1XVLA

The three-dimensional structure of mntc from synechocystis 6803
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
279
Chain Sequence
b'GETEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKDVPSVVLTEGIEPIPIADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQVPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARFGGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGLLAGTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mn transporter
molecule tags Metal transport
source organism Synechocystis sp. pcc 6803
publication title The MntC crystal structure suggests that import of Mn2+ in cyanobacteria is redox controlled.
pubmed doi rcsb
total genus 83
structure length 279
sequence length 279
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1xvlA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1xvlA02
1N2ZA 2X4LA 4WZAB 4FILA 2WHYA 4FI3F 4MO9A 4WZBA 5HDQA 3ZKAA 1QGUB 2XY4A 3AEKA 2PS9A 3AEQB 1M34A 5BVHB 4G09A 5FLYA 4WN9A 2OGWA 3K1AA 2MINA 3NU1A 4HMOA 1XVLA 4M7OA 5M3BA 5M29A 4TKVA 3EIXA 3G9QA 4LJSA 4NNOA 1K7SN 1K0FA 2XDQB 3BE5A 4TKUB 2PS3A 1KARA 1N4AA 4TKVB 4UDNA 5GGYA 1QH8A 5KHLB 3R5SA 1ESZA 1H1LA 3MINB 3TNYA 1QH1B 2PHZA 4WN9B 1N4DA 4N01A 5HX7A 4TKUA 5I4KA 1FP4A 2YNMD 4OXRA 4WZBB 2XDQA 4XPIA 2RG7A 4B8YA 1G20B 3MWGA 2Q8QA 1H1LB 2QI9F 3MD9A 1QH8B 4DBLE 3AERA 3CX3A 3AEQA 4UTPA 3ZK7A 3AESA 5BVGB 3PDIB 2XH8A 3PSAA 2ETVA 2M6KA 3PDIA 4H0FA 4WZAA 3AERB 1KAEA 3R5TA 5KOJB 4WESB 2MINB 1TOAA 1KAHA 4LS3A 5CR9A 5KOJA 2R7AA 2WI8A 2PRSA 4FKMA 4XPIB 2R79A 2AFHB 4INPA 4K3VA 1MIOA 2OV3A 3TLKA 3GI1A 4UDOA 2YNMC 3AESB 5BVGA 3AETB 5KOHA 3U7QA 2AFIA 1PQ4A 2XV1A 1QH1A 4GICA 1N2CB 4HN9A 5JJ5A 2PS0A 4IRMA 3TEFA 4OVKA 4H59A 2M6LA 3MFQA 5B58T 3EIWA 1L5HA 4MLZA 4CL2A 1K2VN 1PSZA 4PM4A 1FP4B 1EFDN 2OSVA 4WNAA 4NNPA 1G21A 1M1NA 3LI2A 4MDYA 2XUZA 3ZK8A 1N2CA 3MINA 4OXQA 2O1EA 3ZTTA 4ND8B 4PAGA 5JG7A 3U7QB 4MX8A 4WNAB 5M2QA 2OV1A 3UJPA 4HMPA 2AFHA 2Q8PA 1L5HB 5JOQA 4ND8A 3ZK9A 5AFSA 3AEUB 5JPDA 3HXPA 2XQVA 1M1NB 3PSHA 1M1YB 1G21B 5CX1B 5KOHB 3AEKB 3AETA 1M34B 3HH8A 4HMQA 5GGXA 1QGUA 4BBPA 1MIOB 3MWFA 4UTOA 3BE6A 1K75A 5CX1A 4FNAA 5M34A 1M1YA 4G07A 3LHSA 3AEUA 2AFIB 4INOA 3K1AB 4WESA 1G20A 5BVHA 3HJTA
chains in the Genus database with same CATH superfamily
2OB1A 5L9AA 4MGYR 2ZIXA 2O7NA 4DQLA 4ARIA 1ECFA 3ZKAA 5KYGA 1E7WA 1WDMA 1JEYA 2CEAA 3VC7A 4P31A 5DNEA 2VJLA 2BCJQ 1D6MA 1QZUA 4UNNA 2RHJA 5HUQA 3ET5A 4GFDA 3PXBA 3D6VA 4OEHA 4UDYX 2DOKA 2ZIFA 3WGKA 2G5GX 4QU0A 5IUKC 2Q1UA 3LCJA 1DIAA 2IXAA 2G82A 4QIHA 3LL7A 1AKYA 2C42A 3I4FA 3M4JA 3S3TA 2QN7A 1L5WA 2O7VA 1NX6A 3DZCA 2GN6A 1EINA 3UWSA 1GTRA 3OZRA 1W36D 1W44A 2FMFA 5LP6B 3Q87B 1XZDA 3D9QX 3QYFA 4QFMA 3TLAA 2IJGX 5KC8A 4DV7B 1QGAA 4LJKA 5AM2A 4IQFA 5BNZA 2GAJA 3HY3A 4NJEB 5JD3A 2ADMA 3QE3A 3EJ6A 4BNNA 1RZRA 3GMDA 3UK7A 2M1ZA 1P17A 2AMLA 1G20B 2X2OA 2IA5A 3WK6A 4DIFA 3IEVA 3OJWA 3BL6A 4GSKA 3EPKA 3LOUA 1M0EA 1BWSA 4N8EA 3PNVA 3VVMA 2GHQA 4EPRA 4AYXA 3L1IA 3O3CA 4G0XA 1ENPA 1TTTA 5KVAA 2NO9A 3GV0A 5ALLA 3RRFA 3WWPA 2P2SA 2P69A 1VIYA 4XRRA 1YA4A 3PXAA 3I9V1 4OGLA 4EO4A 5FWNA 2C2BA 4XGIA 3NVKI 1Q22A 1TQ4A 3F5MA 1GA1A 1EUCA 3SC3A 2QMOA 5L4NA 1W36B 4QBFA 1FDTA 1FSGA 5ILGA 3AL0C 1BS1A 1E9SA 4RZQA 1IXZA 3C1AA 3LCVB 4TV8A 2G08A 4ES6A 4NNJA 1OCEA 2H8KA 3GLVA 2JGKA 4R1SA 1LTQA 3FFXA 3EMDA 4MPTA 1IUPA 3CPJB 3MA0A 4RZSA 4BMSA 4DG8A 4N76A 2ZYHA 4IJWA 2WJIA 3CINA 4JS0A 4L76A 4URUR 1GZUA 3AMVA 3MTEA 4BV3A 1GGFA 3TMAA 4MSUA 1QIKA 1FVOA 1U6IA 5F7JA 4JV5B 2D54A 4Z49A 5KPDA 3UYLA 4HEHA 1E2QA 5BW4A 2RKOA 2BYTA 1NNLA 1P91A 5AT1A 1C1XB 5H4HA 1OH5A 1G6OA 4L95C 1DBIA 2NP7A 1UC4B 2C61A 4F4CA 1NR7A 1D7AA 2GUGA 5ALTA 4I2VA 1D1QA 3L46A 4BRUA 3NTQA 4B6JA 2Q7OE 1NJFA 2YVUA 1U2QA 2C0CA 2O2IA 2Y93A 2ZATA 1KP2A 4OHKA 3ITKA 1ZG3A 4EGSA 4BO4A 3WGHA 2A0FA 4GYJA 5AK3A 1FUYB 1IEXA 1VE5A 1X7YB 1CU1A 3HUFA 3N7UA 4LXIA 5J2UB 4CF4A 5BN1A 5JSQA 2WF9A 4WCFC 2X42A 3EISA 4AB1A 4GPBA 2UZIR 4RD3A 4PC2A 1H9CA 3IR5A 5CX1B 6GPBA 3ASUA 4PZPA 2J7PD 1M34B 2C2GA 1EESA 3CJRA 1CJTC 1GAQA 1K6JA 1OA1A 3CZAA 4O4HB 3WBJA 4G25A 4UVHA 5FI1B 1H2WA 4N12A 4LGMA 1PJ3A 1N8SA 3BICA 3RH0A 4LJ9A 5KYTA 3PB3A 5FP0A 4D4JA 2EW1A 2GJ9A 3E2PA 1L9KA 4RU1A 4YACA 2PLFA 1LB1B 3DZKA 3N3AC 4UARA 5LNK1 5CDYA 3B3FA 1BDMA 1UJ6A 2BFAA 3DZJA 4TGLA 2IEIA 2PZ8A 3DFMA 4TKZA 3RVDA 1RLMA 4PYMA 1EK0A 4KI7A 3TRFA 3F49S 3BFJA 1JIUA 1HYQA 5JZBA 1M2WA 4RHXA 2G5PA 1D0IA 4IDDA 4RD0A 3VYUB 3TUZC 3KTAA 5DCUA 3EQ2A 4KR9A 4B3IA 3EUEA 2OVBA 4R2IA 2JGDB 2JPDA 4GPZA 5EYPB 4FE7A 4OLBA 1P1FA 2P2ZA 4R2XA 1V5WA 5EP2A 5FA5A 3STVA 3AW9A 3PA8A 1O95A 5EE3A 3HJRA 4TT3D 3G0CA 4UU7A 5IAAA 3UWDA 3HC7A 1ZNXA 4DHWA 1VCOA 3KVYA 4MYSA 4C22A 4J07A 3WO0A 4JJAA 1SU4A 1FCJA 3FY4A 5GV7A 1N0HA 4D9MA 3T5BA 2VI5A 1N6KA 1DKNA 3KXKA 4QX6A 4Y98A 5DBHX 1I1QB 2V3CC 3AOGA 4GX0A 1LF5A 5ARDA 2ZIXB 1GPKA 1VQ1A 4XPIA 5ULLA 1KGSA 4KTTE 2PUJA 3CEHA 4YJ3A 1PK7A 4JH0A 2EP5A 4ZAFA 4XVRA 1Y5MA 3U6KA 5GJVC 2J3HA 2G3YA 3ZLVA 1OHHA 3ZU4A 1OMOA 2MR6A 4EF5A 1U98A 4XGKA 4B3CA 4EHHA 3SICE 5H59A 2A9PA 2Y67A 3PSAA 1HR0B 1EPUA 3BZUA 2MSWA 2QAGC 4HB2A 3ENVA 2O3QA 2QXYA 4P4NA 4PSCA 4WNCA 5EE9A 1YQXA 4BNJA 4C4TA 5A5EA 4WESB 4JC5A 1DKUA 1T29A 5EL0A 1TM4E 3AFGA 3IKLA 2SHKA 4KVGA 2QN1A 4G2TA 1D4AA 1UBKS 3U7JA 4IDCA 1Z7WA 3D6JA 5F1OA 2PSFA 2JI9A 1R6VA 1XDSA 3EODA 4HNVA 2P6NA 2RGDA 3CJQA 1EX6A 3EZGA 1GPAA 1CE8B 1KU0A 1SQ0A 2OCLA 5ELLA 4P7JA 3DCYA 1NONA 1YCDA 5DK4A 5SV2A 4B46A 2DT5A 3L6RA 3NVAA 4NCJA 5FL7D 4PFSA 5B58T 4H7JA 4JQOA 3O3NB 1N0VC 2C98A 4XCQA 5C8VA 5AVUA 1VG9B 2FSHA 3CB2A 3EB9A 3HFRA 3P0JA 3FZEA 3IYLW 4V0QA 1CW2B 4MQFA 3Q98A 2WG2A 1Z0FA 5J5AA 1KMCA 3AB8A 4OU4A 3UGJA 4KN9S 4RK1A 1RM4A 1RBMA 3GJZA 1FNDA 3L7OA 3O8NA 5ALSA 3RYHA 5JLJA 3K0FA 4N49A 4YJKA 5FOXA 4PF1A 5CYOA 3U3OA 3WE7A 4ZOQI 5BMVF 5CCEA 2AN1A 2DU8A 3I42A 3PTAA 1R50A 3RVLA 3VPDA 3LYUA 1KDYA 5FTNA 3ZN2A 4E5VA 4XYMA 3C97A 3U4QA 1M1YB 4ZQGA 3T3MB 1RHJA 3AVUA 5BYBA 4TS1A 4BC1A 3Q3VA 2H8GA 4JYZA 1FVFA 1ATIA 1ZSNA 4GPTA 2OBMA 3EXAA 4K2AA 1J8MF 2FPSA 4JMLA 1I1HA 1U1EA 2G06A 5TGDA 2ZYWX 3VMFA 4EDHA 4FNAA 5JCJD 5JNWA 4N4AA 5JRZA 1NVGA 1OGYA 5KPJA 1GYPA 5SYAA 2QX9A 3EUAA 1MVNA 3HM9A 1A69A 1X77A 5AJYA 4BEWA 1GG2A 5DV9A 2I6TA 4ND4A 1XRNA 2J30A 2IHTA 2O2HA 3ND8A 4NCBA 4KL8S 1JG7A 4FHGA 4LKRA 3EGIA 5TPZA 3RF6A 1EVJA 2CXQA 4FYWA 3B6KA 4ICIA 2OGWA 1FX1A 3PJDA 4R3UC 4RTKA 3QOWA 4KR7A 4K0RA 2RK4A 4WUTA 4ZCTA 1NE7A 2OV2A 4Q9JA 4A3SA 2VAXA 1VMEA 4W8OA 2NUAB 3G23A 1DHTA 1PI3A 5EIBC 1DX4A 4CL3A 2LE0A 3Q7PA 1PAUA 1KFCB 2IS6A 3C3XA 5CEEA 4LXUA 4AZ0A 2PS1A 4JJIA 2UYGA 1WQ4A 2M98A 4M89A 4J7UA 1P77A 3WLAA 3BM5A 3WIVA 1OC2A 2VNKA 2ONZA 2P68A 4JUCA 4DV2B 1OU4A 2PLWA 2GO1A 2J5XA 4OHXA 4LI3X 4PX9A 1CJUC 3JSXA 1NFRA 4DCCA 2X5KO 4KSYA 2VAMA 2ZYSA 3V7FA 3ONEA 5DLEA 5KTMA 4X20B 3MJ4A 2QBYB 1FU8A 3ZS8A 4YJ2F 5FIUA 3TLEA 4BVFA 4OXIA 4YCDA 3FYHA 2XR1A 3U3XA 5CK5A 4WOCA 4V1CI 2I4LA 1SC4A 4QXQA 3F8TA 3B1VA 1EMDA 2DPMA 1L4HA 2DLNA 5AUPB 2NYUA 4LY0A 2A14A 2NUTB 1KY2A 4QOIA 2DUNA 4GRAA 2VPPA 1TUBB 3DBOB 4MP8A 1GCUA 4H1UA 4XCXA 1B41A 4OU5A 2HMWA 3SMVA 4QKQA 4KFRA 3B3JA 3V55A 1KO5A 4H3VA 4TLDA 2R6GA 2Q5EA 4QUAA 4QQFA 4RF5A 1UIRA 4QRHA 3JARA 3I4CA 4DLUA 3LQRA 5IU6A 4ENWA 1TVCA 5BV7A 4AC9A 3MB8A 2X5OA 3OTQA 4MWZA 3P9XA 4WLFA 1IDOA 1G6Q1 3EIOA 2BM1A 4P0QB 1XZCA 5G1OA 2B8NA 1C1DA 3BJMA 4MVXA 4TUYB 4BX2A 1GDHA 5L3VA 4Y18A 1T1GA 2VXOA 2AXPA 3O1JC 4JLDA 4EPWA 4WXYB 4BFXA 1D7OA 2NADA 2K7FA 2GI4A 5EIWA 5AW9A 1SELA 1XD2B 2WJWA 5AUQA 3ZHVA 4GOLD 3OIVA 5CEFA 2BR4A 1OWNA 3W05A 4E0BA 4RZHA 3G79A 1GZDA 3WFJA 3Q8KA 1PJAA 4BO7A 3UH1A 3DV2A 1EFTA 1NFFA 3FNBA 2YHUA 2EJTA 1QP7A 1F2DA 3U13A 2Q2QA 3PPWA 1T6YA 3DBRA 1RXVA 3MF4A 3ZHCA 1H66A 4E5KA 2RC5A 1USIA 1L2TA 2VT2A 3BTOA 3PEFA 3NYRA 1XEFA 4IIHA 1N5MA 3T35A 2BFDA 2QTZA 3H3FA 1ZWLA 2WAXA 3TL3A 2ZSFA 4GLFA 1XDUA 2F9LA 2WPNA 3G9ZA 2F2TA 3WK7A 4DSOA 1SHJA 5IM5A 3SZUA 2OHVA 1VPDA 1I3CA 1W35A 3QW4B 2XUQA 1YVPA 1E7QA 5HZGA 1E0JA 3COZA 3MJCA 3N7TA 2JVJA 1A72A 1G18A 1ZUIA 3NOVA 4WE3A 3PI6A 1P7WA 1Y48E 1IVNA 3QVVA 3H9CA 1H4TA 2XMSA 3FI0A 3PC3A 4YROA 3S29A 4DM4A 1JA0A 2D5IA 2O0HA 4BZXA 4CM9D 1L7QA 5CVCA 4ZVKA 2VPWA 1VJ0A 3SNKA 4A8JB 1SCIA 3ZEAA 2VBIA 5C35A 1IHUA 3QF7A 2C57A 4KVAA 1QB7A 2MSLA 2O48X 3A1UA 1YZ3A 3A9RA 4OM7A 5F1YA 5DO9A 1NG1A 3VNBA 4BMCA 1N2IA 1LW7A 2IXGA 3CURA 1LPMA 3DFUA 3HB0A 4LJYA 2O07A 4TKVA 3LYAA 3X1DA 1SK9A 1YMUA 4U2KA 1KK2A 4LF4B 4IY1A 4PYJA 1EHYA 1WCYA 5FI3A 4ZKDA 4BN5A 2X13A 2ZAGA 3OY2A 1XF1A 3OFVA 1YZHA 3FUVA 1MR3F 2I3DA 3PVCA 2P1ZA 4KQEA 1XVIA 1R3UA 4ZI7F 5K2OA 1V96A 3M6XA 5CIQA 1NC1A 2QVYX 2VCEA 4G4IA 5EHNA 1PR1A 3LPLA 1P2BA 4JT4A 3G6KA 3RRBA 4HNGA 1E6EA 1T4DA 1VBKA 1VHWA 2VLIA 5L4SA 4XX0A 2G07A 3EG5A 3K8YA 4FGSA 2BCEA 1F9EA 2HHJA 3L04A 2MYTA 5DHRA 1W8IA 4C2AA 1Z22A 4TROA 2A1TR 4HQLA 5JAUA 5LPNA 3AG5A 9MHTA 3SJZA 3E9DA 1C7IA 4PG7A 4WL0A 4QDZA 2DF8A 6PFKA 5FBVB 3L7MA 4OB7A 1S3IA 5IC5A 5TQ2B 5DULA 1ML4A 1LV8A 3GEHA 4DMHA 3DE6X 3L0OA 1BJRE 3K4QA 3WWCA 1L4LA 4JL6A 4N7MA 2OPBA 3DXZA 2OYCA 5JDIA 1U0JA 2BLNA 3I1FA 2ZTSA 2V7QA 3A9VA 4OY3A 3RU7A 1HTWA 1YDWA 3I8OA 2AH5A 4PZLA 1NLFA 1DAEA 4URYR 1Q3KA 4Q1EA 1AUPA 1HDRA 5ALNA 4B48A 4Z4FA 4AQDA 2WF6A 2VNIA 3HKCB 2H0RA 1U0GA 4ZYYA 2PX5A 1DARA 1T4CB 1DEOA 4DARA 1FL9A 5IWCA 3B78A 2DFKB 4NCHA 1BE1A 1VHTA 2PR7A 4HUJA 4Q03A 4B5KA 3N2ZB 1PLKA 1N1DA 3OQ6A 1KYVA 4JI3B 4UCWA 3ETJA 1DBSA 4AJEA 3H1GA 1LX6A 5LUBA 4UUMA 3SC4A 2GN2A 4XD7D 3WGQA 3QEMB 3R6GA 1DLJA 4Z2AA 1Y4UA 3AI7A 3JQFA 1OILA 3D6AA 4A5SA 2DMRA 3AFNA 4UEWA 3O9MA 1QIGA 3NAQA 1U1CA 1CUDA 1ST3A 1D2AA 1HE8B 2FYTA 3AV0B 2QTMA 3BK1A 1PJQA 2HSEA 1L8AA 3HNPA 3KFVA 2GPNA 1QDUA 2W6JD 3QUAA 4JI1B 2BFMA 4DRXA 2NUAA 4MUBA 3BWEA 4E4RA 3OTOB 4DCTA 2BWJA 1NRWA 3SYMA 4I46A 1A4RA 2W4IA 4CTKA 1L7NA 4KNVA 2BVNA 4B6EA 4CKXA 3DFKA 2UV8A 4H7PA 3NS7A 1GWNA 4OI2A 3ZWKA 4G63A 3BGWA 3EAQA 4GM1A 2VDUE 3BX1A 4R8RA 3RFCA 1EM8B 2OMKA 4G67A 3OQNA 4X6YA 2IC5A 2OOSA 2EQBA 4TL9A 3T94A 5TS2A 3D3WA 1OAOC 4UE3S 2WYIA 4G5GA 1RRVA 1NASA 1C4WA 4K88A 3ELUA 2BGNA 3LC0A 5K05A 3BHNA 2VZ9A 1KZ1A 1RJGA 4TTVA 3CE6A 5D6OA 4TWJA 4NOMA 2GWRA 2VYNA 5G0WA 1MORA 1U1DA 4Z4QA 2JK0A 3OURA 1AVTA 1MA0A 1KR5A 1GZ4A 2IL1A 3CEAA 2DKNA 3C43A 1I7SB 3PDHA 1EUZA 1E96A 4B8ZA 2N42A 3IELA 2HRQA 4H0CA 3R74A 2EATA 3BJEA 1PJRA 4F2PA 1TYZA 1VJTA 3KEQA 2X9GA 1W47A 2BEKA 1Z17A 3NUGA 4RESA 3SC6A 3ZE0B 1GVHA 3QWIA 2RGRA 1C30A 3PUIA 5HM8A 4LNUB 4KLAA 4Q9DA 4HLDA 2WF5A 1BQ4A 3I1YA 3REOA 4MQUA 2FR1A 4KO2S 1AA9A 1FBNA 2QG9A 4EFMA 4U02A 5AI0A 3K1JA 4P0PB 1YB7A 1YJCA 2O7SA 5JFGA 2A0UA 4PX3A 2ZSDA 2XVAA 1HWYA 3JWIA 3L6CA 4G4JA 3WXMA 4KGZA 4B0OA 3C4VA 4U1RA 1KI6A 3DLCA 1E2UA 2JFQA 3F78A 3WOHA 4FWBA 3O0DA 2V7QD 4HAWA 4OO3A 3DPSA 5CBKA 2IUSA 1E1NA 1NJ8A 4F3KA 5HW0A 5CDFE 5BPFA 1PZXA 4Y2PA 1JTVA 5AIBA 3JRNA 4Z5XA 1GDTA 1IBMB 4BKPA 4PICA 2VP6A 4QYMA 1TT5A 3GARA 3KSZO 3K70C 1MBZA 3Q72A 3A1WA 4H0FA 3PQFA 3O74A 5CW2A 3KU1A 5F64A 1XDDA 1E2FA 1R10A 1RJDA 2IHUA 3JWJA 3L3BA 3GAAA 4G6ZA 3OF5A 2Q6OA 4JT2A 4Y2YA 3GLTA 4HHEA 1E1LA 5BORA 4EJ6A 4HGPA 1V1MB 1O08A 4Z8XA 3HVUA 5IRCD 1XPOA 3D64A 3MIIA 3N0RA 4JHLA 4JR2A 3CNHA 3EZLA 1HDCA 3HFJA 4OG2A 4RPCA 3GUCA 3W2GA 5TIIA 5BYJA 1EM8A 1QO7A 4W8GA 1JEDA 4OUDA 3PVZA 1OLSB 4NEGA 2YVQA 3REQB 1E6MA 3G5UA 4WZBE 5ITSA 3LJKA 4WKOA 2G9VA 2WIAA 4I55A 1U3TA 2HPZA 4Y2UA 3WQQA 3G0BA 3HVKA 3DL2A 2WJHA 3NM5A 2DERA 1K2VN 5FFMA 4YJ2B 1EDDA 3DTVD 3OIWA 2FEMA 2BGJA 4OHPA 4UCFA 2HSJA 3T3IA 3FHCB 5K0LA 3X43A 3WNDA 1O6FA 1YZLA 1GPMA 4YEDA 1P4JA 5B64A 1J49A 3AOEA 3NHPA 3RSZA 3W6NA 1ZISA 5DWDA 5IARA 4H7FA 1NPTO 2FUNB 1M33A 3HDGA 3L8EA 4PYQA 4UBNA 3OCWA 3OX2A 1DI0A 2OFFA 3DXFA 5MN6A 3NOXA 2V6IA 3G2OA 3HUDA 2EYQA 2ZVDA 3LPNA 4RQAA 2IXTA 1WP9A 2FOIA 2JJ8A 2QYOA 2EL9A 2QSUA 4LYYA 5AFSA 2YXNA 4DLWA 4QOGA 3M6WA 4DDVA 3UGQA 2QUBA 4GI1A 3M82A 2XYVA 3CA8A 5HOQA 1W5AA 3MHPA 4F92B 1LXCA 1M5RA 2JVKA 2GKSA 1GG9A 2FSVA 4F8EA 3ANMA 3RD5A 1ZFNA 4PIMA 2Z04A 4LXYA 4ER7A 4YX9A 3M3HA 2GRUA 1QB8A 1T6BY 1NPDA 1IOLA 3R5KA 4C4ZA 4DCUA 1KJQA 4H4EA 4ZHQA 4DJTA 3U3MA 2FN8A 2VG8A 5BRAA 1S4QA 3M4YA 2DB3A 2H63A 2OBLA 3FCXA 5LIRA 2WMYA 2WPDA 2CNWA 2WWHA 4IDPA 5FLYA 5K8UA 3VHRA 3FOAA 3CH7A 1BDJA 4NG5A 2YUTA 4CKWB 2OD9A 1QK4A 1R66A 4F71A 1E9BA 1NJ5A 2VSNA 1BGXT 1Z5VA 1FTNA 1Z0JA 1ZRSA 2HUNA 4F3RA 5HCUA 1H93A 4MDFA 1DWQA 1KOGA 1XHFA 2H1LA 3A70A 2CYCA 2FFQA 2X9VA 3L7DA 5CVDA 4YRZA 5HG0A 5L3QB 4S35A 3GEPA 3DM5A 1I7PA 4G5OA 3S1SA 3FPHA 1QU3A 3U60B 2VUTA 3L18A 3MWLA 3CJTA 5IG2A 1IY2A 1W34A 4ITVA 2I2BA 2LGJA 2O5RA 5K3SA 3D31A 1VXOA 3QSGA 4OQFA 5FOSA 3HYNA 3V2IA 4WZBB 3E7PA 4FCTA 3USCS 1JF8A 2F9FA 3K8ZA 1JU9A 1PZEA 1G5PA 1P4GA 2ABWA 1Q3TA 2R7KA 3DZFA 3H4VA 3LUGA 3OETA 4J2TA 3WLOA 2FE4A 3ZDCA 3Q7QA 3BDVA 1XA0A 5HE9A 2O8NA 3OJLA 4S1NA 1S8OA 1T35A 3M81A 4S1VA 5CHEA 1EFRA 1RLOA 3D0RA 1VLHA 2OD2A 3UTDA 2E6UX 2YFKA 4KYTA 3WLMA 4E3WA 1P4AA 4PZDA 1K98A 4W5NA 2FQQA 5DI9A 3U19A 4FM9A 2RE8A 1M6YA 4DLLA 2PMCA 1K7YA 1GV1A 3NXKA 4ESHA 2I2FA 4AJIA 3DJFA 5KC9A 2KHZA 3VBEA 1UQRA 3A6FA 4M7WA 4Y1RA 3WJ1A 5JWRA 1KZYC 2P2NA 1SCJA 3AU9A 4ADSG 1YTUA 2P4EA 1JG2A 4ZPXA 5GJWC 1R0XA 5A4AA 4NTZA 1OJ7A 2NAPA 5B3KA 7ADHA 4DQ0A 4Z1OA 3K4HA 2YXDA 5L7TA 3HA5A 1PFVA 1SXHA 1XDWA 2C29D 2FW0A 2BE7A 4KQGA 2V59A 1ZGZA 2XPCA 4BO8A 4E5SA 4F7WA 5KNBH 3KNZA 2M6SA 1XTUA 3L07A 3GEEA 4RVDA 5C81A 4YY3B 5JNSA 3QSYA 3OPQA 1E0AA 3UPTA 4GWLA 3NKLA 3HKBB 4HUQB 1JU4A 4M9CA 1B0UA 3L43A 4BMPB 3K30A 3WHPA 5KNBD 2ZXUA 1QQAA 4Q02A 5G0UA 1MB3A 4FD2A 1RRMA 1CJBA 4IXTA 4AZ3A 1F7VA 2TMKA 5K0JA 2NW6A 4Q3EA 4RC9A 4UXJA 1E60A 4ZYVA 1GQFA 4V0NA 4FS8A 2QJOA 4YV2A 3UUWA 3FB4A 3HABA 1FQKA 5EQDA 2FMXA 3EGEA 5KTYA 3RAEC 2HGSA 4WXMA 1F20A 2H07A 2FPPB 1WW8A 2C5BA 2CJWB 4YO7A 4F04A 1AK2A 5E4JA 2ISSD 3LCUA 3DAGA 3IIKA 1XDZA 3EOBI 2NZ2A 5CIWA 4Y0VA 2M32A 2R8EA 1T13A 3AR4A 4YAOA 5DTQA 3VR5H 2LP4Y 2ZBGA 1QCCA 3BE6A 2WZCA 1G8PA 1TYAE 1EYZA 1KQ3A 3I53A 3M4XA 5GY7A 1KEEB 1UBUS 1M7BA 1MQSA 4OJNA 2FWJA 3CWQA 1XU4A 3L05A 5KBYA 1NHGA 1TMGE 2Z5VA 2B3TA 3DE5X 1NURA 3MYRA 1LK0A 1CIPA 2QMZA 3BMNB 4OLFA 4UDNA 5CTAA 1PYGA 1TEVA 1J2JA 1TK3A 5DM2A 3VZDA 3PPVA 4KQHA 3I04M 5SZKB 3DYIA 4PS0A 3K9HA 4OFZA 4WOBA 3DW3X 4X60A 1AV7A 1Y7LA 1D09A 4BLPA 2AMJA 2C9BA 4BFSA 1UKYA 4TMTA 1W94A 4C0XA 2VYFA 1ND5A 3U39A 3G8CA 4FCWA 1P7PA 2CSUA 3GZNB 3AQIA 2CWDA 3DDNA 3GNLA 1CY4A 1E1CB 1ZNYA 3QVTA 4QUIA 3B60A 2FWNA 5IBQA 4PCLA 3GK3A 1NI5A 1JKMA 3NKVA 4ND7A 1M7HA 1H0SA 3R6LA 2I6GA 3ROTA 5E9JA 1KDRA 1KQNA 1X7WB 3A1CA 3EGVA 4B47A 4B2YA 1J06A 1X87A 1X14A 2NLOA 3QFTA 4MICA 5ALKA 2O2JA 1HDYA 1PYOA 2WV9A 3GVPA 3SHTA 4BB6A 1JB9A 1PUJA 1WG8A 2BRUA 1IAVA 3Q0IA 4KAFA 1MUUA 1F6BA 1QH8B 1U8UA 3VO8A 4CQNA 5BMVA 1WR8A 4IAOA 1SMKA 1NZFA 2GXSA 2FQXA 5K8VA 1FFBA 5A3VA 5JYCA 2WFZA 4FIZA 1B7GO 2Z98A 4WBSA 3L4SO 3VZPA 3ZY3A 3M89A 4R7GA 4ZO9A 2EC5A 3HQ4O 3CS3A 5CLIA 1RIFA 3G7NA 3Q9SA 4NE7A 4I4LA 1OT5A 2B21A 4HAOA 1NYRA 5C5DA 2O59A 2JFWA 2H59A 4JLWA 1T34A 2M1XA 4PBSA 1ADCA 3L7YA 1Q6YA 1U3VA 2QSJA 3P19A 3TQTA 4IPTA 5KX5F 1O5IA 4EBFA 4GNRA 5AVWA 3JD2A 1BS2A 4FGWA 3PQ2A 1M2GA 3S5UA 3AG6A 4YPOA 2HNAA 5JD5A 1RKUA 1XU7A 1IXRC 1Z6GA 3K0FB 4YIHA 3CUEF 4L3WA 3L06A 3LBYA 1WD7A 2FKNA 1UJ4A 1PFYA 2P3LA 1C7QA 4PCUA 3T9BA 3GGGA 2CK3A 4W6ZA 4BNLA 4AI6A 4D3YA 4IOLA 1NAHA 4XWWA 3ZK8A 1ADFA 1YIOA 4HC4A 3GFRA 4KDCA 4KE7A 2CHUA 4XIGS 4GE0A 3ES9A 1QSGA 3MWEA 4LBVA 1CR2A 1RFLA 1V6CA 3ZHRA 1IQ0A 4FMCB 2WFLB 5DNAA 3MWEB 5AICA 1HDIA 1AD2A 1B14A 1JQ5A 2A1TS 4M1SA 2YWDA 3D7RA 4ND1A 1Z4QA 4B79A 5G0SA 4F84A 2O2DA 3OCUA 1H3NA 4AG5A 3RK0A 1TW2A 5JPDA 1LF0A 2RH9B 5D86A 1MHTA 2ZIEA 4AY6A 3SY8A 4TXNA 1ZIXA 2QE6A 2YASA 4I6EA 4PIPA 2F43A 2QD2A 5GM1A 1UK8A 3KLMX 1H3EA 3NBYC 3A0RB 3CZMA 3UF0A 1AQLA 3MLAA 1LV7A 1ACLA 3Q5EA 1QYDA 3PDWA 1SBHA 5ARBA 2HMUA 1AHIA 4ZWNA 3SSOA 3N8IA 2COKA 2VSXA 4NDNE 1DZ3A 1XR3A 1SEPA 3KEFA 2MR5A 3KXIA 1ODFA 3S40A 9ATCA 3EPLA 3UA4A 2JGAA 4AK9A 4RHTA 2X5XA 2ATVA 1WV1A 2FR8C 5D3QA 1OXXK 3TECE 3U31A 4TYWA 3I9NA 4M55A 2VPQA 1T9KA 1BYUA 3RS5A 2C2WA 4P7BA 2GBPA 3UFXB 3SVTA 5IJWA 3GXOA 4F1KA 1Z4NA 1NVUQ 2AMYA 2GPSA 3DCJA 1Z38A 3JXEA 1SQGA 1U28A 4IHKA 1L5FA 3MQFA 2XODA 5EMLA 3QKRA 3C74A 8ADHA 3UHOA 2WTNA 2XA9A 1LBIA 2B1JA 5CFPA 4M87A 4DEVA 4ENTA 1FS5A 1RBZA 2NZJA 1GR1A 3QJGA 4PINA 5LA6B 5HNKA 2I87A 4DUYB 1ZGAA 2QTLA 2R4TA 4FFOA 4Y2GA 4K46A 2FSGA 3S2IA 3J81A 3KB8A 3MXTA 2I6SA 4X8HA 5IHPA 3ICPA 4GI2A 1KMHB 2RH4A 3R0VA 2NPIA 2P8SA 4RAQA 1LI7A 2JAOA 2CLMB 4IKOA 3NAMA 4WLVA 3EZ2A 4ZCPA 2B8TA 3KLOA 4MPPA 2X8BA 2FZ4A 4QDKA 4CWAA 5FUBA 3KWFA 3PFNA 2HNBA 4BUCA 2Q49A 2Z3VA 3AERA 4FYPA 1JIXA 2IYQA 5G2OA 2BHLA 2Z56A 3C7AA 1B8PA 4D9HA 3ADCA 2Z2IA 2VRNA 4P6VF 2SECE 2AYZA 4JP8A 3EZ9A 3HCOA 2RB5A 5D1NA 4DR1B 3KLBA 2WAOA 1UBNA 4II7A 3VHQA 3CH6A 1S7GA 1J9ZA 2GFIA 3ZVKA 1Q7RA 1YCHA 1OLSA 2WICA 3KX2A 4RDIA 4YXFA 2H5JA 4OHYA 3N0XA 3ORYA 4DCJA 4F56A 4MRPA 4UNPA 4RV5A 1U5BA 2HCBA 4FFBA 2H9YA 3HACA 2HO5A 3M1AA 3ISTA 1TECE 1VMKA 3ROPA 4C6RA 2J0VA 2VDQB 3KSRA 3R4VA 3PYMA 4NI5A 4B44A 1Y1QA 3IJPA 4QXRA 3TB4A 1GNVA 2WOJA 3CYFA 4DY6A 3U0BA 2JJYA 3KKQA 1GCIA 4NBLA 3L82B 4GBMA 4D3XA 1WNFA 3B3GA 4FHFA 1ENZA 3GX1A 2ICAA 1RHMA 1ZC3A 3GZ4A 5E6SB 4RTLA 2EP8A 5AW8A 2HAEA 2UZ3A 4YHHB 5HKKA 1QV6A 1FFXA 2GT1A 3ZZTA 3E9NA 4D9JA 1TFUA 1ZJ5A 3OPXA 1IN8A 2XUZA 2EZ4A 3I1IA 2HIGA 1JJIA 2DM6A 3QW2A 4IO1A 4B81A 1EXMA 3LX8A 1MQAA 4IXMA 1CZNA 1CQIA 3I64A 2FUKA 2AI3A 2BC9A 4AICA 4BASA 1EJBA 2BFPA 3IX7A 5FAKA 1Z6XA 1Z0ZA 2IBTA 2VYND 4MW6A 1G5RA 1L5HB 5DMXA 4AMZA 4D41A 4CF7A 1Y80A 2KB0A 4MQLA 1MG5A 1G3IA 3THXB 4O2BF 3GNQA 1UFOA 1CK4A 3HUEA 3LHFA 3SIXA 4R1OA 3FYUC 4MV6A 3B1KA 2Z08A 4GLOA 3HKCA 5GGXA 1BMFA 4JYPA 4O25A 4X1YA 3TM4A 3MWFA 3T7IA 1CUGA 3T54A 3RRJA 5F9HA 1GCAA 3W5VA 1ZMBA 3UW1A 2ZUWA 1JI3A 2QZZA 1V5IA 2HA5A 2PWBA 2VJNA 4IFBA 3WQSB 3ZHUA 1LSOA 1SU7A 4HWRA 5CU7A 3W5AA 1DC4A 1AKEA 4PSKA 2IYWA 3ADKA 1QORA 1RADA 3L8CA 4LZNA 1RYFA 2VDNB 4FJ0A 5CPBA 4E03A 5A3QA 5JZVA 3LVRE 1L5OA 3VNSA 3F6RA 3OICA 1S7CA 1ZAYA 4JEUA 4S2EA 3RQSA 4NJMB 4CUJA 4PGHA 3Q2OA 2PA3A 4ZV7A 1PV4A 4P80A 5JMWA 4EYSA 3R9WA 3SIWA 5LZ5A 4MYTA 4Q48A 3QLUC 4WZAE 2IPAB 1S2GA 5ALYA 5A71A 1CJSA 3E8MA 3IAS1 1YNSA 4BUJA 4FDMA 4LRYA 1XZMA 4CV3A 4R54A 2FX5A 2XOKD 2ZBFA 4JLPA 1Z56C 1OJLA 4RABA 1FW6A 1UPUA 3QH4A 4C04A 1I6WA 2HPHA 3NHBA 1XCJA 4P9NA 3I1JA 4LZOA 5AM0A 3M6IA 1PWZA 2YNMD 4DLBA 2ATCA 2H9AA 2R62A 1HRDA 5SY4A 5KI6A 4MP3A 2X0RA 3KT8A 3LXMA 3A31A 4YMTA 2PT5A 3K8QA 4BFYA 1UDBA 2KE5A 1H1LB 5CDUA 1U0OC 3EXHA 1N9ZA 4D6YA 3NTOA 1TJNA 5T4BA 2HCJB 4P22A 3HJHA 4XYGA 5CP8A 4RTNA 3WGLA 1AC5A 3OLZA 4H16A 1OPRA 3PXXA 3TDMA 2B5OA 4XDGA 3TRJA 3IPAA 4ALKA 2QENA 3ZZ1A 2QTAA 2IIQA 3E3LA 1TTHA 3CPSA 1Y4AE 3SOPA 4KQWA 3REFA 2FN4A 1G2IA 1QV9A 1TYCA 4P4TA 5L3RA 4BO3A 3PYLA 9ABPA 4RW0A 2HQSA 4Y0NA 4W6QA 2QLJA 2AFHB 2H7VA 3GC6A 3NNSA 4WIAA 5TE9A 4GVPA 2NPOA 4TS3A 3WKBA 4MV3A 2E87A 2EW2A 2IYSA 1OT3A 2NXEA 5H83A 1TM3E 1XRQA 4X45A 3HJUA 2ID9A 1VLJA 1D8AA 1JAHA 4HDOB 4MW5A 4NG4A 4YB8A 5FTWA 4BPRA 4OHUA 2QEQA 4M0EA 4MVJM 3T38A 4U0KA 1AGYA 5T67A 1BWPA 2NYRA 4HATA 3LT2A 1VMIA 1O2DA 1JWLA 1U0LA 1N5RA 3H5AA 4KNWA 3UCXA 2WSSD 1KRHA 5J2TA 2QSZA 1JZQA 1CR1A 3K73O 4OQLA 3HXMA 4Q05A 3LSYA 1WUKS 3OZXA 1AMNA 2NO1A 5JS7A 1DEAA 2ZZMA 2WZBA 1YA8A 3JY6A 1WVGA 2OAP1 4TZKA 4K05A 2AC4A 2X8WA 4QPPA 4MRAA 3B51X 1ZA2A 4JDPA 3QBDA 3SSMA 5FBRB 3WAGA 2BMVA 1H5UA 1QP8A 1UANA 4QYXA 5LDGA 5IH7A 5DYGA 3PLAE 4W7SA 3RGWS 4OQQA 3HXQA 2C4KA 3CX4A 1B6GA 2XZLA 1NBWB 1P2UA 1QWOA 2BJHA 3QMPA 3QIAA 4FGKA 1QF9A 3Q1LA 5EUQB 4ZYUA 3N58A 1M0SA 3EMKA 4HMQA 4OK3A 4MO2A 1N33B 1PVDA 2XE4A 3SJBA 1G9XA 2WHPA 1VL1A 4HWOA 1NVKA 4M9RA 1IWBB 2OO5A 4LZJA 4AN0A 2C8KA 4EI8A 4Q3CA 1HE2A 1ZD8A 2H5EA 3B9QA 3EEBA 1NDUA 3K1AB 2ALJA 2DH6A 2HSDA 1NXXA 3P2MA 3UXEA 3ZE8A 3OY7A 3GDGA 4Q39A 5DTEA 1P3DA 3E5RA 4A8JA 5ICGA 1IHOA 1N2GA 1EWRA 4CW7A 1FDIA 4DADA 4V2IA 4DFDA 2X0IA 4E1BA 4S3MA 1NM5A 4G09A 2F3RA 5EWJB 4HNUA 1GQSA 4QDTA 1WP4A 4UJ5A 3WHKA 3KHSA 4OH7A 5JCPA 2FSSA 1GPDG 3BILA 3OPNA 3UANA 2AE2A 3A1FA 1JSLA 3K70D 5F23A 3E18A 5D01A 4P4SA 3A14A 3QF4B 5EJ2A 3RYCA 4K6CA 4WACA 3EEQA 5ER9A 5LMNB 4UZSA 3W5DA 2WKSA 3KYDA 4GF5A 2GYYA 2VJQA 2VJCA 1H0KA 4D82A 2XB8A 3GDWA 2DWPA 2JFYA 4CCSA 1BC5A 5UKDA 2VHCA 4GP6A 3L02A 2HJVA 5JNLA 2GBLA 1FRQA 1LX7A 1QGED 1R8JA 3G68A 3LBIA 5PNTA 3TUJC 3WLFA 1W0CA 3PQDA 1TMKA 1WMEA 1AXGA 4ARZA 2IHVA 2BJWA 2LWIA 2YQZA 3ZZUA 1LJLA 1CLUA 5A4MS 1GILA 3MW8A 2G36A 4Y9UA 4NPHA 1IJKA 5B58C 3OTGA 4M2LA 4G9EA 4ZAXA 4YRIA 2XE6A 2ZAIA 3B2QA 4V0ME 1AY0A 1P61B 4I9GA 4YI5A 1PLJA 3IT0A 5LJIA 1Z2PX 1TLFA 1UAGA 2GH1A 1XK7A 1VIVA 3GA0A 3OQVA 4ZQBA 1CP2A 3DKVA 3H1TA 1P9NA 2C9MA 4JROA 4HZIA 3TSYA 5CDTA 5IZCA 1DAFA 4FWTA 2A84A 3R75A 3DE1X 1DQRA 1ORRA 2C2ZA 4CM3A 1YV9A 3R3SA 4MVJI 4KKVA 4UBLA 4D99A 3HE3A 2TMGA 1N6RA 1YIDA 2CL6X 1P2TA 2FGKA 2QS9A 4LZLA 4PLYA 1HNXB 1HYHA 1NNSA 1E9DA 1M5TA 4RMGA 1YGPA 1KC1A 2J0UA 2P2DA 2C4MA 2JARA 3HJNA 4IGIA 4FMDF 5TDHA 1P5FA 3Q7RA 4OQEA 4QBIA 1LDBA 5JJ5A 1Y9EA 1LDEA 2ZULA 5JYDA 3PPYA 2JATA 2QL6A 3MGKA 3LT1A 2GO7A 2G83A 2IY8A 4IIYA 2QMQA 1YB2A 3WIBA 1VJ5A 1X38A 4YRRA 5B6PA 1RCUA 1CF2O 5F5LA 5TT0A 5IF9A 4LY3A 1VGVA 1YWGO 4X20A 2BGUA 4L4UA 5B3LA 1M10A 1IVSA 2V1UA 2XA1A 1P6QA 2AHRA 2ZANA 4L74A 1LSJA 4PN3A 3U7RA 2QX6A 2Y0DA 1F4LA 5HQJA 4DG9A 1Q0HA 2UUOA 1XZKA 2GJKA 4W5WA 1KDOA 1T91A 4OMDA 4YVFA 5EKSA 2WIGA 3VU1A 1KZ9A 1E1RA 1IMJA 2J9FA 2ODNA 3R3ZA 4LSMA 5E4YA 4C5CA 2ILVA 2XA2A 1FFAA 3N6VA 1PWXA 2PUBA 1Q50A 4NAUA 2QN2A 3OOJA 2J3KA 4I99A 5TRTA 2AEJA 5GOZA 1II8A 2RAVA 2H54A 4E30A 1C7JA 3GDOA 1WCV1 1ORDA 4Y2TA 1W4ZA 2W42A 1A8QA 4LQLA 5ALGA 1E3WB 4YRFA 1SPBS 4X44A 4JEHA 3M4NA 4Q93A 3OO1A 1I7QB 1NNI1 2GBGA 3K1YA 3OKPA 3OMLA 5ECYA 4JAVC 2RFLA 3U3JA 1ZVKA 1PEYA 2AFHE 3ZBQA 3F3MA 3WQHA 3D2BA 3ZWNA 3GW8A 1F2UA 2D2VA 3ZDRA 5B4UA 3ITNA 4YUXA 2R1TA 3OUTA 3HBJA 2BFEA 4YR7A 1J70A 2P11A 3AM5A 1D1SA 3MSCA 1TDJA 3EGXA 3U1VA 3C8ZA 1L7PA 1ULHA 4N7JA 1RE0A 4UVDA 1ORWA 1XVLA 3Q85A 1L5QA 1Q1BA 4DNFA 2JASA 3M6UA 3R6WA 1WD5A 1DRVA 4GRIA 2OE2A 2XF2A 4MQEA 4UW9A 4WGGA 1NKSA 5ELXA 3S28A 4R05A 4MVJA 3WGOA 1QM5A 5ALJA 4KSCA 2FPIB 2W2LD 3BTSA 1I8TA 3BIFA 4D0LB 2XBUA 1YZUA 2EBWA 5T3UA 2X4IA 1KA9H 2BGLA 2G6TA 4G65A 5GJCA 1BQEA 2I34A 3E7DA 3B3QA 3ET4A 3R24A 4FHZA 4D5EA 1VM6A 2R1VA 2IPOA 3FCEA 4FN4A 4W5TA 5J59A 3OJXA 4L7VA 4NBKA 2QI9C 3BSSA 1AQ6A 4NU5A 1K66A 5E7QA 3FUUA 5K09A 4BMYA 3PFGA 4QPDA 2B4YA 5AW2A 1PFUA 1NC3A 3BHMA 3HCWA 1DMRA 5DWQA 5LYYA 3UA3A 4A7PA 4D79A 3GUVA 1U2EA 2QRVA 1G66A 1HE3A 4DV1B 2C5AA 3T0FA 4BMOB 4ZDKA 3BIWA 4N6NA 3HB7A 4HL6A 4N54A 3E9RA 4BVAA 5HKOA 4AF6A 1ODKA 2VQSA 4I1RA 1X8XA 2BP7B 3I0NA 3KB2A 4C78A 3A6PC 5IHXA 1Q44A 3OCYA 4OGFA 3ROXA 5TVGA 1ZO8A 4NU0A 2O9JA 4P34A 1OQAA 4RKEA 1NYTA 1X3SA 2H7YA 1TOAA 3VO1A 3GUYA 3MOSA 3QUTA 3EVCA 4D0GA 1NKVA 4TYYA 2HEGA 1NWCA 1N5LA 4I4TF 4INPA 4M8NE 5H7XA 4ER6A 5BSUA 2XDYA 4R3NA 1G3UA 2ZK7A 4KFTA 4QGAA 4E46A 5IYZA 4MRMA 2D59A 3SDBA 9GPBA 5AJUA 3NBAA 1Z8NA 3V1MA 7GPBA 3A1EA 1BXKA 1IRIA 1Q0SA 4GS5A 4QODA 4W1RA 3UJNA 4P8RA 4BGDA 3BQ9A 4IUDS 4I8DA 4CI9A 3FUCA 4ZRMA 1PR5A 2VTEA 4RS3A 5B1DA 4AXXA 2VYQA 1IEVA 2JIMA 3B89A 5GZ6A 3OT4A 3UB4A 2C2MA 4BV9A 5DHAA 1R16A 3GLIB 4Y2SA 3RTCA 1JR2A 1UKAA 1NW4A 1H22A 3ETLA 1NF2A 1OX4B 1QHIA 3NHUA 3TOVA 1EWTA 1EM6A 4YMSA 5A5FA 2YINC 3CNLA 1HSZA 4HAUA 3W6OA 4IFTA 2FLWA 5EJ7A 1PDOA 4I4CA 3RIGA 4CT4B 3FZYA 2Y68A 4G0QA 2ORYA 3MELA 3QV1A 3GG2A 1UBSB 5HFNA 4CHGA 1YZFA 2VDPB 1UOQA 1A4XA 2OLKA 1U8FO 4WFJA 5J23A 4H7DA 5LD2C 1GTL1 4L7QA 2N0SA 2C4TA 3I6YA 3N75A 3E1GA 3HN7A 2YYAA 1TB4A 1SUFA 2OP1A 2XX3A 3KQWA 3MERA 1WEHA 1G5QA 4UCQA 4YJ3F 4XUGB 4M1MA 5BN5A 3MHTA 3VISA 3CZRA 2NPFA 3L84A 3LD9A 2CK3D 2IOFK 4JP5A 3DMYA 3FUTA 4MCIA 4JLVA 3C3KA 2YIMA 2EHJA 1EUCB 3MCZA 5EI5A 1ZOOA 4ZV4A 2PZKA 4XYEA 1P2FA 3DDZX 4IVNA 5A03A 5BSVA 1Z63A 1T9AA 4MWOA 2J3MA 4QAJA 5CD9A 2FKAA 2EJCA 2FFRA 2H29A 5JISA 3CT4A 5TJ9A 3ICOA 4FE3A 3X1MA 4DSTA 3L1VA 4MGHA 3EFBA 1IEQA 4G37A 3DMPA 3JZIA 5AM4A 5EFOA 5FR2A 1AMUA 1DT5A 1IOWA 2IP4A 2GSDA 3HO8A 4M0DA 3OD1A 1L1RA 5HDBB 3RB8A 4EQ6B 5FOQA 1EGHA 4J6EA 4YP7A 4LYGA 1QVRA 4QVKA 3V4LA 3UPUA 2GDJA 3TZCA 4IWXA 4TQGA 2W2TA 5KMGB 2ZBPA 1QIIA 5GGYA 4A8HA 3EF1A 1Z06A 4I36A 2HC9A 1LDMA 4OAPA 4FQ7A 4JYAB 1D6JA 1DBQA 3WJAA 4OSOA 5JZOA 3A1SA 2XXAB 7MHTA 3I32A 3H9BA 2VWQA 4IG9A 1Y1RA 4K9NA 3CRMA 1AGPA 3EN0A 3KPVA 2JBWA 3KQVA 3EA4A 1I1NA 3SE7A 2NYVA 4GR9A 2IV2X 2WHQA 5EE1A 1OZHA 3I8XA 3LFHA 3QEJA 5ES3A 3OLVA 2YHAA 1E8MA 4H1TA 1VE6A 2AXNA 2P78A 2ZVJA 5C0OE 5JO0A 2GNPA 1M6HA 2GNOA 1QO0D 4N5NA 2VQ3A 2UUAB 4IUYA 1TX4B 2GZ2A 1GNQA 2QRKA 3IQFA 2HA3A 1KAEA 1DCTA 1A8IA 2CNBA 3RODA 3TZQA 3QKSA 3MJEA 1RQ7A 3KKOA 3MGAA 2CV0A 5F33A 4OXNA 3L8GA 4C4SA 2VTBA 3GFSA 2F00A 1E77A 3KJXA 4IGAA 2JEOA 2V7TA 4RDCA 4MK4A 1AXRA 1I9GA 2HXGA 2GZSA 2JZCA 2XMPA 2OZKA 1L1EA 1HEYA 4LYJA 5DFAA 4XQCA 1SU6A 1Z5NA 2G7MC 3SWWA 1ZM7A 4XWYA 1W46A 4A6EA 3OC6A 1Z0IA 4V3BA 4YP6A 3FOZA 1G2OA 2Y0CA 4YDSA 1SAYA 2GF0A 2J7PA 2PMDA 3FD8A 4PIVA 5TX7A 1SXGA 3WSTA 4QO7A 4YA6A 5ALIA 1OGIA 1A0OA 2W6PA 1U3WA 4CKCB 2MMGA 3JU3A 4HZUB 3PWKA 2NXNA 3NDIA 3TOCA 3T1QA 2QUZA 3C8UA 4HZUA 1NVVR 3CUSA 4C1NA 5LU8A 1P80A 3RFTA 2W2KA 2W83A 5AJTA 3GZNA 3KPWA 4BP9A 4DVJA 2JAUA 4ZREA 1C3XA 3DB2A 3PA6A 4RVHA 3HXKA 1H2YA 1NW9B 4NZOA 3QHPA 4LNUA 4W7IA 5ESXA 3GRAA 4BKOA 2G40A 4HR7A 3ZZ0A 5EY5B 5LYJB 5FPYA 3AJEA 1FFSA 5FQNA 3HKDA 3WYEA 4MIOA 5BYKA 3QKTA 4ACBA 4R2KA 1ZOSA 1ZM4A 1BRTA 1BVRA 3MZ0A 1B0AA 4Y9RA 3CLUC 2R6HA 3HCCA 5HKKD 1GU1A 1OYOA 1M67A 4YJFB 1WPRA 3MMZA 1P0CA 1YQEA 4P33A 5EXEA 2XOKA 5AJZA 5ALFA 2PSDA 2Z8YA 2D5LA 3AFIA 2AV6A 3EZFA 3KBBA 1VG0B 3MD0A 1IATA 4JGBA 4DDHA 2X4LA 2C7VA 4YFYA 2WWWA 1OAAA 1YDHA 1TEHA 2KBEA 3CQ9A 4KE8A 4OXKA 4QPJC 4C6TB 2I22A 3A6HA 2DFDA 3HUTA 1E9RA 3NGMA 3U3DA 2Z5LA 4ZYXA 1ZP6A 3EDYA 2PSJA 3H5OA 2R8YA 1J0XO 3R0XA 1UPFA 1JNYA 1EFVB 1E7YA 3GVCA 3MTJA 3ROZA 3BSYA 1H85A 1JKXA 1Q0QA 3DD5A 3O84A 1N9GB 4HMOA 1O97C 4ZAGA 5FUYA 4YRNA 1YK1A 1Y8CA 4AYWA 4Z7JA 5JZSA 2Y2VA 1RACA 3KKKA 4M1TA 3RKSA 3KZNA 4CL8A 1GFZA 5F3DA 1UWCA 2O7RA 1ZOPA 2YXPX 3VDRA 3EZNA 3BXEA 4G41A 4WTOA 4XZ3A 2CXXA 3I52A 1V1RB 3U9LA 1R4MB 4B4VA 2VP9A 4FNOA 3TJZA 3PICA 4N40A 4N01A 2W2QA 2IBMA 4QUKA 4EECA 3FJOA 4NFHA 4HO1X 1H2ZA 2WG1A 3INGA 1A4IA 1S5PA 3K9WA 4QGFA 3GFBA 4UATA 2AFRA 4F4DA 1E4OA 3HI4A 5BV8A 1HT1E 3FA2A 1PWHA 3BTVA 5L8VA 1JFFA 3C3YA 3SZOA 5KREA 3MWYW 3O2JA 3PQ4A 3QEMA 1RBYA 4M9SA 3URKA 4OIMA 1C81A 5H80A 1QO9A 4ALIA 1V8ZA 3KUUA 2WSBA 3IP3A 3BCHA 4CM5A 3WK9A 1DQSA 2FMTA 3F3KA 3P52A 3G2HA 4PR0A 4WJZA 2J9RA 5EEGA 1CJMA 1FFEA 4KIUA 1KK3A 5M34A 3KQHA 1JHMA 3N76A 1C9MA 3DBIA 2VK4A 4C7MA 2VIIA 1LPOA 2G9RA 3PNKA 1ZH4A 3TL6A 5LLDA 2YW9A 3R5JA 1UDCA 3FDFA 4CQLB 1SULA 3BUSA 1C3LA 2UYQA 4PLWA 3TL2A 4XX0B 4A82A 1M7GA 4BYGA 4JVOA 2CZQA 4EZEA 3GN1A 1FYFA 1Y6QA 2VATA 5ISMA 2PUFA 4RVOA 2JFBA 4Y1FA 1FMJA 1PDVA 1JQ3A 2PBFA 4YRQA 4R71A 2PRIA 2FWMX 4CEIA 2JIDA 3I01A 4BLSA 3H2HA 3SD7A 5LB2A 1YOVA 4YRTA 1DC8A 1Q1GA 5TEWA 3SQWA 1Z82A 3VAYA 1ZH6A 4JEIA 4B17A 4E2YA 2BSQA 2FLVA 1SVUA 4FSXA 5ERYA 5BN3A 1XZNA 3B36A 2H17A 2YHSA 4WZZA 2FRVA 4EYOA 1BXGA 4D4HA 2A9RA 5HIIA 5H3HA 4EMSA 3ZX5A 1TO1E 1YRQA 1RRGA 3NDRA 1QDLB 4HPXB 4MX8A 4G0OA 3GPIA 4PLPA 1GTJ1 2Q4RA 5C4GB 1DMSA 5KQGA 2IX9A 3R76A 4ZOCA 3O0TA 4TZ6A 5K3BA 4GDFA 5JFTA 2CBGA 3ZK9A 4FC6A 3LCRA 3FRHA 5KJFA 5BV2P 4OHMA 3IAAA 5BOSB 2ZJFA 5CGZA 1Z34A 1N5KA 3H5TA 2D0IA 3SFTA 5EXDA 4OQXA 1VKRA 1PR4A 1IEWA 1T2FA 2RB4A 5KEIA 4MI1A 4S1WA 4PNEA 3SYRA 5ESRA 2ZRBA 3TOZA 4AO8A 4L4ZA 1F48A 1DCFA 3R5XA 2Y0EA 4OYHA 2Z30A 2Q2VA 3AHGA 3N0WA 1A96A 3NBMA 1T0BA 4QG3A 1CJKC 2ZI6A 1T5SA 1UR5A 1UKZA 4AJPA 4MA0A 1YB4A 4CETA 2P5TB 2GCGA 1DWPA 3QY9A 4GO1A 2IYVA 4JFRA 1VFNA 2XVXA 2VRCD 4RZ3A 3RFFA 4ZT4A 2OORC 3GCDA 3EGDA 4C3ZA 2OCKA 3IVMA 2XUIA 5BUZA 3TIVA 5A9SA 2ZQZA 4PYOA 1V0JA 1CRWG 1SBIA 4P54A 1E3IA 1F51E 4Q9LA 4Y30A 2FTKE 4Q3OA 2VPXA 4I1UA 2X14A 3SC2A 1O9HA 1HTTA 4IIJB 4RFSA 3SSNA 2IYZA 3QWHA 4PZYA 5LA6F 1ECJA 4M8KA 2ZZNA 3EEOA 1NQAO 3U17A 4TTQA 5KZMB 4JY7A 1CJCA 1EA5A 3T1NA 3T7SA 2PLAA 1WM1A 4FD3A 2RBKA 4CXMA 5I51A 2GA8A 1L7RA 2CLHB 2DE0X 4Y6QA 4WEOA 2JCBA 1WWKA 5EC8A 1EUDB 3ZU3A 3QPVA 4IHQA 1B8NA 5TMEA 5E6SA 4AECA 1T2VA 1G8AA 4NZPA 2PJDA 5B4VA 5JSFA 5K4AA 3LTNC 3CZCA 1AK9A 1KZ4A 2WF8A 1NP3A 2XGGA 3CTPA 4MRVA 4BL5A 5I8PA 4KQ1A 3N2LA 3ZDXB 5D3KA 2OL4A 2XE7A 4PHGA 4AZTA 4P4UA 1NI3A 4RAOA 2FUCA 1EWVA 3HWSA 3D54D 4EYKA 1EBBA 4KH0A 5DE3A 2WSIA 1K3FA 4RHCA 3FGPA 3I01M 2HLPA 1T43A 4XFJA 2G1PA 4KIWA 4CGYA 1EK2A 1T6ZA 1Z33A 4JUAA 5DN6A 3OP4A 3SJAA 4CMEA 2CYAA 2AMFA 4BDTA 1J7KA 1S2NA 4EY7A 1SC6A 3EIHA 1QHSA 2KMLA 2QPTA 3L6EA 3SHVA 2ZRAA 3L41A 3JAKA 1VBNA 3CVVA 1WHTA 1XP5A 2DG2A 4EI7A 4M0FA 1BHJA 2L69A 2YNMA 5IFKA 2RHDA 3FLEA 3R3HA 2AJTA 4FR2A 3LDFA 2MSDB 3HSYA 5GJBA 4U7GA 5K8CA 1WPQA 1Z4PX 1DXYA 1T9HA 4P32A 1KI6B 3GJXC 1O0CA 5CJ2A 3EWIA 2GVNA 4WLOA 3EULA 4ZC1A 1IM5A 4B40A 1PQWA 1RM5A 4DLYA 1H2EA 1RE1A 1P1BA 1UDRA 2WFLA 3KOWA 4GUAA 1DDIA 2YHIB 5CT9A 2RGAA 5K1ZA 4Y2JA 3M6MD 4KBYA 4PM4A 4PG8A 1KEWA 5EPEA 1MJGA 3DA8A 3B6ZA 3K6SA 4PCVA 3U6BA 1J23A 4D4GA 4AY2A 3OQBA 1N0WA 3OAAD 1HZZC 4ZAZA 3HPRA 1OBOA 2VHWA 2H00A 4RKRA 4GXRA 3EARA 4NV1A 3VJMA 4I08A 3WS7A 3NHYA 4RVGA 2AW3A 3DOCA 1WHSA 1G55A 3FPKA 3V8VA 1XCLA 3H6HA 2XCSB 3TX6A 1NATA 4MWTA 3LT5A 2P9ZA 1ZJJA 5B1HA 1Z36A 2PR2A 3EY9A 4HDNB 2N46A 4KAXA 4RK5A 3RVJA 1GPH1 4IINA 3RV3A 4M53A 3ZU5A 3ZGXA 2AR7A 4IH9A 4P1ZA 3KK0A 5EVCA 1S3FA 4TZ0A 3AVWA 2AN3A 5IT9A 1J97A 1Z2CA 1PL7A 1YDMA 1IBKB 1HT3A 3FBWA 4WFIA 5TPWA 4MVJD 3OZAA 4KG7A 3ACBA 1JDTA 3R7WA 5FULA 3K53A 1HBJA 2VXBA 3P20A 5F78A 4AKGA 1X7HA 3RS9A 5A3RA 3I23A 4Q3NA 3RG8A 3DE2X 4RMIA 1QIDA 4I3GA 2ZVQX 1SR8A 3BZBA 3ICWA 3QOXA 5G41A 1IBRA 1ZU4A 2C77A 3IKVA 1WCIA 3O4VA 4MMZB 4EATA 5EWLB 3M5WA 1U1GA 5GZ1A 3ASVA 5JYEA 2A9KA 3U7QB 1MFPA 5EKTA 2C83A 4NESA 3WJ7A 1B8VA 2VO1A 1PS8A 3CUWA 3H8WA 2IRWA 4XAQA 2XT9A 1U90A 4KV9A 1UMKA 4HGOA 5KSYA 1GO2A 2YFYA 1ZR4A 3DNMA 5KMGA 1COZA 5LU9A 3CF2A 1LSUA 4XQEA 3RJZA 1CNMA 2I67A 5IJ9A 2FNAA 2Q6VA 5TSDA 3RTAA 3WYCA 2DKOA 4JLNA 3CN7A 5IBRA 1O57A 3OIFA 4I9HA 3B9RA 1TU3A 3NUZA 1HV8A 3WMWA 2JGEA 4TRMA 4NYMR 5HJ2A 1WIWA 1RAAA 3DWGA 2EF0A 4JB8A 4DYVA 2B4RO 3PC8A 2P0EA 4DDTA 1Q0LA 2XCIA 1SHKA 3L7BA 5JQWA 3ASZA 2Z6VA 3BC1A 3Q8MA 1SVMA 2W5UA 4TZTA 3OT1A 1TK9A 3L5OA 5CPFA 1NJGA 3GFFA 3OCJA 3AKEA 3KZ1E 4IEEA 1IPEA 1WZUA 4BNUA 4C4OA 4L4RA 1T1IA 2CW5A 2QU8A 1G17A 2XH8A 3H87A 5HIAA 2YDXA 3WBBA 2JCSA 3JATB 4BVKA 3EK2A 4WZAA 4V0RA 3ZDZB 1EQUA 2V9ZA 1KI4A 3QU2A 2Q5JA 3WGYA 3IEMA 2VOJA 1JI0A 3ROEA 4O4JB 1UQUA 2B30A 2PT6A 5D2CA 3ZDEA 3CEJA 1ADBA 3DXYA 1AQIA 4CLXA 3I5XA 4AKIA 2W48A 3A2KA 3H7AA 1CQZA 3PS9A 4FE4A 4WK6A 5I01A 2NXJA 2V6GA 4AS3A 4QU8A 4UDOA 4E5MA 2DBYA 2XKAA 3M6LA 2OGSA 1WPGA 5I9LA 1OLUB 2A88A 2X4GA 2OCXA 3FVVA 2R6FA 4R16A 2E4XA 1MOQA 2O05A 1F0YA 2ZYUX 1W29A 1A1VA 3U4HA 1NXOA 1PV1A 2C3YA 2AOXA 1DL5A 5HGJA 3LFUA 5KTPA 2EERA 3DWFA 3CF6R 3M3PA 1R4NB 1WOMA 2WBLC 4BNVA 3MLBA 3LQ2A 3WP0A 1CS4C 3BH6A 2PH7A 3LVBA 2MJLA 5JJLA 1JJ7A 4IJVA 4C9BA 6ABPA 1UMCA 2R8OA 5FDFA 5LQNA 1SKUA 5THKA 3ZTWA 4CCWA 2AD1A 2NX2A 4RKFA 4N3AA 1XG5A 3VR4H 1LQTA 2A86A 2FW6A 4BCDA 5JNRA 3EPPA 2WWRA 1NJ1A 1YKGA 2P91A 3A4MA 1THMA 2L2QA 4BEJA 2G8LA 1Z6ZA 4HCJA 5ADUS 1SUAA 1Q0PA 4PHFA 3RC7A 3O3OB 4E7PA 1IWPB 3W9YA 3B1JA 1J2UA 3QX9A 2AC7A 4GQBA 2IEDA 4GMXA 1JIVA 3IB3A 2EJUA 4RBNA 4TYQA 2JEZA 1PO7A 1I3LA 2GN4A 1SBCA 4BX0A 5EMJA 3WOVA 4W5RA 1ITZA 3BMXA 1OFGA 2ZBVA 3CIOA 2PO5A 3CX8A 3WB2A 1PX2A 2DSNA 2O2XA 3V6MA 1G2PA 1XL0A 2D2EA 2HA2A 2MINA 4H7EA 4MRRA 2Y99A 1BIFA 3DYVA 1U6KA 3HCDA 4A2QA 1PS0A 4X1IB 3ODPA 5LP6C 1RAEA 2DR0A 3D8BA 3JVVA 3M8KA 4JENA 4O4IB 5T41A 3P9CA 4E6PA 2WTEA 5IDQA 2PV7A 2CL0X 3SIPA 1AUXA 3K16A 2W90A 2WD9A 4D25A 1A5ZA 1FDVA 1KNXA 2P9YA 1CNEA 2V74B 3WNQA 3SX4A 4BP3A 4CU2A 4TMZA 2Y9PB 1M2KA 1PU2A 5CVUA 5GQSA 2VT7A 3ESRA 1ZD9A 3THWA 1KMIY 2XLBA 3IBCA 1CF9A 3I5UA 5IAJA 3CU5A 3I5YA 1JIQA 5ICEA 4ECEA 5DBIA 1I2CA 3E5HA 3G88A 3G0IA 1ZITA 4F3YA 1L7DA 2O3TA 1PHPA 1VJDA 4DWVA 2EKBA 2OBBA 2FPXA 1NDQA 3V42A 3RJ9A 3IC5A 1XRLA 3LGAA 4FFLA 5H68A 3LPMA 4DCGA 4UNQA 1KZ6A 2BUAA 2H1HA 2PX2A 3K5PA 2XZOA 4U5QA 3IQIX 3CVXA 2CNLA 4M9ZA 3UY4A 3RRMA 1MHPA 1SCKA 3S2SA 3VHLB 5HUHA 5U9CA 2Z09A 1UZMA 1KF0A 1NZDA 3AX6A 3BMOB 9LDBA 3PGVA 4MYCA 4MVJH 5DLYA 2J1LA 3CEPB 2V4MA 4MR8A 3T3DA 4HDNA 1S1MA 1Z4OA 1M72A 4XA8A 4BFCA 3G59A 4TX1A 2JIZD 4CU5A 4OK6A 4MWSA 1U3UA 1ISMA 2W2NA 2NU6A 3FSJX 1HE1C 2FVXA 2R96A 4QJ4A 3TTTA 1PT9A 3THYA 2HHLA 3BFVA 3DZDA 1OASA 4FGLA 4NV3A 4ZO7A 3WDMA 2X0JA 1J21A 1JDVA 1X1QA 3OKFA 3RQIA 4B7ZA 3VR1A 1Y7IA 3C2QA 3P9NA 3ZBUA 3DAYA 2YZMA 2H08A 4WD3A 2P27A 4M9UA 3R7LA 1PSZA 4HLUA 4UC0A 2F55A 2EFJA 1QO0A 1ETHA 1QBKC 1ST2A 1UFQA 4PLFA 1JR3D 3CF4G 4RK0A 4U7WA 1U81A 1YACA 1XL1A 3WBKA 1S2OA 3O73A 3QUBA 3UAZA 4IVRA 3LPCA 1UKVY 3PRJA 1T8YA 3B70A 4R7ZA 2NUPA 5BRNA 1ZGHA 3O91A 1OLOA 3E0QA 1JYEA 2A0XA 2AJCA 1MV5A 1FMTA 5ALMA 1ODJA 2H06A 4DCOA 1RKBA 2W2VA 3H5IA 1UZLA 4ZT3A 4BFTA 1WKCA 3A2LA 16PKA 2JGFA 5HXAA 3K20A 3ZD6A 4Z4HA 3MS7A 2AQKA 2CJYA 3IT1A 4TXHA 5IC6A 4BO2A 3OI7A 1BE6A 1K0UA 4G23A 2W6IA 4XX1A 4GKBA 1KU6A 3KO8A 4Q18A 1R0WA 4D80A 1PG2A 1WCIB 2P3OA 3B9PA 2A5GA 1UBLS 1MIOB 1PF7E 2N9UA 4ID9A 4G9GA 2K7ZA 2VP0A 1WLYA 4JGGA 3RJ5A 4DW8A 4F45A 3PE4A 5HQ3A 2QYTA 3H19A 3SQMA 3PXUA 4S12A 5JFOA 2BTQB 1L4MA 1A5TA 1GNTA 1EZZA 1MO5A 1FA9A 2B4KA 3ENZA 3NANA 2A5JA 3LLCA 4GZLA 4KWHA 4PSUA 3ONFA 2JW5A 4RULA 2BI8A 3V7NA 2WJJA 2PGOA 3GP3A 2YIVX 2ETXA 2BZSA 2GGSA 4IQGA 2OCAA 1U31A 3LVQE 4Z9AA 4LUCA 1QZ3A 1NXPA 4FNGA 4W4TA 3SMQA 4RH3A 1PG0A 4NOJA 4QASA 1JAXA 2PKEA 1H8HA 2COEA 4WXEA 2Y1WA 1Q83A 1T36B 1X9HA 3FNIA 4I4TA 5BWBA 2ODPA 1L9XA 2REQA 3ESBA 4Q9KA 3UWPA 2W6ZA 4COKA 1YUBA 1ZSVA 3F6SA 5AHOA 3CLTC 2JKYA 2IEBA 2Y1XA 5DGCA 4RMNA 1K88A 2F1RA 3LTEA 3OTIA 3K05A 4KX3A 2EFDB 4R0NA 2EX4A 4RELA 2FLKA 4D74A 1L6RA 2ZIZA 3BWYA 3C5EA 4CNQA 1K68A 4TWBA 3ANTA 4EARA 4ZQHA 3GNSA 1UBFA 4IL5A 2D0DA 2NO7A 2QG6A 2YJTD 1N2EA 1SOVA 3FCOA 1C9JA 4XW2A 2AN9A 1RNLA 5ALXA 4C0HA 3BXHA 3OPYA 4OXRA 1AURA 5IKEA 3BF8A 2WB2A 4ZEWA 1K7XB 5LQSA 4F5DA 5BW6B 1M2EA 2VAVA 1COWD 2D00A 2GD0A 3BWMA 3MTQA 4UXIA 4B7UA 2AX4A 3IS3A 4X0EA 5GIOE 3VFDA 3IOBA 4ZEVA 1F8FA 4DCVA 3S4YA 4Q12A 3UJAA 1JE1A 4REOA 4C3OB 3PGA1 2ZT6A 3PPXA 1SUIA 3GVIA 3UJ8A 3V34A 3P0HA 4U8HA 4TSKA 5DBEX 5FYDA 3DAOA 1A7AA 1X9GA 3SYLA 5K3EA 2FPOA 2VYVA 4RCZA 5AW4A 3DEJA 4ZVRA 4NAVA 4LRWA 4HUTA 4Q00A 4MIYA 2Z8XA 3BRSA 4A23A 4YRDA 5CR9A 5DEIA 2HWXA 3KETA 4OL0A 4HDSB 4DR4B 3AR2A 3HVHA 1M6NA 5T5QA 3IAXA 1U0BB 3WICA 3OQIB 2O5EA 3FOBA 1HQDA 4P82A 4BEVA 3ZVNA 1VC2A 3CHYA 4R4JA 1FVHA 5HR5A 4E5DA 2FPUA 5ICCA 5H81A 1NRIA 1VKZA 2FP4A 1F8GA 1X86B 2JEYA 5DM1A 4BKUA 4QZVA 2OCIA 5LP6F 4H59A 1EVYA 1EJ2A 1YI1A 3CV3A 1CS0B 3GGOA 3LO8A 4WN3A 5U4QA 3VOAA 5JNTA 1SUWA 1P9RA 4LMPA 3LLVA 4OH1A 5KKAA 4FFRA 1AUOA 3FVTA 4L9WA 1DEKA 3QIVA 3H1PA 1XLVA 4HEQA 1NQ5A 5FT9A 4WDRA 4GYKA 3RHFA 4Q7MB 3I9LA 3ZTTA 1NGSA 4ZTBA 3NHZA 4ZVMA 1UK6A 3WBFA 1S1CA 4LJ7A 4C6HA 4WKNA 2BHRA 4MKHA 3WI7A 3M6VA 2MYNA 4HQNA 4X8LA 3W3AD 3H2ZA 1F8YA 1NNUA 5BMOA 3B82A 2Q7DA 2XRFA 4J76A 5E0OA 3ROMA 4Y9SA 1DQPA 1VRWA 1H2RS 2QXUA 2DCUA 1M2JA 4I5GA 1UKEA 4OHCA 4MVCA 1QG6A 2AC2A 2QTCA 1HF3A 1IQUA 4GLLA 4FEAA 3IIIA 5EMMA 2QAGA 1ULBA 3KLPX 3FX2A 3WYNA 5AVTA 5M04A 5EN4A 5FWXA 3T15A 2XWSA 3KVRA 3LHSA 4LOHA 5EXTA 2ZE7A 3TW6A 4EVIA 1RFGE 4F60A 3LT4A 8ABPA 2WM3A 2WVHA 1ILEA 1N8NA 1N2ZA 4A0HA 2D74A 2G17A 2GYVA 1YMVA 4ZO4A 2OT3B 2AN5A 2WR8A 2ZZKA 2ZRPA 1CT9A 3KB6A 2F1HA 1B2RA 3SCZA 4YC7A 1E99A 3UN1A 1E2LA 4XQGA 3NOQA 4HX2A 4I5DA 1V1RA 4IZOA 4BX3A 2AB0A 2RBEA 2QAIA 1CFZA 1PL0A 1ZW1A 2WILA 1JIIA 1E8DA 3RS3A 3ADPA 1JECA 2RCNA 2YWHA 3BORA 2BGWA 1YBFA 2YWEA 4M46A 3TZLA 5DN6D 2KLHA 4QGSA 3QELB 1EP2B 4M6WB 3V2HA 1VHJA 3T1HB 1UPAA 4A0GA 3URMA 1JP7A 4KGXA 5D7BA 4ATNA 1U9IA 4KXYA 2PHZA 1ATZA 2P9QA 3WYBA 2VF2A 4MNTA 3MTGA 1D2GA 3L0BA 3OWOA 4I4NA 5DGDA 5A3SA 4FUQA 5CTJA 4BBJA 5KQLA 4A91A 4HRAA 1ZA1A 4N47A 1GN9A 1BKYA 3BJIC 3GGCA 1X94A 4YREA 4KXFB 1UJ5A 4RZ2A 1FNNA 4M1ZA 1NIJA 2JIPA 4FFNA 3VDMA 5KINB 1YS2X 4RZIA 1U1IA 2QB5A 4KR0A 5K6TA 1LWOA 1H5QA 3IT2A 3W3AA 3CKMA 3I2YX 2WVAA 3D2LA 4GOND 1QS0A 3MK31 4P38A 4U7JA 4WOPA 1L5YA 4C7VA 5JXIA 3FNEA 1TIBA 4IO0A 2C03A 1GFIA 5C7LO 3FTPA 3ZWQA 4DF3A 1H23A 1Y8RB 2JB9A 2OYSA 4HVCA 2AZXA 4KAAA 1H2HA 1YVUA 3SHWA 3I9JA 1USGA 2IYFA 4F4FA 1K86A 4UVEA 1GEEA 1G4UR 2VSFA 4LFAB 2R6CA 5ITZB 2F8TA 2A5DA 4UVIA 1T1JA 5L3SA 5BQ3A 3ESDA 4IH4A 1DT3A 3B85A 3F46A 3BWBA 2QNRA 1SQFA 4DEYA 2CGEA 4X7PA 2Y4OA 1RTTA 4JXKA 3CZPA 5FJJA 1O6ZA 4BNDA 4MEJA 4DR3B 4WAUA 3OPYB 4XJTA 3ZGYA 3FOCA 1E2PA 1V47A 4N7RA 4NJEA 3SNHA 2NV6A 4ZO8A 4Y6LA 3SOZA 3EQZA 2V6JA 1ULSA 2C0PA 4LBWA 5CUQA 2PFKA 3QI2A 3WA6A 4OQYA 4EK9A 5IFLA 3RF7A 2J9ZB 3BJZA 4IICA 3EC1A 3L7NA 4G4GA 4B35A 1K06A 1Y7PA 5AHKA 3HBLA 3C3EA 3PT9A 1YQ9A 1L4EA 4V0KA 1AB6A 1Z9BA 4DR7B 1A1SA 5D3MA 4JC0A 5CH8A 3OHMA 1EI9A 4Q9HA 4UAJA 1D5CA 1UM8A 1OLUA 1MX1A 3WJ2A 1HO3A 4HVTA 1YBAA 3RE1A 3N3BC 1FNCA 3QGMA 3VGJA 5JECA 1P2VA 3FZQA 3ILVA 1CRZA 3EEYA 1G1MA 1A04A 2AG5A 4LE2A 3S44A 1N2JA 1YL6A 4MQBA 3H6GA 4LBYA 4IIJF 4Q66C 2FDCA 2ZIUB 4A10A 1T0HB 1RD4A 4Y1GA 1JDZA 5KB3A 2NM0A 1J8FA 1U0SY 3JYPA 4BLTA 2PT7A 1Q20A 1SIUA 3IEUA 3PFIA 3GFPA 4MUJA 2IDMA 4WESA 3TXAA 4L5CA 2YZNA 1GL3A 4DUGA 5F12A 1FXWF 1CRLA 3GFGA 3TMKA 3LWBA 4YRPA 3TE6A 2XB4A 4UHHA 1I3MA 3F6EX 1XCPA 2WWFA 2VJMA 3E22A 3PXEA 3HKDB 4PGMA 3F4BA 4GU5A 4Y6PA 1P1JA 3RSOA 3CUKA 4AMYA 3BD9A 4DIDA 1YCGA 1R4ZA 4KYIB 2YN2A 1E6KA 4PRYA 2N1MA 3HEAA 3O94A 4MLCA 2Q4EA 3EIXA 4C08A 1J90A 5BSEA 1WXIA 2QT1A 2P4HX 2JKVA 4M99A 1E5VA 2JJMA 1VECA 1GZSA 2D62A 3ZJ5A 2ZI5A 4BRZA 5F21A 2PX8A 1TKBA 4WA8A 1D4FA 1AS2A 1EZ1A 1Y4ZA 1JE0A 5CVJA 2J6HA 3A1VA 1C9NA 4LVUA 5CFRA 4ZVUA 5FEUA 4C4AA 3QEOA 1D0VA 4Q4JA 1ANKA 1EFKA 2WTMA 5ILOA 4ZU6X 1NUTA 4GI3A 4MHOA 2X23A 3M7IA 3O1LA 4RD2A 3VZSA 1XNRB 4UD2A 1MH1A 1MX9A 1OX5A 4MAMA 3WADA 1KMMA 3D8SA 4RIFA 2JIQA 1TJ5A 4J90A 3KS9A 2HI0A 2ZJ0A 3LS2A 2OKGA 4QGBA 3EZXA 3G0GA 2FFAA 4YAGA 2ZB7A 3ZWXA 1U4NA 5J1TB 5LR6A 4ZV9A 4MWCA 1GKLA 2OM6A 5HM6A 4LXGA 3FRIA 1E5TA 1N6PA 2YRFA 1Z12A 3GUHA 4BP1A 4EENA 3GU3A 4F6LA 1BWQA 2J85A 3CLSC 5F7ZA 1RHQA 1L5RA 2HF2A 1GZHB 1GPYA 2E37A 2ZAMA 4HWSA 3COSA 2V7XA 4GYYA 5DYTA 2ZSEA 5JVDA 4FEGA 1EEXB 3CZ4A 4EB8A 2HT1A 3RUCA 2BEVB 3WHLA 3N2GB 3FYUB 3O7MA 3QX8A 4U3JB 3RIXA 1CQJA 3LNTA 1WDLA 4LECA 1BD4A 1CDEA 4RIGA 3R7BA 2X9QA 5FI0B 5TF4A 1JIJA 1VHQA 3UZUA 1Z7YA 3QVGB 4RIHA 4WY8A 1XCBA 3N7AA 3OEWA 1O8CA 2WU8A 3OE5A 1RRPA 2ZRDA 1X70A 4NK4A 1QG4A 4TTAA 4DUGD 4J2OA 2OECA 2M6LA 1ZI9A 1PLLA 3ZIUA 1IRXA 3D4BA 2XNSA 3CNNA 1M8JA 2HMTA 2JD0A 4EA6A 4URXR 1JB1A 1V1JA 2PZMA 3TPFA 1LUAA 1TM2A 2Q0SA 3TW8B 1Z2NX 4X90A 2WJYA 2I6QA 4XCVA 2CVOA 3L2OB 4B3FX 1P1HA 3QX3A 1C9DB 3ZX4A 1VSQA 5T4HA 1CUSA 1Z0KA 2GEUA 1UJNA 1UP7A 2BUBA 2IZ7A 3CMCO 3MC1A 3QNMA 1FFGA 4EFNA 2ZLBA 3ILYA 3L4JA 5KHAA 1TVEA 2GPJA 2P77A 3KTFA 4J0IA 2OA0A 4QHTA 2NQ8A 1LQUA 4E32A 2JI6A 3B3AA 5C8ZA 1V3TA 2DULA 3WFIA 5CYGA 1I4WA 2WJ3A 5FNVB 1XZPA 3VYSB 2R11A 4JYCA 1BRMA 4D4KA 2EFHB 1K5PA 1P1RA 4EY5A 1JG1A 2PWAA 1KO8A 3VKVA 1CR0A 4J3FA 5HBGA 2GETA 2AEMA 4G1MB 2XIJA 3BKWA 1X80B 4D9NA 2H48A 3V4ZA 2X1LA 1TVKB 3CZ9A 3V5NA 5LOVB 5SYNA 2I54A 2I76A 3USES 4BNIA 1CUWA 1OD6A 3LT0A 1CUBA 1CUCA 2QD3A 4PY2A 1E9VA 3I5AA 3O3MB 1S3SA 5EWJA 2C59A 2GPAA 2RGXA 1K6EA 1OA0A 4AF8A 4C4RA 3G1UA 4LAFA 2XVMA 2I8LA 5FADA 2VZ8A 2F3TA 2P5UA 3LF2A 1R6AA 5EP4A 5BR8B 1A2QA 1BE8A 1BHQ1 2PD3A 1JFVA 4JLBA 1JA1A 3TVYA 1AQUA 3RSQA 4PR3A 4BQNA 2P7IA 1GG5A 4JP1A 1Q95A 3NHJA 2DETA 3NVMB 1EX1A 2IYNA 2JH8A 3BB4A 1NAIA 5ALWA 4OF4A 1FMFA 1DTEA 2WHRA 1HE5A 6Q21A 1NXVA 3UMVA 1XCOA 2ATEA 1ZWKA 3PKIA 1KJ8A 2ZETA 2Q5LA 4GKVA 3G2NA 2PE5A 2A1UA 3SQXA 1E64A 3NTXA 3QYAA 1I4LD 1G7RA 1XPUA 1LKZA 4K9LA 3G7SA 4FCCA 3GLFA 1N78A 2O8EA 3RHTA 3WL8A 3EDCA 2QLFA 2R8PA 3T4EA 2E0IA 5J4YA 3VTAA 1AKQA 4B3XA 1KKMA 2AG1A 4IDHA 1E3TA 3QMWA 1AGRA 4ETIA 2LIPA 5EXPA 1T36A 3EW7A 2A9QA 3QXJA 3N39C 4ZJPA 4AG3A 5I7HA 2O3RA 2UXBB 1HDOA 1V5GA 4EKYA 3E7WA 2V55B 4TMFA 1WB4A 1XZFA 2DX7A 1SOMA 1U7DA 3ZQ6A 1U2SA 3R9XA 5C51B 3BJRA 2JA2A 2WQZA 3IUBA 2EEZA 3ZDDA 3QLTA 5FR1A 3JAKB 4EI9A 4Q47A 5AHXA 4QOEA 3S70A 2Q5QA 4DYDA 1QYIA 1V5FA 4GSYA 3DOJA 4WOJA 4IDFA 3RK4A 3PFKA 5EZYB 4EVQA 2IGBA 3A7DA 1MIOA 2RDMA 1OXVA 3W1EA 4RFVA 2X7XA 1EG2A 3IO3A 1L5VA 3CWZA 2AHOA 3PUHA 3KJIA 1U4OA 3V8QA 2PAFA 3M0EA 4L8VA 4M1YA 5EZQA 3ZWVA 4UFNA 3SK0A 1N6NA 1PT5A 4JNKA 3SS8A 4DY4A 1JLRA 1TGYA 4JB0A 1GA4A 3NP7A 4DUZB 3C3MA 4JITA 4K6OA 4N6OA 2RJ3A 3RRXA 4BNMA 4B0PA 4EJSC 2B83A 1N2CA 5DRTA 1U1FA 2JCXA 1DUVG 1HT2E 1I7NA 2RAPA 2R9VA 3KUKA 3OE4A 3OE7A 3F90A 4PYKA 3W6PA 4PAWA 3ZD7A 2ZFUA 3JQBA 5M2QA 1F0PA 3DMRA 2PXAA 4J16A 4ZDIA 3ZDAA 3KLNA 1TZCA 3BCRA 1C0LA 4NRDA 1WTAA 4CF6A 1SRQA 5LCXA 2ZCUA 3D6UA 3N6RA 2POCA 2A6PA 4ID3A 1SKMA 2HA0A 2J3EA 2FFBA 2QX8A 3HEBA 1FQWA 2FF5A 4OJKA 4WUVA 3IV7A 2ZYTX 1NA5A 3H9QA 2OXIA 4ZU3A 4MKRA 1RYHA 3DCIA 3DT9A 1H6AA 2QL7A 4W7HA 3HO1A 2J9GA 3EOZA 5LXTB 2VVTA 4RTMA 2VDWB 3KM0A 1G0NA 1LLQA 2NZ8A 4IW3B 5H3CA 4UOQA 1IBCA 1ZM3A 1UC9A 4FSDA 3DWIA 4DR6B 2WUGA 4ZGWA 2CLFB 3D6NB 3AU8A 3PNQA 4KH1A 4G8CA 1AIPA 3OU7A 4OAQA 5AVSA 3MJRA 2H2DA 2QIOA 4K03A 2HBQA 4V2UA 3UYKA 3PKZA 2ZTUA 1U65A 4KDRA 4MS1B 5TQVA 5FV4A 5LZ8A 1KAQA 3ETDA 5JPCA 5IYZF 3KYIB 1JQKA 3JALB 3I9V6 2I8AA 3JYHA 1XC7A 1ECGA 5U4XA 2Q3HA 4LXHA 3IP7A 2FN7A 2RONA 1ENYA 1XTRA