4FLMA

S-formylglutathione hydrolase w197i variant containing copper
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
286
Chain Sequence
b'MKVVKEFSVCGGRLIKLSHNSNSTKTSMNVNIYLPKHYYAQDNKRIPTVFYLSGLTTPDNASEKAFWQFQADKYGFAIVFPDTSPRGGSWDFGQGAGFYLNATQEPYAQHYQMYDYIHKELPQTLDSHFNKNGDVKLDFLDNVAITGHMGGYGAICGYLKGYSGKRYKSCSAFAPIVNPSNVPIGQKAFKGYLGEEKAQWEAYDPCLLIKNIRHVGDDRILIHVGDSDPFLEEHLKPELLLEAVKATSWQDYVEIKKVHGFDHSYYFVSTFVPEHAEFHARNLGLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-formylglutathione hydrolase
publication title A role for His-160 in peroxide inhibition of S. cerevisiae S-formylglutathione hydrolase: Evidence for an oxidation sensitive motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase inhibitor
total genus 88
structure length 286
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.1.2.12: S-formylglutathione hydrolase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4flmA00
1EINA 1F6WA 4OCZA 1EDBA 1VZ3A 4CI9A 1HL7A 3DOIA 4J03A 4K6GA 2O2HA 4MEBA 1UOQA 5LZ8A 5AK5A 1XZLA 1VKHA 3I2HA 4FWBA 3EBLA 4W9RA 4X6YA 3DDUA 1XZFA 3WJ1A 1TRHA 3R3WA 4HS9A 3SK0A 1ZGBA 1XZDA 2R11A 2C0QA 1FFEA 4FBLA 4KJXA 3C6YA 1BEEA 2WG0A 3MVEA 5EHXA 4Q05A 4BATA 2VAXA 5FRDA 5FXMA 2WFZA 1AUOA 1CUYA 4UBOA 2HL6A 4G8DA 1VE7A 2HDWA 5HKAA 2B61A 3WKEA 1L7QA 1DWQA 3B3QA 1DTEA 1FFDA 1IUNA 3NUZA 4E11A 3BWXA 3LLCA 5LZ2A 4PSUA 1C7JA 2DQYA 3KDAA 5JATA 5ALGA 2BGRA 3C6XA 4L9AA 4J0IA 1DX4A 2WLSA 5HF5A 1WPXA 2PL5A 4V2IA 4ZWNA 2G5TA 4DMKA 1H2YA 1L7AA 1LPAB 1L7RA 1U8EA 2QS9A 2FJ0A 3VJLA 2I3ZA 4JH0A 1UOOA 4W1QA 1GPKA 1ZI6A 4GXNA 3V1NA 4W1PA 5CURA 1J07A 2DFPA 3WIBA 4MQMA 2CJPA 2PUJA 4CIAA 3WA6A 1EK1A 2HA5A 1MJ5A 1A7UA 5K3CA 4AN1A 3DJYA 5ALUA 3OC0A 5T4EA 5LZ7A 2NW6A 3STTA 4BCDA 3HSSA 4B7ZA 1XKLA 5D6OA 5SYMA 1EX9A 3SWWA 4PW0A 4BP8A 1VZ2A 3DL7A 1CPYA 2XUPA 3W04A 1CUBA 4U2DA 1YSCA 1EDEA 2OGTA 3X3HA 1XRNA 5AKJA 4L0CA 5T4HA 4CCYB 4X71A 2WUDA 5DNUA 1IUPA 3KWFA 4ZV7A 2XUJA 1W6RA 3QMVA 4B83A 2WFMA 2QJWA 2XUOA 1ISPA 4C4ZA 2HHAA 4LYEA 4ZRDA 5LLSA 1RYYA 1HKHA 5C8VA 4ARBA 1AQLA 3C87A 2GZRA 4Y2PA 2O2GA 4J0JA 3IUNA 1RWQA 4BAUA 2O7RA 1XZMA 4BZWA 2E3JA 3I6ZA 1BROA 3D2CA 1QIKA 3MUOA 5I8PA 3A70A 4BC0A 4JUIA 4Z49A 5JZ9A 3PICA 5KWJA 5E4JA 3KSRA 3OM8A 4KAJA 5D3ZA 2XMCA 5AOBA 1DWPA 1Y37A 3FYUA 1B6GA 3FSGA 4A23A 2Q0XA 4E46A 5CBKA 2IX9A 4BDTA 2IIVA 1Q0ZA 3IA2A 3Q8WA 3G9UA 4UBJA 3TJMA 1BCRA 4X95A 1YA8A 4DTCA 3WKDA 3P2MA 4MWTA 4UHBA 2I03A 2EDAA 4DM7A 1O6FA 1UK6A 1GGVA 1BN7A 1E3QA 1R3DA 3H2KA 1CUFA 2WFLB 4QNNA 3H2GA 1UXOA 1H2XA 3V1MA 4QA9A 1DINA 1IVYA 4HXFB 1WB4A 2FJPA 4Q82A 1W1IA 1CQZA 3WLAA 4EY6A 4FMPA 1N8SA 3D7RA 4NS4A 5FLKA 4OD0A 2WIFA 2BGNA 3FWHA 5DWDA 2BUCA 4BBZA 2JGJA 4BC1A 5AJHA 3O4GA 3PFCA 2H7XA 2OLEA 3C5WP 4PSDA 2AJCA 2WHPB 2FUKA 3W06A 5AH0A 3HACA 1TCBA 1C7IA 1ETHA 2RONA 4OUKX 3WK4A 1EXWA 5ALEA 4UBNA 1ACJA 3LP5A 1GQSA 5YASA 4J7AA 4EZIA 2BUBA 2WIGA 4BB0A 3Q0TA 2HU5A 2WIJA 4Q3OA 1C4XA 4KE8A 3M81A 3R3YA 1HPLA 3WYNA 2XQFA 4CFSA 5JD5A 4N5IX 1XQVA 2HFKA 2H7CA 3OG9A 2PSFA 4WFJA 4J0GA 2RHWA 4NVRA 5DNWA 1MN6A 4XJVA 1HDEA 4D9JA 5FPQA 2OGSA 2XQIA 4FHZA 3V1LA 4XVCA 1WCYA 4J3JA 5AM4A 1ODTC 3FVRA 3ZLVA 2OG1A 1QJ4A 2QKYA 3G02A 4OU5A 3H19A 4ITVA 2GBGA 2VEOA 1NU6A 1R9MA 1ACLA 5IVHA 3HI4A 3WWOA 4CCWA 5E4TA 1JU3A 1ZD4A 1LPBB 2RI6A 4GEGA 4C6HA 2XLCA 2QR5A 5C81A 4IH1A 3QMMA 2HFJA 2ONCA 5ALHA 5HKBA 3ICVA 5DYWA 2ZYHA 2BJHA 2PBLA 4X3CA 4CG3A 3ESDA 1ZOIA 1J2EA 3R40A 2PSHA 1GZ7A 3VVMA 3C43A 2XMSA 3G0GA 5A7HA 3WZLA 1E5TA 2GZSA 3BXPA 5ALKA 3NGMA 4AB1A 4EUSA 3B12A 1AX9A 5IVDA 2B4KA 2QUBA 2ES4A 3I2KA 4QDUA 1BU8A 4MWSA 1CUSA 3ICWA 1MAHA 4I4CA 3DLTA 1ODSA 1XZCA 4OB7A 1EDDA 1QZ3A 2OXEA 1QIJA 3FLBA 1Q84A 5ALVA 5JADA 4GDMA 5C8ZA 3F8SA 1W75A 1XRLA 1FFAA 3EQ7A 1MU0A 5JIBA 1CUJA 1JI3A 3BF8A 4B9EA 3ILSA 2QOEA 2RAUA 1FSSA 1MT3A 5HCUA 3C6BA 1GT6A 1OCEA 3K6KA 2GBIA 5AKZA 4HXEB 5LKRA 4K6KA 3QMWA 3JW8A 1N5MA 4FFVA 4H7DA 4IH9A 4MYSA 4AO8A 3OURA 3CCBA 3O4HA 4LXHA 2VQ6A 3D4LA 1CUUA 1X2EA 1YAJA 2WJ3A 5JARA 2XUAA 2VSQA 1VA5A 5CMLA 2D0DA 3WWDA 5CT6A 4YASA 1QIFA 5HF8A 2ECFA 1E66A 3C8HA 1WOMA 4KACA 1SOMA 4KAFA 1YA4A 4DYHA 1X2BA 2QVBA 3V48A 1VXOA 1UKCA 4AX4A 4B0OA 3HRHA 3CXUA 1G4HA 5A2GA 3KOOA 4H7FA 3SC2A 2AJLI 3H1AA 2WG2A 4E14A 1M33A 4Q1VA 1XZKA 3DQZA 5AIBA 3I2JA 4AN0A 4WDRA 1QLWA 4PO3X 3PI6A 2BKLA 4QDXA 1E8DA 2HU7A 3HYSA 3F9CA 2XLBA 4IH4A 4RE6A 6YASA 4NZZA 4AMYA 3WL8A 3WL5A 4XWGA 3VJMA 2AXEA 3TRDA 5AIAA 3NOXA 1IZ7A 1ZI9A 1HLGA 3JYHA 3IIIA 3ZWQA 4Y2YA 1VE6A 1TAHA 3FYUB 1CUZA 3S2ZA 5ALRA 3STWA 3A2LA 4K2AA 4FNMA 2DR0A 4GW3A 1QTRA 3WWCA 4N8EA 4QLAA 2QUAA 2PSDA 2QM0A 4X7BA 3DYVA 2C5FA 2BFNA 2HRRA 1LPPA 5ISMA 1VA4A 1P0IA 2V98A 2Z3WA 3F97A 3D5EA 3STYA 2R8BA 4GHWA 2J3QA 3H1BA 4ETWA 4HXGA 4X91A 3HABA 3LS2A 4BRSA 4J0DA 3D3NA 3QYJA 4IO0A 1EVEA 3QVMA 5AI6A 4XX1A 4WFKA 3U0VA 5D7BA 4L3WA 2VJAA 3K2IA 5I9IA 4DGQA 4PV7A 3VKFA 1GQRA 3FYTA 2WHQA 5CT5A 1W4LA 5K3FA 4DMCA 3ZLTA 3ZV7A 4I19A 1F8UA 1XQXA 4FBMA 2RHTA 1P0MA 1MTZA 3I2IA 2H7YA 3O0DA 1YAHA 2VT7A 3PFBA 4FLMA 1WB6A 3HZOA 5A62A 4UHDA 1LPOA 5AM3A 4IHAA 1FFCA 4QDTA 2V97A 3AJAA 2D5LA 2O7VA 4X92A 1HBJA 2CBGA 3UUFA 5ALJA 4DNPA 1ZJ5A 1ZIYA 1QE3A 3DYIA 4DMFA 4OSEA 4Y2QA 4Y2UA 2XE4A 1CRLA 5FPPA 2QRUA 4EY4A 1EH5A 3WWEA 3L1IA 4L72A 2VT6A 4CIBA 3RK4A 2JEZA 2WJ6A 4J0KA 1ZD2P 5AKXA 5H3HA 2J4CA 1G66A 4U2EA 3VVLA 4DLNA 5I7UA 1HQDA 4S0XA 5CH3A 2IITA 4EB0A 1AGYA 4QDZA 2ZVDA 2QJRA 2RGUA 1YB7A 5AM0A 2ZJFA 1VJ5A 3I2GA 1VLQA 5AKKA 1TQHA 1T4MA 3CN9A 1Y7IA 2WTNA 2VJBA 1MO2A 5J3JA 2WUEA 4QE3A 3PUIA 2XUKA 1CLEA 3WIOA 3DNMA 4GECA 3WL6A 2QZPA 1AC5A 3BF7A 5CH8A 2UZ0A 2XUFA 3ZPXA 4U2BA 1DQYA 1JMYA 2G4LA 2XMBA 3WWPA 4A16A 3AFIA 3O9VA 2JIDA 2HA0A 5DTJA 5JD6A 1QO7A 5BWBA 2ZJ7A 4OB8A 2CKMA 1BEZA 2PSJA 4DNQA 5K3BA 3R0VA 4UHFA 3IULA 1FJ2A 3PE6A 3W9BA 4N8DA 3DKRA 1CUGA 2QXUA 3O4JA 5LZ9A 4G9GA 4B85A 5AM1A 3AZQA 4X94A 5A6VA 5AK6A 5EHZA 3T52A 2XUGA 4X6UA 3W2TA 5CH5A 2XDWA 1D07A 3FNBA 4X93A 2XUQA 1ZICA 2ROQA 1XRPA 3I1IA 1EB9A 3F67A 4BDSA 1E89A 2ZYSA 2Z5GA 2XUIA 1CUXA 3EIOA 1SCIA 3FCXA 3GELA 1XZEA 3I6YA 2XMQA 2GBFA 1XLUA 4BE9A 1MAAA 1USWA 3I2FA 5ALYA 5FKJA 4JYMA 1UZAA 2XQKA 1A8QA 2W22A 2GYVA 5ALDA 1CUWA 4OYYA 3D2AA 3BDIA 4W63A 4OPMA 4UBIA 5FP0A 4H35A 1CQWA 5JD4A 3CCCA 4BVJA 3K9BA 1DX6A 3STVA 1NU8A 2W6CX 2WUGA 1R9NA 4JYPA 4PNZA 4Y7DA 1XRQA 2Y2UA 4QDOA 4C4YA 3M3DA 4Q34A 4X97A 3AZOA 1KU6A 2YYSA 4UFOA 2ZJ6A 4UHHA 2DHDA 5LP1A 2BAGA 5ALZA 5JAOA 5DTIA 4AO7A 2VATA 2YASA 1X70A 1MNAA 2VJCA 1FFBA 4BRZA 1BRTA 2XMRA 1B41A 1WHSA 5AM5A 5CXUA 4H7JA 3C6ZA 1O6GA 1S8OA 4M0EA 3WZMA 4A5SA 1DQZA 4MJ3A 1YR2A 4F21A 2JGFA 4B84A 1CV2A 2XUDA 4W1RA 3BJRA 4E15A 1CIJA 2JGIA 1QOZA 4CG2A 2WU4A 2XB6A 1XRRA 5K3AA 2CEKA 4ZV9A 3DEAA 4B0PA 2JEYA 3VJKA 1SC9A 5AI8A 4UFPA 3MGAA 1R50A 2HM7A 4CCYA 1AZWA 1UOPA 1ZD5A 3S8YA 4WJLA 1PJAA 1ORVA 2XQJA 5JZBA 1ODCA 1LBTA 2V96A 1IZ8A 1JJFA 1U65A 4UBKA 5AI0A 3SX4A 4DIUA 1VOTA 2QTBA 1K5PA 3PDCA 1K8QA 4FOLA 4G9EA 3FCYA 4Y2RA 4JNCA 2Z3ZA 2WKWA 1BCSA 3H2JA 3R3UA 2X76A 4MYDA 4G4GA 4YK7A 5AHXA 2B20A 5K3FB 3U1TA 4HTAA 3FAKA 4EBBA 5JAHA 2HIHA 3WA7A 2PSEA 5HK9A 1G5FA 4RNCA 1H2WA 4Y2TA 3ESBA 5T4BA 3CN7A 1LBSA 2WQZA 1QIGA 1G42A 1MPXA 5ALTA 1I6WA 4TVKA 3DD5A 4HRXA 4PSCA 1ZIXA 4F60A 2OCKA 2PX6A 3FVTA 1TK3A 1YCDA 2OCLA 2RIPA 4PF1A 5HK8A 3H2IA 4H7IA 3D2BA 1UFOA 1H23A 1GXSA 1PV1A 2PU5A 2EDCA 4KEAA 5EFZA 3QPAA 4CG1A 4EY8A 2OPHA 2XI4A 1U4NA 4M0FA 4NMWA 5HFAA 4JEIA 2ZSHA 5DNVA 1JJIA 2WG1A 5LYYA 4F5ZA 1WPRA 1XROA 4J0HA 1CUIA 3DKKA 1LNSA 1CFJA 4BZZA 4W1SA 1CUHA 1OILA 5DJ5A 2XMDA 2CZQA 2K2QB 2JGLA 4H7HA 1YB6A 1KU0A 4B6GA 4F0JA 3WMRA 4RGYA 3OPMA 2B9VA 5AKIA 1XZGA 4QWMA 5DYYA 4C88A 5E4YA 2OCGA 4AO6A 5HZGA 3HEAA 5BWCA 4ARAA 1MX9A 2O2IA 4UUQA 3WKAA 3PUHA 4KE9A 1A8UA 3QITA 3ANSA 4IQ4A 1ZJ4A 1K4YA 4P08A 4ROTA 3ZLUA 3WJ2A 1UKAA 1UT6A 4O08A 2DHEA 4WY5A 2OGZA 4Y9SA 5AOCA 2HA6A 3WK6A 4FDMA 3JWEA 3N0TA 3M83A 3R41A 3HLKA 2PVSA 5JALA 1QIDA 2Y2VA 1R88A 4U2CA 4BYMA 3WL7A 5AI9A 1XKTA 4HZGA 4X6XA 5FDFA 1JU4A 4C4XA 2BCEA 3G9XA 3OTQA 4OYLA 3RM3A 5AK4A 4BVKA 1LGYA 3BJMA 3H2HA 4TPKA 4BVLA 3BE8A 4KRYA 4BCBA 4ZGBA 1E8MA 1QFSA 2VTVA 5HF6A 1P0PA 4KE6A 1WB5A 3DCNA 2DHCA 1EA5A 2CMFA 1T2NA 2OAEA 1TKRA 4EA6A 3BL8A 5A71A 5ALFA 3QH4A 3GZJA 1XQYA 3H0CA 3BIXA 4WFIA 3I28A 1CUDA 1H2ZA 4U2FA 1QFMA 5BV7A 5AOAA 2VJDA 4GBGA 1ZD3A 5EIEA 3F98A 5ALXA 2AJ8A 3G9ZA 4WDQA 3IUQA 5HF9A 2GYWA 2HRQA 2WUFA 3C45A 1F0NA 1ZI8A 2XMGA 5AKYA 4DSZA 1XZJA 1R4ZA 1GPNA 1WM1A 4KR0A 3WK7A 1UWCA 3AILA 1TIBA 1QTIA 5AKEA 3G0DA 2WIDA 4KYVA 5K3DA 4LIPD 5AKHA 2I3DA 4AZ0A 1J06A 4EY5A 4B81A 1UKBA 2PU7A 5ALPA 1DU4A 1Y7HA 4UHEA 5EI5A 5JANA 3NWOA 1UK9A 2ORYA 1SCKA 5KREA 1JMKC 1Q83A 3QPDA 5CXXA 2HU8A 5ALWA 5AP9A 1QGED 4G4IA 2Z8ZA 5FOQA 1OXMA 1ZGCA 1YASA 4QZVA 2WM2A 1XZIA 3UMJA 5CW2A 3VISA 2P8SA 2JGMA 2JGKA 3O95A 4FKBA 1TCCA 3WKCA 2PPLA 1SCQA 1EB8A 4M0MA 3F96A 5JZSA 4UBLA 1IUOA 3C8DA 3STXA 1BE0A 4Q3LA 2OCIA 2GYUA 4C89A 2XT0A 3H04A 4G5XA 3IBTA 3IURA 4P93A 3VXKA 1DWOA 4ZREA 4AXBA 5LIPA 4G1FA 2GBCA 1K6EA 3G0BA 3UUEA 3FLEA 4Y2JA 4XIIA 2QXTA 3WKBA 4UHCA 3N2ZB 1QIIA 2I78A 4B9AA 1J1IA 4B82A 1JKMA 3DL4A 3TEJA 3R3XA 3QPCA 2BUAA 1CUAA 3IUMA 3GFFA 1JFRA 4LYDA 4N8SA 2HA3A 4UPDA 1THGA 1LPMA 4WCVA 2ZYRA 3STUA 3WYDA 2HA4A 3AIOA 1U2EA 3A6ZA 1AMNA 3ZI7A 5HQ3A 3FSGD 4K5QA 3KD2A 2HA7A 2WJ4A 1YS1X 3PF8A 1XLWA 1LPNA 2QMQA 1THTA 3E1GA 1XLVA 4B80A 4TGLA 2YH2A 3D0KA 5IVIA 1CUCA 5AO9A 5AKGA 1LZLA 4LXIA 3WK8A 3G0CA 3LCRA 2CB9A 4ZXFA 5ALQA 4N5HX 1GPLA 1XZHA 1CR6A 4DSAA 5K5EA 3DOHA 1R1DA 2LIPA 5C7YA 3YASA 5F4ZA 2JBWA 1KEZA 5ALLA 1H22A 4AQDA 3LIPA 4BE4A 3GUUA 4X90A 3G7NA 2FX5A 4LXGA 4BTLA 3AINA 2WTMA 5A7GA 2ACEA 5AICA 4GWLA 4MEAA 4H18A 4DNFA 3EQ9A 5EIAA 2DCMA 3G8YA 2C58A 3LIIA 3O9MA 3E3AA 4AZ3A 2PKYX 5AM2A 5C8XA 4FNGA 7YASA 3T4UA 4FLEA 4RPCA 2YXPX 3I1YA 1LPSA 3IVMA 4Y2XA 5FV4A 3KXPA 4GLBA 3HJUA 5KBYA 2OQVA 2WIKA 2ZSIA 4C87A 2CUTA 3H17A 3A2NA 1XZAA 1K63A 4PQEA 5IKXA 1VXRA 2Z8XA 1YS2X 5CT8A 3G0IA 5A7FA 3G9TA 5AI4A 4Q3KA 4G8CA 1UK8A 5EHQA 4P92A 3W9UA 2X5XA 5LZ5A 2Y6UA 3BDVA 4BAZA 1EHYA 3ESAA 5JASA 1QIEA 1JJBA 2OAGA 1Z68A 3E4DA 1XZBA 2C5GA 4MQLA 3R3VA 1GKKA 5E2IA 4QWWA 5AKLA 4FFWA 1A88A 5JAPA 3EQ8A 4DNOA 1P0QA 2EEPA 3AZPA 1W52X 4INZA 5LKAA 5K3EA 1WHTA 2H9YA 3R3ZA 1XRMA 3WI7A 5IH7A 4H0CA 2Y1KA 3WK9A 3IUJA 2PM8A 3H18A 4P9NA 3MUNA 1XQWA 5D3KA 1MX1A 1BN6A 5EIHA 3HC7A 4HRYA 2G63A 4HAIA 5AK3A 5ALSA 4G8BA 4ZI5A 3C5VA 3OOSA 5ALIA 5CRIA 1IMJA 4H7EA 1LLFA 2ZYIA 3D59A 4DMHA 4H77A 5KWIA 5HFNA 3RLIA 1AURA 5BOVA 1NX9A 5T4FA 1CUVA 4FTWA 3GBSA 4RE5A 4AMZA 5JYCA 2XQGA 1LZKA 5EGNA 3C70A 3GA7A 5ALMA 5CTAA 2WILA 3AIMA 2H1IA 4KE7A 3W05A 4KRXA 4HVTA 1MNQA 3WQHA 3BIWA 4WY8A 2WHRA 1UK7A 4LHEA 3HXKA 1TCAA 1Q0RA 5CT4A 5FUMA 4OB6A 1GKLA 4Y2VA 5ALNA 2XMZA 4UBMA 4LKOA 1XFDA 1N5RA 4H7KA 2J4FA 5LZ4A 4Y2SA 4X85A 3DS8A 3WK5A 1QO9A 1W76A 3M82A 3FBWA 1SFRA 2OQIA 1N1MA 3GROA 4U2GA 4YX9A 5IVKA 3AIKA 1DT3A 2WU3A 3PF9A 1RP1A 3ESCA 1QONA 4MXDA 2X8BA 4EY7A 2G5PA 3V9AA 2VA9A 1E8NA 3E0XA 4BAGA 4EHBA 4YPVA 2WFLA 3ANTA 1ORWA 4GI1A 2VAVA 2JGEA 1QIHA 3L1JA 1MX5A 4X00A 3EF3A 3TGLA 2C4HA 1AKNA 2DSNA 3FLAA 4UFNA 3V1KA 3KWJA 1CUEA 3ED1A 5ALOA 2ACKA 3FYUC 4QEKA 2Y6VA 4I3FA 5CT9A 2WSLA 2QT9A 2DQZA 4BCCA 5EHNA 1CEXA 1EK2A 3RARA 1BS9A 2WHPA 3O4IA 2HA2A 4BP9A 1JT2A 5DYTA 1EI9A 3A2MA 3QZUA 3QM1A 4QLOA 1QIMA 3IB3A 4K6HA 1PFQA 5JAUA 1F0PA 1DT5A 1EVQA 4BTVA 3FOBA 2J3DA 4OU4A 1CVLA 3B5EA 2HADA 5DLPA 3L1HA 4J0CA 3VDXA 4G4JA 4FLFA 5AI5A 2XUHA 3RKSA 1A8SA 2C0PA 5ESRA 3QBJA 5SYNA 3IDAA 2AJDA 2JF0A 5HQ3B 2V9ZA 3AUKA 4KAAA 2VF2A 2C7BA 4C01A 2PUHA 3I6MA 2AJBA
chains in the Genus database with same CATH superfamily
4RJKA 1F6WA 1WVIA 4IS2A 1H85A 4R4JA 1RLUA 1XKXA 2JATA 1R8SA 3RLFA 3LCCA 3MWFA 1HLDA 3BTOA 4J03A 5B3AA 3HWRA 1N2IA 4MEBA 2G72A 2CXSA 2JFQA 5LZ8A 5B3KA 2SECE 2Y0DA 3UWKA 5F9HA 1QWSA 3H86A 1HE4A 1E60A 1V96A 3Q8KA 1J99A 1GRRA 4WSOA 1IWOA 2AXQA 5BNIA 2ZPUA 3EBLA 2H1RA 1DUIA 4F06A 4MQFA 2O5EA 3DCIA 1GGKA 3BILA 6LDHA 3IL2A 2JH9A 3B51X 4NBNA 4IGEA 4S12A 5K0LA 4J6FA 1DJPA 1H4TA 4KFRA 3FOCA 4IIEA 5LNK1 1UEIA 3AF5A 4PHFA 2PR2A 2VHYA 5CNMA 5U4QA 4KRGA 3SK0A 3JQAB 4KWEA 3TXXA 2RK3A 4A92A 1CK4A 1SHLA 3FGOA 2DWOA 3W8NA 3PXXA 4RJ2A 2DY0A 5FTLA 2C0QA 3F6RA 4U9UA 5ADHA 5DLQC 1FFEA 4IVNA 2COUA 1SXIA 4WXYB 2I33A 4KJXA 8ADHA 4GP7A 2MSEB 4Y1RA 3U7FB 2CK3A 1WPQA 3NNDA 1AIPA 4JB2A 1M0WA 4YMIA 2HJGA 3AT1A 3NHUA 3CLUC 5B7PA 2R7NA 1UIMA 4PFSA 3B13B 4B43A 5EHXA 1S3SA 2GYYA 3GFTA 3U2QA 3QLUC 3FPGA 2V0CA 1Z4NA 2XCIA 4CL2A 5JNUA 1M6VA 4TTJA 2M98A 5DBIA 2NM0A 4Q03A 3DLCA 2C20A 1W0CA 4YT8A 7ADHA 4Q12A 4RPJA 2QM7A 1PJTA 4NLLA 1GITA 1MRZA 5K4GA 4G8DA 2P9CA 3TB6A 4XH9B 1AH2A 4AFNA 2V1XA 5K0ZA 5K4AA 2B61A 3WMEA 4FI3C 2X23A 2QYOA 3WKEA 2KSQA 1L7QA 1XNHA 1KQ3A 2HTFA 2R5FA 2VPQA 5FCDA 1L5OA 3WGIA 3I9NA 4BVBA 4Y6OA 1MDFA 2PZKA 3JWIA 4XX0B 1J09A 2K7ZA 2COKA 3LUJA 3QEAZ 5IYZF 4M89A 1IUNA 2B21A 4AL4A 3ZHSA 4ZMBA 1AKRA 3LLCA 2AEEA 3AFHA 3B8EA 4GFDA 3D1LA 2NU8B 5HIJA 1GT91 1QMPA 1RZUA 1KI6A 3KDAA 3V33A 2OR3A 5JATA 2E5LB 3VV3A 2P1DA 4PLZA 5GM2A 2F1RA 4CM1A 1UZMA 2FW6A 3PNPA 4NEGA 1O94C 3O4RA 4OHRA 2GK3A 2VSXA 2ZWOA 4QXRA 1DADA 1WXQA 1O0BA 3SBEA 1YB2A 2JPDA 2WLSA 1N6HA 1BMTA 1TYDE 2B4QA 3FWZA 1ZU5A 1CETA 1UJ4A 2P4EA 4B6OA 4V2IA 4ODIA 4H1UA 3FZGA 2IYEA 5EZYB 3A32A 2GZ1A 4Q7LA 2A6PA 1HRDA 1IBCA 3SS8A 4DMKA 3P2OA 2CXPA 1XC7A 5BN5A 5I4BA 2BEVA 3P9KA 1FDUA 2JLCA 4AKSA 3IQIX 5AW2A 2W2LA 1V3QE 3V32A 4MUHA 1L7AA 2GFIA 4GLLA 4BNGA 1U8EA 4A6PA 1IXYA 3HDVA 3U4CA 4AKEA 1RI2A 4G67A 4H9GA 3VJLA 4AC9A 3AM3A 1YI0A 2PZBA 3P1JA 4DIOA 2O3JA 1G7CA 1UOOA 4G41A 3JVEA 2J5KA 2H00A 1SVMA 1EUDA 1QZZA 1Z2EA 3HYLA 3EJWA 4MDYA 4A0SA 5KQSA 3HTXA 5FA8A 3V1NA 4F3RA 3H0EA 3NHJA 5CURA 2B5WA 2WM8A 3NDPA 1WDKA 5DNAA 5CA1A 3BXZA 3WIVA 3RJ5A 5L95A 4JR0A 1G8SA 5GZ1A 3MJTA 4LF4B 1EZZA 2WC1A 3ZJUA 1G5HA 1S5PA 3V1UA 2QAGA 4B40A 1G6OA 3L7IA 1I7DA 3K1AA 4WD3A 1MJ5A 2PL9A 3KKEA 3N2GB 3GOQA 1I2AA 3BIJA 3CJTA 3DJYA 1CRWG 2VI5A 3A4MA 5GM1A 3RKRA 5ALUA 3OC0A 2F2TA 1D4ZA 5BSFA 5KYWA 4RTOA 4KNWA 4LI3X 3OCZA 3PC6A 4D9NA 3KR1A 3EJ6A 4FZJA 3PU6A 1N36B 1TJ3A 3HSSA 1DRKA 5C4GB 3A0RB 3PGKA 4KDRA 6Q21A 3ERCA 1PVOA 2NO6A 4OREX 2F43A 4BVFA 1YGPA 1KK1A 3E9EA 1ZDMA 1GARA 5IJ9A 3KEFA 2GK6A 3NKFA 1Q0TA 1OPRA 4GDFA 4CM5A 3L43A 4EP1A 5LWHA 2QBYA 3B20A 1TKAA 3L41A 1F51E 1ZHOA 4HKTA 2DQSA 5KOIA 1CPYA 2Q3HA 2XUPA 3PXDA 2GXAA 1QB7A 3DTVA 1NQVA 1EDEA 3BMNA 2RHOA 3EIEA 4FGKA 5CPFA 3X3HA 2HQRA 5BO5A 1VJCA 2GZAA 3K9LA 3OY2A 4XPIA 2RG7A 3K2BA 4BZPA 2ZE6A 1IIRA 4PAGA 4Q6BA 3EDQA 3NGLA 3T5BA 1JRLA 3WO1A 5DNUA 5K0SA 3OFSA 3WLQA 3LPNA 2QRLA 4IIGA 4PFQA 4LTDA 2HI0A 4OXNA 3A9WA 4DHEA 4Q4LA 3ID6C 2G25A 3JZDA 4LOJA 1BMDA 3RUFA 5CFMA 1W6RA 5L6LB 4G5QA 4C7VA 1P33A 1EFUA 2CHUA 1TO2E 3QMVA 1B0PA 4HAXA 3GLIA 4BXOB 5KYKA 1TUIA 2A88A 3GWZA 4EI9A 3T5PA 5EAIA 2B78A 4BN4A 4EB6A 3QXGA 2I7CA 4YV1A 2OP1A 1ISPA 5HA5A 2BEKA 5A02A 3QVLA 3WGOA 2PJDA 2A0WA 1KIMA 2XWQA 3JQ8A 4G1VA 3DZDA 2QQ5A 1F4PA 2ECKA 4D2IA 4EEKA 1NXVA 1QPGA 2Y1LA 3KYDA 4Y2PA 1CJKC 5KTKA 4TXJA 3RC8A 5G3YA 1X7GA 3GP5A 5BOSA 3KKZA 4C0LA 2VPIA 2BPOA 1BJTA 1D7OA 3D5QA 3OT1B 2X2PA 4KKXB 2FXVA 5JCJA 5KTPA 5D8DA 2G88A 1DJQA 5K3OA 3MT7A 3D2CA 2D3WA 5B4TA 2P3LA 4M0UA 1S2IA 1VGQA 4C4RA 1DEXA 1NVKA 1QIKA 3I01A 3MUOA 3O92A 3C1TA 4KKVA 5GV8A 1WUTA 2HR1A 2YCBA 3AOEC 4LAFA 2XTNA 4KXQA 2R5NA 3MMZA 4JUIA 4MPDA 4I9HA 4MRNA 4OMUA 5JY6A 4Z49A 5BW8A 3FZEA 5JZ9A 2P6UA 3RSHA 1UFQA 1EQAA 2A1UA 2J3JA 2QG9A 3G89A 3CRRA 3F6YA 5LMNB 3A4TA 3KSRA 3A8TA 1YBHA 2FFBA 5CLJA 3OM8A 5BVGA 2VHJA 4KAJA 3OQIB 1KPGA 1J6UA 4FMCB 4MWGA 3AWIA 2HQOA 4KCGA 5AOBA 3EISA 1GPJA 3QQPA 3S3TA 3PKJA 1Z0IA 4PWZA 4KP7A 2XB9A 4JELA 4C5AA 1I6MA 4ENTA 3NQ41 4G86A 4IWXA 4O1IA 1X80A 3A7EA 1Q0ZA 3IA2A 1D1PA 4LXTA 3N2EA 1ZRHA 3IAUA 2GT1A 3Q8WA 4UBJA 5DT9A 1O87A 3JQAD 4OX9B 5CAEA 3TJMA 4RGBA 4RZQA 3UKOA 2PTHA 5GJVC 2YXBA 4V24A 4X95A 1L5ZA 4ILKA 3PQDA 2W7TA 5BY2A 3V34A 1VFPA 4R1LA 5AT1A 2B5VA 3TGPA 2BL4A 4FIZA 3SR3A 3K6SB 3KYBA 3G1WA 1NJ1A 4UHBA 3NC4A 4WVFA 5HFJA 2FF7A 3L77A 1SXJC 2LGJA 4HSEA 1V9CA 3V3TA 4DM7A 3AJRA 2FN7A 5HNKA 2CHEA 3DDOA 3TKLA 5DRYA 5DTEA 1NF2A 4DT1B 2AW5A 4ZTZB 1AKMA 3RS3A 3UJ3X 1CUFA 1QYCA 2JZOA 2D1SA 1P9LA 1Z8FA 2BE9A 1KYQA 3EK2A 1DFHA 3H2GA 5JTUA 3WLJA 4KG7A 3NBMA 3QF4B 4E5NA 3MRVA 4C04A 1GU0A 1E2HA 2XHZA 3V1MA 2PMEA 3ZDBA 3EEIA 3UUWA 3AR9A 1FMTA 2AQHA 2CD7A 2XSZA 3CEMA 3TZQA 5K0JA 1F8FA 3B3FA 3ZHOA 1TEXA 4HXFB 3A4LA 1TYZA 1ZC3A 3UJBA 3OE5A 5ILQA 3EASA 3TSCA 1P1RA 1PDOA 5KTNA 1N8SA 5B58C 2ZIXB 4XYBA 1E4EA 5BSHA 3D7RA 3AGPA 3KUXA 3IGFA 4XVUA 2IS6A 1U0HC 2C8LA 2WIFA 2ZRKA 1AHNA 2D1YA 4DB2A 3HVIA 2J1LA 1JALA 4JJAA 1TTHA 4X63A 5FBVB 3ZTYA 3KQLA 5C80A 4F3CA 3MCUA 4I81A 4Y9TA 2OLEA 1XRJA 1M1YA 1OX4A 5E8RA 1OD6A 2OD9A 3OFVA 2RI1A 4O4JF 4RL6A 3VZPA 1SUFA 3OUZA 5LLDA 2QLTA 4U3JB 2HMSA 4ZU3A 3ZBPA 2A1TS 2FEXA 1QC5A 1SAYA 4Y30A 2PDAA 4G01B 1EXWA 3L92A 4FEYA 1E4OA 4BIMA 4NE2A 2QMHA 1CY4A 2QUKA 3LP5A 4HNHA 4ZI7A 5EPUA 5YASA 4J7AA 3SPXA 3DO8A 4EZIA 3NJRA 2WIGA 4TQUS 3B9QA 4JVSB 3OQPA 3OKAA 2VAPA 2P0YA 1W5EA 2F9LA 1PDWA 3HNPA 3PFKA 4M38A 4WA8A 4WY2A 5BSTA 3AW8A 2ZYTX 3HG7A 3TRKA 1IOWA 3KSBC 4CT4B 5D1HA 1LSSA 4D9IA 5JFGA 2R47A 2WM9B 5ITWA 4UQPA 1J0AA 3OZVA 3R3YA 1JLSA 4GZLA 3MBIA 4DVGA 2O3RA 1SUSA 1NHGA 3FUCA 3K9QO 4EYOA 1XQVA 3CEAA 4PIMA 2H7CA 3UM9A 2PSFA 3AI1A 1BH6A 4WFJA 3GGJA 4BNNA 4J0GA 3AEKA 3N0XA 3SHVA 3KR2A 3ND8A 4NKRA 1V16A 1CKEA 2NZJA 3GLFB 3PB3A 2R86A 3KVNA 3I01M 1HNZB 1S6YA 3F47A 1V26A 1MPTA 1YCGA 1P5ZB 1DC7A 1N6RA 3ND9A 4NXMB 1HDEA 2GJ8A 3ED5A 3T3EA 4D0SA 2VTKA 1L1EA 3BQNB 4FNAA 2XQIA 4E5VA 1E96A 2Y4OA 3FR7A 3H42B 3N6RA 1OBHA 4L5YA 3OHMA 4J3JA 4AROA 4XVCA 4ZYVA 1CY2A 4J1TC 1DBIA 1XNQB 4PAWA 5AM4A 1ODTC 5IYZA 2X13A 2OG1A 5SV2A 2QKYA 1K6JA 2P9QA 4XIJA 4ZRMA 1MRSA 4OU5A 5IAEA 4C5CA 3H19A 2PX0A 4QQ8A 4NBWA 2B8EA 3DH0A 1ACLA 2CNBA 3A4IA 2ODNA 4RABA 1WDMA 3OZTA 4X44A 2FJUA 4EG0A 5DV9A 1N34B 2PGJA 1YBMA 4QPDA 4AJLA 4D6PA 2K5UA 1PFUA 4W9NC 5FTMA 4W5WA 1VSVA 3ZK7A 1Z28A 1JU3A 1ZD4A 2DPMA 2FPPA 1EBFA 2OZLA 4R71A 3AVVA 1PHPA 2G9VA 2TECE 1NE7A 4NK4A 2P9BA 2IUYA 3P97A 4XUEA 4MHTA 1DIOB 2HFJA 1E3SA 3PVZA 5CCEA 5IT0A 3KHUA 2C4VA 1PUJA 2VN8A 1ZK2A 1JV2B 4HSGA 2KS6A 3L7MA 5D1NA 4YWJA 3T5CA 4QNMA 5SZHB 3R3HA 4OXRA 2ZATA 3A9UA 5DYWA 3THXB 2ZYHA 4O4LA 2PBLA 3B2NA 4G0QA 4CG3A 3UT6A 3ESDA 4F84A 1GDTA 1WA5A 2Z9DA 4MVJD 2GDJA 4J6EA 3FNHA 3NOQA 4M1MA 3R40A 2FG5A 5EKSA 2PSHA 4DLYA 1KH3A 2P3SA 1DKMA 2I3GA 4M53A 3KVRA 1CQJB 3FOAA 1GZ7A 1PVDA 2XT6A 3ONFA 2GNOA 3PEEA 5DGDA 1T2AA 2IYPA 4G97A 4NBRA 3CU5A 4R2IA 2ZRPA 1MEJA 2XMSA 2KW5A 4IHJF 3HA3A 3EAQA 5A7HA 1D3AA 3V1TC 1G20B 1EAYA 1RHUA 3NTVA 3KTDA 3Q98A 4LNAA 5CIWA 4Q9IA 2CD9A 2JJ2D 3TD6A 4ZO8A 3U9TA 4AB1A 1II8A 3B12A 3DFKA 4HYTA 4PZZA 5H82A 3WY9A 2I2DA 4DZRA 4YMLA 3LMKA 2IXGA 1T6XA 1WY7A 3L4BA 3P9YA 4QDUA 4S05A 4NEHB 3L0ZA 1XVLA 1PLKA 7MDHA 5I9SA 1A9XA 2Y1CA 1OBOA 1BU8A 1OLSA 2CN1A 4MWSA 4ZOLF 1M10A 2VUIB 4NCKA 2BMVA 5FPYA 5AHWA 1D1TA 3O21A 4FDTA 1X74A 3DLTA 1JG7A 1R7RA 1XZCA 3CRNA 1RHKA 3FUWA 4KGXA 3IOEA 1JKFA 1EDDA 1ATZA 1LDEA 1VJDA 4IV0A 3TCXB 5ALVA 1RLMA 5HUHA 1W7AA 4XR4A 2PS3A 1DCFA 2ATXA 3FKQA 4M7RA 1U6JA 1S4QA 3QVTA 5LIRA 1XRLA 1DLIA 4D0GA 4EA9A 3RYCA 2P8JA 1KA9H 2GBLC 1MU0A 1YXMA 1CUJA 1U4OA 1KJ8A 2EZ4A 5G0TA 2VBCA 3HBFA 1KOLA 3HWX1 4R9NA 3BF8A 3ROTA 1DC4A 4N3NA 4BO5A 4DDKA 3ILSA 4ZKEA 3CTMA 2EWWA 1PBTA 3QNMA 1YR8A 4R2LA 5KDLA 4JENA 3AI3A 4EFLA 4HVCA 1VDMA 1IY2A 4HZIA 1TZMA 3IP5A 1ECBA 4ZZ3A 1PL0A 5FB3A 1GT6A 4ZO7A 2GBIA 1RDFA 4HXEB 5AKZA 3NDBB 4K6KA 4XCXA 4DKJA 4OHMA 1GCIA 2X5KO 1V8OA 1ZQ1A 3E8SA 1MOQA 3M0EA 5JG7A 4MKHA 3Q7RA 5PNTA 3USES 3WLMA 2FMFA 1GSHA 3C6MA 3OM1A 4TV9A 3SMVA 3UPDA 4IH9A 4X1KA 3OURA 1KOFA 4MR7B 3W4KA 4LWZA 3RJTA 4DR3B 3LNTA 2ZCVA 1IXZA 2KLBA 1QV9A 1FTWA 1DEOA 1Y1RA 4LXHA 4N40A 3WRXA 1IWPB 2P27A 4FXOA 2UUBB 3TBKA 3A06A 3ROQA 1ZWLA 5JC8A 2J9YB 5JC1A 2NZXA 2O20A 3N8GA 4QREA 2X0DA 1ESCA 3W90A 4PIPA 1WXFA 4FYXA 2QRNA 1YDHA 4LC0A 1P7ZA 5HKKA 3LWDA 4F9FA 2UXDB 1SD2A 3CB2A 1MQAA 4YA6A 5DKFA 5JARA 2XUAA 3F8TA 5LYJA 1QGYA 5KYNA 1HDIA 3L6UA 1VG0B 4WXEA 1ZS9A 4HF7A 1JDJA 2OSBA 4UNIA 4BWVA 2FMKA 2QX7A 2D0DA 1P1KA 3BJZA 3GVHA 3UPTA 2FN9A 3TE6A 4HNQA 2WAXA 5CT6A 3DOJA 1D9ZA 1ZSYA 2EZTA 3IFSA 4ESEA 4JC0A 1E9EA 5KQPA 1GPUA 5FD8A 1RQRA 4Z4IA 5BR1A 2V45A 5FBHA 1NASA 4UTXA 3SQNA 1J7KA 3OX4A 4I1RA 2XGJA 1W2GA 1WOMA 3Q72A 2AG8A 3QI7A 4H2DA 4I5IA 4KACA 1G60A 4U7FA 3BMOA 3GN1A 4P4TA 4P81A 2D00A 1SOMA 2IWHA 1S7GA 3KBOA 3U3ZA 3FJOA 3FFWA 3IQGX 1GFZA 1T3GA 2GO7A 4JB0A 2HQ1A 4TLMB 5JWHA 2FWPA 3CVWA 4WECA 1M8PA 1NNUA 2ET6A 3I0MA 1VXOA 1UKCA 2P75A 2B82A 1SUWA 5SY4A 2WB2A 4JYBA 5BMOA 4O2AF 2XF8A 2BMAA 1VCNA 3EDRA 2HCTA 2QR2A 1GTZA 3MNFA 4NI5A 4NG5A 3SR4A 5I45A 1VLHA 1GZ3A 4OLHA 2W6JD 1E1CB 1Z15A 2IS1A 2W2NA 2ZRDA 3DLAA 2IZZA 3LPLA 1ND5A 5ENDA 5TT1A 4RV5A 1EQ2A 5EEHA 2GEUA 1U5CA 2BF7A 3KOOA 3SC2A 4H08A 2AJLI 4MROA 4E14A 3KJZA 3UOWA 3R8XA 3MTEA 1THMA 2P9EA 4FQ5A 3E3OA 3GCDA 3ROGA 3SQXA 2V5AA 1GDHA 3FTPA 4FK8A 4M37A 3GLHA 5IC4A 1RCFA 2YZKA 2QD3A 5IKPA 2PT7A 2I2AA 1C0LA 1O96A 2H2HA 2CVPA 3G2OA 4K6CA 5A2QA 3A6JA 5H4HA 4PO3X 2WJAA 4CYMA 3HGTA 2JASA 4NV1A 1PV2A 1A9YA 3OIVA 4FSXA 4ND6A 5EA2A 4ED9A 3VR5H 1E8DA 4LRQA 3EXIA 2XODA 3ZJVA 2W8BA 1T9GR 1T3TA 4TLAA 3T5DA 6GPBA 1PL6A 1M9NA 1MR3F 4DPMA 1UC5B 3KE9A 4NZZA 4BKPA 2Q2NA 2QLLA 4U0KA 3P9PA 4UD6A 2DTEA 3BXGA 4R2XA 3WL8A 1TMOA 2XTMA 2VHTA 3ZVRA 1YVPA 2J30A 1XR3A 4ZYTA 5JNSA 1FE8A 4C5BA 4MR8B 3QIVA 2ZR8A 5D00A 2HZ7A 4FZ3A 2PANA 5AVJA 4DILA 1CRZA 5FV7A 3MTDA 2XIJA 4RF5A 4A6DA 2VCYA 3CUYA 3G17A 2OYRA 5JWRA 1XTIA 3DGEC 5BUCA 5HW0A 4DDMA 5D7NA 1J2YA 1RWKA 3LY8A 3MC1A 1ZISA 3KZNA 3W5IA 3FFBA 4XVQA 2J9GA 5EMMA 4CM9D 3CLTC 1U28C 3H0KA 2P4HX 2Z2YA 3IIIA 1VTKA 3VM6A 4OAPA 1HSOA 4WX2B 1K4MA 2WIBA 1Y8AA 4C76A 4AQYB 2ZPTX 1SQSA 3DMTA 2H29A 3QE2A 4HATA 5EE1A 2B4TO 3WGKA 2Q3LA 1L7BA 2VUUA 8LDHA 1L3CA 1TAHA 5BORA 4LJ8A 3STWA 4EJ6A 3I62A 1OWNA 3OF3A 4NZYA 3ZKWA 4A27A 4YAKA 5A5GA 4K2AA 4ACBA 1A71A 2H17A 2QMOA 2EATA 1Z83A 1KPHA 1NLUA 1KMCA 2PUTA 4WESB 1EFCA 1Z45A 4HUQA 3V00A 1BCRB 1I24A 2P6PA 3IH5A 3VX3A 5TS3A 4X7BA 4ER5A 2G8NA 2OXRA 4GXTA 4E0BA 1N3IA 1KI7A 4DUGD 5JS2A 2PBRA 4FJ0A 5C1BA 3CURA 4WGGA 1BKSB 1YCFA 1CS0B 2Q45A 3F97A 3HVUA 3T3IA 3D5EA 1O6BA 3RT7A 1KZ4A 4RETA 1AY0A 1GDDA 4JBYA 5C5DA 2B35A 1RADA 3H1BA 4KLRA 4RIFA 1GRNA 4BFZA 4A15A 5J43A 2R7AA 3JWHA 2SKEA 4D4MA 4ZAGA 3R6DA 3GRPA 2GLUA 4RADA 3GCGA 1MIOB 3I45A 1BX1A 3BEOA 2A9JA 2ZBEA 3GYBA 5CPBA 4G0MA 4XTCS 2BFDA 2YOGA 5AI6A 4DF3A 2Y1FA 2RKBA 4OHOA 1U3FA 4JOQA 1PFYA 4F71A 1OT3A 2FETA 5REQA 1JUDA 3NG1A 3FWYA 4K1LA 4RM2A 2J3EA 1I30A 3R24A 4FJ2A 2D7DA 1GG9A 1UCFA 3U0VA 5IS2A 3W7BA 3LT2A 4MAAA 2VJAA 4CKEB 3DE1X 2DUWA 1M2GA 2RCNA 4CMJA 1K6MA 1J9GA 3MXOA 2N46A 1QWOA 3PQ4A 4UEKA 1EESA 4YN3A 4ARZA 4DEXA 4AY6A 4D3ZA 2HHJA 2X6QA 4CLRB 4F85A 4HEA6 2PRYA 1CEYA 2YBEA 1ODKA 4IL5A 4BUZA 1MAWA 2P2NA 3D31A 4O3FA 5CA0F 1W4LA 2YZ2A 4GMDA 2FSGA 1U3UA 3L0YA 3QKRA 1GTSA 1JDPA 4DMCA 3O4FA 4K2HA 4GMKA 1G8JA 4HH3C 3ST7A 5KTOA 1JHQA 3DLHA 1UBGA 3FNRA 2P5TB 5K1ZA 4RJIA 3ZV7A 4BNXA 2ZSEA 1HNXB 1BD3A 1Z6TA 1F8UA 4TYWA 4IJKA 1NY5A 2DT8A 3SJ7A 3U4AA 3OOJA 1DAGA 3GIWA 3EY4A 1XZPA 4F2GA 3H6GA 4P3KA 1MTZA 3QXXA 3EZ6A 2H7YA 3FB1A 2QQGA 3PFBA 3PX3A 3OPYI 4EENA 2F9FA 2O2ZA 1UPFA 3EVEA 4M1YA 2JCBA 5A62A 4RKRA 1Q5PA 3MUEA 1KZHA 2ORED 1U0GA 2D13A 3LYLA 2VKTA 1YK1A 1QYXA 1LPOA 1ZITA 2XDYA 1ORIA 2FH5B 3DULA 3IC5A 1FFCA 1W85B 2BTOA 1REQA 2DFTA 3FYHA 4EGQA 1UDRA 4Y6SA 4PYOA 4Q3DA 2WT9A 2SHKA 5AJXA 3KAJA 3RJMA 2ZT6A 5ALJA 1KYTA 2Q4BA 3UUFA 2XNCA 3N86A 2J6CA 1GZ5A 2AOWA 3EC1A 4MVWA 3SXUB 4XWAA 1IJEA 1DIAA 1ULZA 2AE2A 2YINC 4R3UC 2EW1A 5DBEX 1OGJA 1YRLA 4Y2QA 4JDPA 5CBPA 5ADUS 1QU3A 4XOUA 1IY8A 3OOEA 4FMDB 4B1FA 4G1UC 1RQ7A 5FPPA 2IGTA 2YXNA 2FQ1A 4YAOA 3O3OB 1QANA 1XVVA 3C0KA 1QG2A 3WWEA 3A6FA 2R48A 3L1IA 4LF6B 2AFIA 1EFTA 3M4ZA 1ULAA 1I5RA 1KVUA 1RHMA 1C5KA 4G0YA 1R8JA 2YMPA 1OFHA 3EMDA 3LQ1A 3TK1A 2VT6A 2B8TA 3VI4B 2RBEA 3HZHA 4OK6A 3ZCUA 2HJRA 4LZZA 5LL6P 3MAGA 3EH2A 3UB3A 5M04A 5AKXA 5GONB 3FY4A 3FSRA 5H3HA 2AZ4A 5H81A 2WD7B 4I4TA 5EIOA 4OI4A 5TNXA 1G66A 3SE7A 3T9CA 1QUEA 1HQDA 5LUAA 5FI0B 1SG6A 2D2XA 4P31A 3WB1A 3JD2A 1AD2A 4W7SA 2XE6A 1CP2A 2Q4DA 1P1JA 3UCFA 1AGYA 4R1QA 5H02A 4QDZA 5A0TA 5JPCA 3ILXA 4R0VA 5KWSA 2IP1A 1T0BA 5JS1A 2EYQA 3NVAA 4JU8A 2WB4A 4CL8A 1CTQA 5TB5A 3AKYA 1KEWA 1GQYA 2C94A 3BDAA 4BV9A 2P4SA 3T3NA 2IPMA 1OMOA 4WH0A 3I2GA 3PIDA 1R4NA 4HB3A 2CDNA 2J7PA 1PJLA 4ZT2A 4YP7A 4N9QA 3E5RA 2AOTB 5AKKA 4B7XA 3OZFA 3RBXA 1NOKA 1T4MA 1L4EA 3K0CA 3CN9A 5K6TA 4JV5B 1JDVA 1Y7IA 4JJ6A 2ZIGA 3EHDA 4O8ZA 4KW7A 2G07A 2TMKA 3ITNA 1E3DA 1W0JD 1XTSA 2GEFA 1GUDA 1MUUA 3CKKA 3KV3O 2HWXA 1HTTA 1AHPA 3VU9B 2HPAA 3GLRA 1I3NA 3RTBA 4Q9AA 1PGPA 1TJ4A 1J0BA 4POOA 4N76A 4GECA 4A8JB 1NJFA 3WGMA 4DG8A 1AC5A 1MV8A 1D0SA 1VRVA 3CBGA 3FDIA 3NRJA 1SUPA 4ALIA 3H2ZA 4D9EA 1L7VC 3F5QA 1PP4A 5CH8A 5K7SA 2Y1OA 3GLQA 1PT8A 4DY4A 2UZ0A 4YCCA 3CLRC 5T8KC 2GTPA 4XFKA 2YJZA 3S2SA 4LBYA 1DLJA 3WBKA 2P77A 1JMYA 4CF7A 3P2YA 3PNLA 2OMKA 1NFRA 4KQHA 4D9HA 4R8VA 1NXQA 2DUMA 3O9VA 1XFAA 5C8DA 2W42A 4ZDIA 1NIJA 3L9WA 1U7WA 3IVXA 1SZPA 4L08A 2PBZA 3RVDA 3KKLA 1PD0A 2CXTA 4BP3A 4F6RA 1HDOA 3UPUA 3PITA 1A8IA 2VF5X 4GX5A 6ADHA 4DV0B 1V71A 3C3XA 4DREA 2FZLA 1YIOA 2A67A 1L1RA 1Y9EA 2XNDA 5E1MA 1GG5A 2Q2QA 4L8GA 3ND7A 3NIWA 1FOEB 4ZCPA 2PSJA 5A3SA 5C1DA 4MAMA 2IHBA 1CNFA 1QV6A 2WSMA 5E9WA 4E22A 1QRSA 1IPHA 1CF4A 1YE3A 1XAGA 1WSBA 3M70A 4PLHA 4QPNA 3OJOA 3U56A 4OM8A 3EPPA 2VHEA 1WNFA 3CX8A 3O6VA 4RHCA 4MGIR 1JQKA 5LZ9A 2XXAB 2EFYA 4J0EA 4X94A 3HSYA 5A6VA 2EG9A 1RM5A 2QUJA 3QVSA 4TRNA 2Y68A 5AK6A 3OECA 5DDIP 5E7MA 4YJGA 3HJFA 4QYSA 3HY4A 1F2DA 1O6CA 2ONYA 4HCJA 2VDMB 3V7NA 1OLXA 1DXYA 2EX0A 4X6UA 1CP3A 2XDWA 2I2CA 3FHLA 3KUDA 4Q1DA 3RVKA 4WZAB 2YL2A 2AVNA 3FMVA 1S4MA 3IXQA 1Q2XA 4AY3A 1XJQA 3KPJA 4K28A 4MQEB 4N6NA 3F67A 3KT0A 3FB4A 4WXHA 3IEMA 1T36A 4GBMA 4BDSA 4UJ3A 3JQAA 1BRMA 2Z2ZA 4XWTA 1X3SA 1SKBA 1T9CA 2Z5GA 1XO1A 5ADWA 3V8MA 2QX9A 5AVVA 1QLHA 2Z4RA 2D1RA 1SBYA 1V45E 2Q3FA 3EIOA 3FCXA 5CW1A 3E61A 1XZEA 5LB2A 1V9LA 2O3UA 3ZCQA 2XMQA 2C77A 4OHXA 1DIRA 1ZJZA 4M9QA 4OXIA 1XLUA 4BE9A 1UBFA 1FRQA 4DDWA 1WMSA 5TPZD 2CZGA 2XVAA 1PR3A 4LV5B 1ZH4A 1CU1A 4M9ZA 3RABA 4LE2A 3TNLA 1CWUA 3EXHB 2FY8A 3OTHA 5JDCC 4NU8X 5B12A 1KGDA 3BQMB 1OIXA 2CNLA 1U1DA 2GVDC 2X7HA 3GVXA 2X4LA 1KH1A 4YP0A 5FQNA 1VHDA 3BYZA 4TM8A 2FPOA 2W22A 5L8VA 2V6BA 3KT6A 2EP8A 5L7TA 1Q1GA 2W6ID 3LD9A 3GLIE 2B83A 4MVYA 4OYYA 3D2AA 3WNZA 3BJIC 3M5PA 4RANA 4W63A 4MJXA 1UBJS 3K8OE 4JX9A 2VUSA 4N7RA 4UBIA 1ZWKA 1NQ5A 4EG8A 1B0UA 3AGQA 4K05A 3V8QA 2R8RA 4UCWA 3VR2D 2X2FA 3ZH2A 2OKCA 3OTWA 5HVNA 3ZDDA 3T8YA 3ZU4A 4H1WA 2FG6C 1Z0KA 2Q9UA 2W6CX 4ND1A 2WUGA 1R9NA 4JYPA 3T9EA 3WB9A 1U0LA 3SQWA 2BFWA 4PNZA 5EXDA 4C9BA 4YJHB 5M2QA 2JFNA 4L2IB 2XYVA 3KC2A 1XRQA 2VJMB 2X77A 2D8MA 2W8ZA 1S2NA 1MB2A 4IGFA 1SU8A 4WN3A 4YLYA 3B9PA 1EZ4A 3DE6X 3HN2A 5IVPA 1NTOA 4RZ3A 3Q15C 2ZYAA 3KSDO 4BL5A 1IK4A 1I9GA 3X1XA 3MQ2A 2FOXA 4UZSA 3PP8A 4UHHA 5CVEA 3PV0A 3AUTA 3OCYA 1VKRA 4RXTA 2N1BA 3WOVA 5KHAA 5J5VA 4JI6B 3S2UA 5DSTA 2NU7B 4YCMA 1KJNA 3NW9A 1RP7A 2YASA 1X70A 3II6X 3QVGB 4X41A 1R6BX 2VJCA 1FFBA 2DULA 3I09A 4RU1A 5FHQA 5KDDA 2W6PA 1ZVQA 3X1YA 1UAGA 1CJSA 3GGGA 4YNBA 4A2QA 2Q3CA 2V7GA 1B41A 3HA2A 3WLEA 2VP0A 4ICIA 4H7JA 1WXXA 5BPHA 3D7MA 3C6ZA 3QLJA 1OW3B 1NQOA 1SBIA 1JTFA 1X8XA 3WZMA 3EYWA 4Q66C 3U4HA 4E6EA 3GGDA 2I6UA 3GCZA 1WMEA 2HSZA 4F21A 4NBSA 1GTG1 3OP4A 5FWYA 4Q9JA 1XTVA 1KRHA 1TM4E 1HT3A 3UA3A 1RQNA 4B84A 4OGWA 1TDJA 2PGIA 3EWSA 4ZCRA 3M6LA 4YIHA 1JJ7A 5FFNA 4LGVA 1D2MA 1HDCA 4W1RA 2P4UA 4X24A 5D87A 1J0EA 3S6JA 4E15A 3GB9A 1KEEB 3SS7X 4OLAA 2XB6A 1PJ2A 3E3MA 1ZBDA 3F9IA 3P9RA 4NRDA 4RPKA 3W77A 4LMAA 5JNLA 2PRJA 4P7FA 3EGWA 4JI5B 2F67A 3MWKA 4ZV9A 3K0HA 2IQIA 3AESB 4RO0A 3NATA 4Q4HB 1XYVA 2JEYA 3AYXB 1GFSA 5LP6B 1DAFA 4M55A 2R44A 3KOUA 2VQDA 4OQEA 1UQUA 3MGAA 1R50A 4MPPA 3UCEA 1YMUA 3ANNA 5E6UB 3DBHB 3O31A 3ZGNA 4YJFB 1CD5A 3DKIA 1Y5IA 2NADA 3SD7A 5JXWA 1PQ4A 2PFGA 1AZWA 1P81A 2W4MA 3DBVO 4PPGA 4D99A 2QU8A 2XIQA 3EHEA 3KXIA 4H3SA 4QASA 3R7WB 3VNRA 3EX7C 4U9HS 4TVSA 4NDZA 1P2TA 5AD1A 1G1MA 3REOA 1YQUA 3PDIB 3R6TA 2X1LA 3EC7A 5ES4B 1JHPA 2I1LA 2H4HA 3ILYA 3OWXA 3ZX5A 4CTMA 4NCIA 5J5AA 1IZ8A 3I04A 3ORFA 1NSTA 5KYUA 4ZGWA 5CLIA 3NM4A 4MW9A 5AI0A 1YB4A 4LJ7A 4IIJF 1WSAA 3R5SA 2OESA 4DSTA 3BX1A 3L8EA 3MTJA 4G07A 1LQ2A 1U5AA 1AGXA 3SOPA 3SHTA 4JAVC 4MVJA 1VHJA 2FZGA 3B82A 3O1JC 1S01A 3S2FA 2IOHA 2QL7A 3C8MA 3BXEA 5ERGB 3RRXA 1F2VA 4JNKA 2ZCUA 1VBKA 2R6HA 2Y3IA 4U6QA 3LX4A 4A73A 5A3QA 1I7SB 1RMTA 1CY1A 2Z2JA 5F64A 3G5MA 2HTEA 3HU3A 5TEVA 3T1TA 5J2TB 4QOHA 3H2JA 4ZIRA 3RRYA 2RK6A 1OLUB 1ESNA 2B2NA 2IL1A 3KJIA 3OT1A 4Q01A 2N0SA 1WUJS 5ERXA 1GWNA 2AIRA 5KCMA 3RUEA 3ZHXA 4GQIA 1RZRD 3A6KA 4CLDA 4MYDA 1BWQA 4IDQA 4J7XA 5F7XA 3WLPA 3B3JA 4DB4A 3C41J 2GHTA 5K3FB 1A5ZA 1Y3IA 4CI0B 3LKDA 1MC8A 2EKZA 4HDMA 4EBBA 1XP8A 3IP9A 5GIPE 1LLDA 3LCUA 3LC7O 4P83A 4R1UA 2YIJA 4TL7A 2HF8A 4X1YB 1RCUA 1U1IA 1MQ9A 1H2WA 3TQIA 3OIFA 3JQ9C 3GAZA 3GPDG 3OQIA 4NE9A 4DJTA 1B00A 3E4CA 4FYKA 4ID9A 4J4TA 5T4BA 3CN7A 2LIVA 2O7SA 3SF8B 1KDVA 1QZXA 2F9MA 4GVPA 1KZ1A 1Q22A 3M4YA 1YJAA 2Q5FA 1MPXA 4NBUA 4YAWA 5JQGA 4KN5A 4NABA 4TVKA 2O06A 4QOJA 4PSCA 2NSDA 3ZVMA 3OO1A 1Y4UA 4URUR 1Q20A 1ZP6A 3GH3A 4WBXC 1YCDA 1C3JA 3OZWA 4I1YA 1H93A 1WQ4A 1CR1A 2CNOA 3ZJYA 5KSWB 4DANA 1UFOA 5HGXA 1M5RA 1RJEA 1Z82A 2PU5A 4JKIA 2CHQA 3ZYZA 4P32A 4CMHA 3PXUA 2AC7A 4HX5A 1B74A 4FFSA 3P2EA 4B2YA 3QVKA 4QL3A 1DBQA 4NENA 3RO7A 2NXEA 5AR1A 5JEEA 3WV4A 3QW2A 2PMBA 1U3WA 1X0VA 4EY8A 5FPTA 2OPHA 1D5CA 3CJRA 3OJLA 4BWYA 4DT1A 3PRJA 4FE7A 5FWNA 2GZDA 1RFGE 221PA 4L1KA 5HFAA 2NU6B 1B1AA 1VM6A 4MK4A 4ZZIA 4O4JB 1TTQB 5KINB 1X15A 2DWCA 5FTJA 1IJBA 2J5RA 3B60A 1ST2A 4OYHA 5HKOA 1FP1D 2UYYA 2QLMA 4OHWA 1EU1A 4EGSA 3F6SA 1VMEA 4J0HA 3EULA 3HFGA 4U1RA 3GJ3A 3K16A 4EI2A 1CB7A 2Z1DA 1OI7A 1PNOA 2RC5A 1M8GA 2DMRA 2EGHA 2ZQ5A 3Q11A 3UMGA 4KVFA 4DRYA 1R8XA 1UJ5A 1YS9A 2M32A 3FDZB 4W1SA 4WN9B 2WWYA 2ZIXA 3W2FA 2Z6QA 4EF6A 3QNUA 2XMDA 1HZZC 1FRNA 2CZQA 1KY3A 1W59A 2V9CA 3EUAA 4TXNA 4N03A 4BX8A 5DK6A 1USGA 3AM5A 2M1ZA 2QWXA 4PC7A 2CT8A 4RA9B 2H0AA 1E6CA 4NNOA 4LBWA 1H4VB 4MX8A 1U4SA 2Z6VA 3VYUB 2WHXA 2H0RA 4DCPA 3GRCA 3I6BA 4I1SA 3WMRA 3Q2KA 2HCFA 2ZBPA 4DIEA 4ZCTA 2MINA 4RGYA 3OPMA 1ZM7A 5AKIA 1ZLXA 1XK7A 2ZRLA 3I04M 1W87A 1EKXA 1DAKA 3TN7A 4EH1A 3NHBA 5LPNA 1W46A 2HRCA 1Q1NA 1J2RA 1NQAO 1SU4A 1Y3HA 3BH7A 3BN3A 4MAFA 4QWMA 3L8CA 5DYYA 1H5NA 1TEVA 4AO6A 3WP0A 5HZGA 3GBPA 1DEAA 4DSOA 5BWCA 3JRNA 5C31A 2Z58A 2ZU6A 1MX9A 4MVJM 4GICA 2X2OA 3NJ4A 4PQGA 4UUQA 4TUYF 5HS6A 3ZY2A 1GUBA 2O1XA 4WOJA 4CZ2A 3PEFA 2G3YA 4MMXB 1KAEA 1TJNA 3VUEA 3HK2A 4HDAA 1A8UA 3U16A 1CFZA 2J87A 4MZDA 3RROA 3QOWA 4BX3A 2R6JA 4C78A 5LXTA 2DH5A 4G5OA 4V2UA 3PFGA 2I87A 2NP6A 1WCV1 3G2IA 4DA6A 4B2IA 3ZZNA 2XZOA 2A5YB 2P9TA 4HNSA 4B6FA 4KU4A 2B2XA 4G0PA 1R2QA 1XHLA 2ZT7A 3C3EA 3GJ4A 4B6JA 2ZKLA 5TF0A 5IF3A 2HA6A 4ALJA 4MPTA 3WK6A 3ZE6A 5JT1A 1N9GB 3GLFA 3N0TA 2AKYA 3AF0A 3R41A 1WXWA 4E7PA 3HLKA 2PVSA 1TADA 1EVZA 1U7ZA 2BE7A 2ZTHA 5HJEA 5IU6A 2A7QA 4E2ZA 1XQ6A 1KBZA 2QMEA 1B14A 1MA3A 1RVDA 2K2WA 4ZVLA 3ZGVA 4WNAB 2GJSA 2OENG 3GRVA 3CH7A 1FIUA 1GGJA 3E5MA 4XIGS 5DOVA 1X3LA 2XZPA 1G6Q1 3LW7A 4MARA 3IHLA 1XKTA 4TX1A 2I54A 5TVGA 2CC2A 5K8UA 4O4HA 4S1NA 1VE3A 4MKRA 2EGUA 3H3XA 4B7UA 3MWJA 1ZNWA 3ENVA 1TVKA 1QCDA 3O0TA 4G24A 2O57A 3LQYA 4LJ5A 4PXSA 4MV4A 4JBNA 4UNPA 4MQ6A 1XXLA 1SPBS 2OBXA 2A5LA 5FFFA 3T5MA 1QFXA 1EWRA 1QQ7A 3ECAA 2PTGA 3HVRA 2VFAA 2ZUCA 5TQ2A 1E3IA 1P9WA 1ZN7A 2Z30A 4F8EA 3DMNA 3Q3GE 4ZVPA 3ZY3A 1N7GA 3IR5A 4LF9B 1VYTA 2CL6X 2LKCA 3N3BC 5AVWA 3TD9A 2HJHA 2HSDA 4CM9A 3U81A 3PNBA 2VP3A 5LR6A 5L3QA 4NCHA 1Q12A 2BHTA 2PO5A 5EQTA 3NT5A 3WGJA 5C7LO 1T8SA 1ZCFA 2HMYB 3QLTA 1U7HA 4S1PA 1KMQA 1MP0A 2IHKA 1U0EA 4ND5A 2QD1A 1IG0A 4R6WA 3I9V1 3IS3A 5DEIA 3PGLA 5HF6A 1P0PA 2A30A 4JUDX 4UXJA 1SZJG 1FP4A 4DZTA 2WABA 3FPKA 1KXZA 4Z0HO 2GAJA 4V39A 4DRXB 2BZGA 2GN4A 5LWQA 1UKVY 3D4IA 1TE2A 1YFKA 2IBMA 3ZDRA 2VYQA 2BGMA 4X6LA 3WGUA 1KWGA 3GZJA 2F1OA 5ES3A 4QAQA 3VR3A 4R7GA 4V0KA 4I1PA 1CQJA 1WMDA 3QELA 3H5RA 2V54A 2ZAOA 4U2FA 4HH4A 3GEPA 3DZGA 4CIVA 4XZ3A 5B1IA 4CR6A 3MJEA 1QNLA 1FDTA 1L0BA 2ZRHA 5HYVA 2H9IA 5AOAA 2GILA 1BQ3A 1GN9A 2VJDA 3CVXA 2YZNA 2Q6OA 4G0XA 5EEGA 4DSZA 4CL0A 1BVYF 1AO3A 4JP2A 4BLOA 2ICAA 4ZYUA 2WV9A 1AO0A 1TAUA 4WDQA 1M8FA 5HF9A 4IV5A 5JBNA 3L5KA 4HT3B 1F17A 1ZI8A 3OA0A 3R8CA 1AS3A 1H9AA 4B5KA 4UUAA 5FH9A 2AWOA 1PN3A 4CDMA 2E6KA 3WMGA 2AG5A 2PJUA 3TSAA 4ZAZA 2Q07A 4IDHA 2QVYX 2DFVA 3JQCA 3IT2A 4QUIA 3GLHE 1TJPB 4KR0A 3BK1A 5DTRA 1UWCA 4J1TA 2YRXA 1JHAA 1A69A 1TIBA 3PFNA 4RWZA 2WHEA 4I46A 3FUUA 4P7GA 2ATCA 1P77A 4XFJA 3UQYS 3JS5A 4OP3A 2WIDA 1XF1A 4KYVA 5L4LA 2GPBA 2JAHA 3WLRA 4QBHA 5EWMB 1QP7A 3V4VB 2IEAA 4JCCA 4PINA 4X9XA 1NVDA 3K1ZA 4DGSA 4LHWA 1GNQA 3EIWA 3HFJA 4AYXA 4F3KA 3N75A 3ECSA 3OQOA 1VIDA 1L9KA 2YX1A 1XCMA 3CRQA 4YAJA 4WHMA 3R75A 3T7CA 1L5RA 4JVOA 1NY6A 1K5GA 4TOIA 5ALPA 3O74A 1NPYA 1T6YA 1DU4A 4UHEA 1E61A 4H1TA 2G0NA 3TQSA 3UHPA 3OIDA 2AD1A 1JQ5A 5HBRA 1PWXA 4NCXA 2J9ZB 2C4TA 3OAAA 4D8VA 2CLMB 4TVBA 3MWEA 3UXHA 1SKMA 1Z73A 4MO9A 1JMKC 4C29A 1Q83A 3RRBA 1VLZA 3OZBA 3C48A 1YRYE 5ALWA 5DSZA 2JHAA 4CVNA 1QGED 3BGVA 1QMGA 4FFBB 4BNDA 3AFOA 1V95A 2Q5IA 3EGIA 2HQBA 4YJDA 3N8HA 5TMBA 1Q7CA 3AF4A 1ZO8A 1ZGCA 1QGUA 1EM8B 3D5TA 4Z0TA 3MQFA 2A7XA 4ZEXA 2WM2A 4WV3A 4DHWA 1PVVA 1XZIA 3H1FA 1A7JA 3A1FA 3PPIA 3PQEA 4QJ5A 1WHSB 4D57A 3QVUA 4HUJA 4UC0A 4ZN6A 1T25A 4CMEA 1ES9A 3PWZA 2JGMA 4J07A 2QM3A 5HJ2A 4LZPA 3ETGA 5BR8B 4P7BA 2E0IA 2GPSA 3WKCA 3L8MA 5TF4A 3U6BA 1C1XB 4LRSB 4Y6LA 1EB8A 4M0MA 2Q0QA 4MKIA 4B3XA 4UBLA 1G7RA 3O03A 4UATA 4ZT6A 1KARA 3IBGA 4UDYX 3U4QA 3STXA 3IKLA 3QE0A 1HX7A 4ASUD 1V11B 1BE0A 1GV0A 1AB5A 1RPTA 4Z9FA 1ZR2A 2ZI5A 4C89A 3MYRA 2OBYA 5BW6B 3K70B 1W5TA 2HXGA 4HQ6A 4LJAA 2QTZA 3BFJA 1VRWA 1YQTA 1HQYE 2PWBA 4PPNA 4TKLA 5FWDA 4Q9LA 4FZVA 2XCLA 1KDRA 3A37A 1AQIA 4P93A 1KZ9A 4E3ZA 1OF1A 1TO6A 3VXKA 1N2XA 4FS3A 2C2OA 3OPNA 2IYRA 3F3MA 4HGRA 2MMGA 3LFTA 4PS0A 5CD9A 3DE4X 5KTMA 3F6PA 4G1FA 3PFFA 2E6UX 4A03A 3BKWA 1QP8A 3A9VA 3JYOA 4IDGA 1RPAA 2I66A 4JYCA 4ZC8A 3RS9A 4Y2JA 2FW9A 1RSZA 1W4AA 3KP1A 1AQUA 4NS1A 5HRAA 3RJZA 3I61A 4FHDA 9MHTA 1UJBA 3V2GA 4UHCA 5F9FA 4GE3A 3N2ZB 3O7WA 3CT6A 2I78A 3K0FB 3K0SA 3CONA 3HN6A 4N6GA 1J1IA 3SI7A 1UMBB 4L6CA 3KX2A 3PQ3A 2RHJA 5DOZA 1NP3A 3MJHA 1JPNA 2GSDA 2FPSA 1N4DA 3WGZA 2V9PA 3TEJA 4LVUA 1JQBA 1C0IA 1CUAA 3LP8A 3E7XA 1FVXA 2P2CA 3CKLA 3M34A 1ITZA 3DHYA 1U7DA 4Y1GA 1T0IA 1S2DA 3S1LA 3W8FA 5C1PA 4Z3DA 2ZRJA 4A0FA 1THGA 3TLJA 3IKVA 1HQCA 5HDQA 2BFBB 3STUA 1ZGZA 7MHTA 2VHVA 4LVNA 3UWSA 2YWHA 3WYDA 2YJ3A 3GARA 3PA6A 5EVCA 1ZINA 1H69A 2F48A 4ZYZA 3CZMA 5KJ6A 1QHFA 3DMHA 4YIKA 3I52A 4WZBB 4MEJA 2W70A 1PQPA 2UZ1B 1CSEE 3KQQA 2SKCA 2FUCA 2C3OA 3AQIA 1IXRC 4DNXA 1L5NA 2ZB3A 2E49A 2YUIA 4Z0PA 4ECAA 4N3AA 1JR3D 2G76A 4N9WA 3GAAA 3S28A 3P0JA 4GXQA 2WP8J 5DCUA 3FSGD 3TSOA 2EZ9A 2RFLA 2ZDQA 4RTLA 1GOTA 2JFVA 2R1VA 3KD2A 4DYVA 2VOEA 1ND6A 2HA7A 2MJLA 4OKIA 2O14A 4MR8A 3Q7SA 4RDIA 3IYLW 3PF8A 1ZXBA 4DY6A 5B4UA 2WJWA 1LLQA 1ZG3A 3Q88A 2NGRA 3KZOA 4I99A 1WUIS 1PIWA 3COYA 4MKGA 2EBFX 1ZC4A 4RCVA 4JUAA 3P9QA 4ZVKA 3VNBA 5E2BA 5ICCA 1THTA 2JH3A 1ZHHA 1W93A 2NYVA 5FI3A 4TGLA 3HU2A 4PONA 2A9OA 2EJBA 3QX7A 2P40A 1F7VA 2YH2A 2XZTA 3D0KA 4LNUB 3SYTA 3A9TA 2OT3B 3RUHA 2B69A 2LTAA 1CUCA 1D4AA 3QEMB 5LKRA 4LXIA 4G1MB 3WK8A 3KDSE 1NZJA 4IILA 4O63O 3ZWKA 1NURA 3BAFA 1I6KA 3ROXA 3NYIA 1ZIOA 3DBLA 2HXSA 3MT9A 1GM5A 2G0AA 3QXSA 4XRRA 3IPCA 3SEQA 3H8WA 3SDSA 3U0BA 2AFIE 1RTTA 3CF6R 3FUXA 5CB4F 4UCFA 2CMGA 4EG4A 4OXYA 1AN0A 1DHTA 1CR6A 4DCCA 1YS7A 3RB8A 1FVHA 1VE5A 2BC9A 2LR0A 4RF4A 2C3MA 4YYEA 4DSAA 4MB0A 5HCIA 4BUJA 4Z1MD 1JDBC 1G38A 2Q0SA 3KXDA 3LC1O 4K6FA 1ZNZA 4LJ6A 1ZVVA 1O9GA 1N6LA 1E69A 3F6EX 1WDWB 3INGA 3NDIA 3OEHD 1NDHA 2ZI9A 1IY0A 1XG5A 2A2ZA 2JI9A 1M0SA 2JBWA 4AT1A 2A9VA 3R0XA 1V0JA 4W82A 1MZVA 5FUYA 2P2YA 3AEQA 1VYHA 5TE9A 5JEDA 2O8FA 1I2BA 4BE4A 3GUUA 4IUBS 1X7ZB 4I2NA 1Z2OX 3G7NA 1LF0A 3HXTA 3EXFB 4C30A 4YAIA 2E5FA 4EJSA 3WDLA 4YS6A 4KMOA 5E6RB 3CGWA 1PZGA 3HY3A 4PNHA 1ZYUA 3AINA 1NBWB 5CA0B 4D8UA 2DU8A 1E9VA 2J6BA 4DC9A 3HKCB 1D2HA 2ACEA 1MIOA 5AICA 4GWLA 4LCJA 4LECA 3JVDA 2V8OA 2PMCA 5IT5A 5CCBA 5H3LA 1U7OA 5CFLA 1NNI1 3OIGA 3UB2A 4DNFA 1E3LA 1FYFA 2LXNA 1EXNA 1DAPA 5C52B 3D6MA 2W43A 2J5QA 3Q10A 5CA1F 2PUAA 5EP2A 4MW5A 5K6RA 1DC8A 3LIIA 5AXCA 3SC3A 3FDXA 1UINA 2C92A 4WTOA 1RYFA 5K0NA 5ULLA 5C8XA 3TH5A 2GCGA 4KO1S 4DMMA 2H11A 3D8RA 2PJZA 3CF2A 5CJPA 1HFWA 2ZAIA 4ZVOA 4BGIA 3PTZA 1IU9A 1Y7PA 4GYKA 1MCZA 3MS7A 4KQJA 4TWRA 2YXPX 3NNSA 3OFNA 3R5TA 5B2ZA 1KAGA 3OJCA 3THYA 3Q8XB 2TMYA 1HRKA 3LBHA 3SJUA 3BZUA 2R62A 3U49A 1GU1A 4YQZA 1NVFA 2V7EA 4E30A 3OPXA 1AXEA 1HMPA 3NDRA 1K8ZB 1RM4A 2FSIA 2OQVA 1Z2PX 1NF8A 1KC1A 1BXGA 2GCPA 4C87A 2AZDA 1KDTA 2CYCA 2OE2A 3H17A 1YZYA 4YDRA 3SICE 1TIKA 1XZAA 1G4UR 4DQVA 2Z6AA 1K63A 2X3UA 4ZCMA 3VR2A 1XCJA 2V4ZA 1Y9DA 4Q4JA 4MVCA 4BVHA 4BS9A 3PQ6A 4U5QA 4GI2A 5AI4A 2PG3A 2BEWB 3FPJA 4D43A 1Z17A 8OHMA 1IN5A 1IMOA 1OX6A 4FX2A 3ZJ4A 4Y9DA 1WOYA 4FFNA 4IYJA 3FKSA 4P92A 4DMLA 4WUVA 1KKUA 4MGKR 5IKEA 1T5IA 3OCJA 4LY3A 3D8BA 4M8KA 3LWBA 5LZ5A 4QDJA 4MYCA 1WSWA 2QMUA 3CFYA 3BDVA 5FNVB 1LWOA 3W9YA 4BAZA 2QQEA 4OI1A 1QIEA 1JJBA 1N0HA 3EUWA 2VTBA 1M2VB 5KYTA 2WV7A 1W4RA 1YUNA 4YONB 4I66A 3R74A 5K9ZA 2RH5A 4E13A 4EW3A 1H3EA 3U37A 5DX1A 3BFXA 3ESQA 5A05A 4XYEA 4AU1A 2RH9B 3JD1A 1PR0A 2YQ4A 3ZIUA 2GCEA 3CINA 2J9XB 3GJ0A 4JLUA 4NZNA 1CE8B 3MLBA 5F5XA 2FW8A 3E82A 3QFHA 1V6AA 3QKWA 4XSVA 3S2YA 3WL4A 3DW1X 3LCJA 3O9ZA 4FSDA 4OIMA 5KQMA 4QWWA 2NXCA 3HYCA 4FFWA 4XB1A 1DAIA 1P0QA 2EEPA 1GSOA 3EZ7A 3H05A 3DMGA 4DCSA 4NP6A 5BN3A 3OH8A 1X87A 1JPVA 2RMKA 3U09A 1XMIA 1GPDG 1W52X 2Z8YA 4EG5A 4GI7A 3WP1B 1EBBA 1Z0JA 4EPRA 5K3EA 4JLNA 1WHTA 3D8UA 4MI3A 3GA5A 2Z4SA 3G2QA 2MSDB 3NX4A 1NUAA 3N0RA 1AT1A 1KDOA 4L73A 3BXHA 1VLMA 4CODB 5MFZA 2C5SA 1I10A 1U8FO 4ZVSA 4CF3A 3BH0A 2GNAA 3Q9UA 1Z12A 3WK9A 1ODLA 1RYDA 1U5BA 2P4QA 3L49A 3MG9A 4QSMA 2AOXA 4F93B 4PXYA 3GNLA 3QX9A 4JHXA 3OT5A 2QT0A 2QN9A 2XGSA 3TRFA 1MX1A 5JYDA 2H8GA 1JILA 3D3WB 3HC7A 4PGHA 5EIHA 5TX7A 3UH0A 4KQKA 4EUEA 2Q21A 1YO6A 1ZN8A 3EG9B 4HAIA 1AQ6A 1XD2B 1FW8A 3U44B 1QRRA 4XCQA 5AK3A 4G8BA 1EEHA 1W4BA 4MIYA 4ZI5A 4YALA 4BNZA 3C5VA 3OOSA 4UOQA 4XYMA 1IZ9A 1SXQA 2AOTA 2YVAA 1G3QA 3L8DA 2AI2A 3HCCA 5JSFA 2E18A 3H1GA 1MO6A 4MS4B 4EB8A 2YVQA 1HDXA 3OQHA 4M99A 4TWJA 5D51S 5C3UA 2O8EB 5FNZA 3GV0A 4QEZA 2OQRA 1EGMB 2WYWA 3DO6A 3ZGZA 1H0KA 1LSOA 3BIOA 1WEKA 2F64A 3RS5A 5LQRA 3P9CA 1MJNA 5LBUA 4I6JA 4MB2A 1QVRA 2BHRA 2FEMA 2FZKA 1NVBA 2Z95A 1SOVA 2UYQA 3KAPA 4PC2A 4RD2A 2PKEA 5ESDA 1SVSA 5DZSA 1IOZA 3Q7IA 3DBOB 1IHYA 4BIIA 1GQOA 4BE7B 4FE4A 4AMZA 4P4SB 5JYCA 4LFBB 1UJ2A 5G4LA 3CMCO 5EGNA 1YE5A 1MENA 1OH8A 5I4KA 3GA7A 2YWDA 1MORA 3B1ZA 3E8XA 3OLVA 5CTAA 1P19A 2JLRA 2ZXEA 1D0IA 2WILA 3AIMA 1EK6A 3M9WA 5NLLA 1VP9A 1WU8A 4JGGA 4AJ1A 4BO2A 1IPEA 1C8BA 2X4DA 4GI3A 5HEKA 1YTLA 3QKIA 2JAPA 5AXDA 3G7UA 3N2KA 5FR2A 3R0IA 4HDOB 2DPHA 5F73A 4BQFA 1S8FA 2FRVA 2WHRA 2ZETA 3LUPA 2CYAA 4ARVA 1TCAA 4JL6A 3RWMB 1KJIA 1VG1A 1VYVA 4D25A 4OB6A 1OBFO 4M21A 1TJYA 4MGHA 3TPFA 1GKLA 1JTVA 1KR5A 1LK5A 3LAWA 5TGDA 1R0LA 4O4IA 2JZNA 2ACWA 1K0UA 2EF0A 3FUTA 4JZKA 1OXSC 2ZRGA 1G19A 1PYOA 4M1OA 1BHQ1 2F1IA 5J40A 5C53B 2A1TR 3WIDA 1N5RA 4H7KA 3TDKA 2VWQA 5EXSA 1BXRB 1C3VA 1N0WA 4CMBA 4LJRA 5EPEA 3A4YA 3TM4A 4CKXA 1T8YA 1ISFA 2GZHA 2WSSD 1XTPA 4BQQA 4AQ7A 1E20A 3M82A 3W5BA 4TKUB 4B3FX 2GRJA 4Q4DA 2V4UA 3O83A 1VHWA 3HUFA 1E9FA 1QH8B 1FP6A 3AK4A 2TYSB 3VX4A 2E37A 4BX0A 1N77A 2NXNA 3MCTA 1TZ2A 1V6SA 2XB8A 1DAOA 1V47A 4XDHA 3VKHA 3BCHA 1RP1A 3SR0A 4E33A 1FZTA 2MSKA 1UT8A 4MXDA 4QT0A 4NATA 3ZHBA 5SZIA 1XPUA 1EVIA 3G0HA 2JFFA 4MCJA 4HY3A 3V80A 3G0OA 1LTHR 2FE4A 1P4GA 4K6MA 1Y6QA 2PZAA 4EHBA 3HKBA 5I7OA 3ANTA 2QHXA 2JLYA 1QQAA 1IL0A 4GI1A 2VAVA 3EXG2 4INOA 3ICEA 2OECA 2WEKA 5DN6A 4BGUA 3I9FA 1QIHA 4TWAA 3PCXA 3SYLA 3MOSA 2E4YA 4DV5B 2KWIA 3ZDEA 4J1NA 2KBFA 4YRKA 3CUVA 1YNOA 1C3OA 4NJMA 1UC4B 1TFUA 2DSNA 3FLAA 5IC5A 1G3MA 2ERYA 1DE0A 2PZEA 2PCLA 3V1KA 2Q0HA 3JARA 3CLSD 2O8DA 1E1QA 3GQBA 5KNBD 2ZJ3A 1TT5A 4HDSB 4UCQA 2DB3A 3ED1A 4PGAA 3T3HA 1KEKA 1QQ6A 4YJ3F 2BEUA 2ZBUA 3WFZA 2V7TA 3KE8A 1KI3A 1SVIA 2J48A 2Y6VA 3AR8A 4RFSA 3RRZA 2VK1A 2BFFA 3VZRA 4X66B 1E64A 3M2TA 1DMSA 4TZ0A 3NFYA 2QT9A 2XA2A 2ZTVA 2LW7A 3S27A 1T5LA 1ZNQO 4E5KA 4NNJA 4BFSA 2AF4C 1GKYA 2JFOA 2Q1UA 3RARA 3ULKA 2CL7X 2PFSA 1BS9A 2WHPA 3P2KA 4L95C 4I36A 4DR2B 2VDKB 1OFUX 5AW3A 2CCKA 3HPQA 4XYLA 2FEAA 2MYTA 5DYTA 2BF4A 2EL7A 1RTKA 3OCUA 3VKGA 3U9SA 4YAUA 1LDYA 3FW1A 1KFEB 4OJMX 3DPUA 3QM1A 2XYPA 1JHVA 4HD8A 2C03A 4QLOA 3VKVA 2QLJA 2I0FA 2OHFA 1CLUA 1D2GA 4FFPA 2ZSJA 5GV7A 1N57A 3JYNA 1ORRA 2DKFA 4L2IA 4K6HA 4RUKA 3BB4A 3W1EA 2OUKA 4LOKA 2H92A 4M1KA 1PFQA 3OLXA 4HR7A 4F11A 4ZPJA 2WU8A 1MOPA 5JAUA 1EDOA 1ZJ6A 1M5UA 3QFFA 4LS3A 5AJVB 3QG5A 3FOBA 2IIPA 3L46A 5L40A 4KH1A 4P8RA 4EYQA 4ND2A 1Y8QB 3IPLA 5F23A 2JA2A 3T1VA 4AK9A 1COWA 1M83A 3KLMX 4O2LA 2D62A 3I8OA 2D5CA 2HMAA 2PXCA 3REGA 2UYCA 2PS1A 1SK8A 4GS5A 1K7SN 2Q8QA 4JQSA 4Y9RA 2WF5A 1PTJA 1FVFA 2P7IA 4DR5B 2XA9A 4YREA 1TZKA 2C9DA 3AKCA 3R0QA 4INJA 4JS0A 5F78A 2B4RO 3SSMA 4KYUA 4RZXA 1H2AS 2SBTA 3DKVA 1A8SA 1ML3A 2C0PA 3O82A 3R0JA 1QCYA 5F1YA 3UV6A 3LA6A 3QBJA 2BSAA