1XVLA

The three-dimensional structure of mntc from synechocystis 6803
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
279
Chain Sequence
GETEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKDVPSVVLTEGIEPIPIADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQVPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARFGGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGLLAGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Mn transporter
publication title The MntC crystal structure suggests that import of Mn2+ in cyanobacteria is redox controlled.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 83
structure length 279
sequence length 279
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1xvlA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1xvlA02
5BVHA 1PSZA 1FP4B 3BE6A 4XPIA 2OSVA 3ZKAA 1KARA 5KOJA 2MINA 3ZK9A 3PDIB 2XDQB 4CL2A 5B58T 4ND8A 4BBPA 3HH8A 2YNMD 3NU1A 4MLZA 4UDOA 4HMQA 4GICA 5CR9A 4UTPA 3EIWA 2Q8PA 1N2CB 4UTOA 3R5SA 4FNAA 3K1AB 1XVLA 3GI1A 1QH8A 4INPA 1M1YA 1M1NA 1N2ZA 2AFHB 1MIOB 3G9QA 4K3VA 4OVKA 1H1LA 4FI3F 3MINB 4TKUB 3U7QB 3BE5A 5M2QA 1G21B 4HN9A 1QH1B 4WZBB 5M3BA 4WNAA 1K0FA 2MINB 5KOHB 5JG7A 5JPDA 2R7AA 2PRSA 2XY4A 3AESA 1L5HB 1KAEA 5JJ5A 4FKMA 3AEQB 2AFIA 4WESA 4WZAA 4MX8A 4M7OA 2PHZA 5CX1A 3AEKA 2WHYA 2RG7A 4MDYA 3AEUA 3HJTA 4DBLE 3AERB 4NNOA 3UJPA 1M34B 1K75A 2OV3A 1K2VN 5BVGA 2XH8A 4H0FA 3EIXA 5I4KA 2YNMC 4WN9A 3ZK8A 4TKVA 5AFSA 3LI2A 2PS0A 2PS3A 4HMPA 1PQ4A 4N01A 3TNYA 5BVHB 4B8YA 4XPIB 4G07A 4LS3A 3TEFA 5KOJB 1FP4A 1G20A 2OV1A 4WESB 4WZAB 2M6LA 3AETA 4NNPA 3PDIA 2XDQA 4PM4A 4ND8B 1KAHA 2XV1A 3HXPA 2Q8QA 4OXRA 1EFDN 2WI8A 2XQVA 3LHSA 3ZK7A 4FILA 5BVGB 1QGUA 1N2CA 1QH8B 4TKVB 1M1YB 1M1NB 1H1LB 1N4DA 2O1EA 1ESZA 2AFHA 1MIOA 4TKUA 3MINA 3TLKA 3U7QA 2XUZA 4WNAB 2M6KA 5JOQA 4UDNA 1G21A 1QH1A 2ETVA 1G20B 4WZBA 4LJSA 2R79A 3AETB 3AESB 5KOHA 3MD9A 1N4AA 5HDQA 4MO9A 3R5TA 3MWFA 4IRMA 2AFIB 4INOA 5GGYA 5GGXA 3ZTTA 1L5HA 4HMOA 5CX1B 3AEKB 3AEQA 5M34A 5FLYA 1TOAA 1QGUB 3AEUB 3CX3A 3PSHA 4OXQA 2X4LA 5HX7A 2OGWA 2QI9F 4H59A 2PS9A 3AERA 4G09A 3MWGA 3PSAA 4WN9B 1M34A 3K1AA 1K7SN 3MFQA 5KHLB 5M29A 4PAGA
chains in the Genus database with same CATH superfamily
1RRVA 3WZLA 1CV2A 5C7IO 3QSYA 2OPHA 4J2TA 3T54A 4X3CA 2V3VA 1H4TA 2NO9A 3UJ6A 3WL8A 5FV4A 2B7CA 1AXGA 1V25A 4PZCA 1NXTA 3V7FA 3ZC3A 4YCNA 2AC7A 2GILA 2QBYA 3J7AC 2BZ0A 1YDMA 2IHZA 2LVBA 2HRBA 3BM5A 3PGKA 3TLBA 5I4BA 4ND8A 2ZREA 1UC9A 1UT5A 1TM2A 1J8FA 4WWHA 1DX6A 2QX7A 3U62A 2QD4A 4BFWA 1E2KA 4UNPA 2P6RA 2CUKA 2QORA 2QN2A 1T9GS 3K0BA 4KGXA 2E7ZA 2O52A 5IDYA 5YASA 3TX2A 4H17A 1TL7C 1ZZEA 4KLCA 4FI3F 4EJFA 1V1MA 2B7LA 2IEIA 4Y6OA 3C3CA 3UFXA 4AZ0A 2EKZA 1CF4A 1YB1A 1RPNA 1FTWA 1P1BA 1Q0RA 1D4AA 4Q02A 1REQB 5FFFA 1JQ5A 1DJPA 2FYTA 4Q05A 4BO1A 3ZBUA 4BVKA 3PKIA 5KYXA 5EKXA 3W2EA 2BFEA 2Z4RA 2AW3A 3MB5A 1RAGA 4XIJA 4NCBA 1XG5A 3QVSA 4R4JA 3SSNA 1UK8A 2C5LA 4GKAA 3SFVA 4NDZA 1KL7A 2F1IA 2ISQA 4PYKA 1NV8A 4M88A 4DLLA 1G8FA 1Z83A 2Y1CA 4E33A 4QGSA 5B57C 1QYWA 3LWBA 3EXAA 2OORC 4ENVA 4TS1A 2EG9A 2OAP1 4HZUB 3MTBA 2QTFA 3FETA 3NJ4A 1MTOA 4GZ6A 4M0KA 3TZEA 1W6UA 4B85A 3EIXA 2IU6A 1U6JA 2YXEA 3OBIA 1H0KA 2ZDQA 3PQ2A 3DFFA 4RHEA 3ZCUA 4C4PA 3ICQB 2PS3A 4ALNA 2BSXA 1PQ4A 2SBTA 3AVVA 3FOAA 4BVAA 1AC5A 1IZ7A 5EZYF 4HWOA 4DLXA 1QLHA 2HL6A 1EFPA 3HKDB 4ANFA 3FMOB 1WXDA 1EK5A 1F6BA 2YV1A 3NTRA 4O6VA 2ON6A 2J0SA 1V1RA 2I6QA 4YT8A 3HXPA 4MI9A 1QX4A 3MWLA 5LPNA 2QTTA 1NVBA 1J9ZA 2YYYA 2ZSEA 1TCVA 4LQCA 3W6ZA 4RGQA 2H29A 4JXZA 4OM7A 1KDOA 5BN4A 3V2GA 5FBVB 6YASA 1Y1KE 3JAKA 4UVDA 1EDOA 1JHAA 1H1LB 4QIHA 2ZB7A 1TVMA 2IU3A 3G8BA 3LF2A 3NEPX 2NU9A 1G18A 4IIJB 1TUBB 5DULA 2Q50A 2H4WA 1VI6A 4HNAA 1PVOA 5EFOA 2IY7A 1TKRA 3IALA 2OCLA 4PC3A 1D09A 1EVZA 1QFMA 2A5FA 2QX6A 3FHCB 3PNQA 4OFZA 3T9DA 2RC5A 1KO5A 3SGLA 3KHTA 5DOVA 3EY9A 4OQNA 2P6MA 2Z4TA 3RUAA 3HR7A 1YAHA 1NAHA 2C58A 5CLLA 4AUKA 4QU5A 4J0GA 2PL9A 4PYRA 4WRRA 4KN8A 4N7JA 2X2FA 4BLPA 4EB6A 5C32A 4QL3A 2HV9A 2JAHA 3ZX5A 1Y8ZA 5E9AA 3O82A 5IAGA 1UZNA 4M87A 4CF3A 2BKXA 1YHNA 2JBAA 1QC5B 2HD4A 3U60B 2AT1A 2CYCA 2ZDHA 2ZVPX 3LCVB 2C3OA 2EYQA 3KT0A 4XARA 4YWJA 3VC7A 4CMEA 1CUEA 3RJ5A 2W2OA 2JLYA 2PKCA 2PYIA 4D3YA 5FPYA 5T57A 3K3PA 1B3RA 2EEZA 4XPIA 2PE5A 3PLAE 1HX7A 1R8JA 1QV6A 2VHCA 4ARBA 5HTKA 1TW2A 1ZH4A 3LDUA 5JHGB 1ONOA 2D2XA 4P22A 3A25A 3ISVA 2N75A 1Z7WA 3ER8A 3IJ5A 4X63A 4FIDA 4QO8A 4A3SA 4KXQA 1C4KA 1JG3A 2O7VA 3FKJA 2PSDA 4MAMA 3JPYA 1Y4SA 4F2GA 1ATZA 1FLVA 3JQPA 2C2ZA 2HA3A 2R5WA 3OZXA 3AVXA 3ET4A 2BRUC 3FNFA 2PKQP 5IJ0A 3PL5A 1S9HA 1Z6YA 2QU8A 4PSAA 1E1NA 1LVHA 3QE0A 2CK3A 1TJNA 1A9PA 1TMYA 4H1TA 4F86A 1JECA 4F1WA 3UICA 3NDPA 4C20A 4JJGA 4OKNA 5B4UA 4D9MA 5JXGA 1E9DA 3RSQA 1GL7A 1YQUA 2OECA 3CNHA 3ETJA 1XXHB 4WCFB 1F0YA 1PCXA 1ABBA 1CFZA 1YONA 3KJEA 1BTOA 4G5GA 4LAFA 1FFHA 5DN9A 3U17A 3HYRA 2ZB3A 3OA0A 2P7IA 2IHJA 1E66A 1U2GA 2G1JA 3HCCA 5DEOA 4E94A 5A9SA 1ZCAA 5TF4A 2C29D 5IARA 3FOEC 1DGQA 2J9XB 2FEPA 4AYTA 3AXTA 3P0FA 3F7NA 3Q3CA 1DBWA 3PGVA 4JBYA 1I3CA 2MR5A 3UMCA 2ZTUA 3PNLA 1SQFA 5EJ5A 2JJ1D 3PC4A 2A86A 4B82A 2REOA 3CF0A 3PUIA 3R9XA 4L6CA 3GVXA 1ZIPA 2E37A 2OENG 3BWDD 5I01A 3RYHB 4JP5A 2NNLD 4IQ0A 1LFAA 5IKXA 3R0QA 1QE3A 3PIRA 3JQDA 3DTYA 5IK2A 4ENWA 1LSSA 1DXYA 3DQQA 3KJQA 3O2QB 2D1RA 3KB2A 1QCDA 1XAHA 3LA8A 3ODGA 2C4HA 1JMKC 4UCXA 1BW9A 4IWXA 1JU3A 1EGMB 1WG8A 4AY5A 3RFCA 2DHCA 3QI2A 3HCRA 3EASA 3CPHA 1SCAA 3GYBA 3CIOA 3T9CA 3UJCA 1WJGA 1M1NB 3ZWNA 5C7LO 1P9RA 4YJFB 3DEFA 1V4NA 2KSQA 3EYAA 1AHNA 1L7VC 5JADA 3A6LA 5I47A 1FA9A 4MW4A 3GLHA 1K8YB 4NJOA 2ZSBA 3TXYA 4BKOA 4QT0A 3CN7A 3USCS 4I08A 2VBGA 4OLFA 4EJ2A 3MJHA 2FDCA 2J4CA 4WDQA 3RUIA 2IK8A 2XGJA 3PVCA 4CM9A 1KO4A 3U3DA 4AF7A 4QOSA 2LKCA 4C2AA 5ANRB 5B7GA 2HMUA 2I76A 1KOFA 1WDLA 4PRZA 3VR5A 4RHXA 2IPXA 3B2NA 2WHQA 2J07A 5M34A 5C1PA 4LNUB 1F7VA 3LPAA 2X4LA 4G5OA 3LWZA 4URFA 2CDBA 3U44B 5E6RB 5DGIA 2PZ8A 3ESDA 4KI7A 3ZGYA 4G09A 5IDWA 1D4ZA 2ZYVX 3SYNA 1A2OA 1XCGB 2OOKA 3ROMA 2BUAA 2PWAA 3GEMA 3AF5A 1EX9A 2ZETA 3M4JA 1I33A 4L8FA 4UQOA 4JB0A 1Q3HA 4F46A 1CHDA 4AT1A 2PWBA 1Y6ZA 4CI0B 3B6MA 2XEXA 1KWGA 1JEYB 3IKLA 2HCTA 4AFNA 3U7RA 3NM5A 1VGRA 3HL4A 4C2UA 4FZ3A 1W76A 2AX3A 2QTVA 2JFHA 2TMDA 2I67A 4L5YA 2XCQA 2AW5A 4FPXA 3QWIA 4LRQA 5CH5A 3QE9Y 3COJA 1HEUA 3UH1A 5L4NA 1Q7TA 1H2AS 5KB3A 4NBSA 2D1FA 3GJTA 5ICEA 4NQRA 3WVNA 4DN6A 3QW4B 4D4IA 1B1CA 3NANA 1L2TA 4YQFA 1Z4OA 2WJPA 1T8UA 3HCEA 2CKDA 2ZJAA 1G8PA 1TKAA 2YUTA 3DFIA 3ZLJA 2W6ZA 4MW9A 4CV3A 2W2VA 4XJTA 3ZE8A 4F6CA 4FN4A 2JGNA 5BMVB 5TT0A 1M2OB 3UHJA 3ASVA 3JQ9C 2EF1A 3C15C 4HUQB 4D5EA 3HB0A 4ER0A 4BXOB 1KF0A 5KNBH 4GAEA 3WLFA 3DXYA 4QRIA 3M9WA 4HAYA 2UZ1A 1FUUA 3ESCA 4ODIA 3T1NA 1M5TA 3I1YA 2YWFA 2POQX 2NTYC 4J0IA 3GN1A 4PAMA 3P8ZA 3FMFA 1NZJA 1P17A 4WKOA 3WGKA 1P0CA 4F12A 2OA0A 2HRRA 4B8WA 5JH7B 1WV0A 1C1DB 3DW3X 1USVA 1X92A 4JOBA 3PCRB 3SQWA 2WTAA 2EX4A 2VP4A 2Q7XA 3F5DA 2DTXA 4GIBA 4MI6A 5ILGA 2JL1A 1GPH1 4EK9A 4YPOA 2UYHA 8MHTA 2BGWA 4K9QA 2PMWB 3AEZA 2FMUA 3N2ZB 3ZE2B 1L7OA 2FN8A 2YOGA 4ZVUA 3T99A 4OGWA 5AK4A 4GGMX 3PDHA 3ZI0A 1YK1A 3IAUA 1QRAA 3DZKA 3DDWA 3DYVA 3O5AA 2GAJA 4D9EA 4EKIA 3OTHA 1MD9A 1ADBA 5IHXA 3VPAA 3OOWA 1Y7TA 5F4BA 2H1FA 2OCGA 4JHLA 3T15A 4FMDB 2ZB2A 3HO6A 3GPLA 3DZJA 2BTQB 2H6EA 4PZZA 4CR7A 4CIXA 5JQGF 3A7EA 3EZGA 4NONA 1HA3A 1MOQA 1Y8RA 4AAYA 4GZ5A 3BPSA 1MFPA 3ZHOA 5LP6C 1DNPA 2GGSA 1II0A 3OX4A 1KOLA 3DL2A 3FBWA 3JVIA 4HZIA 4YMUA 1XA3A 2DX7A 4MS3A 2EZTA 4BVBA 1D8AA 1GA6A 2A1UA 4M36A 4UHFA 3TTSA 4PPYA 4KFCA 1FQWA 4GBED 3ZHQA 3LPMA 2IUSA 4WQMA 1YIAA 1ZM7A 2H3HA 2PGLA 1KTIA 2W58A 1FEZA 1Z8NA 5EZ5A 2I6XA 4OX9Y 3A6KA 5JCOA 2HJWA 1A7KA 4K28A 5LMUB 3HV2A 2VA8A 3KEFA 4L85A 1P2FA 2WTUA 2Z09A 1T9HA 2F3SA 4JQCA 3TCKA 2GUWA 5KVVA 2GK3A 3N07A 4JYPA 1TQDA 3L8FA 1ZD1A 3IVMA 4KO4S 2JIPA 3ENVA 2JGDA 4QC2A 4B2LA 4RK7A 1S8AA 3O0DA 4XJVA 3G9TA 2BJVA 1SHKA 4P0QB 1JHXA 1GFWA 2QQ0A 3KK0A 1U4SA 4IW3B 4X7BA 1PW5A 2BEKA 1MQAA 1WXQA 2GRUA 1PDVA 2Q1UA 4NYJQ 3L0PA 3HP4A 3IP7A 2I1VB 1X1SA 2LE0A 4K9PA 1U8TA 9LDBA 1ACJA 2P4HX 4ZOBA 2VTBB 3QFFA 1X7ZB 5LQSA 3ZWPA 3OKPA 1J99A 3ZD9A 3TG8A 4LDNA 2A0YA 3U49A 1DIAA 3MMXA 4HWRA 1YRAA 5BSEA 2CCKA 1LRJA 4LYJA 3ISJA 2GCOA 1EJ2A 1EX7A 2PZLA 3INTA 3PQCA 2G71A 3V2IA 2VDNB 2XGGA 4JDPA 5DNCA 2XZDA 3L7JA 4JT9A 1MC1A 1OIWA 3S0JA 1B6RA 1L4LA 1N6HA 3R6DA 5DX8A 3V34A 2CVHA 5CB0A 1XC7A 2AOTB 2AMVA 2QSJA 4OQPA 5FR2A 3HCOA 1JAXA 2C98A 4BO3A 3L4KA 4MQLA 2IYRA 4BBAA 4O2BF 2JIBA 5LQUA 1W85B 2UZIR 4CKCA 3FZNA 5ENVA 2W11A 1KQPA 5DWVA 1AZSC 1CS0A 3OCUA 4IEFB 1XCJA 2JK0A 3W2GA 3WLLA 2G1UA 4EIWA 2EWMA 2PMKA 1PFWA 2WR8A 3JV7A 4GKKB 2CUNA 2P9ZA 5JO0A 1XDUA 1YCFA 3HA5A 1GL6A 3IEPA 4ZRDA 5K8IA 2C7OA 2FUG6 4FFSA 2DF8A 3PQ5A 721PA 1DJOA 2H1RA 2MOKA 2V6BA 2YC2C 3GEBA 3H5WA 2LIVA 3UAXA 4HYTA 4CNQA 4CV0A 3QU2A 4KKXB 5ALGA 5JYDA 2O05A 3FWYA 3VOAA 2ODPA 3OBBA 4C5BA 3DJFA 4N54A 1GG2A 2QTAA 1UT6A 3NYQA 4LNAA 2FSUA 1UFKA 1JDUA 4HAXA 3TG2A 2O1SA 2FZKA 3W8NA 2APJA 1YDWA 5IBCA 1TMKA 4R9SA 1SIBE 1JYSA 1JALA 3JQBC 4BMYA 2JFXA 4FSHA 3WNQA 3HDJA 4XX0A 2H51A 2PV7A 1P4AA 1DFIA 2N47A 3FMVA 1KSFX 4KRFA 5BN5B 4EHIA 2YV5A 5KI6A 3H5LA 4DCPA 5BVGB 6Q21A 3KZXA 2OQ2A 3BMQA 3RRBA 3JARA 3TQQA 3AL0C 2IYNA 4QPCA 1Z8HA 3JWEA 4IKPA 3V4RA 1PJ8A 1ZICA 1FMJA 1WDWB 2Z83A 4ZYTA 5AM2A 3H4IA 4KIWA 1AKUA 2CLHB 1B0UA 1WP4A 3ANSA 3G1UA 1XXLA 3VDQA 7YASA 4QM7A 5A2GA 4DR3B 4NLLA 4NG5A 3TJMA 3FNGA 5TMDA 2QW0X 2DBVO 1L5LA 5E2AA 4EA7A 4LISA 4EEZA 2HGSA 1GGNA 3QTTA 2ODBA 5AW3A 5ALYA 4TXMA 1EB8A 2WB2A 3K05A 1BFDA 1E1DA 1NUAA 4G2NA 5EXEA 4ALKA 4QLOA 4EVIA 1VL0A 4KQJA 2A30A 2F3QA 2YWRA 3KSMA 4IGEA 2UKDA 4JLBA 4D9GA 1QU2A 1U3WA 1AKNA 3NOOA 3D1LA 2H2WA 4LDAA 4FX2A 1JJIA 4KE8A 1DTSA 2XRYA 1QTRA 2OV4A 1A5ZA 3LUKA 4M76B 1BROA 2HLDD 4ZV9A 1JAHA 4ZOLA 2DFNA 1Z0ZA 2JFPA 2ERCA 2ZANA 3GCXA 4MUIA 2Z4SA 3NHMA 4PYNA 1Z8FA 4NEGA 3J7TA 1CULC 2HHCA 1CXZA 3K9LA 3RIMA 4FC7A 3R0VA 2BR5A 2QOEA 4RKYA 2JJ1A 5EHIA 2YY5A 3PEUA 5EGSA 4F72A 2DLCX 1ZJ5A 3EAFA 1NZFA 3K4PA 4FOSA 4GOXA 2E4UA 1QG0A 2TMKA 4KXXA 1YRBA 4QUKA 4DA8A 3AYXB 4NY1A 3RTEA 2YMMA 5GONB 1CNMA 4BWFB 2PXXA 3NU1A 1WXFA 4EJSC 3RIYA 5ALQA 2QGZA 1MFZA 2VYVD 1DRVA 3BWMA 4WY8A 5JECA 1F14A 2VCYA 1E7YA 2FE1A 1P1IA 3NV9A 2R7KA 1YB4A 3R4CA 3RYIA 3CF4A 4ZMSA 3VJRA 4FXOA 1A5BB 3B7PA 4NCKA 3DTVB 2XAUA 3UK7A 2PGIA 3T9FA 2FTKE 3EXG2 1IJFA 3N7UA 4XE5A 3F96A 2FFQA 1MQ9A 5BYKA 1XCOA 4OB8A 2XX3A 1UF9A 3E4DA 4G1VA 1X7WB 2GZHA 4JQSA 4U00A 4ZQBA 3TL6A 5TT1A 5AKGA 2G3YA 1KQOA 2BHLA 1HYQA 2DVMA 2XIQA 3D3WB 3TX6A 3U1TA 4A1FA 1KI9A 5LC1A 2PX6A 4FQ8A 5HCUA 3MUOA 2CN1A 2D5AA 4DV0B 4UUOA 2X2OA 4AECA 1SCBA 1BCRA 3ZWWA 3RRZA 1CLUA 1H2HA 5IG2A 4B44A 1OZFA 3DLIA 4CKWB 4D82A 4OLAA 2NP7A 3NC0C 1H1TA 2VPWA 4C1BA 2FN7A 1UBNA 1QS0B 1WF6A 3FA2A 5CVEA 2O5VA 3ROPA 1HLDA 1O87A 5JD4A 2YASA 4MUFA 5F3WB 3WGOA 3IBCA 3LPDA 3BRQA 2Z9DA 2NAPA 4DADA 1UXJA 2ZYHA 2YIDA 3OZIA 3K1ZA 4C87A 1HXHA 1V8PA 1XZNA 4ZCMA 5DM70 3OQJA 1Z2DA 2WZBA 3IEIA 3QE2A 4FEGA 3VGJA 1TCBA 2HU2A 2EXXA 5HZKA 3SI7A 4S12A 4I1IA 2HIGA 1YI1A 2AKYA 3M4ZA 5FORA 1Z8DA 4O8CA 1GPMA 1XXHE 4QREA 4MV8A 1NW4A 3KKEA 3I6BA 4D8XA 2V98A 1V43A 3IUPA 4KREA 3DBLA 3N1UA 3DMYA 3TTUA 2JZOA 1T9KA 4IUDS 4HN4B 1DQYA 4JEIA 4HNVA 1UOQA 3SC4A 4RA6B 2BR4A 1IUOA 4I8DA 2PGDA 3L49A 1MV8A 1IJEA 2HA5A 5AJZA 4ZVMA 2ETVA 4BOYA 1T9GR 4IIVA 4MYDA 4KKVA 4GMGA 1JDNA 3CV3A 3R3WA 2X15A 1FFCA 4HH0A 4I8IA 1INLA 1GARA 1YDHA 3FDFA 2IE0A 3QYAA 2QMZA 1MA0A 2WV7A 2XMGA 3A6HA 3HXMA 1A8PA 3VKGA 3PENA 5JAIA 3AEUB 4XXHA 3F2IA 3OZFA 3LDAA 4G0MA 3V3KA 1RRGA 3W2TA 1TEVA 2EL7A 3AUAA 3LFTA 3EZ2A 1RCFA 4YMTA 3EVEA 3BGVA 4FDTA 5AM1A 1PS8A 1Q15A 4RSMA 1K68A 1ZL2A 2C2KA 4P34A 1OILA 1ZC3A 3WDSA 3EXHB 1MN6A 3ZU6A 3ZLVA 1U0BB 1DB3A 2YFQA 3SEAA 1ANKA 4L22A 5J4HA 2YXLA 4TYPA 3D8HA 1GTJ1 5LZ5A 5THKA 1MO4A 4IDAA 2C2YA 1X42A 4BNYA 5KSOA 4ITVA 1W4RA 4R8KA 4TUYB 2H5JA 2UXDB 1UAYA 5GJBA 1RPAA 1PYDA 1NA5A 4D4GA 1VHJA 1PS0A 1YFLA 1ZI6A 4GPEA 3BXHA 4EUEA 4KXYA 5TNXA 2CT8A 4WBSA 3RVOA 1U7ZA 4H3SA 3MJEA 3PZBA 4IH9A 3SXUB 1O96B 4BFCA 1VG1A 2Y8EA 4YPFA 1MLDA 5T4BA 2ANCA 4TVKA 3N86A 3PXUA 3U39A 1N3LA 1AUVA 4A03A 3NLLA 4F9TA 1KETA 2JLCA 3KFVA 3NONA 3UJ8A 2QRNA 1BXZA 1KKMA 3MG9A 3PGMA 1U3DA 4B3SB 3NBUA 1ZIOA 4YT4A 2ZYGA 4TROA 3KCNA 1DDIA 5DBGA 5CA1B 3AGQA 4GI2A 4Q6WA 1J2RA 4I3FA 3CO5A 1NVVQ 1MNAA 1PL7A 2R7AA 5JYBA 4CVNA 1KH1A 4P81A 1CIVA 3VU9B 3RSSA 3O4IA 4HQRA 2H92A 2R86A 3ZWQA 3MWDA 5CX1A 4JMPA 2AOUB 2MYTA 2IHTA 4CTJA 5IZ4A 3A1UA 2JAWA 1KZ9A 2NQ2C 2W2LD 4FCVA 1CUSA 5JATA 2HHHB 1YQGA 3QEOA 1P4RA 1EGVB 2FPPB 1NW3A 4R2HA 2H7YA 4YJ2F 2ZQ5A 4BV9A 4P86A 2DETA 2KW5A 3EEBA 1RPJA 1TW3A 1O9HA 2GVNA 3TNYA 3W4JA 5J47A 2GCNA 2PMFA 3BH6A 1PDOA 1QBKC 2B37A 1MOPA 2QL5A 1RTKA 4ZCIA 3SNKA 4WZAB 4MUNA 2VOJA 4UFPA 4JI3B 2ZM5A 1EFCA 4AZSA 2XV1A 1BMDA 3WZMA 4WBNF 1HFEL 5CIWA 2JG3A 1L6RA 4KR0A 4A6EA 4BJ5A 3BIWA 1GITA 4DMLA 4AMUA 3MWKA 5TIIA 1V37A 5DYGA 5GIPE 1RQGA 2NU6B 3A58B 1F2TB 3ZY2A 1ZUIA 4K5QA 3H5AA 1IG0A 4YRZA 3ONNA 1L7AA 2H1CA 4WGGA 5AKYA 3GJ0A 3LIIA 2GZ1A 4F4FA 4Y9RA 2H5LA 1E62A 2NGRA 2R1ZA 4KH0A 5CBPA 4C0QC 5D3QA 3ONVA 2SNIE 5A4KA 3FPCA 2BFFB 4IIEA 4MKFA 3ZWMA 3VOTA 1I94B 5D8DA 3FDZB 6ABPA 3KQYA 5ALDA 1IHYA 2FXIA 5KYWA 1RPZA 2Q6VA 3G2LA 4XUGB 1NKSA 4UHBA 1G4UR 1Y3AA 3EULA 5HGXA 3DEZA 3PKZA 2A9VA 1WPGA 4AG5A 1M67A 3F1KA 4X97A 3GRUA 5G0TA 5JCZA 2J87A 4H3HB 3LUHA 4HX2A 3WFIA 4ZPJA 3MAJA 2ZIAA 3H7IA 3TGWA 3ZIDA 4BU1A 2GERA 3JQ8B 1K5PA 3IERA 2A3RA 3ZU5A 4BKQA 2BMDA 2ZIGA 4H15A 4JL5A 2FFBA 3BE4A 2ZRKA 3D6MA 4KC0A 4KQFA 5C8DA 5JS7A 3GFOA 4A92A 1HE1C 1DDOA 3AUFA 4R2XA 2HR1A 1O6GA 5JDCC 3WYBA 4PX3A 2G80A 3ETLA 3TM5A 3GLUA 4ROSA 4RTQA 2WDZA 2QMQA 4MEJA 5DWQA 1TT5A 2AZTA 2WG0A 2HA4A 2NXCA 1MB3A 1V8ZA 2YN0A 3H1EA 1RYFA 4J49A 4MV9A 4IDCA 3WHLA 9GPBA 2CHEA 4OK5A 4BX9A 4KQ2A 3TRJA 1GV0A 1N2CB 2Q6IA 3O8NA 1XRSB 5DHFA 4LQLA 4MGHA 3ELUA 3U4GA 4RCVA 3COSA 1RXYA 4NPCA 5LZ4A 4B3IA 4I55B 2BH2A 2MMGA 2Y1EA 3HN6A 3LW7A 1RHRA 5TY0A 1PJTA 1RKQA 3HI6A 4TYQA 5JXIA 3Q72A 3ZE0B 3GA0A 4DV5B 5E6SA 4DNXA 4LI3X 1Q0QA 4YBRA 3AM3A 2Y1GA 4X8HA 3TLEA 2IUFA 5T3YA 2XEDA 4PRYA 5JS2A 2R8PA 1TCUA 4D8VA 3DWIA 2HU5A 5CT9A 3F73A 1JT2A 4JCCA 2BFNA 1XA0A 2QZ9A 1VMAA 4OAOA 4KHPB 1Z6ZA 3DXZA 1R0ZA 4FKMA 3TXXA 2EGGA 2GEVA 1XTVA 5IYZF 1CDEA 1DDGA 1MH1A 2BLNA 4Y0VA 5F52A 2QZJA 4EFNA 1JLLB 3UJPA 1BDBA 1SHUX 1HNZB 3QEBZ 2GKGA 3K6SB 1A2BA 2CXNA 3NTLA 1IHUA 2O6LA 5LP6F 1JJ7A 4UVIA 3SEZA 4DR5B 2DQ4A 3Q5EA 4O4HF 3PNBA 1JEEA 1P2UA 2ZR0A 2A67A 4Q9NA 4FVTA 2C5HA 3FNBA 3B85A 4R2KA 2W6JD 3I01M 1OXUA 2EAUA 1VFPA 5DXAA 1PRYA 2AQKA 2WT9A 4JUBA 1BA3A 4JLMA 4B5LA 3NBKA 4OQ4A 2IWHA 1QIKA 2BM0A 1AKQA 1Z2NX 3PK0A 1TEHA 3ZKWA 1A4XA 1DEOA 1QK4A 4UU8A 1ADJA 5J5CA 4D57A 3LXRA 3U7HB 4RMNA 2VC2B 1X0XA 4RIIA 4XGRA 5FHQA 4DMUB 4N5DA 5HSGA 5ITSA 2Q9BA 3WGVA 1YQTA 4AZVA 4GZ3A 3W9BA 1QE0A 1KIFA 4B4UA 2C78A 3B7WA 3VKVA 2O2YA 1Q3TA 4LHWA 4RHCA 3ZBQA 3OEYA 4TXLA 4FUTA 3WWEA 3O95A 5AXAA 2Y1LA 4JGIA 2GR9A 3A2KA 1LPNA 1J5EB 1KAOA 4MWCA 4J0KA 3RANA 1KZGB 3S81A 1KOJA 3IEUA 2R79A 3MTDA 4JXJA 3HB7A 4MWTA 3GJ3A 4MPRA 1Z4MA 3KEQA 1KY5A 3L4JA 4RVCA 5KNDD 1DE0A 4EYQA 3WGYA 3SIRA 3P45A 1G6HA 2F1JA 2R97A 4B4WA 4P4NA 4ZA2A 3KQMA 5UKDA 3DB1A 1YJ5A 3EG9A 3LCMA 3PWTA 5D3ZA 4WHMA 3WL4A 1STOA 2QNBA 3OCVA 3VTFA 1D6MA 1HRKA 2GYUA 1BEEA 4XW2A 5EPOA 1NNUA 1QYCA 3OX2A 1PTKA 3HE3A 4MSUA 2DUMA 3LHIA 1NUUA 1BHO1 2AXQA 2VI5A 2I99A 3DAFA 3N2YA 5ALRA 4ASUD 3LHKA 3O4VA 3FTDA 5LR6A 1PAUA 2WHPA 3B1WA 2ABWA 3S1SA 3SXPA 3R77A 2YMQA 1EFTA 4JH0A 1XEXB 1ZMOA 2MYNA 3R4VA 4A2PA 5KTTA 5KWSA 4KIGA 1NHWA 3K0SA 2AD1A 3DO6A 4OYLA 3ELDA 1KP3A 4GX2A 2DPLA 4J7XA 5KNLA 2XYGA 2P9CA 1K06A 5ESRA 1PBNA 1C3EA 1M8JA 3DPIA 1FQJA 1PL0A 2J3HA 5D01A 4D26A 3AHEA 3M4NA 4IMJB 1E5QA 3FVVA 3L05A 2FWNA 2CJYA 3GMDA 3O0TA 2B4KA 3DT8A 3QPBA 1M1ZA 1ZGJA 1C4OA 2W6IA 4EEKA 2DG2A 2EX1A 4CDNA 4UPDA 1W0JD 3RF6A 1DUIA 2V6JA 4CT0A 1ZK0A 1S7CA 4XIIA 1SZJG 2ADMA 4FQ7A 2IE8A 4RHFA 3E8XA 3INNA 4HJXA 5A3SA 1JKJB 3D8RA 5HE8A 5GINE 4ARIA 4GMKA 4QFDA 1BMTA 1I2CA 1XTBA 1CR4A 2ZIWB 4ZI2A 1MOSA 1AX9A 5I7WA 3CM0A 2GM3A 4EG4A 2CFOA 1N7GA 3ZZTA 5KWIA 1JB1A 4GGPA 2ZRMA 1KP2A 1BE8A 3PTLA 2NO4A 4KQKA 2VNJA 1TO1E 4MDYA 3DEYX 4Z1MD 1ZLXA 5TQ2B 4FMPA 4JYAB 3F8TA 4M9ZA 5CTJA 4JC4A 3O1JC 2YNMC 4WN9A 4X3PA 3C48A 4LZAA 4YDRA 2ILTA 3AFHA 4RVNA 1D03A 3RT9A 1P7ZA 2OHOA 3C8HA 4FJ2A 1D2GA 1G2OA 1ICIA 2II6A 1GPUA 4N5IX 2I03A 4RS3A 4XGKA 2B98A 3KUDA 3VV3A 1Q21A 3WBKA 3AJAA 1XR3A 2BGGA 1I5EA 3WTBA 1YU9A 1DKUA 2X3FA 3K72B 4V1CI 4XVHA 1E9RA 1SKAA 2AWNA 3AR9A 3IBSA 4MAFA 4FDMA 4WXEA 5E4JA 1JP7A 4EWLA 4AULA 2XDQA 1JDJA 5IAKA 1CCWA 1ZRSA 5F77A 5A4MS 4RUKA 1GPLA 2QIPA 4HGZA 1JQKA 1J8QA 1L5QA 1WW3A 3EGVA 2QYOA 1H0SA 3BXOA 1LX6A 2KBFA 4V0NA 3LL4A 5TS2A 5F7OA 3TUJC 2FZVA 3JQ7B 1J1ZA 1ZX1A 3LQYA 2XW6A 1XU4A 2J46A 4BPBA 3EVAA 1K8ZB 4QVIA 3GHYA 4TZ0A 4YRLA 3B1YA 4QGBA 1OFUX 2HQSA 2QM8A 1WEKA 1U7HA 3C45A 4CFSA 2BN4A 1KZ4A 3A28A 1R6AA 2AFIB 3RU2A 1TAUA 1WCIA 3FIUA 4DE5A 1AXEA 1Q1QA 2FWRA 4D46A 4OXQA 2VG8A 3GFPA 1W9HA 3P5SA 1LA2A 3MIIA 3WI7A 2X1LA 2RKOA 2VWQA 3O75A 1BVYF 3R9KA 2AYYA 3I73A 3Q8MA 1T4MA 2I71A 5BV1A 3ADPA 2ZBEA 5KQGA 4JB3A 3TIFA 5KQPA 4YI5A 2W2LA 1RXWA 1C7QA 1JPNA 1XL1A 4G97A 1N6OA 3LLVA 4PZ0A 1T8SA 1XDZA 1WHSA 3PEEA 5KDDA 2JB9A 4N8SA 2AHRA 2LTAA 2Q6KA 4GR9A 1OY1A 1FMFA 1N5OX 1O4WA 1NUQA 1BKYA 2HSZA 2QE6A 3REQA 4I46A 4RVHA 3QX8A 4MTCA 5F4ZA 1H4QA 4L3WA 4AXBA 2C0CA 2J0QA 2BI7A 4HDRB 3RSCA 1VHDA 2X40A 4Q1EA 3LW8A 1R66A 4CLXA 1JEQA 3HADA 4R84A 3S2GA 3SFTA 5TMPA 2D4HA 1D04A 4H7FA 5CVCA 1FNSA 2DHDA 3GUHA 2WYHA 3EBOA 3I6YA 2MSEB 2C4KA 1E99A 1ZJWA 4H4CA 1O97C 2B78A 2HDNB 3F4LA 4BQEA 1ZJ4A 4LVOA 1U1CA 3I8OA 2DTDA 1ZBQA 4H0CA 4KJZA 3C3MA 1SKYB 1LI4A 2QUAA 3CRRA 4EQ6A 1EXDA 4HKTA 1RWWA 2N0SA 3EA5A 3FLMA 2A35A 1ECLA 4ATNA 2WEKA 1QVRA 5D7NA 3A9UA 3CVXA 1D0IA 1BXKA 3NBZC 4J9VA 2QMOA 5BSHA 5IF3A 3E2IA 1BZYA 3UAYA 1WP9A 4N47A 2P2LA 4ZKEA 2YMLA 3CW8X 4LJ9A 3MB8A 2HXGA 2VHJA 3HBJA 3MTAA 4RBNA 5EXXA 5LSAA 1EXVA 2YKGA 1KYXA 1X2BA 4OYRA 1XD2A 4RKEA 1GRQA 3T3EA 2V7VA 4V2IA 4GS5A 4IAOA 4XIFA 3GP5A 5IW8A 4P53A 2HZBA 4PG7A 3E0QA 1JDBB 1JHPA 1DU4A 1R5NA 2CFIA 2VP2A 1OFGA 3J81k 3H8WA 3VR6H 2HXSA 2C42A 5CNIA 5JNTA 4D9CA 1PT8A 2Q9AA 4BMDA 4M46A 4R2WA 4B3TB 2UVDA 3VR6D 4CKYA 1MO2A 2XR1A 1ODTC 1DKPA 3L7KA 4KYVA 4MJLA 2QVBA 1XROA 4KSBA 2PS1A 4US1R 1IN8A 3JWGA 3SHTA 3E5MA 2I6FA 3WQQA 4CEIB 2Z3ZA 4Q9LA 2V7UA 3RS3A 2R44A 2Q21A 3WFJA 4CM4A 4PGFA 3W9UA 1QK5A 1TFRA 1L9XA 3G0OA 4L5JA 3HLTA 3MSCA 5FL7D 1C8BA 2GEJA 5L51A 3KQVA 4ZHSA 3FWNA 2JH8A 1E7SA 4JROA 4DMCA 4F2PA 1ESCA 4NCXA 4TKVB 5MFZA 1P9NA 2O3JA 3RABA 3K6KA 2GRAA 1Z47A 1C9DB 5U4QA 3IFSA 4E4YA 4HBZA 4GVXA 4S3MA 1E2DA 1SXGA 1M5RA 3KBOA 4H7HA 2RJOA 1G20B 2YJ5A 1PZFA 2FSGA 2AR9A 3AP1A 3LM8A 4XCVA 1K3TA 4KUGA 1H0HA 2FUG1 4MA5A 1E9AA 1AIPA 1NVWQ 1PQWA 3VHXB 4D9NA 3BEOA 3EMBA 5HJ2A 5I9LA 1NAIA 3CUVA 4XQ0A 1MJGM 4H08A 3FPJA 4RENA 3ZU2A 2PUWA 3FAZA 3RARA 4WZAE 1BH6A 5IAOA 1SB8A 3AVUA 1Y1PA 5AM3A 4LOLA 4WLNA 5F2NA 3TE6A 4UQLA 1PFVA 4Q1CA 2OO7A 2O8EB 2D5IA 3UTDA 3ZX4A 1C0PA 1NUSA 2AN9A 2VQDA 4KDRA 1RFGE 4D4HA 2JLBA 2KHZA 1LNZA 2PR7A 4AP6A 4NECA 4CQLB 1H4VB 1SD2A 1M7HA 3QKUA 3EOZA 3Q5GA 4BLWA 4F5ZA 4PC7A 4WFKA 1OFHA 4J0HA 4RV5A 3M5CA 4CDMA 1Y81A 5FDFA 1U28A 2BFAA 5HF8A 2DQSA 2ATEA 3DAOA 4M89A 4NJMA 1SH7A 2QLJA 1SVKA 4DCVA 1KFKB 5H0IA 1TIPA 1V2HE 3G9XA 2AWOA 2B69A 2Z2YA 1BWQA 2ZR7A 1RI3A 2O1XA 3MJSA 4RE5A 4RVUA 5H4HA 1AGYA 1VG9B 2QTHA 4M1WA 5BSWA 4JITA 4J9UE 2YJ6A 3SBOA 3UGQA 3HWX1 4QDJA 3KB8A 1U1GA 4KQEA 4LYDA 1ONPA 4ZOAA 1OXSC 3ICVA 3ONFA 3QPDA 4F38A 2G0AA 1QH1B 4Q18A 4DWJA 5B2EA 3K1JA 1R6VA 5IX8A 1SCUB 3OZAA 4RIGA 2IS6A 3QJGA 4ZK2A 4B73A 4Q48A 5DT2A 5HCNA 1KHTA 2DPGA 1FJ2A 3H5IA 3L93A 4OQEA 4PQFA 4AWXA 4MVJE 4DIMA 4QJ4A 4LECA 4X8LA 1FNCA 1R0BA 5KNDA 4QULA 4Q0MA 1FDWA 3IILA 2Q8NA 1ODSA 3U9TA 1JG7A 3LQ4A 1E7RA 3TSZA 4BB6A 2YN4A 3VVCA 1Y7HA 3LZ6A 1QYIA 1Y8QA 2EEPA 4U0KA 5EWMA 2WQ6A 5HF9A 2LBPA 1N2CE 1QFXA 4WX2B 1Z0AA 3RODA 3EVFA 1UFQA 3SBXA 4IGFA 1FW8A 2G70A 2JIZD 1H23A 2BKAA 3AJ8A 2DE0X 2V54A 3EBLA 1E9EA 1H5NA 2FCRA 3H13A 1X74A 3M9LA 4LKOA 4TWBA 5CTAA 3SZMA 3HWRA 1GA1A 5EIFA 3GLSA 1SVWA 1EAYA 3VJMA 4IIHA 3LFUA 4KQ6A 1LDNA 3WK5A 3GRCA 3A2MA 4LYEA 3ZV4A 2V5VA 1XMJA 5K0ZA 4IF6A 1ZRNA 4IZIA 3L1KA 3O8CA 4D6XA 8ABPA 4BMVA 4ZAXA 5MFPA 3NIGB 2CB9A 3HY4A 3BX1A 1YR3A 4DPKA 4NOLA 3C8MA 1M2KA 1II8B 1RYEA 1CX9B 4NBUA 4Q1VA 1XP5A 5DI3B 4CTMA 3PFBA 2RMKA 1L5WA 4FE4A 1HWYA 4H35A 1C3VA 3LC2O 5LLDA 1XTTA 4G85A 3CTMA 2WJAA 3TLKA 4R68A 1ZM3A 6ADHA 4K6KA 4JX8A 1BHSA 1W0JA 5EP4A 1NI5A 1JDTA 3TW0A 1ZGBA 3T7SA 4YACA 1TYZA 1NRJB 3B7GA 3FAKA 4ZAYA 4TWIA 4Q4DA 5B5SA 4TL6A 4PLYA 5I4CA 5LFAA 3GPIA 1YE5A 3S8YA 2V4ZA 1CUHA 1XEWY 1E8DA 3IMKA 3NUGA 4OHUA 4X92A 5CITA 3W2HA 4AVYA 2X5JO 4XH9B 3JYQA 1E1LA 1ZD5A 3OQVA 2G17A 3KYDB 1U7TA 4HZUA 4R1NA 1VE1A 3QY9A 5B1HA 4EBFA 1A1VA 1WHTB 1RE1A 1HG0A 3DE0X 4MW6A 1MB2A 1N77A 3VHRA 1T3ZA 4I36A 2HEIA 4RTKA 1ULTA 4Z4CA 1QVWA 1T35A 1XTJA 3CZCA 1I1HA 4I4TF 1US8B 1Q0SA 1WUIS 2OOSA 2QGNA 3A6ZA 1M74A 4JVMA 4U5XA 4Y2XA 4UEOA 2ZPAA 3FHTA 1RAHA 4X45A 2F55A 4KCGA 1JQAA 1OHHA 2UZ0A 4YV7A 4CU2A 4EKGA 1JLSA 3COVA 1U8CB 4DLBA 1ORWA 4DW8A 1IL0A 3CZ5A 4GLFA 621PA 1B41A 1TU4A 2WIAA 1OBHA 4Z7OB 2ZTMA 1BHQ1 5EZQA 2BYTA 4N6NA 4JUDX 2XB8A 2HMVA 1NZDA 1MC4A 3OZCA 4QGGA 3E23A 1L5GB 5FLEX 1DAIA 3RVMA 3MHTA 3LC0A 3QKRB 1G7TA 3QNWA 5K45A 1JFSA 1G3RA 3CF6R 1H1LA 4KNYA 2C94A 3GGJA 3NHZA 3U7QB 2C9BA 2G9QA 1QXSA 4RF2A 3E9MA 4IIJA 4KXLA 3ST7A 2NUTA 5KTMA 1EINA 4UU1A 2XXBA 2NLOA 5JRJA 5JG7A 2YR0A 4XM0A 1Y63A 1HZJA 4LHSA 4LFBB 4NOJA 3F49S 2CDAA 4YYEA 2YVUA 3E9NA 3DMDA 4P31A 3RSFA 1RIIA 4OUDA 5EP2A 3LPCA 1ENPA 3OM9A 4NPAA 1I14A 1PUIA 1HDOA 2NU7B 3EC2A 4JOSA 4Q37A 4KK4A 1FK8A 1G60A 4KN5A 1MABB 4A0HA 4LX8A 1GQOA 1BQ4A 1YZUA 2CCGA 3CJRA 3E3MA 3KYBA 4A1OA 3S4YA 5KQMA 3QFTA 1SWWA 5EG5A 2BPOA 1QC5A 3IVRA 3EIHA 4KWIA 1WDKA 2GEDA 2IXEA 4X8MA 2BGIA 3W0LB 1HURA 2B6NA 2BZSA 1J0XO 1KY2A 1XUOA 2Y1OA 3C97A 3NC4A 4J07A 4BMXA 5KOJB 1Y3IA 4C2BA 3OP4A 1QB7A 1OV6A 5FO1A 3EYWA 2NIPA 2ZAMA 4MLCA 3R2JA 4HVTA 1XVAA 4TRRA 2HWWA 3R6GA 4QLBA 3D6UA 1XMIA 3WO1A 2ONZA 4Z3DA 4U2FA 2H1OA 1XHEA 1QO9A 5CK4A 3ZJUA 3IKVA 4HF7A 3DBIA 3L8HA 4JDUA 4PSDA 4QTTB 4G1FA 4DXHA 4RCYA 1SVIA 3UC5A 3K9WA 4QGAA 3DTNA 1LPPA 3I2HA 1H3NA 3PS9A 4IX1A 1SBTA 4K46A 3UMJA 4EMSA 3GXBA 4BLSA 4COKA 1PD0A 2BZ1A 2VH2A 1O0SA 5JCJD 4RXUA 5EP1A 1V8BA 1XMXA 5EEHA 4GO1A 3L77A 2IODA 1G38A 1B43A 1CDZA 1GT91 4LSGA 4WN3A 1SB9A 2IOYA 3GD7A 4XUEA 5ICFA 4FHZA 4WCFA 1XXHA 3HHPA 2GZ2A 4KOEC 4B5KA 4I9FA 1PJBA 5JY1A 1VDMA 2HSDA 4S05A 2XB9A 1NRIA 2PSFA 1XQ6A 4NHEA 2QAGC 1ZGCA 4BP3A 2ZUBA 2EFHB 2IL1A 5FNZA 1M6HA 4BQIA 4OQFA 2D54A 4QX6A 4TKZA 3A3KA 3PLRA 4FLMA 4L0CA 3LXMA 2V7BA 3QX3A 1CEYA 2JAOA 3RS5A 4KO3S 3QMWA 5F1YA 3GJ8A 2NSHA 3ZV7A 1M6VB 2PVSA 3IT0A 1NIPA 5JLJA 2C9OA 2PYDA 3RIGA 3RYCA 4S1VA 5JWHA 5LWQA 2FQXA 2KI5A 4RJ2A 1T24A 1MB0A 4WBXC 3T06B 2WUWE 3ZKAA 3RYHA 4DWOA 4KAAA 1H4SA 4Y1EA 2YXBA 3C7TA 3ROKA 4UREA 2WIKA 1XAIA 1JGTA 3WFZA 2H8GA 4TMWA 3OKFA 1IXSB 1I3KA 1E5XA 4XGNA 4FDVA 2I3AA 5FD8A 2XWSA 2AFIE 3G8CA 4TV8F 1SZDA 4ARAA 4B87A 3PV0A 1RI5A 4MQBA 2IYAA 2N1BA 1QDEA 3EUEA 4BO5A 6CHYA 1WXHA 4I4LA 4LWOA 1M1NA 2I65A 5FL7A 4DIKA 1N75A 4YJFA 2XQFA 2OBNA 3SR3A 4D3SA 5IH7A 1LXCA 3B53X 1W96A 3LHDA 4URWR 1RAEA 2FR8A 7ABPA 5LP1A 4BNTA 4IZOA 4PCUA 1L8LA 2CLIB 4D0NA 1SUDA 1UWKA 2EBHX 2VLBA 3LZCA 5TEWA 1GO2A 1LLQA 1PJCA 3I6ZA 5JC1A 4DDMA 1FDSA 4G8BA 1VE3A 3EODA 2WWGA 3G0IA 2GEKA 5AVUA 4IQ4A 4W63A 1ZUNA 2Q5EA 3QKTA 4C6HA 3ILYA 4LGVA 4U7DA 2ANBA 3AQIA 3UW1A 2MHCA 4ZO4A 3LY5A 3KSUA 1EA5A 4FMCB 3U44A 3WKEA 1DLIA 1NF3A 4R1UA 5E6RA 2VWPA 1IIRA 3ASZA 4UBKA 2I54A 4YP7A 5I6DA 4IFEA 1EQ2A 1Q1AA 3T5BA 1XDWA 4Z3KA 3ZDEA 1DHTA 2P68A 1Z0UA 4ED9A 4UJ5A 2XOKA 4FR5A 2GRJA 1U7XA 1SOMA 3OOEA 4GX0A 3GG9A 1W25A 5E3JA 3WLNA 3DOEA 3L7LA 4CIVA 1UXKA 3OPMA 4YFYA 1K08A 1NJGA 1SKYE 1F38A 3FNHA 3UUGA 1EP1B 5CW1A 2IV3A 2XJ4A 4JASB 3KJFA 1GYRA 1O58A 1SMKA 1Z7YA 3QXGA 5TQ0B 1YAJA 3FZYA 4B71A 3SF8B 4ADSG 5FQOA 4ZYUA 3VZCA 4FE3A 4R51A 1YRHA 2C8JA 3IHLA 4FGJA 4Z51A 1R0KA 3EXFB 1R9NA 3GD5A 5G2OA 3UBMA 2XTNA 4K9SA 4BMNA 3KQKA 3KKMA 4LDQA 5BV2P 2BGMA 4HADA 3HXKA 4LMAA 2IWRA 2B4YA 1YVPA 3SFZA 4JI7B 5AJHA 3NXSA 5EJ7A 1DRJA 2AG0A 5BMVA 2ZP1A 1FTSA 4ITUA 1M2OA 1DLJA 3AESB 4OP1A 1PBTA 4WADA 4HUQA 4MRNA 1L8XA 4BXOA 5D3MB 4G0PA 3OM1A 3QEMA 5LU8A 3QWHA 2ZCJA 5F5NA 2OGZA 3WWDA 5FB3A 2IXGA 3BULA 5DSTA 1GUYA 1KU6A 4XWYA 3OOHA 3W6PA 3GEGA 2ZB8A 1OFTA 3LY7A 3O1LA 2OHGA 1WSBA 3CKMA 4DOMA 1QP7A 1UMDA 3KNZA 1C1DA 10MHA 2BKEA 1X0VA 2R7MA 2CB0A 1KAGA 2Q3HA 3B3FA 3BL5A 4OCZA 2QV7A 3GT0A 1FTYA 2AN4A 2JGEA 4WOBA 4RZHA 5L7TA 4XQEA 1QU3A 3AUSA 2OLKA 4LOHA 2O9JA 4IIXA 1KNXA 3PXAA 4PPNA 2O0LA 4PTYA 5DYIA 4HAIA 1NX9A 3RHSA 4FCCA 3QU4A 3KV1A 3ROQA 2GCGA 1UUFA 2DKOA 1XWIA 4R1OA 1SXJC 5HS4A 3CVUA 4IIGA 3FTNA 4G5XA 1PV1A 4GYKA 3D1JA 5AW7A 2YFKA 4JELA 4QWWA 1PFUA 2JIZA 3GO4A 4TS3A 3GPDG 3EHEA 1JNXX 4XZ3A 1G20E 1MO3A 3G2KA 4PX2A 1G0OA 4X7RA 3LQ1A 2F8SA 3RTCA 2PUEA 1DBIA 1B0AA 1Z5WA 4CIBA 1KH3A 2Q8PA 2RHOA 4GLBA 4LXUA 5BWBA 4UCWA 3TRDA 1YUMA 2JC3A 3EF1A 4A5OA 2J1LA 3DAPA 4GF5A 3ABQB 4MKRA 5H7XA 1FP7A 3RVQA 4EHFA 3IP8A 3S2YA 3QBEA 4OXKA 4TM7A 3LWDA 3BAFA 2JRLA 7MDHA 2GEUA 4EBBA 1E8NA 4JA2A 3G2PA 4RSGA 5DNUA 2REQB 1W29A 3GRZA 4O0MA 1OROA 2B6HA 4R9VA 1QOZA 1J56A 4H27A 5FJIA 1PV4A 1DTWB 1L4BA 4Z2AA 4LMRA 2KM1A 2PMEA 5AI0A 4YCBA 3LTEA 3SMQA 5A4IS 2G77B 1P1CA 3OFND 3TS1A 1JG1A 1YCGA 4JWKA 3OTQA 1U5AA 3ZQKA 1WTCA 4B6PA 4YDHB 5J23A 3UHFA 3DDHA 3L3BA 3A8TA 3DE6X 5COBA 5JSHA 5GZ3A 3PICA 4L5BA 2AN5A 1A9RA 2C31A 3D4LA 5ICSA 3HXLA 2PD4A 4N76A 3H3FA 4BQOA 5GM1A 1XMSA 4CYMA 2NSYA 2G9VA 2WYUA 4KIUA 4P7KA 4ZP1A 5LL6P 1PR6A 1B8NA 4BE7B 2CEKA 4PYOA 3H1TA 2NMVA 1NNEA 2FEXA 4Q9HA 1B6SA 3EW9A 3LUPA 4PIPA 4OKSA 1Z35A 5CB6A 3G17A 4V03A 4POAA 2BDUA 4YB8A 1B7GO 1P8JA 3IQXA 3KPUA 4ZO6A 5CAEB 3IRVA 2P3LA 3WAJA 2YCBA 3OIFA 2VTBA 2ZZMA 2AN1A 1X7ZA 2A0WA 4ND4A 4PSVA 4PGGA 5DCYA 1W5AA 1BVRA 3RLFA 1H05A 3B3AA 3S2ZA 3BGOS 3ANXA 1OLUA 4C0WA 2A59A 1FW6A 2O6HA 2I2XB 1GD1O 1JS1X 2PQ6A 1IYZA 1B0PA 4PO3X 2Y0EA 4UU0A 3PQDA 4OYYA 5EIAA 4B7AA 1FQOA 3HEMA 2I9KA 3HYNA 5CYFA 1DX4A 2AOTA 2FPOA 3F3MA 3JY6A 4M3NA 4EB3A 2BOVA 3JTEA 5EE3A 3CLUC 2BP7A 2IC5A 2V96A 1Y48E 3I45A 3I0MA 3JQFC 2BKVA 2IYWA 4HSEA 5K4AA 1TRHA 4BX8A 3UMYA 1TPZA 3T7RA 4RULA 5L45A 2REXB 2X8JB 1W85A 4AURA 3W04A 1SHTX 4EYEA 2C2GA 2VKTA 4US0R 4HX5A 4DMHA 3IQWA 2GPSA 1OZGA 3NBYC 3VZSA 2P5SA 3AEYA 3L6CA 4Q3OA 2PSEA 2NZUG 1S6YA 1VCIA 3DWEX 5C8YB 1USKA 3O1IC 2PANA 1QGUB 3GLKA 2E85A 2G5PA 2C04A 4FNGA 1Q77A 1LGYA 2RHTA 3NP7A 4RLFA 1K7SN 5FPQA 1Y4ZA 4F6LA 3UUFA 4MVJD 3TGLA 4ZWNA 1QFZA 5SYAA 1DOHA 3OOYA 2J0UB 3KSBC 3FKSA 1PV2A 3KXLA 4N7RA 2HN9A 2FDXA 2VKQA 3I64A 1GPDG 4OQZA 3LUAA 1NQ5A 4X8OA 5GY7A 3Q2KA 5HIAA 3GNLA 3G68A 2QVZX 2YICA 3DKRA 4L4SA 4TLDA 3NHRA 3HCAA 3DL4A 3VZPA 3I58A 4PANA 4CW7A 5K0EA 3V8RA 2BGJA 4QBFA 1TK3A 3CA8A 3BMNA 4UE2A 3NV7A 5DTMA 1TO2E 3GDHA 4PLGA 4EMTA 2ERXA 2H4FA 3PR2B 3D5QA 5BT9A 3SBDA 4C7JA 5FLXA 3U3OA 1PZEA 3WKBA 3ZWOA 3ANMA 3WOVA 1PFGA 3MUFA 2B1IA 4MW0A 3HU1A 4DDKA 4K03A 4XB2A 4NCIA 1V39A 4WI1A 1GXSB 2QX4A 3M3HA 4I0WB 4DLWA 4MUMA 2TMGA 3ORYA 2JHAA 2PXAA 1QF7A 2QUIA 5AW5A 2V7WA 5DJ5A 2L17A 2WZQA 3B51X 3QBDA 2CZCA 2DLNA 2D2FA 3X2FA 4R8VA 2OP0A 1LU9A 4QBGB 4AKSA 4LRSB 5JCJA 4DV3B 3NH6A 1DCFA 2FJ0A 4EY3A 2JGKA 2QZ4A 5JNLA 2D1YA 2NM0A 1J00A 4GRDA 4KRGA 4LVCA 2C7GA 1KSGA 2Q7DA 5HRAA 2N42A 3SJZA 2D13A 2I0FA 2SKDA 5ULLA 2XNSA 3SLRA 5F12A 3WISA 4DLSA 1MX5A 1KJWA 1Y1RA 4ZC8A 4LF6B 1GG8A 3NVKI 2BE7A 4EO7A 3N2IA 4ZQHA 1VGVA 1CUIA 3ME5A 2FMKA 2RARA 5CT8A 1J2TA 2OPBA 3C70A 1Z2PX 2PG3A 1T5LA 2NZ2A 3DS8A 1T13A 1KBZA 2F48A 1QYRA 2ZI6A 3COZA 3H2YA 4UAUA 3DOCA 3HSYA 4WZ6A 1U81A 2JD2A 4CT5A 4LDZA 4NBVA 2IEBA 4QUGA 3K30A 4B8YA 2WJHA 4LS3A 4FFPA 1CUBA 4RC9A 1OXXK 1P4HA 5ERXA 1LY1A 1NKTA 2EVWX 4P38A 4W1SA 4ZVLA 3T5MA 2C7QA 4G0VA 1FFDA 5J4LA 2Y1DA 3N2GB 3UMFA 2IBSA 3C41J 3JVUA 3WJ1A 1C3JA 1NATA 2WABA 3L6UA 2VAPA 1T43A 4U7HA 3I12A 2J41A 3N05A 2W22A 4M4SA 5GONA 3JAMA 1K63A 5KREA 5A3JA 4BAZA 4MKGA 3UJ7A 3NEJA 3BXXA 4TSRA 4WNCA 4ESOA 1P4SA 1TYEB 1YT5A 4N0PA 5ED4A 2WQ7A 1B8VA 1IN5A 4KGDA 5BSGA 5J59A 3ZYZA 2WZCA 3R7NA 2DLDA 3TLYA 2O1EA 4MJ3A 5JSKA 1UKEA 3LLCA 2GD2A 3HNPA 5AH0A 3FLBA 1AUQA 4HB0A 2JLXA 2OBMA 3M4YA 1TADA 2IP1A 3ECCA 1HETA 3DTVA 5TDHA 1QIEA 1FX1A 1EUCB 1Y3HA 3DL7A 3FGPA 1NDHA 3KVRA 4HDNB 3UF0A 3U6BA 4MW5A 2L2QA 1EK0A 2FPKA 2AN3A 5KX5B 3X3HA 4RD4A 4HWGA 4MV4A 3I37X 1LDYA 1T2UA 2D5CA 3DXXA 1YR7A 3N0RA 4FWBA 4J76A 4II3A 4I66A 3R7LA 3BORA 3UJAA 5A4JA 4GX5A 2PO7A 3ZIAD 3E22A 1TIBA 3QELA 3AK4A 3L06A 4MUHA 4GOJA 4I4CA 4OOFA 3X44A 3L4BA 2RHDA 3FYSA 5K8TA 1BDIA 3LP6A 1PGPA 4RY8A 4GWGA 2C4NA 2GA9A 5G0WA 2IOFA 3LK7A 4FB5A 4CKWA 4WK6A 3GEPA 2P4UA 1JEOA 3ORHA 4QYSA 3O7WA 1QS0A 2P0AA 4G56A 2E48A 3L6BA 3LKZA 3M5WA 5DIZA 3T5GA 4R3WA 1HKHA 1DHRA 1U8FO 5EUMA 2CBXA 2G6TA 4HAZA 1GDDA 5F5LA 4F8JA 1VSBA 1E59A 1H65A 1K88A 2J33A 2YZKA 3T7JA 2F3RA 2B8EA 2C99A 2ZI5A 3D9QX 2PBLA 3DM9B 4P3YA 1ZQ1A 4QQKA 3E8MA 4MRVA 1G291 2QB5A 3AJRA 3KOWA 5E4TA 5GOTA 3HQ4O 2CFTA 4WV3A 1DBRA 3X1YA 3RYTC 5E2BA 1R0RE 3GFGA 5K2MA 5C37A 2CHFA 1S2DA 4D7AA 2C3UA 3A36A 4FHEA 4QNRA 3MERA 4ETMA 4F4JA 1M2VA 3PHHA 4O2AB 1M83A 2ZJ3A 2GYWA 2NZJA 3V7YA 3PF9A 1BU8A 2BFWA 3H2HA 2JGFA 3BL6A 4O4IB 1RXUA 1W4AA 3Q9NA 1KEVA 2WKWA 3MOGA 2BLLA 4Z9XA 4XWOA 1SBYA 1FYEA 1Y9DA 2ZAYA 3E0XA 4HN9A 2WM8A 4FXPA 3LQ2A 4Q47A 5EFZA 4NYIR 1H93A 3VNQA 5HUJA 3L5OA 1G2QA 2J9GA 2XNDD 3LAWA 2FW7A 4WKBA 3SN6A 2XY4A 3PQFA 1UOEA 3AM5A 2OY0A 2XGOA 3L6RA 5ENDA 1Z08A 2P5UA 1OZ0A 2G06A 4D3DA 4MVJP 4IO1A 4N0EA 3OZBA 1K7FB 1RJFA 4IIUA 4MX8A 4RJKA 2AJTA 5K2OA 3AEUA 1ZOOA 3PR1A 5BXYA 5AVSA 2QM7A 2CD9A 3ZY6A 2PV0A 3STUA 5IEJA 4HNQA 4ZI7B 1E89A 3K2EA 3HVHA 4GH5A 2JHPA 1SXIA 1Y37A 1OAOC 3EXHA 3JYHA 1NLFA 4DIEA 4K0RA 1BG6A 4NBKA 5HUQA 1SOVA 1BOOA 2I29A 2IITA 3SYMA 3ZV3A 1G7RA 4EPWA 1WPXA 1HSZA 2W7TA 4GUDA 2BV3A 4O25A 5HIJA 5EHZA 5HHTA 4U7WA 1LJ8A 4IEIA 4JU8A 3SZOA 4FKZA 3PRHA 1U7OA 3RR2A 3E2MA 3WGMA 4TUYA 2OCXA 3SPXA 5KTSA 4Z9YA 4TYYA 3AVYA 5BYJA 1SC4A 3O03A 4HNGA 1D2NA 4PG5A 1DL5A 3RVSA 3VYTB 4LOJA 3UATA 4KYUA 4NBTA 4RPCA 2FKNA 4V0RA 5AJXA 3QA9A 3SXUA 2O59A 1O96A 4S35A 1HL7A 1KIAA 5F7ZA 5HP4A 3ZYCA 4AIIA 5AOAA 4K26A 2DUJA 3G9UA 2O2ZA 3IUYA 2C8KA 1ZDMA 4H6VA 2FOIA 2YIJA 4L4YA 3RS8A 2FPIA 1JQLB 3UMMA 3F0TA 3BRCA 3ND8A 2GF9A 3ABRB 4FFWA 5EJ6A 3V9AA 3WXBA 3HPQA 5HUHA 2EFYA 2PGJA 1ONBA 5ARCA 1R0XA 2QVYX 2X2EA 3Q11A 4Q7LA 3M81A 3FVTA 5CA1A 3NI2A 4YLEA 3DWGA 2PWYA 4EI2A 1GEEA 1MGPA 3AONB 3MMPA 1NVDA 3W5VA 2QQ5A 2JHCA 5D85A 3K96A 3VAAA 1WSAA 5IAEA 1EVJA 2PQ0A 5KCZA 4UU7A 3CUYA 2ENUA 2EDAA 421PA 3L1IA 3OFNA 4FFLA 2IZ1A 4YUWA 1ZH2A 3VM6A 5JHHB 1OX5A 1NBHA 5JSZB 1MORA 2AOUA 4ILEA 1YZ3A 3QTLA 2Z5VA 1HDZA 3E7FA 4HDOB 4JVSB 1SUAA 3LP8A 3OF2A 2GFHA 5EZ6B 2XMQA 1ZHFA 3ZZUA 3IUSA 2X0DA 2GASA 3U61B 1I80A 2OAEA 1BQ3A 1S1CA 2CVQA 4G1UC 1GJRA 2P9EA 3DVSX 1AVTA 2I7CA 3AY3A 3AF3A 4PGAA 1UMBB 3GIDA 3IVAA 4IIDA 1RQLA 4P80A 1ZH0A 1NG1A 1Q74A 2PKXA 2XQGA 1UANA 3A4VA 4HLDA 5DTQA 1P5ZB 4D41A 4G0UA 3BGWA 4UUMA 1AZLA 1JHDA 3RQSA 5LQKA 1XDDA 1LWNA 3MRSA 5AXBA 3ZCPA 4BMOB 1M10A 5AVWA 2AA3A 4E88A 3FYDA 2NU6A 1ULBA 1EK2A 1F2TA 1R18A 2ZJ7A 3V00A 4F2WA 5A9RA 5CYGA 1OH8A 1P9OA 2PH3A 2Z1MA 1WWKA 3ZVNA 4AWBA 1IZ0A 1J5XA 3PD1A 2JD0A 1VLLA 4ZJPA 5SYMA 3F97A 5HVNA 1NJ5A 4E1VA 1KAQA 3E1GA 2BFFA 3IS3A 3RRFA 2DJ5A 4HWTA 3H11B 3HVJA 5CM2Z 2VQFB 5D6NA 2CLEB 2QLLA 4HR7A 5ARDA 5LA6F 4QQRA 1FSFA 4O8ZA 1N6LA 5DVZA 3WX0A 5JYCA 3WGHA 1PR9A 1JIKA 2MIIA 1U9CA 4U5QA 1C3OB 2CJFA 2Y1FA 2XT6A 1JJFA 3QFHA 3V8VA 1NSFA 3W6UA 4DZRA 5LXTA 4AO7A 3DDUA 1OX6A 1OYOA 1F1JA 2AMJA 4Q12A 5G0SA 5IJWA 4I4NA 3BD9A 1U8AA 4FYVA 5FUYA 2FUEA 3EAGA 4TGLA 5P8WA 3EXIB 1J2YA 2RCNA 3MCVA 4OHXA 5EJAA 3X1KA 3L40A 4AN0A 3R5KA 2OESA 2QVCA 3JQ8A 1U0NA 3STHA 1VOTA 1N36B 2UXBB 1JSCA 1X13A 3USES 2Y2UA 1GZUA 5E6UB 3WJAA 4YHHB 2PAFA 1JLKA 4MVJA 3MWEB 4QTUB 3T9BA 3UHAA 4HUJA 5KKCA 2XA1A 5CGQB 1FMLA 1K9SA 1JLHA 2XI4A 3U7JA 4DT1A 2GN4A 4EW2A 2PUDA 4UOEA 2PSJA 4R05A 3I83A 1J5PA 1JR3E 1C9KA 5C8ZA 2J9YB 1JTEA 4H7IA 4GYWA 4JC5A 4MUAA 4QARA 1OR8A 4A16A 4P0PB 1NV9A 2NVWA 1N2CA 1QHFA 4L8LA 3CX4A 2H85A 2OT3B 1K8XB 4C30A 1UPCA 4LZNA 4I55A 2VYFA 3ASYA 1A0OA 1E32A 1XTQA 4IOLA 5DYWA 2BHRA 2QK4A 1WB4A 4Z4GA 4AJIA 2GJ8A 2ERYA 1AGNA 5ALUA 4IX9A 5JSUA 1JEYA 1FJGB 1CR6A 3VO2A 2FB9A 2HADA 2W0MA 4IFIA 4FFVA 4GGOA 4LZJA 1DADA 4MO2A 4WSOA 3TKAA 4TRMA 3VZQA 3V4LA 1Z5GA 3MPUA 4FYJA 2B4RO 1A5SB 5E7MA 2C9MA 1Y8CA 2J6HA 3OM8A 1VL8A 3OZSA 4S1OA 1G8KA 2Y9PB 2EGHA 4IINA 4JHXA 2XF8A 3QLUC 1TJ5A 3O4FA 2OFOA 4ZCTA 2WWWA 2G72A 3V55A 4YLYA 3K6SA 5EINA 4LJYA 4C0HA 4F0JA 2WZDA 2VJCA 1G17A 5JE8A 4WKPA 1DQPA 3A6DA 2ACEA 4BN0A 4CWAA 3KJIA 1W36D 2XSZD 2YXDA 4JKOA 5LIPA 1MBZA 5SYNA 3LP5A 4CMEC 2RJ3A 1A50B 4ISBA 4YMSA 2AKAB 3A4LA 4LG1A 4F1JA 5CA0F 4XLTA 1NVEA 3ZE6A 4BNFA 2H2HA 2ZOSA 1HQCA 3KDAA 1N8KA 4S24A 3CSSA 3PG5A 4NYMQ 3ZCVA 5ABPA 1N0HA 1KERA 1SGWA 3PC3A 2DXIA 1DFHA 1KO1A 4YLGA 4R1SA 3K1AB 2ZSAA 3TBHA 3V1TC 1A8SA 1EWTA 3VH1A 4RF5A 1QX3A 4TVSA 4TKMA 1L4MA 1FXUA 1Z5NA 4K3VA 3S44A 4F04A 4A8HA 2ZK7A 4A0QA 4BV3A 3TXAA 5DASA 1XTPA 5IJAA 1CY1A 1R10A 1XQ1A 3LLUA 4FJ1A 1P9WA 3UV7A 1E3IA 1I2AA 3SX0A 1BMFA 4XFJA 2IOQA 1CZOA 2CNKA 1IULA 3HSSA 2PRIA 1RW4A 3SE0A 3U3ZA 5AIAA 3QW2A 1BEUB 2I9PA 3TL2A 4CEHA 4Y98A 1FRFS 5ESWA 1VHWA 3WLTA 3WLSA 3HABA 1O8CA 2A3NA 4LY6A 5IC6A 3WGLA 3LC7O 3ILSA 4A36A 4LOAA 4MRPA 3ROXA 1U2GC 3PHJA 1EX1A 4LVUA 5JAOA 3SOPA 4P3KA 2AZXA 4CLOB 1Y42X 3E7DA 5DLEA 3HLYA 1OWNA 3NXKA 4UEQA 3EVNA 3QHQA 4HYYA 3KOMA 2D8AA 4MA0A 4GI7A 4OATA 4RGBA 1UJ4A 5CCEA 1XHLA 1IXZA 4KLAA 1XEXA 2HDWA 3IDAA 1HE2A 1BAPA 2OV8A 1WNFA 4PHGA 1T8YA 4PM4A 3JZIA 4M1YA 8ADHA 1EDDA 4BWVA 4WMLA 4UFOA 4K6OA 1IOLA 4LY9A 4DDWA 1ECGA 2ZUUA 3T5AA 4LE0A 5TJHA 2JASA 5ALXA 1PN3A 1BOFA 3KSRA 3E5RA 3JD3A 3M7IA 4CF5A 3GNTA 1Z2EA 1X7HA 4DUYB 4KMOA 5DHQA 3D4IA 3ZWCA 3DZCA 3BERA 4YJ3B 3URKA 3P4UA 3JCZA 4Z2YA 1KZ1A 1W52X 2Q4OA 1VFNA 3ZBTA 1JKJA 1OGYA 4J90A 1DO8A 1FDRA 4KO1S 5G4KB 5EHQA 4AICA 4OK6A 1ATIA 5J2UA 2XCRB 4JT4A 1ZCFA 2IIBA 3D1VA 1FYXA 1CP3A 2XNDA 3K9HA 3EC1A 1KI2A 2HJVA 1U9IA 3GMIA 3HUTA 2HO4A 3PKJA 4MGZR 2VQ6A 3HHEA 4RF3A 5AJVB 1DXQA 5E7JA 2C5BA 1M2JA 5TQ2A 4XOUA 1FRNA 2QX9A 1E63A 1NF9A 3FDIA 1VIAA 4QG7A 2XMBA 5A71A 4QUAA 2YRFA 2B8WA 1Z7EA 1T1SA 3PCXA 3FZEA 3VPHA 3PRKE 3BCRA 1CRQA 3M1YA 1DWPA 1WVIA 3WRXA 5K0LA 4WGFA 3UYLA 3L0BA 4EZEA 3DHVA 1NJSA 4RK6A 3VPSA 1XPUA 1ZVMA 3HGMA 1LC3A 1WLSA 1Q5PA 5AK6A 5TVKA 1L7QA 1NY5A 5AVOA 3AJ9A 1CS4C 2D5LA 3SC6A 3VHQA 1JWAB 3C1AA 5A0TA 3QU9A 5T8KC 1IONA 2ID9A 5B1EA 4GR5A 2IUUA 4E3WA 3EA0A 3MWJA 2VNHA 1ECBA 2R4UA 2DUUA 3KALA 4IPTA 3KDPA 3CFYA 3IUBA 1V26A 1FTGA 1N2XA 1H2WA 2GB4A 2QUKA 1Z12A 1DT5A 4E13A 3U4IA 4ZN6A 2TS1A 3OIVA 4B80A 3QUTA 2BCEA 9ABPA 1HNWB 1G0NA 1UH5A 1RZUA 3TFOA 4I2VA 2CLFB 4MOWA 1NE2A 2C0QA 2F9LA 5T6BA 1GU1A 4MARA 4DIUA 1T8TA 3WBFA 4DLVA 4RDHA 5HPYB 5JROA 2QT9A 5LDDC 3B6KA 2VO1A 5F98A 3H2BA 2J59A 3CLTD 4CCAA 1QZZA 1J33A 4EHDA 5BR1A 3ZEAA 2WD7B 1SUFA 1JJVA 4LOIA 2AFIA 3ZVKA 4M83A 1OLXB 4Z8YA 3HJHA 2WHYA 4ZHQF 3SZ3A 2OM2A 3LT0A 3AERB 5ALOA 4QOEA 3M6VA 2OV3A 2XWJI 5LZ8A 3GLRA 1AQNA 1B73A 4MQ4A 1OLSB 1WW2A 1YQQA 5TVGA 2R96A 3IURA 1VCNA 2A5DA 1RKVA 4WT7A 4RF4A 5J5VA 1MEOA 3RUEA 4LDJA 4AKIA 1KDVA 4O4LF 4B48A 4Q3EA 3TZKA 3F8WA 2FWPA 4RZ2A 2RG1A 2XRFA 4DJJA 5KYXB 4IOJA 1P31A 2G1KA 2VJLA 2QRHA 4HLQB 3ROTA 2VEOA 3SC3A 4CKXA 5JRZA 5JU6A 1J70A 2O8CB 2Q5OA 5B7QA 1XK6A 1IUPA 1WQ3A 3HBNA 1NI3A 2L0XA 3OCXA 4HQ0A 2D6FA 4HDRA 3PWZA 2O8BB 4E15A 3LX6A 5FULA 4RVGA 2HU8A 1NUTA 2ST1A 1DC7A 4DUGD 1CYEA 3AP3A 2OHVA 1F9AA 2R25B 1RACA 4TL7A 5C5CA 1U90A 2HB6A 3Q6IA 4M8KA 2EBWA 4XD2A 3NP9A 3ZDQA 3ZZNA 1BC5A 1IFXA 2C5SA 3IB3A 4D0GA 3GVHA 1CR1A 2HT1A 4BJ1A 2H2IA 1K6MA 1UFVA 3DMGA 5ALKA 2HRCA 1F3LA 2QUHA 1Z07A 2AEJA 4NFHA 4PC2A 1XLTA 4D9IA 1G5RA 3V9PA 2PZAA 1S89A 5JV5A 1KH2A 1ST3A 1BNCA 1V1RB 3OJOA 3RS4A 2HDHA 1QDUA 2H16A 4U9IS 3SKVA 4LV5B 1O95A 4LC1A 2J6CA 1U1FA 4BJ6A 5E38A 3IPCA 4ZJUA 1BDHA 1WABA 2CJXA 4XDGA 1ND6A 1RLMA 2P40A 3H6GA 5FNVB 3B5EA 4LF7B 4Y1FA 4KUEA 3PFFA 1AMUA 3AIOA 3W4KA 1T34A 1YQXA 1HLFA 3EARA 2FXVA 3JAKB 4UCQA 1VKNA 1CK4A 2YH2A 4G4SP 4W1RA 1I7DA 4B40A 4I1VA 3WYCA 1OD6A 4PHHA 3ETCA 4OB7A 3OU2A 2VIIA 1QVAA 4AZWA 5ELXA 3C7DB 4LHEA 5JNWA 3EVGA 4BQSA 4FE7A 1EFHA 1C1XA 4DIFA 1QWOA 4URXR 5CFMA 4B3MB 3DT9A 5DX0A 3W5CA 2CNLA 2NXJA 2XUDA 1EPUA 1ZNWA 2ZRAA 4M0CA 2X4DA 3GJ6A 1RHUA 4EB6B 3L8GA 1V6AA 3JAWA 1XZHA 2YQ4A 1L4FA 3HH8A 1A5TA 4AN1A 4IYJA 4H1WA 1F2UB 4HMQA 3WNVA 2OVBA 4I5EA 3K9FC 1SC6A 2ZSDA 1K4YA 3NMUF 4YALA 2VK4A 4CMJA 4BVLA 1MAAA 1G5IA 4ZRMA 3KZVA 2OV2A 3L5KA 1XU9A 4TLAA 5AVVA 3FUTA 4XR9A 4HDQB 3HDQA 1S8OA 1HBJA 2ACKA 1G8SA 4AKEA 5HQ3B 4POOA 2I6TA 4M0DA 2CVFA 1FFGA 1YFKA 3OPQA 2PRJA 5CH8A 4L2IB 3WIOA 4MULA 3P0EA 4D0LB 2DB3A 3QE4A 4TXNA 1ZM2A 1MDFA 1YC5A 5JZVA 4FEEA 4ZT7A 3MTQA 4U7JA 4ECAA 3K32A 4RJJA 3UV6A 2Q5HA 3VHXA 4PLPA 4UBJA 3D6NB 1ECFA 4F84A 2XNHA 2CC2A 4FDUA 2GN1A 2RGBA 2FPLA 1HQDA 4GC9A 3TEJA 1UC4B 2QT1A 3ED5A 1EA7A 4Q1DA 1WPQA 5KVSA 2VF5X 5JJLA 2DSTA 3A7DA 2YS6A 3VHLB 1ZW1A 2ZBGA 4KHZA 1KEUA 1UMCB 4NYJR 3DDSA 4Y6LA 5JDIA 4QO7A 2P9FA 2YWHA 1RWPA 3ZQ6A 5KYKA 4CQLA 4EGQA 1WBDA 2VDMB 2HNAA 3OY2A 1WEHA 4PTLA 2FX2A 4REOA 5U4XA 4N8EA 4HNSA 2YHUA 2M6LA 5JI3E 4L7QA 2HCRA 2UUBB 3I6IA 3H6KA 3KT6A 5H02A 1P73A 1A96A 3IJPA 5K7SA 3K7EA 3E1KA 4FZVA 4R7ZA 1T3TA 1WUYA 5GPBA 2A88A 2EU8A 4LZOA 2ZTHA 4MRRA 4U02A 3Q2OA 3UQYS 3WADA 3OLZA 5B12A 2FQQA 2ZQZA 3V4OA 1XJ5A 3MJCA 1IRIA 3H2ZA 2VJMB 1ZVJA 2VHXA 4FN5A 4MVCA 5C5EA 7MHTA 5FBLB 2UUCB 3MMNA 1XBTA 3TDKA 4BUJA 5BW8A 1SN7A 2ZCUA 3DAGA 1O9GA 1I0ZA 4QZVA 3PJRA 4K6HA 5LBUA 1T5OA 4GX1A 3K9BA 3LSTA 3V1MA 1JILA 4BECA 1OZAA 1QH1A 2FR0A 2IDKA 5JVDF 3PE6A 4FFBA 3R3VA 5D84A 3VPBA 1SCUA 4GRIA 2AXPA 4ZYXA 1POWA 5CLHA 2WHXA 4PRKA 4PLZA 2QD3A 4I6GA 4CLHA 3LQRA 1SK9A 4RQTA 3W34A 2GSDA 1MXFA 3AEKB 1APBA 1V3TA 3ITEA 1E79A 5HILA 1VJ5A 4C4TA 1J7KA 2Y4NA 2L18A 3I4LA 1GT6A 4R83A 1UKBA 3EPPA 1T6XA 5FI0B 1PT5A 4HH1A 5G3YA 3D5EA 4N3NA 4QOHA 4MHSA 4CNBA 4ES6A 4HNTA 2QDKA 3KRTA 4OK3A 4OO3A 3GLHB 3PNOA 3IAHA 4OTZA 3RKRA 2W8BB 3C3AA 1ZISA 1EB9A 4P8RA 4XEUA 3LDGA 2QNRA 1HR0B 1KWKA 3R75A 1HORA 2OZEA 3UENA 1T6NA 1NHGA 2DWPA 2XGSA 3WMWA 2IYQA 2K2WA 5G1NA 3OZ7A 1YIDA 3CH4B 3ZOZA 2JIOA 1QIMA 4E09A 3ZDRA 2XUGA 1E3LA 3Q7PA 4TTRA 3RSHA 4BTLA 1X39A 1XVTA 1TM3E 2ZZKA 1RMQA 3Q98A 4M7PA 4YJDA 5HCIA 1C2TA 1HTWA 2UDPA 3DE2X 3TSAA 5H9VA 4N82A 1II8A 1Y89A 1P0PA 5DI3A 3G49A 2WSYB 1YJ8A 3PX2A 2BZGA 4MB0A 4RMHA 3RKSA 3EUAA 3GDOA 4NCJA 2HC9A 3HGTA 4P93A 3ZJYA 4DJ5X 2AG5A 4FFMA 4UNSA 4JUCA 3HA2A 4JL6A 2H1HA 3FGZA 3ZNQA 2CD7A 1UK7A 1RI1A 3JX9A 5ADUS 3D0KA 3UOWA 4B3BA 3USZA 2Q1TA 3PHGA 2AE1A 2VXCA 4Z0TA 3VR4D 1IZ9A 3W5JA 4BQFA 1TM7E 3TFWA 5BWNA 1LCIA 1WX1A 3G0HA 4BIIA 1PNOA 2B1GA 1TC2A 3N8NA 3NVAA 3U0VA 3R9WA 3B20A 1T8RA 4REMA 3ZCRA 4JI0B 3BXGA 4UAVA 4AUNA 3TQTA 5FA8A 3KYDA 3HKCA 4LHZA 5DI9A 3ZZ0A 1N92A 1VLHA 1ISMA 4I1OA 1WHTA 1Q57A 3CX6A 2H9IA 3Q0IA 2O8BA 1EDZA 5AI9A 2GHRA 4BLVA 1WSDA 2IS4A 1DQNA 2XMZA 4HDSB 3VZRA 2WUDA 1ONNA 2HSJA 2QR5A 3UAVA 1G5PA 1YCDA 3V4FA 5EY5B 1FB5A 3DGEC 3QGMA 1HY3A 4LYYA 4COOA 2ISSD 4NNPA 5EIBC 1J0CA 3D7MA 2B3TA 4DCTA 3NT2A 4OFWA 4OXRA 1Z5UA 3THWB 1EFDN 4WXPA 1N0WA 3A27A 3RVBA 2FEOA 2BEWB 4HHEA 4L5IA 5EJ9A 4QJIA 2Z95A 1H69A 4EB0A 3BMOB 3DQZA 5I9SA 3JPWA 1WMEA 1WO8A 2O3RA 3QXHA 1GSHA 3DLAA 3QKRA 3G6WA 3GX1A 4OP3A 4XB6B 4XKJA 2B8TA 5DGTA 4MP8A 5BWOA 5KHOC 1K4KA 3BGIA 4KRXA 4QTYA 3U7QA 3DULA 4FS3A 1XLUA 2HQBA 3OG9A 3QENA 3TLZA 1J39A 4LCJA 4UDNA 4ESEA 5EXTA 3R0XA 1NPTO 2W2XA 4U9UA 4W9RA 4L57A 4Y2YA 2RBKA 1ZU5A 1HUQA 1DBSA 5T64A 1N5KA 3CLKA 5GP1A 1KJQA 4QU0A 1V6CA 3A1VA 4XGQA 1W1IA 1YR9A 4RD0A 4D1YA 3AWIA 1YZTA 1ILEA 1ZY2A 5AW0A 3CNOA 2VAVA 1V5FA 4EO9A 1MT0A 1Y8RB 3G23A 2GD0A 4DA4A 1J25A 1SQ6A 4NE9A 3HUUA 3MM4A 4Q5IA 3VOBA 4DSNA 1TKBA 2ZRQA 3VKWA 3O92A 1MABA 1PJAA 3PGJA 2EX0A 2CMGA 3PE4A 4TRJA 4ZVSA 2AC2A 3CNQS 4RAQA 3R3UA 3W2IA 3AB7A 3OFSA 4X95A 1P4GA 1DKLA 2HIAA 4PXYA 4C07A 3OUZA 4HATA 1SKBA 3KUXA 2VHYA 4KH1A 2PEYA 4CTNA 5J4KA 2CNDA 4G26A 4NEQA 5KOJA 4V3BA 1JXQA 2VK8A 2LGJA 1HKUA 1L4GA 4KTTE 1THTA 1XFAA 3FMGA 3RS9A 4RVDA 1VHLA 1I32A 1HGXA 4LGYA 1ZD2P 3PEVA 4KAFA 4PHTA 2AJCA 4EY8A 4TQAA 5H80A 1IM5A 2FWBA 3C1TA 2JS7A 3SJAA 1ZESA 2EWWA 4JJEA 5DMHA 3FW1A 2M1ZA 3W5SA 3BB4A 5IWCA 1EQUA 5F2OA 5DDIP 1HM5A 3DB2A 4J43A 2C84A 1XDSA 1PGQA 3WY9A 4DUGA 3ZPXA 1OTHA 2BUCA 1IQPA 2NNWB 2ZUVA 1GILA 2PKEA 1L4EA 4TKUB 5EEGA 5J5AA 4CMCA 4DNQA 3T9AA 3QOXA 3VR0A 4X61A 2IY8A 1IDOA 3OX3A 1D1TA 4WA8A 1Z34A 3IA2A 4JBNA 3L7BA 1SOUA 3HNRA 4F3YA 1VL6A 2FW1A 3KZCA 1TPYA 4K2AA 1ZJYA 1D7AA 2OWDA 1EE2A 3OZVA 1I4OA 2V0CA 1FVOA 2GN9A 5FAXA 4WXRA 1H22A 3M6LA 4TPKA 4YRIA 1BN6A 3KWMA 2C3YA 1M66A 4UMDA 3S7TA 5H4GA 3RWOA 2WD9A 3GVCA 3DCNA 2BMEA 1N9KA 1P1JA 1XYGA 3K9NA 1MENA 4Y9DA 4L27A 3NG1A 4FHDA 4HXGA 1QGED 2IELA 1KFCB 3A3PA 1T8WA 1VLZA 2CL0X 2VSNA 4CKCB 4MK4A 1LRKA 1S5PA 2WFMA 1AUOA 2GM5A 5H3LA 1S9DA 3E7XA 1NASA 2GTPA 2FEWB 3B9PA 1KS2A 4PO1A 2ARKA 1DEAA 1XALA 4Y7DA 3DQPA 4IHQA 3GG2A 2OBYA 4FSDA 3K0CA 2JLRA 3UW3A 3G7SA 4M1KA 2J5KA 1D9XA 1SU8A 1QJ4A 5HIIA 3WHPA 2VZLA