNA 4Q1VA 5DNUA 2RIPA 1R88A 1GPKA 1E8NA 3WK7A 5YASA 5AI0A 1LPPA 2XUJA 2O2HA 5ALTA 4YX9A 4UBMA 2HADA 1FFBA 2JGKA 1U4NA 4BRSA 1NU6A 3DD5A 2QJWA 3ZV7A 5ALYA 4AO7A 2H7CA 4DM7A 2FJPA 5FOQA 5JD4A 3BF8A 1G5FA 2AXEA 5AI9A 5I7UA 4NMWA 5AK4A 3WWCA 5T4BA 1XRLA 1YR2A 1EHYA 1D07A 1ODSA 4DNPA 3R0VA 2HA3A 1X70A 3H2JA 3HYSA 4UBKA 5AKEA 3W2TA 4BVJA 2JGIA 4Q05A 5LZ9A 5JASA 2PSJA 2XQGA 2PSHA 1T2NA 4PSDA 2H7YA 4Y2UA 1JMYA 1DX4A 4HRXA 3VVLA 3G7NA 1VXOA 1VE7A 2HU7A 4E46A 3DDUA 3H2GA 4Y2TA 5JAUA 4AQDA 5AKGA 1X2BA 5HKBA 4KE6A 2GYUA 1B41A 1EH5A 4HXEB 3DYVA 2J3DA 2O7RA 1CQZA 1XRRA 5DWDA 4FKBA 5HQ3B 4H77A 4KR0A 3E3AA 5LZ8A 3C8HA 3O95A 3W04A 1I6WA 2DFPA 4FDMA 3EQ8A 3R3UA 1EXWA 3EBLA 2XMRA 2WIKA 4Y2XA 2VAVA 3F97A 4INZA 3JWEA 3H17A 4J7AA 4ITVA 2PM8A 5BWCA 2Y6VA 4C6HA 5FP0A 3LIIA 1MN6A 4J0KA 3IULA 1LPNA 4MWSA 1VOTA 3WL7A 4ZWNA 4J0CA 2GBFA 5HKAA 3GROA 1LLFA 4JEIA 1K63A 2HU5A 3DEAA 2CMFA 1N5MA 5JATA 4UHFA 5H3HA 1P0IA 5LLSA 3WI7A 5FV4A 1XZDA 5AM5A 5AM0A 1GQSA 3O0DA 3EIOA 3LS2A 3JYHA 3IA2A 3D2AA 4QDXA 4AMZA 3STUA 4UHEA 3G0BA 4QE3A 1Q83A 2EDAA 2ZVDA 3QBJA 3NWOA 3DKKA 4V2IA 2Y1KA 5AKLA 1T4MA 1YA8A 3R3ZA 5CH3A 5A62A 1QE3A 2H1IA 4U2DA 2VEOA 4H7JA 1IZ8A 1E8DA 4H7IA 2PKYX 1MX9A 3G9ZA 4H7KA 2B61A 2OLEA 4AN1A 5DLPA 3UUEA 4PSUA 5T4HA 3M3DA 4CI9A 5KWIA 5FRDA 1TRHA 4LXHA 3WYNA 1UFOA 3RK4A 4BVLA 1CUAA 5ALUA 2GZRA 4QDOA 5DYWA 2WG1A 2FUKA 2XQKA 2JF0A 5AHXA 1HPLA 1AURA 4AZ0A 2WUFA 4CCWA 4LKOA 1K4YA 1R9MA 2ZYSA 4C88A 5ALFA 1YB6A 2OQVA 2BUAA 4PSCA 2PUHA 1L7AA 2XT0A 3B12A 3D2CA 3G02A 2BAGA 4GECA 2IITA 3H2IA 5ESRA 5LZ2A 4KYVA 4QEKA 2E3JA 3PE6A 4GXNA 4OD0A 4N8SA 4EB0A 1CUVA 3G0CA 3TRDA 1ORWA 4ZREA 2WHPB 2CB9A 4UBJA 5LKRA 3WKCA 4AMYA 3WK9A 2WIGA 4W1QA 1L7QA 1W75A 1SCIA 5K3EA 4GBGA 2GBCA 4F0JA 1EINA 2Y2UA 3Q8WA 1DT5A 3I2HA 4FLFA 5JAPA 1AQLA 2HA6A 1ACJA 1HKHA 5AOAA 4B7ZA 5KWJA 5CW2A 4P9NA 4UBIA 4FLEA 1BRTA 4UUQA 5C8XA 5HF8A 3WQHA 2XUAA 1ACLA 4AN0A 5ALXA 4Z49A 2WJ4A 1WCYA 4FNMA 3D7RA 2UZ0A 4XWGA 3PF9A 2BCEA 4Q3OA 2RHWA 4CIAA 4KRXA 1QTIA 1Z68A 3VISA 1GKLA 1JT2A 2PSDA 5ALSA 5ALOA 5DTIA 1N8SA 3O4IA 1ODTC 3QPCA 3WWEA 1UOPA 4B0OA 2VSQA 2W22A 3WIBA 1UK9A 5JZ9A 4BCBA 4W1PA 3VJKA 3BJMA 3PI6A 4OPMA 2DHDA 4PQEA 1TK3A 1A8SA 1MX1A 5ALJA 1USWA 3AIKA 3A2MA 1QIMA 3ICWA 3RM3A 5A7GA 3O9VA 5IVDA 3STWA 2QRUA 1ETHA 4TGLA 1MPXA 1UWCA 3G0GA 3R40A 2C4HA 1XRMA 5FPQA 5LZ7A 5CURA 2H9YA 1THGA 4Y7DA 4WDRA 1XZEA 2OGTA 1ZI8A 5DYTA 4UBOA 3MVEA 4B84A 3IUMA 2X8BA 3I2IA 4MJ3A 5EGNA 1LBTA 2RONA 5KBYA 4YASA 2WHQA 4QDZA 2X5XA 2JIDA 4DSAA 4LXIA 3BXPA 2QS9A 4PF1A 2HA7A 3CN7A 4QWWA 2O2GA 4G9GA 4BRZA 2G5PA 5ALLA 4C01A 2JEYA 1UK8A 4MWTA 5EIAA 1QO7A 5ALRA 3H1AA 2WHPA 3C43A 1BCSA 5AI4A 2XUQA 3C6XA 1CUHA 4DNOA 5JIBA 2WQZA 2VQ6A 3G9UA 3KXPA 3R3XA 3C6BA 4M0EA 3O9MA 4S0XA 3C87A 3H2KA 4CG3A 4NS4A 1YS2X 1ODCA 1QIFA 1RWQA 5LZ5A 4BBZA 5SYNA 1U2EA 1IUPA 1QGED 4Y2RA 5FXMA 1PJAA 2HIHA 4QLAA
chains in the Genus database with same CATH superfamily
1E7YA 3LV8A 2CMGA 2AMYA 1LPSA 1YDEA 1BS9A 3MIIA 4HLUA 2QGNA 3GBVA 3N8NA 3MRTA 3F6BX 4MEBA 4WPGA 1XKXA 3RGGA 3D3JA 2OO7A 1RAIA 1S9DA 4BJHB 1V1MA 2JGEA 4QRIA 5HZKA 4FHCA 5MHTA 4EKNB 4K81B 2F3RA 2W11A 5JANA 3SLRA 1WF6A 1NULA 1QYXA 1V8DA 3L0SA 4DCTA 5CCEA 5HKOA 4Y0NA 1J7JA 3VVCA 1WHTA 3QJ5A 1T3HA 1ZMRA 1V25A 1VCOA 3L4SO 3DWEX 3AY7A 3E7FA 3KDSE 1S89A 4RAOA 3U56A 2ZU0C 1BC5A 3MUNA 1T6XA 2AI2A 4A8JA 1QIHA 2R85A 3Q9UA 1OUMA 1N1DA 1E1QD 4XZ3A 3O1LA 4GNRA 1W59A 2Q5IA 3KXDA 3QELA 5EUMA 1Z6PA 2PLNA 2NSHA 3NIDB 1JPVA 2Z6VA 3BRQA 3NETA 3GFOA 3TFWA 3ZEIA 1GUAA 1JQBA 3IVAA 1R5BA 4HUJA 4KIJA 1L1FA 3ZVNA 3GXOA 4KVZA 1BAPA 1P7YA 1U04A 5C8ZA 1I01A 1KBZA 1QX3A 2WNIA 3GT0A 5THQA 4D81A 5BN3A 1H0HA 3FSRA 1VPWA 3WYDA 4RPCA 2B83A 3K1TA 2Q7DA 4HWOA 3JD3A 2XAUA 5A1TA 1DHTA 1DQPA 1GPLA 3FYCA 4Y2SA 1N3YA 3CX3A 1ICIA 3TMAA 2V6JA 3NHPA 1YU9A 4W63A 2R7MA 2AHOA 2E4XA 2WT4A 1QRAA 3IERA 3CPHA 3NEJA 4X62B 1H66A 1SY7A 3OI7A 4EI8A 3M2PA 1G8YA 2OFWA 3EUAA 1JU3A 3B1YA 5AVZA 2XNSA 3MYRA 4LWQA 2QL7A 3RIGA 1E64A 1PEDA 2O52A 3NHFA 3ZQ6A 5KNBH 4CNBA 5K6AA 2E5WA 3WNCA 1SCNE 1T10A 2ZRBA 2H1RA 2AZMA 5EP3A 1BN6A 2XB8A 2H8GA 2HHJA 1IY0A 5KC9A 5CAEB 1KZGB 5F2KA 3RUHA 1CB0A 3VDNB 5CA0A 1EFDN 2RB5A 3EG5A 4G5RA 4V3CA 4C5BA 4LUCA 3UAXA 1QLWA 3L8CA 1L7VC 1T29A 3CLHA 1U1FA 4QDJA 2JZCA 3L41A 4TVKA 1XZQA 3R5JA 4DADA 2VXBA 4Q4AB 3WLKX 1K7YA 3ITNA 1R64A 1S8FA 2F8LA 2ATEA 1EBBA 2Y99A 2X0RA 4TZ0A 4H7DA 1SU6A 3OWXA 5CFPA 2C84A 4EVIA 2HXYA 4NU5A 1KY2A 3R7BA 2QV7A 3H11B 3LD9A 2GCOA 1ZNWA 2E89A 1DQYA 1U2PA 4AD8A 4DV3B 4XJSA 3L5OA 2P9CA 4PLCA 4R2HA 4JWKA 4XKJA 1Z17A 3WV4A 3PNLA 1O5IA 2JRLA 4UZSA 4ARSA 1AMNA 2AL7A 4MUJA 4ZT5A 1C4XA 1P81A 4EI7A 5EWLA 4L9SA 2R48A 3OCCA 1Q44A 1WHSB 4WZBE 3VDMA 4DV1B 1C1DA 3IEUA 3QE2A 1UDXA 3IOBA 4XW2A 1GRNA 2FZLA 4PO1A 4PXYA 4HYQA 5IC5A 2DR2A 1VP3A 4F8YA 1Q1EA 3MWEA 3I73A 4NWIA 1TKBA 3A04A 3CVOA 1BVUA 3LPCA 1EK1A 2BGNA 2H1FA 3GEPA 3LBAA 1K3UB 5C8YB 3MQ4A 4D82A 4D4GA 4PYKA 2JEZA 1UT6A 3AHGA 1DX9A 1E3MA 1JJFA 2ZIGA 4LRXA 2B30A 4G9EA 3IC5A 2POCA 3GAMA 3K8ZA 2B98A 3S1AB 5IF9A 5JXGA 4QD3A 3RVNA 3I53A 1KU0A 5LP1A 2JC3A 1I7QB 3JQAB 3ML1A 1AS2A 5HBRA 3IVRA 4RZ3A 5HXAA 1SKAA 1UZMA 3KJXA 3V2HA 5C80A 3M82A 1DBIA 1DCFA 1BMTA 1NU8A 2CLIB 2OK7A 4I50A 4J8PA 1K89A 4BVAA 3IOYA 5BV1A 1L3BA 3VPAA 1BOFA 2CNKA 2K87A 2R84A 3K09C 1P6QA 2N46A 1IRIA 1JAYA 3OURA 1UH5A 4MUGA 3UHPA 3ZZ0A 3Q7PA 3D8BA 4M46A 4ZV9A 2RGUA 3NMUF 1BEUB 1TIPA 2FWPA 1G3QA 2C9OA 4NZZA 2PRSA 3FSJX 4K26A 3UIEA 1U7DA 4F96A 3LUJA 4DY6A 3PQ2A 2AZTA 3QYPA 1ZIYA 4ZANA 3OJLA 4DDMA 4QPCA 4YV7A 3IAM6 3PC2A 2FWJA 3QKRB 2CC2A 5MF6A 2BUBA 4AICA 2DHRA 2Z83A 4ML3A 3TEFA 4ER6A 1OILA 2A5LA 2JFQA 2K2WA 4NCJA 3R4CA 3BIFA 1XPOA 2BFNA 3OBIA 3RLFA 1KE1A 3UVEA 2IQ5A 2AN1A 2YY6A 1YR1A 3OE4A 4JHLA 4KDEA 2BSXA 1MX5A 3FJ1A 3DV0A 3JQCA 4YFVA 5HE9A 1KQNA 5E1DA 4EEXA 5L4NA 2Q5CA 3WDSA 5I3CA 1QH9A 1GIAA 3FPAA 2OR3A 3GA7A 3QVWA 1NP7A 2JVKA 4HDRB 1GUFA 2O3RA 3OWOA 4DRXB 3IQGX 4HDNA 2E21A 2QI9F 3FWZA 4E3ZA 1P0MA 4ZOAA 4C4TA 2DJ5A 1LPMA 3E9YA 4WFJA 5JPCA 3I8XA 4PYLA 3R4VA 1V2HE 1TEXA 4GX1A 4JQCA 3G79A 3MN1A 4FD3A 4LF4B 1E18A 1NYRA 1ORVA 3F4KA 3LUHA 4ND1A 3UMMA 5E0OA 5GOTA 4NBWA 3F3SA 5C31A 4F21A 2AOXA 3KKEA 1J9GA 3ICVA 3QELB 1IMJA 2IIBA 4WHMA 2IQIA 3JZMA 4HFNA 4GOMD 2P5UA 1DBSA 3EQZA 4KITB 5K01A 3ZVKA 1FVOA 4A1OA 4UDNA 2QN2A 3RWMB 1FDIA 1ZR2A 3NHZA 2ZYAA 2FFHA 4JI1B 4O4IA 4O5AA 4EOGA 1Q12A 4WOBA 1PP4A 1ZRHA 3GP5A 3A3PA 4NEQA 4OBBA 4QBTA 2PUBA 1QIDA 1GFIA 1GVHA 1RBYA 2B1JA 2QLBA 3GCZA 4KQ2A 4M55A 4PAMA 1IJBA 2PH7A 4IIXA 3A7DA 1P1CA 4POOA 1UFVA 2IYRA 5CH8A 1B6SA 1ZIOA 1W1UA 2PLFA 3DAHA 3OWHA 2GDJA 3ZHVA 1E9RA 3W0LB 1ADFA 4G0YA 3U44B 1B14A 2L82A 3IX7A 3PP8A 4HUTA 2DUWA 2KBEA 3CE6A 3VV3A 4YO7A 5DM0A 8ADHA 3F4LA 5EQFA 4BTLA 4EG0A 2W4QA 4L8LA 1C9EA 3C4QA 1OLOA 4Q4JB 5DGIA 1IY8A 4M38A 4W9NA 5JBNA 2A7QA 1CDZA 2P3LA 3AVOA 1KEVA 3CR8A 1DC7A 4G84A 3F98A 4MCHA 2DY0A 5LWHA 9GPBA 1G8FA 3CWQA 3DVSX 5KJFA 3AR9A 5KKCA 1SD1A 1MJFA 1VHJA 5I51A 2GCOB 4E4TA 2XKAA 4F4HA 2D13A 5HRCA 3WC4A 4PVDA 1WEHA 1Z75A 1EP1B 3GEIA 1I9GA 1X15A 2BTQA 4E5UA 1PFYA 2WAYA 5LP6F 2IHYA 1DXYA 2V8BA 4JK3A 3VR2A 4EY3A 1RC0A 4N0PA 3ENZA 1A72A 5JBQA 1GTSA 3QK7A 3VOBA 3Q98A 2BKVA 2G4CA 1SQSA 2BFDB 4B3FX 4EDHA 3BHJA 3GLFA 2V7BA 5TEVA 4ABTA 3BPSA 2BE7A 3MOGA 4GDFA 4PN3A 1IFXA 4YA6A 3UPTA 1Q1GA 2MU1A 5JVDF 5ICMA 4G2NA 3AJ8A 2B4AA 4TTQA 2EBWA 2HA2A 2P79A 3AR2A 4Y8VA 1SXQA 3V55A 2HUPA 1Y9AA 4RZUA 5EHNA 2JI4A 2C96A 2F4VB 2FPSA 1JU4A 1KPGA 3T94A 5DNVA 1EVIA 4IJ6A 4EL5A 1W88A 3OE7A 3U6BA 2UZ4A 3SR4A 3V7NA 3MT9A 2OBXA 3NHJA 2QTHA 1FEZA 2AG8A 3X0DA 2XAAA 5DZSA 2A9QA 4UMVA 4M7PA 1WEKA 1AXEA 3HRIA 2XA9A 4KDFA 2WNSA 3TINA 1X74A 3GUCA 4O59O 4FBMA 3FVRA 2GXSA 2VLBA 4OVKA 5F64A 5IKPA 1ZJ6A 3K94A 1SOWA 1R3DA 2ET6A 1RIFA 4P38A 1RXUA 4ZT2A 2EYQA 1Z4NA 1Y5LA 3ZCXA 4QA9A 5EJ8A 3QE9Y 3LC7O 3NIWA 3VU3A 4OHXA 1W4CA 5AJTA 4LJSA 1KJIA 2KJQA 4LTMA 2PXCA 4MWDA 3VKWA 4OCZA 1LSOA 2BEWB 4RWEA 2AOTA 5AUQA 3S70A 4C7OB 2RGRA 2ASEA 1K8QA 2XUGA 1KOLA 3OHSX 3AINA 2XY4A 3QKRA 1FX1A 3FNHA 1XQ1A 2VTKA 4X7BA 2QEQA 3FW1A 4OHBA 4WJZA 3QF4A 4FLMA 4FSXA 2XLCA 1DC3A 3FD8A 3PPXA 3EQ6A 5LXTF 2WJJA 5DI3B 2ZVQX 1C9YA 1YU6A 3A6HA 4EFKA 2O2IA 2O3QA 4IXNA 5HDBB 5CFNA 4YAUA 4EHKA 4G5XA 5F4ZA 3U7HB 1KY4A 5CB8A 5ALNA 2WQ7A 3PEYA 2GR9A 4DCMA 5D3KA 1A7UA 1NF8A 4RXMA 3RE1A 5IAKA 2OV8A 4B2PA 2WJVA 3CS3A 4M8NE 1AS0A 1FDUA 2AKEA 4WOCA 3AUAA 2PZAA 3SC3A 3CW9A 3DE0X 1RS0A 2HT6A 2VATA 5A7HA 2VHTA 2FQWA 3I4CA 4U7JA 3PUVA 2O8EB 4URFA 1L2TA 1H65A 3KV1A 2NSJA 5LJLA 1E2EA 4PINA 1NSTA 3HP1A 3QG1A 4EJSB 1SVLA 1KAHA 3FH0A 3SF8B 4L5BA 3MPUA 1EESA 1RQ2A 3FSGD 4WNAA 2WUWE 5D5QA 1XWWA 3AL0C 3OLQA 3OU6A 4M87A 3HB1A 1A2OA 3UBTA 4C5CA 1A9ZA 3W6UA 4GOXA 2AR9A 2PXAA 2X8WA 2AFHB 3DM5A 4QAJA 1AO3A 1SHUX 1M75A 1WCV1 3EDQA 2XW6A 3KFLA 1CJSA 2FYTA 4FFWA 2FFQA 2CJWB 2OK8A 4U7DA 4OXQA 3TG8A 3IP3A 2VPZA 3BB4A 4EY8A 1ADJA 3H2YA 3QSYA 3HC7A 3KTAA 2HXGA 2XV1A 1ULBA 4AJNA 1IJFA 1C81A 4E4RA 2F3PA 2IY9A 4LEIA 1LK5A 4Q01A 5IHPA 3N2EA 3CUEF 2FVXA 3RRMA 3TCXB 4EECA 2ADOA 4OHPA 2Y2VA 3B85A 3IA7A 4FTWA 3N2IA 2XUOA 5CXUA 2Q1UA 3G82C 2EZ4A 4HXGA 4NYMQ 2EX1A 5FBRB 1T1RA 1Y8RA 2VFAA 1YJCA 4G25A 3OPQA 1ZVQA 3NBMA 3KPWA 2H2DA 2PGXA 3C7AA 4FR0A 3F47A 1ZUWA 4JP5A 4LYYA 4RZIA 5CM9C 1KYZA 3LOUA 4YCAA 1O03A 2BTEA 1I5EA 1M6VA 2DQYA 3DS8A 2CE7A 1R6AA 1JF8A 4NY1A 4DJEC 3W78A 4GX5A 4F9TA 1X92A 3VU1A 1NBMA 4BU0A 2I1QA 3DPSA 2OHFA 3GXBA 3LHIA 3G9TA 1BXZA 1F6BA 4B8ZA 3DWIA 4PC6A 1KSJA 4QTZA 1CPYA 3H75A 4EJMA 2YJ5A 4ROTA 3GPLA 2G40A 2C1ZA 4RF2A 2DE0X 2QX7A 4TV8B 4F71A 1P18A 3SXUA 4RXUA 2COUA 1UEXC 4LNAA 3U7QB 1QGUB 4N39A 2O4CA 3AVTA 1ZH4A 1FJXA 4ZI7F 3M3HA 3QVXA 5KPDA 1GYQA 3I42A 3VPCA 2BFEA 4AJLA 3DDNA 1BEEA 5I48A 4Q7QA 3A26A 4OIFA 1JYSA 1P1RA 2QL9A 3BMQB 4OXIA 1HH4A 5E3HA 2VAMA 4F56A 2H00A 3TNJA 4GP6A 5KYNA 4M1MA 2CZGA 1A4UA 4ZVTA 1FYDA 1USVA 1X86B 2Z2YA 4B34A 5KTYA 5ER9A 5AQ1A 3GWGA 1FRZA 4MRAA 3OZUA 3QG5A 4LRYA 2J32A 5H5JA 1KDZA 2XRMA 4DSNA 5A9SA 2QXTA 4MPDA 4M9CA 4BNDA 2XH8A 4X91A 4AKHA 1VSUA 4C0SA 2ERYA 3ZDFA 3TAXA 2PYDA 2E1RA 2OHGA 2ZEJA 1NWCA 1RU3A 1VE5A 4M8SA 4TTAA 5ENVA 5CITA 4Y6PA 2CLLB 1LRKA 4WZBB 4R0MA 1I9CA 3NWBA 4MGEA 5LDDC 3A0UA 4C6TB 1H2FA 2OCGA 3HRHA 3N2NA 3ILHA 3MHPA 2PJZA 3R6DA 2IYUA 3IUBA 4DR2B 1P1JA 1PAUA 1WS6A 1XTRA 3MJTA 2OCDA 3PWZA 5IWAB 3ZDBA 3FMFA 5CIYA 1L4UA 1M10A 2E9SA 1W1WA 2W2XA 4NAVA 5LOVA 4PC3A 3RUEA 1ECLA 3PWTA 2J3LA 1X39A 3KL4A 3ZJTA 3VHLB 4CM9A 5EIBC 1C7ZA 2A67A 1QUFA 2ZUDA 1EVQA 2N3ZA 4JVSB 2GK3A 1JI3A 1YASA 2Q46A 2YV2A 4GWLA 4LJ9A 5AUNB 1HSOA 5AVVA 1OXTA 5ICEA 4U02A 2G5GX 3DOUA 3AZPA 2LCIA 5CDFA 2B5VA 3ZHSA 4EJ2A 1KOGA 5K3CA 3V4FA 3VC2A 3IL2A 2PYIA 3ZG6A 1Y9ZA 5BN4A 1X8LA 1A97A 4M76B 1XAGA 7REQA 3V33A 4K1XA 4I1IA 5EIEA 5JAOA 2XYPA 1GARA 3FMIA 4YBRA 3E5NA 3GVHA 1EBUA 3PF8A 4F7DA 1RXWA 1LSJA 1B2LA 4N6GA 3S7ZA 5JQWA 3VM6A 1XQ9A 3KSZO 5HX7A 3NRBA 1FTYA 3HGTA 1RM5A 4TOIA 3LLSA 1JEJA 2SKDA 4KK4A 4ZYLA 3HUEA 3R0JA 2HEGA 3C6ZA 1XX6A 1XTBA 3RDPA 2I03A 3OA0A 2H11A 2KLBA 2DMRA 1NIJA 1G16A 1VSQA 1LVUA 3CJRA 3W5AA 3TUJC 4UVIA 5GV7A 1A98A 1OTHA 2NW6A 4PPFA 2ZTSA 1ZOIA 2VRBA 3C3WA 3K2BA 5JVDA 2ZBUA 3PCRB 3QMMA 4RY9A 1VG8A 2H85A 3ZQUA 4WBNF 2QOEA 5IXJA 2WF5A 4B4WA 5CM2Z 3HPQA 4UTNA 4J94A 3SDBA 1N3BA 2IE0A 2QUZA 4M99A 2EFHB 4G89A 3OX2A 1HNWB 4XM1A 4BJ3A 5INTA 4AK9A 4CCYB 3T3OA 2XCTB 4OKSA 3LPDA 4G1CA 1WUIS 4HS9A 2WKSA 4FN4A 3V8NA 1NWHA 2JFGA 2DJIA 5T4FA 3WK4A 5ED4A 4LRWA 2Q3FA 5A6SA 3OPVA 5I9LA 3FVTA 2ZZKA 3I4FA 2YC2C 1KKMA 3NHBA 3LQ2A 4GM4A 4ZV4A 4DV4B 4DBLE 3BQNB 2CNWD 4G4IA 1H3EA 3AOEA 2XDAA 3FMGA 3IOMA 4HQKA 3CHYA 3MIZA 5IBQA 4J3JA 4U0JA 4E3WA 2G06A 3JWPA 1BE8A 4UNSA 4LXXA 4CR6A 2G88A 2VYQA 1N1GA 2WW8A 1ZM2A 4KLNA 5CMLA 2O2JA 3FCAA 1XZKA 3R41A 4IQ4A 3IAHA 3MLEA 2P78A 2VP4A 4LDNA 4H0CA 1HR0B 3G59A 1KGSA 1Y8RB 2HMTA 3L7MA 5D3QA 3IP1A 5HHTA 2Q4BA 4KQJA 4HVCA 2OSVA 3WLEA 4I3HA 4OHRA 1G17A 2YWHA 3KOUA 2I78A 4MYUA 1KI2A 4TYMA 1W7AA 2RJ3A 5DBHX 5KYXB 1X1AA 1KJQA 1EA5A 3OLCX 4QUKA 5DI9A 3ZWXA 3HKCB 1CRLA 4K6OA 5LXTA 4K9KA 3U26A 3WB0A 3L6CA 5AK5A 1Z2NX 1KI6B 1VRWA 3GLQA 3MUOA 2A3NA 3KUCA 2B37A 2WWFA 4ARAA 3KKMA 2YY5A 1EP3B 1YRHA 4L72A 4QICA 5K3FB 1FZQA 1ZGBA 1XJ5A 2V03A 3Q2OA 4N0DA 3TLMA 2O2YA 4MA5A 3M2TA 3C5EA 1Y1PA 3PQ3A 1U0LA 3ZK8A 4A8JC 4AJKA 2DWQA 4RF4A 2GBGA 5A03A 1CUBA 1UC8A 1V9CA 2MJLA 4QYIB 4C2AA 2BLLA 4KACA 3ZGZA 4AO6A 1K98A 1XVLA 2BFBB 2Z5FA 3FZYA 5KYVA 3ZLBA 3L0YA 4X1IA 1LD3A 1N2XA 1QO0A 1ISGA 3ZDZB 1U0EA 4DPMA 4BQOA 3T9FA 5F23A 1WSBA 1Z34A 2O0MA 2R8ZA 3BK1A 3EEFA 2WPNA 1NPYA 4I3GA 1JFVA 4HGNA 4W9MC 1Y4UA 4MVJG 2A30A 1PNOA 4YP1A 3JPWA 1W5AA 3QU7A 1QIJA 4DJDC 5GJVC 2ZUSA 5DLDA 1KA9H 1DQSA 2OGSA 3CH5A 4QO8A 4RVCA 4XGQA 3KQSA 2OY0A 2C7BA 1CUUA 4XPIB 5FYDA 4TMWA 3DOOA 3FY4A 4JVNA 2NP7A 4LQ4A 4BO2A 5J63A 3PSAA 2ZU6A 5H1YA 5JYBA 2RGWA 4Y0VA 2TMKA 3BWDD 4A2PA 3AB8A 3D31A 1JHOA 3IKJA 1GTL1 3UCXA 1UZLA 2Y1WA 1YFZA 1K6IA 1YK0A 2W6JD 3L0ZA 3TGWA 5KKNB 1D1PA 1NONA 3RBXA 1QCYA 1DTSA 2FN7A 2G3YA 1J5EB 3M5PA 1E2IA 1T8WA 2J0EA 3QPVA 1XLVA 4MP3A 4JELA 1DI0A 1KDVA 2HGZA 4ZAGA 2PUDA 2OQ2A 5BT8A 3Q3IA 1X1QA 4FBGA 1L1QA 1YKSA 3NNDA 3SQNA 4C87A 5LYJF 1DWPA 1BG6A 5B30A 1F0PA 1P7ZA 3JQBA 4UZEA 5LMNB 2VOEA 4HYTA 3V2IA 4UEWA 1E2GA 4A16A 1ZGGA 2V0CA 5EHIA 2R11A 4YN3A 3H84A 1KFEB 1WPGA 3QW4B 4KW7A 3UY4A 4DWVA 1UKAA 2AQIA 1CUIA 2WE7A 4RNCA 2CUKA 2E7ZA 1E4OA 4URZR 2JLSA 5IWCA 2JW5A 1V5WA 1TF5A 3TKYA 3NALA 4FZJA 2PHZA 3ZIUA 2DQ4A 5CB4A 5H59A 3H6HA 1VA4A 1KQFA 3KTDA 4CMCA 4LHZA 4TTVA 4AS2A 1C8VB 1ZJZA 4X6XA 5AFSA 1YHZA 4WLOA 3AFIA 1GTJ1 4LWZA 4BC1A 4EW3A 4EZEA 2D54A 2BWJA 3FM9A 4PHHA 1F0KA 2CNBA 2MT9A 2P2NA 4K9RA 4PNZA 4R8RA 3FOEC 4QGSA 4PRLA 3B1KA 2IUTA 2OQIA 4QGHA 1HDGO 5K5EA 4D26A 1G8AA 1WPXA 4FIZA 4D9GA 5B36A 4BV8A 4LYDA 5JQGB 1EB8A 1PR2A 1WXHA 2YZMA 5KSZA 5CEJA 4PS0A 5DTMA 3K0KA 1CHDA 1F3LA 2EZTA 2I2CA 3C5VA 2F9MA 3JX9A 4MRVA 4NJEA 4RAQA 2D7DA 3WFIA 1FLAA 4BV2A 4G63A 1FUKA 3GJ5A 4HH3C 1EX1A 3ESAA 4D4IA 2R96A 3NNNA 1NBAA 2C2MA 4L75A 2WABA 1DFHA 5HWSA 4KX5A 5E0KB 3NFRA 5B2FA 3N87A 3CB2A 1NVTA 2O50A 2ZSKA 3R5SA 1R6BX 3AR3A 2YDYA 3JALB 1R7RA 4BZQA 5KQPA 4UBLA 3VZRA 3DO6A 4CKBA 1MMFB 4BNKA 1H2YA 3A2LA 1SA0B 2IEGA 3T9EA 4J1TA 2EATA 4B44A 4R3WA 1YIOA 2DULA 3D6VA 3I1JA 2QZZA 3H9QA 4G2TA 4P32A 3I0MA 2O7NA 3JQEA 5KEIA 4M1YA 4MSUA 5G02A 5LCXA 1AK2A 2HF8A 2XMCA 1QHSA 3PXBA 1X8JA 4KMRA 2JJ8A 1NYTA 4KXQA 1TIKA 1XO1A 2C54A 4REQB 5HBGA 3VMFA 5CDUA 3GP8A 1I0LA 3R9XB 1YSCA 3X43A 3ZY4A 2V9CA 3ID6C 5FUYA 4UHCA 5SYMA 1YMQA 3RARA 5AM2A 2XMPA 3HKCA 2N1BA 3KJGA 1X6VA 3HWSA 5EJ9A 4FE4A 1PSDA 3P9RA 2XMDA 4QPDA 2WQ6A 1VZ2A 2O8DB 4J2OA 2LBPA 5LQSA 2YIVX 1RC1A 1MU0A 3CT4A 5C5EA 3R2JA 4PAQA 1XDBA 5KZMB 4N76A 1T0HB 3LK7A 2ZWMA 4F4UA 1ECPA 1YR6A 1G6KA 4CKZA 3RR2A 5DCUA 2VCEA 3LUPA 3NO4A 2XWQA 3WMRA 1Y48E 3B82A 1J8QA 4DMUB 4AX4A 4P4GA 1ABBA 3NT5A 2OFOA 3AOGA 2OM2A 1MJ5A 2CFOA 3PA8A 2JGMA 4L28A 2D62A 2EGHA 2FOIA 3EWAA 4Q3CA 2INGX 3TOCA 1RXSA 4YJ3B 3JZIA 3K4PA 4ETWA 2IODA 3LY7A 4X1IB 1NM5A 2GN4A 4EY5A 2XA1A 1GN8A 4B7CA 1K3FA 1YGPA 2R1VA 4NBLA 4Q9KA 3CCFA 3T54A 2W6JA 1K88A 5D84A 3ZQ4A 5KJCA 1KO1A 4YMGA 4YRFA 3CVUA 2ODQA 3ANMA 4H6WA 1O87A 4QUIA 3IILA 4GD3Q 3GGSA 3BCSA 2O14A 2ZB7A 4AMBA 3FLEA 4RTSA 3JWGA 4E4YA 2PH5A 2F90A 1QK3A 2OGUA 1RTKA 2VJOA 3JQRA 4GPEA 3DNPA 4LZOA 5DBFA 3CEHA 3K6SA 2IA5A 1KARA 3UHFA 4Q7MB 1E6EA 1HMPA 1R50A 2QRNA 3DH0A 2Q3LA 3GI1A 3BX1A 5EMKA 5JDCC 1OBVA 3CVYA 3LY8A 1KP9A 4YIHA 1J9ZA 4BEJA 3BERA 5EKDA 1XVUA 2XYQA 3U4GA 5I3ZA 1KRWA 3ICPA 3IEXA 1NVVQ 1CQWA 4TV8A 1SC6A 4H1TA 2HRRA 3MILA 1TK2A 4ZTBA 4FCWA 4C4ZA 3RQIA 2HQRA 1DRWA 3WTBA 5C32A 1PJLA 1FB5A 2OYSA 4UMFA 2IZ1A 3OH8A 4G97A 2Q41A 3AU8A 4XX0B 3K9BA 1SOVA 2ZSIA 4EEKA 3QNUA 3Q0TA 4MGKR 4HEJA 2ZYDA 4GKAA 1O08A 3DFMA 1ISJA 1JX6A 1POXA 2HH9A 4DQKA 5BMOA 3KYDA 4WZAB 4PLTA 3ECAA 3L8HA 1CJCA 4F2PA 2II6A 2BDTA 2QNIA 3PQEA 4P2GA 4RY0A 1QORA 4BPBA 3GDHA 2PAAA 4HBGA 1EVYA 3C16C 2VTBB 3FGZA 5BW8A 1WDLA 4YUXA 1Y3IA 5CXQA 2J9XB 2PX0A 3K5WA 3SBXA 3ICEA 2XMSA 4M7OA 1B6RA 3LT4A 3LPLA 4O5OA 5JD5A 4J0GA 6ADHA 3L7JA 1GZSA 1YD7A 2EL9A 1Z37A 1YWGO 3ED1A 1XDGA 3QOYA 1HLFA 1ML4A 4K0KB 3NORA 1LBSA 1H2EA 2NNWB 2PSFA 3MAGA 4HAWA 4HX9A 4JENA 1MQSA 2AG0A 4C6TA 2QW8A 3O3CA 1HYHA 3O84A 1QVAA 3G2KA 2IZOA 1T9ZA 1M1UA 1G0NA 4YBZA 1FUYB 3U60B 1D5CA 3W9YA 4M1EA 3BZWA 4UDXX 4MVJE 3NHRA 3RKRA 4S1OA 3TIVA 4KBYA 1IPHA 2OHIA 2PN1A 2REQA 2XCLA 3DV9A 1L6IA 4IEIA 2CDBA 1U0TA 3RHFA 4D4LA 2H2HA 2JI9A 2VDOB 3O4RA 4GMXA 3AP3A 3FPKA 3HFSA 4YJFB 4GWKA 5AI5A 5KO2A 1RRCA 5K0JA 5JZSA 3BEOA 2XVMA 4R1QA 4WXYB 4ZP1A 4MWGA 3QF7A 1CKEA 2NG1A 3AQIA 4DG5A 5EJ4A 2XT6A 2YFHA 4IW3B 3TR0A 3OC6A 3OIDA 5ERGB 1X1SA 1N32B 4UHHA 5L8VA 5AKKA 2UYQA 4WNYA 5CCDA 4PY2A 1IOLA 2OG2A 1S8AA 3WV5A 4BVKA 4E08A 5MGNA 1U7WA 5BN4B 4HL6A 3I92A 2W71A 3ZHUA 2C0QA 4ITRC 3CV3A 3RYCA 4KQIA 3ZK7A 1Y3HA 1Z2PX 4KJXA 1H6DA 4MA0A 3VFDA 4OB6A 3ZKAA 4FVTA 2PJUA 4DCGA 2YVLA 4PQFA 2CXOA 4MH0R 3K32A 3DUFA 4IMPA 5B2EA 3NPMA 4IDGA 3L0OA 3PPWA 1PJ3A 2ZPTX 4J4HA 4B87A 4K3VA 5IS2A 3N0TA 3VBEA 1XLUA 4R54A 3M8KA 4LSWA 4F4FA 1LJ8A 4GXRA 5H9WA 1U3WA 2BHSA 1ZH2A 4N01A 3UW3A 5KX5A 1MOPA 3SQDA 4DMLA 5JG7A 4K6MA 4IR7A 1UMBB 3OLZA 3LXUX 4L51A 3DVLA 3NYQA 4HQRA 1ZK3A 4NPCA 2IIPA 1D8TA 2WB4A 4Z7QB 3TLXA 5ENZA 1X19A 3R75A 4DZTA 1GGJA 4FDAA 2J7PA 3NG1A 3MLAA 4TKUB 2GBIA 4UOEA 1SBTA 3CXUA 2FMFA 1PS0A 3DKIA 1LB1B 3BTUA 3QU9A 3SJBA 4AF8A 3PYXA 4WAUA 1DS6A 1MLDA 2Y1EA 3CJTA 1H8EA 3L1KA 1HXHA 2JHFA 1DUIA 1EI9A 3SQMA 5AO9A 1IEXA 4AG6A 2J46A 3RANA 4PTLA 4KAFA 1AKEA 4RZQA 1KPHA 2LCFA 1XEWY 3AVXA 5MGBA 2P9YA 1M1NB 3HKEB 4LN1A 1ESMA 4L85A 4MW6A 1Y34E 4R51A 2WYIA 4FQ7A 2AS0A 3EIUA 4O8ZA 2FPWA 1ESEA 4HVLA 3WHPA 2QM0A 4EMUA 3R6WA 3CZ4A 5G4KA 1ID1A 1NI3A 1R0WA 3A6LA 3UOGA 2Q3MA 2PL9A 1NN1A 3SHVA 2JLAA 3N0XA 4LDQA 5JZBA 5DGCA 2QZ9A 2WICA 1NKSA 1IULA 1L4KA 1MW9X 1YNSA 2C2KA 1YGYA 4LVNA 4BO0A 3PA6A 2H3HA 4HEA1 2WRZA 1YS6A 2WFAA 4N6OA 5E4FA 3HCEA 4ZZ3A 4ON9A 3HUFA 4WN9B 1MKYA 1P17A 4NCAA 5F1OA 4QAQA 1G5RA 3G6KA 1HE1C 3PZRA 2SBTA 1A0OA 1V4BA 1SQ6A 3AXTA 3MJCA 2NPFA 4C4OA 2OG1A 4BV9A 2CNNA 2YZKA 2LR0A 1ZESA 1O4WA 1OI7A 2PZFA 2XKJE 1AVTA 3CZAA 3LVBA 4MQEB 4M88A 5JARA 1K8XB 1F2VA 4GMDA 4RABA 1OXBB 1BKDR 1V0JA 1CUZA 5DKFA 3UB4A 2RHRA 3HYNA 3UAOA 1AZTA 1IZ9A 2XCIA 2OHXA 4CV1A 1Z5GA 2C0PA 2WPDA 3NONA 3WGTA 4A91A 3IVMA 5TC4A 4N03A 1WB4A 1JALA 1C7FA 1MO2A 3I6BA 6PFKA 2FLWA 2WSYB 3B52X 3LUAA 2Q2VA 1EUQA 5LNK6 3WSWA 1YL6A 4TUYF 5HGXA 1FYFA 1B7GO 2NT4A 3V5NA 5B5SA 4JV5B 3DHYA 3P52A 4F5DA 5K4GA 1BYIA 1N2HA 1YBFA 3CA8A 2IZ0A 1BFUA 2H1WA 3THRA 3C3AA 4ZPXA 2XXJA 4B6OA 1V95A 1Z0UA 2W00A 1CZUA 1X7GA 1ZD1A 3BXHA 3NJ4A 4IMRA 4FKMA 5EZ6B 2PNFA 3NX4A 1BXGA 2YFYA 3ELWA 3IQEA 5CM8B 2XUDA 1CUWA 1VYTA 5CIQA 5AT1A 3K72B 5ITZA 1FTGA 5M29A 2J7KA 4RTKA 4CLOB 3Q9SA 2C00A 2F67A 4XVHA 2CMDA 1FW8A 3IAFA 3QUAA 5DNDA 1KEUA 4FE3A 3SQLA 4O25A 4AZTA 4J07A 3ZU3A 3U44A 3I6IA 5AP9A 2ZJ2A 4DMRA 4ESHA 3H2HA 4YJGA 2NO0A 1RXEA 3OLYA 2C59A 3DAPA 4JFRA 3WA6A 2HDOA 3O9ZA 4OB8A 3FFXA 3IDZA 1J00A 4KXXA 4BP3A 1RXYA 4JVOA 3C70A 2Q0XA 3D54D 3RS0A 1ZW1A 2GZAA 5DM4A 121PA 3QLUC 5FBHA 1KYYA 4E5SA 1C3JA 4Z7OB 4M1WA 2H4WA 4ND7A 3SIRA 2VP2A 2JD1A 4MKXA 4OMFG 3Q8KA 2VHCA 3U1BA 3WGNA 2PV0A 3HWX1 2WSSA 3RWOA 1L4MA 3TX6A 1IZ7A 4LOLA 2FETA 2J45A 4QUDA 4EFNA 3HKBB 3L8ZA 1OWOA 3GL9A 3IE0A 4HFRA 1USUA 5TLSA 4BX8A 3TBHA 3PNQA 5K0GA 3U4QA 3N0VA 4MJLA 2GD1O 4LQLA 3LIPA 2FWAA 3DCNA 3RSQA 4NVRA 4NBKA 1GPBA 3TSZA 4FMDB 2C8JA 2ZTHA 2HIMA 3L7DA 4UDYX 2BMFA 1OYYA 4EMSA 4YXWD 4U2CA 5ALMA 3BDVA 2W2OA 2Y71A 1ZY2A 4DLZA 4D8TA 4Z3KA 1XNRB 2DY1A 1BTOA 3NBYC 5IH3A 1LFDB 2QRVB 3W8NA 1TUBB 1P8AA 3O4GA 3ESXA 2IC5A 2R8BA 2C2GA 3KHSA 3MTGA 1IBKB 2F00A 2L2QA 3FOFC 3U1VA 3LBHA 1YZTA 2EW1A 3E9QA 3OTQA 4A6EA 2MSWA 2R1UA 5JECA 5KOJB 4ARUA 1RPZA 10MHA 5DJ5A 1R74A 3AERA 1VL8A 2O0HA 4UM5A 3RNLA 3A1UA 2XPCA 3ESBA 4MVJD 1X7ZA 2C7VA 4OA8A 4R81A 2QZ4A 1VRVA 2QR3A 3C3YA 4PYIA 1K08A 3W4KA 1YVRA 3BL5A 2A1UB 2HSEA 3HABA 5CYFA 2G82A 5EJIA 4BO8A 4NLLA 2NNLD 3KR9A 1NUTA 4OO3A 1P9WA 4WDQA 3LDGA 4BMXA 4OJMX 3WFJA 2HJSA 2OZLA 2IPMA 2X5JO 4PHFA 3FHOA 5BSEA 2XOEA 1ORRA 3HU5A 1RACA 1IM2A 1LI4A 4JGIA 9MHTA 4J0HA 2TRSB 3CUSA 1KJZA 1OGIA 4U2BA 4FJ2A 4OUKX 1C2TA 4ZCPA 3TSCA 1M6EX 1T5HX 3GEBA 3VTAA 4JOBA 5H83A 4JLDA 1Z6XA 1A8UA 2Q4EA 3R8CA 3ZU2A 2BN4A 3BTSA 4KUEA 2O3TA 2Q1XA 4PZDA 1GT91 5HP4A 4NCIA 5G4KB 3TEJA 1W2GA 3PNBA 1C41A 3DLCA 1DDGA 2EW2A 1W94A 1GR0A 3OQIA 1NJ1A 1NXQA 3KOWA 4QATA 3CB4A 2O7VA 3OG9A 2VO1A 1VDMA 4UE3S 3T8YA 4H7EA 4BO4A 5KTRA 4GDMA 2IZ6A 1GSOA 2AC7A 2GN6A 2IKSA 2V4UA 1DVRA 5A3VA 1FYEA 1MCZA 2EGGA 4REMA 1D2AA 2PKWA 2W8BA 3G5MA 5I7OA 4F6RB 2A58A 5K03A 2V7XA 1CFZA 4JOQA 5BWOA 4B3GA 4FYPA 1PQPA 3N76A 2O48X 5IJ9A 3L8MA 5EZYB 4WCFB 1XEFA 1LTHR 2B9VA 1YI8A 3SWWA 3TE6A 5DOVA 1ZMXA 2BMVA 1D6SA 2VK1A 4JYCA 2O8DA 1D4ZA 3CUWA 4I9UA 4B3XA 5COQA 4N3NA 3NHUA 1R5OA 3NB0A 2BM8A 3OQNA 2Z0MA 1GGKA 4FFOA 5F98A 4OU5A 1RBZA 3E23A 1IB0A 2X14A 2LDBA 3I45A 2MINB 1JG2A 5HOQA 4E32A 3OCYA 2WTMA 1JIIA 1CUFA 1O9HA 2UKDA 3JD0A 4I1RA 4MGYR 1X7WB 4Y6OA 1JR3D 4MMZB 4YJ3A 1IHUA 3EMVA 4LKRA 4PM4A 1KSGA 3OFVA 2XVYA 3U3ZA 3WB2A 5FOTA 4KXNA 4DL9A 4TWAA 1NVWQ 3BD6A 4JP1A 1MGPA 3UJHA 1G60A 3TL6A 3Q3JB 3ND9A 3SC2B 3KD3A 2Y6UA 4TL6A 3AIOA 2VK4A 5CX4A 1YTUA 1H6CA 4DIFA 2V4MA 1JVNA 3GGOA 2X0NA 4R8SA 4B6GA 4CV2A 1E7WA 2ZT7A 4DQVA 2WILA 3HEBA 1LPBB 3JVDA 4ZVNA 4WBSA 4QNRA 2JJ1A 5T57A 2GJSA 4P5PA 3LX4A 3UM9A 4YQZA 5J1TB 1MAUA 4RJKA 1II9A 1BU5A 2APJA 4YJ2A 3FAKA 3AR5A 1MR3F 1A2KC 2AG1A 2NVOA 2IZ5A 2ZB2A 4MYCA 2YMQA 3V9AA 4HT3B 3IQXA 2R5WA 5IZCA 5FOWA 3O8LA 5F3WB 1CF4A 3LCMA 1OBHA 2BHNA 3CTMA 3CLRD 2YN0A 3OQVA 1I14A 5FUWA 5C1DA 3PUYA 5EIBD 5C8XA 4Z0PA 1OAKA 4IUBS 1MG5A 4CUZA 4WZAE 1F5SA 3UW1A 5B4TA 1BDHA 4DN6A 3QUQA 3ANTA 1SU7A 1AHIA 3V4PB 3GQVA 4PGFA 3JR3A 4ED9A 4QBGB 1XYGA 2WR8A 1FX0A 2HMVA 1E63A 1C8KA 2ZIUB 1UJ6A 2W2NA 4U9UA 1U9CA 5BWBA 4ZCLA 3EY4A 4XCXA 1W6RA 4X3CA 1FFXA 1XUOA 1EFPA 1GLNA 1XZFA 2O2CA 1BDBA 3OE1A 4TXNA 3RWBA 3VKFA 3WSTA 4AZ3A 4EPRA 4LZNA 2JGRA 4MVYA 1JFSA 4DMFA 2ECPA 4UUBA 3W3ZB 2IU6A 3L92A 3F6CA 3PICA 4NU6A 4NABA 4WK4B 4TTRA 4MHTA 1NVMB 2DECA 4UJ5A 1E4YA 4W1SA 1C7IA 4YPFA 1Z2AA 2LGJA 2AN3A 3ABRB 4N5HX 1XN4A 3FE2A 4U9IS 3T06B 2CUNA 3PVSA 2I3BA 4HNTA 1EK6A 2C77A 3HDYA 2QM8A 3COVA 3RTDA 5FV7A 3ELUA 3LMKA 3KLPX 3DJYA 3TCNA 2PY6A 4G07A 1AX9A 2J4FA 4AKTA 1UPXA 2BC9A 1QIKA 2DQZA 2IEBA 2Z5LA 1U7TA 4X00A 3SQOA 2WVJA 3RYHA 1PW7A 4J9VA 3VXKA 1JHDA 1WMAA 3KLOA 3VBCA 1ULSA 4JYBA 1MRNA 3LPMA 2E0IA 4MB0A 4XH9B 3R6GA 2J87A 4I3FA 1NBIA 4Z86A 2QJRA 2ZUVA 4YMSA 3HKDA 4TQUS 2W42A 1BX3A 4C07A 1USKA 4FP9A 3EW7A 4YJFA 3WLAA 2QRPA 5CEFA 2GYYA 5ITVA 3ZI7A 4XQGA 3KB8A 4B85A 3AP2A 1G6HA 3G5LA 2GGSA 1MO4A 1P0CA 2Q3EA 3CCCA 4OM8A 1VLLA 4ETMA 1SXPA 1XVTA 1QF6A 2VJLA 5JMOA 4TLMB 5EEGA 3LX5A 3P20A 4BASA 3ADKA 1L1RA 3WXMA 3ZDAA 3G8BA 1K2VN 4UU7A 1A96A 3LF1A 2YOFA 5LDGA 5ADWA 2I99A 3JAMA 2VT3A 4QUGA 5CA1A 3RU7A 3UYLA 3R7SA 4US2R 4PU0A 2IBMA 1T8UA 2ZBEA 1XTQA 1GNQA 2IOQA 2V7UA 1KBOA 3IHWA 2P6PA 1F06A 1JSXA 2AN9A 2ZBDA 3MMXA 4KAJA 3ENWA 2ORVA 4YJDA 4GI5A 4GX2A 4IQFA 4IIJB 4Y2VA 4OMDA 3O8CA 3HP7A 5JLJA 4D56A 3W1EA 2VJYA 4WESB 4E15A 4H7FA 1IVYA 2I4OA 1BWRA 3E18A 2H54A 1R4NA 3CEAA 1UMBA 4EYEA 1FXUA 3MELA 2Y1CA 1B73A 5FB3A 4MQFA 3F3YA 2XVXA 1KQGA 3OHPA 4JJGA 4JOSA 4CE6A 1T9AA 2ZJ5A 1R1DA 1RYYA 3CPEA 1RYDA 1Z4QA 5F52A 3K70C 1EWQA 3CNLA 2J3QA 3SM3A 5EMHA 1HGXA 4JY7A 3ZZNA 3K70B 2JH8A 1DJMA 1XZCA 1MAWA 2ICAA 4MRSA 1ZI6A 3L7BA 1Z13A 4QJ5A 1K7FB 3UUWA 1P2BA 2D0DA 3K30A 1GZ5A 2I87A 1L5MA 4LHXA 5A3JA 1PO7A 7MHTA 1H22A 2D00A 3PL1A 1AGXA 4BNIA 3U16A 1UBNA 3GLHB 4J91A 1W96A 1ZS9A 4K6KA 3JAKA 5CT5A 2GN2A 4ZOQI 4HG2A 1JDSA 1KKUA 1ZMOA 2FG6C 4OQZA 1Q0QA 4P3NA 5MN6A 5CGZA 4WN3A 3GELA 3F2VA 2OV2A 5F12A 1GL3A 4LZZA 1WE2A 5BMVF 4I1VA 1YB5A 3HGQA 1CULC 3ES9A 4IHJF 4L4SA 1O95D 4MW5A 4B4KA 3W8FA 3E4DA 1FDRA 2ZSDA 1MAVA 4H1HA 1F1BA 1L5HA 1M83A 1Z29A 1NBHA 1PV1A 2VPPA 3P19A 3WLOA 2LXNA 2ZJ6A 1V6SA 5I9IA 1YZNA 3PG5A 4GSLA 4NE9A 4OHUA 3P2MA 3AF1A 1RWXA 5FTKA 1SG6A 2P9BA 4A0GA 3OOEA 1GUDA 2VH1A 4F5WA 2VTVA 2WT8A 5EWMB 4MPJA 3ROGA 2JDIA 1XCBA 3SLKA 2OZEA 5ECDA 1PD1A 4UTPA 4B3TB 1Q17A 1EFLA 1MNQA 1TU4A 3P32A 2NQ8A 1P6UA 3COYA 4YRZA 2VLIA 1CF9A 1LLCA 1U3DA 1R4AA 3C8MA 4L8WB 2I34A 4WQMA 4AXBA 3OMXA 2FNAA 5M7EA 4QTYA 1QYRA 5C46F 4KQXA 3QM1A 3BS4A 2ORED 4HR7A 2FCAA 4A1FA 2VCYA 4BO6A 3PFCA 1G98A 2DT8A 4OEHA 2Z6QA 4BVFA 3EWNA 3IQFA 5IW8A 1JE0A 2VF7A 3ABIA 3CMMA 2EZ9A 3EC1A 3LLCA 3T3DA 2BFPA 3EGDB 1NE2A 4OUDB 3A58B 1WMFA 3PIIA 3FPGA 5FNVF 3N7UA 3K9CA 3NFYA 3AUXA 2NYUA 2K7ZA 5DCLA 4MA4A 4RV4A 3JQFA 4UVHA 4JP3A 1C1XA 3O7WA 4JJ6A 2TYSB 5IDVA 3ZLUA 4ZI3A 2XZDA 1RWNA 4OHKA 3OT5A 1EEXB 4G8JA 3BWEA 1T8RA 4MI6A 4XTRA 2EBFX 2LPMA 1E32A 4RH3A 4O4IF 4MCAA 1J23A 3VOAA 2G0NA 4EQ6A 4JQOA 3JSXA 4X9XA 5B53A 1BA2A 2ON6A 2OXEA 4QYIA 4QLBA 3QXHA 5FI0B 1HT0A 2BRUA 3RVJA 1N4DA 4CLOA 3ZYZA 1EVZA 3EN0A 1P1FA 3EZ6A 3L9WA 4YMVA 1VHTA 4M9ZA 2XZOA 3JQ6A 4WOJA 5DNUA 2RIPA 1R88A 3A9CA 1GPKA 3KALA 4D45A 5YASA 3HV2A 3OSUA 4IJ5A 1HDYA 1SXJD 4FC7A 4U7TB 3WOVA 1GHTA 2O2HA 1NQTA 2XUJA 1DARA 4UXHA 5EXPA 4YX9A 1NMZA 2PKRA 1RWPA 4X60A 2F1KA 4J16A 2XZLA 2JGKA 4G23A 5DBOA 3HKDB 3Q6MA 4ZCIA 1NU6A 1LDBA 1IHPA 4X45A 4DIBA 4W6ZA 1NQAO 2FY8A 2ZRHA 3DD5A 2FW0A 2O4UX 1HZJA 1IOWA 1V8OA 2VHYA 2GZHA 3MWDB 2V74B 3ZV7A 4YV0A 3ZVMA 1IWPB 5H9VA 1FP7A 4LGCA 4TM7A 1GAJA 1XKQA 2QVCA 1NT4A 3U2QA 3ZNQA 5C3MA 1SCDA 3GLFE 4NV3A 2NO4A 4RV5A 1NW8A 3KDPA 2Q99A 4Y1FA 2FDCA 2GFQA 4BLVA 2XODA 4IZ6A 3ZWKA 2Z6UA 5JD4A 2GO7A 1G5FA 1XOIA 2PGAA 2AXEA 2CHVA 3CWZA 4JROA 3ROQA 1QH8B 5I7UA 1Z0SA 1ZP6A 4GO1A 1RKQA 4JKYA 3ZHYA 2XRZA 3K0CA 4ZCTA 3QU4A 1N6LA 1C1YA 1W85B 1NSYA 3I8OA 1VFNA 3WWCA 3EK2A 4Q4HA 5T4BA 3O4VA 4R84A 3U3KA 3LBYA 4L4YA 4N7BA 3RW9A 1LBQA 1N0VC 2X9GA 3BRWA 3A9SA 1JHVA 1YQTA 3MTAA 2YHBA 3AFGA 3B51X 4CYMA 3DAGA 1T4CA 5CVCA 1COWA 2WY2D 1VDZA 4DNPA 3HSYA 3R0VA 5GONF 4U5XA 1X70A 2IYWA 1O2DA 2QAGC 2R79A 3HYSA 3ZBPA 4EFDA 1P39A 4UBKA 5FI5A 3GJ7A 3TXXA 4L7VA 2BI8A 3BH6A 4NR0A 3IBGA 4AS3A 3IRUA 5LZ9A 3DA8A 3SC4A 1TD9A 2SNIE 1JR4A 2IK8A 1YBHA 1E79A 1TAGA 1MOSA 2W83A 2PSJA 4OBWA 4TWZA 4EIWA 2WJZB 4B40A 1RCTE 4YVFA 3VVBA 4PSDA 1DX4A 4KQWA 1BW9A 3GRUA 4J1SA 4WCFC 5IF3A 2CXRA 4WNCA 1VXOA 1VE7A 2IJGX 3LC1O 4GICA 5SY6A 2EZUA 4X8LA 4QUAA 4R9RA 1I7DA 4ZVKA 1WXDA 5CHEA 3W8DA 3IODA 4HDMB 2X3YA 1VJTA 5FCDA 2J09A 3UK2A 3KKLA 1LS6A 3EIWA 2GTHA 3H2GA 4Y2TA 4P86A 4RWZA 3TK1A 1M8FA 1TXGA 1EXVA 5FAXA 4B3RB 4HXEB 1EH5A 2Z98A 1E1CB 5B1EA 1AHHA 1KO4A 5AW7A 3ZCQA 1Z6TA 4MINA 3D5TA 3LNCA 4FU0A 2RGBA 2XX3A 2ST1A 4Y67A 5JSUA 5KWEA 1JH8A 2YNMD 3QKSB 4GLOA 4J0EA 5HQ3B 2QPOA 5C4MA 1OX6A 3E3AA 1MH9A 1NDHA 2CHEA 2J4DA 2JARA 2WZCA 4LQDA 4O2BB 5LZ8A 5IJ9B 4OJNA 4BLPA 2KWIA 1W2HA 4M2LA 2JD2A 4JKOA 3JQ7A 4LRSB 3LRTA 3VSAA 2BM9A 1E0JA 3ITEA 4XGIA 3RT1A 1ZVMA 5HVNA 3DF7A 5ELMA 2VAWA 2W2KA 4HLNA 4M6WA 3H3FA 3T41A 4ZKDA 2VNIA 3R3UA 3EXIA 1A4IA 4I55B 2XMRA 2IPOA 4HQLA 1NW7A 1U2ZA 2H4ZA 4KBGA 1KJ8A 5IAJA 3T9AA 2HHHB 2GZ1A 4U7GA 5U1PA 1LNZA 1TMKA 1B6TA 2E49A 1TM3E 3F97A 5AVOA 1MH1A 2QMYA 4BP1A 4LDZA 3SEFA 3UWMA 5JSQA 3H17A 3ZD9A 2GB4A 1F2TB 4HGYA 3DCYA 3KWLA 2PM8A 1ZD9A 2JFFA 3W6PA 2NZ8A 1TPZA 3AXSA 2OO5C 3KOMA 3QU5A 4FYHA 3GJSA 4C6HA 5B4VA 2V0GA 1DDIA 1GNSA 1Z15A 3DXZA 4PZPA 5FP0A 5J5CA 2XE8A 4RZXA 1RRMA 3ILXA 1CIVA 4C0LA 5D3MB 1P4SA 1EK5A 1Y4AE 4FDTA 4R1NA 4YO8A 3OCJA 3OZCA 4ZWNA 1DC6A 3DBHA 4Y2GA 2F55A 1VG9B 1OHHA 4FYJA 5JS8A 3HXPA 3GEHA 3LWNA 3WBFA 4GI2A 1LLFA 2A5FA 2OYCA 3RKUA 3C1OA 1UXKA 4A03A 5JO0A 3TFOA 1C4KA 2R1VB 4TWJA 4BS9A 2PG3A 1SEVA 5IG2A 3V8MA 2FW1A 1D04A 5DISB 5I4BA 4Q4DA 1E9BA 3BIJA 3WGKA 3WI7A 1JSLA 1Z5OA 1FPQA 3AFNA 3PHGA 3DFIA 1O0SA 3KZ1E 5AM0A 4YAKA 4HRAA 2W70A 3R7NA 3SYRA 4NENB 1ZA2A 4D41A 2C7RA 3ISVA 1NLUA 3IA2A 4U7HA 2RC6A 4QDXA 4DR6B 2CHGA 5C9ZA 3UPUA 4DYDA 1N9GB 4UHEA 3RJMA 2EG5A 1QNFA 1YCHA 4IHJA 1V7ZA 5LBTA 1XPRA 3OUTA 2CFIA 5BSUA 1E3EA 3BOSA 2P3OA 1MA0A 4Q19A 3I0ZA 3QYFA 1JHUA 3Q3VA 2AD5A 2GNAA 2FHPA 1CLUA 2MR5A 2Y1KA 3A4TA 4R9NA 3C8ZA 1JDPA 4YUWA 1UIMA 1UPUA 3IH5A 4LMBA 1YA8A 5CH3A 4ZOEA 5E6SA 1UBSB 3LL7A 1QE3A 3VGJA 4QNMA 3BE5A 1OLSA 5F77A 2IU0A 4RGQA 1IG0A 1E8DA 3AKZA 4AWAA 1P2TA 2GPJA 4I55F 1E9CA 2GCNA 5CGQB 4Q9JA 3OEWA 5GQSA 2GAOA 4EJ0A 1L4FA 2CV2A 3SICE 1GCOA 2VZ0A 4KRFA 1EFVA 4CEHA 4MDFA 1GSIA 1M5RA 1MX9A 4KXFB 1NJ8A 2I62A 3R3JA 2P62A 1VGQA 3LK6A 4ARVA 4J49A 5FWNA 4QGAA 3U7JA 4U6SA 4CETA 2D2FA 4Z2YA 3E03A 1M8JA 2BFFA 3MK31 1MF7A 3HJFA 2JI7A 2E37A 4MKHA 4DIMA 2P2YA 1F14A 5T4HA 2ZYGA 1PJ4A 4CTMA 5KWIA 1UBLS 3MT7A 5HJ2A 1TTHA 1L3IA 1DOAA 2OE2A 1NNLA 1TRHA 1XP8A 2ZETA 3QVGB 2PMCA 3TJZA 3AM1A 1FP2A 4LXHA 1AQNA 3BN3A 3EASA 3PPVA 2AUTA 4K28A 4UVEA 3W77A 4A7PA 3G2QA 2QY9A 4DVJA 1VGVA 4BMNA 2ZPAA 1S01A 2VDVE 4BO9A 4EGAA 1HC7A 5EA2A 4D02A 5B7NA 4R2WA 5JS1A 3NW9A 4ZK2A 5K2MA 2P11A 2R6HA 2WUVA 2Z08A 2I67A 3PJGA 2JEOA 4IQ0A 4JI7B 3DPUA 1Q15A 2NTEA 1DXQA 4XB2A 3ZIAD 4MYRA 5LOVF 3B78A 2BFOA 3WICA 5K3OA 2QUIA 4RY8A 2FUKA 4NMMA 1V16A 3UTCA 3RIYA 2AA3A 1AURA 2PX2A 4KQKA 5A1JA 5JSZA 2HPAA 5ES3A 2IXTA 5DT2A 4BNXA 2WUFA 5HKKA 4HWPA 5L7TA 1YZKA 1K4YA 2ILTA 1R9MA 1YRBA 3KVVA 3RYCB 1OU0A 4B3CA 1LH0A 4R7ZA 4E21A 3RUCA 4LOJA 1PG5A 4RHCA 4EKGA 1QV9A 4ND5A 3D4PA 4FHEA 4GZMA 4K7JA 3HXTA 4HS4A 4QQRA 1UQTA 3OM1A 3B12A 1Z8FA 3D2CA 1E0DA 3G02A 1NBWB 2BAGA 2IVZA 1E0KA 1C29B 2DF8A 1QB8A 3RRBA 5T8KC 5KDDA 5ESRA 2PD4A 1RPJA 2IXEA 4R68A 2I6TA 5JNRA 1EKXA 1XPJA 1F9EA 2BDEA 2YFQA 2ZTLA 4QEKA 2E3JA 5LZ2A 2FX3A 3ICOA 3OQHA 2FSHA 4OD0A 2YCBA 2Y92A 3OZXA 3TDMA 4MYHA 1UXGA 3TTYA 4CLDA 5TPWB 4DHWA 4N8SA 1TTTA 1J2YA 5IYZA 1U2DC 1HYQA 1WO8A 1N6KA 4IRXA 3UQYS 2RHLA 2ZM5A 2GAJA 1VJDA 3GJ3A 4ZREA 4KZKA 2RHMA 2WHPB 3SHWA 5HW0A 2Q49A 3S2SA 3NUGA 3JAKB 2ZWIA 3KQUA 4TKUA 1A5AB 2XE7A 4G0OA 3DMNA 2Z56A 5HFJA 5LKRA 4NSNA 2NUTA 5E2BA 2Z3VA 5EYPB 4AMYA 3HB5X 1V1RA 1A76A 3WK9A 3AH8A 3Q7QA 2OP0A 4B35A 1NVDA 1W75A 4QU5A 3TQCA 5KOHB 2P9GA 5K3EA 4GBGA 1L5HB 2QAIA 2BI4A 3S40A 2P2LA 1Y7PA 4Q9NA 2HCRA 4F0JA 1J6UA 3HN7A 4HATA 5IJZA 3QX3A 2BE9A 5B57C 3I2HA 3LL4A 4A26A 3TQHA 1SKYB 3HQ4O 4P81A 3BIOA 3ILYA 3IMKA 4DM4A 1KH2A 2P0AA 4MVXA 1YS9A 3A05A 1W0KA 4DR1B 1XMVA 2XSZA 3HXQA 1EVKA 3OPNA 4FLEA 1JQ5A 2VJPA 3N8GA 3CLTC 4QXOA 1GQYA 3MOIA 1BRTA 4JC0A 4US1R 5LIRA 4OJYA 1MFPA 2H2GA 3JCZA 3RT7A 3COSA 3LI2A 4WN9A 3RHTA 2YNMC 5ALXA 1EE9A 4G26A 3PRYA 1RIIA 1RPTA 4IOKA 5EMJA 2WJ4A 2Z1NA 1DJQA 1WCYA 3OZDA 4BNHA 2E87A 3GGPA 3FCCA 1M6WA 3PWSA 5T3UA 4D80A 4O8CA 4Q3OA 2RHWA 1SBIA 3QU2A 4MS4B 4RFLA 1CQJB 1NM5C 2VYVA 4I4LA 5TXGA 4B74A 2PSDA 2H52A 3N8HA 4YT5A 2PMKA 5ALSA 3PJRA 5L7WA 2Q8QA 3CSDA 3O4IA 3PFWO 4DCNA 1UZNA 4G09A 1RLMA 1WMEA 1IPEA 1L5ZA 2FFAA 4YJ3F 3V4LA 2B25A 2VPXA 3FG9A 2QTFA 3WWEA 1SIWA 2FZWA 1UOPA 5E6SB 1K8ZB 2H8KA 2IV2X 1MENA 2RSLA 3C7DB 4CKYA 1ZH6A 2ZZMA 2W22A 2GZ3A 1UK9A 2ZITA 1U2GC 2V6FA 3FJOA 3LPNA 4YFYA 2JBHA 3CEPB 4KOEC 4BCBA 1K0FA 3VJKA 3IDFA 1NF2A 3PFHA 4IRUB 4X8HA 3UN1A 4FOPA 3BJMA 1HDOA 4B76A 4ZQFA 3FX2A 4MX8A 4DR5B 3G88A 2EWWA 3QE3A 3GP3A 5EMMA 1C9MA 3X1MA 1YJXA 2VR1A 3P2EA 3LM8A 2ZI4A 4H1VA 4RD4A 1DUVG 5LL6P 3UAGA 4PQEA 1N2SA 4URVR 3TW8B 2QN1A 5F1YA 4NDNE 4EUEA 1I10A 1M6HA 1YV9A 3KXLA 5I4IA 3AIKA 4YRMA 5FHRA 1SUBA 1OSNA 1TDJA 1F6DA 1I3LA 2Q0QA 1NPTO 2XOXA 2Z1DA 3GUYA 3PHLA 3FUWA 4IDAA 2IEIA 4OYRA 4Q24A 4DJTA 1O6BA 4P4LA 3MUFA 4N7JA 1P2SA 4IX9A 3U62A 1RHUA 1AV7A 1A2BA 5KQMA 4AULA 4I1PA 3HA3A 2C98A 2VOJA 3Q88A 1FS4A 1ETHA 2FRDA 2PX3A 3AI7A 4IIEA 4TGLA 1UWCA 1XMSA 3G0GA 1EFCA 4UE2A 5FNVB 4BKQA 4OQEA 1IN4A 4BEWA 1SKMA 3RRXA 4LV5B 3N59A 3SJUA 4LYFA 2PWAA 3KM0A 4D43A 1XR3A 4H6PA 1P4HA 1UT8A 3TGPA 4WDRA 2Z43A 1TQ8A 1XZEA 2GNPA 4H0FA 2A35A 2OGTA 3A32A 4PHCA 5DYTA 1U7PA 1XC7A 4O4HA 4DRYA 4TS1A 3W1WA 3SVLA 3F7MA 2WWIA 5DLEA 3RABA 1NMEA 2A0FA 1U8YA 1U9ZA 2VDUE 4P3OA 3H8JA 4R9UC 3W7AA 4IVQA 3WMEA 5REQB 2KQUA 4H2DA 2PCJA 2HSZA 4EKEA 1TTQB 4TQAA 2IDMA 2XF2A 4I4NA 3KKPA 2GJ4A 4FCCA 1LBTA 1ZD8A 3CRW1 2ATCA 4TS4A 3DYBA 1ND5A 3QEKA 3ZW8A 1T24A 1ZSVA 4QDZA 2BV3A 3DLHA 4YONB 4HHEA 4GXTA 3MD9A 3VZBA 5WRFA 3DDOA 1EJ6A 1FCJA 3KJNA 5ED0A 4DMMA 3B1XA 4LX8A 3PGA1 3IE2A 4EUHA 1JIJA 2JCYA 4LAFA 1ZM7A 2PVCA 1U5CA 1UL1X 4O02B 3HJNA 1P5JA 3U13A 2EG9A 4O0MA 4R9SA 3ZVLA 2O2GA 3SE0A 1V8PA 2G5PA 3F6EX 2H4JA 3W4JA 2NXWA 1C3EA 4WA7A 5KSYA 1VIYA 3T9BA 3TPZA 1UK8A 4MWTA 1IE3A 1H2HA 1JPUA 1EM6A 1X7ZB 3C8UA 4HDKA 4AQYB 3EOZA 4KXLA 2O0LA 4J0QA 1PGJA 4RMHA 4WD3A 3ZKWB 5BNFA 4DT1B 3CG0A 3AESB 4F91B 3P7MA 2V65A 2A1UA 2C4VA 1ZK0A 1KWGA 4NXMB 1RAGA 3NRCA 3MW8A 2O9JA 3FMOB 3KLNA 3C6XA 2TECE 2M32A 4MR8B 4KHZA 2ZW9A 4KPFC 3IT3A 2PMEA 3RS8A 5JIBA 3IEPA 5D00A 2H1HA 3B53X 4JMLA 2UXCB 1E3WB 2BMJA 3KXPA 4FJ1A 4R8KA 3L4BC 1U02A 3RREA 4EW6A 1QS0A 3K20A 1LA2A 1WZCA 1JDVA 3CPJB 5JAZA 3GR6A 4TV9F 3QKSA 1Y3FE 4W