2AF3C

Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
332
Chain Sequence
VTFLEKISERAKKLNKTIALPETEDIRTLQAAAKILERGIADIVLVGNEADIKALAGDLDLSKAKIVDPKTYEKKDEYINAFYELRKHKGITLENAAEIMSDYVYFAVMMAKLGEVDGVVSGAAHSSSDTLRPAVQIVKTAKGAALASAFFIISVPDCEYGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSYSTKGSAKSKLTEATIASTKLAQELAPDIAIDGELQVDAAIVPKVAASKAPGSPVAGKANVFIFPDLNCGNIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIVGAVAITCVQAAAQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate acetyltransferase
publication title Structural and functional studies suggest a catalytic mechanism for the phosphotransacetylase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Transferase
total genus 111
structure length 332
sequence length 332
chains with identical sequence D
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 2af3C02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2af3C01
2AF4C 1TD9A 1VMIA 4E4RA 1XCOA 2AF3C 1QZTA 1R5JA
chains in the Genus database with same CATH superfamily
1ESCA 3H2JA 3BTUA 3PIDA 3UUWA 2EYQA 2XNHA 2NV6A 3LS2A 3NYWA 2EWWA 1E2GA 4N76A 1ND6A 1R5JA 3MJHA 3HFRA 3B2EA 4BPRA 5IK2A 4DM3A 1AGPA 4MQ6A 3IT1A 1XD2B 2I33A 3PNOA 2Q3DA 2TMKA 3RUEA 2QX8A 1CR1A 2W4MA 1JR3E 1YL6A 3BSSA 2ICAA 3ID6C 3JQQA 1C0PA 2EZTA 4HBZA 4PCLA 4R8KA 4X63A 3VR4D 2P9YA 3EVAA 4FB5A 5BR7A 3UWKA 2PUVA 1ZVMA 1SA0A 3E4DA 2A1UA 3EFOA 1J09A 3MT7A 4LY3A 4NZYA 3ZE6A 1DZ3A 2PRYA 2ZYRA 5COBA 3R3WA 3AKCA 2Y77A 1IWBB 2V0NA 3QXJA 1SHKA 2PQ0A 4YT8A 1EFPB 2I99A 2WG0A 2ZLBA 1XTRA 3HDYA 4GUDA 4IIYA 5AOBA 3CF6R 2AXPA 2XDAA 1GCGA 3HA5A 3KLPX 3LY5A 3Q8MA 4N8DA 1SB9A 1Z33A 1TUGA 2OCGA 4CTKA 3UJCA 1T9KA 1M6HA 1ORTA 1RFLA 2LTAA 4CFYA 5DNUA 5D51S 3G02A 3RUDA 4KPGA 1W46A 3JR3A 4IJ6A 1Q2XA 1ECGA 1L5OA 3TUJC 2BMVA 3H8JA 5TMPA 2OXEA 1RMQA 3N0XA 2ZWMA 2AZDA 3KKZA 4J16C 2O50A 7REQB 1ZNXA 3QEBZ 2IPLA 3F49S 4YN3A 2A3NA 4IH4A 2PS0A 3KKEA 4CF7A 1N92A 4TMWA 4B80A 1SGWA 3O2QB 3U1TA 4IDHA 1Y5NA 2B21A 1DADA 1UJ6A 1H6AA 5ER6A 5ALXA 2MYUA 5DNYB 2RHWA 2JNWA 2H8KA 4EG1A 4X1IB 3BK7A 2AVNA 3L0YA 2R7LA 2JLBA 4IIJA 3HCPA 4B6RA 4YRSA 5TDHA 2J0SA 4H0NA 1NJSA 1P3JA 4YDQA 5LDHA 3KAKA 5AW4A 5J40A 4C21A 1FXSA 4EKEA 5EIBC 2ZIUB 3AEZA 3QBEA 4D6YA 4XOUA 2DBVO 5A7HA 5B3LA 2C4WA 5B1IA 2OCXA 3T1HB 1WDKA 4J16A 3P94A 4E2XA 5BSGA 4YT5A 5B6JA 5U4XA 5DHAA 5GVSA 2PSHA 2P2NA 2HW8A 3G8AA 3RJMA 5ALVA 2Q6KA 4ETWA 3ZEIA 1RMYA 1PE0A 2UUAB 4A1OA 3IIEA 1FVOA 2AW5A 3A4YA 3NPAA 4UHEA 5FTLA 3L2OB 1RYFA 1E9BA 3RG8A 4G24A 1TA0A 4OBWA 4QUEA 1VBFA 3G79A 4DMGA 4FHCA 4EHNA 4EUFA 3H6KA 7ADHA 1Y6RA 2OG1A 3G6KA 3WWPA 4F3YA 5A4KA 5E6UA 1RADA 1M2GA 1ZGJA 5ITSA 1SKYE 1ULAA 4IO0A 1ZIOA 5AVRA 1U0BB 5JY6A 2EP5A 1DAEA 2ERYA 3I9MA 3PICA 3HGTA 5DHQA 1CUHA 1L4LA 1FUUA 2H7XA 1O6FA 2Q3EA 1X74A 5EKSA 5EJAA 4D5GA 4E3ZA 3AY3A 3MRSA 4HUTA 3BJZA 5SZKB 4TV8B 2XCUA 2YVLA 3CR8A 5DMHA 1YH3A 2LWIA 4UZSA 4C3OB 3HCAA 4YP5A 4D9IA 5JWOA 4RD2A 2DHDA 3AC0A 2JGEA 1FMLA 4QUKA 3K5PA 3KYCA 3PD0A 3KZVA 4IWYA 4XW2A 3IV7A 2R25B 4HDQB 3OLQA 3WISA 4C1NA 5B58C 3C41J 1CYDA 2A58A 4ISCA 3GG2A 1QKKA 5EQFA 3I8OA 3L8FA 4L4ZA 3ETEA 1HWYA 2SCUA 1XP5A 3DL4A 3ZV5A 4BFVA 4JGGA 3CE6A 3OU7A 4ESHA 3FVRA 3HCOA 2QW1A 2D54A 4I6JA 3CX4A 1SM4A 1Q0SA 2B8NA 2Y99A 1NF3A 3GFGA 1DBSA 2QUKA 4MQLA 4P34A 3Q12A 4AN0A 1EVIA 4HOYA 3IQGX 4GGOA 4XI9A 1XZLA 4YALA 2WFLA 3D7LA 3MSCA 5CXUA 1U7ZA 2P9HA 2C54A 1R4NB 3UWPA 3VKWA 2BHSA 4BRWA 3CYFA 5AK0A 1YJ8A 3MTIA 2W98A 2ZBFA 4DJJA 5JNWA 3RVLA 2XA2A 1NW5A 4DXDA 3PEVA 3UAZA 1QE5A 1TJYA 2HIGA 1S3FA 3DW1X 1OI2A 1QF7A 4YDSA 3SXJA 2JFGA 3TLGA 1N2CB 1K6IA 1UJMA 4F5DA 1E0KA 5CLGA 2JLWA 1L5WA 5I7EA 1ZH0A 2C29D 3V1NA 1PGPA 4I50F 3ERCA 1VLVA 1K3FA 2A4MA 3S81A 5DGDA 3GBPA 3DL7A 2Q5EA 4UC0A 2JAPA 1GPMA 5REQB 5TMBA 1ECCA 1SC4A 4FOTA 1HRKA 1E4YA 1Y1PA 5IDYA 4RH1A 2KMLA 3USCS 4BVKA 3KPJA 4ZICA 4K6MA 5KNLA 1SVWA 2WKSA 2C20A 1DRJA 1SG9A 2BKUA 3LG2A 3K8ZA 4H7DA 3OIWA 4URHA 4O2BA 3M5WA 5K2MA 1HTBA 2LIVA 2QGNA 3NAQA 2GH1A 2WVAA 4RYDA 1RZRA 3SC4A 3L18A 1EG2A 1KK1A 2FTKE 1P7CA 3ZU2A 4BWYA 1QC5A 3H5OA 3FOCA 3RCBA 4Q1FA 1HUQA 4ND8B 2EJCA 4WNIA 3GO4A 4Y2VA 4QU9A 5DYGA 1Y6JA 2QXTA 3CKYA 3Q87B 721PA 1PUJA 1NI4A 4XB2A 4EB0A 3AKDA 3B6JA 2HMSA 3E53A 1GO2A 1SEPA 2C8LA 5J5AA 1ENZA 3FWZA 2VDLB 1MVLA 3I4CA 3RKUA 5CEFA 3GRVA 3L7JA 3N8DA 2Y0BA 2HI0A 3OQIB 5K6TA 3WMXA 2AQ8A 1H4TA 3WK6A 2VZ8A 2KB0A 3ZDZB 4M46A 1E3WA 1XVLA 2IY8A 1KORA 3U3DA 1T4CA 4KI0A 2AEMA 4DIDA 2HA7A 2IYQA 1T34A 1REQB 4HAXA 3MGCA 1SEVA 2H1WA 3WK8A 5BSFA 1IFXA 4L8LA 1S1MA 3TTTA 4JI2B 5K6AA 3I32A 3K30A 1U3DA 2CF6A 3QFFA 1NLZA 2C1EA 4TQGA 1YS1X 3R5KA 5EZYB 4BNTA 3ADCA 3TQTA 3NG1A 3OZRA 4RVDA 4DAEA 1Z4JA 4FNAA 1UBLS 3RK1A 4FSDA 2VG8A 5EJ7A 1BN7A 3GGDA 4OB8A 3B5IA 5DHSA 2KBEA 1EE9A 2W4IA 4RCZA 5EZSA 3U4GA 4GYJA 5C81A 1EZ1A 4LF8B 1YFKA 1E5VA 2BTOA 1PSZA 3IDSA 3KUUA 5A02A 1PFWA 1PNTA 2D1YA 2Y1EA 5JBNA 2F4NA 1PJTA 3V8VA 4BIMA 3OQ1A 4EW3A 1QZTA 3KUXA 5KJ6A 1JHZA 4BLVA 2GNPA 4U2DA 4D0GA 5T4HA 5KUTA 1HR0B 1W5TA 2C4VA 2ZWAA 2AZTA 1PR5A 2FI1A 1T2FA 3BRQA 4I5EA 1IK4A 1GAJA 1S2NA 4Y3UA 3G5TA 1XZEA 4NJEA 4EJ0A 1NUUA 3AZPA 3QVUA 2H6EA 2WHQA 3E9NA 2WZQA 4XGKA 4HR7A 3S2YA 5IT4A 2RGEA 1DC7A 4UEQA 5IRCD 3WGGA 3H4MA 1KJJA 1WHSB 2YOHA 4DMLA 1QO0A 3TQRA 4MI6A 4UQOA 2XUJA 1CUAA 4UHDA 1S8NA 3PJGA 2QJOA 3MFYA 1CF2O 3Q3GE 4BGVA 2R5WA 1E6UA 2VDPB 4JQOA 1NTOA 1T6XA 2ZYUX 1W1IA 1SUSA 3V4PB 5AHRA 3U7QA 1A8HA 5FI5A 1H9BA 4CR7A 3BK1A 1Q1ZA 5C8XA 4W1PA 1NQAO 4ZA2A 4LX8A 4M86A 3WYGA 1DT5A 1II9A 2JJMA 3LUBA 1VSBA 3O0DA 1BS1A 1GPKA 1RI1A 3DE0X 1KZ6A 2X8JA 4A8PA 1T4MA 4QIHA 5C37A 3MM4A 2R4TA 2YNMD 4FGZA 4Y6GB 5H83A 5CX4A 1XMPA 2N3ZA 3L07A 3IPAA 4MTLA 2F1KA 4IGFA 4UBOA 2ONZA 3ZTYA 5BQ3A 5BT8A 1SRQA 4UNPA 1WW2A 1NC1A 4FR2A 3AR2A 5TQ2B 4B6FA 4QO8A 5K8LA 3V8RA 1DDOA 3LBIA 2R1TB 1YZNA 2C77A 1P2UA 2QTRA 3MJTA 4RQBA 1X15A 3SQOA 1IK6A 1LVUA 2R6AA 1XHEA 3O8OA 4WKCA 1XRSB 3TXYA 5CG2A 1PL7A 1K2WA 1PGQA 1YNSA 1HRDA 3HCRA 4REQA 3QXGA 2N1BA 4HLUC 1KZHA 2OCYC 2WJVA 1YI8A 4B81A 3S0JA 5E7QA 2XUPA 4H16A 1DKRA 4YHBA 3IEVA 4MQUA 2Z6UA 2GHTA 2RC5A 4ZYZA 3T3NA 2XUOA 1KAOA 1Q21A 2MMCA 3HYCA 4TTAA 5CT5A 4ZO9A 4NENA 4GRDA 5BSHA 3THWB 5HSGA 4UPDA 5CH3A 4EYGA 1ZA1A 2AS0A 3VR6A 1II0A 1ZH2A 1YO6A 2I7VA 3GWGA 3OJOA 3SJZA 1LDGA 5JC8A 1NJ6A 3TS1A 2O7VA 1K0FA 2QU7A 1V43A 3E7PA 4GKKB 1TMKA 2WEKA 1ODJA 4F0JA 1VLQA 3FUXA 2VHVA 1F7UA 1R0WA 3OOYA 4OHVA 1X87A 5C8ZA 3ANMA 1IEWA 4O2RA 3MIZA 4HLUA 4HYTA 2O57A 3M70A 3UJPA 2B1GA 3IUBA 1JYFA 3A27A 3NHLA 2HY7A 2NUAA 1QVZA 2VUUA 3DEHA 4PPGA 5JPCA 5KPDA 1BJTA 1N4DA 1CERA 3I2GA 4LHVA 1CZKA 1TADA 3VM6A 5F4BA 2V4MA 2C4UA 3K0CC 3KYDB 3QVMA 2BGMA 3DE6X 3DVLA 2CE7A 2CD7A 2BEWB 1YUMA 2PIAA 3EPRA 4MWZA 5KU1A 3CN9A 3QQ5A 4OLHA 5MFZA 3M4ZA 5LYJB 1CRWG 4A27A 3D6NB 1T5LA 2MWMA 3ROPA 5F9FA 2DQYA 1ZG3A 4KYTA 1GCUA 2G5GX 3KSDO 1H8HA 2EJUA 2WV9A 3C97A 3TIVA 2CT8A 3HMKA 2WTUA 1T8RA 5LMZA 5DBOA 3GI1A 2FZKA 3LWBA 3PHIA 2XXAB 3AJ8A 2GDZA 4PZAA 3GOHA 3DB1A 3AF5A 4IRXA 5FAXA 2BGNA 4JLDA 3UWDA 5ALQA 4DW8A 3EGXB 2DY0A 1ZESA 1I7NA 1T6YA 3CUKA 4RZ2A 3W2IA 2X4DA 4NF2A 3ABSB 2UVPA 3ICQB 2FLVA 2P6RA 4V38A 5ESRA 4BYMA 1I51A 1BAPA 4R2JA 3E05A 3VSCA 4AJKA 5C7LO 3K0CA 4WOBA 2P2ZA 4AFNA 4F5EA 2NTNA 1TU0A 3OZTA 2GM9A 3G82C 2O06A 2V6GA 5B1SA 3ORQA 2G1PA 2OPBA 1PDOA 3H2YA 1G8FA 3SKVA 4LCEA 2E1PA 2GILA 4UFPA 1EFAA 2IOQA 1IZ0A 1EAMA 1MENA 1W30A 3PC4A 2AV6A 1IVSA 1A4RA 3NBZC 5CXXA 5J2TB 3BQ9A 2H7CA 4AX4A 3TDNA 4NMXB 1G19A 1KEEB 1J8QA 3RUAA 2DFLA 3TZHA 2GJ8A 4B5KA 1QWOA 1B6TA 2BISA 4DM4A 3QLVC 3ZV4A 1SUWA 2BBWA 2PSJA 4CKYA 2A0UA 3OZ7A 3MFQA 2IGBA 3H1BA 3SEAA 2Z5GA 4O3FA 4W9NC 1CVRA 3TAXA 2Y93A 4ZO8A 3IILA 2CB9A 3TFWA 1Z88A 2GCPA 1P9RA 3VZCA 2HD4A 1HDZA 4FJ2A 3OICA 3KPUA 1JBKA 3WGJA 4XM2A 2EX4A 3E15A 3LKBA 2CFRA 5JZMA 3HO1A 2O2IA 4RESA 4E30A 2WMNB 4Q1EA 1IJBA 3AGPA 1WB4A 1DKNA 1UXGA 1ECPA 2DFVA 2Q9AA 3KXLA 2OBXA 4H4CA 5HIIA 3T1VA 4BP3A 1I2CA 2EQBA 2C7BA 5FWYB 3W5SA 4EUSA 3GAAA 4JB3A 4M7OA 1KPHA 2QBYA 4D8YA 3O2SB 1ZMTA 3HYSA 5KC9A 1PUIA 2ENUA 5K8UA 1GGMA 3GNTA 4EG0A 3JR7A 4MQFB 2XBMA 1UR5A 2WTBA 2ADFA 3QLVA 1TD9A 2Q5OA 2XB4A 1RAGA 3PKIA 3ROKA 3UV6A 4D8XA 1I4WA 1KGDA 4JI6B 4G0XA 3H16A 2PU5A 4W9NA 1UJ2A 4RLSA 1LK5A 1L7MA 4YXWD 4NNJA 1O9GA 3D3KA 1RYYA 3JWGA 4ZJPA 1TU3A 3HABA 2G36A 2X5NA 1ATIA 3EUAA 3UK6A 1N9KA 1RKVA 2GT1A 3P4YA 1W48A 3KNZA 1FFDA 3A3KA 3PLRA 3FWYA 4DJDC 3UMVA 3IUJA 4XQCA 1VYUA 4J7CA 5AICA 3QA3E 4B75A 2ZJ6A 3EQ6A 4JB8A 3SSMA 5JS7A 2OM6A 2CBXA 1KEKA 4MRNA 3TDMA 5KYGA 1K7SN 2QNRA 3D6MA 4IDPA 5A4MS 1GTRA 1U7XA 2WU1A 2A9RA 2B4RO 2C5SA 2Q46A 1THTA 4JBWA 5DV9A 2JFZA 1YTLA 5JD3A 2O3UA 5TIIA 1BMDA 2ZVDA 1L4HA 1T0IA 3QOYA 5EVJA 2WBLC 5JXIA 4CDMA 2REBA 4M9SA 3W3AA 4I5GA 3RT1A 1JHYA 1G5TA 5ARDA 3A2LA 1IC6A 2R4UA 2WTNA 3P0EA 4US0R 4Y0NA 4PONA 5FL3A 3WA6A 4MUAA 4BMZA 5HXAA 3HXMA 2EBWA 2WSIA 5LLTA 1NQTA 4EOGA 1UDWA 1E0JA 4J2TA 3T06B 1R0RE 1P80A 2GF0A 1CZLA 1YJQA 4EQZA 5KHOC 3D2BA 3GROA 5A3JA 1PTKA 3C1OA 5JH7A 1KAEA 3A1FA 3MQ2A 1XL0A 2A9FA 1HM5A 2GA8A 3SD7A 3JALA 1W1UA 2JLSA 3CRW1 3R0IA 4GKBA 4BB6A 4E51A 1BW9B 2XXBA 4UEOA 1XTVA 3VYSB 3ZYCA 4BS9A 5E3IA 1KVQA 4X1OA 3LT2A 4DSUA 1OXVA 2VSOA 1II8B 3NM6B 3O8QB 2B69A 4GIBA 1YAJA 3PQFA 5AVKA 1PBNA 2GTPA 3N7UA 3MT9A 4RENA 4D43A 4U8GA 4CCYB 1MV5A 1NUPA 4URFA 1J5EB 5ARCA 2ZBPA 4JJ8A 1OT5A 5DBHX 1EM8A 2XUQA 1RXEA 5BV8A 1RP7A 4ZOLB 4ENWA 1JLRA 3O21A 2ETXA 4C0AC 4D41A 3MN1A 4GQIA 4TMZA 3WQSB 4DEXA 3I3OA 2BUAA 1TKCA 4ODIA 1ENPA 2WJGA 3ZCTA 5KVSA 4RZIA 3J81k 4HL6A 1MMFB 1IPHA 3E35A 2A86A 2Y76A 2GZSA 1ZLYA 1NOJA 2O2XA 2Q07A 4IUCS 4ONEA 5E8RA 5GWXA 5AVSA 1JU9A 1FNCA 2OUIA 1WXWA 5AQEA 3RSQA 2C1ZA 1KBZA 5B1HA 5LLDA 5JC1A 4BO9A 5CNIA 1E2BA 1JQ5A 1QP7A 1W75A 3KKKA 2QE7A 2IPOA 3H65A 2HJRA 3QI7A 4HY3A 4NFSA 4H1HA 5K6AC 4UU7A 4MW5A 1MTOA 1QFJA 2F4VB 3VKHA 4LQ4A 5CAEB 5BVHA 4AD8A 1FUIA 1I3NA 3P2OA 3UGQA 2D2EA 2RE8A 4HWPA 3P9XA 1KHTA 1IWOA 4IDGA 2A33A 1WBJB 5I8PA 5IABA 3CGGA 3BL6A 2WJ3A 1DBWA 1M33A 1Z0JA 3HZHA 4PC2A 5I47A 3U49A 2FJUA 2DETA 1I30A 4FMCF 4W1SA 4C30A 5IJ9B 1V7CA 2ZZMA 3L1KA 2X77A 4BUZA 121PA 3A1UA 2XZTA 1JIIA 1QG2A 5BQOA 4EPRA 5IKMA 4GL2A 3CB4A 1U2GC 1T8WA 4JXZA 2E5LB 4WSOA 1ABBA 3USES 2J9XB 1QKIA 1ZUWA 2O5RA 4GU5A 3LC1O 1R5BA 4L8FA 4TL9A 4F4IA 4YCNA 2CV2A 2BCJQ 4Q3AA 5KYYB 2NU8A 1G4AE 3WLIA 1NOIA 1AKMA 1NMSA 2FUCA 2D7JA 3CF2A 3NTOA 2PIDA 1GZUA 4WVFA 3EDMA 3W05A 4AO7A 1GGKA 4G56A 1NNUA 4LBZA 4ZEXA 1LWNA 5KNCH 2E85A 3R74A 2AI3A 4ZOAA 4HXGA 3EZFA 3FUUA 4H35A 2GN9A 2RI0A 4TRNA 1LNQA 4Q18A 1CPYA 3SM9A 2HR1A 1PR0A 1UWKA 3VPFA 2XTZA 5EXPA 2C3PA 3THRA 2IHTA 1JHMA 1U2GA 3F74A 3EMBA 2B6HA 3ITNA 4NCXA 2Q27A 5FI1B 2CJXA 2BR3A 1CDOA 1N2JA 2V6JA 3DC7A 3L82B 4GQBA 4MAMA 1UP6A 1KC3A 1U8TA 2L2QA 3I8SA 3JY6A 1BKDR 4FW9A 4JR0A 4MPJA 5HQJA 2VJOA 3M34A 2I54A 1NULA 2C2OA 5K8IA 1UOEA 1XYVA 3AXSA 4QVIA 4M1QA 1TL7C 3PUYA 2EG9A 3L4JA 4HJXA 3SMVA 5JY1A 1EJBA 4HC4A 2AEFA 1XAGA 4MR9A 2A0KA 2IA5A 1KVTA 3VO1A 2E4ZA 2H5EA 2LW7A 2EFEB 2H4WA 2JFBA 2XI4A 3DYIA 3H8WA 4OO3A 3DEKA 3ER8A 3BJEA 1EQUA 2V65A 3NV7A 4AX8A 1GFIA 4PQGA 4M0LA 2Y9MB 1NF8A 3HV0A 1M0EA 2W2TA 3ETNA 2UUCB 3ZE1B 1ZJWA 4K1XA 2FSVC 2GK4A 2I9PA 1YOVA 1LQ2A 2IOYA 3AYXB 3F6YA 4MVWA 5FIUA 3V3KA 2QRZA 4AJPA 4Z4HA 3OLYA 1HE4A 3BD6A 4RDHA 5C52B 4Q4DA 3RVBA 2G63A 3OQIA 4BDSA 4D79A 5TGZA 4D8TA 4E12A 3OFJA 5T6BA 5LNK6 2VH5R 3TL6A 2CLLB 1NAIA 1ARZA 2VSYA 3DM5A 4ERNA 2ZATA 2R1ZA 2XD9A 2ZJ7A 4IXMA 3BSYA 2FPPB 3LUFA 2QSUA 5F1YA 1PKXA 1REQA 2WTAA 4CUZA 4D98A 3FPAA 3FSGD 1EUCB 2SICE 2XYQA 1XTJA 2QQ0A 4TQ9A 1HDCA 4MR7A 3NP7A 2P4EA 4MLCA 2WF7A 2PVCA 3L0DA 3ZTTA 5IBCA 3OCWA 3VO9A 1OU4A 1RXVA 3CKMA 1ZGGA 1VI5A 1K66A 2GK6A 1JZTA 5CDGA 4OXYA 4MW6A 3IODA 3I6QA 3WWEA 3OZSA 2ZRIA 3L4BC 4LYDA 3F9CA 3V8EA 5B53A 2AJTA 3IA2A 3VDMA 1EVKA 2QR5A 4BO6A 1K8QA 1MQAA 1VDZA 4KQCA 3IUSA 4JSYA 1K6XA 2B7CA 2BAGA 4ZIRA 5AKXA 3TZLA 1LB1B 3A28A 1ZNYA 5IJZA 3SLKA 5LM3A 1BDJA 1LLQA 5TV2A 1WOYA 2W2VA 1DWUA 4XTRA 5AK6A 4BL5A 2DTXA 3N5KA 1JHOA 1KU6A 2VP2A 4F2PA 3IE2A 1MGPA 3BWCA 4TV8F 3KR2A 1HT1E 3OPQA 4XVRA 4R8LA 1K08A 4RFVA 1Q1QA 3QUBA 2QVGA 1AB5A 2F8LA 2WT4A 4GOXA 5KVAA 1F8XA 3RRBA 5C2JB 4KRYA 1JA9A 2QN1A 3EQ7A 4IR7A 1N7JA 2W42A 3AB3A 1DVRA 3NETA 5EIAA 3WQRA 4V1CA 5KSOA 3DFUA 3L4BA 1P5JA 2IOHA 2J85A 3CBQA 1XWIA 4FE3A 3CISA 1W5AA 1ORDA 3H3XA 1DAOA 1CRPA 4GZ5A 2Y05A 2PMWB 1UZUA 3HKCB 1E1NA 1DJNA 2QLNA 3LYHA 4NFYA 1VLZA 4JLMA 3RREA 3UXHA 2NMVA 1M6YA 1X0VA 2BMDA 3OE4A 4WN9A 1MA0A 1E64A 1UM9B 4ZVLA 3IUYA 4D9CA 1L5SA 2JK1A 2X4IA 4V3CA 1VECA 2JDIA 4E11A 3EZYA 4JAVC 1SBTA 5L3QA 3UFBA 2ZYTX 3Q88A 1WCIB 2VN8A 1UOQA 3O94A 3PPXA 4P9NA 3X1ZA 4BKMA 1CYEA 3OBIA 3Q72A 3DNFA 1Z16A 1V1RB 3C6MA 1PQPA 3IP1A 1FUYB 1V6SA 3NAGA 2W2OA 3OPYB 4ZQGA 3TAHA 4A2WA 4LS3A 3ZVMA 5DTJA 2PTHA 1DAFA 5CX1A 3L92A 5SYMA 1TQHA 4BB5A 3IUQA 5F52A 4BU1A 1C9NA 4NZZA 2MYTA 1JDBB 2X9LA 1U7TA 4M1KA 4XD7D 4ENPA 5JFGA 1J2YA 1ISJA 1KP2A 4L0QA 4MW4A 3W6NA 2HT1A 4ZU6X 5ADWA 1OTXA 5EZ5A 4PCAA 4CYMA 3EZ9A 2EBUA 2C82A 1RRPA 3WNZA 2BI4A 1COWD 5EPEA 3W1WA 5F9MA 5AW1A 5EJMA 3ZHCA 2HAEA 5B7GA 3K35A 2QPAA 3KD3A 2Q28A 4DV6B 5GZ3A 4F4HA 1QOPB 1RHUA 1OASA 1XKLA 1ZBQA 5I4KA 3UK7A 4B17A 4MO2A 3H1FA 4TQAA 2P5TB 4DJ5X 3PGVA 5H82A 4CLRA 4M0MA 3OF5A 3PHHA 5TXGA 1C9EA 1E9AA 3ETDA 1UMDB 4UU8A 4H7EA 1C7QA 2MINB 2P9FA 5IU6A 4YAKA 4G0PA 1GFWA 4WZ6A 1LW6E 3ZTWA 1F0KA 2HYIC 2VP9A 2E3JA 4FOOA 2Y4NA 3ESDA 3RHZA 1XZDA 2J7KA 5DMXA 1MQ9A 1A3CA 1JTVA 1XZGA 4EHJA 4YR7A 4ZQBA 2XWJI 1U3FA 4AN1A 4IHQA 4J4TA 3SK0A 5AHXA 4QPZA 1DEOA 2EXXA 3C7KA 2Z9DA 3GYGA 1GFSA 4G0WA 2JGMA 4E03A 5L45A 4N03A 2CNNA 3N05A 1ML4A 2AJCA 4ID9A 3NS7A 5ETJA 2PEZA 3LTEA 1SXJB 4DLUA 3JQAD 4HPJB 3FWHA 2FXIA 3KSZO 4RY0A 1RHMA 2ES4A 1JL3A 3QVVA 4XEUA 4UHFA 1OLSB 4YFYA 4TRJA 5CITA 5IYZB 1AC5A 4GMFA 5KCMA 3VX3A 2XQIA 5AK3A 1KQFA 1E3MA 1Z28A 2X4GA 1C7IA 1YVUA 2YR0A 3GGCA 5EZYF 2BEWA 4OM8A 5CM9C 3WYNA 2B5OA 4K2HA 4D7AA 4R1SA 3IEKA 1BOOA 2GYVA 2X0KA 3IALA 4G65A 1K8ZB 1U7PA 3KLOA 3DMNA 3T7EA 4ENQA 1VCOA 3EZLA 1D6MA 2WYUA 3VOSA 1M67A 2YIJA 1PS9A 4Q1CA 3WLFA 3FIUA 4QICA 1KDTA 4X0EA 3OPVA 1EQ2A 1GQRA 1JXQA 3EGVA 4XQEA 4DQLA 1TO2E 2VHJA 4EHLA 2OGWA 4KQHA 4JT8A 2AK3A 4UMVA 4NOJA 4C0BA 3RIMA 1AX9A 4J7UA 1UANA 2RHRA 3BFXA 3R5TA 4LJ4A 5TQ0B 2GCGA 3HB0A 1NXVA 1V9LA 2BY4A 3CRRA 5A03A 3L1JA 2B9VA 3NVKI 1O9BA 1JGTA 4YRTA 5TS3A 4LFCB 3B3JA 1QS0A 5KYWB 4ZQHA 2J5BA 1GARA 3NHBA 1OWOA 1X92A 3D64A 4C87A 1F14A 3W2FA 1HFKA 3T5DA 4DIFA 5IVKA 4C4PA 1LLCA 5EY5B 3PUHA 1YIOA 2AHRA 5C5EA 4HAVA 4YLYA 2A8YA 2DUNA 2NTYC 3PFIA 3CURA 1NW4A 3PYMA 2PFGA 2JLCA 3CIFA 1BOFA 2HA2A 4QBHA 2DBZA 5I8WA 2I4IA 3CUTA 4CM4A 4Q7LA 1K5GA 2OGZA 2N9UA 2YQ5A 2OBFA 5LOVB 2FP3A 1ORHA 2Y6UA 2I78A 3HHEA 4YQZA 3AHCA 2VJAA 5P21A 1MORA 3FA2A 3ZWDA 3FYUC 3IEIA 3ZYZA 3UHPA 1NBWB 3SKYA 3HDHA 1MB2A 3EVBA 1IXRC 3AVOA 3NM5A 3Q10A 4OBXA 3ZXIA 3JZDA 3D9QX 3O4GA 5LA6B 2EARA 4QBTA 1M75A 2BT4A 3IAM1 2IEYA 5EWJB 4I99A 4DRZA 4PXAA 3ZZNA 2J48A 3CVXA 4LGMA 2H4YA 3B78A 1MEJA 3U39A 4BN5A 2P6NA 1OC2A 5FWYA 3S2GA 4Z53A 3AIMA 1ZRNA 4UMEA 1R66A 1JXOA 4FI3C 4U7FA 4Z7OB 4DUPA 2LPMA 4MB2A 4MQFA 4TWIA 1P6QA 1B3RA 2QR2A 2VTDA 3MA0A 3DAPA 1VJTA 3OKPA 5JAMA 4QGFA 1KIAA 3DT9A 4MROA 3GGOA 4QGGA 2H1LA 4F72A 4I1RA 3G5MA 4QEZA 3FYUA 4B3BA 1AXGA 2NUTB 4NPCA 4FBMA 1FSZA 2ZWPA 4Y6PA 5F3DA 3U16A 2XCRB 1GUDA 2DFTA 4PYOA 4QJ5A 1YZYA 3RV4A 3NWOA 5FBHA 1OZAA 5DASA 3F96A 5BQXA 3F5FA 3H11B 3EZNA 1ZOPA 2VTEA 2VWHA 2HPHA 3GFFA 3PXXA 1RDFA 3FI9A 5D84A 3HJFA 4LTNA 3WB0A 2FB9A 5HF5A 5CLFA 1W73A 2HKIA 4O1HA 1GPDG 2AA3A 2CDAA 4C4AA 3AG5A 1G7CA 4RHXA 3UBTA 1X19A 4OV6B 1KR5A 1XCMA 3U4MA 1OREA 3SHWA 1O96B 2ZKIA 3IQHX 4Z1OA 3EUEA 2YXLA 3ZDBA 2OAGA 4EHAA 3GPLA 1W36C 1O57A 5HZKA 1AMOA 2FCAA 1VHLA 4KITB 1KJYA 1W52X 1T0BA 4CUKA 1UZNA 3ZGXA 4HAOA 1CQWA 1NUSA 3A6DA 3DJFA 1XZJA 3KIPA 3QENA 2IUSA 3BCHA 4KB5A 4XX0A 3ZHSA 4YO7A 3NIFB 5EESA 1ND5A 1RYNA 3WK5A 5TLSA 2WIAA 1UAAA 2V98A 5E2BA 3VGPA 2KHZA 3AEXA 4YPOA 1L7QA 5EJEA 1WXIA 4FHGA 5BORA 4M1OA 4G8JA 4F92B 2FDXA 1NYRA 5ERXA 3SCZA 1DC5A 3BHMA 3BKXA 4NK4A 4HAIA 3U31A 6GPBA 1TQDA 2IXGA 5A3RA 1O87A 2VQDA 4M9RA 5BV0A 2KM1A 3SYTA 5CDSA 5LYJF 3PFHA 1NPYA 5AHKA 1IVNA 3C5VA 5DE3A 1VPWA 4NMLA 2Z8YA 3QEJA 1IM5A 2NWQA 4NCJA 5IC4A 2FPRA 1K6JA 3B1YA 1A9XB 4M87A 2G9ZA 3JQ6A 3O75A 4P7KA 3LF2A 4II3A 3H1AA 1Q74A 1O95D 4W9RA 3G9TA 5CD1A 3BS4A 4M0CA 4KVZA 3OEYA 1E2JA 1FLNA 1WZCA 5CTJA 1XTPA 2BTQB 4FS3A 3BIOA 5K0CA 4IHAA 3QEAZ 3QW2A 5G4KB 2E89A 2M6KA 5AW0A 3BFVA 3KKQA 4MUIA 1QQBA 2FY8A 3QTBA 4J0DA 3OX4A 4ZKDA 5JJBA 1S01A 2BDUA 1SG6A 1LD3A 3FNRA 4KWCA 5LLSA 1MW9X 2A1TR 3A9CA 4AWXA 5BMVA 5BQ5A 1KE2A 3FMPB 4IIGA 1K5DA 2XCLA 4U6SA 4WDQA 5ALOA 3UK0A 2C7QA 2PUDA 3O38A 4MQEA 4Q48A 1W8IA 3R20A 2AOXA 4R05A 1N25A 2ZYHA 3GMIA 4G3XA 4LZWA 1IYZA 1KO1A 1S2GA 4UTZA 5ESWA 1BJKA 1H2RS 1S8AA 1YQUA 1GFZA 4QXQA 3WMRA 5C5IA 5J2TF 5JSHA 5JVDB 1EHYA 4EUNA 2ZUFA 3T3OA 3LKDA 4J07A 3OFND 4QXRA 1S2IA 2NT4A 1F2VA 1UJCA 1P5ZB 1WRBA 2O0KA 3NBFA 5KX5B 1RI5A 1L4YA 2YW9A 3AI2A 1YAHA 4ER3A 3FKQA 1YZVA 1SRRA 3KELA 1FYDA 2I03A 2LVBA 3C3EA 3WNBA 3ZE0B 3AR5A 1DBVO 1PV2A 1GZDA 1PZEA 3ML1A 5DGTA 2PSDA 1MG0A 1CUIA 4ER0A 5T3YA 5HF6A 3DBIA 3FVWA 1BU8A 1KJ9A 3FTCA 3OQJA 1HH4A 2IK8A 1KDRA 3FCXA 5FL7A 4M6WB 4WKBA 5GGXA 3OAAA 4PG4A 1PEYA 4HBGA 3UT6A 1EXMA 1RRFA 3GBSA 5CVDA 5EWMA 3W5CA 1U9IA 4LBYA 5AKYA 1JILA 4K05A 1P7ZA 4K9KA 3KWMA 3A2NA 4FOPA 5J5CA 3TOXA 3LHSA 4KWEA 2QK4A 3NTRA 1LDMA 3DVRX 3DL2A 1CJMA 3KB1A 3L7OA 3QX7A 9GPBA 4CEIB 1ZK0A 3ZIAD 2Z3ZA 4WJLA 3MTEA 4CL8A 3HWWA 2QN3A 3L5KA 2H18A 3RSLA 3JQBC 3TLMA 3UJ3X 1BE1A 4OPMA 2XMDA 3O8DA 4G97A 3DWIA 4KK3A 4LWQA 2QRMA 1LK0A 4XAQA 1NMQA 2FLWA 2IYPA 3OUZA 3A6PC 2F3RA 1MOPA 2FZGA 3QXCA 2VIIA 3QPVA 4RL6A 4DIMA 3RKRA 2JLVA 1RMTA 3EDRA 3S8EA 1A8SA 4GSKA 5JCPA 2GLUA 2O2EA 2F1HA 5KNDA 4G2TA 2QAJA 1H9AA 3G2MA 1H2HA 3KB2A 3WL4A 1UC9A 4ZU3A 4CMBA 5BVGA 3NTUA 2BUBA 5CYOA 1EFHA 1RPAA 1JKJB 4OXKA 5ALKA 1QFMA 3M9WA 4XD2A 4YLGA 1U6JA 1UJ4A 5H0IA 2EEZA 2JHAA 3MJDA 1Z5VA 3JQBA 4JDUA 2NXNA 2GAIA 1Q17A 2GA9A 4NE9A 3OI7A 2FR1A 3ZBQA 2D4AA 2PO7A 2WF6A 3PXGA 3IP5A 1DFIA 1SD1A 1OROA 1X7YA 4LZAA 1GLGA 2OUKA 13PKA 2C5EA 2YHBA 3L8ZA 3D7MA 1DXHA 2QMEA 3NFYA 4YAEA 5K8JB 1RAEA 5H5JA 2EKPA 3ESYA 4OI4A 4QUJA 2E7ZA 1X7ZB 2VK1A 1AXEA 1DAPA 3H17A 1N8TA 4S1PA 5E3JA 2Q0HA 2V59A 3QHQA 4PLWA 4ZT3A 2VHWA 2EDCA 2YJNA 3SSNA 3WL5A 2WAOA 4GG1A 2BD0A 2PNFA 5LQJA 1GITA 2JJ8A 2NV0A 1HTTA 3MWDA 1RYMA 4GX2A 3ZX5A 3HVJA 1RC1A 4FDUA 1OX4A 5AHWA 4KN9S 5U9CA 1H3NA 1J90A 2D0PB 3HSKA 4KO2S 2HV9A 1GEGA 2FPPA 2D5AA 2J0QA 2P30A 4ZOLF 1KI6A 1LDNA 3G68A 1DI0A 4YJFA 1JR4A 3RC1A 3HY4A 2B1RA 2VHUA 3PFCA 5L6MB 2BGTA 3R8CA 4BMVA 3GJ4A 2CUZA 3COWA 1HLDA 5HGJA 2Z04A 4OF4A 4D99A 4FFBB 4ZFNA 3BTOA 4OL0A 2IYTA 4PG8A 2WUFA 4B74A 1A50B 1Y8RB 2GSWA 1FDTA 3GT4A 1G20B 5DEIA 3VNSA 2VQ6A 1LLDA 1E7RA 1GZSA 3FCSB 3GHYA 4N6GA 1XSEA 2ZRBA 4FFSA 3S1AB 5L3SB 4IJUA 1QE3A 3GCXA 3V9AA 4XGIA 6YASA 4JHLA 4LY9A 1KDYA 1OBVA 4WZAA 4BECA 3UY4A 1L3CA 4JNKA 3U5ZB 1YJXA 5HBRA 5IMSA 1ZAYA 1Z4QA 3ZV7A 4FUTA 4D3SA 2HRRA 3TD9A 4TKMA 2NVUB 4BVFA 5BPFA 4B8WA 2EWVA 4J94A 3C3XA 1IAQA 2I34A 2R6CA 1N2GA 2IYNA 4Y2QA 3DWEX 4R41A 3EIWA 2ENWA 1ZJJA 3A9UA 3HDTA 3SBXA 1QF6A 2D13A 3HUDA 3I0ZA 3TKYA 4CG2A 2AR7A 2XODA 1SBHA 2QVCA 4UMFA 5KMGB 4BHTA 3WL7A 4QOFA 2EC5A 4NONA 1M8JA 3LE8A 4MCAA 3V8QA 4BIIA 1BWQA 1RS0A 3V7UA 4EELA 1WD5A 1GQSA 3GLHA 4JR1A 4PAGA 4PZUA 4G4IA 4OXXA 3IMGA 2Q7DA 4Z8YA 1HYBA 3SF8A 8MHTA 1H2AS 4HGQA 5CTAA 1OH6A 3B6IA 1IZ8A 1U7OA 2BLLA 4LZJA 5JRDS 4GVPA 4EQ6A 3MRXA 4GPZA 3AETA 4U7DA 5TJ9A 2YJ4A 4CT0A 2IQ5A 3MYYA 4IDOA 2BKLA 4R1MA 2UU9B 1IOZA 1EMDA 2XMSA 1P2GA 5DLQC 2OCIA 1XVVA 3UAXA 1ENYA 5JAHA 5A3SA 5CCXA 3RQIA 4EG8A 1MO2A 4MUKA 1ICIA 3PVZA 1KY2A 4J90A 3QXHA 3U2QA 3JARB 3U80A 2RGWA 4GQAA 4KHZA 5IEJA 3A4LA 1MPXA 1A9QA 1TYEB 2IOFK 3E70C 3HU1A 3MHPA 4NICA 8ABPA 5LKRA 3HC7A 4RY9A 1M73E 2GO1A 2GMWA 4RGBA 2J3IA 3UB4A 4CTJA 1D2AA 3H4VA 4TVOA 1E60A 4J9VA 4L3OA 4XDHA 3T38A 3OX2A 3ZHXA 3O9ZA 3PS9A 4KMMA 4EB8A 1NIPA 5E0OA 3SZLA 3Q8KA 4CMHA 4PRKA 3CR3C 4Q93A 3F5SA 2ZFUA 2AR0A 4PYRA 1FFHA 4Y0AA 5JYCA 2A84A 1QGAA 1P7WA 5C80A 3B20A 3JSAA 4HDAA 3I04M 4QPNA 3NGLA 2JI6A 4YRRA 1SIUA 4ZOCA 4Y2SA 2XB6A 1CS0B 2XCQA 3ZV3A 2HU2A 1UKVY 4DCPA 1I7DA 3NRJA 1EVLA 1TQ2A 2QRHA 2ZE7A 4G85A 3SZGA 4E1VA 4RACA 3DD5A 3KKNA 4JBGA 1S2LA 2ACWA 4FOSA 3RIHA 1TUBA 4CFZA 4YJGA 1UPAA 1N0VC 1WXEA 3FUTA 1CEYA 1KSJA 2WJZB 1QO7A 3LX6A 4QEDA 2MINA 4PCUA 4QLBA 3SQNA 3OF3A 2X0IA 4D0NA 1GNLA 2O4UX 1CQIB 4CM9D 4CW7A 3R5HA 1CZOA 4JGBA 4MQBA 3KUKA 1EDOA 1SOWA 2XOKA 3OCUA 4DMCA 3I1JA 5CVJA 3HJUA 1GRQA 5JQGA 1TPYA 5FO0A 2EKBA 4YONB 3TG2A 1DWOA 3HVHA 3HJGA 4LNHA 4TL7A 2IYSA 3PPIA 3QMMA 1R8YA 3TQQA 1SIBE 5EMLA 1OFGA 4Q9AA 1MO4A 3GRCA 1J8FA 4X8MA 5HKBA 2AX3A 2BF7A 4NSNA 2I6FA 4RUKA 1QIEA 2N47A 3NHKA 3BF8A 3U44A 2CYAA 1CW2B 3CSDA 4PBSA 4AUEA 2CYCA 2JLYA 3LCJA 3BMCA 5BN3A 1KI4A 5FOQA 5JECA 5FQNA 4CV2A 4JLSA 4Y67A 5AVJA 2WILA 3R40A 3AM4A 2VRCD 4KVAA 2FN3A 4WXPA 4DGQA 1GG9A 4BNLA 3AVWA 1Z7EA 3V1MA 5HIKA 3OIUA 4ZRMA 4BX0A 2A6PA 3DBHB 3N7TA 4DQ0A 5HJ7A 3OJCA 4A6DA 5TR9A 3QX8A 3TH5A 3OSUA 3TQHA 4OQEA 3WKBA 2C88A 1UUFA 3HU3A 1JZQA 3K5HA 4P4GA 3K7EA 4HWGA 5K5EA 3ZD7A 3HM9A 1O8BA 2W37A 1XT6A 1JDUA 2D5CA 4U02A 4FYIA 4AKGA 4L8GA 3A32A 2ZIZA 1MV8A 5HCNA 2IYRA 4BQOA 2VP6A 4YRAA 4MYDA 3ER6A 1C9JA 1QLJA 1IH8A 2GK3A 3PX3A 2E82A 1I3OA 5GM2A 5LQNA 1S4MA 1V35A 4L50A 1OXMA 1NSYA 1BMTA 1B1CA 2K5UA 4YTEA 1YKFA 2JGFA 3R44A 2NG1A 4EBBA 5IP5A 6Q21A 2H3HA 4QYXA 2WSSD 3T12A 5JSZB 1J4AA 4YASA 2ZXUA 3KT0A 3T4UA 2ONCA 3B7WA 5KC8A 4XDYA 3HJAA 4C7KA 2W8BB 1SJ9A 2SNIE 4NCIA 1TF5A 4MWGA 5JNRA 3RHSA 3SVTA 1YF3A 2DPGA 5TGDA 3VYRB 2BZ0A 3B6ZA 4JJIA 2XWSA 3V3TA 2WF8A 4PTZA 2CXUA 4D80A 4HX2A 4E5SA 4RZUA 4B3TB 4M89A 2A92A 5K3FA 1X1RA 1CQXA 1X1SA 1VPVA 2QROA 4Y8VA 4PGHA 4LNUA 4JODA 5KNCD 3QF4A 1XF1A 3SFVA 4RXTA 1JFSA 1PR2A 3OLCX 3AL2A 5DTIA 3UK2A 1YS9A 3DDHA 4YRPA 2QEQA 3TSAA 2OSVA 4GXNA 5BW6B 3WGZA 5H4GA 1O54A 5IKPA 3VNVA 5ALZA 5E95A 1QUFA 3EW7A 1MH9A 1LDBA 1E6EA 2EZ4A 1EQAA 4U0JA 4CKEB 5JADA 1EUZA 2OZLB 1FPMA 1U9ZA 3OEHA 4JXJA 2X3FA 4PW0A 4ES6A 2FMUA 1ZN8A 2ZU6A 2FOLA 4P4NA 2Q3BA 4UVGA 3DOHA 4FU0A 4AK9A 2BBSA 2NSHA 3ASVA 5KYKA 4N65A 2HQ1A 2PSEA 1YFJA 1U7WA 5CGZA 4QDXA 2XYRA 1L9KA 4WBNB 2VNIA 5CCBA 1GYPA 2I7DA 3LLVA 3O4HA 1DKMA 1VE5A 1CT9A 4Y2PA 5L3ZA 2QRUA 5BUQA 5KTMA 1G8YA 1ZX1A 3QX9A 4NV3A 2Z09A 4JSRA 2GTHA 4C7OB 4CQMD 3U7FB 4OQYA 2XCTB 3PKJA 2O8EA 1MPTA 1T2VA 1ULBA 2NU6B 2XNDD 3B9QA 3DEZA 4RELA 4PE5B 5EXDA 1QX4A 5EJ5A 3AJEA 1YZUA 4XUDA 3MYRA 3T52A 3K53A 1QMPA 1JPJA 3L7KA 1Z5PA 2P11A 3PLNA 3GFRA 1Q0PA 3A0UA 4KOAA 4TLAA 1F9EA 4B34A 3DTTA 5G53C 3UGKA 4YV2A 5I9SA 2O6LA 3E22B 4Z7NB 1TMYA 2G0AA 3BPSA 3RV3A 2FVXA 5ER9A 3PGXA 4UDXX 4OFZA 4DCOA 4RPLA 1NRIA 3H5NA 3A3PA 4WBSA 5EERA 1G42A 3FNQA 4GLJA 2HLNA 3K1AA 4A0QA 4KW7A 2FJ0A 2H9YA 2NYVA 3GDWA 4DNPA 3LPMA 4U0KA 2I1VB 3Q7QA 3Q3HA 4XUGB 5IYZF 4AS3A 1I7QB 1GAXA 4QOIA 2HJWA 5IFKA 3OLZA 2GZRA 2VXCA 1YJBA 4X71A 3UKJA 1TQ4A 3ANTA 1OB5A 1EVQA 1TNDA 2B98A 4JJAA 2RGUA 3ENQA 3P45A 3RODA 4KWHA 1GRRA 4JMLA 4JZKA 1CNFA 3WVNA 1Y8CA 1JKMA 2V7BA 1RWOA 4KPUA 2WKQA 4G86A 5FOSA 2GEBA 1EM6A 1V37A 2CVOA 4JJFA 4R1QA 2BIFA 3ZLTA 1GQFA 1H4QA 3HB9A 4F85A 4L8WB 3VA7A 3IVGA 4XXHA 3IDFA 3KHTA 1Y82A 4IG4A 2QZSA 3I64A 1EX6A 2GPNA 5SV2A 3KSMA 1JBEA 2PKYX 1Y0BA 2RC6A 3JYQA 1ECLA 2WAXA 3BXOA 1CP3A 1X7GA 2JFOA 5EEHA 2Y71A 4K86A 4OHWA 3OPYI 5EGSA 5ARBA 1PGJA 4YRDA 4HCJA 2UZ1A 3LUGA 3P0HA 2CK3D 2BCGY 4RETA 1YVRA 1L4NA 4BFCA 4EYQA 2OG2A 2NNWB 1Y5RA 2OC9A 1QH8B 2BONA 5JR3A 1VP9A 1P1FA 3IHKA 4ZCRA 3DEFA 1NSTA 3TRIA 2DLCX 3CNNA 3D4OA 4BMDA 2CYBA 3K9NA 5DCLA 3LY8A 3OD1A 3STUA 1JZSA 4RVFA 4WPGA 3BXFA 3M6MD 5AOVA 2I71A 3B51X 1MZVA 2RD2A 5JS2A 4OK6A 4ZYUA 5CLLA 5CBPB 1TTQB 2QPOA 4RZ3A 5A4JA 1GAQA 1ODTC 5K4HA 4KXLA 3LK7A 2OHOA 2AE2A 4DQKA 3RROA 2PMFA 4JI7B 5K51A 3TTWA 4E6EA 3A8TA 2DBYA 4LF7B 4PPNA 5LOVF 3IH5A 4TKLA 3MUEA 4O2LA 2CBZA 4ASUA 1UPXA 2BEVB 2OGSA 1EGAA 5JAIA 5KQPA 5G4LA 3ZDEA 4WH0A 3ZI0A 2LBPA 4MW1A 3GEMA 5DPMA 3GFOA 1DARA 5LA6F 1SPXA 3RIYA 3VO2A 1JJAA 1JSCA 1NBMD 3ONWA 2C3UA 5CIQA 2X5KO 1TCCA 3E5RA 1RQNA 3ETLA 5BR4A 1H69A 1KNQA 3D5TA 1T5IA 4YHHB 1SPBS 1L5HB 3GFVA 2XKBA 5C8YB 1FZQA 4ZOQI 1J56A 4MCIA 3CIOA 1N5JA 4IP0A 1JDVA 4CEIA 2D62A 2E87A 4HWSA 1OZHA 2HK6A 3T8YA 4Z4QA 4ZZIA 1WEHA 1HYHA 4R1NA 4DLRA 1KFKB 1KOFA 4MAAA 4P7FA 1RI2A 1G16A 2PWYA 2QB5A 4PHGA 3ZVKA 5IAAA 5FH9A 2OESA 3P71T 4Q1DA 2WYWA 3OM1A 1P9WA 5AESA 4GVXA 4QX6A 2E9SA 1FMCA 3KVVA 4MWOA 2BH2A 2BUCA 1IMOA 2JEYA 3F3YA 3GV0A 1OI7A 1X9GA 2XDQA 2XWBF 5EIWA 1IPEA 5DLPA 5AXDA 5C8VA 2A94A 2SKDA 1U1GA 3WGNA 1QIGA 1RQPA 2W2PA 2DLNA 2XUIA 3K1ZA 3M3PA 4R0VA 1WMAA 1MW8X 5AYVA 2BGRA 5IASA 3AM5A 3B1KA 3H1EA 4OIMA 2DF8A 1WY7A 4HQFA 4Q1AA 2EFYA 4AZ0B 1J2UA 4LDAA 4ZZ2A 4DNXA 3UJNA 1AU9A 2G6TA 4JL8A 1PS8A 2DVMA 2G9RA 2VQSA 1XZ8A 1VL1A 4FK8A 4RPJA 3AVUA 2BI7A 1MJHA 1NJ2A 2CSXA 3OJWA 4RSHA 4AROA 1SKMA 4KWIA 1KZGB 2IBMA 1R6AA 3WGHA 4XCQA 2CJYA 1AKWA 4URWR 3A6LA 1KVSA 3F3MA 1YI1A 2QTVA 4WWHA 4MYRA 4PZ0A 2KSQA 3G1WA 1Y5MA 1H1LB 1ZQ9A 1T4BA 2KLBA 3PFFA 1X7HA 2JIBA 2GWHA 4L9AA 2PLNA 1AH2A 3DBOB 4OLAA 2QTTA 1G8GA 3C7DB 1O1YA 1OBOA 5A7GA 1G8HA 4DYDA 1MOZA 2ZJYA 3OF2A 1TC1A 2OLEA 2PUHA 1DRUA 1E5TA 3QVJA 1D2RA 1HDEA 1NVDA 4KX5A 4B3HA 3W8NA 3LXMA 4NOKA 4QLOA 5TEWA 3GZJA 2IYEA 1SCNE 1BCRA 3DFMA 4BFTA 3LTNC 3I04A 2BFFA 3NJ4A 4PWZA 2H0RA 4O2AA 2EQAA 2WWRA 2JHFA 1GYRA 2G5CA 3EAFA 1JSLA 3F4KA 2FW8A 1YR1A 3IVMA 2J3HA 4I9FA 1AKRA 2GERA 3TXXA 3L0CA 3AF2A 4P3NA 4V03A 3AU8A 4A91A 5HZGA 1PJ2A 4RABA 5IM5A 5IDXA 4INAA 3VGJA 2EL9A 2FWBA 2VKTA 4Z2YA 1SXPA 2O5CA 1DE0A 4B73A 5JVDF 5IBPA 4NBUA 3S28A 3HP7A 4YQYA 1E62A 4R1OA 1ODSA 1VLMA 5DNAA 4QGBA 1R6BX 4CMIA 2K7ZA 2PS3A 1QLHA 4AC9A 2G9NA 1C4WA 4OATA 4G9GA 3CX7A 2I66A 4MV5A 3K94A 2HEIA 4EUEA 1JIKA 1JR2A 3C4QA 2OO7A 4NG4A 2X2OA 4B4OA 2VJQA 3A05A 1SCAA 3PEEA 5KMGA 2R62A 2DY1A 4URZR 1NNSA 4MTCA 1Q0RA 1XVIA 2EKZA 4HZUB 5ICFA 3UANA 4AKTA 4BJ6A 3LBNA 3QPWA 5DVZA 1SCBA 4MV9A 4MUYA 4DMRA 3ZH2A 1GSAA 1FYVA 2YJZA 2L18A 1FB5A 1TM5E 2PCJA 5EN4A 1RRCA 4TWBA 1NVEA 1A1VA 1H42A 4QL3A 1MO5A 2JGIA 3ZCUA 2FPIB 1DQYA 2RBEA 1SNYA 3PD7A 1UEJA 4S1TA 4UOEA 2IS1A 3MELA 3FDZA 2O8BA 5FBWB 4DMFA 4YCJA 4EJMA 3QFSA 4G63A 4TS9A 4WZAE 4U00A 1HOXA 2REOA 4CODB 5IJ9A 4C76A 4R2KA 4NS1A 1AG9A 3CLRC 3WIOA 2CXRA 2OORC 1CY8A 2B5VA 2C84A 1USKA 5EHZA 2JLUA 4OD0A 4P84A 2DSTA 1ZMBA 3MS7A 4R54A 3UHOA 1QHIA 2ZUSA 1F1BA 4UPVA 3E8MA 3O8RA 4RIFA 1EWYA 4Z86A 4MVJA 4M8LA 3T7AA 3G2OA 1HDGO 3ZLVA 3FX2A 5HM8A 3X0DA 3LRTA 2JA1A 4K9DA 4GLLA 2FRXA 2PKWA 3HCWA 5THQA 4AY5A 2GHIA 2QN2A 3ITEA 2QN7A 1BMQA 2PS9A 2BE9A 2GZHA 2NU9A 4JEUA 4F9FA 1JQDA 3AY7A 1B2LA 1IHXA 2E37A 3GLHE 1BSVA 4KAFA 5AI6A 5KJFA 1Z56C 2JATA 2PR7A 4QFBA 2POQX 2IZ6A 3RVSA 2GUGA 1E9FA 4JC0A 2A5FA 4OH1A 4OIFA 4NBWA 1L3BA 5MGNA 4QYIA 1R88A 2OORA 2OY0A 2FFHA 3GDFA 3WLOA 3L46A 3G2KA 4GBGA 3EEYA 4CM8A 5KX5A 4HEJA 5B3JC 1VIVA 4RXUA 1DL5A 1T43A 3VBCA 3VYWA 1ZM2A 4BBPA 2X0NA 1B6SA 1EINA 1HLFA 1RJFA 1N3YA 1WEKA 2F17A 3LI2A 4RLHA 1TM1E 5FBRB 3AYZB 3BMNB 3BXEA 3HMQA 3C70A 4KQIA 4X85A 4R9VA 4XJTA 4JI3B 3ZZTA 5AW8A 4HGPA 3EZGA 4ESEA 2RHHA 4A6PA 3HACA 7MHTA 1UK6A 4N7RA 1EXVA 2OB2A 3P5SA 1KBOA 4LPSA 4KXYA 4ZC1A 1KMCA 3I23A 1L4BA 5HG0A 4ZD6A 2X5JO 4TOIA 3QJYA 4CLXA 2AYZA 2CNWA 2E4AA 4YNBA 3OTHA 1QYIA 1RWMA 4YR9A 5FTMA 5F2NA 2D6FA 3L7BA 2YICA 2VYVD 3OETA 2VYND 2D1SA 2JBWA 1PT8A 4F3CA 2B36A 2VK8A 1YFZA 2Z8ZA 2BH9A 1L5ZA 4YV7A 3G0BA 5I7SA 4UUPA 1EXNA 3D4NA 3EODA 1Q1EA 4GZLA 4ZI7B 3AIOA 2FWAA 4JU8A 2XKJE 4XIFA 4XPZA 4W8HA 3FNFA 4ZRDA 2KI5A 5EJFA 4GBMA 3TOVA 5C7OO 5AO9A 3KHSA 2HREA 2TMYA 1L7PA 4F3RA 2AR9A 1FFBA 1SC9A 4MZXA 3FM9A 4LXXA 2IYAA 3B1FA 2ZSUA 4LW8A 4QQKA 4QTXA 4TSFD 4BFUA 5EHXA 4CG3A 3N0WA 2I2DA 2ZJFA 2Q5JA 3CGWA 3KKMA 1JIJA 2VTBB 3PCTA 3JYNA 1SC1A 1ODFA 3QBTA 3X1KA 3NRCA 2QYOA 4PSDA 3E48A 5KCZA 5J63A 1I0IA 3G8YA 3LX4A 2E48A 3U6KA 5SZJA 2GJAA 3KOMA 4Q6BA 2OV3A 1FP6A 3WFIA 3KWFA 3HBAA 4P0QB 1XWWA 3GCDA 3G9ZA 3MWYW 1LW7A 2NXWA 3AUFA 3QWBA 4NU0A 4Y7CA 2QUAA 4XE5A 3ZHOA 2PWZA 1JHXA 5D5HA 2AF3C 2X6TA 3TW6A 1PJQA 1HEYA 2PPVA 3DMDA 3PWKA 1PT9A 1XELA 1ZSYA 3UIEA 1E2MA 1SUFA 5DSTA 3Q3JB 1IY2A 2J6BA 1XIVA 2RH9B 3SBOA 5AVVA 1I9GA 4Z7QB 2AF4C 4IM7A 1GZHB 1TCAA 3EWSA 4U39A 1JR3D 2GWRA 4DB4A 2HRCA 2M98A 3COJA 4JLNA 1L4KA 4G26A 3KBBA 1XPRA 5KYTA 1VSUA 3JVEA 1XZNA 4MICA 3BXXA 3N6VA 4EA6A 1UC4B 1XXHA 2OD7A 1GRCA 2IHVA 2GVNA 4GT1A 4ZVPA 1TM4E 1V95A 1YQEA 1BE0A 4XSGA 1M34A 1RTKA 2XJ9A 4MITA 5AXAA 3WRYC 4LMBA 4K03A 3D6HA 4YAWA 3KQTA 3SFTA 1QNFA 1W34A 3KZKA 1I24A 2CLEB 3VISA 3L7IA 1JHDA 4EUKA 2V7QD 3GJ7A 2P91A 3SS9X 1EFRD 1O4VA 4MWTA 4AJOA 3VI4B 3VZQA 4FCVA 4OB6A 1ZM9A 4IHJA 1TT7A 4ARCA 3VJRA 5HK8A 1SBZA 1Y4ZA 3OZFA 3JASB 2GPYA 3FH0A 4WBNA 2VXOA 1WU8A 5H4HA 5A5FA 3D7RA 2PYZA 2I8AA 1V9SA 5BMOA 3K3PA 1RKUA 2N42A 1Z08A 1K89A 1BQ4A 1J0EA 1HKUA 3ANXA 3C3WA 3EPPA 1JKFA 2PYIA 1K1EA 1NDQA 1Q0HA 2RG1A 4XVQA 1SCDA 1XMQB 1D4OA 5HFNA 1TAUA 1IZYA 1CEEA 4LV6A 3WRYA 3BZWA 4UM9D 4WCDA 1W76A 1C1DA 5LMCA 3S8YA 2YV3A 4WLVA 3M6WA 1LSJA 2CUKA 3DZ8A 3FGPA 3MRVA 2ZB3A 1XZQA 2YYZA 4HZGA 4TS1A 1MUUA 1N2SA 1WF6A 3CNHA 4I4TA 4R8RA 2P0EA 2QQFA 4LZLA 2AC7A 5LL6P 5BOSA 3COZA 2CHQA 3CUWA 3GCZA 2PHZA 1FEZA 2YZ2A 3OU6A 3E0QA 1ONBA 1IY0A 1RI3A 2I6SA 2R60A 4GNRA 4LZZA 5D3MA 2WM2A 5FKJA 2OEPA 1B42A 1M1ZA 1Z62A 4FCCA 4IO1A 4JZYA 4LG1A 4M2LA 2Z8XA 4JKIA 3IBCA 1E2UA 1H05A 4X8HA 2WD7B 3RUPA 5CD9A 4K3UA 2JJ1D 1N6OA 2Y1WA 4ND1A 1T2AA 4KKVA 5CJJA 1FP2A 2C2GA 3SQDA 3VSEA 3ZWVA 4C5BA 4H6XA 3UV7A 2HHLA 2VH2A 2X9QA 5IARA 3HNOA 1JSXA 2RGGA 2EFJA 1FU7A 2BDTA 4HYQA 1TIKA 3D4BA 1P1IA 3F5QA 4QQFA 1EX7A 4MRRA 4RHCA 4YAIA 3VR6H 3OE1A 5GONA 4LHYA 3WLSA 4E4YA 4YJKA 1JX6A 3FLBA 1NMYA 3BEDA 1NJ5A 3MD0A 4LV5B 3M0EA 4HDRA 1AV7A 1A27A 4BTEA 1TRHA 3K8OE 1TC2A 2MT9A 5D6NA 1Q3KA 1QE0A 4UTVA 3DMTC 3NNNA 4I9GA 2VPTA 1XTZA 2HWXA 3PIIA 1YMVA 4GDMA 4HN9A 4M76B 3AL3A 4PLHA 3ZWPA 2BELA 1RM3A 1ZO8A 2IPAB 2XMQA 3QMPA 3BILA 5E2AA 3RYHA 1ZONA 2JI9A 4I1SA 3H7IA 2VJDA 4BQEA 4F8JA 3FI0A 4Q9IA 4D92A 2PKQP 1QH8A 4Q7QA 4FWTA 1PLLA 1VIMA 3GVCA 2FLKA 3DC2A 1UFRA 4PX5A 4KIWA 2ZUWA 3F7TA 3PD1A 3G9XA 2E4YA 3AP1A 3DBLA 1AK9A 3LO5A 1AHHA 4IYJA 2MSEB 1JJVA 1TJ3A 4P38A 5AKHA 1A8UA 5BSMA 2RONA 4LYYA 3I5AA 4PIPA 3MJRA 2G7ZA 4M9CA 4X00A 1ZVVA 3E4CA 2ZITA 2Y6VA 2IHYA 3HKDB 3KLMX 3MUNA 4L7QA 2CVFA 2Z9CA 4KREA 2JGDA 3RDPA 3FFAA 3HY6A 3L0SA 5ABPA 1N6LA 1VHTA 2KX7A 4LBWA 1Z73A 2IRWA 1RQGA 3DMTA 4NK5A 1W4BA 1U65A 4C0HA 3EXIB 4RA6B 2C1XA 3B2NA 4FPXA 5HE8A 2FZEA 1Y48E 1DRKA 1T3SA 5D2CA 4JB2A 2QP4A 2PLFA 2QL7A 1FFSA 3MBOA 2CHFA 4TN1A 5LBIA 1FTSA 1Q12A 1PSDA 5KBYA 4QAJA 2WD9A 3IESA 1GSHA 4BE4A 1WU7A 3CJRA 1QRRA 2JK0A 2GFQA 2ZI5A 1GZ7A 1FYWA 1TT5B 3I2IA 1F8YA 1BHSA 3KJXA 3X2SA 1A71A 3AY6A 3MHTA 1Y3BE 2TECE 1H9CA 1ZIDA 1QP8A 1RU3A 5CYGA 2JH9A 2NU7B 2YWEA 4U2CA 2IGTA 2YXPX 4JXXA 1XFAA 3LXXA 1J9GA 2QV7A 3Q7PA 4MUBA 4X1KB 1F4PA 3V7YA 4G0UA 4HNRA 5KWEA 1GDDA 3GBVA 4MKGA 1V4NA 2EFCB 5C8YA 4OCZA 3X44A 5C1IA 4BNIA 1PV4A 1XNQB 4FMPA 2W6JD 1MABB 1XHLA 3ORFA 2XCOA 1T8YA 4U2BA 2Y2VA 4WBNF 2LZ0A 1J97A 2F1JA 3GVHA 3Q2KA 4RK1A 1QQ7A 1DRWA 5E1BA 2WT8A 3HKBB 4KXWA 1T15A 2CXPA 5EE9A 2VPYA 3AESB 1YACA 1U2RA 1A95A 3EEFA 4OMFG 3IVCA 3M89A 1U11A 2WVHA 5ALSA 4CMEC 4X65B 2QSZA 3OOEA 2FW1A 5AK4A 3V8BA 2XY4A 4DLNA 5IZ4A 1GN9A 1ZPDA 5SZHB 1RWVA 3I6BA 3Q2IA 5JZOA 3RC3A 5G1OA 4CV3A 2AFHA 2H65A 3QPBA 4AJ1A 3TLAA 4YMGA 1N6IA 2C57A 2I67A 3FPSA 4JYZA 2VPWA 1E9CA 5A2GA 2X42A 2PGOA 1ZD9A 2FPMA 1SBCA 2Q62A 2WINI 4YB8A 2O8NA 3N0VA 4JKOA 4LC1A 4LXTA 2ZJ5A 3Q1KA 3V46A 1LNZA 1RQ7A 2H4XA 2HHHB 1ZW1A 2XZDA 1KF0A 3KVNA 3DE5X 5ILOA 2BEKA 3T1TA 4ZO7A 1SCUA 5E6RA 3TCXB 2YINC 5AJTA 2R7MA 3I39X 4G89A 2VAWA 4I1YA 2OYRA 1XZPA 2C2MA 4CMEA 2HGSA 3UUGA 5F5LA 3E9MA 1W0JD 3LUDA 5L4SA 3RC8A 5K0FA 1M6VA 2OTCA 1XEXB 4KL8S 4U9IS 1NN0A 1E2KA 1L5YA 5EA2A 3LQ2A 5IT0A 3V8MA 3W3ZB 2HBZA 3LX5A 2G17A 3NNSA 4J1QA 3IJPA 2CLFB 1KAGA 1RQXA 2DCMA 1P60A 3LWNA 1H0RA 3OG9A 1JEEA 3PDIB 4LVUA 2QT1A 4L73A 3QI2A 2AQKA 2XV1A 3LA6A 1DB3A 2XGMA 3V4FA 3EF1A 3QYAA 3W3AH 3C3BA 4OBBA 4R9RA 3ZWBA 4MH0R 4HTFA 4LDPA 3KOWA 5K0NA 3RVQA 3W90A 4IJQA 4DMMA 2IH5A 3COVA 4PFSA 5AVYA 2AC2A 4WNAB 4O4JA 2QDKA 1I1NA 2IXTA 1H3FA 5FV7A 1XV5A 5FF9A 4XGNA 1LBIA 2Z30A 1KEWA 1CG6A 3A1DA 1A1SA 1DEXA 3TXAA 3V4VB 4DDHA 1JWLA 3C5HA 1DIRA 2O54A 2QN8A 3JQGA 3T5MA 1MVNA 4B7AA 2GKSA 1IDOA 3BWVA 5BWOA 1VSQA 1JG7A 1YIAA 3PU6A 2GYUA 3AHDA 4YJ3A 4OSOA 4YI3A 4YRGA 5C31A 4DC1A 1EXDA 2CCJA 3OO0A 3Q7SA 2G5TA 1WP9A 1QIIA 2ZJ1A 3WYDA 4BNVA 2VDWA 2C7OA 5JYBA 1QQTA 3Q5EA 4HVAA 4A23A 1WETA 1HNWB 1FIUA 2H57A 3VVBA 4OJQA 1KMIY 3AK4A 4ZT4A 2R65A 3I01A 4WUTA 5IVHA 2WPDD 4N5IX 2IIBA 4WRRA 1PYDA 1J42A 2YZGA 3KD2A 4R1UA 4Z0HO 1NN5A 4AZ3B 3THXB 3A2MA 2DERA 3LJKA 4TUYB 4TM8A 3DHWC 3FPHA 5TT1A 2WY2D 3FHTA 1YCFA 1E5DA 2HPZA 4IS2A 3SR0A 2FSGA 4GMGA 3K0FB 4WACA 5HS6A 3GP3A 5DI3A 4I55B 4XPIB 3ZOKA 3TOZA 4R71A 2AI1A 5A3QA 1TZ2A 4H7IA 5KWIA 2R6GA 1C0IA 1RFGE 3GJ3A 3K96A 4HNSA 1PWHA 1K2VN 1ZU5A 4M36A 4YCLA 4JYMA 2WTEA 1CXZA 4XB6B 5C8YF 5JZ9A 2IHNA 4ERXA 1E1CA 1SWWA 2HU8A 1SXQA 2ZPAA 3F46A 2G83A 4R3WA 4A5SA 3HDQA 1QFXA 4LJYA 3RBXA 2G1KA 1YR2A 2XE4A 1XZCA 3VSDA 4DC0A 1YMUA 5FBQB 3SLGA 4CCWA 2H1IA 1EDEA 3N75A 4RL4A 4G1EB 3KR1A 3PL5A 4NBSA 3LWZA 3BIWA 4M9QA 3D2CA 3FOWA 4GWLA 1KA9H 2YMPA 4S05A 3ZCPA 2PYDA 3L6BA 4NZNA 1G59A 1KK2A 3DE1X 4W99A 7MDHA 1TM7E 3NLLA 4LI3X 4MPDA 4LRYA 4QTZA 4B2PA 5EZ6B 4F60A 3D02A 5CA1B 2FEMA 1WL8A 2VHTA 1RAHA 1W7AA 1ZGAA 1VMKA 3U4IA 3QPDA 1ODIA 2GHRA 4JWKA 5P8WA 4NPAA 3WY9A 2CDCA 2JHCA 3DE7X 1COZA 2FDRA 3TTUA 3CRMA 3CZAA 4UBJA 5F98A 4G5GA 1ULSA 2IXEA 4LGYA 2RJNA 2FPUA 4U6QA 4QZVA 1OFVA 3QU9A 4OTZA 4S0ZA 5A4FS 3Q9UA 4NE7A 4XWAA 1Z7WA 4QWWA 1B26A 3INGA 4JCOA 4R4JA 3WYFA 3SXUB 4EJFA 4OX9B 1YCGA 4Q03A 2JKZA 3KYBA 2WZBA 1A88A 2FUG1 4EG7A 2PGJA 3V34A 2P3QA 2A5JA 2EL7A 3EIFA 4Y2JA 5LQSA 3DV9A 2CFOA 1W4AA 1IXKA 2F3PA 3K4QA 4G8DA 1CU1A 4AQYB 2X4LA 2HDNB 4F2WA 1OIXA 4EB6B 3E9QA 4WK6A 4ND4A 1GTSA 4I5IA 4DA8A 4MVJE 3T5CA 1R0ZA 1C2TA 2HRBA 4JQZA 1WV0A 3PDWA 3ZCQA 4BAUA 4DLTA 2JIMA 5FBVB 5DN6D 4PAQA 3G1UA 4GM0A 4YO8A 3BGOS 2F6RA 1VGQA 5AJUA 5G1PA 2PMEA 4M53A 2A9KA 1ESNA 2ZETA 1VKNA 4E2FA 1KZ1A 1YGPA 4M83A 4GP6A 1QVWA 2RH5A 2REXB 5C4IA 3ER9A 4H1WA 1WDMA 4GFDA 3QEKA 5LYYA 4UZFA 2WWYA 2WJWA 2OFPA 2Q1SA 3H5LA 4JI4B 4MP6A 3NT4A 4HF7A 4B4WA 4CQJA 3HBMA 1WNFA 1ISFA 1A2BA 2EFDB 5F33A 3NDJA 4KX3A 5IG2A 4IV0A 3PDCA 3EGDB 5AWFC 1DX4A 1UCFA 2OZKA 3LKZA 4J7AA 2RIRA 1JAZA 2GEJA 1PNOA 3I52A 4BLWA 1V8ZA 3WBJA 3FHJA 3NBUA 4EG5A 1ULZA 2X58A 1YI0A 3NIBA 3T3IA 1OHHD 3GFBA 2QN6A 2ZRDA 4JP2A 3AW8A 2QZZA 4N82A 2G88A 2W9XA 1WPQA 1WPXA 2BN4A 2PT7A 3BRWA 3LUPA 4GM4A 4BFSA 1EP2B 1JJ7A 3B3FA 4XDGA 4BZQA 3EXG2 1LI7A 4C7JA 1KMQA 1KTVA 4B83A 3UXMA 4GZMA 4RCYA 3V4OA 4BX2A 3ZVNA 3GAZA 1KI9A 2EHDA 2OR3A 4U8HA 3CCCA 4IVPA 5A4DA 1NVTA 1X7WB 4QBFA 4Q1VA 4TMKA 4L08A 4CL3A 4GC9A 4HHEA 1FDVA 1RRGA 1E77A 3HBNA 2IIQA 1OJ7A 4J1SA 1IN7A 2JCSA 1I32A 3PX2A 5H16A 3RU3A 5ITZA 2J7PD 3M49A 3EISA 3QKUA 2I2BA 3IYLW 3BMOB 5GVRA 4BLPA 4BLRA 1NBEA 4V0RA 4RHUA 1PG0A 1P9OA 1FMTA 5LU9A 5DTEA 4D6PA 4PYLA 5AVUA 5JEEA 1ECJA 1XO1A 3KB6A 5EOVA 3S7ZA 1E8MA 3H1GA 1YC5A 1UEXC 2QYTA 3JYLA 3L04A 4MR8A 1Q7TA 3STVA 5B1YA 1DG9A 2WD8A 4DCVA 2ZR9A 3H05A 3UFXA 5BWCA 5A2QA 4DKJA 1HQCA 1PNVA 4HUQB 2ZJZA 1R0YA 1W49A 2FWMX 1T25A 1Y4DE 3GD5A 4MK4A 4DCTA 4LRUA 4G67A 2PTGA 1Y3HA 2JAWA 3DVAA 2AFIB 1XRLA 3C4VA 3H0CA 3NEPX 4JLUA 1KJQA 3LRXA 4L5AA 4JYCA 1S8FA 4JXKA 4NHEA 4JUFA 4UBMA 4EFNA 5CCDA 3T9AA 4HEQA 3IDQA 5DBIA 3RU2A 4XWKA 4Q47A 1G63A 1GQOA 1NF9A 2R8BA 1LCIA 2NAPA 1QAQA 1MJGM 3JVIA 3SSOA 3UMMA 1FFXA 3KOOA 2VAVA 1UBEA 1N77A 4KUEA 4RQUA 1ZRHA 1HORA 1HETA 1XRNA 1I7SB 5IK2D 3IIKA 2VR1A 1AUXA 3I42A 4JQSA 2QQGA 1AJEA 1EG7A 2GPBA 5HZHA 1Y6ZA 4MUXA 3CMCO 4BFYA 2CSUA 1BS9A 2ZBDA 3FIJA 4I1IA 3WLRA 5K45A 1USUA 2DXIA 1BZYA 4AW9A 2RH4A 2D00A 4Z0PA 4G0VA 1XXHE 4HRYA 4MOWA 1EHCA 4F4JA 4CFSA 1KFBB 2E5WA 3KWJA 5L9AA 4B87A 3RUHA 1CUCA 3JD1A 2QW8A 3R23A 1NBOA 1KSGA 1GGNA 3U6BA 1M34E 1P18A 4ZV4A 4JI5B 4MKZA 2BFCB 4Q9HA 3GYBA 2QZPA 2WWIA 5JISA 1OILA 5EE3A 4DNFA 3SOZA 4Z5XA 3HYNA 1N5MA 4DDTA 3O26A 1O0SA 3T5BA 5LUAA 1U5BA 3I62A 4NU8X 3ZDYB 1LJUA 3UAWA 4UUNA 4I36A 2VDMB 4NYMR 4ZOEA 5EMNA 3KQYA 1H0HA 4TLEA 1NV9A 3NH9A 5DN9A 4ZI7F 3UAYA 4E5UA 1TX4B 3DFFA 4D97A 3MMXA 4ZP1A 3S40A 4J49A 2Q2OA 4GX0A 2DHQA 2IS2A 3H2HA 5GMOA 4ZTZB 3RTAA 1F8GA 2PX3A 4S12A 2P6OA 2QVXX 1MH1A 4Y98A 3S2IA 3UOAB 4ZZ0A 4C7VA 1DEKA 1X77A 5B37A 2GK7A 4QUGA 2IC5A 5AW9A 4HAYA 1F0PA 3V8PA 4BQRA 3UC5A 2X40A 1FNMA 2IW1A 1ZR4A 3B12A 1WZUA 2PZBA 4TKVB 3SMQA 3TFQA 4AKSA 2F64A 3MSXA 1RLIA 3CRVA 2WNSA 3A9TA 2C8JA 2NPOA 4U3JA 2O1EA 2JGJA 4TMYA 3KV1A 1M7GA 1VLLA 3WQBA 5LQAA 1ZINA 4G5YA 2DWPA 3C39A 3OHPA 5B58T 5B7PA 5AVQA 1IM8A 5DM2A 1KP9A 1GD1O 4Q82A 3W2EA 5E9QA 1GGJA 1Y5IA 2XUHA 1Q22A 3UO8B 2IP2A 3BERA 3OOWA 1AS0A 1UFOA 3N2YA 3OMXA 1G8KA 4DE5A 2Z1MA 1IJKA 1RKQA 2BI8A 2EBHX 3SVZA 4BY9E 2IKQA 4FW8A 2OAEA 4PS0A 1U5AA 4AIIA 3SNKA 2NUPA 5H3LA 1E0DA 2XDYA 3K0EA 1QP0A 3FYTA 2VDUE 2VYQA 2I62A 1ISRA 2P2CA 2R66A 3R7WB 3AW9A 4O25A 1DKUA 2HIMA 3BE4A 4OGGA 5H9VA 3L8EA 4DVGA 1ZSVA 4F45A 5JYEA 3BA1A 1C3OB 1T9GS 1J23A 2DHEA 3DE2X 2H54A 3PYLA 5IHPA 1P74A 1IZZA 2FU5C 4NBRA 2A57A 3CT6A 4BCCA 2PMCA 3H3JA 1MAUA 3UMFA 3WZMA 2HQBA 2VF5X 5JRJA 3BDIA 4AQ7A 2D0OB 1CR4A 2QM0A 3OIDA 1A0OA 1M1YA 1WB5A 1GG2A 1ULUA 2P79A 3GRFA 4LTDA 2GBFA 1PV1A 3D8BA 3FRHA 3GARA 2GS9A 4XRGA 2O3QA 2QNIA 1QH1B 3ITDA 5JSFA 1PO7A 1NWCA 3PUKA 2VT2A 3TDKA 4ZCIA 3BGSA 3A4NA 4RPCA 4DRXA 2QLMA 3CVVA 1U0RA 1IXZA 2LUOA 3RC7A 4YS6A 2C00A 4MB6A 1A7AA 3AHHA 1T3HA 4J0HA 3WHIA 3I53A 2XEXA 4HB2A 3ZD9A 5J58A 3F6BX 3H1PA 3UW1A 1RXSA 1FP1D 1ISHA 4XA8A 4A0RA 1MABA 1WDWB 3FFWA 2ZZKA 2WC1A 2WMDA 4FC7A 3EAQA 3H2BA 2P3LA 5JW6A 4DPLA 2R00C 4AB1A 2ZTLA 1CY6A 2JCVA 2RHTA 1YDGA 2ESRA 2QYHA 3HKBA 1UBUS 5ED0A 3NYQA 3TTYA 2R8OA 3P32A 2H1SA 3HCFA 3OKFA 3RUCA 2Z3VA 5DT9A 3D3WB 3VR4A 4BO3A 3IIIA 2G0NA 1NFQA 1U2DC 2RGYA 1EWQA 1PFUA 3LL4A 4FYWA 1BX3A 1DXYA 3ZWXA 3OFSA 3DDNA 4EA7A 2OE2A 3H86A 5FYDA 3JQ8B 5KZMB 1CE8A 5A9SB 1ZI9A 2LGJA 1A77A 1FLVA 1UMCB 3FNGA 4DABA 3GEEA 4BMNA 1MR3F 1N0HA 3C8HA 2WUWE 4UJ5A 3ESAA 2H1RA 4ZAGA 3V7WA 5I48A 4TKUB 3RI3A 1DCTA 3W2TA 4HVCA 3HVUA 3IULA 4PAOA 1Z5ZA 2Q4DA 3NEYA 5BY2A 3B3QA 3FAKA 2QD1A 1U28C 1PFKA 1VBNA 1P29A 3NBXX 1XZBA 4BKUA 1VZ3A 2R00A 3N9IA 4Q21A 1G3QA 1PVVA 2ZUUA 1X80A 3Q8WA 4RPKA 1RZRD 4GZ3A 3GQVA 1I6KA 3M6IA 1J20A 5F5XA 4DKXA 2Q3FA 3IKMB 4N6NA 4X97A 2HJHA 3CWCA 2WZCA 2WSYB 3VNQA 2HNKA 3QUSA 3HJRA 1V26A 2ZBVA 3E58A 4D3YA 5TPWB 1CR6A 3KU4A 4M9ZA 2AWNA 3HXLA 5HUHA 2OSBA 1YQQA 3RSFA 4FQ8A 1YCHA 2P2YA 3PTLA 2HK8A 2WABA 3AM3A 3DVQX 3EXHC 4KNWA 4UVHA 5HDBB 2AN5A 2PWBA 2PXCA 3WDKA 4ARBA 3ICWA 3LCRA 2X0EA 3OQPA 4P7JA 3FROA 1U28A 1PTJC 4CKWB 1UMBA 1EUDB 1LZKA 1JF8A 2AFHE 2OQIA 1ISGA 3RYCB 2KLHA 3HBLA 2WJPA 1D2HA 3HFSA 2VL7A 4E5KA 1JE0A 2J8ZA 3T7DA 3ODGA 1FP4A 2D1QA 2PUTA 1BGXT 1OFTA 1USWA 1AS2A 3LCMA 2GYYA 2VNHA 3UH1A 5B4VA 3AUXA 5CH8A 2QTNA 1CJBA 1JFVA 1WR8A 3NW9A 1O5IA 3LBYA 4D9NA 2OBBA 3S5JA 4D8VA 5IF3A 2IUEA 1PAUA 4P2BA 1PJZA 5J4VA 1V11B 4HFJA 1KS9A 5JRZA 1F51E 2X41A 3AHJA 2I8CA 3IQXA 2BKXA 5DDIP 3H83A 3WLEA 3DAOA 4PC6A 2O5VA 3C6XA 1UIMA 1W94A 2FHSA 3AKEA 3DE4X 4Y2RA 4ZVUA 5GV7A 5LDGA 3K6JA 3T5TA 1IRIA 1SKYB 2XMCA 3EXHA 4L16A 3N8IA 2R6ZA 3D5QA 3JRWA 3OQHA 4BP8A 1RHKA 2M32A 4E0BA 4ZYTA 4IMPA 5IH7A 1AO0A 3NAZA 1MKYA 2O7SA 3N2EA 1P77A 1PTJA 4RQAA 3SC2B 3I0MA 2B8TA 4CKBB 5A5EA 2ODNA 3FGOA 1SZDA 1HZJA 2XEDA 3DDSA 3HEAA 4P5EA 2VT3A 4QJIA 2O2GA 3KJIA 3CNLA 2ZDHA 1TYDE 4FYMA 2EW1A 4UNSA 2C92A 3EPKA 2QTFA 1YZGA 1XD8A 2FQYA 4AYTA 4P2GA 4FSXA 3UAOA 2XAUA 4JVSB 3S2FA 1I7PA 1QG0A 2IS4A 1DIBA 2NVBA 1NYQA 3IDOA 3KZOA 2I5PO 3QPUA 3TLJA 4G4SO 2WUGA 2CW5A 1MEEA 3K0FA 2YWRA 4DT1B 1JYEA 2YS6A 4JLBA 3D3EA 2BWJA 3TEJA 4KR6A 4AJ9A 1ZGCA 4C0JA 2JKYA 1SVLA 4X24A 3T1QA 4O3MA 1MIOA 2GBGA 5FTKA 4KE6A 2E49A 3A9WA 4DZZA 1QDEA 5EHGA 5DCYA 3R5XA 5IUNC 1E20A 1I6MA 4MDEA 3T0FA 1WW3A 4GHWA 2BEUB 2W8ZA 3KQMA 4QOEA 2W71A 4C43A 4C22A 3DV0B 4NQRA 1QUEA 3MGBA 5AI0A 1ENOA 4PPYA 3CVYA 1P8JA 5H80A 4RTSA 1YKSA 3B52X 5ELMA 1OH5A 1FFYA 2EJBA 4CM7A 2IP1A 4C2TA 5KO2A 4UM5A 3FZGA 1WMSA 4RE6A 4FHZA 2XX3A 1QHGA 5AR1A 2C2ZA 3QF7A 3BIJA 1XNGA 1ZGZA 5AP9A 2LIPA 3T5PA 1CRLA 1MU0A 5TVKA 3E84A 1U4OA 3F98A 3QBVA 4C78A 4DPKA 5JTUA 2FEAA 3KK0A 3MWJA 3WRWA 5LXTB 1VI6A 3CBGA 4R83A 5M2QA 1CUGA 2QMOA 3PZRA 1WMFA 1ZP6A 4L72A 5CDFA 3GN1A 4FXOA 3DBRB 3B6MA 2IFTA 2OZEA 3R1IA 4J6EA 2DQSA 2ZXFA 4ZVTA 3V80A 4YYZA 4KNYA 5HF9A 4NXMB 5EKXA 1MB9A 5JT1A 1JN0A 3RVNA 4CEJA 2CE2X 1NM5C 3AFMA 3RTEA 1MX5A 3ADKA 4FP9A 3HP4A 5JU6A 3IAXA 3OO1A 3ZLJA 1WHTB 3AP2A 4YRIA 5ES4B 2JAXA 3DWFA 3GMSA 1Z8HA 3LPLA 1L4EA 4G1MB 4K3VA 3Q3CA 4KFRA 3TTXA 2PL9A 3K9BA 2JIQA 2RKOA 1PSWA 2LDXA 1UK8A 1CIJA 1PG2A 3FXAA 1CUWA 4YJ2A 3T3HA 3FPKA 3VR6D 3IHWA 2PVSA 3NP9A 1OWLA 3QA9A 4PRYA 1AF4A 3NYIA 2W2LA 3BHJA 3EE6A 5DWQA 4BLSA 4EB6A 2OM2A 1EP1B 1XG5A 1XN4A 2JFWA 4Q7MB 4D56A 3B85A 1MA3A 2AJBA 2YHUA 1M2VB 4X5OA 3UUEA 2RHLA 2FX3A 1KXJA 5D85A 1RVDA 2V5VA 2Z56A 1HE8B 3VVMA 4BV2A 4TVBA 1Z25A 5E0KB 4DLVA 1VPLA 1AQJA 3TUZC 3E7DA 3CMMA 2O8CB 1MRNA 3CX3A 5JSKA 1NM5A 5HA5A 4C3UA 4E21A 1SR8A 2CLDX 4KN8A 1OD6A 1YVEI 2YQ4A 3DOIA 1ZKMA 1MJGA 3WLLA 5B2FA 3AF4A 2BRUC 3WQHA 3DMFA 5JSQA 1JXAA 3QLTA 2XR1A 3L8GA 4LKRA 4MJ7A 3CLUD 1S9DA 3HQ4O 4NYJQ