1XVLA

The three-dimensional structure of mntc from synechocystis 6803
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
279
Chain Sequence
GETEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKDVPSVVLTEGIEPIPIADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQVPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARFGGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGLLAGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mn transporter
publication title The MntC crystal structure suggests that import of Mn2+ in cyanobacteria is redox controlled.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal transport
total genus 83
structure length 279
sequence length 279
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1xvlA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1xvlA02
3R5SA 3AESB 2ETVA 5KOHA 1H1LA 5JPDA 1QGUB 3LHSA 1FP4A 2M6LA 4TKUB 5GGXA 1KAHA 2O1EA 3TNYA 5FLYA 1N2CB 1M1YB 4IRMA 4N01A 3ZTTA 2R7AA 3TLKA 4WN9B 4PAGA 3PSAA 4WZBA 2AFIA 2AFHB 4WESB 4FNAA 4CL2A 5BVHB 4M7OA 3TEFA 2XDQB 3U7QB 3AETB 3K1AA 1N4AA 2PS9A 2X4LA 4UTPA 4HMPA 4XPIA 1M34B 2YNMD 3PDIB 4WZAB 5CX1A 3ZK9A 1PQ4A 2XV1A 3GI1A 4WNAB 1MIOA 3CX3A 3MFQA 4OVKA 3UJPA 3MWGA 4DBLE 4LJSA 5KOJA 4OXQA 5M29A 1QH8A 3AERB 1ESZA 4OXRA 1M1NA 5JG7A 5KOHB 5I4KA 1H1LB 4FILA 4TKVA 3G9QA 3AEQA 1M1YA 1XVLA 4MX8A 2QI9F 3R5TA 1N2ZA 3MINA 5BVGA 3MD9A 4K3VA 5M3BA 2OSVA 4BBPA 4G09A 1K2VN 5GGYA 2PS3A 3MWFA 5B58T 4INOA 4UDNA 2XUZA 5KHLB 2WI8A 4WZBB 2AFIB 1L5HA 2M6KA 1QH1A 1G20A 2OV3A 2WHYA 3AEKA 3PSHA 5M34A 3AEUA 1KARA 3HH8A 4ND8A 1G21A 2MINA 4UDOA 4UTOA 3ZK8A 2Q8QA 3AESA 2PHZA 2OV1A 2YNMC 3K1AB 1K7SN 3NU1A 4MO9A 5CR9A 4PM4A 4XPIB 5AFSA 4FI3F 4NNOA 5CX1B 1QGUA 3HXPA 3LI2A 1PSZA 4G07A 4NNPA 4TKUA 1K0FA 1MIOB 5JOQA 2Q8PA 2RG7A 3BE5A 1N2CA 1KAEA 1FP4B 2R79A 5M2QA 3BE6A 4WN9A 5KOJB 5JJ5A 1QH8B 2PRSA 3HJTA 2AFHA 4WESA 3ZK7A 4B8YA 2OGWA 1TOAA 5BVHA 1M1NB 2XDQA 3U7QA 4MLZA 3AETA 4HMOA 1N4DA 3ZKAA 1M34A 3EIXA 2XH8A 3AEQB 3PDIA 4H59A 4TKVB 4WZAA 5HDQA 5HX7A 1K75A 4WNAA 3MINB 4INPA 2XY4A 2XQVA 4FKMA 5BVGB 2PS0A 4HMQA 4GICA 1EFDN 1L5HB 4LS3A 1QH1B 1G20B 4MDYA 3AEKB 3AERA 3AEUB 4HN9A 4ND8B 3EIWA 1G21B 2MINB 4H0FA
chains in the Genus database with same CATH superfamily
4PFQA 3KFLA 2LTAA 3QEJA 3V1MA 1M6VB 1T5OA 2OESA 2GJ9A 2CMDA 1JYSA 1U31A 1IRXA 2ZOSA 5A4IS 1A5AB 4ZZ2A 1K2WA 5CVVA 3ONFA 4DC9A 2ZRKA 1MAHA 2RGBA 3OWXA 3E23A 4FCVA 3V7NA 1PDVA 3QSGA 1ZK2A 3AB7A 4R8MA 1U99A 2ANBA 2FSGA 1OKKA 3PUYA 4JLVA 5JQGA 3BJMA 4MI3A 2AFHB 3IEVA 2Z5GA 1FW8A 4MKHA 3CPEA 2NO9A 3DAFA 4WNYA 4Y6LA 2E4VA 3KPWA 4U0KA 1XCGB 1ZHOA 1F5NA 1NN5A 1J49A 2Q2VA 3CWZA 4K86A 4UEOA 3DONA 4LXYA 2WUGA 3OQIB 1ZEJA 3Q2KA 1CIJA 4CIDA 3N7TA 5JLJA 2IHJA 3L49A 3NHMA 4IM7A 1UBFA 2G25A 2LCIA 3L7CA 3VTKA 1TTHA 1UXKA 2Z83A 5HE9A 4AXBA 4U8GA 4ZOEA 2QNRA 1OF1A 3CZRA 3E1KA 4ZMRA 3LFUA 4IMPA 1OH6A 1Z6YA 2C7RA 1Q0RA 2JH3A 5M29A 2Z4TA 2OD9A 1PJTA 2WIKA 2YFKA 5B53A 5TGDA 3PWTA 1BH6A 4GPTA 3RLIA 1F0YA 3F4BA 3AK4A 1Q7EA 3OI7A 3GZTB 3LXMA 5HIIA 5KI6A 3WYBA 4D0GA 1TX4B 3BXEA 5FADA 2KHZA 2Z9CA 5LP6B 2I3GA 4RU1A 3G9UA 5DXJA 4C7OB 2VF2A 1TU4A 2J3QA 1QE3A 1IZ9A 2VF5X 4D74A 3KE9A 3AH8A 1Y6ZA 4FZ5A 1OA0A 2R6FA 4BYGA 3UA4A 4QHYA 1L7XA 5SY9A 3VR6D 4YRPA 4ZDKA 3UPUA 2I2XB 1QE5A 1PT8A 2CLFB 2C4KA 1XNQB 4GOKA 3TB4A 2FX5A 5JU6A 1F4PA 4FEEA 3BKWA 3QVVA 1YULA 2ZE7A 4GO1A 3RHZA 3WA6A 4DCJA 2FPSA 3VZBA 2G77B 3WDKA 3HV0A 2N9UA 4LHWA 2B99A 2YYAA 3KXLA 1WP9A 2M2IA 2FHPA 3U7JA 4R0MA 2ZUTA 3R0JA 1KYTA 3QG1A 2UUCB 1F8FA 3OCXA 3W5VA 4Y2XA 5HA5A 2BGIA 1JXQA 1H2YA 2I8CA 4PHTA 4XM1A 2ZTUA 4N7JA 1UZMA 3B20A 1FY2A 3HXTA 4GNKA 4Q6BA 5FI0B 2NG1A 5TV2A 4HEA6 3G2HA 4X3OA 4RY0A 2DR0A 3T41A 2PBZA 2WYVA 4YYEA 4F3YA 3QJ5A 1JJAA 5DGIA 4H18A 2WF6A 2O06A 3D0KA 4L4SA 5BO5A 4TYMA 1UWLA 1B1AA 4X24A 5AKGA 1OWOA 3Q9UA 1D2EA 5A4AA 2ZUEA 4LPSA 4LWOA 5H4GA 1R5NA 4O0MA 4D9GA 3OUUA 1DRJA 4ANFA 2G09A 3PUVA 3TYXA 4AF7A 1K8RA 1TT5A 1PBNA 1U0SY 4QASA 3UG6A 2OZLA 1IK4A 4XUCA 1DJNA 3JQAB 4ALIA 1IY9A 4DL9A 4DC1A 4QAJA 4UDXX 4WEOA 4F71A 3D5QA 5CLIA 2L69A 1GCGA 2PS0A 1DZIA 1ZVMA 3CURA 5TGTA 2OV6A 3A3OA 3WFJA 1YRAA 3FZQA 1KDOA 5LR6A 4OX9Y 3CR3C 3AEKB 4JLNA 4I9UA 3KQQA 4WOBA 3U48A 1XLTC 4Z4FA 1MC8A 1FZQA 1DINA 1PQYA 1XI2A 3MJCA 2RH5A 5T4EA 1EWTA 4XM0A 2IEGA 1WPQA 1YZLA 4N82A 1LBSA 4BAGA 4U2FA 2DR2A 3IHWA 1BFKA 5JAMA 3RM3A 3RTCA 1DTEA 3FVRA 3P9PA 4LJ8A 3V9PA 1A7KA 1JLHA 1DRKA 1YQTA 3CUTA 3AJ9A 4YCDA 4G8JA 5DNAA 1E20A 3IAM6 4A0RA 3EG9A 3ZHSA 4NE9A 3HPQA 2HNBA 4ZV4A 5JMTA 1G4HA 5INTA 2VH2A 2W6MA 3GA5A 4GPAA 4DCVA 1ZA1A 4AJEA 3A4MA 3NDBB 1DCFA 4P3NA 1Y81A 1C7ZA 1YHYA 4M8SA 3PCRB 3RVRA 4AMZA 2O6HA 3CX8A 5E9QA 5KTTA 1V3QE 2TSYB 1VJTA 2X4LA 2LNDA 4IJKA 4C5AA 2XRYA 2X7XA 1V4NA 3HHEA 4QU9A 2PUEA 3TSAA 3IP1A 2EHJA 4GBGA 3PHIA 1PR2A 4EP1A 4X3PA 3EEBA 4YIHA 4CM9A 3SR4A 3MXOA 2HMYB 2ZYSA 4G0PA 2QAJA 1LBQA 3EB9A 1FFDA 1SC3A 2N3ZA 3DDNA 1LCIA 2XMBA 1JIXA 2JGDB 4X54A 4ZQFA 4JUDX 2QTBA 2BOVA 5C35A 3C8MA 4Q00A 4N65A 3K0AA 2UZ4A 2FDCA 4ZTBA 1DX9A 3DH0A 2ZI7A 9LDTA 3A6HA 3U6BA 1Q1ZA 5IASA 4D5GA 4CLOA 2NVOA 4OHUA 1OYWA 3L8HA 2IK8A 2XIJA 2GAFA 4F9FA 5KYKA 3D0RA 3PNMA 3V32A 5F7XA 1EXDA 2VPPA 5JS8A 1TM3E 4FDAA 1BIFA 4KGXA 4X1OA 1N7HA 2AWOA 2AG5A 2VQ6A 1RBZA 5ULLA 3DYBA 4ZMSA 1JNYA 1WCIB 4DIFA 1II0A 2ATCA 2PQ6A 1J8MF 1B1CA 2PK3A 3DBOB 4W6QA 2OV2A 3D6MA 3UCEA 2XNDD 5ITWA 2Y0CA 1OB5A 1MHTA 1NY5A 3E3LA 1H66A 4AW9A 2OQ2A 5IKPA 1BD3A 5ILQA 4ND2A 3K1AB 5KVAA 3NNDA 1EB9A 1X7HA 1C2YA 2OSBA 2KBFA 4Q3KA 5CX1B 2VQSA 3MJSA 3PF9A 4CT4B 1WD7A 2OXCA 3UG7A 3GELA 1EM8A 1DQZA 2O5EA 3IXLA 2R7KA 4C01A 1U81A 3PC3A 2EFJA 3UA3A 9ABPA 2FH5B 1GV1A 3WBBA 4OMFG 3PPIA 1LXCA 3UHPA 3A9SA 3OJOA 4U7HA 3LLCA 1QTNA 2PGXA 5AHKA 3ZWVA 2I2FA 1Z6ZA 1MVOA 3PUXA 1KR5A 1EM6A 4MV0A 5HQJA 3CIOA 4QDKA 3O8NA 3NNNA 4YJ3B 3U4HA 4DDKA 1ZX1A 3H8JA 4EKEA 4YRGA 4F04A 1ZGHA 4ZWNA 4NJMB 4RVSA 4EB8A 5BWLA 5K2MA 2P2NA 5AKLA 2AOXA 4BBJA 1A77A 1ZR2A 1J97A 1Z6TA 1NBAA 4AZTA 5BNIA 2QT0A 3RSHA 1YE3A 7ABPA 1J6UA 2F43B 3Q8LA 4IXWA 5EYPA 4YCSA 4CCWA 4JSYA 3ZX5A 1B0PA 1G5RA 3Q8WA 2WT9A 3DOCA 1TF7A 3JYNA 4G0WA 3VYWA 4BMXA 4URYR 5EMHA 1CV2A 1N2XA 4KE9A 5F78A 2AMVA 3QLVA 1ZJ5A 3UK6A 1UKVY 5TJ9A 3UHAA 3IUMA 5H0IA 1Z8HA 3WK7A 2UV8A 1N5JA 3D2AA 4HLQB 4S1VA 4QTZA 2MR6A 5BRJA 2IKQA 3AI7A 1W36B 4B83A 4RD0A 2HEGA 1Z2NX 3V6MA 4C2UA 2C9CA 1QRAA 1N6HA 3N6VA 4MS1B 2P2CA 1JV2B 1Z47A 1Z3IX 2PSSA 2V97A 3GT7A 3FW1A 4RIIA 4D4GA 3UUWA 3VAAA 1O4WA 2HDHA 1XWFA 3NETA 3RWMB 1FPMA 4V02A 4XLZA 1O4VA 2Q7XA 3R6WA 1W9MA 4N5LA 5AM4A 2FPOA 3TW4A 2R85A 1X87A 2EX1A 2I2AA 4DQ0A 4EW1A 4Q39A 1U98A 5EIFA 2QMOA 3CTPA 4HNGA 4B6FA 1U5BA 5TMPA 5CT9A 2IX3A 1E2HA 4EKIA 1W87A 2J32A 2P9BA 3Q3VA 1NQOA 3HU3A 1IC6A 2RHTA 3GCZA 1AXEA 4PSKA 4DUPA 4IG4A 1J0XO 1GLVA 4DLPA 2FJPA 2OMEA 4RZIA 3S5JA 4EQ6B 1V47A 2C5AA 4EGQA 4BKMA 2JEYA 3NPAA 4AY5A 2CEKA 5HQTA 3KELA 1QQTA 3GN1A 4P22A 1QHNA 4I99A 5K3OA 5IH7A 1EVYA 3H6KA 4S0ZA 3NEPX 2FFHA 3QHQA 4IJ5A 1RRKA 3HEBA 3LG2A 5AHXA 5DGTA 5GINE 3MHPA 4IWYA 2H8GA 1N8NA 3C1AA 4UNIA 3RTEA 4ZDIA 2DFLA 3M3HA 4COKA 4QBHA 5IJ0B 1LBEA 4RNCA 3P1JA 2OGTA 3MQ2A 3QOWA 2UU9B 1N3IA 1MC4A 2Q28A 4KNVA 5HDBB 3JATA 4EKYA 3GFFA 5CBPA 2O2YA 2XI4A 4C0BA 3K6SA 2PV7A 1TYEB 3N8HA 3WWDA 1NG1A 3DXYA 4OCZA 2FE4A 1EP1B 4UHKA 1PQWA 4CI9A 3GLSA 3K0BA 4CDGA 4Q4HA 1CEEA 3VHRA 4NICA 1KK1A 2WF7A 3IUQA 3PXCX 4GVLA 2I99A 2XPCA 3FKSD 1R64A 4HNTA 1RQXA 1EK1A 2PGDA 3UFXA 4FONA 4YT8A 2G0TA 1P2GA 4C0JA 3B6ZA 4GQIA 4NBTA 1DCMA 2DFTA 4NQZA 3LIPA 4E5VA 1KP9A 1YB4A 3M4NA 3OLVA 3UK1A 1L5YA 2ATIA 1P4JA 1GARA 4YMTA 4ZJUA 5HQ3B 4O02B 3O91A 4GF5A 1WHSB 2ONKA 1MTOA 1YZYA 1XNJA 4LYEA 1ISPA 4D7AA 4BX3A 1V39A 3AKEA 2QE7D 3O8RA 3W5IA 3TIXB 4JNKA 3MCUA 3QNWA 4WESA 1DKRA 1ANKA 1SCUB 2QD4A 4TMVA 3ZK7A 3ENWA 2W22A 4MW5A 1WR8A 3P2OA 3AFGA 1K3UB 2HPHA 1B7GO 4IXDA 1JZTA 4PZUA 4DHWA 2EW8A 1YS1X 3IXQA 1HT1E 4GBED 4WK6A 2GAOA 1D2MA 4H1TA 2I4RA 4L0MA 1FYXA 1V0JA 2JGLA 1VMKA 3UMRA 1AGNA 3TIVA 3X0DA 2P4QA 4BO0A 5FP0A 1KYYA 3VKUA 1R3UA 4X62B 1JEDA 3ANNA 2O3QA 3GRRA 4RZSA 4PXYA 3WIBA 1XYVA 1GTVA 3IS3A 4X61A 5EMJA 5JI3E 1XZLA 1X42A 4Z8YA 1NAIA 2BWJA 2V9CA 2VJYA 3M49A 3MRSA 5BY2A 3DG9A 1OV4A 5HCUA 3VR5D 2PX8A 4CODB 4LUCA 3THSA 5ITZA 1NNEA 3BJRA 4P58A 1C9KA 1KO5A 5FNZA 4E5UA 3TCNA 1QZ3A 1SPBS 2ZCUA 3M4XA 3OPNA 3OX2A 4UVGA 1QLHA 3PNQA 4J6FA 3LUJA 3C3CA 1JBEA 1UC4B 1BWRA 2PWZA 3D3QA 3PNSA 4QPZA 5E9JA 4BZZA 2J6CA 1BA2A 1H8ED 2NZVG 3SKXA 3L6UA 4LQCA 4NMHA 4Q4DA 1I1NA 2E48A 2I9KA 1R0WA 3OEYA 4YMSA 1MU0A 3EVTA 3F5SA 1TECE 3FNQA 3OTQA 4ZREA 5GZ3A 3W6PA 2C59A 1PI3A 4HX5A 5K0LA 3E7FA 4Q1DA 4DJDC 1UK7A 1MT0A 2I76A 3R6DA 4NR0A 3DW3X 1EFKA 2AF3C 2AZXA 2LUOA 3BXFA 5I7VA 4TUYF 2XBLA 4M1ZA 5DN6A 3L84A 3ZY2A 2EWVA 1Q16A 3EXHB 4BGIA 1NUQA 2JJ1A 4LJAA 2RARA 4EPXA 1D8AA 3DBIA 3TAXA 2C3MA 2JK1A 3D6FA 3LX6A 3ZE6A 3JZMA 1Y5NA 3TQIA 2HSJA 1AD2A 3KXKA 3Q4GA 3QLVC 5E6UA 2PY6A 1DRUA 3MMXA 3LLUA 3MS4A 1NMQA 4ILEA 3GMIA 3TOVA 1Y3AA 2C20A 3SK0A 1IXYA 3K35A 3RGGA 3KKMA 4C21A 2VTVA 1SB9A 1L4NA 2A9KA 1NUTA 4TYNA 2CLCX 2IYPA 2IL1A 4XDZA 5M04A 1GSIA 4YONB 3X1ZA 1J0EA 3ILYA 1TTQB 3D8TA 3O84A 4N7RA 4Z3KA 2JVKA 2P9CA 3T4EA 1AXRA 4QNNA 1C8VB 1I7NA 3L1JA 4FINA 1K63A 5KHLB 5LLSA 2P30A 1L9XA 1TIKA 4MRMA 4J0GA 5AVZA 1NJGA 2NMVA 5ENVA 3LUGA 4MGYR 1SY7A 3AUUA 4B4WA 1K6XA 3P0EA 3PHLA 2PHZA 1C0EA 3KKNA 1T8PA 2CYBA 1N0WA 4GWKA 2MSLA 4FFBB 1TKBA 1D2AA 2WDPA 1ZUWA 4QECA 3AV3A 4D4LA 1VMDA 4G86A 2BT4A 4NENB 4W8HA 5FFMA 3J81k 4ZU6X 3FOZA 2ZJBA 3SFTA 1X0VA 4M9UA 3A1WA 1Z0AA 3BDIA 1T9GS 1L5LA 2KX7A 3FUUA 4MDFA 2Y4OA 3CPHA 2HMVA 3RE1A 2Y1LA 4TKZA 3MSXA 4Z1MD 4CDNA 4IXNA 3S40A 4E1VA 1LLQA 3W06A 3FHTA 1IULA 3U0VA 4DJEC 2BR5A 2FPXA 1GGMA 1BCSB 2J0SA 4D02A 3R3XA 1T8SA 1H6CA 3EVGA 3DEFA 3S8YA 2D5BA 3IJ5A 1ZEMA 4UEKA 3LC0A 4L95C 2HOQA 3HYTA 4BGUA 3WYNA 3FSJX 2DM6A 4YP5A 2JCVA 4OP1A 1KEUA 1PGPA 1L1FA 2XTAA 3RBXA 2CW5A 1N1DA 3ZE7A 3ABRB 3G23A 4RVDA 3VJKA 4D56A 5JZOA 2WTUA 1AZLA 1Y37A 3HLYA 4HF7A 4YJFB 1QTIA 1SUDA 3WK5A 4Z53A 2R1UA 4AK9A 4X6LA 2GN0A 3ZJ4A 1SUAA 5K3BA 3TAHA 3JALB 3HNRA 4DA9A 2HHCA 3ISJA 2A3NA 4N76A 3V8VA 2PE5A 2AG8A 1PIWA 1CQJA 1XNGA 1JQBA 3OUTA 3R6TA 5BSRA 4OHRA 4RZQA 1DV1A 5H59A 2CMHA 3V4VB 4E31A 1Q1AA 3QW2A 1TCUA 5F5NA 4BIMA 4GI7A 4EATA 4YP9A 4DCSA 5HMLA 1WW2A 6LDHA 3GAAA 5FULA 3FETA 2ZBQA 4EUHA 3KCQA 4MI9A 4YHHB 2KLBA 1J56A 2RI1A 2ZWVA 4RELA 2NZ2A 5AJWA 2G1KA 5HUQA 3WG9A 1VCMA 2Q2OA 3N2YA 3TX2A 2PL3A 3R77A 1X1CA 1R4MA 3OETA 1ZPDA 3DZBA 3G2LA 1P4RA 2FVXA 4YRIA 4UMFA 2IZ0A 2JIBA 1XMIA 2EU8A 2JI6A 2ZREA 1PQ4A 4PQRA 1FSGA 2J3MA 4I1OA 3OFSA 3VV3A 4YALA 1IJEA 5I45A 4TL8A 2I1QA 2VT6A 1E79A 4HUQA 3H0EA 4X45A 5JJCA 1JFLA 3GJ6A 4UJ5A 2R47A 4H1WA 4PZAA 4D9EA 4KW7A 2PMBA 2ZWMA 3AR6A 1BX3A 1YUBA 4MQ6A 4XYGA 4O63O 5EIOA 1JG6A 2BZ0A 1V5WA 4MOWA 3WGYA 5A0VA 4HQLA 2PGLA 3FLEA 3HACA 4R2KA 5AXDA 4HWSA 1NTOA 3T3PB 3AEQA 3ZWYA 3KL4A 3B53X 4FGZA 1QGYA 1EVQA 1X7XA 2GJ8A 2OBFA 3MWYW 4IFEA 5FX2A 2ZM6B 2BGRA 3OHSX 1HFWA 4ZVKA 3D6UA 4F4FA 1V96A 4URHA 4NBUA 2VTKA 2OP0A 2C4MA 4RJJA 2PKYX 3OZEA 4LY3A 1BVRA 3RIYA 5GM1A 2QPTA 1N1EA 3QNUA 3GEGA 4XEHA 3AI3A 1ZGBA 3O1JC 1BHSA 2R68A 2YVLA 3O8BA 5GV8A 1KQNA 3WOHA 2FW9A 2ZSAA 5DNUA 3ZY4A 4Y1EA 2K7ZA 2XZDA 3FDXA 3PE6A 1MAAA 1KJ8A 1ISMA 3TE6A 4KYVA 4AF6A 5LXTB 5JOQA 4HPWA 4PGAA 3LVBA 3TRJA 1DAHA 1ZMOA 4E5SA 1BX0A 1U8FO 5LD2B 1E1CA 3T61A 3LT2A 4KSBA 1OXUA 1M83A 4UHCA 3C6BA 4PCUA 3EQZA 3I28A 3S81A 1NVMB 3DYIA 1VECA 1OE0A 1E8MA 1KSHA 4TTSA 3VKHA 3OZWA 1FUUA 3IO5A 3IKLA 3PGJA 5H16A 3VI4B 2VJLA 4YBRA 4DXHA 3PTZA 3VO2A 1K5PA 4HJXA 4D9NA 3LPNA 2XKKA 4KYIB 3GD7A 1BMFA 1CJUC 3AF6A 4DPMA 2AMFA 2BM9A 5ED4A 3N8KA 1Y1TA 3UJ9A 3UWDA 1I51A 4RMIA 3RYFB 3WMRA 1TYCA 4BP1A 1GTZA 3JWIA 1IOWA 1SCBA 3OQVA 3Q15C 1N25A 3Q3HA 4OI1A 3SDSA 4TXNA 5KSZA 2JI9A 2OKCA 4KRXA 4CKCB 4M55A 2REQB 5IT4A 4FMDB 3TZ6A 2HUNA 4KDEA 2DY1A 3WZLA 3BWMA 1JDBC 2C99A 5K0CA 1AHPA 2I8LA 4NV3A 1SKYE 5EFOA 1QFJA 3EW7A 1JJFA 3HB7A 1FP4A 1EG2A 2I62A 2SKEA 2AC4A 4M89A 2RGYA 4OXIA 5ER6A 3SEZA 2QORA 3MCWA 2BTOA 1UOOA 1N0HA 2J46A 3N0VA 4CM4A 4ML3A 4PC7A 1V48A 1N2CB 1JEQB 3RRBA 3V1NA 3ESZA 3ZCXA 3UCFA 2QY9A 4NZPA 4C7XA 1FFGA 2BZSA 1ZL2A 2FF5A 2AOTA 3PT5A 1QYIA 5DHTA 1NW8A 4CE6A 1GPBA 4M8LA 3TEFA 6NULA 4DV1B 1QORA 5ALJA 4O1IA 2FOIA 4UBOA 1I0LA 3EBLA 5AW1A 2VSYA 2XJ9A 1ST3A 2OA0A 1TE2A 3EUAA 4YDQA 3HDGA 1JILA 1DG1G 1QG4A 3D1LA 1HG0A 2EP8A 1GNTA 1W30A 1T4GA 5G41A 1KIMA 2NTEA 3AW9A 1QQ6A 4DJ5X 1QC5A 1E5LA 3IELA 3JAWA 2V7UA 5CW1A 4A8JB 3PD1A 1FTSA 5IC6A 3UO8B 3FWHA 2VP4A 4DLBA 5F23A 1ZUIA 2ETXA 4AURA 3HYLA 4J07A 1DXHA 2AR0A 4ZCQA 1E63A 1PT9A 2ORWA 2YUTA 4RKRA 4EY8A 3HVIA 4HADA 3NM6B 3O9ZA 3R76A 2AHOA 5KDOA 3AR5A 4BC0A 5FTJA 2H7VA 3WZ2A 1RYMA 3VDMA 1HWYA 2BEKA 3OEHD 1KZ4A 1JQ5A 4TSKA 1D2GA 3CHYA 2GTIA 3CONA 1A5BB 1ADJA 3UC5A 1PNOA 1VLHA 1WW8A 4K3VA 1P0PA 1IY8A 4R2XA 1G19A 2FFJA 4DEVA 1A82A 3EF1A 1VOTA 1T9ZA 3GLQA 3E82A 3ZIUA 1JXOA 1G66A 4W5WA 2XUZA 5GTDA 2H1LA 3UJDA 5B4TA 1BQ4A 4FFNA 3L6BA 1R5BA 4L9RA 2WA2A 4PX2A 3NEAA 4QLOA 2QBYB 3PLNA 5JXJA 1D4OA 1CEXA 2IDKA 4JASB 3E27A 2I54A 4JP3A 2O8VA 3IBTA 1K68A 4AMGA 2IXFA 2NADA 1MVLA 3JQ8A 1JWLA 1K3FA 2XQKA 1VSQA 2YWCA 5AD1A 4EY5A 2BP7A 2K2WA 3TGWA 5AUQA 2ZS8A 1L4FA 1LK0A 4V38A 5F12A 3RDPA 3QKUA 5JC1A 3LUDA 4OFXA 4EHLA 3VR6A 3ITKA 2JG3A 2QZSA 3DHVA 4GPEA 5KSPA 4BKPA 2PUAA 2I6GA 1YQQA 1DJMA 3O4HA 2A94A 3M6FA 1HORA 2QL6A 4MIYA 5LDDC 2VXBA 4JI2B 4BEJA 4D3SA 2XE6A 3GVXA 4XXHA 2B1GA 2GEBA 1B3BA 2CJWA 4HZUA 4MVYA 1OWPA 1K8ZB 1Y4DE 2EZ4A 3K0CA 4QYIB 4CLEA 5EIAA 2UYOA 4CMHA 1Z8NA 5BVGB 1MQSA 4CL8A 4J29A 3MTIA 1AIPA 4XWOA 5KREA 2WVHA 3O47A 3ROFA 4AKGA 1EQ2A 5LA6B 1V5IA 1X13A 1SG9A 2VK1A 2FEPA 2TMDA 3FSGD 3OAAA 2AB0A 4P81A 4YRCA 1PL7A 2GR9A 1MMFB 2FUNB 3Q72A 2AHRA 4TTAA 4J7CA 1K08A 5FJJA 3R7FA 4TLAA 4UHFA 3ET4A 3ZQUA 2H1RA 2R97A 3QPBA 3OC0A 4KEAA 5G53C 2DLDA 3KPUA 3GX1A 4B9EA 3HP1A 1OFVA 1P1IA 1DIGA 3H6HA 4UPVA 3WVNA 4C4SA 5JAPA 3WHIA 3JZFA 4XJSA 4HN4B 3FHCB 5BYJA 1J2TA 1ZFNA 2ZJFA 3I42A 3LA8A 4IR7A 3VVLA 3MTQA 4RH3A 1CKEA 4F12A 4Q4LA 3EVAA 4Q3DA 2VQEB 1MX9A 4OKNA 2CD9A 1Z73A 1XTVA 2H3EA 2OXTA 1L5NA 4F38A 1FX0A 2AL7A 5BSFA 4GYJA 3ACBA 2W2TA 2XUFA 2YWEA 3K0FA 2BFBA 4MMYB 1HLDA 1XXLA 2C2MA 2RONA 2WKPA 3VBEA 4B35A 4EI2A 1L4BA 1LSOA 2D1QA 5I3CA 2Z9BA 3HVHA 2W93A 3ETNA 2ABWA 4HBZA 4GI1A 1I1HA 4DILA 3BHMA 6ABPA 5SICE 1A88A 1N6OA 1CDZA 1QYXA 2WF8A 4GDFA 1Q3HA 4I50A 1AZSC 4G5XA 5AJVB 4I4TB 3AZPA 4GKJB 3RV4A 4FMCF 3WHPA 2Q50A 4ASUD 4LOJA 5FB3A 4LNUB 1BEEA 2IPNA 1T5HX 1A72A 2HWUA 1J5XA 3KPJA 2VAPA 3REQB 4C03A 5C7YA 3ZCRA 4OX9B 1N2SA 5HZKA 3FMGA 1M74A 1WMSA 3P94A 3PDUA 1KMMA 3X2FA 3V1UA 1M1YA 1OGYA 1YB5A 2RAPA 3PWKA 1U0GA 3BRSA 3UQZA 4J9UE 2R8PA 4RIFA 2CNDA 2Y05A 3EFOA 4C6RA 3QBDA 2WFMA 1GZ6A 2DQSA 2B1JA 1E1QA 2WU8A 4G09A 2FMTA 1VL1A 2FWPA 2ZSBA 3HABA 3HB1A 1A2OA 2PXAA 3UKJA 1HC7A 4HNQA 4WT7A 4KI0A 1MIHA 4CVNA 1RJGA 1XA0A 2WMYA 1CF4A 3F6EX 1SXJA 2FSVA 4I9HA 4JR0A 1ZU4A 4KQHA 3T4PA 3GUUA 3UWKA 3H1GA 4F97A 2RBEA 3UJ6A 2VP0A 4ZCIA 3M9LA 2AUNA 3WLMA 3G2QA 3C3KA 2BI8A 2IZ1A 1FTGA 2IT1A 4OOFA 3AGQA 3LPMA 4IQ0A 3CW2A 1KMNA 1JIQA 1VFNA 2PZFA 1W88B 1QG6A 2IYYA 3C1TA 3KV3O 4I1SA 4IUCS 4K05A 2Y27A 3A9TA 1XAGA 2WV9A 3B85A 3M0EA 3OCWA 4PYJA 5FOUA 3I9V1 3TLXA 3KKLA 4Q47A 3DBRB 4RFSA 4YRAA 2H2IA 1P2UA 1FUYB 2FR0A 4I08A 2C4VA 3MQ4A 1YL5A 2WJYA 4MYUA 1TVKA 2WBLC 3KQLA 1QH9A 3RAGA 2ZJYA 1HURA 3PZBA 4BFTA 4V0NA 1C0LA 3G5UA 3O82A 2AFRA 5TQVA 4BNUA 4WY8A 3NHSA 3EXIA 1ABFA 3MGGA 4EJ2A 2PH1A 5DBFA 4HZGA 2W2LA 4DM3A 2VDWA 3BVPA 1JQKA 2HPAA 4P5DA 3BGOS 1G1MA 4P3YA 2JGNA 3VU9B 3P4UA 5GOZA 3WI7A 3UK0A 3AR4A 4FU0A 2GJ4A 3HSYA 2I3DA 4GZ3A 4Y2QA 1SK8A 5T3YA 1FUKA 2P77A 4L76A 3VU1A 2GM9A 3GGPA 1YQUA 1L7MA 1WXQA 2O2SA 2PCJA 2QU7A 2CSUA 3M6XA 2WW8A 3N2GA 3WGMA 3AU8A 2I3BA 1C3OB 3LXUX 2RAFA 3QPWA 4GR4A 4MTLA 4MZDA 4P34A 2QPLA 1Y6QA 5BT8A 3LY5A 4HEHA 4PXAA 4UAGA 4LVOA 4BGEA 3QELA 3GQBA 1C2TA 2P9ZA 3BJIC 3PXUA 4WD3A 4CN9A 3MXTA 1E1YA 2WR8A 4LBZA 4EG6A 2W2KA 4JS0A 5E7QA 1U9CA 4N01A 5B1DA 4II3A 2HK8A 4XR9A 1RYBA 4JI5B 1M33A 3I1YA 2C2OA 4DUZB 3SICE 3ZGLA 4G89A 2CVPA 4X5OA 3QVWA 3A1CA 4PZPA 5HJ2A 4DSAA 3OPYA 4GMDA 1I0ZA 2RHBA 4OLHA 4MTCA 3RVJA 3IPCA 1AKVA 2G4CA 5AHOA 5E2AA 3A26A 2GYYA 1KQ3A 3N3BC 1NQ5A 3ANTA 3AFMA 3K0CC 4EMTA 1FMLA 3HNOA 5DM60 1WMEA 1Y7LA 1HLGA 1ZNWA 3L6CA 1UDXA 4IQGA 2A9OA 3R0IA 3VYSB 1F8YA 2EJBA 4B3GA 1Y5IA 1QHHB 2VHTA 2P11A 5DIZA 4ITVA 3JY6A 3SIPA 1IN6A 1E2JA 3B2EA 3VU8A 5TJHA 5DYIA 2QN3A 5FTWA 2G83A 1ACMA 1AS3A 3NB0A 2QJWA 1GRNA 3P2IA 5EUMA 4ARUA 2GHQA 1CUAA 4C4AA 1W85A 2DT5A 3EF0A 3GRAA 3LLVA 4ZZIA 1Z5GA 4OA5A 3WLIA 2ZIZA 5LFAA 2BUAA 2J3DA 3ET5A 3KT8A 4PU0A 4Q01A 4TTIA 2W5UA 3IUEA 1LJLA 2VP3A 1AGXA 3DE7X 3PWSA 3IE0A 2RFLA 1PJSA 1XJ0A 1ENPA 1L5ZA 4FCTA 3RC3A 2QN1A 2X0FA 2IYVA 2X8JA 4AU1A 5HOEA 1FVFA 1EGMB 1YOVB 2AFIB 2C77A 1TLTA 3JWHA 3QVXA 1JDNA 4L0QA 3AJRA 4L5BA 1A7JA 1EFCA 2H2WA 2FFRA 1TCAA 2UYQA 2UZ1B 3CNEA 4HLUA 3JZDA 4ZXFA 2J1LA 1ISRA 4UHEA 3WWOA 3DS8A 2F62A 4JH0A 5IYZB 2XRZA 1Q1GA 4RQBA 2J9FB 3S28A 2JH9A 3I23A 4EG8A 2XLBA 5TB5A 4GGOA 1JG3A 4JEHA 2VRWA 3ZHZA 3AVYA 4HC4A 3F5FA 2IITA 1R5OA 2O2ZA 4RZUA 4AULA 4HDCA 2WTMA 4D1YA 1L3CA 5LOVF 3DOOA 3D0OA 1ORWA 4QHTA 5KAPA 5THKA 5JALA 4M9CA 4F5EA 5FLKA 1YACA 1UQUA 1J70A 3R9XA 1J39A 1XMXA 4HBGA 5JPCA 3Q5DA 5JVDF 5KYUA 1KI3A 3GO4A 4MGKR 1V11A 3ZDXB 5CFNA 1UKCA 1QDEA 1JI3A 2WNIA 4OSPA 3PXAA 3P26A 4XIIA 1T6NA 1DBWA 4BLVA 4D4KA 1L8XA 4QDUA 1CULC 3S0JA 2CV0A 3FNBA 3CPJB 4ZHQA 4IFIA 4W1PA 2AXPA 2X6TA 3PPWA 5BSKA 1T2AA 4EEXA 5FEUA 1AMUA 4BNWA 2WQZA 4DLKA 2RGAA 4K9OA 1XK7A 2ILVA 1PV2A 4REQA 4HS4A 2PPVA 5DASA 5B4UA 1JFFB 1U2GA 2QM3A 1Z7WA 3T4XA 4D0NA 4DQUA 3A3NA 1T2DA 1G16A 1KBZA 5EMKA 3RFCA 1SXJC 2FSVC 4XDYA 1AO0A 4TLBA 1Q21A 4ITRC 1OZFA 2QE7A 3KR1A 1X80A 2FQXA 3WK9A 3ZHVA 1E9EA 1QK4A 1U2EA 4BEWA 1EB8A 2JIZD 3HEMA 5C3MA 4H08A 5A3RA 3V3TA 4U7FA 3OCZA 1SBZA 2ZM5A 3MK31 2OCYC 5IVKA 4A5SA 2CWWA 2YZKA 3AF4A 3M6IA 3MGKA 1FC0A 2ORIA 3KQYA 3O4FA 4HDKA 2C7OA 3TLKA 4MWSA 5GVSA 4PYOA 2D0PB 1GU1A 1Q6YA 2GPAA 3A1EA 3KAJA 2J45A 4X97A 2GZ2A 4P4GA 1CB0A 4J1QA 1EFAA 1Q12A 3Q85A 4RWZA 4XD7D 5C46F 3FKQA 2G6BA 3GBPA 1W4LA 1IUNA 3L02A 2Z30A 4GOMD 4M99A 4X9XA 1QGZA 3FCUB 1Z0DA 3KZKA 4GW3A 1CS0B 4R8RA 4IJMA 4YPFA 2WYIA 1S3SA 2Q5EA 2XB9A 2Z6AA 2XGJA 5ALQA 3UJNA 1XQYA 2HC9A 3OFVA 2JVJA 4RDCA 2H5LA 2V9PA 1O54A 4ONEA 3L40A 5ICSA 4BQSA 1G7SA 3PEVA 2VUIB 1UADA 2X13A 1VPDA 4FKZA 4II2A 4G5OA 5AI5A 4GMGA 4BJ1A 4F6CA 1EUYA 2HK9A 3DZ8A 1N5OX 3BE4A 4BNDB 5BP7A 4MW2A 3RJZA 3ZKWA 3BMCB 4KE8A 5TS3A 1GITA 3VNBA 2QRPA 3I1FA 4D97A 4UBIA 4DM7A 1G38A 1VPWA 1YTUA 2PSDA 1GAJA 1EUZA 1CFJA 3JWPA 4DMHA 5KDDA 4UVDA 4R71A 4FDMA 4HXYA 5BV0A 3C5WP 1CJSA 3EOBI 1KJJA 1C0IA 4H31A 1N5KA 3ME5A 4KO2S 1AH2A 1MX5A 5J47A 4KSYA 1NV9A 4D6YA 1IEVA 5TPWB 2WJGA 3F9CA 5FR1A 5IC4A 4RK6A 3TXAA 4C22A 1X9IA 2PJDA 2YHIA 4ID3A 4FW9A 2H4ZA 3SSMA 2AX4A 2A6PA 4UDNA 5HGXA 4OHMA 5DNYB 4QYSA 1T35A 1PVDA 2FP4B 4B85A 2XT9A 4ZIRA 4ZI2A 2QXYA 4OQPA 3A9UA 1A5ZA 3GLFA 2QQ0A 2C2GA 4A6DA 1RP1A 3M6MD 5B6PA 2E49A 3K1ZA 5F77A 3THYA 4CIBA 4QFCA 5CM2Z 1IBKB 2P0EA 1C0PA 4M37A 5FO0A 3DZGA 2PX4A 1IATA 1KK3A 4I46A 2W2PA 4TXHA 3TS1A 1P3Y1 2NPIA 2NXEA 4ZV7A 4B87A 1QFMA 3EVDA 5DEIA 1D03A 2XIQA 2NVWA 4QEDA 5CYOA 3S4YA 3TH5A 3V5NA 2D2IA 2VTDA 1DRWA 3IV7A 5M2QA 2VH1A 1E7SA 4LJRA 4B09A 1UM8A 4OHZA 1UBJS 1A9TA 2YWDA 3H1AA 1JDVA 3UB2A 1FTYA 4AS1A 2PXCA 3OOEA 3OT1B 1JLLA 4TVOA 4GAEA 4WFQA 3M1IA 1ZSVA 3BQ9A 5J2TB 4WA7A 2HKIA 1WHTB 1YZTA 1E1MA 3DHNA 5J1TB 1PLKA 4N9QA 1YONA 4J3NA 2EJUA 4IOKA 2VEDA 4NK5A 2EL9A 3DEIA 2QDKA 6ADHA 4RY8A 5KYGA 3RRJA 5I7UA 3VMMA 2JJYA 5KIAA 1PZNA 1U7TA 3JD3A 4KQ2A 1AQUA 1RFGE 2L2QA 3CMMA 3KUDA 4HLUC 1W0JA 1XVTA 2ZJ4A 1WSWA 3UV7A 1NI4A 2WSBA 2J9ZB 3BMQB 1QE0A 2JHGA 2JDID 2IQ5A 3OIFA 2RKBA 4CF6A 4CLRA 4DMUB 1VB3A 3DTVD 1NNUA 2O0HA 4BKRA 4B3RB 1GSAA 2OG2A 1KAHA 2YOGA 4AJIA 5REQA 1AA9A 1CRQA 3FKJA 3TSWA 2VDKB 3LK6A 1SUPA 3ZH2A 1LI4A 3LKDA 3K0KA 3R5FA 3PJFA 4WZBA 4IGAA 3PFWO 4LOKA 3VGPA 4K5QA 1KH3A 3N9IA 2M6RA 5DGHA 2JCGA 4FKBA 2FG6C 4YUZA 2HBQA 1QAOA 2QZZA 4G5HA 3DM5A 2G4VA 1HL7A 3EG5A 2CVFA 4MQ4A 2Q5HA 3TDMA 4YGXB 2NP7A 3G0CA 1QB7A 1E9VA 1P1RA 2NQTA 3FA2A 4XPIA 2X77A 2ZJ3A 4QXQA 1G42A 1QIFA 1WPGA 3CEHA 4WLVA 1A9XA 1W75A 3WGTA 3IBGA 3QSYA 4AN4A 4JA2A 2ECPA 3HJAA 1Z5ZA 1CY2A 1KVRA 5BWOA 1Z3CA 1VHWA 1VP9A 2CJFA 4AI6A 1U2GC 3T7JA 5ITSA 3K30A 2GA8A 5ALZA 1TYZA 2FFBA 2RH4A 4PFSA 4CYMA 3V7YA 4H1HA 1WCXA 1K1EA 3GUYA 4L02A 3HZRA 5COAA 2CHGA 1BGWA 2XITA 5B57C 3EEFA 3MJFA 4YAEA 2HF8A 4YAWA 5A5VA 1X39A 2QU8A 4DJFC 1R74A 4POOA 3SKVA 2D1TA 1JG2A 1Y5MA 4R6XA 2VJMB 4WZ6A 1QVZA 3DTVB 4B7AA 3LJKA 2GBPA 1U8ZA 2H4HA 2PBLA 4S1PA 2YBEA 2YJGA 4K2HA 2W2MA 4KMRA 4E32A 4PPFA 1ZCBA 1FMTA 2VWPA 4K1LA 4DANA 4NZ9A 3UJAA 1SC6A 1YNOA 4BFYA 4U9HS 2A0FA 4LMBA 2I9PA 5ENZA 3BN3A 1M2GA 2FG5A 1H6AA 2WF5A 2GCPA 4KJZA 3MHTA 4ZTUB 2O1WA 4KI7A 4BMOB 2O07A 1Q0PA 1GDHA 4GR9A 5DBIA 1WG8A 2O54A 2BKAA 1IEQA 1VPTA 4FYXA 4A9AA 3WQBA 2ZUUA 4KHPB 2V7PA 5CHEA 3PE4A 3WGUA 1UKAA 4QPCA 3DWGA 4D8XA 5JXIA 5LZ7A 3Q6MA 4QM6A 1MJ5A 1MHPA 2EHDA 3Q8XB 4B75A 5AVQA 4CKEA 4ENRA 4BO1A 2JLZA 1MOSA 4BNGA 1FDIA 1Q7GA 4BLSA 2QT1A 2ZJ5A 2ZCVA 4IZOA 4QQNA 5ICEA 2HQRA 3LP8A 4HR7A 4ZVNA 3D43A 5KWIA 1ML4A 1TO1E 1VA5A 2WYUA 3A28A 4LNHA 1WX1A 3NTLA 2D4AA 1BU5A 3LY8A 4TMWA 5KTSA 1E2MA 2BVNA 1U5AA 4KCGA 1VHLA 1G6Q1 1FZTA 3ZNQA 3ZVKA 3LF2A 1TD1A 4WUVA 4ZI7A 4Q3AA 3ZDZB 3O4VA 2IH5A 3WYCA 1GHTA 4WECA 2OM6A 1R16A 3JASB 2MYUA 4J3FA 1XNHA 1MAVA 4HFRA 1Q50A 1EK2A 1PJBA 2QGFA 2PD3A 1ULZA 4G9GA 4NTZA 3TR6A 5EE0A 3W9YA 2F4NA 4B74A 5BORA 5CG2A 1CP2A 1KZ1A 1O57A 3FFBA 1BC5A 1FP2A 1EXNA 1WB6A 4U5QA 3FPLA 4XR4A 4AZ0A 3RVPA 1JA0A 2PS1A 3CQ9A 1PYGA 4TZKA 5AUNB 3RYCB 1E6UA 4GXQA 3B1ZA 4KDFA 4M83A 4DRZA 4IEEA 4MYSA 1EJ6A 4MKRA 3LRPA 2NTJA 4TMYA 2OQVA 3HN6A 3MC1A 1QKKA 1HOXA 2FN3A 4QC2A 2HHHB 4IDOA 5F2EA 4EZBA 5H3HA 2B7BA 2I5PO 4ALLA 3AVWA 3H2BA 3PHGA 2EFCB 3ZW9A 4FIZA 1ODFA 3MJRA 4ZA2A 1QIDA 5KYWB 5K7SA 1J1IA 1Q83A 1R6DA 1U4NA 3INRA 4FNGA 1BD4A 3PUJA 3F3YA 5HUJA 4I5DA 2Q9UA 5IAOA 4AG3A 3RUAA 1KRXA 5KBYA 3B60A 3GLFE 3O38A 4RX1A 2EKZA 3L8FA 4ZO8A 3W7AA 3Q3JB 4IGEA 2C9BA 2R87A 1U9JA 2JIDA 4NMWA 2MR5A 3FR7A 2TYSB 4S12A 1J42A 4UFPA 4YPOA 4L16A 4GQBA 4Q4JA 1XZAA 3MWGA 3AHEA 1XR3A 2E1PA 3NPMA 4JI7B 5ICFA 3D3WA 5JZSA 3SQXA 1I0IA 2GZHA 2OE2A 5AVVA 1LVGA 1MB3A 1JSZA 4FC7A 4TL9A 3W9SA 2VHVA 1M0WA 1Z82A 2ZIWB 1V9CA 2H1IA 4PSAA 5T41A 2EIXA 1M6EX 1E8NA 3QUCA 1YZKA 3UK7A 3WFIA 2EFGA 1BOFA 4QUHA 3VGJA 1JDSA 1RRGA 2VUTA 2Q99A 2OQIA 3K2BA 4R84A 1R00A 1G3RA 4IJWA 5F2NA 3ZGZA 5HJEA 1J9ZA 1XVLA 3G0IA 2FZ5A 3BCRA 4H2DA 2I3AA 2NU7A 3I0ZA 1XN4A 3V7WA 4A8TA 5KEIA 1E3MA 2OVFA 4PLTA 1WBJB 5EWJA 3IIJA 3WFZA 1TNDA 1QUFA 5G0UA 2GSDA 3T8YA 2HK7A 2FSHA 2H4WA 2XYHA 3P45A 4F6RA 4ZVQA 4BNNA 3KLPX 2VDJA 4QARA 3U19A 2IHBA 2YCLA 1SWWA 4K9RA 3ILVA 1MEEA 2MSNA 1N9KA 4US1R 4NZZA 4OB6A 5JSZA 1F9EA 1QONA 3OTHA 5BSWA 5CG1A 2DPHA 3MJVA 4CUKA 5F2KA 4JUAA 3RS7A 5C2JB 2FZGA 3VC7A 1D1TA 1BX1A 3VSAA 3W4JA 4YYZA 5KNBD 4HNVA 2FGJA 5BN4A 5SZHB 1FP4B 2HGSA 1HKUA 2C5SA 3V8MA 1Q20A 4QXRA 3VR2A 4X8MA 2IW3A 5LZ5A 1O95D 3CE6A 4FYKA 2B9EA 3A2MA 4WZBE 5JH7A 2Q5LA 3P2KA 4FD2A 1C8LA 3JVVA 4L72A 4AZVA 1ZNXA 4H7DA 4LGCA 4NL4H 3B1XA 3F2VA 1M34A 2FF7A 2ZXEA 3EIXA 2Y6UA 4PPYA 2Z8YA 5D01A 1Y80A 5C34B 2J9YB 3IUNA 4LEIA 4RNDB 1MH9A 2GXSA 2ZI3A 2RD2A 4A0QA 2AF4C 4YAFA 2PO7A 4QDJA 1J7KA 3P0RA 1CY6A 4RC9A 4FC6A 1U7HA 5JXHA 2R7MA 2JJ2A 2XB6A 1AB6A 1NMYA 1EH5A 1GFSA 3HCFA 1EG7A 3A9RA 3K96A 2CXHA 4G3XA 3O8QA 4UXHA 2XXAA 3JAWB 4ND8B 1QMGA 1CDDA 1JKFA 5LZ9A 4JOCA 4QVKA 5ALDA 4DB2A 5D5HA 1GA6A 5B3AA 4QO7A 1WZCA 1ZLYA 2VNHA 2P27A 4MUMA 1UBOS 2JB9A 3GCGA 5I9TA 4JLAA 1O6ZA 4NE2A 5J63A 1CE8B 1H6DA 3P9CA 2CUZA 5C4GB 4HQKA 4CR8A 3HB5X 4HEQA 4X71A 3RUEA 4TVBA 4IO0A 2JANA 4IF4A 4IRMA 1WQ1R 4GECA 2D1RA 1DKNA 1HQKA 4TLCA 1DEOA 3X1KA 4YCCA 3WGIA 1E3LA 2DFKB 4EQZA 1P81A 2Q3HA 2D7DA 2UAGA 2VP5A 2IJGX 2QX6A 1OGIA 3NP7A 3GJYA 2G04A 3BXXA 3VUFA 5GADl 4W5TA 2ZPAA 3MIIA 4EB6B 1OCEA 5B1IA 3VHQA 2BMVA 3DP7A 4Y30A 1VGQA 3EGVA 1F2TA 1FS5A 4WKOA 5SYMA 4EVRA 5DLEA 1EP2B 4IS2A 1LW6E 3L3BA 5AK3A 3TOXA 3RK4A 1EFTA 3LT4A 4F4CA 3WXMA 5LOVA 3OG9A 4UNQA 4P0QB 1KC1A 1SCAA 5A9RA 4A10A 1XZGA 2HLHA 2VNAA 1GQQA 1WF6A 4IIGA 3TD6A 3ZVMA 5JVDA 2C97A 5C8YA 1R9MA 3F3KA 3VPXA 3GLHA 3HJCA 5CTJA 5TARA 4FYPA 1LZKA 5BXQC 1E3WB 1RKQA 2YXDA 4B3TB 1TQ6A 2KSQA 3TI9A 4BVAA 5HR5A 1CUCA 3HKDB 2PRZA 5BW4A 2EC5A 4G85A 1JQAA 2AH5A 4JVMA 5IK2A 2C9DA 2GAJA 4LZOA 4HZUB 1DADA 3ZV4A 4BLTA 1QJ4A 1QHFA 4MW7A 4TPKA 1W76A 2NUTA 4GE0A 4R1TA 1QH1A 4EFKA 3BPSA 3KZCA 3QYFA 1AKYA 4JY7A 2F1HA 4KQIA 3WIVA 3CVJA 3GFSA 3EDQA 4TTPA 1L5FA 4TLMB 3TMKA 4EI8A 3LECA 5MFZA 3C4JA 1PS0A 1M2WA 4ZQIA 1W5FA 4HV4A 4LBWA 5HBGA 2RSLA 1WZUA 4MQBA 4LYJA 3GCXA 3I34X 1QP0A 3S2SA 1MBZA 1QMPA 1ML3A 1Z08A 1KI2A 1TADA 1G17A 3B1WA 1HTTA 4NPCA 5C0OE 4CFSA 3GXBA 4NH0A 4W5NA 2XDWA 3KYDA 3BXPA 4L9WA 4OQMA 1SCKA 3NBQA 2C7PA 2XNJA 2RMKA 3H5AA 1X8LA 4EL0A 4RTSA 4XQCA 2RHWA 1K98A 1Z0IA 2Y0EA 2WB4A 2QWXA 1DAEA 4HB4A 1G6HA 1P4HA 1C9EA 1EDOA 3KEOA 4MW4A 1CUSA 1G98A 1JDZA 1YR2A 1RJ9B 1DQRA 1PE0A 2TMKA 2UZAA 3QY0A 1FX0B 4GRAA 4W6ZA 3PV0A 2D0DA 3DHWC 2QUZA 5F3RA 1RWOA 1I5EA 1N0VC 1X7DA 2A67A 2FJUA 2ZYGA 2BFBB 3HY4A 4N12A 4X84A 3U3KA 2HIHA 1EDBA 2IF2A 4IHQA 4UNNA 2LIVA 5ALPA 4XWWA 1AN0A 1RTKA 2BSAA 4MRSA 3WBJA 2GFHA 4LS3A 4IVNA 3PR3A 5ICCA 3FOEC 1OXSC 2A1UB 2A5GA 3WBKA 1KP2A 2QKYA 1TPZA 1XVUA 2Q1YA 2ZZKA 3GNSA 4MJ3A 4DN6A 3RADC 3N8IA 5AP9A 2DX7A 2XUAA 4EJMA 5IKOA 4F3NA 1E2KA 2PDAA 5G1PA 3PKZA 4AMBA 4DRYA 1K0UA 1XD2A 1KDYA 1GXSB 1QS0A 1XJ5A 2O20A 3L0OA 1P61B 5CJPA 4QGHA 5DLYA 2J5RA 3KEFA 5EL0A 1ZZGA 1I2BA 2J0UB 1M1YB 3W5SA 3EVCA 4O2BF 2Z0MA 4BMZA 2V45A 5C31A 3ZY5A 2B4YA 3EFOB 2VT3A 1KVUA 1MG5A 2QIPA 4FNAA 4KWCA 1B0UA 4R2MA 3K31A 5EXSA 1UZLA 1JXMA 4F92B 3NC4A 1UPFA 1XTRA 4ZK6A 4BNJA 2CHFA 5IDQA 3M4YA 1SXJB 2W6ID 5IXYA 1WXIA 4G0QA 4ZCPA 4EG5A 4JLBA 5IBCA 1N2OA 3EIQA 4R7ZA 1SCQA 4INZA 1SIBE 2VAXA 3BCUA 3OKAA 1Z62A 2ZT8A 2O5RA 1QG2A 2Q6TA 4TLDA 1ZIYA 3EHEA 4LN1A 5DMXA 3F7NA 1E3SA 2GD1O 5FWNA 1PGJA 1T3SA 3H5TA 2IIBA 2GS9A 3WNVA 1HDIA 2BMJA 2J5BA 4GYKA 4AECA 1RQRA 4Z4EA 3EJWA 2HLNA 2GD6A 4Z8XA 3DSRA 2GXUA 2CGEA 1M34E 2P91A 3I6BA 4H60A 4O4IA 1CC1S 3C0KA 1UBRS 2I55A 3JQCA 1YJAA 1BE1A 3I1IA 4AX8A 2CMFA 2OSVA 1VHTA 2ORVA 4M7PA 3F8WA 4TUYB 3ND9A 4CU2A 3OZRA 3UWPA 2VDWB 4IJUA 4IKPA 3DFMA 2CCJA 1XEXA 2SECE 3JPWA 3LUCA 2WSSD 3O2SB 2BEWA 4HZIA 3JQ7A 3WGOA 5KQGA 1T8TA 1LTHR 2OWDA 3A04A 1KARA 2YYZA 2H92A 2VWHA 1BS1A 4HGYA 4C1NA 1EUQA 5A5EA 4KR3A 3N2GB 1P7ZA 3NTQA 2PUJA 3KOWA 5KSOA 3HP7A 2PIAA 4AP9A 3LW7A 3N87A 1NZJA 4CMGA 1NVXQ 4Q21A 1J8YF 1NRJB 3LWNA 5BYKA 4G24A 3TL6A 3WK6A 1UPBA 4YX9A 3IALA 4K8OA 4NCXA 1RHKA 3QELB 4JT9A 2MWMA 2SCUB 4HEA1 1W47A 4WERA 3GGDA 4LI3X 5FHRA 1EWVA 1GLNA 2QTMA 4I5EA 4F2GA 2RJ3A 2OFPA 2W2KB 2W43A 5LBUA 1OTXA 3KTDA 1GAEO 4ZQBA 4MS4A 2Z6VA 1Z5PA 4F60A 1ESEA 1PR5A 3EYAA 3HFJA 4RJKA 4JYBA 2PH5A 5IWAB 3FHLA 2CV2A 3NOXA 2HF9A 3KP1A 3OPYB 1KRWA 3LSYA 1T9DA 4RYDA 1Y33E 3HUEA 4LMPA 5F9HA 2XYRA 1KEVA 1ORHA 1TVEA 1EFDN 1UMCA 3CLRD 3AI1A 3UJCA 1HE4A 5KMGA 4M54A 4Y7DA 5FYDA 2WB2A 1FLDA 1ODJA 1UKEA 5KOYA 2JGRA 4N7BA 2BEUA 3DMYA 3BGSA 2HLDD 1SHUX 2RGGA 3E1GA 5G1NA 1CEYA 3W79A 4R05A 4DCMA 4B2LA 4JZKA 5HMMA 2XA9A 4O4HF 1FNNA 1FBNA 1QH0A 1VMAA 1RI1A 2PGIA 3RT1A 1F7VA 4O29A 4YT4A 4Y2PA 4KVGA 3RYIB 2HHAA 4EKNB 4OM8A 3IAM1 1YJ8A 4ZO4A 3DKPA 1NGSA 5I7AA 3JQQA 2X8JB 3P9YA 3MCZA 1OWNA 1PKEA 3WDMA 4JEIA 1FSFA 2CVHA 4O2LA 2HO5A 3ABSB 5IF9A 1OI4A 4QGAA 5KJFA 4UTPA 3E7PA 2Q2WA 1OC2A 3G0BA 1EVZA 1L7BA 1E3TA 5DHFA 3UYLA 3MMSA 4NEHB 3CT4A 1R6TA 4HGRA 2RGUA 3UYKA 3IAHA 3M1AA 3HBAA 2N42A 2WYWA 4I7EA 5IG2A 4XTCS 1HNNA 4FFLA 1RPJA 3LP6A 4MPPA 5DX0A 2DCMA 5F21A 2IXDA 1M7BA 1UFVA 4QYMA 4Y1RB 5FRDA 4UZEA 3HUFA 3I3SR 1BQ3A 2YJZA 3I2YX 4I0WB 4MMXB 1KY2A 2IGTA 3BFVA 3DFFA 3KR2A 5D3ZA 4K9KA 2AD5A 1KEPA 3O93A 2A88A 5EERA 4DOMA 3AHJA 2ZWAA 1S8OA 1D07A 2EG9A 1RFLA 5I4KA 3BRWA 2QNBA 3ZJTA 3GV0A 3LX8A 5JMOA 2V4ZA 5KYUB 1GPLA 2EYQA 1IG0A 3R5TA 4KYTA 3FF1A 4TLLB 5CNIA 3RV3A 1AQJA 1Y1SA 2OZVA 2WZBA 2XE7A 2XUOA 2ZUVA 4KN6A 1FXUA 1U2RA 4M0KA 4RV9A 1V8DA 1DS6A 5IJXA 1RPZA 1L5MA 3GYGA 4PGMA 2R00A 2JIRA 1HETA 3BB4A 3VO1A 1RWQA 3JXEA 4PQYA 1L5HA 2X2EA 1IZ8A 4E09A 2BFCB 4DIKA 3TM5A 3UXEA 4DTCA 4WXHA 4REQB 4QNRA 1T43A 3DL2A 3RSQA 4HPXB 5EUBA 2WWGA 3NM5A 1P2FA 2P79A 1XTIA 2B5OA 3KRTA 3QPAA 2BE7A 1E4EA 1YBHA 3U3DA 1S6YA 5BR4A 2XX3A 3RVOA 2YN0A 3S1SA 2X0IA 2YWGA 3CKLA 4NXNB 1RCUA 1PSZA 4ER0A 4G5QA 3S70A 4EHNA 1RZRD 2R6DA 1JHMA 2BV3A 2CMKA 4AUNA 4N5IX 1ZVVA 1ZXBA 3NDJA 5DM1A 1LRLA 3LQQA 2JHCA 3VPCA 3WWZA 3CZAA 5JWHA 2GZMA 4AS3A 4RAOA 2Y3IA 2FW8A 4D9CA 3BMNA 1TJYA 3UANA 5JJ5A 5JSKA 4ZMBA 4QJ4A 2QTNA 4FFSA 1CZRA 1OW3B 2PM8A 2DFPA 1H2EA 4TOIA 5LUBA 4F5WA 3IKTA 2RGDA 2VP6A 1CNFA 5AM2A 2G28A 2FOLA 3TRKA 1PD0A 3NVKI 2REXB 2JFOA 2K2QB 1AK1A 3K9LA 3V2HA 3WSTA 3ZJUA 3CNQS 3MB5A 3PC7A 1ZQ9A 1GJRA 2OCLA 5FL7A 3TE7A 2YMLA 2F3QA 5CDGA 2POCA 3FWNA 4IZHA 3RK1A 2B4AA 4NJEA 4TXLA 3R9WA 1Z18A 1Z7GA 2PSJA 3DV2A 1U0EA 4LK3A 3ZWOA 2FWRA 2BPOA 5GM2A 2KJQA 2YIJA 3EARA 3RHFA 3T5TA 5CFMA 3ZYCA 1SKAA 4HJRA 5EJ6A 1P7WA 2PGAA 2QRJA 2O2XA 2WJ4A 3TBFA 2O8EB 3QX9A 1JEOA 2FZVA 2ZAMA 4KWEA 4JGBA 3WLSA 4K81B 5HW0A 3R7AA 1ODKA 1KJ9A 4FLFA 4XSGA 3T3GA 3VAYA 4IBOA 4MQMA 2K4MA 1OX6A 3ZUPA 1IONA 1MXHA 1PV4A 2Q3FA 3PYLA 1RI4A 2QLJA 1S7GA 2DUWA 2YIDA 4QPPA 3OQPA 2CKMA 2GVZC 2RK6A 3CF4A 4RSGA 3W90A 4U3JB 4BJ6A 1CR4A 5JZ9A 3G17A 1KDZA 2XUIA 3EGOA 2QV7A 3KQKA 1E8DA 3JWJA 4I55B 1ECJA 4WNIA 5FD8A 2I6TA 3DZKA 1DZ3A 3IAAA 5LBIA 4EZIA 3CR7A 4TYQA 4TMFA 3AR7A 2ZYTX 2O3RA 3KVVA 5CEJA 4DYHA 1XEAA 3M83A 3T5PA 4V0OA 4X94A 1B6SA 1ENZA 2D2VA 3ORHA 1NJ2A 1US8A 4G4SP 4GX2A 4K6CA 3P52A 1C3LA 5T64A 2WFLA 1OI2A 5EXDA 3LBNA 4JLKA 4YMLA 3H65A 2QTVB 1IAVA 3VVBA 1E60A 1L5WA 4XQ9A 8ADHA 1IWBB 4PC2A 1RR6A 1N57A 5TQ2B 1YZ3A 2XJ4A 3G7SA 5CGQB 1MOZA 1IVNA 1JLLB 3IVXA 4MX8A 1DIAA 3NTOA 4YK7A 3S27A 5A7FA 1N8KA 1N2BA 2WVJA 5BN3B 3QWHA 1FJ2A 3DNMA 3N7UA 1TMOA 2C95A 2NXCA 1LRJA 4PNHA 1JFSA 4JBLA 2QG9A 2Z1DA 3SHOA 3D8BA 4Q82A 1N33B 2J3HA 1OUMA 2AMLA 4MQFA 4ER5A 3QYJA 4MUAA 4WY2A 4MR7A 5HK8A 1SOWA 2MINA 3QE0A 1OLUA 3CJRA 4REOA 5E6SA 1ZZEA 4M36A 4DMGA 4CL0A 3NBAA 1AUVA 4NNOA 3EQ2A 4EYEA 2PG3A 3FF4A 4LCEA 2D5CA 1RCFA 3GFRA 4PO1A 2VI5A 5IN5A 3BXHA 4DKJA 2WUFA 4OL0A 1PKXA 3RG8A 2QI9C 3QK7A 3LQYA 2XKJE 3NORA 3PKIA 3ZDQA 4H3SA 5REQB 2PUDA 1VI2A 4LDPA 3A4YA 3RWBA 4EFLA 2J08A 1YB1A 1T4CA 3M3PA 1JVBA 1XTBA 1N6PA 4JLDA 3EZXA 5H83A 1UBEA 1ZBDA 2FDXA 3BF7A 3IH5A 4G56A 3BK7A 3ELYA 4E13A 2HUPA 3ORSA 1WXHA 1RVDA 2ZB7A 4IH1A 1XZPA 5THQA 5K6RA 3KIPA 4JC8A 3OM1A 2DTEA 4LJKA 4RCYA 1RMYA 4XDGA 5D5QA 5DNWA 5ECDA 3SSAA 3HZHA 2R00C 1N8TA 2P5TB 2FPPB 2Q21A 4PYKA 1QBGA 1A9XB 2R84A 2E82A 1CJBA 4LECA 4NNJA 5L7TA 1AKWA 3GP3A 3KAPA 4AN1A 4CQMD 5HZHA 3QKSA 2K7FA 1I5RA 5GJVC 1MB0A 4CG1A 3B13B 1FTQA 1GIAA 5JG7A 3P0JA 3F6CA 3UPTA 1L5VA 2Z8YM 3U7RA 1OGJA 2ERXA 3S55A 1KZYC 5JCJD 3SFZA 2GK6A 2GASA 2O4UX 4V0KA 4U63A 5FBHA 4RTKA 2GJAA 3OX4A 1WZ2A 5LLTA 2WY2D 1QKJA 1PHPA 4RCZA 3JRNA 5F76A 2NVUB 4YFYA 3WRWA 1JBQA 2FDRA 1J8QA 4MWDA 3USZA 1RAFA 2NZ8A 2HNKA 1E9AA 1K7FB 1S01A 3RNOA 4DQLA 1ZCZA 2EGUA 5AVJA 2BFEB 3U49A 2WOOA 1JNXX 3CSSA 3WQQA 1Z5VA 4DM4A 4DMLA 4GVXA 2H2FA 1K27A 3BWYA 1M1UA 1F06A 4AIRA 3UHFA 5JISA 1JR6A 1TT7A 3GB9A 3GH1A 3VX3A 3IQEA 2O3UA 4M9XA 1FTWA 4NU8X 1CRLA 3WJ2A 3WRXA 3PKJA 2X5XA 4MCAA 1N5IA 1AGPA 5JYDA 3LUHA 4ZALA 3BL5A 3I52A 3NTUA 4I5FA 1YQDA 4IG9A 1MJGA 3DNPA 1PZGA 2AYYA 3CZCA 3MUOA 1L6RA 5BUSA 1YVEI 2IYZA 5JRJA 1H5NA 1XFAA 1IOLA 3CKMA 4EJSA 2JGEA 3VO9A 3KXDA 5J5AA 4JA0A 621PA 3LCRA 8OHMA 5D6NA 5LMNB 2P2DA 1DBIA 3DOIA 2TRSB 1IN4A 2Q5JA 4IWXA 4L8YA 2PT7A 1PEDA 1AVTA 1TEHA 2Z57A 3UJ7A 5TQ0B 2ASEA 4DNQA 1Z15A 1ZU5A 5ARDA 3GMSA 3HBLA 1O08A 3HCRA 1N2ZA 5F1YA 1ECBA 1VYUA 2G0AA 2JLQA 5CPFA 5ENDA 2HFJA 5G4KB 1VCNA 1W5AA 3SCZA 3OZGA 5AVKA 1HT2E 4QJIA 3ZV5A 2ZBRA 4OU4A 2I6QA 1KOJA 1ND5A 2GNOA 2VZ9A 1Z9BA 5BW6B 2AKEA 4OUKX 2OV4A 3G2JA 1NASA 1NWHA 4R9VA 1UT6A 3HH8A 1MEJA 3JQRA 1U02A 4LCBA 1JG1A 1SPXA 1M7GA 4HDRA 3PQ2A 5E4JA 4XW2A 3PF8A 5PGMA 4F21A 1PYDA 2Y2UA 1OXBB 3T7KA 5DXFA 2NO1A 5CVCA 5FPQA 2G8NA 3AP2A 5FHQA 1N3YA 1UF9A 3LL4A 4KQEA 3JZIA 4ER7A 4CEHA 1XBTA 1GNRA 1Q5PA 5TGZA 1NP6A 1WUTA 2HH9A 1EHIA 2UYGA 4WHMA 1V8FA 1IK6A 2OILA 4Q6WA 1WXGA 3N05A 2GZDA 2AW5A 3GEIA 3P5SA 3G89A 2ODWA 3G2KA 5FBWB 4NOMA 4YQZA 2GJSA 4UTZA 3WWYA 4JIMA 1NBMA 3BZBA 1A97A 4HY3A 4Q9JA 4ZRDA 3LM8A 3VNSA 3E18A 2W00A 1ZM4A 4TKVB 3KUKA 4ACAA 1R0BA 2NQ2C 2Q5FA 4P7BA 4ESVA 2R8OA 5CD1A 1IL0A 1KJWA 4QOEA 1GNLA 3H4TA 3OE7A 3LWBA 4HQ0A 2H48A 5FH9A 5ESXA 3VZRA 2QJFA 3HCEA 4XVCA 3N5CA 4MB0A 1O8CA 5KNBA 4YJ2A 2Q3BA 3GLVA 3W2TA 1FS6A 1ZESA 5H68A 2NU9B 3G9XA 1E9RA 1K9VF 1YRLA 1M0EA 2HXSA 3N8GA 1WSAA 3DF9A 1SHZA 3D31A 3HRKA 3GEBA 2H1OA 1T4MA 2WTEA 1JQDA 4WADA 1C1HA 1R0SA 1E62A 3TFOA 2HHLA 1ZJZA 1S96A 2OCXA 1QK5A 2NZXA 3CSUA 4XFDA 4KQFA 2VDQB 1P1KA 1U6KA 1NTRA 4UBMA 1VCOA 4QQKA 1A8HA 1E61A 4ZARA 3UPDA 5A7GA 4H7IA 3TKYA 3D4IA 4G9BA 5HKKA 5AKHA 3WKDA 2VF7A 1LV8A 2IWRA 4QLBA 4F96A 2NU7B 1EU1A 1TF5A 4P98A 2PNJA 3WADA 1N7GA 2II6A 4IXMA 1Y8ZA 4AL4A 1XTQA 1PDWA 4RVOA 4LRWA 2UYYA 3FNFA 2O8FB 1O6GA 3BULA 2NYAA 2DHDA 2W6OA 2XCOA 1TK2A 2I6XA 4I5IA 2CDNA 4YP6A 4DUGD 1QCCA 1J8DA 1IVYA 3EWSA 3FRHA 2FRDA 4PX5A 4YRBA 4DG5A 4D0SA 3V8NA 1GT91 5CDHA 4TTQA 3I5UA 4HCJA 1DXOA 3CRMA 1P73A 4YAJA 1DFIA 3LBIA 4JODA 3F4LA 3EAGA 3ZHUA 1ZN8A 1EYZA 4NMMA 4XJVA 4BB5A 3EDMA 3I2KA 3WA7A 4EMSA 3Q5EA 4KG7A 1NQXA 3HXLA 4MB6A 4S1TA 5ALUA 4BO9A 2I7VA 4MR9A 4V1CB 2UUAB 3I58A 4BNMA 2GAAA 3QGMA 2E6KA 2WKSA 3QVSA 4LMRA 4U9UA 1EIZA 4FJ0A 3RRFA 3ZR4B 1MN6A 4MHTA 1NLYA 2YVKA 3SVTA 1R6XA 1TM7E 3K0EA 2B35A 2O23A 3NVMB 4DV6B 3DKVA 3A32A 1KJZA 3K16A 2B61A 3MGCA 4JOQA 4LVNA 1T2EA 1HQCA 2PZLA 1GQSA 3DDOA 4U4AA 2G08A 3EPPA 1XMSA 5CT4A 3TXXA 2IYXA 1GZDA 2DFVA 3SJZA 4F1KA 2D1FA 4MQEB 3ILSA 2FNAA 4FVTA 2MU1A 1B26A 1P74A 2H2GA 1Z5OA 1I32A 3S2FA 4LBYA 5COBA 3M1LA 3QKIA 3WRXC 5E4TA 1MAUA 1YZQA 2CVQA 2DWUA 4I66A 1U0BB 2GDJA 4O4HA 1M2VA 4Y2VA 3M5PA 5C51B 3ZE9A 1DJQA 4TV9B 4P32A 3CINA 1RIFA 2FZEA 1QR6A 4PSDA 4DSUA 1H3FA 3E3NA 4EJSC 1FUEA 4CV1A 2PWAA 2ZB3A 4HLNA 3GZNB 4JL5A 2PRSA 4LZLA 4PG4A 4HLDA 2G40A 2QQEA 1RBQA 1LQ2A 4JNCA 1C3EA 4M21A 4J4TA 1TOAA 4BX8A 1L7PA 1NI3A 1BVUA 3FWYA 1UH5A 2CNBA 2P4EA 1USGA 3C98A 4IUYA 1FJXA 3P5BA 3EXEA 3PD7A 4FKMA 2JCXA 4Q48A 2GT1A 3L92A 4PRZA 1YIDA 3GNQA 1HBJA 4IEFB 3T5GA 3CEAA 1PJ2A 1REQB 1KFJB 3MTGA 2J7PD 5F1KA 4BQOA 4XX0B 2CXQA 2NNLD 3GRKA 4MVJH 5DF1A 5HTOA 2C1XA 2E85A 4IOLA 3BMOB 4ESHA 1DKLA 5LOVB 4M7WA 3GCWA 5DSXA 1F1JA 4AKSA 2P4HX 1MORA 1ULAA 4D8TA 1L3IA 2VCEA 5G0SA 2W70A 5LC1A 4C4PA 4C76A 1DVRA 2LE0A 4ZKDA 5ALRA 2VPZA 2IYNA 5JVDB 1PR4A 3IAEA 1LF5A 4RQUA 1DWPA 4C3OB 2XCQA 3GLHB 3ZI4A 4CMBA 1G7RA 4FTWA 4E7OA 1PQUA 3QXCA 5TIIA 3IQXA 4BZXA 4CMKA 2ALJA 3E3OA 4QLAA 3IPRA 2WU1A 5GONF 3B8HA 1L4EA 2I6UA 3C3XA 3CRQA 1OZHA 3LZDA 4NS1A 4OBWA 9LDBA 5JO0A 1YNSA 2JJQA 2XRFA 4GS5A 1V45E 3T7AA 3MVEA 4CNQA 4S1OA 2C82A 5I7HA 1FQOA 2IP4A 4CLHA 3I9FA 1ETUA 1HFJA 2JFNA 2PUHA 3OCYA 4R8KA 2B2NA 4XH9B 4BO3A 2PD4A 2K87A 2V6IA 4RE6A 5F4BA 4N7MA 2P35A 2FKNA 3CVYA 3UVEA 2OYCA 3BB3A 2VCHA 2EG5A 1EZ4A 3DGFC 3EDRA 1CVRA 3NBYC 3ZV7A 2JLBA 1C1DA 3JYPA 4JGIA 4BNXA 1PFVA 1QYWA 3GDWA 2BJWA 3PC2A 4KAAA 3I62A 1XKXA 2VK4A 4JL6A 1LWNA 4NBKA 5D3MA 3CNBA 3TQSA 2W8BB 3QLJA 1Q0QA 4R7GA 1NG9A 1IOZA 2JBAA 3OU2A 4IMJB 4C04A 5EJ4A 1YRYE 4LYGA 4TWBA 4Y9UA 1NBME 4KR0A 4NF2A 2HU7A 1LS1A 1R8YA 3TM4A 1WDKA 1UBKS 3IQZA 4QPJC 5KHOC 3CE9A 3GMTA 5LJLA 4X1KB 3D7LA 3LYLA 4ZCSA 4BFLA 1JYFA 4DJJA 1E98A 3BWEA 4HTFB 3ROGA 5C5EA 1XMPA 2G4LA 3GROA 4OHKA 2Q0XA 5D84A 4DCTA 2PO5A 2ZZNA 1Z0KA 5DNCA 5I7RA 3H6GA 4RANA 5AESA 3HVKA 1EX7A 1GGNA 1RP7A 3EOAI 1QKIA 2CXTA 5J4VA 3GUHA 3WGLA 3BQNB 1SWVA 2ZRFA 5FPYA 4M1EA 1LGYA 2XNCA 2YMQA 1RE1A 3R0QA 4OKSA 1KSJA 2HIMA 1K7SN 5EA2A 3U3XA 4YY3B 1ZBQA 4ZV9A 4RPKA 1ZN2A 2CL7X 2FRDC 2A9PA 3FWZA 1QVRA 3HKEA 3N0XA 5EJ7A 2AOVA 2A92A 2GVDC 5HCNA 4D42A 1A71A 1XCJA 2ISSD 2JI4A 5L3RA 1KHHA 2PRYA 5A03A 3L0BA 1B93A 3AYXB 2BFFA 2BZGA 2D7CA 3BD6A 2NX2A 3LUBA 3R3ZA 2FMKA 1JVNA 3UJ3X 2PT9A 1F6DA 1GRCA 3C24A 2OBBA 3CF6R 3OKPA 4KV7A 4OF4A 2AG1A 2OAGA 1LLCA 4Q9AA 1EP9A 4OLBA 1CY4A 2WSSA 1FVXA 3PQ4A 1N4DA 1SG6A 5E7IA 1RM0A 4TV8F 5CJ2A 1KI9A 1OHHD 3MINB 1RM4A 4IDBA 2JFHA 4LDZA 3BSSA 3H05A 4RL6A 1XYYA 3C15C 5DWQA 3ZU5A 2JAUA 2WWVD 2VHJA 2FPLA 5ALWA 1E5XA 2JA2A 3L1HA 3FFTA 4KOEC 3SJUA 4EFMA 3A6GA 3CF4G 3FOAA 1EUCB 4HAIA 4RS3A 1B14A 4ZQHA 1E3QA 3CVOA 3IE1A 1EJ0A 1ESDA 5DHRA 2GMWA 1SIWA 2WU3A 3FD8A 3V34A 1VKNA 2ON6A 4HLCA 3VPFA 5C4IA 5IH3A 4YMWA 4CM7A 2C92A 2JFQA 2UVQA 3SF8A 2IS6A 4H27A 1IHUA 2AJBA 2WYOA 4FCWA 1L6IA 5AOCA 2UDPA 4FDLA 4MA4A 4FFWA 4O33A 5KX5F 1FDWA 4I2NA 1KYWA 1A2KC 1P33A 1WY7A 3ON5A 4D41A 3OOYA 3D1JA 1CG6A 5CH5A 3PNVA 3SHWA 2OHOA 3PT9A 4EO4A 5B7QA 1I6WA 3WLJA 3C7DB 4HWRA 1YCHA 4OXNA 1KAMA 4WKGA 3TBHA 3WTCA 4KMOA 1HO3A 1Y1KE 2O0LA 1XEXB 2BBSA 4CLOB 2P6MA 4RTMA 5I51A 2JI7A 1J90A 2OFOA 3OJLA 4YECA 1WDTA 5DCUA 1TLFA 1FPQA 1H93A 4R8LA 4KFSA 4PIMA 4BMCA 4YAIA 1Z2OX 1YKFA 3F6RA 3PQ7A 4MIEA 2G1PA 2HNAA 3CH5A 1PZHA 4UM9D 2VA9A 3AKDA 2BFWA 3QBVA 4O25A 3IAS6 2DOKA 1YHZA 1HEUA 2RGRA 3KC2A 2ATXA 1G2QA 3IPLA 1JUDA 1Y8QB 2NO6A 2VYVD 2WT8A 5E2BA 4DZTA 1VXOA 5DBGA 3SXJA 4RPJA 4TT3A 3E48A 1W5EA 2OGZA 1PWHA 2YINC 3MJDA 2QVZX 1LBHA 3CPSA 3SDBA 2XCIA 3VFDA 2WWIA 2ZB4A 4Z86A 4JJ6A 1JAYA 4ZVPA 3S6JA 3W8NA 3I6ZA 2ZE6A 3UOAB 3PX7A 3MD9A 3K05A 2H3HA 4E5PA 2DUUA 3F73A 3FWKA 5KTRA 5CNMA 5ALHA 2R751 6YASA 1BNCA 1UXGA 1WNFA 5AW6A 2NWQA 1SCNE 4HUTA 4M2LA 3WMWA 4BP3A 2V58A 2WZDA 4QUIA 1UMCB 3MNFA 4KPUA 5D00A 1NQTA 1E69A 1T5BA 2IY9A 1DC6A 1NSYA 3C3YA 3KU1A 3BGIA 2J67A 2JI8A 3LHFA 3NU1A 4CUZA 2G63A 4E46A 2OG1A 3H9GA 4JROA 2X23A 5EIWA 4RL4A 3AR9A 4XIGS 1JYEA 2BEUB 3ENVA 3KBBA 5DYTA 1K0FA 2GLUA 2WAMA 1WY5A 3FE2A 2MTBA 1VSUA 2D2FA 4O3FA 2D1YA 1PN3A 4X1IA 4ZN6A 1K7YA 4GX0A 4AWXA 1P29A 4EHIA 5BNZA 3SHFA 4BRSA 1FYEA 1OYVA 1M2KA 2A59A 1UJNA 2HMWA 3AYZB 3ORRA 4GFDA 5BOSB 1P0IA 4YCNA 2HBZA 3F8SA 4MK4A 2C2YA 3SJAA 3VPAA 5FUYA 2QUJA 3ETCA 4B6JA 5CB0A 5AW4A 1KVSA 1RHQA 1MABA 2VDNB 1F0KA 1HLFA 1VLMA 1PS8A 1BXKA 2B25A 2XDQA 3LVQE 4J7XA 1PJRA 2WEKA 5FQOA 4BO4A 1UEXC 1L8QA 5CT8A 1OU0A 1KZ7B 4JUBA 2HQSA 3W9BA 3WIUA 4Y2GA 3R5JA 1EVKA 2GDZA 1ST2A 1XZHA 2OECA 2ZYDA 1M2NA 5KWSA 3OJXA 2RCNA 1CWUA 4YC7A 1JFVA 4DR6B 4J0HA 3X1WA 4EENA 1RZRA 2QM7A 1H2ZA 4QQ8A 3H2YA 2H1VA 2IYFA 3OO0A 1SZCA 2NSJA 2ZDQA 3NTXA 4Q12A 5SV2A 3NRCA 1YHNA 2I2DA 2B4TO 2CE7A 2KE5A 4H9GA 4YV0A 2FMFA 2VDPB 1Z4LA 3GD5A 3JCZA 4I1IA 5CXXA 3P97A 1APBA 4E22A 3AU9A 3H19A 1NR7A 2X9QA 4G0NA 4FSDA 4ZEVA 1ZR4A 4RK7A 1W1IA 1OJ7A 1PTJA 1JB1A 1QTRA 2D5AA 3GEDA 2Q9BA 3L4KA 1Z12A 4DV7B 4NLLA 4WFKA 4Z9FA 3GPCA 1IHOA 4YT2A 1USIA 2FPIB 3AL0C 5ECYA 4XIYA 2I66A 2ISCA 1XEWY 3VH3A 2GK7A 2YY7A 1KDPA 3BTVA 4HP8A 3M34A 2EWWA 3LRTA 2CLSA 1PWZA 3BSYA 4CMEA 5K8LA 3G5TA 4GPIB 5A2GA 1I6LA 3F97A 2Y92A 2OK7A 5JNSA 3V8PA 3FZYA 5HHTA 3L18A 16PKA 2C8VA 5T3UA 1X15A 2XMZA 1FK8A 3FNIA 3Q6IA 4MEBA 4PHGA 1IY1A 2BGKA 1YA4A 4XGNA 5JIBA 4PTZA 2B1QA 3X2EA 1BGXT 4DNPA 4KLAA 3VNRA 3I64A 1TC1A 4M86A 1F20A 2ZFUA 1SD1A 1XF1A 2VP9A 3PNBA 4L9SA 2B83A 4MS3A 4P38A 1S4QA 1VDMA 3BE8A 3B51X 1G2PA 4L85A 2AQIA 4BL5A 2P4UA 3A06A 3D0QA 3DZIA 4PC6A 3DZHA 4JOSA 1RM5A 1WZIA 2VS1A 1SOAA 1RLMA 5CJJA 3WQSB 5AVXA 1TUIA 1MJGM 3LX5A 2WC1A 4OAQA 3RYHB 3BTOA 1PO7A 2OHJA 3GJ7A 3INTA 1KJNA 1VRVA 2C4NA 4LE1A 1DC5A 4BE4A 5I9NA 5IPFA 5DISB 3AR2A 1G18A 2XMPA 3SNKA 4IGIA 1XHFA 3HDYA 3KWFA 3L4BA 2PX5A 4JMLA 1OFUX 1TJ3A 2XBUA 2WYHA 5JRDS 2Q27A 1FTNA 4MUNA 1CUHA 1PTKA 2UUPA 3O3NB 1XXHA 1IM8A 4ABYA 4I9NA 4MUXA 4ZHSA 1M66A 2Q5QA 1KVQA 2VRCD 4B5LA 2E9SA 4D81A 4O3MA 3KYBA 3PLAE 2JGMA 1NVVQ 5FNVB 4GPZA 1G8GA 1JR3A 3GIDA 4NYMQ 2IZ6A 2DHEA 3Q8MA 4X8OA 1JN0A 4MKFA 3H97A 2Z5LA 3QP9A 5A06A 3K70D 3TFQA 3I4FA 2VOEA 4JCCA 1XYGA 3CSDA 4ARZB 7REQB 4NAHA 2QR3A 4Y98A 1EESA 1DEKA 3U1VA 3FDFA 2SKDA 5BSUA 3GAZA 1EZ1A 3HCAA 3ZE1B 4B8YA 4JOBA 4J91A 3E7DA 1U94A 2GNPA 3G2MA 4L8WB 4NYIR 1WQ4A 5K6TA 1R0XA 3QUBA 3DAHA 4OM7A 4W63A 1ZG3A 1GUZA 3W8EA 5IWCA 3FPEA 1Z22A 2C8LA 3BHJA 5SZJA 1GUAA 3LY7A 4PZ9A 3OE5A 1BXRA 5I4CA 1MF7A 1NN3A 2FKAA 4RK0A 1EJ2A 4OMDA 1V16B 3GEPA 1QO7A 3E5NA 3NHWA 4WWHA 2Y9PB 4M9ZA 4CFZA 2CUKA 2PBRA 1L7AA 3NHPA 3MS7A 4JP1A 3MWDA 1W0CA 1WUIS 3O3MB 1HYHA 3RD5A 3Q1KA 3F7MA 4J1NA 3NDPA 4QUKA 1P0MA 2A84A 1I3OA 4CIYA 4Y0AA 1TGVA 5HF6A 4IV5A 1B16A 4AF8A 3MJHA 3ZDCA 5L40A 3VR4A 3IAXA 4PLPA 1KIFA 4HGPA 4PRYA 2CLMB 3T7TA 1E9CA 3UJHA 2WNHA 2XWBF 2ZJAA 4KFTA 4D0LB 3BICA 4D92A 3K70B 4OYHA 1ZUNA 2ZW9A 2BGGA 4RJIA 2IUYA 1DL5A 4WCVA 1ADGA 2QG4A 1YWGO 3LS2A 2HU2A 4JEMA 5DT2A 3CLKA 4PZCA 1CQIA 1O89A 1JL3A 1DMRA 2XQFA 4FYHA 1OXXK 1T4BA 3B6MA 3T7EA 3Q7IA 3ZTYA 4EVSA 5U1PA 4MRRA 2E1RA 3VU0A 3M3DA 1EBUA 1RXIA 4CQMA 1G8AA 4H7JA 1NLZA 2VO1A 3LWZA 5IULC 2Y71A 4C0WA 2IOHA 1U2QA 3FCAA 2WRZA 4IFBA 1OLUB 3KS9A 4S24A 1YK0A 5DI9A 1DSSG 1ECLA 4XGIA 3O74A 4ZQCB 1AUOA 4B71A 4BIIA 4CT0A 4JLOA 4QG3A 2ZETA 5AJHA 2NZJA 4Y9RA 1YRWA 3H2KA 4HSEA 2ZRIA 1YDMA 5LWHA 3NHRA 2DPXA 4WCFA 3FPKA 3OZVA 2OCBA 5IFKA 5BT9A 2YMMA 4S04A 2PRJA 3LHKA 4X7RA 3BDAA 2DSNA 4HVCA 4GMKA 1PJLA 1TLLA 1WRBA