1S02A

Effects of engineered salt bridges on the stability of subtilisin bpn'
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSEGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of engineered salt bridges on the stability of subtilisin BPN'.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
molecule keywords SUBTILISIN BPN'
total genus 96
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1991-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1s02A00
3LPAA 3F49S 3GT4A 3AFGA 1TM3E 3LPCA 1Y1KE 1TM4E 1TM1E 4LVNA 1WSDA 5AVKA 3T41A 3DE6X 4OV6B 2SICE 1S01A 2PQ2A 1S2NA 3F7MA 4ZOQI 3VHQA 2IY9A 5JXIA 1Y4AE 2SNIE 2Z2XA 1C9MA 2ZWPA 2PRKA 4WOCA 1Y34E 1PJ8A 2X8JB 3QFHA 1GTG1 2WV7A 2Z2YA 5AQEA 4YN3A 3ZXXA 3Q40A 3SQOA 1AH2A 1XF1A 2W2QA 2GKOA 2ZRQA 3GCWA 3I2YX 4DWWA 2PWBA 3DE7X 1SIUA 1HT3A 1BFUA 2V8BA 1SCNE 1ZVKA 3DWEX 1T1GA 3DW1X 4HX2A 1YJAA 5AVJA 3WHIA 1SCBA 3D43A 1DUIA 5ARCA 2Z56A 1GNVA 1C9NA 2Z30A 1P7VA 2PKCA 3L1KA 1BH6A 3A3PA 3VTAA 1SUAA 2DUJA 1T1IA 1WVMA 1GA4A 1Q5PA 3I37X 1SELA 3WIVA 5JXJA 4FONA 1GTL1 4B5LA 2PMWB 4K8RB 5B1DA 3VV2A 1Y4DE 1NLUA 1MEEA 1P8JA 2HPZA 1KE2A 1ST2A 5ARDA 1SPBS 1KDZA 4RYDA 3WIUA 3DE2X 5AMXA 1SBCA 1PFGA 1DBIA 1Y3FE 1GNSA 1OYOA 1BE6A 1YU6A 2W2OA 3AJ8A 3DYBA 4H6WA 4WOBA 1R6VA 1SUCA 3CNQS 4CG0A 5JXHA 1SVNA 1YJCA 4NMXB 1YJBA 1A2QA 2W2NA 3I30X 2WUVA 4AKSA 1SUDA 2IXTA 1EA7A 2XTJA 4KPGA 3H42B 2ID4A 3AJ9A 2DQKA 3UNXA 4Z2AA 1TMGE 5JMOA 3TECE 1WMFA 1KE1A 3F7OA 4CFZA 2Z57A 1Y3DE 1PEKE 2PYZA 3EIFA 2Z58A 3DVQX 4JP8A 1MPTA 3LXUX 5I9SA 3DE5X 3GT3A 3VSBA 4DZTA 1C3LA 3LPDA 1Y9ZA 3EE6A 1BE8A 1TO2E 1R64A 1BFKA 1SUEA 1R0RE 1TECE 1IAVA 1Y3CE 1SIBE 2G4VA 3PTLA 2X8JA 5CW1A 1CNMA 1JEAA 3BX1A 1SBHA 1GA6A 1NDQA 3CO0S 4GI3A 3P5BA 4HVLA 1NDUA 1TK2A 1SH7A 2ID8A 2QTWB 4H6XA 1WMEA 1GCIA 2ST1A 4M1ZA 3A3NA 5ARBA 4BWGA 2ZWOA 4MZDA 5JXGA 1S02A 1ST3A 4ZARA 2XRMA 1C9JA 4KB5A 3DW3X 3GCXA 5FFNA 1AK9A 1THMA 4J94A 3EDYA 2W2PA 1VSBA 4H6VA 3DE1X 2Z2ZA 3SICE 1PTKA 1UBNA 1AF4A 3I34X 1CSEE 3HJRA 1GT91 2E1PA 2B6NA 3DE0X 3DE3X 3BGOS 5FAXA 1TO1E 3WQBA 1SCDA 3TI7A 3ZXYA 5FBZA 1KDVA 2DP4E 3VYVA 1TM5E 1LW6E 2P4EA 1V5IA 2SECE 3QTLA 4NE9A 5K7SA 1OT5A 2SBTA 3QMPA 1AQNA 3PRKE 1Y3BE 4KG7A 1SCAA 4AKTA 3A3OA 3DDZX 3TI9A 1SIOA 5SICE 1SBIA 1AV7A 1GTJ1 1SBTA 1AU9A 1GA1A 2W2MA 4OMCA 3Q5GA 1EGQA 1SN7A 4DJ5X 2TECE 3DVSX 1SUPA 3DE4X 3VV3A 4C3VA 1BJRE 2WWTA 4I0WB 4CFYA 1IC6A 1ZVJA 4LVOA 1KDYA 3BPSA 1T1EA 1Y33E 1WMDA 1SCJA 4C3UA 4NE7A 1SBNE 4OMDA 1P7WA 2HD4A 1AVTA 1V6CA 3D9QX 3OSZA 1SUBA 1TM7E 1Y48E 2PWAA 3DVRX 5B1EA 1OYVA 2WUWE
chains in the Genus database with same CATH superfamily
4YPVA 1ZU5A 1E2FA 4GE3A 3NC0C 4PLCA 4P08A 4LVCA 1P4GA 1I1OA 4UUBA 4BUJA 3AM3A 4KMRA 5LIPA 3Q6NA 3RIXA 5CB4A 1UK9A 5F1YA 4GDFA 2B0JA 3PLRA 3ZG6A 4DR3B 1UAGA 2O8FA 1L2TA 2FZEA 2G5PA 1AZTA 2ZSBA 1Y37A 3TOVA 3G2QA 5CH8A 4Y9DA 1XG5A 1XIVA 2EZUA 3C5HA 4CLXA 3ZU2A 5B2FA 4URYR 4EKEA 4Q4CA 4XGKA 1W34A 3X1XA 3O83A 1Y9EA 2OYCA 1PN3A 4QYXA 1NXVA 4WZBE 2X1VA 1I5OA 1HE4A 2EYQA 5LZ4A 5JPCA 4UQOA 2OXFA 3BFVA 4ZOBA 4TROA 1J42A 1QRDA 3LCRA 4TTVA 3IIEA 3BIWA 3DDSA 3U49A 3QPWA 1BGWA 3U60B 4UAGA 3WTBA 1IK4A 4LKOA 3KPUA 4MDHA 3N2GB 4D9IA 1EB9A 1QCYA 2H0RA 3WX0A 4ZI7A 4DGSA 1KDZA 4I8DA 2KI5A 3AUTA 2Z3WA 2ZRAA 5EZ5A 4S0XA 4PG5A 3WLFA 2ZWMA 3OA2A 4H27A 1I3KA 2JJ2D 5DBFA 3USES 2XSZA 1E3EA 3I30X 2WUVA 2RH5A 4ZV9A 1ONOA 1Q22A 3MCAA 1Q1BA 3AJ9A 4ETWA 3JARB 4I3FA 3OT1A 3FCOA 1M34B 4HGOA 1G0NA 3FETA 4QXOA 5C1PA 5HUQA 1VHTA 4XJXA 3V4OA 1Z8HA 3PQDA 5IBQA 4UNQA 2QK4A 3Q88A 5FPYA 1J9ZA 3UMJA 2O5EA 4TLMB 1IY1A 1LVHA 4RKYA 1MMFB 1BCRA 1E0JA 7YASA 2QJFA 2J0QA 3IMFA 3K9QO 5A71A 3KD3A 3IX7A 4BGIA 4DBZA 3OTHA 2QTLA 3PD0A 3V46A 3HBMA 1Q0QA 1SCIA 4II7A 4K7JA 1E18A 5FPKA 1U8UA 3LO5A 1RM0A 1GPJA 3ENQA 1THMA 3T3IA 4BMYA 4WBNB 5JASA 3U7GA 1ECJA 1QH1B 3DZGA 4D3YA 4A2WA 4DAEA 3N07A 2DXIA 2QBYA 2R00A 3AV0B 3GK3A 3WGLA 3AEYA 3I1IA 1NN1A 1OLSB 3KPVA 4NIMA 2CMHA 1RAHA 4X8LA 5IUKC 3CEJA 5IF3A 4AP5A 1PD0A 4O08A 3MLEA 4IIVA 5J4KA 4POOA 2QXUA 3D81A 4WZBA 3ZGYA 5KQMA 3OQIB 5B1IA 5JS2A 2QJWA 10MHA 1GLVA 5AESA 5A7GA 2SBTA 2YR0A 2P6NA 2HNKA 2XR1A 4Y98A 1Y1RA 4NCKA 3N0RA 4PNHA 5BRJA 1N5IA 3GWZA 1N5RA 4IBOA 1SBTA 2CSXA 1YUNA 3T0IA 2ZDQA 3ER6A 1SOMA 3ZDZB 1G0OA 1TW3A 2O3QA 3LBNA 1UBJS 4ZEOA 3N2KB 2Q3HA 5UKDA 3IYLW 3WK8A 4ZTZB 4GI1A 1QG4A 2WHXA 1TLFA 4M83A 2Q7DA 3HKEB 4JXJA 5BSGA 5JS1A 4IJ5A 3MJEA 4B6SA 2RJ3A 4V1CI 1FMCA 2CJFA 2HDHA 3I6BA 3OVMA 4IINA 3VQTA 4I99A 3M6FA 4TQ9A 2BHRA 2QVCA 4DDMA 1IONA 1HG1A 1TT7A 4ASUD 1KPIA 2CSUA 4MQUA 2IYPA 2YWCA 4KQKA 1C41A 5DV9A 2Z8YM 5J2UA 4DQ0A 2GMWA 3EVGA 3CE6A 3PXDA 4FFBA 5DYTA 4KWTA 3MHPA 1XF1A 5P8WA 5CGZA 1I0ZA 4V03A 4ZGBA 4LJYA 1GDDA 3FR8A 4PS0A 5K3DA 2WWHA 2IXAA 4H7DA 2W42A 4ZQIA 5G02A 4ZZ0A 2HQOA 2VA8A 1C0IA 2AR7A 3L7IA 4G4SP 4U2GA 4XEHA 3T35A 3B13B 3CWZA 4OO3A 1KFCB 4XH9B 1R3UA 5JNTA 1II8A 2DY0A 3T7RA 1U7XA 4TLEA 1T1IA 4IIYA 2AYXA 2E4WA 4N5MA 4NHOA 5BYAA 3T5CA 3Q8KA 1RXIA 2XA1A 4I2NA 3U44B 1KIMA 1PJTA 1RC1A 2B4QA 2P9BA 3CUUA 4X3PA 5H1YA 1QFSA 3UWPA 3PBKA 3JXEA 4WCFC 1A4UA 1DKPA 2WHYA 2Z8YA 5G0VA 1JG1A 1X7WB 3EBOA 1XMSA 2D1RA 1FNSA 3B12A 2YN4A 3S2IA 2V97A 4IF4A 4NFSA 2LBPA 1EVIA 3K8OE 4ZVLA 4XWGA 1YS1X 2XUOA 2VPWA 1HEYA 4F2WA 4DR2B 1ZAYA 3VRHA 4RM3A 1LJLA 3QWIA 3E70C 2Z1DA 2E2WA 4TQUS 1QAMA 1S8FA 5JS7A 5FA6A 1B23P 1A96A 1L7XA 4QO8A 4Z1MA 2VWPA 4GOJA 3UAVA 4BNFA 4F2DA 1UBTS 3TBHA 5IHXA 2IYAA 5AK0A 2D1YA 1NUQA 3E9QA 4WA8A 5B37A 2PYZA 3VR5H 2A78A 3G0DA 2PE5A 2Y0EA 3R3XA 1FNMA 3F1KA 1I7DA 4LF8B 1Z37A 2GBFA 1MN6A 2O3TA 4EB8A 1GFSA 2VJAA 2ZPAA 4YX9A 4BRUA 2W70A 3I2KA 3TD9A 3ROXA 2PGDA 5FCDA 4RULA 2Y0CA 1U8YA 4CMHA 1S8OA 1ZVQA 5K8VA 3GLUA 4CLOA 2RCYA 3OURA 1WKBA 4KCGA 4U3JA 4XD7D 4ZT4A 3SBDA 4OB6A 3SLRA 1GCIA 2HDNB 4NCXA 4R9RA 2PJRA 1F7UA 4LJ9A 3AUSA 1K3FA 4KVZA 3LL4A 4WY2A 2DZDA 5JCZA 5J23A 3QEMB 5HE9A 3STTA 4EPTA 3VKGA 1VL1A 2ZS7A 4KGZA 1AX9A 2G25A 2HRQA 1H3EA 3GH3A 2VDQB 1W46A 3AM4A 3AW8A 2FX2A 3LPLA 4HEA6 4H16A 5FHRA 5JQGB 4RVUA 4OHKA 4B3JA 5F78A 3LUHA 3E3AA 3S4YA 1WX1A 2PS3A 3JWGA 3PHCA 3V9PA 4AQDA 4IMIB 4L3OA 3PQCA 5F5LA 5SY6A 3AL0C 3IUBA 3HADA 2FRDA 4OKIA 4AAYA 3ZD6A 2IUEA 3B85A 3EGWA 4MVJH 1WY7A 3KOXA 4BMPB 1U7WA 1VZ3A 1XHFA 4QIHA 1SUPA 5ETJA 2FFRA 4C3VA 2CLSA 2YMQA 4MCJA 1MKYA 2Z9DA 1G98A 3B5JA 4JKYA 1OY1A 4L1KA 5JNLA 3L92A 3OD1A 4CKCB 5AXDA 121PA 1ZSYA 1QKIA 2D62A 2DQZA 4FGSA 4KMSA 1TLLA 4MWEA 4Z9YA 4ZVVA 4X00A 4BFVA 3WNVA 5EVJA 1NBME 3MSCA 2XMCA 4F4CA 2P0EA 2ACKA 3GJXC 2EQAA 3EPKA 1COWA 2P6OA 2VRBA 2B3DA 3D7RA 3GQBA 4BO0A 1NIPA 5TY0A 2XVYA 2AG1A 5C7LO 1TA4A 3JAWB 1G41A 3JYHA 4MP3A 1KQ3A 2X8JB 5I01A 3VJRA 3H9EO 2D2XA 4LQCA 4DYDA 1PZFA 3OZRA 3W3AA 4YRIA 4UQLA 1L7EA 4WJLA 4DV7B 4U2EA 3WLPA 2BFWA 2AYYA 5KYWB 1DBQA 2NQ2C 1GUAA 4ALIA 3SK0A 5CEJA 2BM0A 2L82A 4EG1A 4JP1A 4YRQA 2NPOA 1CUAA 1EBUA 1O6ZA 4UARA 3OJWA 4ED9A 4QPDA 1C5KA 4DSUA 1P7VA 2JCYA 1F9AA 4CQMB 1BYIA 5EL0A 2IP4A 3OZAA 4HRAA 5KTYA 1DAKA 1JEEA 1VJGA 3M6LA 1AZLA 3C6YA 5CCEA 3QU5A 5TT0A 2DFVA 4JI3B 1T9CA 3IJPA 4J0KA 4NS1A 5JNSA 3A26A 1DX4A 5B1HA 2VF8A 4EGSA 3D31A 4UAUA 3O8QA 3N87A 1Y6JA 4PHGA 3O4IA 1P17A 1I32A 5FO0A 4KAFA 1FFEA 2LW7A 1E0DA 2Q3EA 3QV2A 4B8ZA 3HEBA 3H1AA 4QX6A 1PFUA 3AFIA 5KTOA 4Y2GA 2EW2A 1DTWB 1P9WA 1R6XA 3IURA 2JAXA 4Y2XA 4DAOA 1IHUA 4UUAA 5K9ZA 4AMYA 1P3JA 1XTKA 1JKJA 1WOMA 2FJPA 3W1VA 2DLCX 1BGVA 3KVRA 3U13A 4HRYA 3TR6A 5CA1A 3U6BA 3DCJA 2WQ6A 4UDOA 5AR1A 1JTFA 2OQ2A 4F3YA 2CXHA 3OLVA 4Y1GA 3EGVA 2IIQA 2H06A 4YCMA 1E61A 4YUYA 5HK9A 3IHWA 3G9UA 4OAQA 4G86A 2X3YA 3BCHA 4FW8A 2AEEA 2P6UA 1DC7A 4NCJA 1G291 2BFBB 3UUWA 1IEVA 1XYGA 3EOBI 3EVNA 3E8MA 2D1SA 2TMKA 3FNRA 3KPJA 3OICA 4Q3EA 2PUAA 1MB4A 1I9CA 1R0WA 1UMCA 4HXFB 1VIYA 2MSWA 1T9DA 5EFZA 4GBMA 5JCPA 3JS5A 2BEVB 4CUJA 3SE7A 3SICE 3G8DA 4E1AA 3WYDA 3OFSA 4QDJA 4EL5A 4ER0A 2VJDA 1ULZA 5EE1A 3TLGA 4D4HA 5DNYB 3ZWCA 1DVRA 1O87A 1GZ6A 1SCDA 4UM8B 4DJ5X 1N1EA 3N7AA 2RH9B 4QYTA 4ZRNA 1CY6A 2PLWA 1FU8A 2DYKA 2ZDGA 4FINA 2B92A 1R0KA 4YQYA 3HO6A 3K4QA 2V4ZA 3S44A 5A5DA 4QVIA 3OEED 4MMXB 1Q84A 1XTJA 5C5DA 1Z33A 2ZVPX 4MQ4A 4PCLA 4B79A 5FBRB 1WHSA 4CLEA 5KTPA 2O54A 5B7NA 4XYBA 1SA0B 4MK4A 4ETIA 2YJ5A 3PQ8A 5LZ2A 3BE5A 1A72A 1W2HA 3COPA 4HB4A 1XJCA 4CMKA 3M83A 1JYFA 1QDLB 1I80A 1Y33E 3ENKA 1UJNA 3GLFA 1EQ2A 3OZCA 1O0CA 5KMGA 1PHRA 4O2BA 3V55A 1AO0A 5JCOA 1HKUA 3P0FA 1B3BA 2F00A 2HLNA 2ZKIA 3LDUA 1E2KA 4JEIA 4DMUB 4UM9B 4GMHA 1KOJA 2J0UB 2HAEA 4J16C 1YJQA 5F4ZA 1MJ5A 2WIGA 1NBAA 1ISIA 3SS7X 5JS6A 3T41A 3H5RA 1JECA 3D1JA 2QMOA 4PYRA 1Y8CA 4FKMA 3UJBA 3WZ2A 3T38A 4XM1A 4BDSA 3QA3E 4IQFA 4ALNA 4E2FA 2V7PA 3OZGA 5IT9A 3BKXA 3ESCA 5EKSA 1ODKA 2VXCA 4MS3A 1RP1A 3BULA 3MAJA 2XWBF 3ML1A 3CRMA 1DXHA 1DBVO 1E1YA 2WSSD 1WXHA 3G2IA 3NBXX 4FYKA 3BFPA 4TXNA 5CPFA 3W3ZB 4NLLA 4PR0A 4U00A 4CEHA 3UICA 3CLUD 1VOTA 4H7FA 3O2JA 1LSUA 4EG4A 2B8NA 2ZPTX 3ETDA 2CE2X 4OPMA 5FPTA 1LLFA 1U99A 2ZYVX 3IS3A 3NAQA 4JASB 1EE2A 2XRYA 3A4NA 5ILGA 2AG8A 4FDTA 2ONZA 3C3MA 3EIOA 4EGQA 3I3OA 3C43A 2FN7A 3JWHA 4L22A 1MAUA 1RCFA 2HF2A 2OV8A 2P5SA 3QK7A 5CNJA 1YZHA 1E5XA 2FFHA 3IILA 4KN8A 2Q4DA 1A8QA 4OJYA 3JWIA 1XZBA 1B0UA 2QYSA 3BSYA 4RYDA 1HE1C 4UCWA 3CX6A 3Q3EA 4HBZA 3HY3A 3L0PA 4WOBA 1CQIA 1J7JA 1L0BA 1EM8A 1L8XA 2Y1OA 3THSA 1JG2A 1N3IA 2XXBA 4MWZA 4QJ5A 4CM4A 3ACDA 3TUZC 3KXKA 2D2FA 1O57A 2D1FA 2J3LA 3LBAA 3O31A 3IHKA 2DFDA 4BFCA 3KSRA 4BB9A 1ZXLA 1XCOA 2ID9A 1M0WA 4TWJA 4CMEC 4ZK6A 3KNZA 1RQ2A 3QX9A 3N6XA 1LRJA 1R0ZA 3A6JA 2VQFB 2FSVC 3ACCA 1ZJZA 2F59A 1FNDA 1TU0A 4X91A 1SVWA 3ZDXB 3BX1A 1VL5A 2JLXA 2GPJA 4E2YA 5EJ6A 1HXHA 3O82A 1JQLB 5TPWA 3TBKA 1WMEA 3VR3A 1U8ZA 4KE6A 4YBRA 3SSAA 3HJHA 2FETA 3WGTA 1MF7A 1L4YA 3DW3X 4MW9A 3ORHA 4UDNA 4XD7A 4ZODA 5D84A 5IM5A 1LS1A 2NSHA 2R8YA 2B5OA 5F33A 3T7AA 3K1YA 3IVRA 4YRCA 1AF4A 5K0BA 3OE7A 3W6PA 2H1SA 3IDAA 2P7HA 4QRHA 3HB7A 3O94A 2BTQA 5K6AC 4IZIA 3AEKB 5J5CA 1QRUA 2GZAA 4EY7A 4W5HA 2BP7A 1GGMA 2DP4E 4YQFA 3K9FC 3SC4A 4JROA 3PTAA 1ZD8A 1PNQA 4M7PA 4WNAB 4GWLA 5K0JA 2H0AA 1FOEB 1OT5A 3C2QA 2XB9A 3DCYA 3UPUA 3GPCA 1A7UA 2WIBA 5BN5A 3HR7A 1I2MA 1AIPA 1X7YB 3ZDFA 3OLYA 2ASVA 4K9LA 2VUIB 2FN9A 4OHOA 1IC6A 3P1JA 4EFNA 1BEUB 4IDHA 5KNCA 1VMAA 4Q9KA 3TRFA 2XEDA 3RF6A 1J1UA 4X1OA 3DDCA 2XZTA 1HTBA 2RIRA 1X1BA 1NVAA 1XNJA 2BTOA 3JQ9A 4PR3A 1OYVA 1ZGHA 3PQ4A 3TE7A 3DMFA 1BDJA 4UZFA 2R11A 4O6VA 2C2MA 4MO9A 2FMXA 4JJFA 2XOKD 1MAWA 1OLOA 2OHVA 2EIXA 2HUNA 1KEVA 4DMFA 1SVIA 2VUTA 5KX5A 3EGXB 3KWJA 1XB2A 1UP6A 4FE7A 1NVKA 4JGBA 4YN3A 4B7XA 3EPJA 2XTMA 4N9WA 1A8SA 2Z6VA 4HVAA 3JALA 4GOMD 1B1CA 2XWJI 1C3JA 3EMKA 3NGMA 3L7CA 3A1NA 4IIBA 4BFLA 3EIEA 2G72A 2R6GA 3FYTA 3KX2A 4OHWA 1GGNA 4YMWA 2WOOA 1Y9JA 3ANNA 2PUEA 3CGWA 1M0SA 1YVEI 3EWIA 5F3DA 3RW9A 4BRSA 1E98A 2FPGB 3V1LA 4D9GA 1R5JA 3OZVA 2QRZA 2VDLB 4Y0NA 4YJFA 2VDRB 5J58A 5DLPA 2E21A 4HV4A 2QN1A 1FFYA 3KKNA 1QGYA 1EVEA 3C1AA 3VV2A 1QIHA 2VJOA 2ZRBA 3E2IA 2QX6A 1R4MA 1SIWA 3L1IA 4P2GA 3BXFA 1KE2A 1PJBA 1ILEA 4H35A 5K3AA 3MINA 1GTZA 4XOUA 3T34A 2J5BA 3RU7A 4X8OA 3TOSA 2FQ1A 1CUCA 1EQUA 1LPNA 3GP5A 2JRLA 1ZWLA 4FIZA 5COAA 1MO4A 3L0BA 4ZO9A 5D8DA 4PIMA 1J2EA 4O4IA 3OMXA 3PEFA 4OKSA 2GPYA 3HSKA 2D1QA 5TGZA 2NUTB 1JQKA 4F11A 1SKAA 2H1CA 3ZK9A 4LRWA 5D3MA 3ZV5A 4OLBA 4F72A 1ZCBA 1FLDA 1KORA 1JBKA 3UBMA 4BV2A 2EEPA 3L1VA 1JEOA 1U90A 2YZKA 4UTXA 3IMEA 4F91B 2BV3A 1W48A 4IEFB 1RZVA 3TMAA 3WKEA 4IZOA 1ADCA 2PGLA 1WLSA 2JIZA 4XTCS 4Z7NB 6REQA 2UV8A 4IDPA 1M74A 3DLCA 5L4NA 1CS0B 4DILA 4WCVA 3RT9A 2DTEA 1L7NA 3C41J 4YB8A 3MRTA 3NDIA 4EYOA 1Z8FA 4LCJA 5BN4B 2H57A 4EX6A 4UCXA 3T5TA 3L6CA 3ZQKA 4YRPA 1K06A 1ZGBA 1IBRA 3OE4A 4Q1CA 3BB1A 4A36A 3R5XA 2I1WA 1WCXA 3E9YA 4RYLA 4WW0A 3K70D 4Z7QB 1F8GA 5C3UA 5AJHA 3FNHA 1T2CA 3BWXA 4URXR 3I9KA 1K0UA 4K6HA 4OMFG 1TYDE 2QAJA 4NZMA 4M8NE 1M10A 1CCWA 3LJKA 3E2MA 2E9SA 4Q01A 1Z0UA 4DMRA 2CGEA 3Q85A 5GIOE 1PV1A 1KZ9A 2PBRA 4C88A 1CVRA 3J80A 4KMMA 1TCUA 3ZW7A 5T5QA 2C31A 4GQAA 4CDMA 1MZPA 5E6UA 5K01A 4W6QA 2P9YA 1L8AA 1C8BA 1R4NA 2QG4A 2IPNA 1CE8B 2PVSA 3RSZA 3FSJX 2EJVA 2F3PA 3NX4A 4QHTA 4CF5A 1CUDA 1ZGZA 3F6RA 3RJ9A 1IN1A 2B82A 3JZIA 1JA0A 4P0PB 3D54D 1QH8A 3QY0A 1NX9A 1TM3E 2IZ7A 3HU1A 3LPCA 2A5LA 2IH2A 2VCEA 3RABA 1U3TA 4RC9A 4D44A 3UXMA 3V1NA 5L4SA 2AKAB 3JU3A 3QW4B 4M8IA 2XWSA 4RF3A 1E2MA 2WD8A 3BE8A 4QPPA 4J3FA 5CX1B 1HSOA 2BCJQ 4JQCA 2HRDA 5FBHA 5EGSA 1ADJA 2IYYA 2NU8A 2CFIA 4DQDA 1KAHA 3IUQA 1Z73A 2PBFA 3KVNA 2WQZA 3OFNA 5AUPB 1BMDA 3IB6A 3QELA 3F98A 2O3UA 3AP1A 4X71A 3SGLA 3LQ1A 1P81A 3QEOA 3ZDAA 4JCCA 3B52X 2Y99A 1ZK1A 2O9JA 1JJIA 5JMWA 3IALA 1PR0A 1R27A 1A5AB 1JL3A 1I7QB 5KOJA 1PK7A 3GVHA 4IOJA 2R97A 3D4OA 2YZNA 4H6PA 4L8YA 1KJ9A 1OILA 4WN9B 4ZCSA 5KBYA 2AJBA 4O4IF 1JFRA 5KWIA 3S3TA 1DX6A 3ADPA 1USGA 3AX6A 1V48A 1DIGA 1UK6A 1ENYA 1ZFNA 2C04A 1NJ1A 2J5KA 4FMBB 4ZU6X 5AWFC 2XKKA 3KQQA 2JAWA 2QVBA 3AM1A 3C6ZA 3BE6A 4KO3S 1Z4MA 4GIBA 4DCGA 4UEWA 1GAQA 2H9IA 4RVSA 3TOXA 4B80A 3GLSA 4JOCA 4H1TA 5K0SA 1TEHA 3EC7A 3CVYA 2ZEJA 1YJCA 1REQA 2UZ3A 4HAVA 4NZNA 2XUJA 2AOVA 2AZ4A 1O54A 3EEIA 4R4JA 5EHGA 5F1PA 4EBBA 1XZQA 3GYBA 3KFXA 3NBYC 5DTMA 3V5NA 3M89A 4A2CA 2ETVA 1K75A 2Q5HA 4JL6A 3H84A 5ITWA 1T8YA 2YHBA 3NO4A 4JB8A 2I4LA 3IPRA 1VG0B 4OVKA 3SYKA 1V45E 4KQ9A 2Z58A 1ZM7A 3I2HA 1XVIA 4UUOA 4YRGA 4G9BA 2C2OA 1QBGA 4YJ2B 2PGIA 4HNRA 2AQKA 2EG9A 3I1FA 2LV8A 2Z83A 3FLAA 2CZCA 1WQ1R 1ZG3A 5ALLA 3EPLA 3EPRA 4B3TB 2YZ7A 4ZHSA 4JK3A 2R2AA 3LT5A 3PQ5A 4PPGA 2BGIA 1HF3A 2AI2A 3QF4A 3WMXA 4BNKA 2G07A 2ZIEA 1Z34A 4O4HA 2QN8A 3ROEA 5GONB 4MVJF 3DC2A 4HZGA 4FMCF 2XCUA 4E31A 3LNCA 2I8LA 1FX0B 5JAIA 5JTUA 2V3VA 5I8PA 3H2GA 4QYIB 2QTVB 4LC0A 4PZLA 3EIQA 1GZ3A 2A9PA 1Y1PA 2JD1A 4LK3A 1EBFA 3WKDA 4CMGA 4OFXA 4D79A 3EH1A 2C3MA 4LWQA 5JWRA 4GMXA 3IT3A 3K73O 3GLIE 1E7QA 2HEIA 1A50B 4MQFB 3FPJA 5KPJA 3PSAA 6ABPA 1E59A 2Z3ZA 1WS6A 1V5IA 4C07A 7ABPA 2FMKA 4CCYA 3I5UA 5BUCA 4ZKDA 3UJ7A 4EHHA 5JYBA 1X8JA 2ZUEA 3BQ9A 2RKWA 5LP6F 2GFQA 3OTIA 621PA 3WI7A 1Z88A 3DPIA 3SHOA 4LDAA 1E9VA 4CLOB 2CXUA 3CGGA 1X7DA 2QM7A 1WSAA 1A4IA 1TF5A 2BDTA 2CMKA 4YJGB 3KQNA 2OYRA 1F8YA 3OQ1A 2OG1A 3GROA 3U2QA 4B3BA 3WDMA 2X8AA 4UPEA 1OVMA 1ACMA 1BU5A 1CDOA 3L40A 4R8KA 3T9EA 4ESOA 3UTDA 4H60A 1EESA 4RJTA 1FMJA 2HTEA 4O4JF 4C7BA 1S2NA 1Z0KA 3NALA 5CX4A 2RGDA 3NUQA 4IO1A 4NMLA 1WNFA 4FD2A 2ACEA 4LY9A 5LLTA 3K70B 1KJJA 4FQ5A 4TLCA 3FPHA 4GPIB 1S3GA 2INGX 4I36A 3VPXA 4DIBA 1CZNA 3A27A 3H1EA 3Q7RA 4U5XA 3CVXA 2PJZA 2VYND 1YI0A 1SCNE 1YMQA 4G1CA 5H8WA 3LKZA 3ZHRA 2PA0A 4BEWA 4YRAA 4MUKA 1K3UB 1YXMA 1NQ5A 4AX8A 2B98A 2DTDA 3UFBA 3LUBA 4MVJG 3DOHA 1INLA 1Z7EA 1EX6A 2EW1A 3ECAA 3PNKA 3B1FA 3A4MA 3ICCA 3QF7A 3K9NA 3P94A 1UXGA 3LNTA 3QUSA 4BO2A 4LC1A 1JFFA 5AXBA 5JZVA 1QLJA 4EB3A 2PL9A 3GUHA 2VDVE 4YUVA 3DTNA 2PL3A 5AQ1A 5IG2A 2VSOA 4JD5A 2KSQA 3THRA 1DADA 1Z68A 5JXHA 3HYSA 3QBTA 1P5FA 2EBWA 2QLJA 4LXIA 2V74B 3N5CA 1KYIA 5I7UA 2BONA 3H9GA 4UC0A 2XXAA 3O3CA 2Z5VA 2DJ5A 3CB2A 1KEEA 1HNZB 1CJVC 3AF1A 1NUHA 1U5CA 4BZQA 1E96A 3O1IC 4JYMA 3DAHA 1GJRA 4F3NA 4ZIRA 2GZ1A 2A0XA 4LSGA 2FE4A 5L95A 3IXMA 2VHZA 3KUKA 4ZYXA 4DCOA 2WM8A 1EVZA 3F6BX 3AG6A 4QUDA 1OPXA 3GUUA 1TW2A 3PTLA 2AX4A 1JSCA 2XE7A 4R8MA 2O50A 3EVCA 1M2OA 1Y6RA 4G97A 1Z8NA 1ZZGA 4JI1B 2Y68A 3B51X 3R0XA 4HN2A 5IDYA 1W76A 2H3EA 2WG2A 2BI4A 1PSZA 2WE7A 3S1AA 3G8AA 1LVGA 4RV5A 1IM5A 1N2EA 4ZXFA 3ELWA 3K5HA 3TZQA 4Z53A 4B4WA 2G7ZA 2QAGA 4HDOB 4L8WB 4J9UE 4UHHA 2Z4TA 1T4MA 2PUTA 4KQIA 4Q3KA 3FBGA 5IXSA 4CG2A 2WWGA 1TQHA 3AWIA 1OBOA 4ZOLB 2PFKA 3KQPA 4CCAA 1BHQ1 2I7XA 5F7JA 3QKRB 4DS3A 1J5EB 2ZJ6A 1P61B 4IHJB 3JTMA 3N1UA 2X42A 2JB9A 1P44A 3L8MA 4IIUA 2AQHA 4JT9A 4N5NA 3QVOA 1ABFA 1GKYA 4PRZA 1S3IA 2WSBA 1P4RA 2BMDA 3PVCA 1SQFA 2B25A 1HDGO 3FPEA 4MUHA 1DO8A 4XYGA 4L5BA 1AV7A 1YIAA 3FHJA 1TGVA 3FSEA 1FRVA 2AG0A 2WFLB 2OK7A 1F2TB 1VI5A 3CC8A 5IYZB 5JALA 2VR1A 1C3VA 2KBFA 1XNHA 1YR6A 2O2DA 1TFRA 3FDZB 1J2YA 2G8LA 4TOIA 1NQWA 3IMKA 3SR4A 1D0VA 2YWJA 4OMUA 1DBRA 4PSUA 1IIBA 2A5YB 2PWAA 1Y81A 2Q29A 3MRVA 4FPXA 2G9UA 4RHEA 4WESB 4C01A 4S04A 4UFOA 1YBHA 1G3QA 1EUCA 1CEXA 4LF6B 1GQSA 1F8FA 1RI5A 1OU4A 3GVPA 3CW8X 3TR5A 2Q4EA 4BLTA 3TLGB 2QTTA 2EVWX 1NATA 2HY7A 1KDRA 2ZSUA 1JJ7A 1NKVA 2I2XB 1E6KA 2QPAA 1W6RA 2PRKA 3Q9UA 3O95A 1MAVA 2EEZA 2XV1A 5EKUA 2JFFA 3G23A 1LU9A 5MN6A 4NV0A 4ZQBA 5I5GA 5A5GA 4X60A 4ZXPA 1RRGA 2OKCA 3IAS6 4RGQA 3BREA 4RIGA 2M32A 1EKXA 2NT3A 2JFWA 4BC1A 4DOMA 4K86A 5FTWA 3WLJA 1WPGA 4YPOA 1ID8A 2XE4A 1YTUA 3T4XA 2UXBB 2V7BA 3OIGA 4FMPA 2M6LA 3LCMA 3VVCA 3ASZA 4P38A 5ALDA 2IP1A 3R5HA 3LP8A 3KSDO 1C14A 4YEDA 2H1LA 3MFQA 4HDNB 1U1IA 4B35A 3PVSA 3U48A 3O21A 4QT4A 4JEMA 3GFTA 1G3IA 4L85A 2PMBA 4ZANA 4ZVKA 5JD3A 3JQBC 4BZZA 4EGJA 3RAJA 1YS9A 3GGCA 3K9GA 3BSSA 7REQB 1AA6A 4MQ5A 2A9JA 2N3ZA 3EGDB 5AW1A 2Q2VA 1UC8A 2I2AA 4QUKA 5JY1A 4L50A 5JDCA 4BUCA 4FGZA 1KJ8A 1O1YA 1IUPA 3VMMA 1V35A 2GM4A 2VAXA 1VQ1A 4PXSA 2DQKA 4DCNA 1J2UA 3ZJUA 1JIUA 3C24A 2HU7A 3PUZA 4ZI2A 1ULHA 3AU9A 4I3GA 1KSFX 2ARKA 1T9KA 1E5VA 1JIVA 2BEWA 1F6WA 3JATB 3O84A 1L7RA 2XDAA 4GLJA 3BD8A 5ALZA 2HHLA 1T2EA 1EFVB 1VIVA 1NVFA 3U9TA 1IPEA 3F7TA 3PL5A 4RJKA 4LJLA 5FL3A 4ZJPA 1QUFA 4LY0A 4P4GA 2OXTA 3WTCA 5ARBA 2G17A 5IVIA 2ATIA 4M0KA 5KNBA 1TCBA 2JEYA 1ZRMA 2GD0A 3NHUA 3LECA 3T5GA 4BNUA 1YK1A 2IQIA 4S05A 2HN9A 3OM9A 5TV2A 5CCDA 1Q0TA 2ECQA 4D25A 2FOLA 5LYJF 1TJPB 3KWMA 4LTMA 3SFVA 1T26A 5GJBA 3ZV4A 2AXPA 1DAPA 3C3JA 1BWSA 1O6CA 5C9ZA 4M0FA 1Z06A 2CKDA 2R6JA 2BL4A 2CBGA 1NL3A 3WWOA 1AV6A 3ZIDA 4KQ1A 1J0AA 5FT9A 4D56A 2KHZA 1UT8A 2CE7A 1KQFA 4N48A 4G23A 1ZN8A 1ZUWA 4ERXA 4JH0A 1O96A 1FBTA 5CG1A 2C2ZA 1DIRA 1YH3A 2R96A 2ZT7A 3R3WA 1OLSA 3GFGA 3NORA 4L6IA 1R00A 2Q9UA 5CNMA 3OFJA 4Y1FA 1OBCA 4OM7A 3SDBA 3ZE9A 4E1VA 3W8RA 1BYUA 2DWUA 1PR4A 3DS8A 4MIOA 4KKXB 3WV4A 1T1EA 4MI6A 2YXDA 3MUOA 4Q21A 4LBYA 3BL8A 1U9ZA 1RWKA 5FWDA 4UD6A 5D1NA 1DP4A 1A27A 2LZ0A 1VLLA 4JBIA 5EYPB 1M5RA 2QSYA 2P1ZA 4UHDA 2QM8A 4CLRB 1DEHA 2WSMA 1VYVA 2KLBA 1N5KA 1AMNA 2FLWA 2V7GA 4IVRA 4PGAA 1FUYB 4TMTA 2R751 5JHGB 1QTRA 2MYTA 1FMFA 1AE1A 2XWQA 4LXUA 1JR3E 2BGJA 3EZ2A 3WMRA 2OV6A 3ZXXA 1Z7BA 4RHCA 2VPTA 3GLTA 4UREA 3TZ6A 1D2EA 4PO3X 4W5TA 1EXMA 2QYOA 3AHEA 5KYVA 2HHCA 4GEGA 1YBFA 1PDOA 2DUWA 3NIDB 1ZCFA 3KJQA 4OXRA 5HKBA 3O4VA 5AFSA 4PF1A 3S81A 2WHEA 3ND7A 5KOIA 2QF7A 5FP0A 1LLUA 5LZ9A 1OXSC 2NV2B 3IPCA 3OPVA 4K46A 1XMQB 3Q3IA 2JGRA 1YT5A 2BR5A 1QOZA 2QL5A 2QKYA 3VGJA 3BWYA 5HXAA 5EN4A 4WA7A 3V48A 3VVBA 2FWNA 1U8TA 3K53A 3IVMA 5E8JA 3FWKA 3S1SA 2YS7A 4W9NC 3O1HB 2V5AA 1IZ0A 2IKQA 3DE2X 1II8B 3DO6A 2G4LA 1L7AA 1SBCA 1T0PA 3CXRA 2FQXA 1H5UA 3BJMA 3EUWA 3IOEA 3KOYA 4YAJA 1W88A 3AI7A 3BHIA 3TQIA 3USZA 3FKQA 1YULA 4E94A 3OC6A 3A05A 5LP1A 4BX3A 1V25A 2WTUA 3M4JA 4I50A 1FS4A 5BP7A 5I7EA 3JVIA 1ZKDA 5JAUA 2ZBQA 3U3ZA 2X15A 4ESVA 3OT4A 3WJAA 5FUYA 3GUVA 3RRJA 4EFMA 2X0IA 1G8GA 1SUFA 3ELBA 1RI1A 4LDQA 3TIVA 4BJHB 2YBDA 1GA6A 1NKTA 1NI5A 3FGOA 3PPYA 4I5EA 2FJ0A 3EZYA 5BORA 1U1GA 1JS1X 3RFVA 3E23A 1B6GA 5BRNA 3ONFA 3BF8A 2ACWA 3QVSA 4Y9TA 1IB6A 4HAZA 3KWFA 4P7KA 4ZARA 3W2IA 4MW2A 1NAIA 4INPA 2UKDA 3AOEC 4WADA 3LIIA 3AMVA 4TQGA 5YASA 3WAJA 1HQCA 1UXOA 3HNPA 4PXAA 1EVYA 2BC9A 4R9VA 4WZZA 2Y9PB 4NP6A 2XUHA 4KO2S 2AFIA 3MMZA 2E1PA 1NJGA 5AK6A 3OSUA 5ALPA 1UKZA 1V26A 1UFRA 1J0BA 1UMDB 2XLCA 4BMSA 2IQ5A 4G9EA 4DQVA 2C92A 2R84A 1WP9A 2I1VB 2AVDA 4EATA 2QNIA 4NQRA 1OX5A 3HWRA 5EEGA 3TLKA 4UTOA 2FN3A 3TNLA 5AVZA 2C42A 3IV7A 3L4KA 1OI4A 2BFNA 1NSTA 3KZCA 4H15A 2QP3A 2D2IA 3D4PA 2R6DA 3R23A 4Q9AA 4QEKA 3UTCA 3K0FA 5FULA 4KDEA 4DANA 4FLMA 1JEJA 2I0FA 5HQ3B 3E7DA 1XDWA 4GYKA 5BSVA 2QP9X 1N2JA 3EQ6A 1JKFA 1TC1A 4MKHA 2O8DA 3D9QX 1MUUA 4BNDB 1SO8A 4XCQA 2Q9AA 4HNVA 1YIOA 4XIGS 5JIBA 3GB9A 1T3GA 4LE1A 4WCDA 5ALRA 4O1IA 4FYWA 4YCDA 3G2MA 5EMKA 3R9XA 1VPTA 5HCIA 4JP2A 1D1QA 2ZZNA 4ND8B 4M0MA 5IWCA 5D86A 1WY5A 2AN9A 5CVEA 1SHTX 2WVGA 3T4EA 2QW8A 1WB4A 2WA2A 4TSKA 5EPUA 3A3YA 3MGAA 1WCV1 1EK0A 1QK4A 1PJRA 3FYUA 2YY6A 2VHYA 4C4ZA 4KU4A 4MUYA 2PTGA 4OGKA 3E27A 2GJKA 2C2YA 1KH1A 1RLJA 3CEHA 4NBRA 3VBEA 4KXMA 1IY8A 3BDVA 4A8PA 1ENZA 4BO9A 5CA0F 1F48A 3S5UA 5KQGA 1T5DX 2IOHA 4FGJA 3WAGA 1ESDA 3V34A 4ENTA 3AF0A 1K68A 4P33A 4Q05A 1TDJA 2J48A 3EVBA 4MVCA 5DB4A 4GMDA 3VH4A 1GRVA 1VM6A 4KSBA 5AW2A 1ZICA 1G16A 4CMIB 4OIMA 3H19A 3P8ZA 4UW9A 1L3CA 4LOIA 3WIVA 3JQDA 2K2WA 5AKIA 4YJDA 5L9AA 1YR9A 2ZRLA 3SIXA 4ZZ1A 3HL0A 1JXQA 3QENA 2R4TA 4GC5A 4BXOA 3C6MA 5CEEA 3TIXB 3EFHA 3KHTA 2A2ZA 1QM5A 1ONNA 4OFBA 1ODCA 4NBVA 4F3RA 4CQMA 2M2IA 1G8JA 4N18A 1NQVA 4L75A 3S68A 1H4SA 3TFWA 4XR4A 1O6BA 1PEYA 3CZAA 4G2NA 4RADA 1S7CA 1FCJA 1WEHA 2W8ZA 4HDAA 3UKOA 5AW9A 2G1AA 3DLIA 4N3GA 2IS4A 5LA6A 5FPPA 1DWOA 3H8JA 1GVNB 4XWAA 3P9SA 4JR0A 3T5BA 2CDBA 4K0KB 2YW2A 4RANA 1UDBA 2EL7A 1JTEA 5B6PA 2JFZA 4Z0HO 3P5SA 4IFBA 5GZ6A 3WHLA 4EUFA 3NVDA 1D4OA 1E20A 1QNLA 2Y67A 4MWCA 4PSCA 4ALLA 5K8IA 1IM8A 2OO5A 2BTEA 3A0RB 4PFJA 3I52A 1F2UB 3AP3A 1SKYE 4NONA 3IT1A 3QE3A 5AVWA 3V7FA 3VU3A 2NTYC 4O4JA 3PR3A 2DKOA 2M98A 2NTVA 3AF4A 3I2IA 1HETA 2NOAA 13PKA 3A6DA 3L4SO 5BW6B 1IOZA 2QL9A 3UVEA 2PO5A 4R16A 3UJ8A 5AW8A 4S1NA 3DMTC 1JKIA 1VXRA 3L8ZA 2ZBFA 2O2EA 2O8FB 5ECGC 1T9GR 2V58A 3FSGD 4F5WA 2KS6A 2R1UA 4NICA 3IBYA 4H1VA 2OHIA 3ESRA 4RHFA 5E7JA 2I2WA 1T6XA 5CG2A 1R3DA 2XZLA 5C8VA 3D7MA 5LSAA 1I2CA 3CXUA 3D3EA 4RIFA 2UDPA 3RVKA 1LW6E 3SNKA 3WVNA 4I4CA 1D09A 1U3GA 3RTAA 2DR0A 2H8KA 3MGBA 3X2SA 1U3FA 2QMQA 4G5RA 4B8YA 1QQTA 3EHEA 4DL9A 1X14A 1MG0A 2QGFA 3KEMA 2BIFA 4DCVA 1C3EA 2G0NA 5F51A 5IBRA 1DAIA 3FGNA 1UBCA 4B3SB 2RAVA 2LCIA 4I46A 1J90A 3G88A 4E21A 2WWXA 3EMBA 5A0TA 3I5XA 4ZFNA 2FAXA 4MCHA 3PE6A 2HSJA 1C3OB 1FTQA 1UCFA 4QOFA 2DWPA 1Z13A 1P4JA 2I4NA 4D0GA 5K05A 2J3HA 4A9AA 1D8AA 1GU1A 3U7RA 5L45A 3BBPA 3Q5EA 2I1QA 5U4QA 4YJ3F 4R54A 1VBKA 3RVBA 1L5MA 2VXOA 1N32B 2XYGA 2GAJA 1T0UA 3KG2A 5ICCA 4RWZA 3MWEA 3N86A 4UBMA 1N2BA 4KX3A 4YV2A 3TTVA 5CVVA 5C8DA 1L6RA 1JUDA 1OVGA 1ZLYA 2VHEA 3GPLA 2BR4A 5K6AA 3HBFA 4R8LA 3ZDQA 2XZDA 4EQ6A 2DLNA 3AWDA 4FFNA 5DTJA 3RM3A 1ZM4A 1P77A 1V5EA 3AF2A 2IYQA 3L9WA 4IYJA 1CUYA 1T1GA 2JHCA 1JIJA 5AVJA 3K20A 3ODPA 1U1EA 3H2YA 2DBZA 4RL4A 4JJ7A 3NYWA 4JENA 5C7YA 4F6RA 3HYCA 3UAOA 1P18A 1X9IA 1QANA 4RVNA 2CJYA 1KO4A 1F2DA 1KK0A 2DU8A 4CGZA 3LWZA 4BAUA 4KX5A 1JKMA 1QMGA 1GQOA 2ISCA 4G0YA 2N1BA 4S0ZA 1V16B 4RK1A 2RG1A 4OQMA 4QLOA 2W6IA 1XA4A 5ALQA 1ZGGA 4AJNA 4D97A 3I9V1 3DB1A 5E3HA 1NZFA 3HG7A 5CP8A 1PK8A 4Q3DA 4CM9A 4B43A 1YDFA 2V4MA 3AVOA 1PGPA 4HX5A 1KZ1A 3HUTA 2YZGA 3M3HA 4GWGA 5ALXA 4R0NA 1IFXA 5G4KB 5HIJA 3VPHA 4EHNA 3PPVA 1W49A 2VNKA 2B3TA 3OQ6A 3HB9A 3L0ZA 1UPUA 5CLGA 4D9FA 4TTAA 5JDIA 1QS0B 4FMCB 4XQ0A 5JMOA 3G9ZA 3ECSA 3F7OA 4LA4A 4QBTA 1O4WA 3QYPA 4IUYA 4C1NA 1E3WB 4FCWA 4G9GA 3DE5X 1KGSA 2GBLC 1M2VA 2QTCA 1DKOA 1RWQA 1V47A 4I8XA 5KSOA 3AJAA 1CPYA 3L3BA 4V24A 3O73A 4RTPA 4EKIA 2B5WA 2JAHA 3NTQA 2D7JA 3TCXB 2HBRA 1BKSB 2CV0A 2YX1A 4U39A 4ITUA 4B46A 2ZWOA 1IOWA 1Y1SA 4RO0A 3IAAA 4PAWA 5I51A 2CFRA 2O8NA 4DJAA 5DXFA 4EP1A 1WJGA 2Q3FA 4EMSA 3BWEA 2VFAA 4LS3A 2H48A 1U0JA 4OHPA 2Z2ZA 2HH9A 4OH1A 3X1WA 1AXGA 1RZUA 1TMYA 2EF1A 3CJTA 3GRFA 2ZBPA 2ZSIA 4XIIA 5EXPA 4ZCMA 5REQB 2J4CA 1RYBA 1UKVY 3IXQA 3KOWA 2C88A 1KY3A 4LV8B 4R69A 5IBPA 5B7GA 4NNJA 1MXHA 1JTVA 2ZYTX 3BDAA 3OE7D 1U2SA 4KP7A 4UHCA 4CIXA 2CJWA 2Q1SA 1WO8A 4DDTA 3KTAA 1DQZA 4Z7JA 4ZC1A 1BHJA 3T94A 1Y3BE 2HMAA 4J0QA 3CINA 3A7EA 3OHSX 4NBKA 4Q39A 4Q48A 4Y6QA 4IFIA 1GA1A 3WGYA 3QSGA 1O97D 4PHCA 4DKJA 2VYQA 1E1RD 3IUEA 2HMWA 3SKXA 2VF4X 4B75A 4BFSA 4WNAA 1RLOA 1SBZA 4O8CA 3D3WA 5B53A 5LLSA 2VEDA 4G09A 2DAPA 3WADA 1NN3A 4DM4A 3FROA 2UVPB 1DBSA 2YVUA 4J1SA 4OMDA 4RMIA 3G79A 4X54A 4AJLA 2GGSA 1RAIA 3CWQA 1J06A 4D9HA 5AJWA 2PGOA 4AMGA 1XBTA 3EEQA 2IPMA 2P35A 3I2FA 3THYB 1QGAA 2XEXA 4M9XA 5TMPA 2QVLA 4Z49A 1AKTA 1J6UA 1FFHA 2RB5A 1PK9A 2VC2B 3IIJA 3QOYA 3FDFA 3PHJA 4UTZA 4ABTA 2C7OA 1IE3A 1T24A 3E5HA 4F1JA 1JLKA 4HGPA 4RELA 1UMBB 3KOOA 3OETA 2UUPA 1B7GO 3FE2A 4Q9JA 4BFWA 4IP0A 2XKJE 4MJLA 4YJHA 1JNYA 4FDVA 4W7SA 2EFYA 2WA1A 1GPAA 2COKA 4TS1A 4X85A 4R7GA 2GKOA 1P2GA 3VNVA 4XUEA 2AF4C 4ECAA 3JWEA 3PXUA 5MN5A 2J3KA 4C5BA 1SCBA 3L7MA 4PNPA 3VYWA 3DV0A 4DG9A 4RD6A 5FTLA 3VX3A 2NAFA 2HXYA 2WPNA 3DL4A 3EOAI 2BOVA 3ZJ5A 1GY8A 4CLDA 1JJVA 1XVVA 3MMPA 2HPAA 1PR1A 3MJTA 3WXMA 2C5BA 4GT1A 1MB2A 4AQYB 8MHTA 3FJYA 3V9AA 2HQ1A 4HQ6A 4IICA 1JE1A 1DAHA 4N9QA 4MHOA 3T5DA 2JCVA 1PLLA 2W43A 4RZXA 1L7QA 3I6QA 2P8JA 2SKDA 3BWMA 1VDZA 1KEEB 3SSNA 3K6SA 1U8FO 2P3QA 4RDHA 4P3OA 5DGDA 1KYQA 1W2GA 2HCJB 3OM0A 4Q9HA 3GCGA 4OHVA 4DV5B 2JH3A 3ZWYA 3WNZA 1YHNA 3EBLA 3U61B 4HH4A 4IL5A 1M2HA 1Y8AA 4QUJA 4E2ZA 3RTGA 2BMWA 3MINB 3LY5A 1ZHHA 1QGUB 1GZVA 2H31A 4YLGA 4BNTA 2OXRA 3EZLA 2OCBA 1X9GA 4RKWA 5AJZA 4AUKA 5JC1A 2C4UA 1LVUA 3EXIA 3R4VA 3UM9A 4B44A 1EDZA 1O94A 5L6MB 3FCAA 1STOA 1MW9X 1SIBE 5COQA 1PHPA 2CFSA 3IPXA 2YIMA 1ZIXA 3ZZUA 4ZC8A 2EP7A 2MOKA 4MYHA 4UJ5A 2BKLA 4BVLA 1WA5A 1XP8A 2UZ0A 4KK3A 1CF2O 2CVPA 5JY6A 4QVGA 5JI2E 5E9AA 4I4IA 3BD7A 4CKXA 3H1TA 2BGWA 4ZT7A 4IXMA 4TWIA 1PWZA 3C70A 4WNYA 4DSTA 1AUPA 2BHLA 1YRAA 3D7KA 5DLDA 2NUAB 5EJ9A 1U7ZA 1YL6A 4MRVA 3WIBA 4BY9E 1ZOIA 5DFAA 5LB4A 1CVIA 1CZRA 3CX4A 3NCTA 4KW7A 3SZOA 2R79A 2WU3A 4QPJC 2FV8A 1F20A 3FMGA 2J31A 3EDOA 3OOEA 3QNUA 4HZUA 1C7QA 3CLUC 2IV7A 3RROA 3EQ8A 3UV7A 5K2OA 1RJWA 4Q47A 3SAJA 5HBGA 3VPFA 4EGFA 2OV2A 3VMFA 2Z98A 2AN1A 1V1MA 2XRFA 2RBKA 5JAZA 1OA0A 4L0DA 4Q9DA 4H4CA 1SHZA 3ZHBA 3U31A 4D6YA 3DFUA 2OV3A 2GARA 1VSVA 3C7TA 4CFYA 3LDFA 4RPJA 4ZQGA 4R71A 2BFEA 1Y0BA 4XVHA 3CPEA 4GP9A 2FK7A 2WDZA 3G9XA 3PI6A 4B9EA 4TVKA 4NSNA 1DFGA 1HFJA 2ETXA 1A3CA 1EZZA 1QDEA 4H59A 4HB2A 1EXVA 1X3SA 2Q1TA 4TSFA 2JI8A 4ONEA 5IEBA 4GX1A 4I6EA 1KU6A 4V0RA 4HGYA 4KTTE 4AY4A 4DIDA 3IDZA 3B6EA 2GBPA 3LOUA 1RXEA 4HLUC 2VSNA 2DC1A 4ZAWA 3HN7A 4D9CA 3VNUA 3RUCA 5LKRA 1KJWA 2G4CA 4RQBA 3FNGA 3DMRA 4Q9LA 2FGKA 4HEJA 5KC8A 5HZMA 3IKVA 1XUOA 4L3VA 3HDVA 3VPBA 3COWA 1E7WA 4R1OA 2P2ZA 1Z4NA 2XQGA 3O8RA 4Q4JB 2GPNA 3WGZA 5CLIA 4PYIA 2OT3B 3DLHA 4Z9XA 1AKMA 1Y3IA 3MMXA 3NZEA 4J76A 4NJMB 4EITA 3D6VA 2ZTUA 1D3AA 2ZVJA 2VJPA 2BBOA 3AP2A 4MW0A 5LDGA 3DEYX 4GGMX 3LAWA 2IYEA 1LSSA 2RGNA 3LUAA 3PQFA 4R2HA 7REQA 2DUJA 1U3CA 3E9DA 1XLTC 5A9SB 2XVAA 4L0QA 1IN4A 2BFCA 2RARA 3DVLA 4MJXA 4EARA 1T5SA 3GZNB 5FFMA 3L6EA 3A6KA 3RWMB 1R74A 4V0KA 5DK6A 1UM9A 3WP0A 6ADHA 3BZBA 5EYPA 4CG1A 3H5NA 2P9FA 2W98A 4EG3A 2B94A 4IIHA 4PZYA 4WN9A 4IWXA 1O3YA 1UM8A 1OH8A 3DYBA 5CJJA 2C4WA 2NO4A 1MQAA 1P9OA 4CQLA 2O8BB 5EZYA 3V4PB 2DCMA 4R2WA 3R7AA 1B8OA 1XZIA 3BA1A 1XCJA 2QWXA 3T9FA 2XODA 4AF8A 4LI0A 3A31A 2ZULA 4IUDS 4TLBA 4Q3NA 1J0DA 1S2GA 2AE2A 1HFWA 2YN2A 4XFKA 1U0OC 3I23A 2WIKA 3H1GA 1RHJA 2CVHA 2HLPA 4EQZA 4MB6A 5DLQC 1GSHA 1N2CA 3I9V6 4KL8S 3CEAA 4WCFA 2FE1A 3BAZA 2IU3A 1X38A 3GLFE 1RYEA 5JISA 5DSZA 1KL7A 1X3LA 3B2QA 4YJKA 3PF8A 4ETMA 2FDXA 2I4RA 2NUPB 1E77A 1NDQA 3DXFA 1OSNA 3KQSA 4JB3A 4M4SA 4ARBA 3D4IA 4F4HA 1OX4B 4FQ7A 3S0JA 3X43A 4IQ4A 4M46A 2WLTA 2YWGA 2IIBA 1T8TA 2ENUA 1A82A 3ISVA 3LSTA 2RK6A 4MZDA 4RJ2A 3HI6A 3N74A 4C6SA 3C4JA 4QE3A 1JWBB 3ZQ6A 4FZRA 1I7PA 2J5XA 1XD2A 2GZRA 3CM0A 3ORFA 1V2HE 3IVXA 4M38A 3UENA 4NBNA 4EW1A 5F2OA 4Q6BA 1FSSA 2GLUA 5I5EA 5F2KA 3L7AA 3GFVA 4E4YA 2J9YB 2PX2A 1KDVA 3VYVA 3G2KA 3DKVA 2WB2A 4QYIA 2Y05A 4JI4B 2P4EA 2Y8EA 1ZNWA 5FWNA 5TJ9A 2A86A 1KY5A 4FQ8A 4F04A 2FN8A 2C4NA 4DC0A 5EHZA 1XPRA 4Q4LA 4FOLA 1VBMA 2HT6A 2RD2A 1KARA 1LNQA 1BE1A 1I6WA 4JN6B 3NHRA 2B1IA 1R6TA 3ZE1B 5MHTA 1M54A 4KOAA 2P9CA 2WTXA 3K0EA 4CEJB 2GTPA 1PF7E 3NT4A 1I4DD 4O2RA 4BEBA 2XMGA 2VYNA 4G07A 4IIJF 3VM6A 1ZH8A 5IW8A 3B5IA 2QIPA 3FMOB 4IV8A 5CBKA 3RS8A 3HFRA 4QJBA 5DLEA 1E5LA 1XEWY 2JGEA 1Z35A 2PTHA 2ON6A 1ODFA 1L4NA 3BA6A 3NP9A 2FPKA 5A4DA 2I6UA 1SC3A 1W8IA 3QFFA 3UMBA 4YDSA 3GJ6A 4NY1A 4MV3A 1RM3A 4RY9A 4DF3A 4DCTA 4P84A 5G1OA 1BD3A 3MD9A 4L8VA 1UP4A 3WISA 1X80A 3CPJB 3W8FA 1Y7TA 4X0EA 1Z0FA 4OXKA 5FAKA 3F5SA 4MR8B 3AGPA 2X8LA 1DJNA 2J7PD 3AONB 4KWIA 3NTVA 5TRTA 3RRNA 2R3SA 1C9YA 3JVEA 1DIOB 4XPIA 3ET4A 3AEQA 1UKAA 1XLVA 1OBFO 2D54A 2TMYA 3A06A 5IANA 3KLMX 4FCVA 2ZR0A 1G6KA 3UA3A 5TQ2B 5KOYA 1BA2A 2D5CA 5IDXA 2R1TA 2X86A 4Q1AA 2Q7XA 4X7MA 3IAEA 4WVFA 1XQWA 2ZK7A 4ZJYA 2WAAA 2EKBA 3RNOA 1YKGA 3W5DA 1YHYA 3ORQA 4IVPA 1C7RA 5IZ4A 2QSUA 1FS6A 3ICWA 4P7GA 3INNA 4F86A 1C81A 1M6WA 2PQ0A 4OX9Y 4AZWA 5HOEA 4O29A 3KCNA 4RPLA 4S1VA 4Y30A 4DGQA 5EAIA 2WIDA 4EFKA 2O4CA 4A27A 1MIHA 1TT5A 3AM5A 4M8KA 5M3BA 4QTZA 3WB1A 5BN1A 1E7YA 1JVBA 4XCXA 3SDZA 2YWEA 4C4SA 3JRNA 3H13A 2HV8A 2Q5EA 4HN4B 4EHJA 4DJFC 5IVHA 2Y1FA 4RGBA 5LXTB 1J39A 3IAHA 4HATA 3GGGA 3BSWA 2YDYA 4A2PA 1J2RA 1AB5A 1GFIA 2O1XA 2Y6UA 4OHXA 3ANXA 4TKLA 4AJ4A 3Q3CA 2B9EA 1YZYA 2A1IA 2ZJ8A 4OX9B 3HK2A 2BEJA 1L1FA 3CEMA 3C3AA 3F6YA 3LXUX 3QVUA 3R7WB 3EYWA 2QE6A 1VIAA 5EE3A 3BORA 1M7GA 1VKJA 2LVBA 3A70A 5FORA 2I7TA 1PNRA 1S4MA 4HNAA 1XLTA 1RBQA 4N7RA 4ILEA 3SS9X 4D3DA 4WFJA 1JFTA 4US0R 3U56A 1I13A 5JADA 1PL0A 2PZMA 5LJLA 4ZAXA 3UYKA 5JXGA 4BXOB 3GT0A 1GGEA 4UZEA 2BGUA 1RE1A 3CZ9A 4B82A 2CUKA 5DCWA 3VPSA 1EGHA 3DBOB 2C9DA 3C3YA 2QEQA 1EFRD 3IT0A 5SZIA 5HRCA 1G5PA 1QHXA 3DEKA 2F8LA 4CL3A 4DC9A 4C4TA 3K1AA 4RK7A 2IXDA 1JBEA 5B4UA 4G0PA 2ECOA 3A28A 4ZD6A 1O9GA 5IXYA 4QOSA 3AK4A 1VA5A 2I7VA 3UUEA 5CYOA 3VJMA 4RZUA 4JBGA 3VZCA 1U9YA 3PKJA 2YVQA 4PYKA 4OBWA 3IUPA 1T0HB 1RQRA 5LCXA 3ZHTA 1FW6A 5DKFA 3K96A 4K6FA 3RSOA 2QUZA 4D98A 1SIOA 1C8VB 2YYZA 1VCHA 1VMDA 2CYBA 2E4UA 3EJWA 3FTNA 3GUZA 3IPYA 4TXJA 3ZH9B 2G1KA 4RY0A 3MT7A 5HR5A 1NG9A 1SMKA 3E5NA 5CXXA 2VJCA 3VVMA 1YMUA 2EAUA 2I6XA 2Z2JA 4P7FA 4GSLA 1ZVJA 2PX5A 4GR9A 3OZEA 1PCXA 4F7DA 5IVKA 2I3DA 4EYQA 5EHNA 1JDBB 5CA1F 1WQ3A 3Q87B 3TRHA 3GNTA 4Q19A 3VYRB 4YMVA 3E48A 2JAPA 4FIDA 2DTXA 2Q99A 5F73A 2WUWE 5CITA 3OFKA 4GYWA 2XTAA 3WO0A 1DC6A 3EARA 1LC0A 3Q12A 4M0PA 4WGFA 1EVLA 3SZGA 4CEIB 1UKBA 2IOYA 5TC4A 1E1QD 1QB7A 2Q21A 1SXJB 1ESCA 2C9CA 1THZA 2QQEA 3FFWA 1GGJA 4LWPA 2R1VA 2WD7A 2FUNB 4K9NA 5HK8A 1BXRB 5AQEA 5DEOA 1EUCB 4LJ4A 5IJZA 3GGJA 4TV8A 2HGSA 3A6HA 2ADOA 1QYIA 1N1DA 1H6AA 2WTBA 3KOZA 4XB6B 4DR1B 4CG3A 2ZSJA 5K0FA 4L5CA 1SIUA 1CUIA 1JZQA 3BGIA 4Q7KA 2HJVA 1O5IA 4FVTA 4P82A 4PTYA 4X20B 4BJ3A 3CR8A 2NMVA 2HWWA 3DG9A 1X94A 3STYA 3PC8A 2FPOA 2IDJA 3VKVA 1X7GA 2YJZA 1Z6ZA 2Z30A 2KYRA 1WDKA 4BNMA 3TKLA 3PT5A 3VZQA 1ARZA 4JR2A 3PNVA 2Q3LA 2NYVA 1FYWA 4LSWA 1JT9A 2E4YA 1AHHA 2WVJA 4GX0A 1Q0SA 1FZTA 1RFGE 2M6SA 3OQIA 4CDRA 2FEAA 4WK6A 3U3KA 1LDYA 1TMOA 3PDIA 3RRMA 2D0IA 1I3CA 4HDNA 4WDQA 2BY4A 3UT5B 2F8TA 3DP9A 2CEKA 4LY6A 5IARA 1XRLA 2PT7A 1TIPA 3RODA 3R6LA 1EXWA 1JXAA 3ZVRA 5KQPA 1SVLA 4KLCA 5HRUA 2YVAA 2PPVA 4FU0A 3EGDA 4QELA 4TVOA 3LCVB 5AVOA 1DRUA 1WXQA 3TH5A 1CHNA 4RE5A 1RSZA 2B2NA 1NBWB 4G0WA 1QUEA 1ZI6A 4QARA 4TZTA 2PD4A 5THKA 3GZ4A 1K8QA 4WKCA 3O9ZA 3KYBA 4Q1BA 1Z08A 2VAMA 4Q4HB 3IP6A 3G6WA 3QMWA 1IL0A 1X1TA 2G88A 2ZSAA 1PIWA 2YJ3A 3L6UA 4LNUB 3S1LA 4F5YA 5JJBA 1V16A 5JECA 4MV4A 1BMFA 2Q1WA 4INJA 3E82A 1XTUA 3GCXA 3ME5A 3HJTA 3JQ8B 4WKBA 3N7UA 1BDMA 2Q46A 2VNAA 2DWCA 2RHCA 2CHVA 2V9CA 3NHLA 1M1ZA 4QPZA 3WG9A 3EX7C 2B99A 1GPH1 1OI7A 2HCBA 2ORIA 3PNOA 4U6NA 5CLLA 3KOMA 1O5TA 1QHSA 4XX0A 3FMVA 3VHRA 4Q18A 1IEQA 2BJHA 1D6NA 4EA9A 2ATVA 4NCIA 3NHYA 2A9RA 1SQ0A 1T15A 4LE0A 4B76A 4QRIA 5JWOA 1P91A 4G41A 4BGDA 5I9TA 2BGGA 2A0FA 5EKTA 3OZDA 4BN5A 3FGZA 4JBXA 3QKUA 2GSDA 3CW2A 1JDVA 1SCAA 4MULA 4YJ3B 3DDZX 5EQFA 3HM2A 3TI9A 3TLEA 1TTHA 1RKVA 1U2DA 3I0NA 4JYBA 3I32A 2Z0MA 4LVOA 4UJ3A 2QV7A 4JUDX 5H3CA 4YRMA 5D2CA 2ZTLA 4BE9A 2W22A 2EXXA 4RCVA 1G21A 1DOHA 1H3NA 2QVXX 2XYVA 1ESNA 3M5CA 4Y2HA 4BNYA 4A8HA 4F85A 3KE9A 4EVIA 4OSOA 3MWEB 1Y48E 4YACA 3FOEC 1U9JA 1V3UA 2QTBA 3EXEA 1REQB 4DBLE 3IJ5A 2FOXA 2Z4SA 4LVNA 4R5MA 4H0CA 2R6HA 4M9SA 1JFSA 5GOTA 3ND6A 3FPKA 3LFUA 4A91A 1OKKA 1RYYA 3BWDD 3E1KA 3QZUA 1I3NA 5LXTF 5I4KA 1RXVA 1ISHA 2BFMA 3LY7A 4HYQA 4WLFA 1QYWA 4RZIA 4TYMA 1KPHA 5EWMB 4QOEA 3UWSA 4DIUA 2PLAA 1RRVA 3DUWA 3GJYA 4UBJA 3KQTA 1P80A 1XRJA 3B6IA 1DG1G 2CXNA 3C45A 4H0NA 4RPHA 1RVV1 1TAUA 4XOIA 2WD9A 1CR6A 4X6YA 5HSGA 2Z1MA 2QTGA 5C1BA 1KDOA 1H2YA 5EKDA 2WG1A 1C2TA 3GMDA 3A9TA 1QK3A 3TQTA 3DHNA 4RDCA 3TVTA 3U0VA 1A2KC 3RBVA 2IX3A 5ED4A 3DEJA 4IDEA 1Q5PA 2HRRA 3DLPX 5E6SA 1N6HA 3COSA 1ULTA 3WK4A 4IH9A 1H93A 1R88A 1X1RA 2AUMA 3C15C 3IUJA 4K1LA 2NVUB 1ZI9A 4JC0A 3DTTA 2FEMA 1XZGA 4AS1A 4G4IA 1A8UA 4ALJA 3IP8A 1TYZA 4PSKA 4PCVA 3ZX5A 3HXKA 1XN4A 4ZYVA 3W7VA 1GNSA 4KAXA 2VHCA 3ULKA 3I9MA 2RGEA 4FI3C 2BELA 5HQTA 2YYAA 1FX1A 1UMBA 2EF0A 4HQNA 5DCUA 5K4AA 5C34B 2FVYA 3O3MB 1NOJA 1KZ6A 5IASA 5HPYB 1CQPA 2ZT8A 3ZDCA 2OAGA 3F9CA 3ZKAA 3NATA 1TQ2A 2PSJA 5D51S 3RFTA 3U16A 1YVDA 2FX3A 4GPAA 5FNZA 3RUDA 3HKCB 3VR3D 5HCUA 1E4VA 1RMYA 4R41A 3S7ZA 3EODA 4B3XA 5HJEA 4ZOEA 4Z0PA 3FPSA 4AZ0A 3QTBA 3IKTA 1BFKA 1FYXA 2ZT5A 3O7WA 2UYGA 4V0SA 4WZAE 1RXCA 1Q6ZA 3AEUB 5LZ5A 5KTTA 4GM1A 4EWLA 2FHPA 3HCRA 3OA0A 1IJEA 3IODA 4HHEA 4NZYA 1DAEA 4G6ZA 4JLVA 5FI0B 1WEKA 1FA9A 1UWKA 4AURA 2RB4A 2IYNA 2SCUA 4UNSA 4FUTA 3OJOA 4QOGA 1TX4B 1XEXA 2RHOA 1QORA 4QAQA 5B1SA 2OHFA 3EDRA 3NNNA 4N8DA 1QWSA 2HMVA 4EGCB 5D5HA 1L5KA 4QM6A 1W5FA 4PHHA 1LV7A 5EIWA 4C2BA 2MDTA 1VMKA 1ODSA 3ZWWA 4NF2A 4BV8A 4CW7A 3L4JA 5IT5A 1KOGA 1XDGA 2W2KA 2Q62A 3QU4A 2QDKA 3HVHA 2WM2A 5BW5A 4KNYA 2WZBA 2GWHA 2BE9A 2V7WA 1OLXB 2YV1A 3G5AA 5EFOA 2PA3A 3B6KA 4IX1A 1OZGA 2XIQA 4C4XA 2F3UA 4R05A 2BFFA 5B30A 1ZO8A 4AO7A 1LPBB 4NOMA 3GAFA 1M8JA 5DP1A 2LPMA 2W2MA 3K2BA 1JJAA 4OQQA 3ZVMA 5GMOA 3VJKA 2FPIB 1E1KA 1H05A 3EQ9A 3FVQA 4GD3Q 5ALWA 4A5SA 4TRJA 4IIXA 3LVFO 3WFJA 4JI6B 4C3UA 3MM4A 1O5OA 3CRVA 4BGUA 1AVTA 4D46A 1CUZA 2WSSA 2F9LA 2CL6X 3WYFA 3S55A 4J6EA 2XD4A 5DEIA 2V3CC 3GMIA 4DA6A 3AIIA 1QLHA 3GJ0A 3RKUA 4CMJA 4BE4A 1S8AA 4PLZA 3VSCA 5HQ3A 2BRUC 3H5IA 1JQBA 4RGVA 4QGBA 5FFFA 3A2KA 1G20B 2MU1A 3KV1A 4BNDA 1LJUA 3A6ZA 3SIRA 2FWRA 1UPXA 3DT6A 4DLTA 4RENA 1E3TA 1K9VF 1Z07A 4AZ3B 4Z4HA 1VYTA 3T15A 1KTVA 4BAGA 4C89A 3IDOA 5GWXA 4JC4A 4MNTA 3LGSA 1M2OB 2HLDD 2VHVA 4PE5B 1NVUQ 3OG9A 2PX0A 1EXDA 2H4HA 1RYNA 3P0JA 4PQFA 4TZKA 1A2BA 1MRZA 3V1YA 4EZEA 1F5SA 2ZJ1A 4CM5A 2H17A 3BGVA 3FNIA 4WTOA 5CMLA 2FK8A 3BHNA 1HMYA 2V6GA 1EGVB 3CUEF 3FYUB 3NEJA 1NJFA 5KKCA 1UPBA 3CNOA 1VHJA 4YGYA 3RIMA 4PTLA 2FX5A 1GZ7A 4XB1A 4AY2A 1DARA 2E37A 1ZK4A 4MWDA 3SHQA 1DS6A 2B83A 2QAGB 4KBYA 4HMQA 1CR0A 2GSWA 2P41A 4RMNA 1T43A 4HADA 4B5LA 4I2VA 4BZPA 3DLTA 3F6CA 3I01M 2YTZA 4ENRA 1BZYA 3I3SR 1GL6A 4HD8A 5AI0A 4C06A 1IATA 4JLJA 2FPLA 5T8KC 3EZ7A 2EFCB 3H6HA 5EMNA 5K5EA 3VHXB 1DKLA 2GA9A 1EH5A 3H11A 5DGCA 4NAHA 1JDSA 2Z43A 1PR9A 3KZNA 1J7KA 2AEJA 4RXTA 2WLSA 2JARA 4E5KA 3KT8A 4CVNA 1U0HC 4N12A 3S2FA 3UB4A 1WETA 3SCZA 2C83A 3EIWA 4OD0A 4ZO4A 5AUOB 4G0VA 1T29A 4KAAA 2AWNA 2FPWA 1OBVA 4ZDIA 5IJ9B 5IAJA 3ZGZA 3GX1A 4BNNA 4MWSA 4EDHA 1IBMB 4DMMA 1NE7A 1Z2PX 1X0VA 3RS9A 2ZZMA 4MVJM 3PGVA 1TECE 1XVLA 2GAAA 2I8AA 3FDZA 3A9SA 4MKFA 4RZQA 5IK2D 5J4HA 1VSTA 4ZCQA 3CO0S 3GPDG 5F76A 2ECKA 1V6SA 3OU7A 3E9NA 3CW9A 3P5BA 4P8RA 5AM1A 2ID8A 4RL6A 1D9ZA 4H6XA 4BYMA 2PIDA 4B84A 5EI5A 2C94A 1DQSA 4W5OA 5L3QB 2VPPA 3K1TA 5EE0A 3WSWA 3EBPA 3QNWA 4M36A 4R1LA 3TSZA 1KH2A 4NZPA 5DOVA 4C08A 1ZW6A 2C5EA 4WKNA 2H2GA 2X9QA 2ZIAA 1A5ZA 4CEHB 1G2OA 2GUGA 4M0LA 2AN4A 2VO1A 1W29A 1Y1QA 2ONCA 3Q5DA 4B3IA 4PYJA 3ENVA 1X13A 3N28A 3H99A 4PO9A 1LDMA 2GEJA 2IPXA 3BFXA 3ZU6A 4IZ6A 1K7CA 4OYRA 1IQ0A 1DLJA 2R7AA 3BIOA 2L18A 3F5FA 1BOOA 3HLKA 3JAWA 1NVEA 3K6JA 4LYFA 4CQJA 5JZSA 1L3BA 2XNSA 1KKLA 2YIVX 4R1TA 2PZ8A 1KVRA 2AJ8A 4TWZA 4Y2VA 5M2QA 3R9KA 1JLLB 1N0IA 2JAOA 4MR7B 3WZLA 1OTHA 2C54A 3JD1A 4G36A 5KOHA 1ZU4A 4F12A 3I58A 4ZOAA 1V41E 1AM4D 2UUOA 1JQJC 4H7HA 4ZVPA 4Q7MB 1QH9A 2IYZA 3WLAA 5FF9A 5KIAA 5IJWA 1OZAA 2HSDA 2GHQA 4FGWA 3TL3A 2OXEA 2O05A 3SNHA 3ZD9A 2GBLA 3ZY3A 3EGCA 4PRKA 1FDVA 4EA8A 2VPZA 2DH5A 1XP5A 1TUBA 3PT9A 4HWKA 3BEDA 3HDJA 3V4RA 3O7MA 3IEVA 2E4XA 2IIVA 5ALVA 1Z4IA 4NKRA 3ZE8A 3NDBB 1MOSA 1COWD 5IJ0B 1W0JA 2NW6A 4JVSB 5JXIA 3QA9A 3OQNA 4O2AA 2O8VA 4N5LA 4NZ9A 5LLDA 1JHQA 1XCGB 2WFMA 1MV8A 4HAIA 3W4IA 1Z0DA 221PA 4RS3A 5F3RA 1RKBA 1RKXA 4PPNA 4DUYB 2B20A 3WDLA 4NFHA 5FWYB 2W11A 4WDRA 3RHSA 2JLBA 1J07A 1C30B 1UQRA 3PRHA 1MO6A 1HEIA 3VXKA 4QTTB 3MJRA 4BQOA 3U7IA 4DKXA 1RRFA 1Y6FA 4AO8A 4W5WA 1JHMA 1YQ9A 4MV9A 1Y4DE 1W8DA 3LWNA 3RASA 4EPRA 2Z9CA 4YQEA 4XWYA 2IE8A 3UB3A 1ELOA 1GIAA 2DE0X 3PCRB 4WERA 3TWOA 2DUUA 4IJWA 1LBTA 3AVYA 1YU6A 5I7SA 4ESHA 1BX1A 1ND6A 1GILA 1ZNZA 2PUHA 3NHJA 4UATA 3BL5A 5KC9A 2BI8A 3TRIA 4FTWA 2J3MA 3I9JA 4WCFB 2PUGA 1NX6A 1NVBA 3FTEA 1DAFA 3RUAA 3ANYB 3TOZA 4AU1A 1LBIA 5LNK1 2VP0A 1Q0LA 5B7PA 1CUGA 5KJEA 2GX6A 4Z99A 4DG8A 5BYJA 4BEJA 3CWCA 2GM9A 4CV3A 3GT3A 3OX1A 3HA3A 3QU2A 1P2TA 4QG7A 1ESEA 3RU2A 4YXFA 3GJ5A 5F2EA 1CIPA 3P32A 2B4AA 3AERB 3RV4A 3CKYA 3OJLA 3OEHA 1BDBA 1H94A 1LI4A 4HLNA 2ST1A 2PZBA 1QONA 2GFHA 1R50A 1T13A 2YNMC 1KYTA 3D0OA 4LV5B 3TXAA 3DAPA 1SRQA 2ZSDA 4Z1MD 1NP3A 2VS1A 4EJSA 1AK9A 3TMYA 3LC7O 5AW5A 3GLFB 2POQX 4MSUA 3KEGA 4GKAA 1KEZA 1O77A 4HYEA 4DNOA 1SXPA 4E32A 2Q41A 1UDXA 2FW8A 3PR1A 3NIGB 3O8CA 1L6IA 1PO7A 4CODB 1ENOA 3NV7A 4DABA 5HKKD 3DPUA 3TE6A 3V7NA 2XQJA 4V0ME 4P5PA 4RGYA 5KJ6A 3QE9Y 1WB9A 1A8HA 1SXGA 3D8RA 3DM9B 1VCMA 4TMWA 3SVZA 5KSYA 2FGJA 4IH1A 1JEQB 5EPOA 4L2IB 2V8OA 4QJ4A 5IH7A 4G26A 3L1UA 4XUGB 4C0LA 3GF4A 3OKFA 4DNPA 4YCNA 1E1CB 2YJNA 1IUKA 4CT0A 2J45A 4C5AA 1TVKB 2C9ZA 3BMXA 1M1UA 1OOEA 3RFUA 4TN5A 3DULA 2A9KA 3ROMA 1E3LA 3E3LA 3RBZA 1HFEL 1SBNE 4KR9A 3TPFA 3Q3HA 1TVCA 5HFNA 2G9NA 5JSUA 1I0LA 4E1BA 1I51A 2D5BA 1SCUA 2WBLC 3JQAD 4FN5A 4D4IA 1DNPA 5EXEA 1YF3A 1KS9A 1H1DA 5DN6D 4CQNA 2C2HA 5DHRA 5IH3A 4B4KA 1Y1TA 2IZ1A 2VJMB 3MCWA 1KMHB 3HCBA 4NATA 3TMKA 5TPZD 4PGGA 4OI4A 1DPGA 4PNEA 5HIAA 5B58C 4LZOA 4F4DA 3RS2A 4QPCA 3JQAB 1NMXA 1ZN7A 3LM8A 2HLDA 5KCZA 3QFTA 2IXGA 4AT1A 1IRXA 2NZ2A 4J1NA 5K0NA 2B69A 1GG5A 2A5FA 2XF2A 3MS4A 1Z2CA 5JT1A 3KVOA 9LDTA 3UJNA 4BVBA 2QV0A 4BQPA 2CFCA 1XZAA 1CRZA 4UEKA 4R6XA 2AC2A 3AKDA 1Y6ZA 2ENWA 4YYEA 1NUUA 3K8YA 1KK1A 3FTQA 1TUEA 1DQYA 1DWQA 1ANKA 1W85B 1OCEA 4LJ8A 1EHCA 2EJTA 2V45A 1RRKA 4K9QA 2H2DA 4Q9IA 1KHHA 5ED0A 2LTAA 1H2ZA 1VB5A 3KWLA 3DT8A 2HPZA 4IJMA 4NAVA 4Q00A 5LIRA 2H4WA 2ZU0C 4XRGA 2ZJ4A 1YRWA 1FRFS 5KCMA 3TJZA 1DZIA 1URPA 9ATCA 4XA8A 3DEIA 2EWWA 5BVGA 2ZE7A 3AUJB 2JGDA 5DJ5A 4AW9A 5SZJA 1TAQA 4XARA 1CX9B 1G5QA 3QUQA 1JALA 1K8XB 3MGKA 4KJZA 5FR1A 3NQ41 5E2AA 4AN0A 2GO7A 4RY8A 3V2IA 2V0GA 4ADSG 3UWMA 1Z6AA 3MPOA 4NE2A 1QHNA 4UPVA 1TJYA 5I9SA 3RTEA 2OBLA 1JHAA 4TX1A 2X0DA 1JHUA 3A9UA 2GN1A 2EFJA 4N3CA 8GPBA 1E9RA 1IQUA 1IHOA 1U7OA 2V6MA 3R24A 4A8JA 1TUIA 1C0EA 4OG2A 2PZEA 4YP9A 4BLVA 2XUGA 2PLRA 3UQZA 2JCGA 2ZFUA 1VPEA 3UWKA 2QG6A 5F35A 1LPAB 4BVAA 4DWOA 3WY9A 3KM0A 4KYTA 2WJHA 2XMZA 4RMJA 3MIIA 2CHEA 1JIKA 1J1ZA 1X7HA 3TL2A 2IBSA 4HB0A 3RC9A 4DV3B 1JH9A 1R9NA 4ARZA 2VTKA 2YUTA 4BN0A 4XQGA 2JJ2A 1M34E 1MB0A 3D5TA 2QTHA 3AIOA 2N1MA 3TLAA 2CNBA 3PICA 3VR6D 4JKIA 4WFIA 3RS0A 2JATA 4QBIA 3A2LA 2Q8NA 3S99A 3AKZA 2HF9A 1NI4A 3AQIA 3RT7A 4Q12A 1Q16A 1GG8A 1RCTE 2X2PA 2JAQA 4E4RA 2Z6UA 1L8OA 3PS9A 1FSGA 3OWHA 1A69A 2Q3BA 1LRLA 2C61A 3P97A 4YONB 1IOVA 1RT9A 2VJYA 1ZK2A 5T4EA 1IRIA 1ZD9A 4ARSA 1GARA 2MMCA 4LQDA 5LWQA 4D9KA 1U4OA 2GWRA 1GPBA 1CZKA 4MWBA 4CTJA 2PZAA 3H97A 5A6VA 3IE0A 4UQPA 3NS7A 1JYEA 3GEMA 1AY0A 4IJUA 2DULA 1Z3CA 3NNDA 2FKAA 2ZATA 3MOSA 3UT6A 3W77A 2WYOA 2IYUA 5DNVA 3KPWA 3F49S 1HZZC 1N57A 2N46A 4RTLA 5DM2A 3FY4A 4W1QA 3PNQA 3ZY2A 4WXEA 3MOIA 1IXKA 3HJGA 4EPVA 2DLDA 4UOZA 5KHLB 2XQIA 1BWRA 3HL4A 4GR4A 4B48A 1NXTA 2P9JA 3KJEA 4XWWA 4IXWA 3FG9A 4OGWA 4WEQA 4Z4EA 1PJ8A 1Z62A 4KVAA 5CYFA 1IHDA 5JH7A 1WU8A 4PPFA 2QRJA 4QXRA 4XDGA 1F2UA 1FVOA 3K7EA 3RTBA 2FR0A 3PHHA 1AQIA 1G42A 2IEAA 2LIVA 3II6X 4W9NA 3RGGA 4BWVA 1RHUA 1H8HD 4IIJB 5EIEA 1PD1A 5DX0A 5PNTA 3E1GA 3A2MA 2QN6A 1OMOA 4MUJA 1N8TA 4LSZA 2FZ4A 4R51A 4FYPA 2EX0A 3BTVA 5JZBA 5JJKA 5EIAA 1MTZA 1N2OA 3PGXA 3U81A 3A1SA 1YBVA 1JFLA 3I37X 3AVXA 3TB6A 4JZYA 1BGXT 3OH8A 1LDNA 1SB8A 3U4IA 4I4TA 4M76B 1DB3A 2ZS9A 3H5TA 3KALA 3P9RA 3ZI4A 2YINC 4TTTS 2D7CA 3WK7A 3AZPA 1SPBS 5H81A 5DM1A 3VH3A 4J4TA 2JNWA 4AXBA 3O8DA 2Z8ZA 4PY2A 5FWXA 1I3LA 4BHTA 1WZIA 1T5TA 4JB2A 1BCRB 2PQ6A 4ZEVA 3MVEA 3OLQA 1N6RA 3E9MA 1DQRA 1VJ1A 2HA2A 5G40A 4U7GA 3WMGA 1L4LA 3IOYA 3WB2A 5IEJA 1P0QA 5LUAA 3OZFA 2I9PA 5EWMA 1XKTA 3ZHVA 3FCXA 5KYKA 2DBVO 1RAEA 2CNKA 4TZ0A 3GLGA 2IZ0A 3HI4A 2RHGB 1GITA 1XU9A 1GZ5A 4JGIA 4B6EA 1G66A 5GVSA 3DHYA 3CH7A 1CDZA 1QV6A 3U3JA 3SQXA 1SVSA 3OZBA 3GRUA 1TO2E 4ZT2A 1P5JA 1ONPA 2XITA 3EB9A 4K9RA 4WSOA 5ICMA 2I6GA 1I14A 2GRJA 4MB2A 3UKDA 3OP1A 1POXA 4F4JA 4Z8XA 3IP3A 5KINB 1Y8RA 3ILHA 4L78A 3DL2A 4LWZA 3RVNA 1NWCA 1P2UA 2V55B 3ROZA 3RRZA 5I6DA 4C76A 1YDMA 1WDWB 1ZITA 4HGRA 4MQMA 4DNFA 2POCA 1LDGA 2NUPA 3ITEA 3RK4A 4QSMA 4K6CA 2FEOA 3SOZA 4P7BA 2GFIA 1N5DA 3HBLA 4JUFA 5DX8A 2HA3A 4HYYA 2P90A 4PSVA 3VAYA 2QUKA 3GVIA 4C0AC 1KVTA 3KUCA 4AB1A 1AS2A 3HP4A 3I1JA 1AZWA 2DF8A 2B6NA 2L2QA 1E64A 2PZKA 2AN5A 2QJOA 4P31A 2WTNA 3HMKA 4R83A 5FAXA 1ISJA 2QT0A 1XROA 2XT9A 1B8PA 4X93A 1XD2B 4WUVA 2R44A 3WICA 4F4FA 4UOEA 1F8UA 2E48A 2OZPA 3B1KA 2BHNA 4MGYR 1PQWA 4LRQA 1ZUHA