1XVLA

The three-dimensional structure of mntc from synechocystis 6803
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
279
Chain Sequence
GETEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKDVPSVVLTEGIEPIPIADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQVPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARFGGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGLLAGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The MntC crystal structure suggests that import of Mn2+ in cyanobacteria is redox controlled.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal transport
molecule keywords Mn transporter
total genus 83
structure length 279
sequence length 279
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1xvlA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1xvlA02
3ZK9A 1G20B 2MINB 2OV3A 4N01A 5BVHB 1QH1A 1G21B 4ND8B 5CR9A 4G09A 2PRSA 3MFQA 4FKMA 4B8YA 1G21A 1N4AA 3K1AB 1M1YB 3MINA 2ETVA 2PS0A 1L5HA 5BVGA 3LI2A 3HJTA 4INOA 5KOHA 2O1EA 3ZKAA 5KOHB 5M2QA 4XPIA 3AESA 4MLZA 3AETB 3PSHA 4FI3F 1M1NB 5M29A 3PDIB 4MO9A 1PQ4A 4IRMA 4UDOA 5BVHA 2XQVA 4FILA 1K0FA 2XDQA 3R5TA 1KAEA 1QGUA 4TKUB 3AERA 1N4DA 4WNAB 1MIOB 3MWFA 2Q8PA 2M6LA 1N2CA 5JJ5A 3U7QA 3MD9A 5AFSA 2QI9F 3HXPA 3AEUA 4UDNA 1QH1B 3PDIA 4ND8A 2X4LA 3AEQA 4UTPA 5KOJA 1KARA 2AFIB 2PS9A 3AESB 1G20A 1QH8A 2MINA 2WHYA 4WN9B 1FP4A 5HX7A 3TEFA 4HMPA 4TKVA 4OXQA 1K7SN 1TOAA 2XDQB 2YNMD 4HMQA 2XV1A 3TLKA 4NNOA 2OSVA 4LS3A 3UJPA 4H59A 5HDQA 2XH8A 3MWGA 4WZAA 4OVKA 2XY4A 3LHSA 4INPA 4GICA 3GI1A 3AERB 2AFIA 4BBPA 5KHLB 4UTOA 4WZBB 2R79A 3AEUB 4H0FA 5JG7A 5JOQA 4FNAA 4HMOA 5I4KA 1K75A 1PSZA 1N2CB 5JPDA 3AEKA 5GGXA 4MX8A 1FP4B 2AFHA 4DBLE 4LJSA 4TKUA 3G9QA 1M1YA 3MINB 5CX1B 3EIWA 1KAHA 5GGYA 3U7QB 4NNPA 4M7OA 1N2ZA 4K3VA 2OV1A 4TKVB 3BE6A 5B58T 4XPIB 4WNAA 2AFHB 1QH8B 1QGUB 4PM4A 1M34A 3AEKB 3AEQB 3R5SA 3PSAA 3TNYA 3ZTTA 1ESZA 2XUZA 1EFDN 5FLYA 3HH8A 2YNMC 3EIXA 4OXRA 2R7AA 4WZBA 5CX1A 4MDYA 1XVLA 1M34B 3CX3A 3ZK7A 2RG7A 2PS3A 3ZK8A 4WN9A 3BE5A 2PHZA 5KOJB 1L5HB 5BVGB 4G07A 4WZAB 4PAGA 3K1AA 3NU1A 4WESB 2Q8QA 2M6KA 2WI8A 4CL2A 4WESA 4HN9A 1K2VN 1M1NA 3AETA 1MIOA 5M3BA 5M34A 2OGWA 1H1LB 1H1LA
chains in the Genus database with same CATH superfamily
2JCGA 3L7DA 3WK8A 4R1LA 3QLVC 3OF2A 5C1IA 4C0LA 2I7DA 4FVTA 2HYIC 2GFIA 2MOKA 1ELOA 5A7FA 2I2FA 5AUNB 3SMQA 5CBPA 4ZO7A 1QIJA 3AF1A 3KETA 3OMXA 1QHIA 4PQGA 3LT1A 4X44A 4XB2A 1SBCA 2GRAA 4WJLA 4LDNA 2ERYA 1E3TA 4DC9A 1RVV1 2ID9A 3AFGA 4YC7A 4B33A 1HXHA 1LQUA 2E5FA 2HPAA 2Z04A 2PK3A 1ENYA 1XJQA 1MB2A 1TVKB 4JITA 1SUEA 1PJRA 2XQVA 4HAYA 4EZBA 3LK6A 1H4SA 3SM9A 1GPLA 1KDYA 1E9CA 1IB6A 1DBRA 2I4NA 3S44A 2C3OA 1LPMA 4ZO8A 2APJA 2RHCA 2IYZA 4LTMA 1JYSA 4XOUA 1ZAYA 6PFKA 2B1QA 1T8UA 3BGVA 4XIYA 1NMXA 3V9PA 4X00A 4L22A 1KEKA 4JI7B 2O2CA 3A4TA 3JATB 5I8ZA 1UAAA 3DLBA 1PK8A 1VG9B 1KARA 3E9NA 3P19A 3Q72A 3SIRA 3U3JA 2FPWA 1UDXA 1W0KA 2JGLA 1CNEA 4CM6A 1Y1SA 4WUTA 3TFQA 1TOAA 4HNSA 1TKRA 3JQ7A 5IASA 6YASA 2AQHA 1UXKA 5K3SA 4IMPA 2YIJA 4MCAA 1KRXA 3FFAA 4DWOA 3I4CA 1OI3A 3Q7QA 2AWNA 1V96A 2XOEA 5B36A 5BSWA 4JENA 4MI1A 1NXQA 2O1XA 3LUAA 4TGLA 3KV1A 4AL4A 4U00A 3KRTA 2I6SA 4GF5A 3CR3C 5K4HA 5ILOA 4ER7A 4YRMA 3FGOA 4XIJA 4S1TA 1ACLA 2DLNA 4DSNA 2IOHA 2RDMA 1U2TA 4KQEA 4QRIA 1MO2A 2OSBA 3AP2A 1U94A 2Y76A 4J0CA 3RSHA 1UM8A 2XPCA 1MO5A 1DHTA 2ONKA 3D3WB 2ZDHA 3OPYI 2X76A 3C43A 1QG2A 3W5IA 2J9YB 4E5VA 3JWPA 1ZD1A 3TTVA 4QFBA 4BX0A 1R6DA 2HJ9A 5GONA 5A2GA 1DJOA 2D54A 3NXSA 3A1DA 4GLLA 2PJZA 3LKZA 4HAVA 2BE9A 4U7HA 2WWYA 1VE1A 5TMDA 4N3AA 5EVCA 1V8PA 5K3DA 4F3TA 1K8XB 2Z6UA 4RKYA 2V3VA 2OKGA 2FEWB 3O1JC 4EHDA 4DLPA 4BO3A 3TLGA 4FB5A 3IDFA 5LSAA 2UYHA 2O3RA 1JKMA 4MK4A 3FOEC 4MUXA 1GUAA 3Q2IA 2R4UA 4NZ9A 1CF2O 2ZYUX 1WMFA 1QP4A 2F1JA 3HACA 4M36A 3R2JA 3LX5A 2MMGA 2ZSHA 4O33A 2JC3A 4PAMA 3F2IA 3LZDA 4N8SA 4PC3A 1GLGA 2QD3A 3HKDB 3I4LA 3V7YA 3W9BA 4AKTA 1DG3A 2D8AA 3N2KA 4F1WA 3U7GA 1FDUA 3FPJA 3PGJA 1Y8AA 4AO6A 1RVDA 4DW8A 4P92A 4Z4FA 4O5OA 2ZAMA 1R6TA 1X9GA 4Z9YA 1ADYA 2WHQA 4MRRA 4Q9AA 4HC4A 3VYTB 3IPCA 3N39C 4C4ZA 4LAFA 3V1TC 4BX3A 4IDFA 5J2UF 1TYAE 2LRHA 2AK2A 3AHDA 1PD1A 1HFEL 3G7UA 1T5SA 1PL8A 3EISA 3WQBA 2VF5X 4KXLA 4YCJA 4BN5A 1TTTA 3KTDA 1I33A 3SZMA 3OX4A 5HM6A 2OLKA 1WHSB 4XVHA 3VDRA 4LYFA 2GOYA 3GCXA 3K94A 1V4VA 1YONA 2FRXA 4YUZA 5LQJA 5ELLA 1UMDA 3QYPA 3TR5A 5AW0A 1QDEA 3RFCA 4ZVPA 1JIJA 4AG3A 1LDBA 2F8MA 1JNXX 3F47A 2OC4A 1YC5A 1N9KA 3PHGA 3K0FA 1YBAA 2XUKA 1U3GA 4LCBA 3GWZA 2B34A 1KSGA 1HT1E 5REQB 5KOJA 4EYSA 4AMZA 2JLZA 4M2LA 2CHGA 3OT1A 2PKXA 4H27A 4ZVKA 2BEKA 3R77A 5ES3A 1AK2A 1VKOA 1RKUA 3AJAA 4RVSA 2UZ3A 1NXSA 2GZ2A 3ZE6A 2OZLB 2GGSA 1JH9A 5E1MA 1IJFA 4YCLA 4HB0A 4NL4H 4DA6A 1JQ5A 1V71A 3IIKA 4Z9FA 4GICA 2EZTA 5GONF 3W5HA 2Q0QA 1RWNA 4IF4A 1BX3A 1X6VA 4PX3A 2VDLB 2QP3A 1HE1C 3BWCA 3MMZA 4U9HS 3RO7A 4UOZA 1Y1PA 1GFSA 4JJZA 4YMIA 5CDSA 3TLGB 4GMGA 2H48A 2Z98A 1B2RA 4XLTA 3SHVA 5DULA 3S2UA 4AM8A 3FCOA 1YB6A 2VZ8A 1YZ3A 3L4EA 2EU8A 3NPAA 4Y1GA 1LZKA 2FRDA 1GCAA 4H6VA 3VPAA 3L01A 2V1XA 2VYVA 3LS2A 3QPCA 4YRQA 3SG0A 5IFKA 1L5GB 4LRWA 5EMNA 2HU5A 3LDUA 3GLQA 2FP4A 2QLNA 5LYJA 5JIBA 3H18A 3PNKA 4LHSA 1L0BA 3EIWA 3PFFA 1ZK3A 2Q1UA 2Q1XA 1X7ZA 3LP5A 3WGLA 3B1FA 5I6DA 1NOKA 3IOYA 1AKEA 1LS6A 1BCSA 2LZ0A 3O3NB 4EYKA 2YDXA 3PX7A 1UEXC 3TJRA 4D4LA 5BYBA 2GPYA 3FE2A 2OD7A 5ITVA 1DAPA 1W96A 2Y1EA 3KXPA 2AOXA 3PF8A 3SQNA 4WMLA 2DQKA 3DW1X 3MWLA 4X6XA 5CP8A 4BJ3A 2B4QA 4TUYF 5CM9C 2CF5A 4J0IA 4TKLA 3ZOZA 1XAHA 2ZJ1A 1OH6A 4BCDA 3C5WP 3N8GA 5FR2A 4KREA 4V0NA 2Y93A 3KALA 4DQDA 3WWEA 4DADA 3KD2A 4R3UC 1TFUA 5LD2B 1TTHA 4LBVA 3AQIA 3DJFA 3EZLA 1QOZA 1XF1A 2FSHA 3O82A 4YI3A 4C05A 4FYWA 3QG5A 3UV3A 2XCSB 2ZZNA 1G3UA 2A35A 2P9TA 1JRLA 1Q92A 4PX2A 1CPYA 1T35A 1DCFA 1G55A 2XGMA 3JATA 3WNVA 1YZKA 1AKRA 1FYXA 1ZN8A 5LUAA 5EIWA 2GBLC 1P91A 2VT7A 2J0UB 5KU7A 1GPH1 2CBXA 3IEKA 4HLDA 3KFXA 3GH1A 5HQ3B 4O3FA 4OYLA 4RNDB 2WABA 3SLKA 5CJPA 3AOEA 3IXQA 3WADA 4W99A 4E88A 4OJMX 4LMBA 1NG9A 3RVKA 3OCVA 4L0CA 4QHSA 3U2QA 5B6JA 2QDKA 3C74A 3OQVA 5JZOA 5DCYA 4QNNA 1PEKE 5D5HA 5E3IA 4CFSA 3RARA 3F5DA 4J3JA 2GO1A 4NABA 3M4NA 2HTEA 4DM4A 3NVKI 1K6JA 2M2IA 4MARA 1W9HA 1EFPA 3DO5A 3OIFA 4JBWA 4QIHA 2ZG6A 2OP0A 4C6SA 4LISA 4GKAA 2ESRA 1G9XA 4OI4A 4CU2A 3KPUA 1F4PA 4MUHA 5CBPB 1Y1LA 3EEFA 4XE5A 1Q74A 1H65A 1U4OA 2D8MA 3AZQA 3DT8A 3I5UA 1CE8B 2A4MA 5HHTA 3AVVA 5LIPA 3OUZA 1E8NA 1G6HA 2YS6A 2LIPA 2PX8A 2VP3A 4KYVA 3ZIAA 3CNHA 3VO9A 3RUDA 2Q99A 4Q47A 3HXTA 2I9PA 1KNQA 4JQYA 4MYRA 4IGAA 4O4LB 2WLTA 2JHGA 2JNWA 4EATA 5K0GA 3HZHA 1O89A 4G1UC 1C14A 3QU7A 1JLRA 1G8MA 1H2YA 4XWAA 5LBIA 1JBKA 1RFGE 1YRYE 5CB4F 2UVDA 4M7RA 3KVVA 3WJ1A 1BJKA 2X9NA 4R2KA 5JJLA 2ZTUA 2VSYA 2BGIA 2AZDA 4ID9A 3TE6A 4KR7A 3HDYA 3CEJA 2IP1A 1YAJA 4WJZA 4D92A 1XVIA 3WK6A 2HO4A 4UHDA 5FCDA 3H9QA 3R09A 3DKIA 3LRPA 1K3UB 2IK8A 1D9XA 1BRTA 1P0MA 1CZKA 2ZRIA 1FFCA 4JBGA 4G0NA 4X84A 1F2TA 1XAGA 2YV3A 2ZSJA 4WLOA 5JSZA 2AXEA 4LFCB 3WWPA 1AXRA 3IUQA 4C7OB 5KSZA 1D5WA 2LVBA 4Z0HO 5G0SA 3PDCA 4IDCA 3LWNA 5JHHB 4PFKA 4BZZA 5DMHA 1K5GA 3P2MA 3FYUC 3BL5A 1KGSA 2Z3VA 4K26A 3W6ZA 3WLJA 2EFCB 2W4MA 4IEIA 3GPDG 2XCOA 1RBQA 3N5KA 5KNBH 3DKVA 4RVFA 1HV8A 3Q87B 2BHNA 3PUZA 2NNWB 5AVSA 3A27A 2Q6KA 4MW5A 1BNCA 1VSVA 1A7KA 4CLOA 5KQSA 1G18A 4HPJB 1SPXA 4XSVA 4DDWA 2QNBA 4MW9A 4PHFA 2GHQA 2VJDA 3HHPA 3N59A 1V2HE 1IPHA 1GQQA 5F5NA 5BO5A 4BMNA 2M6KA 2QL6A 2Q27A 4EHAA 1HRDA 1K97A 2IPXA 1MD9A 2X8JA 3KFLA 3O7MA 3DHWC 1YJ5A 4HAOA 3SZOA 4BQEA 3ZJ5A 2E87A 4L8YA 4ZT2A 2J7KA 3VDXA 3DQZA 2ZS9A 2CXNA 2OV3A 1RACA 3KR2A 4L0DA 3WKBA 4PN3A 2DQ4A 5KAMA 4BP1A 1SOAA 3HKEA 4WXYB 4WNYA 1FOEB 3RSSA 3W6NA 3TXYA 1UK8A 1HZJA 2X5KO 3WBJA 3B9PA 4JI2B 4HSGA 4QAJA 5HKLA 1G21A 3ZNOA 1EDZA 4KQMA 2NAPA 4TQGA 5IDWA 2ISSD 3FYCA 2XW6A 3I4FA 5M2QA 3TDNA 2F4VB 1EXNA 2BMJA 3EOBI 4Q02A 4DLBA 5JANA 1AS3A 3HXQA 2O8FA 2FZLA 3OQHA 1G8JA 2NU7A 1YQWA 3MT9A 1RI3A 4WHMA 4U5XA 4CL3A 4CQLB 3JAWB 2GCIA 4M1ZA 2A1TR 2KPOA 2QT9A 1P3DA 2XBLA 4BGUA 3SP1A 3HBAA 2BGJA 3ABQB 5KX5B 2ENWA 2XMPA 3HDQA 1IB0A 2BEWA 1C9EA 2P2GA 2ZZKA 1VHWA 3EDMA 4J43A 1GYQA 2C42A 1VLLA 1XL1A 2IYQA 3O9VA 1QFSA 4H9GA 3KLPX 4WKBA 3D59A 1UOPA 1BYIA 2EWWA 2VK8A 3L40A 2F55A 2MSWA 5K9ZA 4PC1A 3BCRA 5EXDA 4TLMB 5JBNA 2IHTA 1Z47A 5AVOA 3ESBA 4Q37A 2R6DA 4CF5A 1P1FA 4JAVC 5I5GA 1OJLA 2L17A 4PNEA 2RGNA 2Z43A 1Z88A 1GRRA 4RGYA 1ST3A 1D2EA 1SKUA 5ADUS 2XDAA 1KBOA 4FFPA 4I5DA 5LD2C 5C37A 3ZEIA 5IT0A 1GKIA 1V1MB 3UKJA 2Q29A 2WKPA 3C6ZA 3KUDA 2TECE 4YJHA 1U98A 4CEJB 4CN8A 1R9GA 3VC3A 4F0JA 4F5WA 1UJMA 4MEBA 4IZOA 1NT4A 1T5HX 3BQMB 4MJ7A 2WFLA 2GJ8A 1YMVA 4L9SA 2CVZA 3M5PA 2W6JD 3FAKA 4TXMA 2W9XA 5CYOA 4UOEA 5IF9A 2UZ1A 3T5PA 1K5DA 5LP6A 4ER3A 1CUVA 1XRPA 2Y6VA 1IWBB 3L79A 3T3IA 4ZYXA 4CMIB 4MUAA 1QO0A 4GSLA 3RUAA 5CVUA 4N8EA 1ZEMA 3PR1A 4HR7A 3TBKA 2Y1CA 1Z22A 1G5RA 4RVGA 1PWEA 4OHCA 1B3BA 4F2GA 1IUOA 3ETDA 5IDYA 3OKFA 1MLDA 2WF5A 4Y6RA 3VZDA 5IKMA 4XIGS 1NSFA 2XXBA 1P1HA 1O08A 4P98A 3G9UA 1QK4A 2G25A 5JT1A 3Q11A 1P62B 3NYRA 4ZK6A 5BQFA 4WACA 3L84A 1JV2B 1RWPA 2UUPA 4GEGA 1LPBB 3NATA 3NWJA 4H31A 4PCAA 4B3HA 3H75A 4CM8B 2IW3A 3DXZA 5ELXA 1M5UA 1TNDA 2ZTHA 4MP6A 4YN3A 1IONA 2A78A 3ZD6A 4DIMA 2ZPUA 4RFLA 1EHCA 5ETJA 2PGXA 1HE5A 4KBGA 4I6GA 5CEJA 2ZIAA 3T3MB 4FBLA 1T26A 3NYWA 1BVUA 3SR3A 2KSQA 5FUBA 4W5QA 1X9HA 2WSSA 4HWKA 4WZBA 3S70A 2VWPA 2P75A 1XPUA 4WOPA 1L5OA 2HU2A 4M55A 5EN4A 1GT6A 4M0KA 4BJ5A 3FYSA 4AZ0B 2ZDGA 3GVPA 2MYPA 1E7WA 3EEQA 4JU8A 3TI7A 3E7PA 4GH5A 2XDWA 5GJBA 1CX9B 2B2XA 3UYKA 4CKYA 2GZHA 2GM5A 2X8LA 3Q85A 1GL9B 3MWJA 3PXXA 1DEXA 3M6LA 2QTLA 5A5VA 1HNZB 3NDRA 3P20A 4IXNA 1G98A 1X3LA 2Q62A 3E81A 3HO6A 4OQZA 4RPGA 3UAOA 3V4LA 3SQWA 1YRQA 1N5KA 4ZOCA 4W5NA 1TE2A 1FW8A 2WKRA 3G88A 1YBVA 4C5AA 4YRKA 1B0UA 1XC7A 2GK3A 2ZSDA 2ZANA 4Y0VA 2P3SA 3NAQA 2H1IA 2WA2A 1AU9A 1PK7A 1UKAA 3EOAI 4UQOA 4UBJA 3PQ5A 5IDVA 3RYFB 5BNTA 1LLDA 1WB6A 1X7GA 2E9SA 2OV8A 3QUQA 2BFFB 2EP5A 3TEJA 4BMSA 3ANXA 4BE4A 4BNKA 2PO7A 4UM5A 2P0EA 1B2LA 3AF0A 4FFWA 4MMYB 4MYCA 1GUZA 4TM7A 2YS7A 4AZ3A 1Z8FA 1DO8A 2PLWA 3ZZNA 3RYFA 2EBUA 3LQKA 1U0LA 1UZUA 3CPHA 2GEFA 3TB4A 2IWHA 3VGJA 3WTBA 1OR8A 4C4PA 1D8TA 2CKMA 4ZCSA 4YV0A 2GR9A 2IELA 2P9BA 2Q5IA 4L3WA 1PT7A 2EQBA 3ZCTA 2VH5R 3I12A 2FPXA 5K8JB 3X43A 2IEBA 1QLJA 3VHRA 3FGZA 4HVTA 5H59A 4N5DA 2HJSA 2YV4A 3IMEA 1NW3A 3IV9A 1FMJA 3LQRA 3WYCA 3PWKA 3RDPA 2D5BA 3ZHUA 3ELDA 4IIUA 1N0WA 2P6MA 2PRZA 2E49A 4US0R 4JK3A 1HNXB 2R85A 3HU1A 2W2KB 2IH5A 3RRXA 5JSKA 4NENA 1MJHA 4IYJA 4Q9DA 1WIWA 1XMSA 4D0GA 3NOVA 2XSZA 3QPBA 2PFSA 3V1YA 3H9JA 1R6UA 4E51A 1ZXXA 5I7WA 5I48A 3BFKA 4IIHA 5EUCA 4X95A 3SYKA 4N12A 1KY5A 1J0AA 1IN5A 1P2DA 2UDPA 3VZPA 1JAZA 4HOYA 1I0IA 2C54A 3RG8A 4BO2A 3MEQA 1JUDA 2P77A 4JP2A 2LXNA 5JY6A 3A31A 3O31A 3KQVA 4MVJF 3LX6A 4XUGB 1DFIA 1XK7A 4I99A 4P7FA 3AINA 1LXCA 2B0JA 4XUCA 1MVLA 4ZGGA 4E31A 1XDUA 2QPAA 3CSSA 4IIJB 1Q1EA 5DOZA 2I5PO 3NYQA 3BC1A 5FJIA 4MQEB 3IPXA 5HRCA 821PA 1C4XA 2GPJA 4GX0A 4PLTA 2BKLA 2WSSD 2A7QA 1C0PA 4FW8A 4CIVA 4E4YA 3ZGZA 3NTOA 1GQRA 2I91A 4FYVA 4IJMA 3OTHA 3TSWA 3KEQA 1SBNE 1T8TA 2YZ2A 1C0LA 3RC8A 1CF9A 4M49A 4K3VA 3P9IA 2CL5A 2XKAA 2JD0A 3T7DA 3W04A 1RTKA 4A0FA 1Q0UA 4BNDA 3FPGA 1IEWA 1L8XA 1ZEJA 4B79A 4AO7A 2Z6VA 1QP0A 1HQKA 2ZJ2A 4DC0A 2WJYA 5CVEA 4EFKA 1VKZA 3V1KA 4LFBB 3FYTA 3VUFA 4RFVA 1SVKA 1OB2A 1CUEA 5JYCA 1QJ4A 4A6PA 1NUPA 3L0SA 2ACKA 3AJ9A 2NU9A 4KIGA 3W5CA 1E3LA 1L5RA 4QGSA 4M88A 1Z29A 3AGPA 1U0JA 1UADA 4ZOLA 1XAIA 1ESEA 3L9WA 4GW3A 4K6OA 4DAEA 3FPSA 3HKCA 1X39A 3AETA 3FPFA 1O8BA 4FHGA 1QCCA 1RQXA 4BVBA 5LN1A 1YCHA 3S5UA 5ALOA 1TJ4A 2I67A 1EIWA 5IC5A 5EWLA 2ZYSA 5AQEA 4KQKA 1TQ6A 3VGPA 1YTUA 4YDSA 3TJZA 4HGOA 5PGMA 2P6UA 4UEOA 1YKSA 3KLNA 1I1QB 4IS3A 2BIFA 2IXAA 3HJCA 3SBXA 3ICOA 3ME5A 3QKTA 3WLFA 1VMKA 1WLYA 5IKXA 3PDJA 2FZEA 2IEYA 4AKHA 4CKWA 1OLSB 5JBQA 1COWD 1QIDA 4UAJA 1BO6A 2TMGA 1SQFA 5DSXA 4JQCA 2PIDA 4U7DA 4WE3A 5JI2E 3C15C 4NMMA 2GJKA 1W76A 2RGGA 3C6XA 5KB3A 2C1XA 2R97A 2IEAA 3N1UA 3TCXB 1ZC4A 2QRNA 1KC1A 3OTWA 3JASB 3VRHA 2AQ8A 4IQ8A 2P5YA 2O7NA 2VZEA 1LLUA 4UARA 3I42A 3I2HA 1YNOA 2IYAA 5IMSA 2H18A 4ZODA 5AMXA 1BMFD 4LTNA 3KTFA 4C1NA 4N03A 1JZSA 1H2XA 1OFHA 2O2ZA 3WWYA 3DE1X 2B7BA 5K20A 3L0BA 3NEYA 3TZ6A 2BONA 5GIPE 3D1JA 1PF7E 4TMTA 2YYAA 2XUPA 2GK7A 4W6ZA 3E2MA 5HBRA 5TEVA 4R1MA 4WWHA 2DJIA 1SHLA 2P4SA 2WWVD 3HFRA 2DY0A 3CINA 4B9EA 3MIZA 3NT2A 1I4LD 1RC0A 1LPNA 3IGFA 4PNHA 3AT1A 4F56A 3IUSA 2YRWA 3CE6A 1O95D 4Z1MD 5CLJA 1QIKA 2G5CA 2H4HA 2VPPA 3MVEA 2Q9UA 2NZWA 3C7KA 4RLHA 2CDBA 2VQ6A 5DYNA 3WMFA 1PNRA 4AJPA 3GFOA 3CBQA 5CVDA 3GJ5A 4GC9A 4BRWA 4YCMA 1T6BY 1PN3A 2N47A 4ZC8A 5JOQA 5K01A 2ODWA 2ZGVA 5DASA 2X1HA 2XCUA 5DDIP 5D87A 4N3GA 4YX9A 1EXWA 2IZ1A 4OQPA 4OMFG 1NNI1 4DCSA 4L0MA 5C5CA 3EH1A 5ARBA 4IWYA 1WCYA 2C96A 1TVMA 1VJTA 2G8NA 3EC7A 3K2EA 2QIPA 3NCTA 4HH1A 5BXQC 4A2QA 4DCVA 3HM9A 2PH1A 1FFXB 1ZSVA 2BUCA 2GJ9A 1WCIA 2YIDA 3GC6A 4LSZA 3GLIE 2XA1A 2QJWA 1L8LA 4K1XA 4N5IX 4ROSA 2EW1A 1T9BA 2C9YA 3KDPA 3CLKA 3R7LA 4ENSA 5HZGA 1Q17A 3TOCA 1P7WA 2ECKA 1P33A 2J7PD 1Y9AA 2XBUA 3B3GA 1CLEA 3DKKA 4GQAA 3GYGA 4ZP1A 2M1ZA 3D6FA 1H23A 1XXLA 3KCNA 1MENA 4DS3A 4GVPA 1NUUA 3QFCA 3MOSA 4MGYR 3COZA 1U0NA 1GKUB 1C1XA 1HDZA 1CQWA 4YAKA 2NXCA 1DZIA 3KZXA 4YCDA 3PC7A 4W9NC 5LUBA 2Q2VA 1QS0A 3AXTA 2QL9A 5DTIA 2BFEB 1AS2A 1TB4A 1LSJA 1TJPB 2WUWE 2YCBA 1W581 1IU9A 3CVJA 4G5OA 4LJ5A 2JB9A 4Q4JB 3WQQA 1N34B 2OAQ1 3OZTA 1ARZA 4ENQA 2XLBA 3V1UA 4HFNA 1F3OA 4KKVA 4NP6A 5AKHA 3ZK9A 3WA7A 4G1VA 2DETA 3T7SA 1Z4MA 5CCDA 1PR9A 3LQQA 1NJSA 1VL8A 1X94A 2DPGA 3ANTA 3SOPA 1L7XA 3GDFA 1P80A 2G7MC 2JLBA 5CLLA 1YRLA 4AP6A 1QHXA 2G9VA 4M8NE 3JQQA 4BAZA 3SHOA 5KEIA 1ZESA 3LD9A 3CUYA 1RTTA 4R7GA 1GA4A 2J0SA 5FA6A 1QWSA 2CHQA 4UHEA 2B99A 2JBHA 4OV6B 2ON6A 5ALIA 2QDXA 1HC7A 1NONA 1K2WA 3Q9SA 4DLUA 1PZEA 2C5EA 1CJTC 2YFQA 3SDZA 1L7RA 2B8NA 3ILSA 3FYUA 3F7TA 1WABA 4UQPA 3E22A 2FN8A 5ESXA 2VAMA 1V6CA 4IG4A 4JODA 4ZICA 1N4DA 3UXMA 3CF2A 1V4BA 2X2OA 3RHTA 4B17A 3SIPA 1YMUA 2QYTA 2IY8A 1Z4KA 4K03A 4B44A 3T3PB 4U0JA 3TTXA 4YR7A 3P4UA 2BHSA 3ZCQA 1V9CA 2F3PA 4JV5B 2TYSB 1GAQA 1U8ZA 2YBEA 1MVNA 3B1VA 3ESRA 1HG0A 4PHGA 5J9FA 4E5SA 1Y5RA 1L4EA 3THXB 5I8PA 1R5NA 3FHJA 4EQZA 4YWHA 4BFCA 3UMMA 2EFEB 2HCTA 2O59A 1LK5A 2CBZA 4N5HX 4NESA 3LBYA 4PO1A 1WETA 1JR3D 1CRZA 2QY6A 3RSFA 2WF6A 1OH5A 4LV8B 3LNCA 5BY2A 5IC6A 5ICEA 3HJNA 5UKDA 2Q21A 2MSKA 3CU5A 4O25A 2XGOA 3QXCA 2ODAA 3WK9A 1C3VA 2UUAB 2YC4C 1I4OA 3AFMA 3PA6A 3BFPA 4LA4A 3UMGA 4Q7KA 1F2UB 1NAIA 3PEYA 4IGFA 2WICA 5LU9A 2X6RA 1DQPA 1QGZA 1PU2A 4QYTA 3JVEA 2JLUA 1ZCAA 3OZRA 4FJ2A 4KN6A 2CNKA 3JQBC 4PCLA 4RA9A 5CCXA 2X0NA 4KAJA 4JSTA 5I4KA 1GIAA 2X7XA 5IYZF 2P2NA 4IVPA 1JG6A 1Z5GA 1U2RA 3ADCA 1NZJA 4NFYA 5SYAA 1Q20A 3WLNA 4GOOD 5L6LB 3CRZA 1VZ2A 3BMCA 1BMTA 3V46A 1HUQA 2P40A 3C24A 3LY7A 4NDAA 3JWEA 4L5BA 2BM1A 1J23A 3OM1A 3DTNA 3PIIA 4GM0A 5DHPA 2PH5A 4G56A 1JI3A 1CUYA 1KDZA 1JILA 4FEGA 1T36A 2GYVA 4ALNA 1KO5A 5E7IA 2IVZA 1WL8A 2QRHA 4B48A 1NUAA 1QGUB 2JI8A 4HK4A 4TV8F 5K05A 2JS7A 2O2XA 3D2BA 4HP8A 1ESNA 4RVHA 3KWFA 4U9UA 4MWGA 3P2EA 4J1SA 1OH7A 2FGKA 3EHDA 3N6VA 4PY2A 4RPCA 3LZCA 4ZI7A 4RTRA 4FMPA 3QU2A 1T0UA 3LOQA 4NKRA 3OLQA 4LNUB 2AQIA 4J7AA 1KZ4A 3D3WA 4TTJA 4E5KA 2CSXA 1V5GA 3CRRA 3R5HA 3EVAA 1ZRMA 4YT8A 1ODCA 1CIJA 1ZNWA 2XNDD 2DCUA 1HRKA 3OZIA 2A2ZA 1LTQA 4FN5A 1XVAA 5DXAA 1QPGA 1V9SA 4H6WA 5CIQA 5F76A 4K9QA 4PBSA 3CUSA 4G0WA 1QIHA 2WE7A 2AC2A 1Y80A 4YACA 5J5AA 3R7SA 1I2BA 4KV7A 4YCBA 1VKJA 4LHWA 3JQGB 3FDZA 4G0OA 4NCIA 5FA5A 1NVAA 1ZYUA 2A3RA 3FUCA 4WGFA 4ATNA 1P0FA 5B64A 4ESHA 3N2GB 4PYKA 3EFBA 3TIVA 1HWYA 4INOA 1G5QA 1XYGA 2MSCB 2WAOA 3OF5A 3UN1A 4FOLA 4KXUA 3HDVA 1M8GA 3ZHTA 3GGPA 1IBKB 4G85A 1U3FA 2Z58A 3JRXA 4RIFA 1MN6A 3GRYA 1MOPA 4J76A 1RYMA 2N46A 3P5SA 4OM7A 2J09A 3CLTD 3ZYCA 4Z4GA 5M04A 1KF0A 2V7TA 3D4BA 3NETA 3QW2A 2PH7A 2ONJA 1S2OA 4ZU1X 4AO8A 2VQ3A 1NVVQ 2O2IA 3GRZA 4U2CA 2IYOA 3G7NA 2F2TA 3HY6A 4V0OA 1N2CA 1U1CA 2AMFA 3RABA 1WZCA 3N2YA 4OU4A 4DCGA 4GR4A 1V0JA 2G17A 4IX9A 1UT8A 2EIHA 3DT9A 1MTZA 4DM7A 4G0VA 4YT2A 1DPFA 1J00A 2HBRA 3F7NA 3QVSA 1JJFA 1S7CA 5CVJA 4G81A 4DLNA 1DNPA 1HGXA 1DKRA 1FPMA 2H85A 2IP2A 4FHZA 2QAGB 4KFSA 2QD1A 4G9EA 3WRXC 2ZUFA 2CXOA 5C8YF 4G1FA 1YR9A 2B0CA 3UCXA 2FRVA 4J0JA 1O6CA 2AF3C 5J1SB 4OGLA 3H1FA 3PXEA 2C84A 3UAVA 5BSFA 4U7FA 1R00A 4Q3LA 5EI5A 2IUYA 3UTDA 3CE9A 4ZAFA 1OXMA 3FBWA 1G5PA 1OLSA 4H60A 2ICAA 1PGOA 5DYGA 3CUWA 2QG4A 3CSDA 4PLPA 4GI5A 1IDN1 2QD2A 4I55A 1UQTA 1ZUIA 1C7JA 4MQFA 2PZMA 3LLVA 4LRUA 1N6LA 1IMJA 1CVRA 1VA4A 1H6AA 4MKXA 3K6JA 2ZREA 3Q7IA 4LE1A 3GXOA 4B3XA 5KTRA 3VNBA 2REBA 2I7CA 3KSRA 5A4IS 4R8KA 4I1RA 1E1NA 2VSFA 1S1CA 4KQWA 5LQUA 5HS4A 4MUFA 1RJ9B 3B13B 3CNQS 1FTGA 5A4DA 5DNWA 4ETIA 3FPLA 4QPZA 2G0NA 2CFSA 3QKUA 3DMDA 2WZDA 3NHZA 2Z4RA 1JT2A 2XF8A 1UBGA 1MNAA 5FORA 2GEKA 2Y4OA 1VOTA 4H16A 3G0BA 5DT2A 1J9ZA 3FPBA 5IH7A 3VO1A 1CD5A 3PVCA 4KP7A 4PHTA 3OOHA 1ESMA 3ZWOA 1M76A 2ZKIA 1ZVQA 2MMCA 1XZQA 3GLRA 3OZVA 4GM1A 4KOEC 2XUZA 4LJRA 3WHIA 1VGRA 1KYXA 3D3KA 3KXLA 1KAGA 3WNZA 4CV2A 2D0IA 4Z7JA 4OKSA 3DZJA 1HDGO 1NVUQ 1YQUA 2XWPA 3EH2A 3IBTA 3CX3A 4XDYA 3NNNA 5AW6A 3INYA 5KYWA 3ID6C 2WJZB 3QPUA 3CVVA 4EW2A 3EA5A 5FPTA 3SEAA 3M49A 3QF4B 1MJFA 3DDNA 4RKWA 4RKRA 3M6XA 5KJ1A 3KBOA 2L82A 4YDHB 4YDQA 1XZ8A 2W43A 2IGTA 4DWWA 4HN9A 3MFYA 3JQ7B 2IHKA 1YQ9A 4AP5A 4ER6A 2DPLA 3EMVA 4ZVSA 1NNLA 2ZCUA 4LX8A 4H1VA 1H1LA 2VI5A 5JJCA 1YAHA 2XMQA 3H5IA 1E8DA 1FLAA 3VR4H 4G84A 4WZAE 3WLAA 1B74A 1QVZA 3DDWA 2OM6A 2ZB3A 1DLJA 1ZC3A 1YASA 3FFWA 3O21A 4DLYA 1DAGA 2RHWA 4P1ZA 3QVVA 1DS6A 4GPBA 4ARIA 2RIPA 3GIDA 3QV1A 3LTNC 1EESA 4DMCA 2ORIA 3HA3A 1MV8A 1X3SA 3Q3EA 4OHMA 2IXBA 1XZCA 1CETA 2YWGA 4I4IA 3QPWA 3FDJA 2RGWA 4FGLA 3W8RA 5C9ZA 3GLIA 5HDBB 1NI4A 4O2RA 4O4IA 1G64A 4KQ1A 4N7BA 2NTVA 3W3ZB 4AF6A 3ADBA 2J3IA 4YASA 1IIRA 4NENB 1MU0A 1IY0A 1VLMA 4HYEA 4ROTA 4UDOA 2C8KA 2EFYA 3B82A 4QUDA 5TMEA 3SJAA 3ZLBA 5LVAA 2X4DA 1Z63A 3ZDRA 2FEOA 2O8CA 1RJFA 4LGCA 1EFLA 1EGVB 1UBUS 4NZYA 5DK6A 4MR9A 4PAQA 2VUIB 4YAJA 1G19A 1Q14A 2WYHA 3C8MA 3OWOA 2H1HA 4CTJA 1BVRA 2VHVA 1AXEA 2QI9F 3PNMA 1K9SA 3KYCA 4MTLA 3H4VA 3ZKWB 2FU5C 3EMDA 4QREA 4DQKA 1D4OA 2GN1A 1MRNA 2J1LA 3QEJA 3GEBA 4YJGA 5F12A 4DDHA 1USIA 3GRFA 4DR2B 1ML4A 3OY7A 5CUQA 4DWVA 1OZ0A 2A1TS 1PJAA 1FRQA 1NDUA 3TW0A 3JPYA 4MQ6A 3FD8A 4A2PA 4WW0A 1U7ZA 4LS3A 3TIGA 1N1MA 4TTSA 2YWBA 5HIIA 2AXPA 3Q9UA 4KLZA 1X1BA 3MMXA 4PZLA 3TD2A 1HK7A 3HJBA 5BN4A 3N8KA 3BULA 3O3MB 3FVVA 3FVWA 4HDMB 4MIKA 2OA0A 5C31A 3GEHA 4DRXB 1GGHA 2XF2A 1OFIA 3TZLA 1EGHA 1KFBB 1ETUA 1RPTA 2BGNA 3E5RA 3G17A 1WWKA 4UNPA 4MW1A 4KAAA 2CFIA 3PENA 2CMFA 1NOIA 3DA8A 2XZTA 1TT7A 2Y2UA 2TS1A 3UGTA 1E9BA 2QSJA 3BDVA 4WOJA 1SXPA 2E6KA 121PA 4G36A 2ZJ8A 1XN1A 1HYEA 1ONNA 3GJ0A 1GV0A 1SQ0A 4WCDA 4EWLA 3NKLA 5ALDA 5EHZA 4DCNA 2H1FA 1UPXA 3PUWA 1FB5A 4B6FA 1E1KA 1KY3A 1OIVA 1PGJA 2OOKA 2ZEJA 3OTQA 4BNLA 4ZT7A 4CEIA 4R1NA 1U7WA 1ZM7A 1LW7A 3GFVA 1V7QA 4XKJA 4ZXPA 3L1JA 1MIHA 1BHSA 2WU4A 1XVLA 3MMNA 3CONA 3OLWA 1XKXA 5ES4B 3M5CA 1LH0A 1LI4A 1T4MA 3MC1A 5JNWA 3U4IA 4PF1A 5CGQB 5JSFA 1H69A 3CUKA 2PHZA 2OXIA 4EG4A 2VHWA 1QRTA 1X7YB 4WLUA 4MUYA 4TV9B 2X0RA 4X7RA 1WOMA 2BAGA 4L0QA 4IDBA 5I7EA 2GF0A 3U4QB 4B09A 1ZD8A 3BL6A 3IDQA 1BWPA 3EIHA 4V3CA 4BVGA 4IIXA 3B36A 4NK4A 1AVTA 3MAGA 5HCIA 4IQFA 4POOA 2YASA 1KEUA 1Z0UA 3LY9A 5FEMA 1T1GA 4W1QA 3DOIA 1VI6A 1FL9A 4HLQB 2X23A 4Y2QA 4W82A 2A5YB 5EL0A 2NV6A 4ALMA 1FS5A 4KQHA 4G25A 3B2EA 1FXWA 2GPSA 3D2CA 5G3YA 1JG7A 1K4MA 1YMQA 1YBFA 3KTAA 3MELA 3P2YA 4HDSA 5FOSA 2B8EA 4XWYA 3TVDA 1XNRB 3KWMA 2OMKA 3KS9A 2W6NA 2O50A 3DOEA 1GKKA 5TF0A 3UANA 1MV5A 1W4CA 5F33A 2G77B 3GX1A 4J16C 1EJ0A 4BMOB 2QZPA 5L4SA 4E22A 3IDAA 2EYUA 2C83A 5JQGF 3LT2A 3E3OA 1KFCB 1QVRA 4YJKA 5BVHA 1LRKA 2XQKA 5CW2A 4R81A 3KYJB 3FR7A 5H9WA 3QE2A 1X92A 2B94A 2FVXA 3HB7A 5AQ1A 3OEEA 3RHSA 1Z2CA 3PS9A 1XVUA 4KQ9A 3TXAA 3VBEA 1PZHA 2PH3A 2WUGA 3H2HA 1OLUA 3GLGB 5MN4A 2Z2IA 2FOLA 1T0PA 2IZ5A 3OU7A 1EGQA 3RYIB 2LDBA 3GFFA 3TR6A 3M0EA 4BWVA 1GL3A 4PYIA 1EUYA 5ECDA 2AQKA 5GADl 1OILA 2PUGA 4OXQA 4Y67A 5CJ2A 2C0QA 3S5JA 4I50B 4EHIA 2Q07A 1DJPA 1D5CA 1NQTA 3CB2A 3HWWA 1QTIA 5DX0A 1K3TA 3FOAA 5L95A 5KX5F 5E95A 2AYZA 5JSYA 2IEGA 4CQLA 4PAWA 5ALMA 1QORA 3ROPA 4NMXB 2HNAA 5I7AA 1NUTA 1VSUA 1RAHA 2VRBA 3QEMB 5TARA 1SD1A 5I7HA 4E5UA 2GCEA 3AERB 3FOFC 4UTOA 3V4FA 3KTAB 2WMOB 1N8KA 1V8FA 2I22A 2QTTA 2VCHA 2WM8A 3BTVA 4H0FA 4HWSA 3TQCA 2A0WA 4D02A 3QX8A 4RIGA 2RHJA 4EX7A 3UNXA 3EDRA 3STXA 5JC1A 2QMYA 1XCJA 4YRFA 4AJKA 3EFEA 2HQSA 3VAYA 1GNRA 1R8XA 2CUNA 3PFWO 4MUNA 2PEZA 5HFAA 3WLRA 4MRMB 1X7YA 3OOJA 4P3KA 4BX2A 1T5IA 2OV1A 4AZVA 2X9GA 4B43A 4BFVA 4UD6A 1II0A 1HTTA 5A02A 4PZZA 3JQ9A 1CS0A 2E4UA 3A32A 2Z1MA 3L7MA 1VPTA 5CT6A 3W06A 1Z0SA 1BEEA 3CW9A 2HA3A 1VPLA 3KAPA 3M1IA 1TMOA 2BISA 1KJ9A 1X0VA 1PX2A 2PPLA 3DPIA 3K8ZA 4KIFA 4N41A 2V3WA 3FZGA 4YMSA 3PWTA 3R9XA 3IMFA 1SCDA 2OT3B 2II6A 4IJVA 4D44A 2B2CA 2GB4A 3MB8A 2W71A 4QFMA 1JDJA 4F4CA 2YHBA 2COUA 4TMXA 3HBLA 2JFGA 1HM5A 1YHNA 1Z36A 2PMBA 5KHAA 1N3BA 1MABB 1U63A 2DHDA 3GZNB 3HYTA 2C2HA 4ZRDA 1PT6A 1XTQA 2YUIA 1U2PA 2F9LA 3E1GA 3ONDA 4L76A 1XJWA 1V7PC 5ENZA 5CA0A 1ZH8A 2P9GA 2P9YA 1X38A 2YN4A 4LDPA 4B9AA 5A5FA 2CT8A 4EFNA 2I8LA 2RB5A 4GP9A 4OG2A 3GRRA 4RW0A 3RPEA 1OLOA 2CMGA 2WF9A 3RTCA 1A8HA 4FYHA 5F4ZA 3WBKA 1V1MA 1E2PA 3E70C 1M0WA 3L0YA 4EITA 1GGMA 1R6BX 3GFSA 2ZATA 3L6CA 5HF8A 3H1AA 1H5UA 4F6RA 5LKRA 1J2JA 1R4MB 5ESDA 1FJ2A 2WB2A 4MW2A 3U56A 3FTDA 4OQMA 1KVTA 4JLJA 4RHYA 1NNUA 2BMWA 1E89A 1M1NB 4OOFA 4D9BA 4DIKA 1RRFA 4NU8X 4K1LA 4ZYTA 4GO1A 5IU6A 3ZY6A 4C14A 1FDRA 1AKVA 1P3Y1 3NWPA 2QRVA 1VJ5A 1LI7A 3GQBB 2YXEA 4TKUB 1EXVA 1Z39A 3NDBB 3EEIA 5BW4A 4QDXA 1T2NA 3KR1A 3HVIA 3VR4A 3W8DA 2I65A 4DJAA 3SYMA 5KYXA 5B2ZA 2XNCA 1ZM2A 2JH3A 4KGZA 3ACDA 1K92A 3KKLA 3P0JA 1L5VA 1LU9A 1PJSA 4XW2A 3LIIA 4BZWA 4CKEA 2LPMA 2IV2X 2CZGA 2F3RA 5IUKC 2Y9MB 1JECA 4XD7D 1FTNA 4MR9B 2FEXA 1BC5A 4JYBA 4F86A 3TGPA 4KC0A 3G3EA 1MFZA 4KIJA 4A92A 5KSOA 1UOEA 2DFVA 4JC8A 3RC7A 1CFJA 1QK3A 4IICA 2XQIA 3MBOA 2H4XA 2YJNA 3A37A 4JC5A 4JVSB 4KGVA 3U7IA 1N6HA 3A70A 5IBPA 5L7YA 4ZYUA 1DAEA 2J0EA 1CUAA 4UTVA 2AB0A 1WXQA 3QU5A 1KSFX 4JXXA 4ZQIA 3H9CA 1E7YA 1GLVA 2RHGB 4URHA 3AR2A 4M0LA 4UFPA 4BDTA 5TQ0A 1FIUA 3A7DA 4NG4A 2X40A 2OFPA 1B8NA 3ND7A 1P6XA 1KXZA 4N3CA 1INLA 1UBCA 4BMVA 1Z6YA 2OCDA 3H4TA 4WKOA 3BGWA 1QQ6A 1X8LA 1TLFA 5FO0A 2XTZA 4MZDA 3TI9A 2JD1A 3QM1A 4MX8A 5TQ0B 3WNBA 3OJWA 2HT1A 4PQRA 3I9NA 3TOSA 1YFLA 3U13A 1YULA 3HDJA 3HGMA 1M75A 3TVYA 4KXNA 4PR3A 1Y8RA 1QQTA 2GCOA 3JQAD 5CX1B 3GEIA 5AICA 1NVXQ 2Q7OE 4ZT6A 5ISMA 4YAEA 4A5SA 4F4JA 4RK4A 3TJMA 2XNKA 1JSCA 5F78A 2EDCA 1XEFA 3I01A 4YRPA 3SS7X 3VHQA 5KSWB 3WGVA 4X65B 2C94A 2VNSA 1SUIA 1Y7LA 2XVAA 3DTVD 4C7JA 5MN6A 2QENA 4QL3A 3NDPA 5K6RA 4AVYA 2J07A 1AIPA 3S6JA 2IDMA 1GYPA 3ZCRA 3OJ0A 1U6KA 4BLPA 3SJBA 3VKGA 1BTOA 1I7DA 2AG8A 2JIPA 4FONA 1E59A 4MV3A 5LC1A 1KR2A 3MD0A 4GWLA 1EK5A 3BWBA 1J0BA 2B9EA 1NF8A 2HOQA 4IHJF 4ZV9A 4DCJA 2GHIA 1TJ3A 2I1QA 1QGYA 1JT9A 3BF8A 1RJDA 3VR5A 1FW6A 4DT1B 1TAQA 4OI0A 3SSNA 1TD9A 1V25A 1M8KA 2C3PA 4WBSA 5FI3A 1EDDA 3S55A 2ZRDA 4FFNA 3FGPA 3V33A 4BZPA 3EXFB 5B57C 1XTIA 4B6SA 5J63A 5KYYB 2IS1A 1YE3A 2WYVA 2P6NA 2CNLA 2VRNA 3A6FA 2NZXA 4C0JA 4OAQA 5JS7A 5E2AA 1AKYA 4A0QA 4C20A 4PZYA 3LBHA 2P4HX 2X6QA 4J0FA 2CLKB 1JMYA 2JFVA 4MVJE 4PGHA 3KQKA 1Z2OX 1KO1A 5JECA 2JHFA 3ORSA 1QZTA 3MGAA 3ZWAA 4CFYA 2CFOA 1JJ7A 2CVPA 4LRTB 1WS6A 4B5LA 3UF0A 2R7KA 1CQPA 2W2MA 4X71A 3BXFA 3K9CA 1S02A 1WY5A 5TDHA 4BVFA 2XKKA 1UMBB 1JKXA 2VK4A 1ZJZA 2BSQA 5HZKA 2OO5A 3C1UA 1A76A 1M2KA 3I76A 1G9TA 1U8EA 2D2EA 3VR6A 2V7PA 1PEAA 2B1JA 2HA7A 1A2BA 2VH1A 3KVRA 4G5HA 1MIOB 3PL1A 1G3QA 5H83A 2ZB8A 1YZTA 1C4KA 3AHJA 3OPXA 4JHXA 4JLWA 5LQSA 1GEEA 4BKUA 2JJ2A 3IDZA 4D0NA 1AGPA 5DMXA 4X45A 1RWMA 3GZ4A 4HUQA 3NVAA 2XD9A 1M8PA 5JDCC 3TLAA 4PTLA 1I3CA 4AG6A 1TUBB 2GF2A 3LW7A 4UXIA 1DT3A 4HQLA 2J9FB 2JCXA 3OPYA 2PT7A 3RGWS 2DTDA 5FWYB 1OLXA 1OQAA 3MAAC 4V0QA 3ET4A 1FNCA 3ZWVA 5K8UA 4PGFA 2WHPA 5KKNB 4M1KA 2W2PA 2WU1A 3EDYA 3T1NA 3AM5A 2DXIA 1SXHA 4LW8A 2JFNA 2B6HA 3K72B 5IEBA 2PT5A 3A6PC 1HE4A 4D3SA 3KSMA 4F1KA 2XCIA 3D0OA 5EKXA 2QSZA 5SZJA 1L5NA 3Q8MA 3UV6A 3UB4A 2HIHA 3N2GA 1JE1A 1NA5A 5FR1A 5EJGA 4BNHA 1PNQA 3DVAA 4WT7A 4ENTA 2ZXUA 2LIVA 1GCUA 1GSHA 3B51X 4H2DA 2PMEA 1WUIS 4AWBA 8GPBA 3KJHA 4LY6A 1DG1G 1O1YA 4MVJP 5DBOA 3H5RA 2IYWA 1E3WB 3N8HA 5DM2A 2VIIA 4D4GA 1E2UA 2RGCA 4YREA 1V5EA 3L0PA 1QE0A 1OI4A 1N2IA 4JJFA 1SIUA 3SYTA 1A77A 1QONA 4FS3A 3EF3A 1DBIA 3LGAA 1CUZA 3MJSA 4MHSA 5TEWA 4XLZA 2PMFA 1BA2A 1O4WA 1UT5A 4JXZA 1SOVA 3MQFA 1JEDA 3SM3A 3RRMA 1NIPA 2VP9A 3ANNA 1ONBA 2Q4DA 4CIDA 4YHBA 1DJLA 3AOEC 4E03A 1GNQA 3LAWA 3RFXA 5I9NA 3DLPX 3ZWBA 3FMVA 3R75A 2VK1A 5C1PA 2I03A 2X4IA 2EKLA 3A6DA 4KYTA 3ROXA 4ENWA 2QZ4A 4E3WA 3B52X 4UNIA 1FUUA 3CH7A 2VO1A 4AQDA 3IEMA 1VIVA 3AILA 4OAPA 3U5TA 2WJWA 3WSVA 2WFAA 2O8BA 2EJBA 1FP6A 1W8IA 4J7UA 1VHLA 3AYXB 4JLSA 3SLRA 4AY5A 4LDRA 4CIWA 3NVMB 2AC7A 4KXYA 3PD0A 1GZ3A 5I7UA 1ST2A 3FUUA 4L73A 4DIBA 4ZFNA 4Z53A 1IZ9A 4J03A 2L69A 4LWPA 1N1GA 5JATA 3RJ5A 1KE1A 1F5SA 1UEJA 4Y9SA 1OVGA 5G40A 4HDSB 4PO8A 1WP9A 2EAUA 4YEDA 5HKKA 1PJBA 5AIAA 4V0KA 5DLQC 5JFTA 2Q6IA 2XNHA 4LYYA 3NALA 1P44A 1Z26A 1W46A 5DHRA 4U3JA 5IJXA 3UTCA 3WLOA 4MV1A 2C5LA 4FQ7A 3L2OB 3MWEA 5AVYA 2OHVA 1CQIB 3QENA 2PJRA 4R05A 1XROA 4PG6A 4Q6WA 1ECLA 1GPYA 3RLFA 3VTZA 1WBBA 4X63A 1XMOB 4EY5A 2I7TA 2A5LA 3QKRB 3ND6A 4GUDA 1RPZA 3EFOA 3VYSB 3HVKA 2OCKA 1SCIA 2W4IA 4J9VA 2NV0A 1YR1A 1KQNA 1ZNZA 4GOKA 4M1MA 3WIDA 3SQXA 1G2OA 3DWFA 4PZPA 4RACA 3A25A 4G5YA 2J3KA 5IT5A 5JYEA 3H2JA 3RUIA 2CLEB 3BGOS 4GGPA 4GWKA 4HNGA 5EHXA 1FU7A 2RB4A 4QD3A 2F8SA 1X1AA 2NXJA 4WA7A 1F8FA 5IKOA 1HT0A 1NYRA 2IU4A 5KYWB 4NBNA 2WTBA 1ES9A 3KZOA 4HMPA 1CZUA 4QJ3A 1CRLA 1QNFA 1E0DA 3A1CA 2F43B 4PWYA 4AMBA 4PYJA 1VJDA 3ZHRA 1L3CA 1U2ZA 2NW6A 1E2DA 1UKZA 1N2EA 2RHHA 3M6UA 2BSXA 2HUNA 5CITA 4XJVA 1O97D 3I61A 3TFOA 4E32A 5AKZA 2X8BA 1TEHA 5CK5A 2XJ4A 2AFHE 2ZIWB 5CBKA 1MPXA 2A9OA 1B7GO 1F8YA 4N7JA 2D0PB 4NJEA 1SVWA 1B6SA 1C7RA 4ASUD 3F96A 2XWBF 3MBKA 1RMQA 2LP4Y 1UWVA 1DIGA 1N2JA 4RJLA 4EO9A 3BK7A 1LY1A 1YJQA 5KYVA 2ZYGA 3IBFA 1BH6A 1K3FA 1XCPA 1CDEA 3O1IC 3SYLA 3CEAA 2JL1A 3T54A 4JASB 3DONA 1XEXB 1W34A 2EP7A 1DBVO 1XDGA 1Z25A 3M34A 4WY2A 1ZI9A 2D1YA 2QTMA 2QRQA 1EZ4A 2VEOA 4PLYA 3BE8A 4JGGA 4CDNA 2OPBA 3H5AA 4HG2A 4YJ3B 3V4VB 2FW1A 3UB2A 4EYGA 2VAXA 3IRVA 3L5KA 1AUXA 5CFQA 4ARVA 3IAUA 2ZBDA 5K6AC 2R1VB 4LKRA 2J9ZB 2BKUA 3JY6A 2YVUA 3KG2A 4RKEA 2CVHA 4RXUA 4UDYX 5ALGA 3A3NA 2IZ7A 4NK5A 3UMRA 4Q00A 1Z8DA 5EXPA 5A9TA 2AH5A 1FQKA 1N2XA 2VNKA 4KUEA 2W4QA 1M34B 3JAKA 5IAAA 2QLFA 1USKA 4PS0A 5L51A 2V74B 2A9PA 1O94C 4G86A 4LMPA 1QX4A 1XOIA 4RD6A 4N47A 3JR3A 4YS6A 1KDOA 2Y2VA 1B0AA 2CEKA 2YN2A 3KU1A 3WLIA 4JH0A 4M1OA 2ZTSA 4BNUA 2GN6A 2V9CA 9ATCA 1OF1A 2IC5A 4CN9A 5EJ8A 1N0VC 2ADFA 4EGAA 3ESZA 3QW4B 4TS3A 1XD2A 1NI4B 1NY6A 3S27A 1Y5IA 4L5CA 3E6AA 4QBTA 3UXEA 1E2MA 1C3LA 2QZ9A 2VDQB 4LZJA 1PUXA 4ZOBA 3U48A 4CE6A 4D6XA 5KVVA 1IM8A 1AKMA 1U8AA 1WCV1 1XHLA 1LNQA 1WVIA 3A2LA 3B6EA 3MWDA 4HQFA 5HCUA 1G1MA 2P91A 1MX1A 3OCXA 5HGXA 1OSNA 3A3YA 5IUNC 3LSYA 1GKYA 3RAJA 2J0QA 2F62A 1U5BA 5IJ9A 1KZ9A 3DF7A 1A04A 4L74A 3UMBA 1A1VA 1KVUA 4BYGA 5CX4A 2CVOA 4D4IA 4ZTBA 1B8UA 1CUHA 2LKCA 2V6MA 3I6MA 2BM0A 2P7HA 1XRLA 1A2OA 4KFUA 1AV6A 2DJ5A 4DNOA 3FRIA 3R5TA 1BHO1 1E9EA 3BF7A 1CQJA 1A4XA 3K20A 5C8DA 1TPYA 4I4NA 1FZQA 5BSKA 1QRUA 1BU5A 5H68A 2OEPA 1YKFA 3HCPA 3MK31 1D6SA 3GT0A 5KVQA 3Q4GA 2PO5A 3U3KA 2VNJA 4HJXA 4GP7A 1D09A 1RRMA 3SKYA 2P30A 4QHTA 5EZYA 4W9MC 2H2AA 3DTTA 3FMOB 3P0FA 2YJZA 4IZHA 2Z09A 3KPYA 1NFRA 3IP6A 5DGXA 1LZLA 3K0CA 1J0EA 1EVEA 1POWA 1H5NA 2NSLA 2XV1A 2A8YA 1JHVA 1SRRA 2I3AA 4PC2A 2I1LA 3QFFA 2EARA 2IYFA 3IULA 2FP4B 5LYJB 1IFXA 1PS8A 3CZAA 4IUYA 4Z0PA 4A8HA 1XTKA 2J7PA 1TZBA 1O4VA 1P5JA 3DFIA 3O8LA 1NQWA 5AI4A 2C29D 5CH8A 3LBNA 4MQMA 3FTQA 1NASA 4GUAA 3N2IA 1AQLA 2PUVA 3UJHA 2W2LD 3O8OB 1RT9A 3DFUA 4Z4EA 1KEEA 1BSVA 2YN0A 2FLKA 4RVNA 5I7OA 4KLRA 5FL3A 2X2PA 4HBZA 3WYDA 4MB0A 4F4DA 1N5LA 1VCMA 1Y48E 4CF7A 2FPMA 4H7HA 4A16A 1G5FA 2PU7A 1FDSA 3EE6A 3H1TA 4Q7JB 4B0OA 2LR0A 3W8FA 2OR3A 4PSKA 3R7AA 3SR4A 4OH7A 1KAHA 2YQZA 2B4TO 3VAZA 3BG5A 3G9TA 2G9QA 3OJEA 5FULA 5BNFA 4BNFA 1L4MA 3MLEA 2CNOA 4W8HA 4L72A 4MRSA 4DKJA 3NRJA 5DYTA 4LHYA 3ENQA 4LQ4A 3N0WA 3NASA 3GAFA 2VWQA 3BGDA 3RSQA 3UMCA 4NFHA 1KYTA 2R7AA 1ZMXA 1NV8A 2F43A 3FNGA 4ZVRA 1GLNA 1WCWA 4LXUA 3EJ6A 4M9XA 3HNPA 4A1OA 5LLTA 2VZ0A 1AJEA 4QBKA 2BV3A 1W5FA 3ELYA 4U2EA 4DCUA 2FOIA 1A88A 2F59A 2K2WA 4MRPA 4WESB 2WWHA 4EJ0A 4UEWA 5E1DA 3Q9NA 2Q0XA 2UUBB 3Q6NA 5ILQA 3QIAA 4HS9A 2XVMA 2QAIA 2WHXA 2GAFA 1Q1NA 3HPQA 4EBFA 1FJXA 1IBRA 3S68A 3OQIA 4C0BA 4M89A 2HKIA 4IDAA 1FE8A 2PT9A 4CDGA 1P0QA 3NHLA 5EUMA 2BTEA 4A6EA 1DINA 1LCIA 2Q2NA 1VMAA 3RVBA 4FLEA 4GGOA 1UM9B 2VPWA 3BMOA 1G60A 2GN9A 1QYWA 4NYJQ 4N3BA 2D1SA 2NIPA 3ED1A 3HKBB 3LYLA 3NXKA 5FUXA 5GV7A 3UWOA 1B16A 2HA4A 3AUJB 3FFXA 2H6EA 3QPAA 1TA0A 4GE0A 4PZEA 1SBHA 4ZYYA 1LF0A 2FR8A 5FBVB 5CYPA 4JOBA 1M8JA 1KMNA 1DQSA 1Y33E 1DCTA 4PLVA 5JZBA 1E1QD 3IBSA 3SC3A 3WGIA 3BWMA 3CO0S 4XUDA 3DBIA 1EXMA 4WEQA 2J67A 1WMAA 1WVGA 1NKTA 2XGSA 4K3UA 3JWJA 5JROA 5HTOA 4HXFB 7ABPA 1G291 4GBGA 4B71A 1P19A 5BORA 5J2TB 2OZPA 1GOTA 3TAUA 3BRCA 5DLEA 2WK1A 1NC3A 1UBMS 1HURA 4WV3A 3ZIAD 2CVQA 1W47A 4UVDA 5KDOA 3T7IA 1GGVA 2DH6A 5L45A 4K46A 4LDZA 1BWQA 2WHYA 3A36A 4PZCA 1VCHA 4XX1A 4EJ6A 1GSAA 4DB4A 3WXMA 2ZWPA 5CA1F 4RE6A 1XKQA 5JCJA 1RYFA 2EKZA 1IN7A 1AB5A 1A96A 2I80A 1JPNA 1P4AA 4HAXA 5G3ZA 5KDDA 1WPXA 1S2GA 2RC6A 4HNQA 3HSKA 3OBBA 1NKSA 3TNDA 1BS1A 4MV7A 5THQA 1HI9A 2YJ3A 3CPJB 2OHJA 3IALA 2V59A 2ZVJA 4IX1A 4QQFA 1Z2NX 5AVWA 1LFDB 5GJWC 2JAPA 1APBA 1KK0A 4V03A 4UHBA 5DK4A 2EF0A 3VZCA 2OLEA 1NX9A 3OD1A 4PW0A 3K2QA 3LY5A 2FPIB 1XU7A 1AHIA 4TS9A 3IRUA 4RQAA 1XP5A 2GAIA 2R1TB 2VDKB 4C0AC 1UKVY 3OOWA 3AL2A 2FDXA 3VU3A 2D0DA 3RHZA 1KMIY 2FMIA 1P81A 3DO8A 4XH9B 5BQOA 4C07A 2I4LA 4F06A 3DBLA 3N7TA 4K9MA 4IDDA 3ZGVA 1D4FA 4C01A 2XYVA 3DZHA 4LK3A 1RRCA 3ZOKA 2OBMA 4DC1A 2TSYB 1ZLYA 5BT9A 3CFYA 5BSMA 2E21A 2R6R1 3FVTA 3TDKA 1S5PA 4RTMA 3X1DA 5FTLA 4EUKA 1ECCA 2BELA 2YXLA 5C5EA 1CJBA 2CZCA 2O54A 4MLCA 1U8FO 3MRVA 2CUTA 2HH9A 3CUEF 3MUNA 5DBEX 1TKBA 5FF9A 3UQZA 3ZK7A 4EA7A 5FWYA 3OP4A 3VPCA 3EFOB 3INNA 3HCWA 2VYND 3D7KA 1G16A 4ZU6X 1XJ0A 2GWRA 3ADOA 4IOLA 3QGMA 1QGAA 4XM2A 1OKKD 1MH9A 3LUJA 4XRRA 3NONA 3OLVA 4C78A 4RVCA 1JU3A 2JAHA 5EIOA 4MR7A 1VG8A 2AW5A 1QO9A 3C4VA 4S1OA 5K7SA 1GR1A 3SIWA 3BXPA 9MHTA 4K0RA 4UU1A 2OZEA 3CC8A 2GLTA 3EGVA 4CV1A 4MDHA 4TLDA 5BWLA 1H6DA 1QV6A 3LFTA 2UYOA 5CD1A 2QTRA 2XMDA 2BCJQ 2YHUA 4KQJA 4CMIA 4E5DA 3A6ZA 2NP6A 1NRWA 4BJ6A 3CM0A 2ZJ5A 1XZJA 5AW8A 3LOUA 5FH9A 3O74A 1U2DA 3QX7A 2RJOA 3F46A 4R5MA 5LR6A 3HR7A 4KEAA 1NYLA 2WF7A 5IVKA 3AF3A 4HN2A 3QNMA 3TPFA 3FW1A 4MWCA 1PDWA 2R6FA 1WD7A 3CZQA 3BT7A 5BMVF 5DNCA 1G5HA 4BQPA 1Z0AA 2Z8ZA 4RHCA 4J8PA 4UHHA 3IPAA 2TMKA 3JQDA 1JA9A 2EZ9A 2AIRA 1EAYA 3FCCA 1J2EA 5T7BA 3IKTA 3EZFA 4MW7A 3CTMA 2X9VA 2R7LA 2V6IA 3MGGA 5BQ5A 3W3AA 2RKWA 4GOJA 5IM4F 3I1JA 2A94A 4X92A 1E0AA 3M3DA 4D9IA 1WG8A 1KI1A 2OB1A 5DKFA 1KHHA 3QY0A 1PJ3A 3HFGA 4B85A 3KUUA 4WCVA 3NJ4A 2MT9A 2Y0CA 1JAHA 1N3IA 5E6UB 5HKOA 1E4OA 1OBVA 1Y9ZA 3UK6A 1PFYA 1Y7HA 1GZVA 1XCMA 2Q0SA 2QTFA 3WYEA 1V8BA 3ILVA 1PJ8A 2Q1SA 3BKXA 4PYOA 1D2MA 4OHZA 3MSXA 4HDNB 1SZPA 1N9ZA 2PNJA 3CVOA 1JGTA 1N25A 2RKOA 3ND5A 3OFVA 1EM6A 3QQPA 4QA9A 3NQ41 4COOA 3GMSA 3MTQA 1VRVA 1TM3E 5C7LO 1J0DA 1CJVC 2D13A 2HJWA 4TYMA 1QO0D 1R0RE 3CGWA 4FDTA 3OQ6A 5E1BA 3OO1A 1TQ2A 1C2YA 2TRSB 1Y3BE 2V5AA 2VPTA 3DXXA 3QUCA 2PKRA 1R0SA 4ZPJA 5EA2A 5YASA 3DEKA 4WBNA 3ZI7A 4U4AA 2AR0A 1UDWA 4HQOA 4MLDA 3V7NA 4ZOQI 2CD7A 2CL6X 1WZNA 3GT7A 4LZPA 3A4LA 1I2ZA 1DTWA 1JQ3A 1J90A 4CYMA 4LE0A 3RTAA 3CCCA 1NNEA 1VTKA 5IMBA 2NSDA 4RSMA 4LK2A 5EJIA 5EJAA 1GN8A 2ZCVA 3QLVA 2A5DA 4MW4A 3CEMA 1UP6A 2J31A 1CYEA 3IE0A 4OBWA 2FSUA 3RT1A 3DT6A 4JKIA 4NFSA 3U7QB 1J24A 4MSUA 3P8ZA 3T41A 5AIBA 3RUEA 1ORVA 2WWTA 3Q88A 4B31A 2IY7A 2OBXA 1FFEA 4HGYA 2WNHA 2QZZA 2XOKA 3RSGA 3PGXA 1F60A 4R0NA 1T91A 3BL8A 4RH0A 3N0XA 4OHOA 4F4HA 3ZWYA 2WTUA 4NY1A 4RPIA 3SI7A 4R3NA 4PGMA 2OYCA 2OZKA 3HVHA 2A9RA 3SKXA 4HADA 4UEKA 1GUYA 1JTEA 2C95A 3IMCA 1EI9A 2QQFA 3LL4A 4CMEC 1CUCA 5AUPB 5C7OO 4R9RA 3OJLA 1SXJC 3OEYA 2YJGA 4P08A 4KWEA 3NAMA 1TW3A 2BFAA 1A8IA 3T9EA 2ZRHA 3FHOA 2AG0A 1RBYA 4Q01A 1VRWA 3DUFB 4YRBA 3OZAA 1U04A 2OCYC 3UYLA 4DEXA 3JVDA 5BMVA 3JWGA 2ZJ4A 4LVNA 2GNPA 1SXIA 1S3IA 4HSEA 3MTJA 4ON9A 4RHTA 4YAFA 4M86A 3I2GA 4WOBA 4DY4A 5KINB 4P36A 1MHTA 5AW1A 4A8JA 1KETA 4B84A 1PDOA 3FPCA 4HBGA 4DLVA 4JXKA 1YB1A 1O96A 2O2HA 3V2GA 1QMPA 3EXHA 3QELA 4HDRA 5AI0A 4ABYA 3V3KA 3A1SA 1ONSA 2F3SA 4XVCA 1ZD5A 3DFMA 4BATA 4QDUA 3IXLA 1VA5A 1ZCBA 4YHHB 5JJIA 3R8FA 2JLXA 1EINA 1ISIA 2P7IA 1X9IA 3HZOA 3TE7A 4WKGA 4K6FA 3GLKA 3O6VA 4YO7A 5GVRA 3RTBA 5KMGA 2FZKA 4PVCA 3WMRA 1T8PA 4YRTA 3SOZA 5A3RA 3SX4A 3PHJA 5AOCA 2BJWA 1PLKA 4LF6B 1ADBA 3LYUA 1GDTA 4EGSA 2C99A 3G7SA 1EX1A 3HUDA 3MJFA 3PE4A 2V9ZA 1XJCA 4M0EA 7MDHA 5K4GA 4N5MA 2HHAA 5GY7A 1KIFA 1Y9DA 5EHQA 5G0TA 2GPNA 3B6KA 4FSXA 1GSIA 1KZ7B 3AESB 3R6LA 2MINA 4GYJA 4IHJA 1VHDA 4Q3OA 2RC5A 2GJ4A 3LHKA 4NYIQ 5AK6A 1SA0A 3D0KA 4MUIA 4FK8A 4LDAA 1NXPA 4RGBA 5CURA 3DEFA 3FSGD 1L5QA 1CXZA 3W5UA 3K5IA 1QSGA 4NWIA 2VTVA 3VVMA 5AI5A 3NR2A 3U9TA 3KB8A 4KIUA 4AD8A 2C9OA 2FI1A 2CFCA 3ZQUA 4D9JA 3CUUA 2Q7DA 1C3XA 4LY3A 1UPTA 2AFRA 4RF3A 5ALYA 3R3HA 4LV5B 4DA7A 1P6UA 2HADA 3KEFA 5LYYA 4CM8A 2BPOA 4CIAA 2CBGA 3VR2D 2FG5A 5IAGA 3EMBA 3V6LA 4MRMA 2W0SA 5IWAB 4X1OA 2BT4A 4ED9A 1OA1A 1VYUA 3K70D 2QJRA 3KL2A 2GDJA 4IOKA 5TB5A 1G4AE 1V11A 3Q3GE 1GRVA 2XB4A 3PPVA 4OGFA 3H13A 4FR2A 1J97A 1JQJC 3E2PA 1XXHA 3IVGA 3QKWA 2SCUB 3I2KA 3Q7RA 2AG6A 1TA9A 4WBNB 4ETMA 1RQGA 3WK5A 1LDYA 4YY3B 3E9MA 5BNWA 3A9RA 2O23A 3ZWNA 2HGZA 4WTOA 2PZKA 3IP7A 3VPDA 3L8YA 4JLBA 4LWQA 5IBCA 2IRWA 2BJHA 3HA2A 2A5GA 5AVUA 5BOSA 2JJ2D 1J07A 4QASA 4HNHA 1L1RA 2ATVA 5A4JA 2UV8A 5L3SB 1CR4A 2J4FA 2ZYWX 5FRDA 4JT9A 1JPJA 1RNLA 2XHZA 4XTRA 1AXGA 3BQ9A 2R8XA 3AUAA 3G89A 1FYDA 1DQRA 1OHHD 1HOTA 5LJIA 1JW9B 4OUKX 4ZI7F 1X7ZB 1L8AA 5T41A 3EX7C 2BH9A 4D3FA 2J5BA 4Y9UA 2HWXA 1VBMA 2JLAA 3PYMA 2IHYA 3PD7A 3RFUA 1NFFA 3AIOA 2NPOA 1EM8A 2WEKA 5KJ6A 2EQ5A 2ZB7A 4HH0A 1Q1ZA 2EFGA 1VSBA 3FI0A 4G4JA 4OGGA 4RA6A 4DDVA 2XVXA 2PX0A 3GNSA 5H1YA 3ITKA 5JMTA 3J80A 3A9CA 4H18A 3O4RA 5DYIA 4TZTA 4B6OA 3OHPA 2HPHA 4V38A 3K1AB 4KFRA 1EKXA 1P1BA 2PD3A 3E7FA 2QBYB 1IM5A 3E8SA 2C7PA 1XZBA 2O0HA 1AD2A 4J90A 4L9AA 4Z51A 5TR9A 3F3KA 1U65A 5AYVA 3ZTWA 4ND7A 4M53A 3H04A 1CERA 3JR7A 2J5RA 4WJKB 1DXOA 1E0KA 3ZQJA 1GPAA 3WSTA 3BXGA 3FJ1A 1I24A 3PUYA 4EDFA 2X4GA 3FBTA 3ODGA 5TPWA 1UFKA 3VA7A 2DFNA 1YQXA 1SB8A 1YE5A 2O57A 4BMDA 3CGGA 2BBOA 5C1DA 3PKZA 1UK9A 4PG8A 3PZBA 1IXRC 3S1AB 4TZ0A 2UXCB 3IOBA 5IUJC 3PXGA 3T7EA 4AJ9A 1FNDA 3KT0A 3UMJA 2NGRA 1D0SA 1JYEA 1SVMA 3WLKX 5E7JA 3RUCA 4YRGA 1W2HA 3HP4A 4P31A 3ZWPA 3PTAA 2JFBA 1VXRA 3HCRA 3HFJA 2VHYA 4DLSA 2QVGA 5J23A 1UMDB 2JFYA 5TQJA 2IBSA 1BWRA 4G5SA 4HNVA 3K6SB 3U0BA 3LJKA 1QV7A 4OJKA 1V35A 2ZRPA 1LDMA 4B76A 3NPMA 1GTJ1 2ALJA 1DBQA 5GM2A 5KPJA 4KO4S 3U3RA 3V7UA 5AK4A 3IA2A 3PP8A 2OV4A 1XLTC 2AN3A 2EFHB 5TSDA 4ND4A 2VDOB 2AFIA 4RZXA 1M5TA 4GG1A 2ILVA 4WI1A 1QPZA 2XXAA 3CX8A 4RGVA 2C3MA 2GSWA 1OAOA 3NOOA 1SU4A 1D07A 2BMAA 3AY3A 4NQRA 3KQQA 1QKJA 5AW9A 4HO1X 1A98A 3IEVA 5CFMA 1RXYA 2H1SA 1HSZA 1NXVA 4QUJA 9LDBA 1YR6A 2R62A 3T5TA 1JHDA 4X20B 4L6IA 1XXHE 2O3JA 4UPDA 3LF1A 5A6SB 3F8TA 5JRDS 3IPYA 4LC9A 4BLSA 1A95A 2R96A 4MV0A 4XQ0A 1DT5A 1MXFA 3TLCA 5MDHA 2IPNA 2GLUA 3NIGB 4UMEA 4KXFB 1KS2A 3P9YA 5G1NA 5HJ7A 4L1KA 2WZCA 1ZQ9A 2AMYA 1DAMA 4ZA2A 4G1BA 5B58T 3WZMA 4D2IA 2H7CA 3T7CA 4EG6A 1NHWA 1B8PA 1SULA 2VT2A 1UQRA 3A05A 1RC1A 3BTSA 4QOHA 4EHHA 2D1RA 2RFLA 2ZVQX 3JWIA 2HDWA 2XMBA 1Y7PA 3A6HA 1P74A 1KOJA 4GP6A 1KSHA 4HDKB 4Y1FA 5DN6D 2WKQA 4AKIA 2Q3HA 1P1IA 1RP7A 1LEHA 2PMWB 1GADO 2G67A 1M5RA 4Y2TA 2YWJA 3DMYA 5BVGB 2DQZA 3KXIA 4AWAA 5EIFA 3S29A 4JP3A 5F9MA 5K0LA 5CXXA 4IXTA 3C7CB 1CJSA 2F3QA 1DI0A 1M7BA 1PWZA 3LVQE 4UPVA 5DTRA 5A7GA 4DJ5X 4YXFA 2O3QA 3A26A 1ZO8A 4ZI2A 9GPBA 2DGDA 1EX7A 3CWQA 1ZG3A 4XYBA 4DR3B 1GDHA 3C97A 3PG5A 1G21B 2UZ0A 1TCBA 3CSUA 1O5TA 1RCUA 4IHKA 2ET6A 5E4FA 3GUUA 1QHHB 2AI2A 4RELA 3OU2A 4D3DA 4B3RB 1FY2A 1B00A 1GILA 2EJWA 1JR2A 2H2HA 1YCDA 1GCGA 3V1NA 3F6YA 1NWHA 3EGWA 4BTLA 4YV2A 5BXYA 2JI9A 2BEJA 2V65A 1ONPA 4CI9A 3I52A 4C0KA 2FCAA 5CAEA 2PMCA 1ZR2A 1Z0FA 3N8IA 2NN3C 4UMDA 2AUNA 3MPOA 3TMKA 5BV0A 3EA4A 3RS3A 3IKVA 1JI0A 4EIWA 1JSLA 1KZGB 1LDNA 2PRIA 2YOGA 1D6NA 5CCBA 2QV7A 2WINI 4OYYA 1D8AA 2KE5A 3NP7A 3IODA 5ER6A 1R74A 2DFKB 3B5EA 4NX2A 4O4IF 4DM3A 5C18A 3U7HB 1QOPB 1Q0SA 1GA6A 1Y3HA 1KFEB 3O84A 4GC5A 3LHIA 4YLEA 1JDBC 1B8VA 1NF9A 3M5DA 4IXDA 3P0RA 4YJ2A 1NU8A 2QZSA 2JGJA 3JZDA 5CVTA 3IP3A 3U49A 3A06A 1CCWA 2ORWA 3S2GA 5KYUB 4GI3A 4WFKA 2GBLA 2OORA 3EIQA 2G70A 3ONWA 2PZGA 2J41A 10MHA 4WECA 1AZSC 3PLNA 5TLSA 1CY6A 1V39A 3PFNA 1KYWA 4EI8A 3K0SA 3EG9A 1T3HA 3L6OO 2ENUA 2B8WA 4P4SB 3PITA 1NQUA 3ZV5A 4EG8A 4F3RA 2J3QA 2YXNA 4IIYA 1L7PA 5AJVB 4YH1A 1XNQB 2R1UA 2EEPA 3U26A 3CJRA 5IJZA 2PSDA 1KI7A 1SVUA 1WDLA 4XIFA 2W00A 2RHBA 2VSNA 4HAWA 2ZRAA 4RMGA 5LZ4A 3U3OA 1FDIA 5AJUA 4QODA 2GUWA 5IKPA 4A8PA 4IGIA 5BWOA 2RMKA 3FZEA 1EBFA 3EPKA 1AKQA 5EJ7A 3G23A 3EEOA 3E15A 5HRUA 2XQFA 3UZUA 2NLOA 5MHTA 2DE0X 4C22A 1KEEB 2WLSA 5DCUA 3U6KA 1N2HA 3PGA1 5B7PA 5LDHA 2HBZA 3MILA 3P2OA 2W7TA 4G1MB 3UICA 5CNKA 2XCTB 1AQJA 1XNHA 1X7WB 3D7MA 4ZIRA 5JXGA 4NOLA 3MJRA 3JQFC 4D9EA 3U44B 3SWWA 1M1ZA 2I2BA 3HRHA 1Q2XA 4F9EA 4UM9B 2PUCA 5K09A 5BSUA 2BCEA 2IDKA 3Q8WA 2Z56A 3ELWA 1FMTA 4F3KA 2P4QA 4AW9A 4YV1A 3IQEA 3F49S 4EHNA 3EXIA 5CFRA 1KO7A 2YH2A 1P1RA 2ZE7A 4C04A 2JBAA 4LGYA 2VHJA 4HLUA 2FZWA 4RHUA 3USES 5AUOB 1VHJA 5E7QA 3DV0B 3SX0A 2AN1A 7GPBA 4PSAA 3KQUA 1DHRA 3URKA 3PKIA 1PFGA 4N9QA 3PC2A 1KH1A 2I9KA 2IL1A 3TVTA 1JR3E 1ZN7A 4IQGA 4EEXA 2JIOA 1MOZA 4Z9XA 3KIPA 4IDEA 4OJYA 3C41J 3DL7A 3ROFA 2PKQP 1TYEB 2C5GA 3GU3A 4YQZA 3G5TA 4RSHA 1Y0BA 1IWOA 1NR7A 4QECA 4DBZA 2OCXA 1DKUA 4X8MA 1WXIA 2C7GA 1COZA 3GGOA 3NG1A 3ZI0A 4UAVA 1J9EA 1A50B 2Q9BA 5DOVA 3ZY5A 1XEWX 5F3RA 3OQOA 4FHCA 4OOEA 2C07A 4ER0A 1NURA 2OOSA 4DZTA 1QXSA 2X86A 2ZXFA 5H80A 2OHFA 1HL3A 4L4ZA 2OMEA 3LP6A 3N6RA 2SNIE 2A33A 2ES4A 3S2FA 3NB0A 1XD8A 1DU4A 3QVJA 3C3PA 3HDGA 1GU1A 2VSQA 2GTIA 3GFQA 3V1MA 3GBSA 4A2CA 3LGXA 2Q1WA 1LBIA 1MW8X 2OLJA 1E3DA 2FYTA 5L53A 1K1EA 3IAAA 2H29A 2JJMA 2PL1A 2V0CA 3UG6A 3ZWDA 2VJQA 4AB1A 3LVBA 1L6IA 2I2DA 2VAWA 4F72A 2N9UA 2HRCA 4WX2B 4W7HA 4F9GA 3NEAA 2OQ2A 4N49A 3AW9A 4OQYA 1QB7A 3TUZC 4AAYA 1H2BA 2R87A 4WBXC 2WM2A 4NE7A 3DH0A 3GEDA 1JIKA 2H1WA 3DULA 3B5IA 2PCJA 2Q28A 3KYDB 2FX3A 1TCAA 3VSEA 2FJUA 2JCVA 3N2ZB 1ZS9A 1W1UA 2FSIA 2JZNA 3KHUA 4URWR 3B2QA 4OSOA 1H2AS 4R0VA 4YROA 4BRZA 1EUZA 1MQ8B 2V54A 5BQXA 3MTGA 2J6BA 2O05A 3QLJA 4ADSG 3U44A 2NO4A 1T1JA 4PRZA 3A2KA 5EIBC 2JFUA 5G4LA 5EIEA 4RYDA 5ITZA 4Y2GA 1FS4A 5J5VA 3D6VA 3ESYA 3URMA 2K7FA 3HA5A 4CM4B 4P7BA 4QBIA 1NBEA 4UD2A 2CDRA 2K7ZA 2PJDA 4C4AA 2HSEA 1I6KA 2RAVA 3OFNA 1E61A 1R0YA 1QYCA 4BKQA 1UJNA 4LJAA 2G4CA 1H2WA 1UOOA 2AE2A 3RLIA 1U5AA 1VPEA 2PA3A 3RGGA 4PG4A 4PLHA 3UA3A 3VU0A 2DR2A 4AC9A 3RC2A 4KITB 1IHXA 1O9GA 3F3YA 3UPUA 2P11A 1D7AA 4HPWA 4J91A 2FR8C 4RAQA 2QZJA 3TQTA 4BKOA 3T4XA 3P7MA 4TL9A 4WFJA 2VDJA 3I5AA 3THYB 2ODQA 1LPPA 3AEXA 3OT1B 1S2IA 4Q6BA 2A9VA 4IJQA 2HCBA 5AJTA 4C2AA 5JH7B 1E96A 2IHUA 2FG6C 1ZJ5A 4OM8A 4P53A 4JYPA 2MIIA 5IK2D 5FUQA 2OXFA 4KWIA 3W5JA 3OKCA 3V8PA 3T35A 3PXUA 3MJEA 5CCEA 3O2QB 2YNMC 2QE6A 3DAOA 1O5IA 3OSZA 1W4RA 3DE3X 2R66A 2R47A 4KG7A 3ZWKA 4W1SA 1IY8A 3LWDA 4NTZA 4N5NA 5BYAA 1OYVA 2WT4A 2AG5A 1VBKA 2WOJA 2HV8A 1VJ1A 2Y71A 3OE1A 3PDHA 3QKSB 4IRUB 4QOIA 1J8DA 4MPJA 4Q4HB 3IE2A 4Z99A 4C2TA 1TRKA 2PMDA 4TRMA 1M2FA 1YU6A 4YAWA 4UHFA 1S4MA 3HZRA 2H8GA 2B36A 3NTQA 4ZV4A 3SZUA 3BEDA 2H11A 3RAPR 4HEHA 1QUFA 4MWBA 4U7GA 5HS6A 4A8TA 1QP8A 4B6QA 2JEYA 3SFTA 1KEZA 3DOCA 1N78A 2H7XA 2HIMA 2QP9X 4NCJA 1IN8A 4EEKA 4D5GA 5GVSA 1HNWB 4ALJA 2VWHA 4C0XA 2HEGA 3DV9A 5JNVA 5K0JA 2F7SA 3PPIA 4HATA 5FWDA 1N4AA 3PEFA 1WKCA 1DPGA 1US8B 4TKMA 4I1UA 2EHJA 1Z5NA 1PI3A 2ZI4A 1Z28A 3H0CA 3O8QA 4M9UA 4MV8A 3QWAA 4XASA 4DQLA 1RDFA 1SAYA 4C7MA 5JDIA 4HN4B 1OKKA 3S0JA 1KI8A 3HKDA 5I4BA 1XR3A 1QZZA 3DOOA 2ZB4A 4P84A 5FPYA 2IZOA 1DRJA 4DSUA 3BMNB 4PSVA 1CVIA 4C3UA 1VE5A 1IQUA 2WT8A 4H3SA 4PXSA 3S81A 2AKEA 4NQZA 1S8FA 3A9WA 4FHDA 5DRYA 5A5DA 2PY6A 3K09C 3RU9A 3SEZA 5CHEA 3G13A 2OXRA 3LXXA 4IKEA 3D2LA 2HWKA 4P4UA 3KHTA 3PHLA 3L3BA 3EGDA 4CCYB 1W30A 1Y34E 4Q4JA 1KI6A 1UFRA 3CKKA 4QULA 2X42A 1C7FA 1DRVA 1UC8A 2XHEA 5BV7A 3NC4A 1L7BA 3KLBA 3KPJA 3ZDEA 1QE5A 2I2XB 1BQEA 4QC2A 5CB8A 3T3OA 3EY9A 1HPLA 3VZRA 1G20A 3GRCA 3T3NA 4LC0A 4KXVA 1H94A 1ZGBA 4TYNA 4XCXA 2GM4A 2IGBA 3U40A 1VB3A 2ZIEA 4YXWD 4HMQA 2SICE 1Q7BA 3EK2A 3AUKA 2XZDA 2A92A 4TLCA 4S12A 1FUEA 2VUUA 2XH8A 4HX2A 2FQXA 4KO2S 1XDSA 4UBOA 3GROA 3KQMA 1UCFA 5I3ZA 3QI2A 2OENG 1AE1A 4G8BA 1P9RA 4DJTA 4BGDA 5HZHA 1KDRA 2ATCA 5E9AA 1KEVA 3UKOA 3HP1A 4M9SA 3SYRA 2PGAA 1FYWA 2XT6A 4QQ8A 3PE3A 1XE3A 1CLUA 2LE0A 1U3CA 5LIRA 2MSNA 1R6VA 3QWFA 4PPYA 2GLXA 4MZXA 3WGGA