2AF3C

Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
332
Chain Sequence
VTFLEKISERAKKLNKTIALPETEDIRTLQAAAKILERGIADIVLVGNEADIKALAGDLDLSKAKIVDPKTYEKKDEYINAFYELRKHKGITLENAAEIMSDYVYFAVMMAKLGEVDGVVSGAAHSSSDTLRPAVQIVKTAKGAALASAFFIISVPDCEYGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSYSTKGSAKSKLTEATIASTKLAQELAPDIAIDGELQVDAAIVPKVAASKAPGSPVAGKANVFIFPDLNCGNIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIVGAVAITCVQAAAQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphate acetyltransferase
publication title Structural and functional studies suggest a catalytic mechanism for the phosphotransacetylase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
total genus 111
structure length 332
sequence length 332
chains with identical sequence D
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 2af3C02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2af3C01
2AF4C 4E4RA 1XCOA 1QZTA 2AF3C 1R5JA 1VMIA 1TD9A
chains in the Genus database with same CATH superfamily
2Q5CA 1SBNE 3U7QA 4TMVA 1CFJA 3UMBA 4DNXA 3KSAC 1I4LD 3O8BA 2ZJ8A 1AE1A 1UK9A 3WRXA 1P4GA 3C5HA 5EIWA 3REQB 4RTQA 3N75A 2ZT6A 2W6IA 5BT8A 1SC9A 5IM4A 3F9CA 1NURA 2FP4B 4D44A 2GVDC 2KSQA 3DMRA 5DLQC 1BA2A 2XA9A 3GQBA 2WF8A 3BL5A 3MGKA 3M4YA 4GAEA 1H1TA 4J6FA 1M2VB 3QW4B 4FGKA 4IOLA 5DNAA 3P19A 1MAUA 4LF7B 4Z3KA 5ED4A 1PS8A 3K2EA 3OCZA 2JRCA 4RK7A 1NUHA 3W4JA 4O4HB 3R0XA 4YAKA 1CVLA 4NG4A 5BN4A 1NVTA 2FVYA 4OSEA 4WE3A 1KI4A 5ALTA 4TTRA 2V7PA 3T95A 1EXNA 4C20A 3A1EA 5AJHA 2HLHA 1YJXA 5F64A 2ALJA 3T5CA 4B5KA 2O2IA 3CEPB 1AA9A 2WTBA 1RJ9B 4KJZA 5FYDA 3AHCA 1FFXB 3VSAA 4Z54A 3ABSB 3W8FA 5AOBA 4E1BA 1V11B 4UVHA 5A7FA 8ADHA 1YQDA 3Q0IA 1CRQA 2PANA 1SXPA 1O77A 2QLBA 4OM7A 2POCA 1OH8A 1NULA 1NXWA 4IZOA 4MV4A 4OHXA 4H27A 4OQQA 4U02A 5AKLA 3OFKA 3PSHA 3KFXA 2F1JA 1EA7A 2L18A 2QEQA 2MINB 4GLBA 2X15A 4PPNA 5TMDA 2OXTA 4ETWA 4F7WA 4PTYA 3NDBB 2NUAB 2R7KA 3KZNA 4MQEA 1NBHA 4V0RA 3KPYA 2WOOA 3M70A 4QXAA 1E6WA 4DWVA 4Q5IA 1IK4A 4GP6A 3TW6A 3UCXA 2VK2A 3T1YB 3O75A 4UUOA 4BNZA 2SHKA 1Q1ZA 3RFXA 3UPDA 1ZGGA 2Q9BA 1DAIA 4BNDB 2IXBA 4XD7A 2XXAB 2D8MA 1KQOA 2Y0PA 3EVBA 3HCEA 1DJMA 2GM9A 1E4YA 2AZXA 1J21A 1DWQA 1GR1A 1KU0A 4LK2A 4DLLA 4JGIA 2B8WA 2ZAGA 3LRXA 4UHBA 4EG8A 4O3MA 3ZWNA 3JQFC 4R68A 4BNYA 5F7JA 5EZYF 4PC3A 3VH2A 1MLDA 3WK8A 5C8YB 3GMTA 3DMGA 4E7PA 1CUUA 2OCAA 2VHJA 1SCUA 2P4EA 3HDYA 4DQKA 1K68A 5DGIA 4EY8A 1L9KA 4ZIRB 1A76A 5IP5A 1UMDB 5TV2A 1RQXA 3D59A 4IXWA 2Q4BA 1BDIA 1P7WA 3BFXA 5LYYA 1Y8QA 1WF3A 4DFDA 4RWEA 4TYNA 1Y6GA 2VC2B 2IBMA 4FNGA 5EE1A 5HA5A 4GOMD 3AEQA 4KRYA 3ADBA 3KQKA 1A50B 3MCUA 5BSRA 3RYCA 3L7BA 4ROSA 1E7WA 3WGOA 1ZUIA 3IIKA 1KRXA 4NAUA 3OQPA 2ZRFA 4QM6A 4A91A 4IIVA 5K4AA 4IHQA 2UUPA 1NJ8A 4JSYA 2BBSA 4AIIA 5BN3B 4AJEA 3W8RA 1J9ZA 4Q4AB 1UJNA 2QRMA 1BEEA 5KQSA 4JU9A 2FZVA 2RD2A 5JADA 1EJ6A 3TVDA 1PFKA 2WA1A 4HAWA 2VBIA 4BV3A 4AS2A 4UHJA 1IHPA 1Z16A 2YMQA 1AQ6A 3I53A 4ZAWA 4JI5B 5JEDA 4F60A 3OJEA 4C06A 4LPKA 3QGMA 4BNNA 2BEWA 1XPOA 3GG2A 3NBYC 4ZALA 1R6VA 4K6CA 3NOXA 3WWOA 2XUIA 1GPNA 3GF4A 4BWVA 5IK2D 3HRIA 4H1VA 1G3IA 1N6LA 2C77A 2ZQZA 4MQLA 4AXXA 5ICFA 2DP4E 1LCIA 2ZZKA 1AXEA 4FNAA 4NRDA 4PTLA 3TH5A 4CLXA 3LDHA 1G8KA 3GRRA 1VKNA 3OI7A 4J75A 3M4XA 1WPRA 4EJSC 4Q00A 2CZCA 2IW1A 5LBUA 3K20A 2CDAA 2QVBA 2DF8A 5FJJA 3G9UA 2AN3A 2AXPA 4G0WA 4ZI2A 2QR5A 3ZGZA 3IE0A 1B3RA 4BNTA 1UBSB 1SMKA 4LZOA 4N8EA 1JIJA 4P08A 3R7BA 3RU9A 2BE9A 4WLFA 5CBKA 5FEUA 1ISSA 2R6GA 3OBIA 5IKPA 1NRXA 3WIVA 2BGJA 4L5CA 5CH8A 2IUUA 4LWOA 5LXTA 1NF2A 2VQ3A 4ARIA 2GB4A 1C7JA 4EG0A 1TIKA 3A7DA 1XTKA 2ZW9A 1CQIA 3I01M 4QUKA 3SXJA 1CZRA 2HDOA 1Y1LA 2WAMA 1MB4A 2IDZA 4G01B 2GASA 3AIOA 2XCOA 4NYMQ 3OQNA 1Q14A 4F1JA 4X60A 1M5RA 5JCOA 1I51A 4TUYA 1XZGA 1OLXB 1QFJA 5JYDA 2I29A 2NXCA 1H0RA 1QH1A 5L4SA 1TCUA 4GSLA 2AKYA 2RHLA 5KVSA 1T5IA 2OYCA 1E0DA 3A1FA 4MKGA 2BWJA 4BATA 4Q3DA 4N5IX 2A1TS 2WKPA 3IODA 1PR1A 1RQGA 4YQEA 1GG5A 2WSBA 2Z2JA 3CTMA 1AKEA 4NZNA 1T2AA 3CNEA 4QAQA 4A82A 2QQ5A 4J1QA 3QTTA 3CBQA 1JDZA 4X61A 1DMSA 2AUTA 3Q1LA 4HQFA 4XZ3A 4B4DA 3OE5A 3QF4B 2CNKA 4XR4A 5G3ZA 3RC1A 3QSGA 4HCJA 2H2AA 1TYZA 3JTMA 3UWOA 1M1YE 3FB4A 4PCVA 5BV0A 5GPBA 4LXYA 3RVJA 1NNSA 1OFUA 3AXTA 2RE8A 3LBYA 1OAOA 4TQUS 4HPXB 2P79A 3G2NA 5TPZA 1FFGA 2QN1A 2Z5VA 1FF9A 2RGRA 2QMUA 4JYPA 3DEKA 4KUEA 4D02A 4OHZA 1MKYA 5B7PA 2F3PA 4MQBA 2YJNA 3L4KA 3O4VA 2VUHB 4LXQA 3VO1A 3WADA 4K46A 4R5HA 4FB5A 4JXXA 2UVDA 1PJCA 1EYZA 3EEIA 1IK6A 4FILA 4DEXA 5BV7A 4IGIA 1XDDA 1YHNA 4PBTA 4KK4A 4PS0A 4UE2A 3K8QA 4A2WA 5J2UF 3DGFC 3JYOA 2QZ4A 1ESNA 2XHZA 1NMYA 3TD9A 1V7QA 4CM7A 4J1TA 2X22A 5DBFA 4ARUA 2OO3A 3GRCA 4GR9A 1ICEA 3HXPA 2I6FA 4X7BA 3HP4A 4G5OA 3EMVA 4Z9FA 4DZTA 5JO0A 1CJTC 4B35A 2X1VA 4J8PA 1RWKA 4LBYA 5FBKA 1NMXA 3FIJA 5TJHA 3Q7RA 1A2KC 3VKWA 4YWHA 4MI6A 5L3RA 3TW0A 4F93B 2FSIA 2WZQA 3QFCA 1ZVVA 5JAIA 2AC7A 2P1RA 3M4JA 5TQJA 1AGYA 1BXKA 1RC8A 3IAHA 2JI4A 1WSDA 2R8YA 4WFKA 1OX5A 3KFVA 1DL5A 3LC0A 1JNYA 3R8XA 1UIMA 4AM8A 3JQ6A 3L6CA 5DI9A 3T7JA 2QTNA 5BWCA 3DDHA 1K63A 1B6TA 3QU4A 4DPMA 4DC1A 2JI6A 1BW9A 1L1RA 4L2IB 1T2UA 4XTCS 1P1KA 4EHBA 1G3UA 3HL4A 5BNIA 4RVSA 4XWKA 1VLJA 3BORA 2B36A 3GVHA 5JQGA 3G6KA 4I0WB 3T3IA 4O63O 4Y9SA 1EZ4A 3C5WP 5FUQA 1K3TA 1XA0A 3BDVA 1ATZA 3B8HA 4E7OA 4IH4A 1C0IA 2KMLA 2QM7A 2FNAA 3HCDA 4IIBA 2ZZMA 1V9LA 3G0OA 3ZDFA 5CDHA 4R9NA 3E81A 1KK3A 3E9YA 1WBDA 2ISSD 1JVNA 3HXKA 3FJYA 3L4BA 3I12A 4CR7A 5DCWA 3IBTA 2ZRLA 4XI9A 3J80A 1MQ9A 4I5IA 1L4HA 1V26A 2JJYA 4ANFA 4K9SA 1K1EA 3L43A 2J30A 4HDOB 3DNPA 3ZWMA 1BJRE 3QWAA 3A6DA 3A3OA 3VISA 4BO3A 3DONA 4CNQA 1PNRA 1T0HB 3EQ9A 3VZPA 2CKDA 4LV8B 4BFVA 4BVHA 1OFIA 2G80A 2Q5FA 3E1GA 5K3SA 2ASVA 2CDRA 2W6JA 2ZWAA 2PCJA 4MUEA 2ZAYA 5ESDA 3URMA 4BFCA 1G38A 3HNOA 4AK9A 1TTQB 3F5QA 2D8AA 5DOVA 1Y7TA 4HYEA 5EQFA 5HQ3B 2I0FA 3WL8A 3UWMA 5JAHA 1WMEA 2VWQA 3ZK9A 1AKUA 5HSGA 3DVQX 4ARCA 5E1OA 3J81A 2YR0A 1Z6XA 4OHBA 4TTTS 1RM5A 4REOA 3NAGA 1X7XB 5AJVB 5A4KA 3PT9A 5BSHA 5I3ZA 4RIGA 5E6SA 3L7MA 1GAEO 4NK4A 4ZJYA 3OPXA 2NVUB 1BCRA 1WD5A 3GZJA 4PTZA 2CK3A 3PGA1 1WXQA 4NX2A 1RWNA 4NAHA 3II6X 4XEUA 4ETIA 2K5UA 4DMMA 4Z9AA 3TLBA 2PKQO 2CYCA 4TSFD 2IHBA 4M0FA 5IEJA 2W2XA 1LWOA 2O7NA 4MUXA 4E94A 4ISCA 1QZ3A 3B20A 3AEKB 3JATB 3QRWA 4QU9A 2J3MA 1A82A 4FFBA 1LX6A 1WCIB 3DPIA 4FT2A 3NRCA 4FZ3A 3L1VA 2IPAB 2I2XB 2NT3A 1Z2DA 4RETA 5B7NA 3PUVA 3HTXA 1K89A 2R6ZA 3UAZA 3WKCA 3G8CA 3PFGA 4PO1A 3OIVA 3W5CA 4N6NA 1WCWA 2HHLA 1RKXA 1TM4E 1U7XA 2J33A 1T8SA 2QRVB 2Z2XA 4QYMA 1Z4OA 1X7HA 1ZG3A 4ACAA 4IXNA 3R20A 5DBHX 5LCXA 3K09C 3CPJB 3KYCB 4X84A 3JAKB 1ZLXA 3P9SA 4UD6A 4UEJA 1Z6YA 2I3DA 4L4UA 4M0MA 1ECFA 3E48A 3MIZA 3QBJA 1XLTC 1T5LA 3ZG6A 3H4MA 3IR7A 1E79D 2A88A 1TM5E 1YF3A 3ASZA 5IX8A 4AWBA 3VC7A 5B1DA 5FL7D 2BM8A 1DKQA 1VKOA 2EQBA 2SCUB 3GROA 3KSDO 5FOUA 4ALMA 3L7AA 4DUGA 5LZ9A 5LM3A 2GSDA 5HMLA 3K0HA 2I2AA 1NBAA 2JL1A 4U4AA 2ZB7A 1AGNA 2OM6A 2OV8A 1NVGA 3K4PA 4M6WB 5HIMA 4YV2A 3ANXA 4KAAA 2HJGA 1NNUA 2G4LA 2C83A 1Q21A 2O2DA 2GOYA 1CQPA 3HDHA 3LBNA 1RYEA 1E2HA 2I78A 2BKVA 2NZVG 1VYTA 3QE9Y 1K6XA 4NU8X 4D4GA 4REQB 2CCKA 4K9PA 1GA6A 2B1QA 2C8KA 4TS9A 1KQPA 4QOEA 2GF0A 3B6JA 4WL0A 1XRQA 1P31A 2OHGA 2OAGA 4L51A 2F2TA 4Y18A 2COUA 1NP3A 3H0EA 2PRZA 2EZ8A 1VMEA 3UHOA 1ZH4A 1QE0A 1BWPA 1K6JA 1SKBA 1Q7RA 3NWJA 5H82A 3UH1A 2YYZA 1DKRA 1JDUA 1M2HA 1TF2A 3ZGXA 5TS3A 3CEAA 3TIVA 4EGAA 1DBIA 2PG3A 3BWBA 3R3HA 3HL0A 3O8OA 1WMDA 4Z4FA 3BQ9A 5DWQA 2IFTA 1N8NA 3C3AA 5BSVA 4B3TB 4YAIA 1U9IC 2RC6A 3VHRA 3LZCA 3KCNA 2BBWA 4Y9UA 4YX9A 4Y6OA 4OFWA 4HJXA 4WN9B 1N5LA 3A3NA 3AKDA 1AS0A 1ZN8A 4TYQA 1XT6A 1Q50A 3R7WB 3ZQ4A 1XROA 4QOFA 3SZUA 2G1UA 3CXRA 1OU4A 4ZODA 1WD7A 4WZZA 3AY7A 5FWXA 4XCQA 3KAKA 1IXRC 4AJOA 2IHYA 4B81A 5KOHB 4RTJA 1VLHA 1SC1A 4BLOA 1RWWA 2LIPA 2JIRA 5DHQA 3N2NA 2WBLC 3PIDA 4IIUA 4YV0A 1IZZA 2OORA 1FDIA 3NC1C 2R00A 2IEZA 2RBGA 3NHLA 4HNGA 4PAOA 4NABA 3ZLVA 2I4LA 3MW8A 2YNMA 4TPKA 3PJFA 2Z30A 4OI0A 5IAAA 1U0JA 3DNFA 2PS0A 4RPKA 1NX6A 4FSDA 2X5KO 3H9QA 3DEJA 4HH1A 2ONYA 2ZULA 3FUTA 5DGTA 2XVMA 1E20A 1Z74A 3HYRA 4YT2A 3QE3A 4E33A 4Q4JB 4RK1A 4RZIA 4HOYA 1QB7A 3DBRB 5FAXA 4YQFA 1KYZA 3B89A 2RGGA 1YACA 2RBEA 2YJ4A 1DVRA 2IE8A 1VA4A 4UPDA 5JSKA 5KSOA 3IQXA 2GAIA 1OASA 1PWXA 1T1SA 3LUKA 1FFAA 1MXFA 1W4ZA 4LF8B 3ICQB 2XMDA 2NVOA 3OFJA 3UGTA 4AJ1A 4ENTA 2VATA 4PN7A 1DP4A 1UZUA 1K97A 5CCBA 5IASA 1GQYA 4WKOA 4QLBA 1UXKA 3K16A 1EXWA 1U5CA 1Y5MA 2DFDA 2B8JA 3ZD8A 5IT4A 1H3NA 2IU4A 2ZXFA 3P4XA 3RLFA 3CVUA 1GQOA 2QYOA 3DV0A 3IP1A 2AYXA 2WT4A 4FEYA 2B2CA 4GX2A 4HSEA 4OQZA 3UJ8A 3BJIC 3D8HA 3K71B 3LHSA 2Z09A 4X7PA 4E12A 2QN8A 3MCVA 4HZUB 1L7XA 3CO0S 4XWAA 4FWTA 3INNA 1PJ2A 1Q1BA 2SECE 1W5TA 4X1YA 1V3UA 1R1DA 3ZIUA 4F7DA 3ELYA 1E3WA 4C4RA 3CZAA 3MTAA 1XAHA 1GRRA 2XDYA 2NTVA 3FLAA 3N87A 4Y7DA 5ITZB 2CMDA 2P3LA 3E22A 3GRPA 4KU4A 1EXVA 1JHDA 4UCXA 1Q5PA 4DTCA 2G8NA 4ZYLA 5AOVA 4JBLA 2AQKA 1V5FA 4NBKA 4DLYA 4MAFA 3TCXB 4K26A 1JPUA 4AG3A 5THXA 1FSZA 3FFTA 2HXYA 1DKMA 1VP3A 1TEHA 1ZY2A 3IBSA 1VLZA 5J4LA 4M7WA 3BZWA 3ZDRA 3FI0A 2VK8A 2AFIB 2D7DA 1T2FA 2A5LA 2LTAA 3DHVA 3VYRB 3V80A 4XVRA 3WFZA 4EHLA 3GJ7A 4QJIA 4JR1A 5F9FA 1US8A 1E62A 5EJ4A 2UUBB 1IJFA 1OSNA 3JASA 3K31A 1FMLA 3M5WA 4G8JA 1YQQA 2A7QA 2P2CA 2GBLA 1JSZA 2P6UA 2UYGA 2C2GA 5GOZA 2OM2A 2XT9A 3EXFA 1I7QB 1GL9B 2VQFB 3O3OB 2IYEA 2C7GA 2FMFA 1J8DA 1W75A 1V39A 3HKEA 5KWJA 3V9AA 2X0DA 5F1PA 4LXGA 2A9JA 2LW7A 3CNQS 1AX9A 1XMIA 3FG9A 3FHJA 3TQSA 2ZETA 3I28A 3H2ZA 4AJPA 1P6XA 2XF2A 3BJEA 3NM6B 4DLZA 5ALLA 1ZVKA 1SBZA 2OPBA 4D8UA 5HMMA 3IEUA 1B8UA 1XD2A 2QAGB 4CKBA 5EZYB 1I3OA 1GPUA 4FZ5A 1TAUA 4O4IA 3Q12A 4DCCA 1XPRA 2BGKA 3PE6A 5F7XA 2Q50A 1VKZA 4POOA 1S8FA 3AM5A 3WLEA 3U7FB 3BGVA 4R1QA 3DXZA 1ZKMA 1N1GA 2VJQA 1JJAA 4QQFA 4JI1B 3GLGA 4YCNA 1TU3A 4PINA 4FB4A 4QDZA 4I36A 1L5KA 3S2FA 4ABYA 1D07A 3FMFA 2GD0A 1JN0A 4QBHA 1CUYA 3IKTA 5B2FA 3SC2A 2D5BA 2UYHA 3O91A 3OLQA 5SZKB 3ONVA 3INYA 4R4JA 5AYVA 2I9PA 3GJ0A 2WHYA 3KEGA 3P26A 3R3YA 5COAA 5K3DA 1UH5A 4TTAA 1FUIA 3PNQA 1B7GO 1UCFA 2QU7A 4L8VA 1E59A 1NJ6A 5F52A 3RC2A 4UU8A 1Q7TA 1SUFA 4JLSA 5E6UB 4YUWA 5M2QA 1DEHA 1OFTA 2DBRA 1IQUA 3CUVA 3EIEA 4HHEA 3WGGA 3AI3A 1K88A 1O8BA 1W581 3VR4A 1X1TA 3O2QB 2J7PD 3UJ9A 4EVRA 1ISGA 4X1KB 4L4YA 4LXHA 1SJ9A 1VL0A 5IH3A 5DT2A 3S1SA 1O9GA 3V97A 4E30A 3AVPA 1H2RS 2RHHA 1MIOB 3FUCA 1Y34E 4M0PA 4EA7A 4FR0A 4DJFC 3PCTA 1V2GA 1DELA 1JZQA 1XEWX 2FR1A 5AUNB 1P6QA 2J4CA 4MJLA 4EB6B 1EP9A 3I6ZA 3GNSA 3U13A 5FWAA 4DEVA 2V7WA 3L6OO 4HLNA 3GWGA 3IHTA 1XYGA 4KH0A 4OHVA 5D8DA 2FF7A 1ISHA 1ETUA 1RWMA 2GK3A 5KWIA 3AW9A 2Z2IA 1T36B 4L0DA 4UTZA 5FP0A 4ESOA 5JOQA 1MQAA 4C0LA 2QV7A 2JFQA 1O5OA 4LG1A 1SPBS 2C61A 3UMJA 2V9CA 4W7HA 5KJ1A 2VUIB 3OOSA 2HJHA 3GRFA 1W94A 3CW2A 1D2CA 2UZ3A 3BA1A 5TGZA 3CVOA 2XCTB 3GNTA 5A4AA 3K9QO 4AY2A 4ZVTA 5JWHA 2YC2C 5HF8A 2FF5A 1E98A 1P4HA 3JR3A 4MJXA 1YULA 1U31A 2PE5A 2DB3A 5B58C 1PNTA 1CHDA 1WZEA 3K35A 2QGFA 4M22A 4F84A 121PA 3H9BA 3LL4A 4EL5A 5L3QA 4E6EA 3R24A 5KDDA 4YMIA 3RI3A 4HDMA 1WXDA 3HDTA 3STYA 1K6IA 3PS9A 3GG9A 5FORA 3O38A 4M0CA 4MDEA 2XNSA 4BASA 1UANA 1Y80A 2N3ZA 3ESDA 4UBKA 5EZ6B 2QP3A 1ZM3A 4X1OA 1WKVA 3V7YA 1R4ZA 3DE3X 4R51A 3TUJC 2RBKA 4OI4A 1CDEA 2ERXA 4JBIA 2VF8A 3O2SB 2HF7A 3SYMA 3TZ6A 2FE4A 3AF0A 1NTRA 2JKYA 2FRDC 1EIWA 1DLIA 4F9EA 2OMEA 5D5PA 3W5HA 1R0LA 2EFGA 2VKQA 1ONNA 5CFZA 3LA8A 4W9RA 2ZRGA 3UENA 4DR6B 2Z6VA 4FJ0A 5BN1A 2WYHA 4FBMA 5JPDA 1E2EA 2WZDA 4Q02A 5FEMA 1JE1A 1RS0A 3D3NA 3CZQA 1PEKE 2NLOA 2X0NA 2C2KA 2J6CA 3AVOA 2F62A 3WYBA 2JZOA 3HJTA 3ZEIA 4KWHA 1Z7BA 3VSBA 2C99A 4BCBA 4N48A 5FKJA 2H1LA 4S1PA 1HMYA 3AKYA 4UZSA 1QYVA 3TFOA 1RBYA 5DSTA 1PGNA 5J59A 4KIJA 1Z4NA 4TTVA 1OGYA 1QHIA 4QICA 5LQKA 1JDBC 1XVLA 2VPTA 2CB0A 3TAHA 1MO3A 4D9NA 3X1JA 2GERA 1VHQA 1W87A 2B4KA 1FQOA 2HNAA 1DJNA 1V45E 1ZGCA 2QD3A 2XQIA 3JQGB 1NN0A 4LNUA 3ERCA 1T26A 3WR5A 2TMKA 4CDGA 4LDJA 3VTAA 4Z4CA 4YAFA 3F8TA 3GLHE 4WESB 5EJFA 3PFFA 3IAM6 5DM4A 4C4TA 3LUBA 1N2CA 4C04A 4IX9A 4MRVA 1WDWB 1ZHOA 2QBYB 3I9FA 3MJTA 3NNDA 1A9QA 3ACDA 2XD9A 3P0IA 3OAAD 3P1JA 5JSZA 1QDEA 4GI2A 5TGDA 3S2GA 3ZJTA 1JALA 4HYYA 3PHIA 4RD4A 3UJDA 3IMKA 2PEYA 1ZMOA 1PZNA 3K0FB 3M5DA 1N7HA 4YCJA 3VMMA 3VR2A 4E08A 4KN6A 2W22A 5J2UB 2E1PA 5K8LA 1N2IA 1D7AA 5JSHA 3TLYA 5B4UA 1Z0FA 1ZN7A 1FYFA 2G88A 4IFEA 4BJ5A 3JQAA 4BB9A 1THMA 4DMCA 4X64B 2ASEA 3HU5A 3S81A 2RGUA 4IICA 4UOQA 1A0OA 3HHEA 4OD0A 3SZRA 1Y1RA 2CL7X 3F6PA 3TINA 3WG9A 4YK7A 4CF5A 2YY5A 3VOBA 5DCUA 5LJLA 3NYIA 3S1AA 2PKCA 2YOHA 2ZRIA 2XJ4A 2IV3A 3GGJA 3GRVA 5AJTA 2GLTA 2H1OA 4D4JA 5G1NA 3SQOA 2IIBA 2QP9X 3HKBB 1SD1A 2XQJA 3P0HA 4IEEA 1SUEA 4HFRA 2FW1A 1G2QA 3ZW8A 3QJYA 1M54A 3ZXUB 3VZRA 1O0SA 1OB5A 1RLMA 4KRFA 3D4LA 3EZFA 3O1IC 4P34A 1T2CA 1QTQA 3Q8MA 5I9MA 5B30A 3KQMA 4DLPA 3QVGA 5BUCA 1ISJA 2VYVA 1H6DA 3KXPA 3WL5A 5ESRA 3GR6A 2R25B 4WRRA 1S01A 4KQHA 2OAP1 5K3EA 4DJ5X 1Y8CA 2DUMA 1EPUA 5A04A 2WZBA 3PXAA 5FHRA 4A16A 4YMUA 1MV8A 3FNGA 1QIGA 4XGNA 1E8DA 5HIJA 1M2KA 3M3HA 1J1UA 3WFIA 1B76A 5AJYA 2CMFA 5CBPA 2XB9A 4ZDWA 2PUGA 4IIXA 2GBCA 2PU7A 4DHWA 5JD6A 2GJKA 1HEUA 4CV2A 2WU3A 4KRGA 4V03A 4D0LB 3EBLA 4J7XA 6CHYA 2D5CA 4QTXA 2FX2A 3HEMA 4NAVA 4PLHA 4OQYA 3ELWA 1PKXA 3OX4A 3HMQA 3HPRA 4XTRA 1TZBA 2V59A 4EYEA 4R98A 4PWYA 4YLEA 3AHJA 5CFQA 3F97A 4QOIA 4WJZA 2M98A 4OHMA 4WWHA 3OCWA 1LZKA 4WK0B 1I5RA 5EAIA 1X0VA 3UB2A 3W1WA 2QUHA 1SVKA 1P4AA 3FYDA 3L0DA 5DBOA 2ZAOA 2CJFA 2NP7A 5KTRA 4D4LA 2D1RA 4XOUA 5GM2A 5ITWA 3EPLA 2O5VA 3MMPA 4DDHA 4LHXA 2BFFB 3B1XA 1C30B 2AMLA 4RACA 3KBBA 1UQRA 3HP1A 5AVOA 3LLCA 3G8AA 4ZVSA 4TOIA 2NV6A 5FNZA 5IBQA 4RTMA 4FFOA 1CY6A 1SEPA 1DEOA 4TYYA 1WUJS 2GYUA 4V02A 3HJCA 4MUNA 2I4MA 3GN1A 4PF1A 1FJ2A 4RA9B 1YR9A 3MCTA 3SLRA 4YIHA 2EDCA 3MGCA 3T1HB 1HLPA 1NW3A 1GA4A 1QORA 3OE7D 2CF5A 4DNOA 3THWA 2ZWMA 1U6IA 4JOQA 1SA0A 4ZDJA 3N8DA 3HNRA 1X7GA 3OP1A 1JH9A 1QAOA 2R1UA 1X7ZA 2VPXA 4YMWA 2OAQ1 2JLXA 2FJUA 2MWMA 1ILEA 1MJHA 3LO5A 5A03A 3ITKA 5FWNA 2OFXA 4JIMA 7GPBA 1Z0UA 1AV6A 1DC3A 1W96A 1XU9A 1Z13A 3I4LA 3JYQA 3V4OA 3X1KA 3AKEA 3G1TA 2D1FA 3VPFA 1KY3A 2B99A 4MYDA 3IBCA 1B8PA 2BFAA 4N7BA 3CUSA 5K8UA 3Q0EA 5ALVA 2IA5A 3KUXA 1CVRA 1YSCA 3PPVA 5BV1A 1ZESA 2O1EA 1MN6A 3H2GA 2DG2A 3U4IA 3ZDQA 5D1NA 4WZ6A 1MW8X 1PLLA 3IUBA 3NU1A 3OEYA 3L79A 3T5BA 3NKFA 5BNTA 2OO5A 3DEHA 4I1PA 3CF6R 4KAJA 1U4NA 1A2BA 3TPCA 4GYKA 2OK7A 4ND8B 5KYNA 1Z2EA 4YONB 4URXR 4WT7A 2D54A 3D6MA 4GRDA 1TZMA 4J3FA 4ECAA 2JW5A 2XOKD 3UZUA 1NLZA 3KOXA 5REQB 1NBOA 2PX0A 4NESA 3AHFA 3K8ZA 4Q16A 1RZRD 1UBGA 5I9NA 4FHGA 2R4TA 3WWDA 1N0WA 4BCDA 4QXRA 8MHTA 2YQZA 3OA2A 1Q0HA 3C98A 3P5SA 2I4NA 3I05A 4Y2JA 1KEWA 1PF7E 4F6RA 5LP6F 3DFUA 1QGZA 4QA9A 4MJ7A 4AZVA 1KDTA 1V4BA 3FDZB 2XUAA 3L0IB 3CX6A 4G5QA 5IF9A 3OQMA 4FE3A 4PYMA 3RK0A 1Y37A 3PU6A 4OK6A 4YRPA 3ZLUA 4PO9A 1JEYB 3KJXA 2VHEA 2EFEB 4YCCA 1RBZA 2HWUA 2O8BB 3MAJA 1U8CB 3BKXA 4RGBA 4AJJA 1UC9A 4MV5A 4US0R 4OB7A 5A71A 3S2SA 5LQNA 3DCIA 1A5TA 2BW0A 5BR1A 3CZCA 1T10A 2E5WA 4HAXA 3PUKA 3VU9A 1EFCA 5LA6A 2BZ0A 3FWPA 2Q5EA 4Z0NA 1PWYE 4LMPA 1B41A 3O4FA 4ZRDA 4B79A 4INAA 2FA9A 4CEJB 3P2YA 2QUAA 4IDBA 4JEMA 3MWLA 4WOPA 2E4WA 3UJ7A 2Y0DA 2AQHA 1L5VA 2QN2A 4DQLA 4I2VA 2FY8A 2H92A 1KYVA 2YDYA 5G2OA 1CUHA 1EK0A 1V9CA 2FG5A 4UW9A 3OX1A 4E5VA 2QT1A 3ZYZA 3VH1A 1IQPA 3MN1A 1H1LA 1CUBA 1D8TA 3V8VA 2YWJA 3N8HA 4K6OA 4J0FA 2D1SA 3KZKA 5C5IA 3K2BA 3NTUA 2C78A 2OQ2A 3RIXA 3WQSB 5AVRA 3L8GA 3MYYA 4AO7A 3WAJA 2QTAA 3I58A 3A8TA 2F8LA 4OYYA 4R69A 2EW2A 2GX6A 2JB9A 3R5JA 3BK2A 4OU5A 1YB4A 5LWQA 1IVSA 4URFA 4EH1A 2ZXUA 1MABB 3FUUA 3Q9UA 1SOAA 3TL2A 5LQCA 1PK8A 4JBXA 1KZ6A 4BQNA 2I2CA 5GAJA 3CX8A 4G6ZA 5DTRA 3USES 1ECPA 1T35A 4NMWA 4CMCA 3AF6A 2FZWA 2EFDB 3IULA 3KXIA 4NYJR 1XZPA 4GOLD 1PS0A 2GNOA 4KYIB 4P4SA 2A67A 3SZOA 4DQXA 3QUQA 4H77A 2AOVA 5CP8A 2ISQA 4XH9B 1XZJA 1JG3A 4YBZA 3FCSB 4UEWA 1H5UA 3O31A 1KKMA 3OEHD 4J7AA 4E22A 4J3NA 4UMEA 1WTAA 1KVQA 2WAOA 4GLJA 1Z82A 1TK9A 2HTFA 4QKQA 4ESVA 4NL4H 4IDAA 1NX9A 1PFQA 1NF8A 4JC0A 1Q0SA 4S2EA 5K6RA 1NSFA 4GQIA 4DWWA 4FUTA 3K8OE 4HGQA 5JJBA 3PLAE 3JQ8A 1KEEB 1L7DA 3E9EA 4KN5A 4O2AF 1NMSA 1OTHA 1HEIA 5IS2A 1ADYA 4MS3B 4ZO6A 1ZNZA 4XSGA 4ASUD 2IEDA 4FGZA 4HLUA 1KF0A 4MYHA 2CC2A 1L3BA 2IC5A 3G7NA 4FHEA 2VA9A 1YVRA 1VB5A 4AMGA 1WXFA 1OFGA 3PVZA 3SDBA 1IQ0A 3TXAA 4HQLA 2NYRA 1GV1A 2A14A 2IU3A 2EF1A 1Q1NA 3IPAA 2BI8A 3NKLA 1E2DA 4MO9A 3BMCA 4RX1A 1VE5A 1DWUA 4H7KA 4WUTA 3VUFA 4M1ZA 1L5FA 2DUNA 4Y6LA 1OZFA 4C4SA 5BW8A 2O3TA 5KQRA 4O0LA 3A9CA 1G21E 4IZ6A 4BX3A 1E9BA 4K05A 4BFUA 4BWGA 3HYCA 4KYVA 1K66A 3KKQA 3D1VA 4NBSA 4QOHA 1LXCA 2NV2B 3B2NA 2XQVA 1NQTA 4FC7A 5IVDA 3TTTA 1YV9A 2QZPA 3K9CA 2GKOA 3W3ZB 2P1ZA 1H85A 2FPUA 1JKIA 2HQBA 1YGYA 3G2MA 3GDOA 4JQZA 4CIYA 2JHGA 4EPTA 5B4VA 4BX9A 1WW2A 4N7MA 2HIMA 3ROGA 1OXVA 1I7LA 2EEZA 4CCAA 3VYSB 3GCDA 4H7FA 3MGAA 3RTGA 2NOAA 2HXSA 2DCUA 5AM2A 1P0PA 5G40A 3W6ZA 1HFKA 5JBQA 4Q9NA 3G5MA 2O2JA 5JBNA 2YCBA 3FOWA 4LZPA 4PHCA 1N2CE 1Z2CA 4KBGA 3USCS 6ABPA 3THXA 4E31A 5EERA 3VKGA 2QTBA 3NIGB 3KKEA 4DA9A 1UAAA 4HAUA 4DRYA 2O0MA 4ABTA 1RI3A 3R5TA 3ICVA 5ARCA 4G89A 3QF7A 4E15A 2Q1YA 3G0IA 2UKDA 4Q4HA 1UF9A 3C3EA 1G7CA 2I4RA 3GV0A 5T4BA 3MK31 3AI2A 1Q6ZA 2C7PA 3RHZA 3NOVA 2FCAA 1X9IA 3EPJA 4C7JA 4JT9A 1OW3B 2WDZA 3S0JA 5J1SB 3H11A 2EQAA 1LPOA 1ESZA 1NL3A 5B1IA 3RIHA 4ARSA 1ZOSA 1PL8A 2EIXA 3F5FA 1U0NA 4FMPA 4MUIA 3M2TA 4DY6A 2WKRA 4D74A 4A7PA 5DN6A 2OBMA 5H3CA 4PLCA 3TW8B 1U8FO 1L8LA 2GZ2A 1SKYB 1WP9A 2NXNA 1QGED 4DW8A 3PNVA 3BT7A 3STTA 3LOQA 2BRUC 3SOZA 2Q41A 5JAPA 4LX8A 2PO5A 3MFQA 4Y6PA 5FLKA 2QROA 1XI2A 2V96A 1Y1TA 4C7OA 3E84A 3FVWA 5C18A 3PD1A 4DCJA 2CCGA 4PQYA 2PWBA 2VWPA 3JQ9A 4N18A 1P4SA 1AQLA 4HPWA 5AXBA 1VBFA 3KDPA 1ML4A 1UBCA 3N76A 5D01A 2QUJA 4U8GA 5IUKC 1QTRA 1M34B 2YJ5A 4IO1A 4V3BA 3D5QA 3LQRA 4QUBA 4C0KA 5FUYA 1RWPA 3EAQA 5BRNA 3VPDA 3N8IA 3Q72A 4XRGA 3T1NA 2DCMA 1Z5GA 4OA5A 2ZCVA 4S1OA 1M75A 3T3DA 2SKEA 2ROQA 4C1NA 2Y1EA 3OKAA 1DAEA 5AW9A 2DKOA 2PAAA 4MR8B 2C8VA 3LY5A 2YTZA 2V4UA 1O89A 5KYVA 3IVXA 3JPYA 4JA0A 4LNHA 2VYQA 3S44A 4CF7A 3DEZA 3LWZA 3O8NA 3Q8WA 2XECA 3NR2A 1KSHA 2XYVA 3MINA 4GXTA 3OURA 2Z57A 2A6PA 3D8SA 3O4JA 4Y2RA 2C7QA 2Z58A 4MW1A 4JT8A 1GTJ1 2UVPB 4Q39A 1M1NA 3VOTA 1UBEA 2XQGA 1Y6RA 2FZGA 2ZIAA 4OB8A 4AP9A 1T25A 3EIWA 4JVMA 2GBFA 1OV4A 3GPBA 5C81A 4LS3A 4QC2A 1OZAA 3JV7A 1KDZA 5JAQA 3NFRA 2DUJA 2XAAA 3FNHA 2ODWA 1ND6A 3G17A 3OC0A 5SICE 2YYSA 2IKQA 4AULA 4TWIA 4NCAA 3KLPX 2LD4A 4BGVA 5C1PA 1XA4A 4RTLA 5FBVB 4KIFA 1XF1A 4MAAA 5KYXB 5FPHA 3AETB 5T67A 1V4VA 5BUQA 1SU6A 1NYLA 4TZ0A 4O33A 1XJWA 5CIWA 1W0JD 3E7FA 1G19A 3IAEA 1E4OA 3T3PB 1G7SA 2FPOA 5LZ8A 3UOWA 1QVAA 2EKZA 2O14A 3E3AA 1OYWA 1H93A 2PGXA 2W6PA 2QJTA 1WVIA 2WSYB 4F3KA 1RPZA 5FNVF 5ADHA 3AESA 3MMNA 4JMLA 4U7TB 4AUKA 2O8CA 4P3OA 4BLPA 1G5QA 3FCXA 2R44A 3ZHZA 5C51B 1I4DD 2PQ6A 3E7DA 2IEYA 5GJCA 3DQPA 1GRVA 1GDDA 1TZCA 2O2XA 5FI1B 2ODNA 3L0CA 1VIDA 1ITZA 1Y0BA 2HF2A 3GELA 4JEHA 4LYGA 4RSMA 4HXFB 4ZQIA 5E3HA 5FX2A 4B3SB 4Z9XA 3ZGYA 1SXIA 5E7JA 3T4UA 2IHZA 1ISMA 4EYGA 5CRIA 4GM1A 4WY5A 1JIIA 1AGXA 1LI4A 1XEFA 4MW0A 3Q1KA 3LMKA 4M86A 4W99A 2J9FA 2NO9A 1SG9A 4MUBA 4DDWA 1DU4A 2GETA 3DCJA 3H42B 4GSKA 4YP5A 3X43A 1GTG1 5G0TA 4AX8A 3ISJA 1YE5A 1W5AA 4B4UA 1QUEA 1YBVA 3ICPA 3O7MA 5D3KA 4ZAYA 4MQUA 3NM4A 2VAPA 5TPWB 5CB0A 1Z63A 3IJRA 4N6OA 3CX4A 1IM2A 5H5JA 2OCLA 1T9AA 1BVHA 3L4EA 4LXIA 2O8VA 3A58B 3E7XA 3F96A 3NHAA 4IMIB 1PG5A 4D4IA 1THZA 1EB8A 1R64A 3DMYA 1O6FA 1UJ4A 2NU8A 1EGHA 1Y82A 3DW1X 1WHTA 5FL3A 1YS2X 5A3JA 1FSGA 2ERYA 3O93A 2I55A 3H2YA 5FA6A 3U5ZB 4J3JA 2VYFA 3HHPA 3GYGA 1G4AE 4EF6A 3L77A 4KVAA 2A9PA 3M81A 4D9BA 5ES4B 1HDEA 1CT9A 3ZZUA 3DZGA 1ZGZA 3CH5A 3I6BA 2EX4A 3B5JA 4Z49A 1JA9A 3CF4A 5JWRA 1E1QA 4FXOA 3O74A 3OMWA 3AVYA 1W36D 3KX2A 3MT8A 2BKAA 2EKBA 2ZI6A 1E2LA 2YICA 1HFWA 5IAEA 4JI6B 2WHRA 4TL8A 2WEKA 4XVQA 1PWHA 3EGEA 2HDHA 4NS4A 3MTQA 2CMHA 3HWRA 1FP2A 1TVKB 1OI7A 1DG1G 1X0XA 2PPVA 2QVGA 4CQJA 3FRHA 3A04A 4A36A 3H84A 4Q3KA 4D9GA 3CLSD 1R4NA 3QE4A 2OLEA 4HEA6 5T64A 3SIWA 3WHPA 4DLRA 2PBRA 4Y9RA 1TX4B 3PE3A 3QU5A 2AN9A 2PGIA 4B82A 5ITVA 2BH2A 4F46A 1RYDA 2ZBUA 1E61A 4HFJA 5FTNA 2C4UA 5ICEA 1CF9A 1GNLA 3KZOA 2IZ5A 3LWBA 1L4LA 2A8YA 1LBHA 1ZM9A 4K87A 4M54A 4X62B 1OC4A 1CXZA 1OLSA 1RKBA 3M9WA 3PRYA 5KB3A 5FBWB 4DR2B 4KYTA 1SKAA 2VDMB 2HKIA 1GKIA 3VGJA 3UK6A 3P9XA 5CVCA 1FP4B 4UAVA 2F8TA 2WJGA 2SICE 3BIJA 5HOEA 1UMCB 1W85B 4TXHA 4XSHA 1AB6A 3OFND 5KNCH 3MRXA 3COPA 5GY7A 4ZPXA 4A92A 1XZHA 3PFBA 4BMYA 3I0NA 3LUGA 1PI3A 3HUDA 1E1RD 3HU1A 1U5BB 4L08A 1MQ8B 2VXOA 1EE9A 5DULA 4FD2A 3KALA 1XCOA 4ARZB 2UAGA 3I1IA 1DLJA 1XTTA 3HB5X 3IYLW 4MMXB 2QLFA 1B8VA 2VQDA 5CFMA 1VHTA 4OQFA 3ROEA 3X1DA 1NVVQ 1S5PA 3A28A 4KAFA 5KOJB 3GH3A 1RPJA 2GHRA 2V0NA 2O8EB 2Y68A 3OJ0A 3FA2A 5BSTA 5KNDD 1EK5A 4ZZIA 3WNZA 1GM5A 5TF0A 4CBVA 3I39X 1BYIA 2A0KA 3WK4A 4QUAA 2WNIA 3A9SA 9ATCA 2B9VA 1T4DA 4J76A 1L7VC 1TUEA 1N8KA 2C00A 4C22A 5AM3A 5JT1A 1NM5C 1YL7A 4LDRA 2O5CA 4IGAA 1NU6A 3OO0A 4U2KA 5BWMA 3H5AA 5I47A 2Y1KA 4UVGA 2R48A 4M38A 1AN0A 2IZ7A 2IYUA 4LCBA 3VR6D 3X1XA 1DUSA 1T4BA 1LLCA 1DTWA 4LZLA 2WWYA 4U00A 3LLVA 3QU2A 4YJ2F 5EUMA 2ZLBA 2QUZA 3LCJA 3R44A 1RDFA 3GZNA 1DO2A 3DOIA 3KZXA 5EPUA 5K0ZA 4JELA 1Y7IA 3KUKA 3S4YA 1LSSA 3FDJA 3CM0A 1O94C 1GGEA 1LQ2A 1OU0A 1WE2A 3B78A 3SYKA 5F1OA 1XO1A 4MDYA 4OHRA 3JWIA 1GSOA 3PKZA 4CKEA 1M0TA 2E55A 4QFBA 3ESZA 1Z0JA 4DCUA 2PYZA 4AZ3B 2ECFA 1PGOA 4U5XA 4BO2A 4RFSB 3LC1O 2MR6A 1U7ZA 2XI4A 1VJTA 1QDLB 4RVFA 3B53X 4WNAB 2GAFA 5IBRA 2JIOA 5FCDA 1IZ9A 3G0HA 1TLTA 4MWGA 2PBLA 3BMXA 2BMAA 1A2OA 1VRWA 2OCIA 1QLJA 1EE1A 1MC1A 4NNJA 4QYIB 4ZU3A 5BOSB 6NULA 1M6VB 2QG6A 4ER7A 2GCIA 1TFUA 1XQ1A 2RHBA 4WCFC 1RWVA 4L9RA 1T0IA 4LBWA 5AK6A 2VJNA 1ZD1A 1Z83A 1CNFA 5K3FB 2OR3A 4E2FA 3EDMA 5NLLA 4ND1A 3BN3A 4KFTA 2MHCA 1Z7GA 3LQYA 2G1KA 3C39A 3BXFA 3GZ4A 1PGJA 4RZQA 3OD1A 4FVTA 2ZE7A 2ID8A 3SIPA 5HOQA 1Z5OA 4MVJA 4RVUA 2DFKB 2NNLD 2JGDB 4YN3A 2QW1A 2ZRJA 5ICGA 5F78A 1OA1A 3IUMA 1Y63A 2IYNA 4HTAA 4LYEA 4OLHA 1UEXC 1YS6A 2NU6A 2NVWA 3ANYB 4KW7A 2AK3A 2VNHA 3PLNA 1WUHS 4FKBA 4NU5A 2PA0A 5C5CA 4HGNA 2A33A 2H31A 1D1PA 1ECJA 3QKUA 5LMNB 2WNHA 4UHEA 5KOIA 2JAHA 2BM0A 3A6ZA 3W5SA 2FLKA 2IZ1A 1SCNE 2X42A 1ZPDA 3WK5A 2W8ZA 2VJMB 3WP1B 5L4NA 2XBLA 1JWBB 2MSNA 1KARA 4N3NA 5DI3A 5ELXA 4II7A 4WXYB 4XJSA 1GQQA 1Z34A 1LSUA 1ONOA 1WWKA 2QE7D 1DC5A 4H6WA 4KLZA 1LPSA 3L05A 3L8ZA 4JR2A 2OQIA 2VS1A 4TZTA 5JPIA 3W8NA 4C0XA 4ZYXA 5JDCA 2O7RA 5LP6B 1MAVA 2ZIXB 4QTYA 1BU5A 3N9IA 3S2IA 5KC9A 1KAHA 2GEJA 2WC1A 3P4YA 2QP4A 3F6EX 3FCOA 5KHAA 3QMPA 5IM4F 4BMOB 3T7TA 4EB0A 3RAJA 4AMYA 5LYJF 4JI7B 3QOWA 5CX1B 1M2VA 1Z2AA 1PSDA 4IW3B 3RTEA 3EVDA 1T1JA 2W4MA 3OZAA 3K8YA 4UDXX 5THQA 4C78A 3J7TA 5FT9A 1L0BA 1VXRA 4GS5A 4ZAVA 3TMKA 4C89A 3DXFA 4BE9A 4O4HA 4H6PA 5AW3A 1MOSA 3RVOA 3PNKA 4HT3B 4RELA 5HZHA 3E8SA 3DLHA 3OF5A 1JLLB 3D5EA 2RONA 3OQVA 4OHOA 3JQ7A 4N0PA 3I04M 721PA 1XAJA 2BEUB 3PK0A 1QK3A 4BKQA 2ZIUB 4MPTA 3AR8A 3DR5A 3EW9A 1CR1A 4QARA 1NFFA 2VHUA 1EDOA 2WRZA 3LW7A 3ZWYA 1J07A 1RYFA 4CLRB 3S6JA 4HN9A 4IHJB 5AR1A 5LMUB 5DGCA 1XD9A 1KTVA 3GJYA 2VHXA 3KT3A 4FU0A 4CKXA 4C3ZA 1E0JA 2Q1WA 5EJ9A 1H8ED 4XPZA 4GWLA 1CQJB 2FW6A 1FYDA 1NKVA 1PWZA 3ECSA 3QVXA 4RSRA 5TJ9A 3UK7A 1XWIA 1Z07A 3F9IA 4LRQA 4UQOA 2R68A 2HSWA 3D2BA 3NJ4A 5C4MA 1MO6A 3MQ2A 4FEGA 2XYRA 2W5UA 2ORVA 3CISA 3T5PA 1J0DA 2VRCD 4BV8A 2OL4A 3TR6A 2HGSA 2FI1A 4TTSA 4HEJA 1GUZA 3FR7A 3FFXA 4DCOA 4QIHA 1JAZA 4RS3A 2JCXA 3AJEA 1VE1A 2JFVA 2ZS7A 4G4GA 2PVSA 3EDOA 1CNMA 4Z5XA 5CTJA 1GPDG 4JROA 1KI8A 4PG4A 2AV6A 2ZPAA 3JU3A 4LZZA 2ILVA 5DNWA 4BTLA 2P9QA 3WNVA 4RTRA 5DTJA 1MVLA 4IIDA 2W7TA 3IHWA 3H7IA 1TIPA 3KEQA 3MTIA 4O2AB 4P9NA 4Q12A 1LK0A 1VBNA 2NUTB 1UJCA 2W8BB 3EODA 1M2NA 1AUQA 3AP1A 3K7EA 3QUCA 4CTJA 1DT5A 1FRZA 3K72B 5JJ5A 1A8QA 3K0EA 3ME5A 3IUNA 3RS8A 4KVZA 4HXEB 5TSDA 3HCOA 2J85A 2GO7A 3Q6NA 3I2KA 3KUCA 4G97A 4LSMA 4MTCA 5DIFA 2GS9A 2C9BA 2ENWA 3ON5A 3N0XA 1QP8A 2IYAA 2OKGA 5FHQA 5I9TA 3WA6A 3KJQA 4CI0B 5FWYA 3FSJX 1E0KA 4DC0A 2YFHA 3Q8LA 5E6RB 4EGSA 2XRMA 1P8AA 4FDVA 5DX0A 1HEYA 2H3EA 2QQEA 2G5PA 1P5FA 1KQFA 3OZEA 1LS1A 1KIMA 2R5WA 3B13B 1CD5A 2M6SA 2ZUCA 5INTA 2G77B 2JFUA 4JYCA 2FW0A 1P5JA 4CT5A 3P2JA 5YASA 1OBOA 1AOXA 1GPAA 4IS2A 4K6GA 3C2QA 2JVIA 4QDJA 3WLOA 1T1IA 3WWYA 1YR8A 3DBIA 4KPUB 3CMMA 2BI4A 3KOWA 4C29A 3AP2A 1ACMA 1HRDA 1RLUA 4KFSA 1D7OA 3FYSA 4G0PA 1T3HA 1H6BA 2ZJ1A 1Q1GA 4NZMA 4F1KA 1TK2A 2FPIA 1R0ZA 2HIAA 5L3ZA 3AO0B 4I14A 3TM4A 1D4AA 4A1FA 2JD1A 3TVYA 1QHHA 4PLYA 2NXEA 1VIMA 3MJCA 5DRYA 2REBA 3B52X 5A3VA 4UEOA 3I6QA 4FYIA 1V96A 4L0MA 4DC9A 1L3CA 5JW6A 2AJCA 2GAJA 2B4AA 3K94A 5EWLA 3TJZA 1OLOA 3GIDA 4QGSA 4WLEA 3QKTA 3GRZA 3KZCA 3FM9A 1T6NA 2XTMA 4ZOAA 3L9WA 1YHZA 4LV5B 3H5IA 4Y0VA 1N3YA 5HGXA 4G8DA 1JU3A 4OGLA 4HDQB 2JANA 4JY7A 1FK8A 4KI7A 3U16A 3BMNB 1HSZA 1MVOA 5EGNA 2C04A 2Q6LA 2VHVA 2ZB2A 3HGMA 3RWMB 4GFDA 1G5HA 2W0MA 4FYMA 3X1ZA 1RR6A 3FN4A 3CN7A 3Q88A 3OIUA 4QHTA 5HUQA 3BXOA 4EMUA 4O2LA 5AVZA 1QCDA 1QGYA 1W8DA 5I3CA 2XCLA 3G23A 3IAUA 3IKMB 3KDAA 5BO5A 1MT3A 1G8HA 2UUOA 3LE8A 1WCYA 2I34A 5B6JA 3H2IA 4F06A 4UUNA 2IUEA 5LXTF 1FNMA 3AHGA 1HYEA 4IM7A 2AYYA 3ZX5A 4HNUA 1Q16A 4OL0A 2AX3A 2WPNA 3FFBA 4XSVA 2BFBB 3TRHA 1PZXA 4W82A 1MQSA 1XJQA 2IX9A 3AB7A 3JZFA 3QXHA 3SS7X 3FMIA 1PIWA 5AM1A 5H9VA 2GO1A 2WNSA 3CXUA 3M2PA 2C3MA 2Z8XA 2BZSA 3KU1A 4KXNA 4RIIA 3V2GA 5KYGA 2WYWA 4IV8A 5IH7A 4NBVA 1FL9A 1NBIA 5FTJA 4QFDA 4BN0A 5L8VA 1EU1A 5JXHA 3FSEA 4TUYF 4W1RA 2V97A 3DE2X 4RVNA 3ESQA 5AKYA 3A4IA 5H80A 5JFOA 1Z7YA 2OQVA 1I0LA 3UMMA 1CK4A 3X1WA 4P84A 5F21A 1Z6GA 2Z6QA 4RZSA 2XYHA 3DOCA 4BKPA 3VTZA 2VK1A 2C4NA 2PWPA 1ZSYA 1Z6QA 4PG7A 1YR7A 3M1YA 3RGWS 4KNWA 3ZH9B 5ECDA 4BP1A 5U9CA 4RQBA 2YASA 4S2UA 3UBTA 1WU8A 2QN7A 4IVRA 3W7AA 4XE5A 5D7NA 1XTRA 3EN0A 4M8IA 1KIFA 3EVZA 3ICOA 2A0FA 2PK3A 2H2FA 3FFWA 4R2HA 1XZNA 2JBAA 3BCRA 3EWIA 4I81A 1QH0A 1VJ0A 3MUFA 3K92A 4NF2A 2BH9A 3SEAA 1GQ2A 1ZWKA 1JHXA 1HFEL 1MB0A 3QA3E 1LVUA 1BGVA 1F1JA 2IXDA 4NATA 4OHUA 1KDYA 3KEMA 5JRJA 1NYRA 3FWYA 2YUIA 4L7VA 4YCBA 3BERA 4O1HA 3NB0A 4L16A 5HBRA 1I3KA 1CUXA 4FGSA 1CR4A 4ZYYA 2YJ6A 4PFSA 1Z6AA 4OQEA 3BEDA 3ESBA 4BAGA 4GGPA 3O1JC 4Q01A 4DJDC 3I9LA 3A26A 4UKDA 4EDFA 2AZDA 3QPBA 5HFJA 2XB8A 1L7PA 5KKAA 5I48A 3N2GA 2FUKA 1ESEA 1KOJA 1QO0D 3OPYA 3A6LA 4P54A 5COBA 4D8XA 4F3RA 1NLUA 4HMPA 2NSLA 4XWOA 1UOPA 4NY1A 4R8KA 3TKAA 1D6JA 4EHKA 3OZRA 1ZGJA 3HNPA 3LO8A 4U7FA 4YPOA 3A6JA 2W37A 3BAFA 3BRQA 4JB0A 3HZRA 4M89A 3H9JA 4OG2A 1TW2A 4F92B 2UXBB 1BEZA 2QRUA 4RCYA 1AH2A 5C52B 3HXOA 4AF7A 5HZKA 1GPLA 3PFCA 1NR7A 4B4WA 2EFCB 2Q3CA 1GL6A 1M2WA 1MA3A 1X38A 2AMFA 2OD9A 2WSLA 2HRZA 1EVJA 4J1NA 4TGLA 5DBIA 5DLEA 5FNVB 1TXGA 1YJBA 3MWYW 3NKVA 5KHLB 3E8MA 4TVKA 1DC6A 3MRTA 3QA9A 4IJMA 3RANA 1BHQ1 3HDGA 4K88A 4FR5A 4OY3A 5GTDA 5KNBA 4P31A 2GTPA 4CU2A 3IHKA 3FZQA 2WYUA 1SXJE 2J1LA 2QK4A 3OG9A 3EG9A 4BZQA 5C3UA 3GDHA 4DPLA 1VPWA 2J0EA 2PR2A 1M10A 3HB4X 3MCAA 5AI0A 4BMXA 3KQYA 2H6EA 3VPBA 4R7TA 4QNNA 3WJ1A 4BZZA 2BTEA 1JMVA 2VP5A 3PEEA 4G07A 5TXGA 3S3TA 4PNEA 2V6MA 5D00A 1T3LA 3HKCB 4BNGA 4OPMA 4XX1A 4G25A 1ENYA 2FKNA 2FEOA 4TL9A 1ODLA 4MV6A 2QX6A 4FUQA 5JQGF 4HLQB 1KYQA 3KV3O 2IE0A 4MUGA 3G85A 3IH5A 3H13A 2KM1A 4MVCA 1I2ZA 5LZ2A 2PGDA 2NO1A 3ZV3A 1TC2A 1ULUA 4R2LA 3BJZA 4WNCA 3DZIA 2YZ2A 4IF6A 3V7WA 4ILEA 1I4EB 2HO4A 3IEXA 4MUYA 2VOJA 2F1IA 1L3IA 1QIMA 1OXMA 3EQ7A 2O07A 4E6PA 3EWAA 1GPJA 1V37A 4G0UA 1P6UA 4IDDA 1EWRA 3UFXB 2FFJA 2TS1A 4NBWA 1M2FA 3KSZO 3QEMB 2R6CA 3BB3A 2AXEA 1ULTA 2CLIB 2NUPB 2OHVA 3UB3A 1YS9A 2DUWA 2HR1A 3HEBA 1B0AA 3RB8A 4B3HA 3C14C 3RYIB 3WKAA 1IXZA 2FPWA 1II8A 4HTFB 1Z15A 3IBYA 4K03A 3QP9A 1U2RA 5DFAA 4MW6A 1PR2A 1ZH0A 1HE1C 3SSAA 2ZDQA 4BO9A 4P1ZA 2GZHA 5U4XA 2KQUA 1G4HA 3RT1A 5TQ0A 1PJZA 3QX8A 2WJJA 1V7ZA 3NAZA 4YI5A 3BMQB 4S1TA 3R7DA 4F4CA 5HQ3A 1XAGA 4I9FA 2OCBA 2XZTA 5T3UA 3WLJA 3B51X 2WJ3A 3IP7A 1P0IA 1TJNA 3DTVD 4DGSA 1YIAA 3AF1A 1W35A 1X7XA 1Z37A 1F2TB 1BDMA 3C6XA 2NQ2C 2OXRA 3QTBA 2C98A 3HB9A 4H4EA 3FNRA 5IK2A 1LLFA 3HGTA 4UTPA 3PDJA 5JARA 2I2WA 3LT4A 3ZS8A 4KQJA 4CMIB 3RAGA 2FGKA 2RMKA 2FPRA 3HSYA 3S2EA 3U3XA 1KHTA 3IPRA 3CSDA 1V35A 4X1IB 3L0BA 1D2MA 1USIA 1PG0A 2GPWA 2QGNA 3QIVA 4JH0A 1P9WA 3JATA 1XRPA 3DBHB 5A9TA 2AMJA 3ZCRA 4QDUA 4ZJZA 2XZLA 3Q7TA 3EX7C 2GFIA 1YC2A 2J31A 2A0WA 4N5NA 1DJLA 5EL0A 4ZKDA 1JXAA 3KS9A 5FPTA 4HBZA 1CUWA 3W9YA 5BSFA 5AVXA 2QYTA 2B5OA 3SVLA 1OX4B 1SUAA 2H9AA 4KXXA 1RKQA 1HNWB 3EISA 2IGBA 2NYAA 2O6HA 3BWVA 1P62B 1U3DA 4UHKA 4NCNA 1JAYA 3VR5H 4GBMA 5EKSA 1S4QA 4NYIQ 2NNWB 2WB2A 5DNCA 1XZAA 3U1BA 1I94B 3F3SA 1QO9A 3QNMA 1K6EA 1DRUA 2MDTA 1PGQA 3UPTA 2Y2UA 2BV3A 1PUJA 1UADA 4F2GA 2FWBA 2PXXA 4CCWA 3QLJA 2GKGA 3AR9A 1PT8A 3NDIA 3H9CA 3ENWA 4NCXA 4UHHA 3SMVA 5KSPA 1QPGA 3PNSA 1CEYA 1WVMA 2DY0A 2FXVA 3AVQA 3DMDA 4PYLA 1JR4A 1YZVA 2XVAA 5EA2A 2HDWA 1KZ1A 4GPZA 4B7AA 4EKEA 1OH7A 5FPSA 3PFHA 1DO0A 1KZHA 2XX3A 3O2NA 4KO2S 3AI7A 3HFRA 5KQPA 3Q2IA 5BURA 2BD0A 3EVNA 4N0EA 1P91A 1Q6YA 4BO4A 3CVYA 5D6NA 1FJXA 3E5RA 1LU9A 3OCXA 2EC5A 3NZEA 4NQZA 5H3HA 4TS4A 3B12A 3VAAA 1UBHS 3C1UA 1DJPA 3ET4A 4A10A 3RF6A 2O8NA 3WWEA 1S2GA 1WB6A 2VUTA 2O2HA 3QU9A 3HSKA 1Z3CA 4S0ZA 3K9HA 1CRPA 1IBRA 4OUDB 4JLBA 4G4IA 4D57A 4EL0A 4F85A 1L1FA 2CFTA 1Z2NX 3UBMA 1IPFA 2RI1A 2X6RA 4LE2A 4U6NA 4YUYA 5BPHA 2N9UA 1KK0A 5KNLA 4NEHB 1XTIA 1Y3BE 1WUKS 2PN1A 1L7MA 1GUAA 3RVQA 4W9MC 2G5CA 3NS7A 4MLPA 3EBOA 3V8MA 1EA5A 2R751 2KBFA 1K5PA 1Y4ZA 2O3UA 2P41A 2YVQA 2CVHA 4GC9A 2AK2A 5K09A 3X1MA 2DFPA 1R8SA 2XE6A 5GMOA 1YH3A 5EHIA 5BRJA 1QB8A 1NQ5A 1TUIA 3ZWKA 1H42A 1G20B 1ZUD1 2PMKA 3CZPA 1DTSA 4OREX 4WFJA 2JHPA 2BGTA 1X7WA 1SOMA 2ZITA 4PZAA 4Q9LA 2R79A 3AEXA 4DLXA 3AF5A 1G7RA 3LTEA 1EM8A 4RAOA 1U8YA 3R3SA 1CP3A 4KNVA 1I7PA 1AQNA 1BN6A 3I6YA 4Q6WA 2C5EA 2SKDA 3EDYA 2PMBA 1A98A 3C48A 5F5NA 3RTDA 3H2HA 3A0UA 4MPDA 1YZUA 4ES6A 2QMHA 1NGSA 5DIZA 4JLNA 3SFTA 1JFRA 4JNKA 2XNJA 1K8RA 1RIIA 5JFTA 3Q8KA 4MR9A 3T7KA 1QKIA 1VP9A 4PZDA 1ESDA 1K6MA 2NG1A 4BNHA 3U0VA 1GOTA 1PGPA 1SHKA 4Q4JA 1PJQA 1PX0A 3BYZA 1XXHA 2DWQA 4NEGA 4TV9A 5CVUA 2GFHA 2Z9DA 4ZVUA 3BWMA 5EYPB 3V4SA 1UDRA 3U7QB 4WVFA 3AFOA 4YB8A 2R4UA 1SD5A 1U2GC 3FLMA 1HDGO 1TMYA 3EW7A 2DR0A 3GAMA 1B23P 2AT1A 4XYMA 3K09A 1MC4A 3I2YX 1R0KA 2Y2VA 4PQGA 5EQTA 4DV7B 3WIUA 2HU2A 5KQLA 2X2EA 2P2DA 1XQ9A 3GNQA 4AQDA 1QONA 2D5IA 4ZYVA 2WJHA 4OXRA 4KIUA 3SFVA 1MJNA 1A95A 2HO5A 2HLDD 4Q05A 4YFVA 4DSOA 1EAYA 2VQ6A 3A10A 1T6ZA 4LYAA 4B80A 5LYJB 2DULA 2ZDGA 3NTXA 3PNPA 5TPZD 4GGOA 5B12A 4F5ZA 1M0EA 3KIPA 3K0CA 2Q2QA 1AKNA 2B69A 2YZMA 1HH4A 3DDUA 3RUAA 3B1JA 1TQDA 3TS1A 2FZ5A 2RARA 3DBOB 4NXMB 2JKZA 5BN4B 4YCAA 2XVYA 5AWFC 3TWOA 1J8FA 1SHTX 4EKDA 4P82A 1CY0A 2IZOA 3P9RA 1B6GA 1U1EA 3HKDA 4YP1A 2PUBA 2G0NA 1LVHA 2CL5A 2A86A 4RVHA 4P2BA 5HILA 4XOIA 2W2PA 4AT1A 1KPIA 1M7GA 2JH3A 3U7HB 1CDDA 1EBUA 4ZQBA 1FIUA 5D86A 2BFWA 4B32A 2QN6A 2W43A 3JXEA 2WWFA 1QP4A 2D7JA 1TJYA 4CM4B 5ERXA 2EVWX 1K06A 2I76A 3WLPA 5ALYA 2AOUA 3QVTA 4PPGA 4BLRA 4LGYA 5AVQA 1KMIY 2JVJA 3EGVA 1PUIA 2PGNA 4PE5B 1M5UA 1ADBA 1QFYA 2GD6A 2Y67A 4QZVA 1RYMA 3QI7A 3NGMA 3O9VA 3T5DA 4QXQA 2IIVA 2K87A 5JJIA 2AG8A 3EUEA 1QIFA 2TMYA 4EW6A 4RFLA 4TXMA 3GRUA 2BR3A 3KPVA 1USUA 2VAMA 4NARA 5KX5A 3TNDA 4GM0A 4IILA 1FNCA 1T15A 2I8LA 2RHDA 3DKPA 3RVNA 3VJKA 4DZRA 4JAVC 1FS5A 3NATA 5LBIA 3ZJ4A 1CR2A 5C0OE 2QAGA 3D6HA 1DIOB 4X8LA 1JLHA 2G83A 4IV0A 1B42A 5IARA 1RRVA 4YMHA 4J0IA 1RHKA 4O4IF 1RCFA 1JWAB 5DTQA 1SVWA 1AKVA 1C4WA 4OHFA 1SCUB 5ANRB 2R6HA 3CNBA 3HACA 4NFLA 2ZSIA 3GLUA 3J81k 1K0UA 2FW8A 4NSNA 1NQXA 2JJ8A 2JD2A 5DHTA 3T52A 4D5GA 4F86A 1KAMA 5EHNA 2ZIWB 3C7DB 3D3JA 3A32A 3KRTA 4KFCA 1DWOA 1OD6A 1Y8QB 3ZWVA 2D5LA 5AMXA 4EG4A 5BXYA 4V38A 2OY0A 4MVWA 4X8MA 3ROMA 1NW7A 4XQEA 4QUHA 2Z83A 3AEQB 4V0KA 4AY5A 2W6NA 1NNI1 2WWWA 2C2ZA 1SVSA 5ESXA 5A9SA 3ZZNA 1C1HA 1MF7A 5KTPA 2Q6OA 3N59A 4CR6A 2ECQA 2FW7A 2OBFA 1E6LA 5FL7A 2XUOA 5EE9A 2UXDB 4Q7LA 5E6UA 4IDQA 4DLNA 1GVNB 1BXGA 5NULA 4B84A 3E2MA 3A3KA 4QBTA 4R8LA 2K2WA 3HM2A 1J2YA 1O97C 3FVQA 3GFSA 4GOOD 2QRPA 2YL2A 1GPKA 4DIDA 4JSTA 2HJWA 5EVJA 4BVLA 1N7GA 2CB9A 2WMYA 2V5AA 3PXEA 1UWVA 4A6XA 4OJTA 1K7YA 3NBUA 4NDZA 1PJ4A 3D31A 4BVEA 5B6PA 4M9RA 4R1SA 3T1VA 2Q3HA 2ZJYA 3WBFA 2B1JA 1G1AA 2C5GA 1CY4A 4TWAA 5TY0A 4MP6A 2BEWB 1QQTA 1U3GA 1KYYA 1W52X 4GPTA 1GGKA 1F5NA 5JD5A 4UFPA 1GN8A 1D3AA 1OILA 5B2EA 4CEIB 1YZFA 4WD3A 1T36A 1V8DA 2JLAA 3EFOA 4AJ4A 5HBGA 3RRNA 3M1AA 1JDNA 3F46A 1M6EX 2YXDA 4Y2VA 2CK3D 3A06A 4NFYA 3EGOA 2OK8A 2ZT8A 5CJJA 5H02A 3HI4A 3I4FA 1XNRB 4R3UC 1E64A 5BT9A 4IDHA 2FWNA 1E9DA 4MKRA 1RLIA 3DL4A 4ZV4A 3D2LA 1HQCA 3R9XB 4L22A 2PUJA 4C4PA 3ENZA 3ADCA 4BO5A 5IEBA 3DZBA 3I92A 5AJZA 10MHA 4IDFA 5DYIA 1JFFA 4CFYA 3D7NA 5ARDA 1KMNA 3S7TA 3HY3A 5FQOA 3QEKA 2BE7A 2X7HA 3NC4A 2O7SA 3DQQA 1CIPA 3FDFA 2VTKA 1R74A 4M1QA 4I8IA 3QZUA 3FPSA 4F2HA 2VF7A 2D62A 5F9HA 2FE1A 4LYHA 3Q15C 4ZMRA 2QSYA 5LXTB 3ICWA 1HTTA 2CHEA 4LTNA 3HFJA 1II9A 2AR9A 3AR4A 4ZYZA 1G98A 2F8SA 4CI9A 1CQIB 1Z45A 4FC6A 5FOTA 3BCUA 5ALHA 1Q17A 1D0VA 3LUPA 3QBEA 4P98A 1KDPA 2CDBA 4R16A 4RA6A 5CPBA 2ZIFA 1LDBA 2AD1A 3MOGA 3MWDA 3NNNA 3CJTA 3T34A 1MX1A 1QS0B 3QHQA 1LNQA 4TUYB 4UNIA 4C08A 2ZM6B 3DZHA 3KLMX 1NN5A 1RHUA 3IQFA 3TSAA 1QH1B 3NEYA 2AEEA 4IDCA 4WADA 4WFIA 4B44A 3QX9A 1DIRA 1WF6A 2VP0A 3OIFA 1JYFA 1GZ6A 1AB5A 1SBCA 4C30A 1UK6A 1GZ5A 3KETA 1T3SA 1XKQA 3CUWA 3LU1A 4EMBA 4NENA 1VC2A 2V3VA 3C8DA 5I5EA 4R40A 1SNYA 4ZTBA 1UC4B 1WR8A 3FVTA 2C0QA 3ZHBA 3QVUA 2AGVA 3KT8A 1ZJ6A 4H0FA 5A3RA 1O6ZA 2CMGA 3QW2A 2PRIA 5GWXA 3AMVA 1KQNA 2P5YA 5HKKA 1S3GA 3I23A 3TDKA 2P0EA 4MB2A 4I99A 3WYDA 2Q3BA 3PGVA 2Q49A 3RC3A 2ZIZA 2ARKA 5L7YA 2JFZA 1V41E 4JFRA 1I1QB 1DHTA 2XUGA 3SR3A 3ETJA 3A9VA 2QI9F 5JCJD 2WIFA 4C76A 4O0MA 2GCPA 3FPHA 4BNLA 3S28A 2QM0A 3FF1A 3H99A 1YUBA 3NRJA 3TCKA 5CDUA 1XALA 3GZTB 5AJWA 3WDSA 1JQ3A 4EKIA 4GNKA 4D8YA 3K2IA 1YB2A 5KYWA 5AICA 5BVHA 5LB4A 3GVXA 1NOJA 4O08A 2WT8A 2WMDA 4I2NA 3I3SR 2PH5A 3O0DA 4AY4A 4NPHA 1Z0ZA 2M2IA 1DT3A 1O87A 2IYFA 3HA3A 4G0QA 4G0XA 4N1AA 3SJBA 4Z7NB 1ZYUA 4BMVA 4B85A 1H66A 2P2YA 1JE0A 4PANA 4X3PA 1JKXA 1HDRA 1NDUA 3PL5A 4OKNA 4YRKA 2H4WA 3FD8A 2P1DA 3WO0A 3HO1A 1KSFX 5JNWA 4H7HA 4WBSA 4BVGA 3O9ZA 3OTWA 6AT1A 2VPYA 5JZ9A 4QOJA 3DFKA 4XIYA 1W30A 4LX0A 3JW8A 4RIHA 3U39A 3WLLA 1XTSA 3MD0A 4RTKA 3HKBA 2FEXA 3NTRA 3Q7PA 3QXCA 1KY2A 1LTKA 3CV3A 3LVFO 3PJDA 5H83A 3K5PA 3RKSA 1CB0A 4AUMA 5K8CA 5BR8B 4Z4HA 5EMHA 3H05A 3P8ZA 5DYYA 3FUWA 2VH5R 2YWDA 3CX3A 5E9WA 2HU7A 5DK4A 4ALNA 4GE3A 3MOSA 1PFWA 1U7TA 2WM2A 3C7AA 4XQ0A 5JECA 1PQYA 1SG0A 1T1RA 2MIIA 1BD3A 1XZLA 2OT3B 2D06A 1PG2A 2VHWA 3C6BA 3H87A 4NV3A 3CR3C 1BW9B 4UJ5A 3ZDEA 1C1DA 4B6PA 2ZYWX 3CEMA 4B83A 4Z51A 1R66A 2O1XA 4B71A 1UDWA 1CPYA 3EOAI 3H8JA 5DLPA 2PU5A 2ZREA 3EVFA 3NCTA 2I7VA 4MEJA 2PHZA 1GNQA 4NWIA 4UCQA 2B25A 2REQA 4C2AA 1KNXA 2FRDA 2HWYA 4YMGA 1MJGA 4QTZA 1E2GA 4IUBS 4ZHQA 1IJBA 5IULC 4B3MB 2IL1A 4EZEA 1ACLA 1Z38A 3SOPA 1KAOA 3AZPA 1RABA 1GYRA 5I8WA 2XUDA 1O0CA 4J4HA 1HNNA 5CD1A 3RS4A 2Z4TA 4ZVPA 3NWPA 2R7AA 2CDCA 2O9JA 4D8WA 1VHWA 1QTIA 4ZRMA 4D3FA 5BYJA 3LD9A 3A1UA 3B38A 1WZCA 3RSSA 2FPPA 1C7ZA 2IP1A 3FI9A 4UTNA 3JAMA 1JJFA 1E3IA 1WA5A 2OP1A 1BNCA 3E0XA 3L06A 4LKOA 4ZAGA 3AM4A 3I2JA 1SELA 4A8JB 1ABBA 1G2IA 3IQGX 2XUZA 1Q83A 1PEYA 1GLGA 3B1WA 4JODA 2HMUA 2CXTA 1YDHA 1Z6TA 2IQ5A 3ZJYA 4DWJA 3LXXA 2PS1A 3OY2A 2J7PA 5G41A 5BW5A 4RY9A 4RHTA 4EGFA 4P0QB 4LUCA 3D6NB 2WINI 4KDCA 1OFUX 3ESAA 4JLAA 1B0UA 1RRFA 2ZSFA 1JBEA 1JU9A 1RADA 5BORA 3F6BX 3HWX1 3HB0A 1WCXA 1AKQA 1UT6A 4OXQA 1I5EA 1KVTA 1AG9A 1Y33E 4GZMA 3ZY6A 4EW2A 1CP2A 1O5IA 4OX9Y 1PT6A 3GLKA 3EVTA 1IUPA 2PUVA 3JZIA 3LDGA 1H05A 5E6SB 2XRZA 1N2EA 2DZDA 2G9VA 1BCRB 2OWDA 4CE6A 1MO4A 3OZ7A 3PKJA 1NWCA 4PQRA 4G9BA 2Q6VA 3OETA 1G60A 2EEPA 2BIFA 1Q0LA 2HRBA 1I1OA 4A0HA 1TYDE 3H5LA 2PT6A 1FYVA 1DKUA 2G7ZA 3N7UA 6YASA 4WKNA 3V1TC 1NW6A 2GN4A 3V1UA 2D0IA 4FI3F 1CVIA 5A1JA 3H65A 3T9FA 4UVDA 4KQ1A 3KKKA 4FFBB 3R9IA 1BS9A 3NWEA 2XZPA 3V8EA 2XUJA 2YZNA 1XFAA 3V3TA 1P1BA 3LRTA 3G49A 3C8MA 2CE2X 1V8OA 2PLWA 3V33A 2Y66A 2GN0A 4JP1A 4KC0A 3FCCA 4RHUA 1FLDA 2W2LD 3ZE2B 1WUTA 4L78A 2AFIE 2V6IA 3OUTA 4FNOA 5I7UA 1U9CA 3ZHXA 4RXMA 4X3OA 2QLLA 2FWPA 2VRNA 3FOBA 4C7MA 4KXFB 3DHWC 1XB2A 4WTOA 3N0WA 3VOAA 4D3DA 3U60B 1EKXA 3IE2A 2VH1A 3AJDA 5JYEA 4HVCA 2CZQA 3M1LA 2VKTA 3KTFA 3D8BA 4FD3A 5F76A 5A05A 3SI7A 3TPZA 4UUPA 4X85A 1RLJA 3HP7A 4M4SA 5KTMA 4OYLA 2RG1A 2UZAA 2IYVA 4IUCS 4L07A 4EYQA 3NEJA 2IYQA 1U0TA 1ZEJA 3CX7A 1G8SA 1JEQA 1HPLA 2EBFX 3PXDA 4J0JA 2XRYA 5A5DA 1COWA 4G4SP 1BOFA 4KOAA 4KWCA 1Q91A 1YZYA 2G08A 2Y76A 3RRZA 3T3EA 4BL5A 3U4DA 3VR4D 3M89A 3UV3A 4CKCB 5H68A 1Q1AA 3E9RA 1BHSA 2P9HA 4RC9A 1UZMA 1F38A 4B48A 3FDZA 3DFFA 3DE1X 1ST3A 1X2BA 3D5TA 3UATA 3BWYA 4JEIA 2N46A 5ENVA 5J4YA 4I9GA 4RLHA 1NSTA 1DBPA 1MX5A 2FOLA 1EHIA 4FFMA 6ADHA 1ZBQA 4KO1S 3ZTYA 3NQ41 2W93A 3RK1A 2ANBA 4BMSA 5JXIA 1Q57A 4LJ8A 4X6XA 1E1CB 4YHHB 4R9VA 5TGTA 1UEIA 3VFDA 5ICMA 1FX0B 1WZNA 4V0MA 3LVBA 1FFSA 3CZ4A 5LA6F 2KS6A 4C87A 5IJAA 1CYDA 1QZUA 2O19A 2PX6A 3HSSA 3UHPA 3QE0A 4KAXA 4UM9D 2OENG 5ER6A 1WEHA 4F0JA 2AFHA 2M9MA 2XLBA 5GZ3A 3OJLA 1VE9A 3O8OB 1I6KA 1AN9A 4D3YA 2BUAA 2P30A 3O95A 1B0PA 4BQQA 2BP7A 2FN3A 3HWWA 5AP9A 1YRWA 2XBMA 3Q7SA 2WKSA 3W2GA 5A6VA 4BDSA 3IUJA 4Z1MA 2EF0A 2HQOA 1AQUA 3EYWA 2OB2A 4MKZA 5I5GA 1YCHA 5DNYB 1NOIA 3PUWA 3UTDA 3UJHA 3B6KA 2VOEA 5J58A 2Q9CA 3AHDA 1Z4IA 1T6YA 2QTVA 2XBUA 3TGWA 4O4LB 4KE9A 4DAEA 3CVXA 3KWFA 3L5OA 1Z5UA 3H3FA 4RJTA 2G0TA 3ZDYB 1VLLA 2PGAA 2VSYA 4OTZA 1VRCA 1IN6A 2FSUA 1E1NA 2ZBEA 2BFEA 4EX7A 4XVUA 3QYAA 1WAMA 1DAPA 1YKFA 3EPPA 4G09A 4R71A 3M1IA 1OI3A 3FVRA 3I6IA 2BBOA 4C6SA 1KAGA 1U0SY 4IQGA 4RDHA 1P8JA 1ZK2A 3WI7A 1V1JA 4AF6A 5JFGA 1DJQA 4FMBB 3ZE0B 3E23A 5BXQC 1GCOA 3TUZC 1ZUHA 2GZMA 4MRMA 3UJ6A 3I8SA 1Z18A 1Z12A 3L6BA 1FUUA 2NP6A 2R62A 2W4QA 4CR8A 4DR4B 3QPVA 2VCYA 3CSUA 3LG2A 2QSUA 4HDRB 4ID9A 5TT1A 3I61A 2IEGA 3I5UA 3N2IA 1LS6A 2OGUA 4RPCA 5KYYB 1KEEA 3H16A 3CNLA 4YDHB 4ZN6A 4X8HA 5H3LA 3WKDA 1ZM2A 3QTLA 2WZCA 3UK0A 4IVPA 2FK8A 2VP6A 2CJPA 2DM6A 3VX3A 4M0DA 2XKJE 4CV0A 1GAWA 3N0RA 3DBVO 3HE3A 3E82A 4R1LA 3OD5A 2C4HA 1YI1A 1JEJA 3OX2A 3GRAA 5B37A 2LVBA 4LZJA 3AILA 3QXGA 4QECA 4ZEMA 3PTLA 2VDRB 4HNHA 5CM2Z 1ECLA 4X1YB 5LDDC 4MPPA 2AOTA 1I5OA 1E3WB 1OVGA 3FROA 2PLNA 2D0DA 1R9JA 2OD2A 3OBBA 1J8MF 1IPHA 3GMSA 4GIBA 4OFBA 1B4DA 3VRHA 3MWKA 5B7QA 4B33A 3NHWA 5C53B 3E22B 3BJMA 1PFYA 4U1RA 3ROFA 4RQTA 3RBVA 1X80A 2ST1A 1XCLA 2YWCA 3F5DA 3CFYA 4P5PA 5IM5A 1Z56C 1EUYA 3A0RB 3DR3A 3ZQ6A 4JQOA 1AS3A 3WWZA 4GKAA 2R7NA 4DNQA 4RF5A 4ZD6A 4CUJA 3ZCUA 5KWEA 5IJXA 1JKJA 2RSLA 4WJLA 5IT9A 2AI2A 2JA2A 3MILA 4MWSA 3K9BA 5FRDA 2PH7A 2OZLB 3HXTA 2O2YA 2ZBPA 4EG7A 4FPXA 1Z88A 5BMVA 5CXUA 2ZXEA 3G2LA 4H3VA 4XEHA 3CG0A 3GA0A 3B7WA 1US8B 3HABA 4G4JA 4HDNA 4IVQA 1K8ZB 2ZJOA 4TRMA 5FWDA 2VNIA 4BFZA 4EABA 1GZ4A 2I7DA 3JASB 5FFFA 421PA 4C9BA 1UEJA 4MV7A 5J5AA 1L4MA 4I4LA 4QJ5A 1S7CA 1LBSA 1T4GA 2FQXA 1OTXA 2AL7A 3CHYA 1W1WA 2E6UX 3EXFB 4BPRA 2L2QA 2QXUA 2VDVE 1H23A 4DVJA 1N3BA 3HKEB 5FBHA 5FA5A 3QITA 1ODTC 4OAPA 2H1CA 4B6SA 4EPYA 4EM6A 5KU7A 1K2VN 4JI3B 3L4JA 4ATNA 2ZS8A 4IQ0A 2E82A 1ES9A 3GFQA 3IVGA 3ZD9A 2PT9A 3A27A 5BYBA 4IIFA 1F9EA 5DYNA 2C0CA 4B9AA 1ADGA 1OPRA 3FRIA 2IEIA 1XD2B 2C4KA 4J1SA 2ZP1A 4CKBB 3WL6A 2J3QA 3FYTA 3IL2A 1NVXQ 2O0KA 4PONA 1NW4A 2GD1O 1KORA 1Z0KA 4O4IB 2XUFA 4EZBA 1HMPA 1NKSA 4R84A 3QHPA 3SHQA 5DLYA 2I7XA 2IBSA 3T9CA 2D2XA 2GJ4A 2WAYA 3H1TA 1VOTA 1CUVA 5J40A 3GLGB 3QI2A 3BIOA 2H5JA 4J0EA 4QYSA 3LQ1A 3MCWA 1M1XB 4G65A 4M0KA 3VDMA 3GW8A 1DINA 3CZ5A 1HUQA 4IDEA 4JFAA 3KJFA 2RGYA 2KE5A 5EXPA 3SC2B 4NCKA 1RACA 5DSXA 2AC4A 2YJTD 2DLNA 2X4IA 4MA0A 4IWXA 3WQQA 1XX6A 2UZ1B 3KOMA 2UYCA 3KZVA 1FP6A 1WPQA 2XOKA 5KCZA 1AMOA 2I8CA 1KYTA 4YJFA 4UUBA 1BGWA 2OGWA 4L5BA 5AI4A 3FSGD 3VC3A 1RZRA 1UM8A 2GCGA 1ZA2A 3PG5A 3D0RA 3TE7A 5K2OA 2ZI5A 3AK4A 3JQDA 4GRAA 5FAKA 3B9BA 1RHMA 1VSBA 4FK8A 3KE8A 5IAKA 3EH2A 1NV8A 3B7PA 3F6RA 1WJGA 4J0GA 4TKMA 5HCNA 3TRIA 3EOBI 3RV4A 4NMHA 1Y7PA 1VFNA 3UTCA 3MPOA 2BGWA 2FWIA 4CNBA 5HR5A 5BN5A 4KLRA 1M8JA 3TUIC 4RAQA 1W0KA 4I46A 1SHJA 4IJVA 3PUHA 2JIQA 4BO7A 2BCJQ 4HAIA 4BRSA 1ORIA 4Y7CA 3WO1A 5AKXA 1E99A 3PC3A 2H1FA 3UHJA 1WZ2A 5EY5B 5KAPA 1NR5A 3NHMA 4OP2A 1YIOA 1MO5A 3EDRA 3G0BA 4KN8A 4LY3A 4Z7OB 1IBSA 4PLZA 4ALJA 1TTHA 4UM9B 1U28C 4G1MB 3IKJA 1H22A 1ZNWA 2HREA 2JFFA 2QD5A 4QLOA 2Y4NA 4TZKA 4OJMX 2VT6A 4OA8A 4B34A 1KFKB 1IN5A 3T3HA 8LDHA 3L8DA 4BN4A 4DB4A 1OWPA 1IJKA 1V3TA 2FB9A 1GZHB 2IP4A 4W5JA 3C0KA 1WZUA 2QW0X 1U99A 4KL8S 4M9SA 3WHKA 4TWRA 1QJCA 2QPTA 4EUEA 1HRKA 3EEYA 3LYUA 4BFSA 2C59A 2IF2A 3O3MB 1NQUA 5L3QB 2AE1A 4YJDA 1UWLA 2W6OA 1TZ2A 1DDGA 3E3LA 4GEKA 4R3NA 4D4HA 4KPFC 3MWJA 1LJUA 3F5SA 4HDMB 4OGKA 5AHXA 2ZE5A 4ETMA 4F3TA 1EJ2A 3L7CA 3SNKA 3ZE7A 1W88A 1R4MB 1PEAA 2X0IA 5JI3E 2G6TA 4NP6A 2I66A 4HDSA 1XAIA 2XMCA 2H4ZA 4NYIR 4R1PA 2PFSA 1VLQA 4Q1EA 3I5MA 2QZ9A 3EQZA 5IVPA 4UOEA 1YDEA 3C45A 4JL6A 3OKCA 5ENDA 4FFLA 4BUJA 3ETDA 3D4OA 3ZGVA 1KZYC 1C7QA 4I6JA 2IPLA 2ICAA 4MB6A 1Q2XA 1AUOA 5D5HA 4IVNA 4PSAA 1E0SA 2R84A 3OEHA 1BDJA 5CNJA 4D0GA 1WXEA 3PQ5A 3Q8XB 5A7GA 5LP6C 4A6EA 5I4CA 2NPIA 2J0QA 4RJ2A 4TTPA 3DH0A 1K7CA 5KSYA 2HT6A 1E5LA 4R8MA 3MTGA 3ZWQA 3Q40A 3IQZA 4AJLA 3JQPA 4YQYA 4JDPA 1YOBA 5IW8A 2ZBRA 3T0FA 4FTWA 4DDMA 4NE7A 1AGRA 2O50A 1JGTA 4ASUA 3QWBA 5CU7A 2Q0QA 1GWNA 3RGGA 2FSFA 2Z95A 2G9ZA 1GGNA 2E87A 4QQNA 4BVBA 4E5NA 4NZ9A 4FYVA 4X24A 1ORDA 1V2HE 2R2AA 1RPNA