4FLMA

S-formylglutathione hydrolase w197i variant containing copper
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
286
Chain Sequence
MKVVKEFSVCGGRLIKLSHNSNSTKTSMNVNIYLPKHYYAQDNKRIPTVFYLSGLTTPDNASEKAFWQFQADKYGFAIVFPDTSPRGGSWDFGQGAGFYLNATQEPYAQHYQMYDYIHKELPQTLDSHFNKNGDVKLDFLDNVAITGHMGGYGAICGYLKGYSGKRYKSCSAFAPIVNPSNVPIGQKAFKGYLGEEKAQWEAYDPCLLIKNIRHVGDDRILIHVGDSDPFLEEHLKPELLLEAVKATSWQDYVEIKKVHGFDHSYYFVSTFVPEHAEFHARNLGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords S-formylglutathione hydrolase
publication title A role for His-160 in peroxide inhibition of S. cerevisiae S-formylglutathione hydrolase: Evidence for an oxidation sensitive motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 88
structure length 286
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.1.2.12: S-formylglutathione hydrolase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4flmA00
3NWOA 4Y2PA 5ESRA 2EDCA 5AJHA 5A7GA 4Q05A 4G8DA 5FRDA 3GA7A 1QIDA 2DHCA 3I1IA 3AIKA 4UBMA 3CCCA 4AMZA 3O9MA 4WFKA 3VDXA 5HFNA 2BUAA 1LZLA 2ZYHA 3DOHA 1CUIA 5ISMA 3BL8A 5JATA 1E66A 5AKKA 1J2EA 1XZBA 2C5GA 4EY5A 5K3CA 4P9NA 3E3AA 3KOOA 1DT3A 3I1YA 3C45A 2BJHA 1QZ3A 4HXEB 3G9UA 4JEIA 5IVIA 1G66A 1DTEA 4CCWA 5ALIA 2XMSA 1H2YA 1WCYA 4GLBA 3SX4A 2HA4A 4X91A 3FOBA 2HA2A 3A6ZA 3PF9A 3DDUA 4E15A 3R3UA 1XRLA 2OCLA 1QIMA 2XUIA 2AXEA 4P93A 1VXOA 4J7AA 1DWOA 5CT6A 1CUVA 2JBWA 4K6KA 3DS8A 1G4HA 4EY7A 1EHYA 4BCCA 2G4LA 1MU0A 1MT3A 3FYUA 4IQ4A 4RE6A 5T4BA 1AQLA 1UKAA 4FLFA 2QUAA 4PW0A 1EK2A 1HLGA 1OILA 3K6KA 4GXNA 2XUAA 5LZ7A 3BXPA 3NUZA 1DX6A 2D5LA 3O4HA 1CUUA 1AC5A 3H1BA 3H19A 5ALZA 2HA5A 2WLSA 2QKYA 4H7KA 3IA2A 1QFSA 2BAGA 4GHWA 1VOTA 3AZPA 5T4EA 2WTMA 3WYNA 3PI6A 4CCYB 3VJMA 3WK6A 5HF5A 3PF8A 2CKMA 2XUGA 4FMPA 1ISPA 1FSSA 3FCYA 2HU7A 4Y2YA 5AKYA 1CUSA 2IITA 1ACJA 3ESAA 5E2IA 1FJ2A 3IB3A 1XQVA 4OB8A 1XZFA 1QGED 2BKLA 4ZI5A 1XZCA 2GBGA 3D59A 2NW6A 1J07A 3G7NA 3AZQA 3GFFA 2BGRA 4AX4A 3UMJA 3BIWA 1CUYA 2XUJA 3VJKA 4BP9A 3ESCA 5AKZA 3C5WP 2IX9A 3WL5A 1FFBA 1XLVA 4AZ0A 5JYCA 3B5EA 1BN6A 4FFWA 3QVMA 4B84A 4X85A 1CQWA 1WHTA 3D2CA 5JARA 1S8OA 1ZICA 2GYVA 4KE7A 1BCRA 1A8SA 1B6GA 2PKYX 5ALQA 3STWA 5AM0A 5JD6A 5CH3A 3LLCA 4JNCA 2J3DA 3HXKA 4BC1A 2XT0A 1LNSA 1GGVA 3H2KA 1XZHA 3AZOA 2XB6A 4H7EA 3C6BA 4ZV7A 4G9EA 1USWA 4B0OA 5IVKA 4AMYA 2RAUA 5CH5A 3IUMA 2JIDA 1XROA 4DGQA 2OAEA 3HI4A 3G8YA 1ETHA 5DYTA 2Y2UA 3FLAA 1R9MA 2B20A 4Y2QA 2WIGA 3UUFA 2C4HA 4HS9A 1MNQA 1XQWA 1E8DA 5JAOA 2QJWA 2OLEA 3V1MA 3O4IA 2RHWA 1YS2X 1XZDA 1SC9A 1A8QA 1MX1A 3IUQA 1ZI9A 1A88A 3AINA 1R50A 3A2NA 3F8SA 3AUKA 3PFCA 3QPCA 5D6OA 3BE8A 3ZV7A 2O7RA 2FX5A 4X3CA 1CUJA 4DM7A 5FPPA 2WJ6A 3PICA 1K5PA 3QITA 1LLFA 4H7HA 1P0MA 1T4MA 2OG1A 3WKAA 2PUJA 3SC2A 4ITVA 5EHXA 3DCNA 5LZ4A 3VVMA 1CUAA 1IZ8A 3PE6A 4EY4A 5T4HA 3WWPA 5AI5A 1DQYA 2XMCA 2CUTA 4NS4A 5ALEA 1ZIYA 1LPNA 3WI7A 3PDCA 3DL4A 3H18A 3C5VA 3WK9A 3FNBA 4WCVA 2OAGA 4MEBA 2RIPA 3O4JA 4X71A 3STTA 5HQ3A 1JJIA 2AJBA 2HA0A 4XJVA 4XWGA 2XQGA 3D2AA 3G0CA 2DR0A 3C6ZA 1AURA 4BVKA 1DQZA 3B3QA 1CUZA 3AIOA 3IUNA 4F60A 3K9BA 2XMQA 1BRTA 1EB9A 3FVTA 2HU5A 4J0CA 5E4TA 2Z3ZA 3WKEA 3T4UA 1BEZA 3G9XA 1EB8A 2GZRA 5CXUA 1L7AA 3QZUA 2VAVA 4ROTA 4BAUA 2XQIA 1YSCA 3HYSA 4U2EA 2CJPA 4KEAA 5D3KA 5AO9A 1P0QA 2RI6A 5EHNA 4J0JA 2XI4A 2OCGA 4YX9A 2H1IA 2P8SA 2C7BA 4MWTA 3RLIA 3VVLA 4CI9A 2UZ0A 2O2HA 4FOLA 2DHEA 4ZXFA 1E8MA 2Y2VA 1ZJ4A 3VXKA 4I4CA 1TCAA 2VQ6A 4HXFB 1K6EA 4ZREA 3IBTA 1UOOA 1K63A 4PSCA 4WDQA 1ORVA 3H17A 3PFBA 4HRXA 2BUBA 2H7CA 2DSNA 2C58A 4JH0A 1HBJA 4BE4A 5AM5A 1BCSA 2XLBA 4X6YA 4B85A 5DTIA 4HRYA 2Z3WA 2ROQA 3HSSA 5JD5A 5K3FA 3GZJA 3CN7A 2GYWA 4NMWA 3C43A 5BWCA 5A2GA 2PM8A 1UOQA 5HKAA 2PL5A 1EVQA 4X97A 3W2TA 2HRRA 3BDIA 3I2IA 4BCDA 4CG1A 2DQZA 1EH5A 3TEJA 3HACA 5AI6A 1SCKA 5EIEA 3BDVA 2HU8A 1TIBA 5FV4A 3WWDA 3WL8A 5K3EA 5JADA 3KXPA 5CW2A 2QXUA 4BVJA 1AKNA 1DX4A 4NVRA 4RNCA 4Y2UA 3G9TA 1MAAA 3M3DA 3YASA 1TK3A 1LPPA 4FTWA 2CBGA 2PSDA 3DKRA 4UBOA 4U2GA 2PX6A 4CIAA 3KDAA 1CUBA 4QA9A 1TCBA 4OU4A 1NU6A 4ARAA 4C4ZA 5FKJA 3I6YA 1GKKA 2AJCA 4ZGBA 4K5QA 3BWXA 4AO7A 3H1AA 1EDEA 4W9RA 3OG9A 4WY8A 1YCDA 2G5TA 2OCIA 3KSRA 5JAHA 1LBTA 1W6RA 4N8DA 2WIKA 5LKRA 1U2EA 1VZ3A 3H2HA 3ICWA 2ORYA 4LXHA 3IVMA 2WILA 1OCEA 3ZI7A 2XUKA 5C81A 2PSFA 4C87A 1IVYA 2GBCA 3OOSA 5HK8A 1MJ5A 3WKDA 1CUEA 3LIPA 1F6WA 3OPMA 1CUCA 3TJMA 1VZ2A 5CH8A 3R3YA 4K2AA 1LPSA 2ECFA 4ZRDA 1MTZA 3G9ZA 3L1JA 1XFDA 5A71A 3C6XA 2QM0A 4OB6A 3H2IA 2CZQA 1ZD3A 4G4IA 2XUOA 4X90A 1E8NA 4G4GA 5CMLA 3CCBA 2HDWA 1GPKA 4P92A 3DD5A 1QO9A 3FCXA 3A70A 4H7IA 2XQKA 4P08A 1JI3A 1CFJA 3O4GA 1U65A 2PUHA 2Y6UA 2Z5GA 4UFPA 4UHHA 3DOIA 1TQHA 3BF7A 3MGAA 1J1IA 2X8BA 4WFJA 1DWQA 3WK7A 1BU8A 5D7BA 2VEOA 3ED1A 1MNAA 4Q1VA 4YK7A 2XUDA 4TGLA 1HKHA 3RM3A 1ODCA 1LBSA 1XQXA 1E5TA 3JWEA 4KE9A 5AKHA 1MX5A 1RYYA 2XUQA 1LPOA 2QMQA 3HRHA 4MEAA 2VTVA 2XUHA 4UHCA 5ALHA 3HZOA 3L1HA 3RKSA 2HIHA 1TCCA 5AM2A 4QWWA 4YASA 2JGKA 4X92A 4INZA 2AJ8A 3ZWQA 5A7HA 2WTNA 2PU7A 2OQIA 4F0JA 2OPHA 5E4JA 4B83A 5AOBA 1WB4A 5I7UA 3I2HA 1DWPA 1UKCA 3JYHA 2QTBA 1W4LA 4K6GA 1AZWA 2GYUA 1W75A 5K3AA 3WZLA 5FOQA 2WHPB 4GEGA 1JMYA 4KAJA 5AIBA 1SCQA 1THTA 2XQJA 5AKEA 2OGZA 5DJ5A 1KEZA 4ZWNA 5H3HA 1HDEA 1DU4A 4LIPD 4QLOA 5ALGA 1UK9A 4X95A 1UK8A 4PO3X 4U2DA 3IIIA 4MQMA 4FLMA 1QOZA 4DNOA 1JFRA 4C4YA 5T4FA 4I3FA 3ICVA 1XZAA 3GELA 5EIHA 4DMHA 3D5EA 4QE3A 2C5FA 1M33A 1WPXA 5K3DA 1QO7A 5CT4A 3T52A 4UBNA 1G5FA 5AKIA 3V48A 3GBSA 2QZPA 4PF1A 4K6HA 5JANA 4KJXA 3STVA 4KAFA 5DNUA 2QT9A 3STYA 4GBGA 3WA7A 5J3JA 1CPYA 2IIVA 3I28A 1SFRA 5HF6A 2XUPA 2HFJA 1Y37A 1CV2A 2O2GA 1Y7HA 5K5EA 3V1NA 4QDXA 2E3JA 2DQYA 1GKLA 2CMFA 2XMDA 4B81A 5EI5A 3X3HA 4BB0A 4GECA 1UXOA 3QPAA 1E89A 3G0IA 4J0HA 4OYYA 5ALWA 2V98A 4NZZA 4Y2RA 2VA9A 5IKXA 2WUFA 1MO2A 2WIDA 4KE8A 2ZYRA 1O6FA 4BVLA 3I2JA 2Z8ZA 5FPQA 3DYVA 3AJAA 5LYYA 5F4ZA 2GBFA 1AMNA 1YS1X 4M0MA 5FXMA 5IVHA 1N5RA 3R3VA 6YASA 1GZ7A 2GBIA 1ODTC 3O9VA 4CFSA 3A2MA 5JALA 2W22A 1XKLA 4W1RA 3WK5A 2B4KA 1F8UA 3Q0TA 5D3ZA 4DMCA 1CUDA 4BZWA 4DMKA 1GQRA 5JZSA 3ZLTA 4J0KA 2XLCA 1JMKC 4WFIA 2ZYIA 1UK6A 5AOAA 1FFEA 1BEEA 5AH0A 3QMMA 3DQZA 5SYNA 1L7QA 4UHBA 1YA8A 4UHEA 4W1PA 1UWCA 4QNNA 2XDWA 1I6WA 5CXXA 5AK4A 2PVSA 1QFMA 3R40A 3HC7A 5C8VA 3LIIA 5KWJA 2PSEA 4BBZA 1D07A 3DYIA 2WG1A 4Y9SA 2V96A 1H23A 3E0XA 5FP0A 4DYHA 4UHFA 4B6GA 4BAGA 1LPMA 1CUXA 4BRSA 5ALLA 1X2EA 5DTJA 1OXMA 5EHQA 2XUFA 1VA5A 5CRIA 3GROA 2HA7A 2WHRA 4GW3A 1R3DA 4EA6A 4LYDA 2VT6A 1UFOA 2QS9A 1H2WA 2VJCA 3OM8A 4HVTA 3Q8WA 4J0GA 5ALYA 4UFNA 3ANSA 2B61A 5IVDA 4W1QA 4QWMA 3WWEA 1JJBA 2RHTA 4WJLA 4HTAA 3PUIA 1XRPA 2VJAA 3WLAA 4W1SA 5AK3A 4QDUA 5ALNA 3S2ZA 1ZI6A 5ALFA 1XZEA 3VJLA 1N5MA 1YAHA 4WY5A 2ZJFA 4BYMA 4IH1A 5HFAA 4OD0A 1PV1A 2WFZA 1KU6A 1L7RA 1BS9A 1U8EA 4FHZA 4X94A 1U4NA 1QIJA 4O08A 2YXPX 4C89A 4IHAA 1Q84A 3IURA 4G8CA 1UK7A 3IUJA 4FFVA 4IO0A 2RONA 4YPVA 1WB6A 1YB7A 2I3ZA 3KWJA 4Y2TA 4JUIA 3LS2A 2H9YA 5SYMA 1KU0A 4RPCA 2QXTA 3G02A 4X93A 1WB5A 2HM7A 2QUBA 4AN1A 3GUUA 1P0PA 1Z68A 2G63A 2WM2A 3RARA 3H2GA 1R9NA 1QIGA 1ZOIA 4KAAA 3WK4A 1QLWA 1XQYA 4L3WA 4CG2A 2DHDA 2XMGA 4Q3OA 1EDDA 3EQ7A 4MWSA 1GQSA 3C6YA 1SCIA 3STXA 5ALDA 2XMRA 4C4XA 3ESBA 1CIJA 1ZGCA 1VA4A 1IZ7A 5CBKA 1RP1A 1VE6A 2ZYSA 4DTCA 2WFLA 1XZLA 3C70A 5LIPA 5A6VA 5A62A 4IH9A 1GPLA 1YASA 1ZGBA 2WJ4A 3QM1A 2XMZA 5ALPA 2WU3A 2OGSA 4DIUA 4X6UA 4E11A 4M0FA 1QIFA 4RGYA 3C87A 3NOXA 2VJDA 2WKWA 4H7JA 4HAIA 3V1LA 4LKOA 3VKFA 4BE9A 1P0IA 1SOMA 3S8YA 3L1IA 1ACLA 1QIEA 4BDTA 2B9VA 3FBWA 1H2ZA 1ZIXA 4UHDA 3QPDA 2QR5A 1QIKA 1MPXA 3FLBA 4TPKA 4E46A 4KR0A 4B0PA 3FYUB 3E4DA 3DLTA 1T2NA 4MXDA 1MN6A 4DNFA 5HCUA 2PPLA 4C6HA 1XRQA 3ANTA 2JGJA 5JIBA 5LLSA 5BOVA 3HABA 3R41A 4PNZA 3EBLA 1WHSA 3D4LA 4KACA 2PBLA 5LZ5A 4Q3KA 1H22A 3KWFA 4BRZA 1EXWA 3M81A 4KRYA 1K8QA 1XLWA 1O6GA 1EVEA 5ALXA 4EUSA 1ZD2P 4PV7A 5AICA 1XLUA 2HHAA 1GXSA 3QMVA 3WWOA 3I2GA 1W76A 5AIAA 5LZ8A 1X2BA 4E14A 4MYSA 1XZGA 1JU4A 3O95A 1GT6A 1BN7A 4EBBA 2AJDA 2R8BA 5BV7A 1QONA 4H0CA 2CB9A 3OTQA 3AILA 4G4JA 1N8SA 4OYLA 2VF2A 3ZLUA 2WJ3A 2WG2A 3KD2A 4BTLA 2ES4A 1AX9A 3M82A 2WFMA 2EEPA 5A7FA 3G0BA 2YASA 1EA5A 2VJBA 3WMRA 4N8SA 5LZ9A 2HFKA 1PFQA 1XZJA 1HL7A 2R11A 1ZD4A 4CG3A 3RK4A 4BTVA 1CUGA 3WYDA 3WK8A 3V1KA 5HK9A 3G0GA 1LPAB 4D9JA 2O7VA 1UZAA 4EY8A 3H0CA 4OPMA 2W6CX 3WIBA 5ALMA 1UOPA 3AIMA 4C01A 2H7YA 5AM1A 1ZJ5A 3WZMA 1AGYA 1TKRA 1N1MA 4EHBA 1A8UA 5LKAA 4IH4A 4DNQA 3B12A 5DYYA 2DFPA 4M0EA 4AQDA 1VKHA 5AP9A 2ACKA 2I03A 2J4FA 2BCEA 7YASA 4Q3LA 4N8EA 4B82A 1K4YA 2I78A 3F67A 5AK5A 2BFNA 5C7YA 1B41A 4MQLA 4L72A 4N5HX 1EK1A 1RWQA 2WSLA 2BUCA 4AO6A 4DNPA 2WUGA 4QDOA 3EIOA 4Y2XA 5C8XA 1TRHA 5DLPA 4UPDA 2AJLI 1IUNA 3WL6A 1QE3A 3ZPXA 2ZJ7A 3D3NA 3TGLA 2GZSA 5KWIA 1YA4A 4QZVA 2J3QA 1YAJA 3F97A 5K3BA 4BATA 2JEYA 2WIFA 4RE5A 2PSHA 2ACEA 3E1GA 4Y2VA 2EDAA 2JEZA 1Q83A 5EIAA 1BE0A 5AI0A 4L0CA 1CRLA 4OCZA 3WWCA 1GPNA 2BGNA 3R0VA 5YASA 3QMWA 4WDRA 2WIJA 5ALKA 4AXBA 4G9GA 5HQ3B 3CN9A 1X70A 5EGNA 1XZMA 1XRNA 1CVLA 3W9UA 4UFOA 4FBMA 4DMFA 3ILSA 3IULA 3BIXA 4G8BA 2X76A 1YB6A 1UKBA 5DNVA 5DWDA 1AUOA 4Q34A 3WL7A 4BC0A 4CIBA 2VSQA 1WM1A 4S0XA 1Q0ZA 4LYEA 4AZ3A 5CT8A 1J06A 5CTAA 4EB0A 3H2JA 4EZIA 5ALTA 3W04A 2CEKA 3MUOA 4UBLA 2VAXA 1C7JA 3FVRA 1ZI8A 2YH2A 4H77A 5JAUA 3D2BA 1FFAA 4F21A 5ALVA 3K2IA 5AOCA 5AI9A 4FLEA 4HZGA 5FUMA 4LXGA 1JJFA 1EINA 1R4ZA 1QIIA 4FDMA 3HLKA 3MVEA 3N2ZB 4J3JA 3A2LA 1VE7A 4A5SA 1CLEA 4BAZA 3R3ZA 4B80A 2JGIA 2JF0A 3P2MA 5AHXA 4DSZA 5LZ2A 3LP5A 2ONCA 4ZV9A 2LIPA 1EX9A 2OXEA 5HKBA 1H2XA 4GI1A 3EQ9A 1DINA 3EF3A 2QRUA 1VJ5A 2ZSIA 1NU8A 3OURA 4KYVA 2J4CA 2HA6A 3W05A 3QYJA 4TVKA 4XX1A 3DL7A 5AI8A 5ALJA 4H18A 1MX9A 1F0PA 3BJRA 3BJMA 3EQ8A 4B7ZA 1TAHA 2HL6A 1CUHA 3WJ2A 3FSGA 2JGMA 5K3FB 1CUFA 4I19A 1FFDA 2WHPA 1DT5A 4BP8A 2FJ0A 5AI4A 2WFLB 4QDTA 2XMBA 2C0QA 4QLAA 3W06A 3N0TA 4LXIA 1THGA 2O2IA 3HEAA 5DYWA 4B9EA 5HF8A 4CCYA 2K2QB 1HQDA 1CR6A 5ALSA 4A16A 3V9AA 2DCMA 1QIHA 4U2CA 1Y7IA 4KRXA 4ETWA 4GWLA 4FNMA 4FKBA 1QJ4A 2I3DA 4QDZA 3STUA 4PQEA 5AKLA 4UBKA 1A7UA 5ALUA 4XIIA 5AM3A 1XZKA 5KBYA 1EDBA 1XRMA 3I6ZA 4BDSA 5FLKA 1LZKA 5I9IA 2YYSA 2QOEA 4PSUA 5AKXA 5KREA 2Z8XA 1QTIA 1LPBB 4Y2SA 4OUKX 1WOMA 5ALOA 1E3QA 3R3XA 4U2FA 4XVCA 4Y7DA 3SWWA 2RGUA 3FYTA 4Q82A 2VATA 2ZVDA 3BF8A 3M83A 3FWHA 4J03A 2XE4A 1IUOA 4DSAA 3U1TA 4AN0A 1C7IA 1XRRA 4HXGA 1CQZA 3ZLVA 3TRDA 1C4XA 5EFZA 5JD4A 3QBJA 3FSGD 2HADA 4QEKA 4W63A 2HA3A 4H7FA 2QJRA 2ZSHA 3DJYA 3CXUA 5HF9A 3DNMA 3SK0A 3FAKA 2V97A 4MJ3A 3F96A 1IMJA 4N5IX 1ORWA 4OB7A 2VT7A 4UUQA 5BWBA 2Y1KA 1NX9A 5FDFA 4PSDA 4GDMA 1CEXA 1PJAA 3WJ1A 4UBIA 3FLEA 3NGMA 2V9ZA 4H7DA 5AK6A 4J0IA 1CUWA 3FYUC 4G1FA 5IH7A 3JW8A 4FBLA 4H35A 2WHQA 4LHEA 3OC0A 1XKTA 4Z49A 1JKMA 3IDAA 1QTRA 1F0NA 1BROA 4AO8A 3I6MA 4G5XA 2Y6VA 4FWBA 3ESDA 2OCKA 2D0DA 1WPRA 3DKKA 3F9CA 4B9AA 3VISA 3W9BA 3G0DA 5JZBA 3I2KA 5CT5A 2OQVA 5CURA 1W52X 2X5XA 5DNWA 3H04A 4KE6A 3WIOA 2JGEA 1YR2A 2H7XA 4OSEA 3HJUA 1HPLA 2WU4A 5ALRA 2XQFA 4UBJA 2QVBA 1XZIA 3WKBA 4F5ZA 5LP1A 2ZJ6A 4FNGA 3D0KA 5JASA 3I2FA 1W1IA 1JT2A 3MUNA 4EY6A 3AFIA 2JGFA 4J0DA 4X6XA 3U0VA 3R3WA 5AKGA 3WQHA 4MYDA 1VLQA 1R88A 1G42A 5JZ9A 2FJPA 4JYPA 2JGLA 1IUPA 2PU5A 1JU3A 1ODSA 1UT6A 5JAPA 3WKCA 2WUEA 4X7BA 5CT9A 4U2BA 4BZZA 3QH4A 3D7RA 2OGTA 2WQZA 2Q0XA 3DEAA 1EI9A 4C88A 1R1DA 3WA6A 5EHZA 2WUDA 5AM4A 4DLNA 5I8PA 1VXRA 5HZGA 2PSJA 4L9AA 2WG0A 3F98A 1MAHA 5AKJA 5E4YA 4A23A 3PUHA 1LGYA 4BCBA 2HRQA 2G5PA 1Q0RA 4X00A 3UUEA 2FUKA 3C8HA 3O0DA 4AB1A 1ZD5A 4ARBA 3LCRA 1FFCA 4Y2JA 4JYMA 4OU5A 5C8ZA 3C8DA 2C0PA 4V2IA
chains in the Genus database with same CATH superfamily
4YJHB 3NWOA 3QKSB 5F4BA 3R7WA 2A4KA 3K30A 5ESRA 5BYBA 3IBCA 5GGYA 1OZ0A 5DBHX 5I01A 4UD2A 4R2XA 3GA7A 3R7FA 3UBMA 3ZJVA 1V1MA 3LNTA 3OWXA 5E1BA 4ZVTA 3P4UA 1TMGE 2FR8C 1BKYA 5EG5A 1J25A 3AIKA 1CDOA 1PQUA 4RKYA 5DBGA 3CCCA 3P9ZA 3GLFE 2I1WA 2CF5A 2LCQA 1DBQA 4D3DA 3WLLA 2AF3C 1DC4A 3G2IA 5K0FA 1EJ6A 1U3CA 2HDNB 1QFXA 2QP9X 3JXEA 3QPVA 5TQ0A 1ZR2A 3DC7A 4WESB 4C7KA 2W43A 4IIVA 2OVBA 4J0QA 4DL9A 2C2KA 5AKKA 1HEIA 4XKJA 5KYGA 2I3AA 1J2RA 3QEMB 4RIHA 4JKIA 4EY5A 4DHEA 4XTRA 4P9NA 5K3CA 5I4BA 1NNSA 3AO0B 2FP3A 1KE1A 1CSEE 1DT3A 1GNRA 1HT2E 5EGSA 2LXNA 4ZO7A 1ZESA 4I6GA 3G9UA 4JEIA 3WIEA 3UKJA 2NNWB 5BN1A 1U0LA 1Y8QA 3GFOA 1WQ3A 2FZWA 1NI4B 1L7VC 5IVIA 3SJZA 2VDRB 1BD4A 3EGWA 3KEGA 4Q7JB 5TIIA 4GZ6A 4QPJC 2OP1A 3THSA 3D7KA 1X9IA 1ZNYA 2REBA 3GT7A 1A27A 4M1QA 1WCYA 4GLBA 4FYHA 4MLCA 5AD1A 4KBFA 5DLYA 2J0UA 1LTQA 4NMMA 4R3UC 1ZUNB 4GMHA 1JFSA 1PBNA 1HOXA 2ZBPA 1W4BA 2CUKA 2FY8A 4LJ9A 3EFHA 1JH9A 3UJNA 4RTKA 2OBYA 3EFEA 3R3UA 4G0VA 4DCOA 2YHAA 4K2HA 1E2FA 3GK3A 1C2TA 2YJNA 4KNVA 4DJFC 2VK8A 2PTHA 3LHSA 1NM5A 3ESQA 3ETDA 4AUMA 1IOZA 3GQBA 4NJEB 2ZXUA 1G2QA 1QX4A 1DEHA 3DS8A 4MLZA 2XCOA 3HBMA 4HLDA 2IY7A 5DBIA 3ZHCA 1A9PA 1XU9A 3E3NA 1EHYA 1X7WA 2IHBA 2Y1CA 4OLFA 4EY7A 1ORIA 1O94D 3M4NA 2HZ7A 2R8XA 2GM3A 4XR4A 5D5HA 1U1IA 3B51X 1UKAA 2P4UA 5I48A 5KOJA 1QGZA 4AU1A 3D0QA 2ZWOA 4EHHA 4LCJA 2HV8A 4WUTA 4UTPA 5SICE 3WLSA 1D4FA 1M9NA 1UBHS 1DGQA 4CLHA 3SJUA 3WGIA 2XCIA 3K70C 1K6IA 1XL0A 4GXNA 1LFDB 3TSCA 4DLKA 2JD1A 2J1LA 2B37A 5LZ7A 4M9XA 4DM4A 4Q66C 3NUZA 3NTRA 4OK3A 1E1QA 1U2RA 1BSVA 3FRHA 4YRFA 4PO8A 3HH8A 3O4HA 1QCDA 1QE5A 4RDCA 4IM7A 1AC5A 1Q19A 3H1BA 1LS1A 4ESVA 5JWRA 2WLSA 3VC1A 4UUBA 4IOKA 4PSKA 2VBGA 5J59A 3TFWA 2IS4A 4XIJA 2V7TA 1TGVA 1SVIA 4DXDA 4TV8A 1RWMA 3B1YA 3DPIA 5DHPA 3QKIA 3AZPA 5THQA 2A0YA 3IEUA 5H68A 3V2GA 4P7JA 2HMAA 1HE4A 4JEMA 1OFUX 1YQXA 2FPPA 3FB4A 4YNBA 3PI6A 3Q40A 4O8CA 4CCYB 2IZ7A 3AKZA 4DR1B 3CVUA 2G6TA 2R79A 4LZJA 4TKLA 2YVKA 4ZOCA 1DMRA 3BKXA 2FW1A 5HF5A 2CKMA 4RO0A 4WXYB 1RPTA 1MHTA 3NDPA 1PLKA 2A9OA 2GXUA 3EXEA 5KX5B 3ZDDA 4GKBA 4JB0A 4ZVUA 3ZQUA 2IL1A 3M70A 4Q48A 1QGYA 2CNOA 3DGFC 3A3NA 3E9YA 1CUSA 4PZZA 1ACJA 2H63A 3KVYA 1XWIA 2NO6A 2PS3A 3ZZ1A 2ZTMA 5B58T 3NKLA 1Y3HA 3IB3A 4KR3A 2BKLA 4MVCA 5F7XA 1J2TA 5LDGA 5IKEA 3OJXA 4MS4B 1I13A 1V6SA 3ROFA 4D3XA 4NBTA 4E22A 1AQYA 6AT1A 3D59A 1TF7A 4EUFA 4A0QA 4A10A 3UBTA 3WE7A 2ZB3A 3EVFA 5C1BA 1JDSA 3B5IA 4AWBA 1KA9H 4Z54A 2XHZA 1KJYA 2XNKA 2I6GA 3G7NA 5HSGA 4MWCA 5JPCA 1Z63A 5GIPE 3GNLA 2FPIA 3K0KA 1GLGA 3GFFA 4AX4A 4C4TA 3BHJA 3UMJA 1R00A 4G09A 1DKUA 3FZGA 3L8MA 4ENUA 3VJKA 1VCOA 5LNK6 5JSYA 1L8QA 4W8HA 4YT8A 3NVKI 4BNKA 2DSTA 2BKVA 6CHYA 3C5WP 4U02A 2QTGA 4KO2S 4LK2A 3H9JA 1CY6A 3OIDA 4GPTA 5J1SB 1MZVA 1RLUA 4X8MA 2JAPA 2WNSA 3BXFA 5DNEA 2PQMA 4YRAA 4HDCA 1O97C 2DTDA 2Y1WA 4TXMA 4DCVA 4JDUA 1VL1A 1S8OA 3C8ZA 3MZ0A 5JARA 5KYNA 2QTHA 4TTSA 1Z28A 4IJQA 4IR7A 1GDTA 3AR7A 1JBEA 3I6BA 4KQ9A 1HQCA 2ZTSA 4CMIB 4K81B 4CMEC 3ON5A 3U4IA 4PZDA 3NBQA 5ALQA 5A9TA 4IMIB 5AM0A 3PRKE 3DW1X 2H1VA 3CWZA 3LA8A 4R3WA 5HCNA 1IBLB 2QIPA 2CC2A 2DE0X 2H5JA 4X1YB 1NMYA 1MTOA 2G0TA 4LNUA 3U7HB 2E5LB 2PNFA 4PIVA 3FZNA 2J3DA 5CB8A 3JQCA 2PLWA 1GD1O 1Q6ZA 3GRFA 1PR9A 4GPBA 5C31A 4ZI3A 1EVIA 1LNSA 1JEQB 3BERA 3H2KA 3QU7A 5G4LA 1TZJA 3AZOA 3TQFA 5LVAA 2YNMC 3V4PB 3VBEA 1UJ5A 5FWYB 1T9GS 3EAQA 4RH1A 4ZV7A 1IHDA 4I81A 2EJVA 5AJVB 3D7MA 2AOWA 2RAUA 2X1VA 3D9QX 3DZDA 4ND8B 1N32B 4YRTA 3PKIA 1NBMD 1XROA 4DGQA 1W36D 5DX0A 1FQJA 3E35A 2P6MA 2XDAA 3HI4A 3ILXA 1XWFA 3K20A 4QVGA 4TROA 3QY0A 3PFWO 4BMVA 1SUEA 3B13B 5INTA 5LNK1 4FEGA 3ANNA 1A5ZA 3O8DA 1KETA 2B8NA 3IMEA 5CUQA 5J1TB 5EKSA 1Q91A 3DEFA 4G4SP 1PD1A 1MNQA 4HHEA 2C0CA 1XQWA 4HS9A 4Q9KA 1MMFB 2HWWA 3DFFA 1WUJS 3RYHB 5EJ5A 4ARCA 3V1MA 3LT1A 3SDZA 3SKYA 1F60A 2IS6A 5IBRA 1P18A 5JJCA 3F3KA 2RHWA 2YN0A 2YINC 1CR0A 2OV4A 1SUPA 3O2JA 4Z53A 4IFTA 3IVXA 4LWZA 3RIXA 4N48A 3MN1A 1O3YA 3ABSB 1AT1A 3MF4A 5DBEX 2HK9A 2CHVA 3OE4A 3LUPA 2WF7A 4L02A 2YJ4A 4KXVA 2EGUA 3C7CB 2QG4A 1NLYA 2A57A 4EB8A 2Q50A 2XITA 2C94A 3Q7SA 4N7JA 1A8PA 3RCBA 5CX1B 3JRXA 4IRMA 1PL6A 4HGZA 1UQTA 5A3JA 2G8NA 3DHVA 1UF9A 2WTBA 3IESA 3V3KA 2O7RA 1A1VA 2FX5A 3Q8XB 1WBJB 2ZSUA 1Z2PX 1I2CA 1X0XA 1NQ5A 1NBWB 4BKQA 6Q21A 2GRJA 4CIDA 1Y8RB 3HCRA 1K5PA 3ZBQA 1FP2A 4GYWA 1JAIA 4P8RA 4YUVA 2CXUA 1P0MA 3BK7A 1GTRA 2ZIUB 2O05A 3C3WA 3H1TA 1JDUA 3P19A 5CDYA 1ZA1A 3REFA 2JATA 1VYHA 2XZLA 2GNPA 2P91A 5FOTA 1RE0A 2IUEA 2NQ8A 4AKEA 5LZ4A 5CEFA 2ZJOA 3PWZA 1TYZA 1QRDA 1TM2A 1JG3A 1SK9A 2C84A 2OYCA 4TZ0A 1JG6A 3PE6A 1M2GA 3CW9A 4JCCA 1SURA 2MINA 2W2VA 3ZX4A 2ZGVA 5T4HA 3WWPA 2Y4OA 4Z4QA 2DB3A 1DXQA 5IAGA 4MS3A 3X1YA 3PEWA 1NNUA 3THRA 1ORHA 4JLSA 2JJ2A 3BFVA 4X1KA 1ZIYA 1QHHA 3BK2A 4F4JA 4ZTUB 5C4IA 1XOIA 2WJWA 3GGDA 3BQNB 4DW8A 2DR2A 4QFDA 3C5VA 4YAFA 3RV3A 2VFAA 1QPBA 3MJHA 4Q1DA 3UAGA 3FNBA 1PVDA 4WCVA 5BMVF 2ZRGA 4JDPA 1KOLA 2GKGA 4XGKA 1HE3A 5DF1A 3VSCA 2DXIA 5J47A 3VU0A 4K05A 2CFIA 3O4JA 1J6UA 3DAGA 2IF2A 3NXSA 2I4LA 3C3CA 4X71A 3TTWA 4A36A 3UV7A 1WY7A 3W5JA 3MHPA 4WXHA 5HQ3A 1ISFA 2YRFA 3ND8A 4U8GA 3CKMA 2V74B 2XD4A 3HN6A 1MH9A 3RLFA 2Q7DA 3W2HA 3C3YA 3X1XA 2XQGA 3D2AA 5GVRA 1AGPA 2PMKA 4MJLA 1KY3A 4L16A 3DDSA 1AURA 2D2XA 3U13A 2W2MA 2ZE7A 3A9WA 4DYVA 4E88A 1OUMA 4NMXB 3H3FA 1DC5A 4WUVA 5A02A 1W581 3WBJA 5KTRA 3PVSA 4RENA 1NWCA 4DV5B 4Y98A 5J63A 1D1QA 1LLQA 1HM5A 1CUZA 4ER7A 1UMDA 2A33A 3LUHA 4PNEA 4ZYTA 3KU4A 3GRPA 3KYIB 3A4MA 4JL5A 1LK5A 2VTBA 4RSGA 1W2WB 1YOVA 4HX9A 2RKWA 4M37A 2E9SA 1EB9A 2Z57A 3INRA 3T1TA 3OQ6A 2HU5A 4BFLA 2JI7A 4GGOA 5HZKA 1PL7A 4MUKA 1M1YE 1NKSA 1NVVR 1Z39A 2BELA 1YQQA 3IQIX 4Y2GA 5DCLA 4ZKEA 3AG6A 2X1LA 4PHTA 3H3XA 1E6KA 4QARA 2G4VA 4REMA 5E4TA 1VJRA 5GONA 4MQEA 4YCBA 3T4UA 4WXRA 4GOKA 3UHAA 1EB8A 5HWSA 3UOAB 4KVZA 4KC0A 4KLZA 1Y7LA 4Y2HA 3WB1A 4BNUA 1XTSA 1T5DX 5HJ5A 2NT3A 1OLSB 4Y9TA 5DTEA 5NULA 5F7OA 1A77A 2J5XA 3QE4A 5HW0A 3CZRA 1GZUA 4HR7A 4A8HA 4PLZA 2NZUG 3FWZA 3B20A 3CEJA 3F74A 1FDSA 4GVPA 3AETB 1VI5A 1WZCA 5FR2A 3UQZA 3LHDA 2JCBA 4OXIA 1PW5A 1RM5A 1YSCA 3FTQA 1T2CA 3HYSA 4L95C 4YR9A 5JTTA 3T95A 4KIWA 1OV6A 2E2WA 4FC6A 1KRHA 1P0QA 1IQPA 5EHNA 2ATXA 1VPLA 3HKEA 4ZI2A 1PUIA 1D5CA 2H1IA 3RLIA 4CI9A 1EJBA 2UZ0A 3O7WA 5FTMA 3U61B 4Z3KA 1SUAA 1DEOA 1EWTA 2PWAA 4P98A 1VKRA 4QXOA 4CKBB 1YDEA 5IFLA 3GLVA 1D6MA 2DHEA 4U3JB 1LJ8A 2E21A 4Q12A 3TSZA 2OZLB 4KR7A 5AUPB 1DEXA 2O07A 1NXQA 3UICA 5KYWA 5MDHA 2YC4C 2C5BA 3KHUA 1K7CA 3VOBA 3G2HA 3W3AD 1PZEA 4AF6A 4BQFA 2ID9A 3V7WA 3A1DA 3DMYA 5KTKA 3BRWA 1RLOA 1JRLA 1TCAA 4LJAA 5GJVC 3ZGOA 2Z9BA 3OE7D 1RC0A 5MF6A 4ZREA 1CDEA 5G0VA 2Y1FA 1YA6A 1UAAA 3DO6A 1O95C 3L8GA 1SUDA 4UD6A 3GUYA 2G1KA 4DC1A 4MYHA 1C7FA 2CLIB 1UJMA 3MTGA 4CKZA 1AQIA 2O9JA 3PFBA 4OQXA 1Y6JA 3CR7A 3DE4X 2C3PA 3IBGA 1G20E 1RLIA 1QSGA 5KMGB 1ZK4A 3RRFA 1J49A 2FPKA 3AEUB 1TQ2A 2BGKA 3KR9A 3NJ8A 4E09A 2NXJA 2CLOB 1I7LA 4A26A 2UUCB 2C58A 4JH0A 1HBJA 3OFND 5FYDA 4LW8A 3ND7A 1IQ0A 3GFPA 4ZARA 1NT4A 2AIRA 2V6FA 3I6QA 1J2JA 1X1QA 2XD9A 4W8GA 5DXAA 3NHJA 2EFHB 4UDOA 3ZE0B 5TDHA 1DKRA 3ONFA 3AEYA 1LNZA 4LQCA 4HRYA 3RAFC 1BKSB 1OZFA 3W8NA 3CUUA 4K1XA 1V1MB 3HSSA 4TS9A 5K3FA 2EF0A 4JVOA 2FW7A 1J99A 4JSTA 4QPDA 2EFYA 3GMTA 4YP9A 3DWFA 4N7BA 3WO1A 4ZJZA 1U0BB 4GS5A 2FOLA 3DQPA 3C43A 4C0KA 2JHAA 3OP1A 3QPBA 3WRYA 4BO3A 2JL1A 4ZHSA 1PYGA 1T36A 1M2FA 1JVBA 4YQFA 3G3EA 3OQBA 1EU1A 3OC6A 1G7TA 2H16A 4X97A 5AUQA 5IK2A 3W2TA 3CKLA 1QH1A 4OJNA 4MKGA 4OQNA 4FVTA 4GVXA 3OFJA 3KXLA 2VYQA 1XZ8A 3MNFA 3I2IA 1GAWA 3OSUA 4JUDX 1KXZA 3TQQA 3WBBA 4CG1A 4ZHQB 1ID8A 2DQZA 2EBUA 3QXHA 3TK1A 1PN3A 3HACA 5BXQC 1WXWA 1EUCA 4P38A 1KZ9A 3BDVA 3VYVA 2D13A 3CINA 1Y8QB 4XSGA 2WWGA 1RAAA 2OD2A 3PE3A 1TIBA 2IEGA 4EKIA 1TAQA 2I6TA 1UP6A 1UFKA 1JBKA 2NV2B 4U7PB 3F6EX 4CDRA 4A92A 3EVCA 5CW2A 5B2ZA 2JGDA 4MVXA 4ZAWA 3RU9A 4P82A 4UEJA 3DZFA 2IUFA 4DIOA 1AKNA 1TM5E 4CT5A 4ZDJA 3W5VA 4X1OA 4B76A 2IEAA 5E4FA 1HLPA 1M8FA 4M8SA 1MAAA 4CMBA 4JY7A 4XPIA 3L4BA 1QYWA 3FNRA 1Z33A 1FOEB 4PHFA 1BKDR 1CCWA 2F3PA 3W6OA 3KJHA 4A5OA 4Q16A 4DXAA 2CHFA 3DKRA 4UBOA 1HORA 1SPXA 2PX6A 5HTOA 3M6AA 3ZY6A 4HL6A 4TTQA 3OQJA 4WK2B 2WF6A 3VO9A 4NATA 4A6PA 2P78A 3QUAA 1U80A 1ADJA 1VM6A 3GGOA 1I33A 3GQBB 4A73A 5B1DA 2QUZA 1TM7E 2I6SA 4M9CA 3WADA 4B2IA 2ZATA 1GKKA 1P33A 4MH0R 4TKVB 3ABZA 4H16A 3BWXA 2Z2YA 2JFGA 3V8RA 1H2AS 1G16A 3F3SA 1PX2A 3H1AA 5A5FA 5I7AA 1RMTA 3Q7PA 1ZH4A 5KOJB 3MTQA 3H6HA 3OLQA 3PD1A 2CJXA 1TKBA 1LSSA 1ND6A 2XEXA 5JV5A 1RHJA 1FBTA 2D0PB 2OCIA 4FCWA 4B3HA 3KALA 2QD5A 5HPYB 1JTVA 3KVRA 2JBHA 4FDTA 3CC8A 1E60A 2D62A 1QGUA 2WYHA 2ODAA 3MIIA 5ICFA 3ETLA 4YCDA 2PX2A 4E4YA 1BFUA 1UEJA 2BMJA 1HDOA 1UWVA 4YJ3F 3T3PB 4LXHA 2Z6VA 4AP5A 2XYHA 3HUEA 2P5SA 4FYYA 4KHPB 4L4ZA 2R6AA 5JROA 2YOFA 2FEKA 1ULUA 3T4XA 3UVEA 1T43A 1U0NA 4M0PA 3VYTB 4J7CA 4C87A 4NBRA 1N25A 1EXDA 5CXQA 3DAHA 4ZD6A 2LCFA 3OOSA 3PQDA 2YOHA 5HK8A 4LRTB 3DVRX 3VDRA 3W9SA 4C4PA 1EXVA 1GVHA 1MFZA 5HDBB 1NTOA 1SVNA 1RJFA 1RZ3A 2E49A 5UKDA 3T3MB 3C7KA 1Q2UA 2Z30A 1HSOA 2P4SA 2V7GA 5E2AA 5B53A 2FPPB 1I4LD 4L2IA 3KSMA 3OPMA 4N0EA 2XGOA 3O4RA 3TUIC 4AJKA 4TL9A 1II9A 2PS9A 4TQ9A 1EK6A 1UBOS 2IZ6A 5HJ2A 2Q9UA 2QW0X 3OX3A 1P3JA 4P2BA 4RA9B 3GP5A 1UAYA 4M9QA 3FOFC 4JLWA 1D7AA 1BX1A 1PQWA 1XNGA 2FGJA 3P0FA 4P32A 3WB2A 4EW6A 1LPSA 1CR1A 2ECFA 4MR9B 521PA 5LSAA 2J59A 4ZRDA 3II6X 1JT9A 1G6KA 2WKPA 2VHYA 2H1HA 2LBPA 3G9ZA 5TS2A 4RK7A 1Q50A 3GP3A 5EZSA 5A71A 3ZZMA 3Q8KA 3C6XA 7ADHA 2QM0A 3L7MA 2OVFA 1HDIA 3O8OA 2CZQA 5HMMA 4G4IA 1TAUA 1LC0A 1OIXA 1XXHB 2JAXA 3UYKA 5A5VA 4UW9A 2NZYA 3HDVA 5EUCA 3T34A 1K8ZB 1R4AA 3ILVA 3TIGA 4ZO8A 4B09A 3S1AA 1VCMA 2PEZA 2EGHA 2QPAA 2RIRA 5CMLA 3DMNA 4UTZA 4W6ZA 4BB6A 1UC8A 2QM3A 4QECA 4GYYA 1RQRA 1X19A 3OE5A 4DQXA 3IAXA 3FKJA 3DXFA 4X6LA 3QSGA 4Y18A 3FCXA 3FDZA 3LXMA 2OWEA 1R3UA 3A70A 3URMA 5GQSA 4JI8B 1OU0A 4MLDA 4IDPA 5FOUA 4JD5A 3L0PA 3O4GA 3GJ7A 1X1CA 5A4FS 5C53B 3RVQA 4UHHA 3GNSA 2YJTD 2PD3A 3KKOA 1LDEA 2B5WA 3IS3A 4R9RA 4MB6A 2CNBA 3C1OA 3JATA 3UPUA 2H1FA 1Z8FA 2X8BA 1K4KA 1NVUQ 4TUYB 1ESDA 3AL2A 1CZRA 1QE0A 5GOZA 3ZW8A 1AKMA 2GF9A 4XW2A 4XA8A 4WFJA 1N0IA 2G9RA 4HH4A 3V33A 1D03A 4HBZA 1BU8A 5D7BA 1X92A 2Q5HA 4X41A 2KI5A 1N7GA 4PN7A 1MNAA 5KJEA 3DP7A 4YK7A 5F21A 2QRMA 4IRUB 3DLBA 3IAM6 4PANA 5KWSA 3JWEA 3HJNA 2P7HA 3C3JA 3WYEA 2F8LA 3GA0A 4FFBB 4LNUB 4DSOA 1I7DA 4QC2A 5I4CA 4UXIA 4TTTS 2NUAB 2M1XA 2HQRA 5TEWA 3OIYA 2FSGA 3JYNA 4MGKR 4O0MA 1IZYA 2VTVA 3JQGA 1M54A 1CR4A 3GQVA 4BRWA 2RBEA 3HZOA 4DR4B 4P34A 2GJKA 1E69A 3M6VA 1EDOA 3UATA 3HCFA 4CQMA 3U48A 4M1EA 2DFVA 4ZICA 1U1CA 3DG9A 1ECJA 1RMQA 1KYXA 1U3VA 3B9QA 1VMDA 2WNHA 3LDUA 1XTRA 4G63A 1AKQA 4RVUA 4CL2A 1C1DA 4C4SA 3RVPA 1KEKA 4LX8A 3Q3JB 4PRLA 3HKDB 3HKCB 4L8LA 4B33A 3VKVA 4GE3A 1GHTA 4W9MC 1Y3FE 1U7XA 1NRJB 1X7GA 1HTBA 4WECA 1AB6A 3ORYA 4OM8A 5JMWA 1LJUA 2VI5A 1ODIA 2I9KA 2OQIA 1EWRA 2YWXA 4F0JA 1U2TA 1R7RA 2BM1A 2XVYA 3JQ6A 4HQFA 3MLEA 2H1WA 2ZT5A 1LBQA 3GPLA 4RYDA 1YZTA 2OC4A 2YY7A 1MCZA 5EERA 3RUAA 1KPHA 4INJA 5AOBA 2HRDA 1IUKA 2AQIA 3ETGA 1G60A 1ZW1A 1L3IA 3A4YA 3JD1A 3QA3E 1YWGO 3LUFA 1E9SA 2WT8A 4G0UA 5JRDS 4B2LA 4HGYA 1P1CA 4CTOA 2Z09A 1YNSA 3FOZA 3I2HA 1CYDA 5KVQA 4DA4A 2PD4A 4GXTA 3CBQA 2FETA 1QMPA 1ZOSA 5CJ2A 3RS5A 4JSYA 2JFHA 1MRNA 2ZTUA 1I6MA 2O8NA 4C4AA 3MAGA 2IWHA 3ANMA 2Q2NA 1KL7A 1Z0JA 3P1JA 2IU4A 4Q9IA 3CJTA 4ZO4A 5C5EA 4K86A 4FJ1A 4AVYA 3IL2A 1LWNA 2VZ8A 1AZWA 1J8YF 4MVJF 4TYWA 4JU8A 5FOQA 1FLNA 1U3TA 3UMYA 4INOA 1FMFA 4GEGA 1UBKS 1C3VA 3FTDA 4YJ2F 4NHOA 2G83A 3T1VA 3TKYA 1M2HA 3E7PA 3PV0A 2BBOA 5AIBA 2E87A 3Q8LA 2WKSA 2W6NA 2ZI3A 4UVHA 5H3LA 1E4YA 4CR7A 2PH5A 4BV8A 4BGIA 2AX4A 2IVFA 1NBOA 2EKBA 3KZOA 4GEKA 4P7KA 3BCUA 4NECA 5DJ5A 3RYIA 1FCJA 4TRRA 3WLFA 3PXAA 4MIYA 1Z0UA 5EJAA 1GUYA 4A03A 5K03A 2ILTA 2V03A 3PFNA 1R0LA 1ISIA 3FGZA 1A9OA 1B8PA 2V7BA 3U37A 1JQ5A 4PO3X 3Q7IA 1OLUA 4JWTA 3MWDA 3M34A 2JH9A 1NP3A 2H4XA 4M1KA 1U0TA 5I7FA 4MQMA 3D02A 1F38A 2H92A 3PLRA 3OQVA 1QOZA 3NIGB 4RSRA 4W5HA 2EZ4A 2JFOA 4GXRA 1IJFA 4KXLA 1YZUA 4FQ8A 1A5SB 1ZDMA 4MV9A 3GELA 2ZIGA 3ZDXB 3PGXA 1E4EA 1VGQA 4EABA 2YVLA 2DHQA 3WDMA 3I9FA 1QHHB 1SC1A 1WPXA 4IXTA 1EP1B 2KM1A 4QU8A 3HRKA 4MKFA 5CT4A 3SLKA 4BGVA 1WJGA 5JSFA 3T52A 5AXDA 5KNBH 3HA5A 2X0FA 1PFKA 4CEIA 2H2HA 1C0KA 1GY8A 4IHJA 4UNPA 5AKIA 4EAQA 3E82A 1C4OA 7AT1A 3NZEA 4K6HA 1GM5A 4NCBA 5AHKA 1JR3D 3ZHZA 1RI2A 1MDBA 3UAOA 2LZ0A 3LLUA 1BGWA 4HPWA 2QMZA 3STVA 3O8BA 3IBYA 3Q1KA 4NFLA 4YDRA 3RWMB 4PAMA 5DNUA 5BWNA 5KKCA 1RKQA 5JDCC 2VTDA 3SBXA 4AFNA 3UGTA 4KYIB 5JAQA 1Z0ZA 3HXOA 1DJMA 1F14A 3WA7A 2W7TA 4R5MA 1G8JA 2G17A 4HG2A 4ZA2A 4RLQA 2Q29A 1SFRA 4ZDKA 1G0NA 2XYVA 1H2FA 2XRFA 4HWSA 4JLNA 2WA2A 1S3IA 2EJBA 4YI5A 5AXAA 2C7PA 1QDEA 3T1YB 3IALA 4IW3B 4QPNA 1RTTA 5CNJA 3HVRA 3R5SA 1HYBA 4LWPA 1JDTA 1Y7HA 1NJ5A 3RTDA 1L5YA 5TGZA 4BNMA 4DDUA 4JJFA 1ICEA 5JOQA 1DG3A 2XXAB 3B1ZA 3SKXA 4ZYWA 4XVUA 3IP3A 3KC2A 2DQYA 2CMFA 2QL7A 1YOVB 1R8YA 2X2FA 4ID9A 1UM9B 4FBGA 4GECA 4IGEA 3D4IA 3D7NA 3PC3A 4OI0A 4RJLA 1NYRA 2ORED 3FZQA 3QPAA 3UIEA 3KUCA 2VSNA 4LC1A 3JWIA 2VYNA 2X6RA 3EXHA 2JCSA 4J1QA 1C3XA 2OO7A 4MB0A 3R7NA 4ARUA 4ZCMA 3PJRA 3TOVA 4UOZA 4OQDA 2GJAA 2V98A 4KLCA 4Y2RA 3CWCA 5GONB 4MQEB 4UKDA 4DCMA 1PFWA 4C20A 1GTMA 1XX6A 3CSUA 1GQFA 4OQYA 2ZWVA 3C7AA 3KPUA 1OZAA 1FDVA 1GPDG 3ET4A 2ZYRA 1O6FA 3FYHA 2C9DA 4H7PA 4OQFA 3KJFA 3B2NA 3W5IA 3EW7A 4AG5A 4G84A 5CFOA 2Q3DA 1JHAA 2G82A 1OKKD 3EOBI 3DD1A 1U7ZA 1UR5A 5DX1A 2GVNA 3ZD7A 1L8LA 2OB2A 1RHMA 4XVRA 1QC5A 4PYMA 1I0IA 4DARA 3GLHB 1NBME 1JKFA 1NVKA 1YR7A 4MVJI 1E79D 5KYXA 4M1WA 3MXTA 4QUDA 1K06A 5F4ZA 1QHSA 1NWHA 5EMJA 4OUDB 4M0MA 1EE1A 1P19A 5FXMA 3AVWA 2A4MA 1TD1A 1N5RA 3HKEB 1Z4MA 3O31A 3HA7A 4N7MA 4CKCB 1N9KA 1SUCA 5IUJC 4OJQA 3L8CA 1T9CA 1D2RA 4NYJR 1I4EB 5BWOA 2V3WA 4ZOLF 1JQJC 4GOJA 3G13A 3OA0A 4U0KA 3TBKA 5JH7F 3K96A 8OHMA 2FFQA 4E5NA 1Z5GA 2GBIA 3BQMB 3EGXB 4XD7D 2PRKA 4JZYA 4EELA 1V0JA 1T3LA 5J43A 4LF8B 2O8EA 1EVJA 3MLBA 4OAOA 1GUBA 4ABYA 4V2UA 4OLBA 3GJSA 3H87A 2QD4A 2R86A 3GVHA 1C7RA 5KQSA 4D92A 3GC6A 1XKLA 3LNCA 1F2DA 3KHKA 4U00A 5IHPA 3R9KA 4OL9A 5T8KC 4P7BA 2JW5A 1FW8A 1I6LA 3H4TA 4Q7LA 1JNXX 2PAFA 2YV1A 4J16A 3UHOA 2B4KA 3D2LA 1YF3A 2O1EA 2P90A 5J5CA 2ZWIA 3EVTA 3FR7A 3KB8A 2Q8PA 3OOYA 5D3ZA 3HCNA 1CUDA 1GQRA 4IKEA 1Y89A 2NU9B 2FAXA 3DMGA 2XLCA 5K0SA 1G5IA 1GL6A 1YC5A 2AEMA 3NP9A 3EIUA 3L82B 1DB3A 3LCUA 4NZNA 5AOAA 4AYXA 1GSOA 5DM1A 5CD1A 3KJXA 4F3TA 2AVNA 1OHHA 2FR8A 2PZEA 2C2MA 3DQZA 5SZIA 1L7QA 1YA8A 4UHEA 4YHHB 2A59A 4QNNA 5A6SB 1PFUA 2I87A 4Z0NA 3SHOA 4UMFA 2XDWA 3AUUA 3H0KA 3KRTA 1WMDA 2DWUA 1QYIA 2JAHA 4QT0A 4XIFA 1HO3A 4F2DA 4ZJPA 2V1UA 1M73E 4D43A 5AK4A 1KO8A 3D6NB 5DYNA 4I9UA 4LJKA 1LF5A 3T7IA 4QDKA 1U8ZA 2B7LA 2QPTA 3BD7A 4GP7A 3ZNOA 2J9ZB 5C8VA 3LIIA 3O2QB 1AXEA 2PSEA 5BN5A 1VL6A 2PV7A 3FB1A 3FVWA 4BBZA 4GLLA 3DTVA 2Q27A 4BMCA 1XU4A 1T36B 2IW1A 2WG1A 1FDOA 1FRQA 1G8PA 2C2BA 5JY1A 1VG1A 1N2CB 3WJAA 1N4DA 4K0KB 2OZKA 1R6BX 5AESA 3F46A 1QH1B 5REQA 1P1JA 2D7JA 3DHNA 2ONYA 3PHBE 4HB2A 5E1OA 3VDQA 2FPXA 2HC9A 1A1SA 1M1ZA 1B6TA 1BVUA 3EUEA 4FJ2A 4L4YA 2B69A 4V0RA 3RDPA 3AP3A 3T61A 3KZXA 2LKCA 4LY6A 2V8OA 1PHPA 5ER6A 3K09C 1N75A 2FWMX 3MPOA 1EUCB 1XE3A 4JP2A 5ALLA 3O8CA 5EMHA 4DIFA 4PG5A 5C34B 5TX7A 5EHQA 2HGSA 3BXXA 5HE8A 4WZAA 2QZ4A 3EMVA 2QVGA 2IVZA 3BDAA 4J6FA 4XWAA 5KCMA 5LUBA 3SZMA 4BX3A 4QHYA 1MXFA 1RLJA 2BMVA 4UPVA 3LH5A 4P4NA 2FHSA 2GHIA 5IM5A 1VJCA 4BP1A 4COKA 2ODNA 3GPIA 2CXQA 1W9HA 4NTZA 5BOSB 2QS9A 1H2WA 1BA3A 4IIHA 1BDJA 4DMUB 3Q8WA 1U8AA 5J4VA 1Z8DA 2RGAA 1N3YA 3R1IA 3DMPA 1BAPA 1O94C 5TF4A 1JHQA 5JVDA 4CV3A 1L4YA 2W9XA 3O93A 2WLTA 4MW1A 2B61A 1I2ZA 3K9QO 3AKDA 1NBAA 1TRKA 2OGWA 3H11B 4YREA 3U26A 3FTCA 3F4KA 4B47A 5KIAA 2PYDA 3GUZA 1CBUA 5HA5A 4BBJA 3T1HB 3EFOA 2GB4A 3DLAA 3WWEA 3A36A 4O4IA 1L5GB 4HB0A 1A82A 1I7NA 1CRPA 3KPVA 3U3KA 2O7NA 2ZYUX 3H0EA 2VDMB 1T2EA 1ZEJA 4XQ0A 3MWLA 4MA4A 5IJAA 1Y1SA 4BNYA 3VJLA 4NEHB 1Z6PA 2I6FA 3GFVA 2IZ0A 1ZUHA 4IH1A 2O3QA 3P2JA 4HEA1 5ERXA 3URKA 3I5XA 4Q6BA 1V35A 3AWIA 4DEVA 2HYDA 4MUYA 4EH1A 1H0HA 3PQ6A 1PV1A 5F64A 3BM5A 2WFZA 1WMSA 3NO4A 4ZZ3A 3DKIA 1QGUB 1FX0A 2XOKA 5LP6F 1D6JA 1RADA 3EE6A 3VYWA 3PDJA 2VP4A 3PNKA 4RGBA 3NEPX 2GAAA 1U4NA 3QPWA 1UBSB 2BV3A 2V59A 3TB4A 4E6EA 2BFCB 3O1IC 2AOXA 1VCHA 2PGIA 1AB5A 3ZZTA 3F0TA 1X1TA 1VLJA 3R0QA 1D8AA 2W4MA 2IOFK 2YXPX 3CSSA 3OX4A 4MVJD 1QZZA 2ISQA 1ZQ1A 1Q84A 4OYRA 4YTEA 1PNVA 4O2BB 3E7FA 1ND5A 1UK7A 3ZW7A 4DR6B 1COWA 3BWBA 1CW2B 4HMQA 1GVNB 1SM4A 2JI6A 2RONA 3RTAA 3N9IA 4CT0A 3HDTA 4TWBA 2EKPA 1KK3A 1PWEA 2F3SA 2FB9A 1C9YA 1RPNA 3I76A 3KWJA 4Y2TA 3IUEA 3NRBA 3PXXA 4DVGA 1U9IC 1PWXA 2FPGB 3B48A 3DGEC 4JUIA 4C0BA 3LS2A 3GGGA 5H9WA 5KB3A 4KGZA 4QT4A 1Z62A 2NWQA 1GIAA 3I73A 4UJ3A 3H84A 2AMLA 4WK4B 1Q7GA 2HX1A 4LOHA 3AYXB 4OK5A 4RPCA 3AUTA 4QUJA 3HLTA 3P2OA 3GT4A 3O8OB 1KH3A 3DJFA 1WCWA 2WF5A 4BEWA 4G5HA 3LPDA 4UAGA 4GIBA 1N6KA 5ENVA 2AFIA 2QN7A 4JASB 1ODFA 4UCWA 1T8YA 2GHQA 4DV0B 3V4OA 1QLWA 4CM7A 4DPMA 3K5IA 3SQNA 2PR7A 3KQKA 3S1AB 4KIFA 1CERA 2AOTB 3HPRA 4MJ7A 2DULA 5T3UA 2V7VA 3DCIA 1EFLA 3RSCA 2JG3A 2IX3A 3LY7A 2IDKA 1IHOA 2RGEA 3USZA 4MPRA 4V0NA 4MWSA 2QRKA 1XNHA 1RJ9A 3OJWA 4LQDA 1U2GC 5FFMA 5D1HA 3EVEA 4Z1MA 1VLZA 3VPBA 5DU2A 1RHUA 1FDUA 2APJA 2C95A 3STXA 3CTMA 4CF4A 5FAXA 3EQ2A 2QSUA 3IFSA 1K68A 4L0QA 3ZBUA 3U4CA 3ESBA 2JH3A 4AMVA 3ZIDA 1XRJA 1ZFNA 4CMEA 2DGDA 4YR7A 1Q3TA 4YCNA 1Z7YA 3WIVA 5BMOA 5KOIA 1O9GA 2WD9A 3FYDA 3DFUA 4ZMBA 2WFLA 4KQIA 4PPYA 3G9QA 1PR5A 1L7XA 1CLUA 4AD8A 1NOKA 1S01A 2GH1A 1U6IA 2Y71A 3M6IA 4I4LA 4UTVA 2VP6A 5A6VA 4OH7A 4HSGA 2PKXA 3VR6H 4NCJA 4R54A 4H60A 1B2RA 2CSUA 2UVPA 3LDHA 4RVHA 3SFTA 5BVHB 2PYIA 1S3FA 1EA7A 1F8YA 3QX7A 5ALPA 4EUNA 2AKAB 2PUAA 3HN2A 5BXYA 2HIMA 5A4KA 4E11A 4EG7A 2I91A 3ZIUA 2HUNA 4NNJA 4MDYA 3HNRA 5C7IO 2JLCA 5IVPA 1YDFA 1W36C 4RGYA 3LTEA 4DQKA 4E2WA 2IOYA 3K4PA 3JQGB 3QXCA 1IBMB 4H7JA 1RP7A 5FEUA 4AICA 2FLVA 4HC4A 2PFGA 3Q15C 1E9EA 2CLFB 3N2GA 1TLTA 2A9RA 4J43A 2C2XA 4M9RA 1D1TA 3VKFA 1VKOA 2AEEA 3ER6A 3PITA 4S3MA 1P0IA 3FNIA 1J7KA 3GAAA 3L1KA 3LUAA 1XELA 4M0UA 1QG0A 1P5HA 4MSUA 1CS0A 4M7PA 3U3OA 2Y4NA 4I5FA 3S2EA 4B3DA 2V4UA 3A6LA 2AUNA 3RRNA 1KEEA 1NJSA 5KTMA 5EXSA 4Q9DA 3RQSA 1QCCA 1NUHA 2XECA 4NICA 1H2ZA 1R8SA 1NFQA 4X1IA 1ZIXA 3NV9A 4UHDA 1Z07A 1HG1A 2BMWA 4WERA 3W79A 3DT9A 3W6ZA 1SKQA 1JDNA 2WVAA 2PMDA 2WIBA 3CJRA 3OJFA 3VR2D 1QIKA 1QF6A 5CLLA 3LXRA 4N1AA 4XDGA 2BCGY 1WNTA 2EF1A 4E0BA 1IBSA 3ACCA 5F1YA 4EHIA 3TZKA 1T5OA 1NX6A 4B0PA 1MQ9A 3FYUB 1KFJB 3D6FA 3N7AA 4JEHA 1U9ZA 5FUVA 1MN6A 1FYEA 3OJEA 3RRZA 3DVQX 5B2EA 3ZD6A 2PQ0A 5KSZA 5HP4A 4FT4A 4QTXA 4ZN6A 1LS6A 1L5HA 2AR0A 3AFMA 4LYAA 2WUVA 2D4HA 1P77A 2JZCA 4QJBA 4B4KA 1P8AA 4MPDA 4RQAA 1MVNA 2HF7A 2F3TA 1KEWA 1VRVA 2DLNA 5JIBA 1LSJA 2QMOA 5K8LA 1ZH8A 3COJA 1E7YA 1PJ3A 2BHSA 5LLSA 3GLFA 3G23A 4UC0A 1VPTA 3C1AA 3VNBA 1KO4A 1ZWLA 3KJQA 4ER5A 4I5GA 3A2KA 2QN2A 5IT9A 2N3ZA 4HBGA 2FN4A 4GUAA 3KWFA 5AHWA 5ILQA 2XSZA 2XTJA 1TOAA 4ILEA 3V7UA 3N70A 3PNMA 1JHUA 2ZUBA 3SD7A 4FMCB 4EKYA 3U62A 1BQ3A 2Z98A 5LR6A 3P96A 5JYBA 1K8QA 4GR9A 1KFBB 2BEWA 3G8AA 2NU8A 2QEQA 4FNOA 1P1KA 1QPZA 3VZRA 1XJ5A 4PR0A 3HMQA 1DJLA 1Q22A 2VPQA 1E1RA 2FRVA 1PZXA 3QMVA 4Q7KA 3PYMA 5F23A 3WWOA 1VBMA 2BFWA 4PGHA 4I50A 3EB9A 4EGAA 5TF0A 4F96A 1ANKA 4JL6A 4QQNA 3DEIA 3R4VA 4MYSA 5KQPA 2ZJ2A 1E4EB 3OJCA 1R6VA 4MVJH 1ZN8A 2F1JA 3ORRA 5D8DA 8LDHA 4C5BA 4D3SA 4UM9B 5I7SA 1JU4A 3RGWS 3T5MA 3BAZA 3O95A 3RODA 4C78A 3RAEC 3T0GA 2AFRA 1VI6A 3HDGA 4RZQA 1UM8A 2C8LA 5E8RA 5EP2A 4KUHA 4CEIB 1MUUA 3PCRB 2R8BA 2ZSBA 4G0YA 3KTAA 4F7DA 4F8JA 5KPJA 3CO0S 1T4CA 1UMBA 4XE5A 1GEEA 1FU7A 4MUFA 4DV7B 4FOSA 4RTOA 1MIOB 1KBOA 4ZC1A 4ZVKA 1BHQ1 1JAYA 4FZRA 3QEAZ 3R20A 2BH2A 1WVIA 1R5JA 2WJ3A 4KWEA 3ZS9A 1T9BA 4NH0A 3A6FA 3ZYCA 2QRLA 3VR3D 1SRRA 1UBLS 1AX9A 1RACA 2RAVA 1OA0A 3DNPA 3BN3A 3PC4A 5TQ2B 3KQHA 2FSSA 2REOA 5CYOA 1JGTA 2H65A 2Z1DA 3G2MA 2OOKA 3PB3A 4CMAA 2F62A 3S2IA 2XZTA 4DRXB 4EF6A 2P69A 1Q92A 1C8VB 5BSMA 3QG1A 1YCFA 4IFBA 621PA 1FX1A 5EE5B 4UEWA 3AJ9A 5ES4B 3K2EA 3QEBZ 1EA5A 3KL4A 4RMJA 2WMYA 1WHTB 2VOEA 5TVKA 3ZE1B 3IO5A 2FMTA 3ZCQA 3WMRA 3ROTA 1OX4A 3BZWA 5FOXA 1LW7A 2QPOA 2W6JA 3EYWA 3PNLA 2HWYA 3ZY3A 1DKLA 3FPFA 3I9OA 1P1IA 4CXMA 3VSBA 3HN7A 3EXHB 4RD0A 1PFQA 1U2QA 1CD5A 1EE2A 1VTKA 1XZJA 2VPZA 2X2OA 1XHFA 3TZLA 2YXNA 4BWFB 4HATA 1QRRA 1T5TA 4DSUA 3A4LA 4DUGA 1N5OX 2QLTA 1DDOA 2BTOA 3GEIA 1V16A 2KMLA 1L4UA 1KK0A 2QTAA 5K8JB 1CDDA 3ZCVA 3EULA 4G2TA 4D9JA 1NXVA 1DC3A 3C8MA 1WCIA 3BTOA 1W5AA 5JFGA 1RVDA 2QHXA 1KXJA 3HYLA 5K99A 5KKNB 4HDMB 2WJYA 1CJUC 3H0CA 3UMMA 2AKEA 4OPMA 2PLFA 4EPVA 2H2DA 2HMYB 3UMCA 2YJ3A 5KSPA 4BRUA 1SR8A 3AIMA 3LCMA 2E6KA 1N5DA 3AUJB 3SX0A 2FJUA 3GG9A 3ZIAA 3D4PA 3EZ7A 1AGYA 3FFAA 2O0MA 3WZMA 4CTKA 4DBZA 4EL5A 1A98A 4HTFA 4ITUA 4L4XA 4JKYA 1WBDA 2WSYB 1A8UA 5IYZB 5LKAA 4ZOEA 5JSQA 3WAJA 3I8XA 1MDFA 1E1CB 1O57A 2C5AA 3OPXA 4LECA 4Z8XA 2ZJYA 4H1HA 1J5XA 1L7BA 2WVJA 2X9NA 2QN8A 3IMCA 4G24A 5DYYA 4AP6A 5E8JA 2XNDA 4EEKA 3GZNA 2WNIA 3LY5A 4AQDA 2WTUA 5EKTA 1NF2A 1VKHA 3KIPA 3NBUA 4TT3D 4OFZA 2OKGA 3EZYA 2OFPA 1YL6A 5BP7A 1FXWA 3GFBA 5TR9A 5IAKA 4RTMA 3SYTA 5AT1A 1Y7TA 1FE8A 2X23A 3IILA 5KNDA 1YHZA 3O6VA 2Q7XA 1O95A 1GRRA 1OWPA 1T5LA 1VB5A 2EFJA 5MFZA 1QHNA 3EC7A 1NRXA 4F38A 5I45A 4PGFA 3F67A 3IKJA 1FF9A 1T2FA 3K8OE 3P97A 4N3BA 1OV4A 4JENA 5LWHA 4KLRA 3ZNPA 2WQ7A 1P2TA 1SHJA 3AR6A 2GZHA 2R4QA 4CMKA 3X1ZA 4NBVA 3V8PA 4O2AF 3D0OA 3TM4A 3E3OA 1RJWA 3GGSA 3TL3A 4PYQA 4N5HX 3H3JA 4FFSA 4XXHA 1RWQA 1L8AA 1YHYA 3QSYA 1U2ZA 1AQNA 3TECE 3HM9A 1KEVA 2WUGA 1ZMXA 4QQKA 4V0OA 3NP7A 3ZVLA 4F71A 4QDOA 5EJFA 1QQTA 5C2JB 4J07A 4PZEA 3WGJA 4Y2XA 5K8VA 3ADDA 5TJHA 2CNKA 1IPFA 4JIMA 3E1SA 2B99A 3H16A 4UPDA 5EPOA 4CLOA 5EJ7A 3TAXA 5LOVF 3R3HA 3GLQA 1IY0A 1P7PA 1X14A 4B5LA 3CKYA 1JH8A 1AGXA 3OQHA 4JQZA 1G4AE 4D0SA 2BT4A 5CG1A 4DZZA 1HDYA 1WVMA 4F4IA 5DNYB 4WBXC 2WYUA 1DXOA 5DM60 1W0JA 2G7MC 2QV0A 4X5OA 2L42A 4QXRA 4A91A 3PQ4A 3RUPA 1YAJA 4BFXA 3QUQA 3TEMA 2ORVA 3TZQA 1KSJA 4YLEA 2JEYA 1JALA 4L8VA 1U9JA 5K8UA 4PE5B 3SIXA 5HVNA 2JAUA 3IKLA 3JD3A 3N75A 1LQ2A 2OM2A 5DI3A 1Y33E 3TBHA 2JEZA 1DIAA 1XN1A 1DL5A 1P31A 3D1VA 3HZZA 2SCUA 3DE6X 1BW9A 3I52A 3SF0A 4RLSA 3BREA 3NTVA 5EIAA 1QHXA 4NBKA 3RNOA 1JR3E 3LE8A 3VPHA 2Q07A 4I4TB 2BEJA 1ATZA 3SZUA 3BEOA 4M36A 5YASA 1I3MA 3KLNA 2AYYA 1XUOA 2FF7A 3NIWA 4KRGA 4WZAB 4IOJA 5D86A 3TQCA 4WLOA 4BQSA 1TI7A 3THXA 1FS4A 3PFIA 4P84A 5F98A 4EGJA 1MR3F 5BY2A 3JQEA 1E2MA 5CA0F 3PP8A 3CN9A 4DG5A 1XCPA 3TTVA 4Y6GB 1STOA 1CY8A 3SJCA 5GAJA 2ZEJA 1V37A 1NN0A 3TIXB 1T5SA 4LE2A 2CMHA 3E15A 4MS1B 4UFOA 5DB4A 4UAJA 5JVDB 3GFGA 3HYNA 2PIDA 3ILSA 4IX9A 3OJLA 1D6SA 4MIKA 5TGDA 2PGLA 5IZCC 5IP5A 1YB6A 3T5BA 3L93A 5AQ1A 1K98A 2YZNA 4CE6A 3EFOB 4B3MB 1LK7A 1AUOA 3WL7A 4O4IB 2VJMB 3AMVA 4XB1A 4KL8S 3R3JA 3OU2A 2OV8A 4Z9XA 1WM1A 3L05A 2E82A 2ST1A 2I65A 2Q6TA 2NVUA 4BU0A 2HHJA 2QD1A 3X0DA 4FX2A 3BXGA 4UZSA 3T1OA 3N6RA 5HUJA 1DOAA 3FCUB 2C78A 2YXEA 3ZCUA 3MRXA 2D1SA 2YY5A 1LVGA 3K70B 2XGMA 1TK2A 2GBLA 4GSKA 1DJQA 5GOTA 3CVWA 2NPOA 3PRYA 1Z6GA 1E2PA 3NHPA 3H1GA 4EZIA 4JELA 1SEPA 3I1FA 3J80A 4QXMA 2FW0A 3J81k 2ZIEA 3KEFA 4KB5A 3C0KA 4FU0A 5CJJA 1I36A 3FVRA 2UYYA 1PFGA 1YMQA 2ECPA 3I5UA 4CF5A 1IHXA 4D5EA 1FX0B 4LV8B 2OENG 3SXUA 5C3MA 1WV1A 1PEAA 2QYHA 5DXFA 3D2BA 5ERGB 4TLBA 4Z9AA 5KC9A 2JLWA 2J08A 3UNXA 1CJCA 4HAWA 4OOFA 2IK8A 3K2IA 1QBGA 2CXNA 5AI9A 3AU8A 4MKXA 1OYYA 1XYGA 4X20A 5KVCA 3OI7A 4X24A 5IBQA 2Q8NA 3IO3A 1PVOA 4OHOA 3HB1A 5ELMA 1R4ZA 4C6SA 1ILWA 4NZ9A 1QQ6A 4CMJA 1M10A 1XMJA 2LKDA 4B6JA 1Y5LA 4I1PA 2HF2A 1B6RA 2CJWA 2EAUA 3EJ6A 3FIJA 3TQOA 4JS0A 3LXXA 5KYYA 3MVEA 2P0AA 1MKYA 2QW8A 2W2XA 1K8XB 4ZCIA 3VBCA 1I32A 2EQAA 2HSZA 5A1JA 3H9QA 1CLEA 2H2WA 3QVWA 4WFQA 4NZPA 3JYOA 4CV2A 1A4IA 3R3ZA 2V54A 4TYQA 3MWGA 2GA9A 1IULA 1BHJA 2G5CA 3N2KA 4GO1A 3VR5A 5JC1A 1IN6A 4WBNA 1QR2A 4R8SA 4WKPA 4LI3X 2IGTA 2VHUA 5DX8A 2BF7A 4ZV9A 4BGUA 2OO3A 2O19A 4CEJB 2VXYA 4OX9Y 1Z5UA 2EWVA 2JZOA 3KUKA 2X8JA 3MW8A 5HKBA 1J1UA 4JODA 2DZDA 1QH9A 2Z8YM 1Q95A 2PKRA 3CSDA 3QBVA 2IYRA 5F5XA 4AJJA 5B3KA 4GRDA 2VHQA 2QRUA 1VJ5A 3Q12A 3CVYA 1NU8A 2AFIB 3BG5A 4FSHA 1PS0A 1R6XA 4R2KA 5P21A 5CEEA 3OTOB 1EFPB 4NF2A 3N0RA 4KTVE 1KSFX 2CNDA 2XIJA 4G5QA 1M0EA 1QUFA 5BR8B 3QYJA 1RYDA 3BB3A 1R5OA 3GD5A 4JX9A 4OP3A 2WJJA 1RRFA 2HGZA 4XX1A 5ALJA 4E3WA 3EEQA 2HHCA 2HLDD 4H18A 1Z2OX 1MJHA 1QHEA 1MX9A 4AJ4A 1NVXQ 2Y1OA 3BJRA 4ZV4A 1DIHA 5JECA 3GDHA 4HQOA 4G89A 1CZOA 1ZH6A 1RJ9B 1FQWA 1YUMA 2KW5A 4IL5A 5TMPA 5A5DA 1QG4A 3U39A 3W5AA 4BIMA 3S27A 4HK4A 3I92A 1NOIA 1JSLA 2X0KA 4KH0A 1JEEA 4ALIA 5JS7A 2JGMA 1QK3A 3T7CA 4JL8A 1SZDA 4I19A 2B7CA 5FX2A 3TXYA 1N2IA 5M7EA 2B36A 2BR4A 2AA3A 5J4HA 3T3OA 3NT2A 3V5NA 2DPXA 2HIGA 5FL7A 1NJ8A 2P30A 3DE7X 1VMIA 1DJOA 4DFDA 2WFLB 3RGGA 5FH9A 3DLCA 2OCYC 1EK5A 1A3CA 2MSDB 2I4NA 4Z8YA 4YMUA 1YNOA 4RNDB 3JZAA 2VLIA 4F9FA 3CW2A 3QEOA 5EZYB 3JVIA 2UVPB 2H51A 1P4SA 2RK4A 4WW0A 4WQMA 4FI3F 4L9RA 2O2IA 4OIFA 5DYWA 1RXEA 1HE1C 3PGMA 3RYCA 4Z4FA 5HF8A 3QWBA 1IM5A 1HQDA 1TIPA 3D6JA 1JXAA 4EKEA 2P79A 3HVJA 5JXGA 5ALSA 4EL0A 2OM6A 3V9AA 2DCMA 1QIHA 2QX7A 4WNCA 4ETWA 3QFFA 2H54A 2YTZA 4G1UC 1R0YA 1RYNA 3HHEA 5FO1A 4LA4A 3NEJA 4ND1A 1CJBA 2PGAA 3ZI0A 5KNCH 4PIPA 2VT2A 2GAJA 3BH6A 3T94A 3ZHRA 5U9CA 5LMZA 1RABA 3WR5A 1UBNA 1KFCB 3R7DA 3M8KA 2FMXA 1C5KA 2I3DA 3KAJA 4F46A 5JR3A 5K45A 2VPYA 1EQAA 1GZ3A 1U5AA 4QDZA 4JUFA 1XCJA 4B6PA 1NVEA 4P4SB 2XQVA 3K05A 3OETA 1KVUA 3GZTB 3OT1B 3NTXA 4P54A 3VTFA 4KU4A 4DLZA 3FDJA 3HWWA 3WGOA 1VP3A 4BZXA 5LCXA 3NGLA 2M6RA 4XIIA 5IJ9A 2BMFA 4ZI7A 2AS0A 3B7GA 4A8PA 5JNVA 1Z3CA 3IR5A 3HV0A 3CLRD 3GUVA 1EDBA 4GOND 1LJLA 5FBLB 6ADHA 1D5WA 3I6ZA 4BDSA 1E2EA 3KQOA 5J2UA 1N78A 1R74A 1G20A 3NC0C 5LA6B 2O8DA 4Q3AA 1H1TA 3H1PA 4V3CA 4LSZA 3ROXA 4YAWA 2Z8XA 4XM1A 5HOQA 3FDIA 4AECA 3ANLA 4Y2SA 4YV7A 4EG3A 4QFCA 4BFWA 1E2LA 1F6DA 2EEZA 3VUFA 3E27A 1UWKA 4PM4A 4R01A 4BQIA 4TTAA 5DH9A 5FUWA 2NTYC 3DOJA 5FYQA 4TMVA 2FKAA 3CLUD 3KOXA 4TL6A 1RTKA 4D9GA 4R1PA 1G8KA 2VATA 3BF8A 3BSWA 3M83A 5BSKA 3RWBA 1L4LA 3DB1A 5A3QA 2ANCA 2H18A 2IXAA 1IFXA 4UCQA 1L5NA 4QODA 4DSAA 4JLMA 2HHHB 3WB9A 4AN0A 1C7IA 1F7UA 3I1JA 4TOIA 5CDUA 5FFFA 4HXGA 4OBWA 3NM4A 3ZLVA 3IJPA 4WK6A 4ARIA 3ND5A 2YDXA 1M2OA 2Y1LA 1WKBA 2X19A 1MOQA 4ZVNA 5LC1A 4BNXA 3EEBA 3IKMB 3WFZA 5DGHA 1C4XA 2JB9A 5F7ZA 2JFZA 2OGUA 1JDZA 4K9MA 4B31A 3QVJA 3L0YA 4NNPA 4B7AA 5JMOA 3DBRA 1T6XA 1BJRE 1QV7A 3AF2A 4X3PA 4WKBA 2BONA 1IOWA 2UV8A 2PX3A 4DABA 2I55A 4C43A 2IE8A 4H7FA 2QJRA 3FMVA 4J29A 4KJZA 4YUYA 2RJ3A 2YFQA 2PYZA 4US2R 2BEWB 3W8RA 2C2ZA 3E5NA 5HF9A 3GA5A 5E9QA 5ICGA 3AHGA 3K2QA 4F86A 1R0WA 3SBDA 4RY9A 4FE3A 3VNQA 4B3JA 4B6QA 1C50A 1KYQA 4MUMA 3RTEA 2ZS7A 3A1CA 2JLXA 3ZJUA 3NHZA 3VI4B 2WF9A 4C0XA 4I50B 2XRYA 3F96A 3HY6A 1XCBA 1P74A 4Z1OA 3AOEC 1EGMB 2F17A 3BTUA 3NW9A 1E3SA 1ORWA 1RXUA 4QEZA 5CIWA 1F5NA 2OPBA 4YDHB 5NLLA 3TF5A 5JDCA 1P0FA 2RGBA 2Y1KA 4L6AA 1E63A 3AHEA 2DKFA 3LRPA 5EZ5A 2CDCA 5FPTA 5KKAA 3W8EA 1U2DC 1XALA 4UNNA 1T4CB 1UMBB 2X7HA 4GDMA 1EKXA 2J6CA 1ZW6A 1PJAA 3RREA 3WJ1A 1J5PA 4UDNA 1AK9A 4BLWA 1ZJWA 1C4WA 1T4DA 4BVBA 3E9CA 3TZHA 3U3JA 3W4JA 4YMIA 1HNXB 2UAGA 1XEWY 1N7JA 1VJGA 1C80A 5BNWA 6LDHA 2V9ZA 3PFHA 4ZXPA 4AK9A 3OQNA 2VP0A 4QYSA 4HQNA 1KI3A 3E9NA 3B53X 5AJUA 4WNAB 1QOPB 3ZKAA 4PHCA 4TM7A 4P2GA 4P1ZA 4QOEA 5DPMA 4ASUA 4LFAB 1TADA 5EJ2A 4C05A 4ZODA 1PZFA 2Q0SA 2XBLA 4ZAVA 5HIAA 3NFYA 4KO8A 4H35A 2WHQA 4LHEA 4F56A 3C3EA 1HZZC 1VECA 2DYKA 2XA9A 3JAKA 4AZWA 3OC0A 4A6EA 1XKTA 4II7A 1OX4B 2L0XA 2VWQA 2ENWA 5D84A 5JXIA 1GG2A 3S2YA 2XUZA 3DE3X 1NVBA 3IDAA 1P75A 1QTRA 1SIWA 1F0NA 1Z88A 3S44A 1XJCA 3TPZA 1FFSA 5SY4A 1L4GA 2HOQA 4D6PA 3T9DA 4AO8A 4ZVRA 3CLTD 2IBTA 2I6XA 3AX6A 2G9QA 3I6MA 4D4GA 3N58A 2Y6VA 2ZYDA 3G8BA 1DWUA 4I8XA 4Y6SA 3PK0A 4BYGA 5ITZA 4IMJB 2Q9CA 4WKOA 4HT3B 3GJ3A 1E3IA 2D0DA 1W6UA 2P5TB 2PZLA 3B1XA 3KZNA 1V16B 2GRUA 3CUVA 5CB4F 5KYVA 2PCLA 4WJZA 1MJGA 3F5SA 3EQ6A 2WJHA 1RJGA 1H8ED 2B1QA 5C18A 3U7GA 3DPUA 1MW9X 4EX6A 4DF3A 1FVHA 3QJ5A 3GPBA 3ONNA 4C4RA 2O4UX 1TGYA 1GCIA 2Q7OE 4OA8A 2FTKE 3MB8A 3GLGE 3D3WA 2QRQA 2I67A 3BRSA 2GEKA 1RWWA 2HK6A 3OIFA 5DNWA 5HG0A 3COZA 3TRKA 3DE2X 3QJGA 3GOHA 4AS1A 2DBQA 2MMGA 3IAAA 1WMEA 1W73A 3OAAD 3BVPA 2FPWA 1RRKA 2JGEA 4UVGA 1QUEA 5EE1A 1ADGA 3T9BA 2H7XA 3W78A 2HT6A 3GXBA 4RZSA 1WXHA 5EUQB 3M2PA 5IT5A 5EN4A 1HPLA 4DCSA 2NM0A 4EAAA 3RBAA 4WSOA 4FDVA 1XAIA 3TUJC 3CEPB 2XQFA 1FSZA 1KORA 3AB7A 4UBJA 4XJXA 3VZCA 2PKCA 4HAYA 5T8KA 3U7RA 1VIVA 3VR1A 5DIFA 3WL4A 5LLDA 4ENWA 1SXJD 4COOA 2HNBA 1ZM3A 4XYGA 4CM4B 2XNSA 2BZ0A 1OYOA 1P4JA 4RMGA 1SA0B 5CR9A 3GH1A 4QUKA 1CQIA 2CK3D 2DWCA 2QTTA 4I1OA 4KX3A 2Q5EA 2YY6A 2ZIWB 1VJDA 3HJTA 1JILA 1WY5A 3MJEA 4GWKA 4NONA 4RHFA 2FW6A 1GZSA 3K9WA 1YZFA 8ADHA 5JASA 3NKFA 4A8JB 3MMNA 2SECE 5CVJA 4DMMA 4K7JA 4RELA 5FI3A 2C07A 1MF7A 3B8EA 5DP1A 3IXMA 4ZEOA 2Q0QA 3O8QA 4C08A 1WU7A 3KKZA 2DF8A 2GTIA 2COKA 2ZUSA 4MP6A 1M6EX 4RFSA 2MSLA 2CXPA 3LT2A 4C3UA 3UJPA 1XPJA 1Y3BE 2EP5A 1NONA 5JYDA 2A67A 2BFDA 1R88A 4O4LB 4EB3A 4UQLA 4YMGA 2IU0A 1NE2A 1NJ1A 2Y1EA 2QVCA 5IX8A 4EATA 3L6UA 1Y4AE 4MR7A 4PRKA 4RD4A 3PKJA 1NL3A 3JQAB 2JGLA 4RMNA 4OF4A 1IUPA 2XCTB 3F3MA 2K6GA 2BFAA 3K1TA 3O91A 2DHRA 2JJMA 1UT6A 1R5BA 2D5BA 1P9RA 4ZYXA 5E6SA 1T9DA 5J5AA 4F93B 3WICA 2HMUA 3LUGA 3EY4A 3H1EA 3EPHA 1DQRA 2WUEA 1LBEA 3QQPA 5FOSA 3JD4A 1E9FA 3IIKA 4U2BA 1KOGA 2PIAA 3EGIA 4FMCF 3QH4A 1HWYA 1Z4OA 1OXUA 3D7RA 1NULA 1ZN9A 2OGTA 3DEAA 4IEFB 3U6BA 3MTIA 2J3JA 1EI9A 2LD4A 4JUCA 4WRRA 4C88A 4B17A 4GR4A 1T3SA 4O2RA 3K09A 1AUPA 3SQMA 1OQAA 4KBGA 5AM4A 4RS3A 3ZG6A 5I9NA 1XMPA 4LRYA 1FFYA 1XT6A 1BW9B 1DHTA 5IG2A 1YZHA 4S2UA 1OJ7A 1PT9A 2B78A 2PSJA 2WWHA 3T5TA 1E2NA 4PGGA 1ZJ6A 1QZXA 5B6IA 5E4YA 4LDAA 4PYRA 4L4SA 1T0PA 2G5PA 2HD4A 2E18A 3IEXA 2W8BB 1OLXB 1NMSA 1T5IA 1Q21A