2AF3C

Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
332
Chain Sequence
b'VTFLEKISERAKKLNKTIALPETEDIRTLQAAAKILERGIADIVLVGNEADIKALAGDLDLSKAKIVDPKTYEKKDEYINAFYELRKHKGITLENAAEIMSDYVYFAVMMAKLGEVDGVVSGAAHSSSDTLRPAVQIVKTAKGAALASAFFIISVPDCEYGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSYSTKGSAKSKLTEATIASTKLAQELAPDIAIDGELQVDAAIVPKVAASKAPGSPVAGKANVFIFPDLNCGNIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIVGAVAITCVQAAAQDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate acetyltransferase
publication title Structural and functional studies suggest a catalytic mechanism for the phosphotransacetylase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Transferase
total genus 111
structure length 332
sequence length 332
chains with identical sequence D
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 2af3C02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2af3C01
1VMIA 1XCOA 1R5JA 1TD9A 4E4RA 1QZTA 2AF3C 2AF4C
chains in the Genus database with same CATH superfamily
1EM6A 1YL6A 3P2OA 1K2VN 3KVVA 1KK2A 2PZJA 4ZZ2A 5F7XA 2CNBA 3JWPA 4MKRA 4BOYA 2JGDA 1A88A 1G8JA 3R9KA 3QKSB 1IHYA 4KWCA 4C05A 1OB2A 1MO5A 4QUDA 3QVGB 1YACA 1BDIA 4E1BA 2I6UA 1JKJB 3EXHC 1BS1A 3GIDA 4HKTA 4C06A 4QXAA 4N76A 4WOJA 4D80A 4DB4A 5DRYA 5KNDA 1XNQB 1TRHA 1TZBA 4Q1AA 1SVUA 4RANA 1K1EA 4UFOA 5J4VA 1M34B 1P77A 4I2NA 2G25A 4K3VA 4MVJI 3MUFA 2IEAA 1HUQA 1VIMA 3CZRA 4RSMA 5FH9A 2OC4A 5KQRA 1K3FA 2VHTA 1YF3A 1U0RA 2BGGA 5LQSA 3AVXA 3RU2A 2ZUBA 1YR6A 3JYPA 4BGVA 1A2QA 1L5FA 4LBZA 4MJ7A 1DJNA 3HKEB 3GJ6A 2GPTA 3L7JA 4ZHQF 4YRQA 1U63A 2I1LA 1HL3A 3ESQA 2N75A 4WLNA 1HQCA 1NJ1A 2OESA 1UDWA 5CPBA 4JP2A 1ZIDA 3PDIB 4P86A 3SBOA 4LOHA 3W7BA 2MTBA 3ABOB 4BO4A 3IE1A 4BC0A 1Q1NA 4IS3A 3ELUA 4JB3A 4X3CA 5FXMA 1H23A 3OBIA 1WPQA 3QPCA 1B0PA 2PLFA 3LI2A 4RKEA 5ALJA 1N3IA 2RGYA 4FB4A 4TL7A 5DIZA 5F4BA 5D3MA 3UK0A 4CPDA 2AMVA 2V5UA 4P4UA 3KK0A 3S8MA 1YZFA 2GF2A 3ES9A 2YRXA 4JASB 4EPRA 7MHTA 2PUAA 3A3PA 2DWCA 1JKFA 2HIHA 3RIHA 1T24A 5ALRA 1U8ZA 5AOAA 1VXRA 1MENA 2OORC 1UKYA 3WWEA 2EFGA 1TQ2A 4WLOA 4FKMA 3X1YA 1GLNA 3DNPA 3UMYA 4PFSA 1XMIA 4DC9A 1MJHA 5C8ZA 2AW3A 5AKZA 1G0OA 5EMJA 1X7YA 5B1YA 4V38A 2XZLA 4QYMA 1MOQA 4C1NA 3PGVA 1L7DA 2D3TA 4RZSA 1SKAA 4Y6GB 5EJ7A 2D8AA 3H17A 1EFLA 3AFIA 4DLUA 2IZ5A 3AUKA 1LSOA 5E7QA 1IUNA 3ZZUA 2VPWA 1ZSYA 4HQKA 5IG2A 1T5OA 3HB7A 3PA8A 1NXXA 1SU7A 3BWMA 3GJ3A 3T54A 3SXUA 2NW6A 1KRXA 2WFZA 5I8ZA 4H4DA 4BMCA 1EUCA 3ASVA 1PS0A 2I2WA 5CW2A 4KQJA 4MPRA 1SU8A 3ZR4B 4AUEA 4B3SB 4YJFB 2DPHA 4RGQA 1A98A 3SLGA 3X2SA 3JQ8B 4YJHA 3IHLA 5ULLA 1QVVA 4M46A 3DOCA 1ADBA 1M1NB 1XQ9A 1XWFA 2AK2A 1DXOA 3GFQA 4Y6RA 2I8AA 3OEED 4RJIA 3AFMA 4AZ0A 4BDTA 3AKEA 1W4ZA 1VHJA 5JNUA 1W48A 5BMVA 2X9LA 5C18A 3TH5A 3WGJA 2BCGY 2ZRDA 5CIYA 3HFRA 2OM6A 3H84A 2DMRA 4J2OA 4Z0HO 4ZU3A 1E77A 3RKUA 1CRLA 2SBTA 4CKZA 1OTHA 1UBJS 3FM9A 3L7KA 3G0BA 5JASA 1WKBA 1U3UA 2RHBA 2YCBA 3HWSA 4PCAA 2PSEA 1SC9A 4M99A 4XX0B 3JD1A 3WBJA 3CCCA 4KRYA 1V8FA 1Z7BA 2BMJA 4Z1OA 3B9QA 5K51A 3UMBA 1B2RA 3HMKA 2L42A 4TWRA 4PZAA 3GR6A 1IHPA 2ZUTA 3STVA 4PSDA 1WMBA 2O1XA 2UZ1A 4P34A 1ONOA 5KEIA 2OHVA 2ZT7A 4AO6A 3RFTA 2JVIA 3Q6MA 5AO9A 2E89A 4PYNA 3VZBA 2WJZB 1ACLA 4CDRA 1H8HD 2DBQA 2GD2A 3B6MA 3NYIA 3S8EA 4ID3A 5IDYA 4E1AA 2PZ8A 2ZXUA 4LF6B 4ZXPA 5BORA 4MVJD 5HIKA 3MYRA 4DUYB 1QR6A 3TNFA 4NYIR 1IPEA 1KEVA 3KR2A 3ZGXA 2BFEB 1M34E 3B6JA 4JROA 4N12A 1F4PA 4P7JA 5IF9A 5KQSA 4JI0B 1N5LA 4W5HA 3UG6A 3W6UA 2BYTA 3JPWA 4BP1A 4FYYA 3NG1A 3OWOA 1OY1A 3TDKA 4EW6A 4MR9A 1PQ4A 2HTFA 3R41A 5AKGA 1EPUA 3RIYA 4QRDA 1RJEA 1IQPA 1YJCA 3LBIA 1T91A 3SHWA 4D92A 4OEHA 4F9EA 2VWPA 3L8FA 4FYXA 2YNMD 1CX9B 4WSOA 4HWSA 2J0UA 2IS6A 5KYTA 9LDTA 4OX9Y 4Q19A 1LK0A 4OUDB 2JFWA 2QX6A 3BG5A 1TB4A 3D8SA 3G82C 4DDUA 4KR6A 3ZD7A 3EQ6A 4B85A 1L7OA 1R6XA 4X63A 3OEWA 4MYCA 1G3MA 4ZAGA 3OA2A 3UW3A 4EVIA 1XZIA 2WBLC 1T6YA 3A1FA 3OQMA 2WIDA 2WIJA 5BUCA 1XDGA 3PA6A 4EVSA 3LVBA 1HFKA 4OYHA 1JHAA 3L6CA 1DJMA 4QUBA 1FUKA 2H85A 1BW9A 1I14A 1KBOA 1DB3A 3OU6A 5EFZA 3ORQA 5DP1A 2JBHA 2O0KA 2OWDA 2VXBA 4GZ5A 4I9HA 1LRKA 4K5QA 1RLJA 3RUFA 3UXEA 4AKIA 1RXEA 3A10A 4L4SA 5JMTA 4UUOA 1CTQA 1WO8A 1B41A 4DLRA 4Y2UA 4OQLA 1XKQA 4N0DA 4KVZA 1C2TA 5BSHA 3LUHA 4OQDA 5BW6B 1SEVA 3KWLA 2NXCA 1JHMA 3VTAA 2R7LA 3NHSA 2ZQYA 4ZMRA 4W1QA 2HQ1A 3UK2A 4KG7A 4F7DA 1CNMA 1G6Q1 2B78A 2EYUA 2GSWA 3AGQA 4BMZA 2V97A 2Y05A 1PL6A 1ZVKA 2WE8A 3VU3A 1WZCA 3EULA 2OORA 4R0NA 1ZRNA 2NUBA 1Q0RA 2KM1A 1L1FA 4WA8A 2L19A 3QLJA 4GOND 3IQDB 3TKYA 4AJ4A 1QU3A 5EGSA 3GNSA 4YJGB 1QMGA 4LRYA 4FYVA 1SKUA 4QYWA 4DJJA 1CZHA 1SCDA 2IY7A 4OLAA 1ZH0A 5B53A 2IDMA 5CNKA 3AM4A 1VLZA 4D9NA 1JFLA 2XMSA 4YUAA 3L7AA 1PCXA 1EJ2A 4JUDX 2YRFA 5DWDA 2ZBQA 3FPFA 3GD7A 4Y2JA 5JSZA 3TRJA 1VSTA 3HI6A 2Q0HA 2BMDA 3N2NA 1C9DB 2OUIA 4DDHA 4CF4A 3COVA 2FEKA 2REOA 1TO6A 3BHNA 3DBRA 4DSNA 2DPYA 8ADHA 4LSMA 3KUUA 3PUXA 4KGXA 5EIEA 4DSOA 2AG6A 1QZZA 3WLFA 3G9ZA 2XKKA 4KPUA 4HVAA 4NICA 4YREA 4WFIA 4ZWNA 4E15A 3K2IA 4X54A 4UTNA 1U7PA 4HGRA 5AM1A 4JV5B 4ED9A 4PCLA 2AZTA 2EG9A 2W2LA 4XYBA 3G7NA 5FI1B 4I5EA 3TXXA 1RMQA 3EYAA 1T6BY 5J2TA 4EHIA 1T3TA 2HWYA 4LXHA 2DWOA 4LY0A 4JBNA 1P8JA 1TVEA 1M8FA 3QU5A 3RK4A 1D6JA 3D8BA 1DAGA 5TPWA 5AVJA 3T7TA 4IJMA 5JDCC 4OXYA 4TSFD 5KYYB 4JQYA 2GQ0A 2Y0PA 2H4ZA 1Q1AA 4Z8XA 2O6HA 1C0KA 3FBTA 1UMCB 1E62A 3CLRD 1H2EA 1PGQA 3SC4A 4PLCA 4W8HA 3T7JA 5IABA 4Q7KA 1EYZA 4UQLA 3VM6A 1EHCA 4BMNA 4DUPA 1M7GA 1XWWA 2VKQA 3PGKA 2YR0A 4H7FA 4K9KA 3IA7A 1G3QA 3GC6A 1RHUA 4CM7A 1UBKS 3K1ZA 4MK4A 2W6ZA 1QYIA 1VE1A 2AFVA 4IIXA 3TBHA 5HWSA 2AIRA 4MGHA 4F3CA 4YRCA 1ZP6A 3WB9A 4OLBA 2GEVA 1RC8A 1MD9A 3LT2A 2IWRA 4HXGA 1XPJA 2Z83A 2W8BA 2VZ8A 1LS6A 1OJ7A 1R5BA 2V3WA 2VHCA 4IXWA 1RYNA 2GBIA 3HYRA 5H7XA 4EMSA 1BD3A 2RE8A 5C4IA 1JJBA 2GF0A 3HDYA 2P69A 2G83A 1Y9AA 4KQIA 5CBKA 5JO0A 3O83A 4XJSA 3GMDA 3QMWA 3OM8A 4L08A 4J4HA 3HJTA 4WUVA 3KOOA 2R6AA 2XDAA 4C4RA 4AI6A 1VIVA 2QDXA 2VHXA 3UJ7A 2YMQA 1MXHA 2D8MA 3AO0B 3EPJA 5HKAA 1SCIA 4EA9A 2X4LA 4ITRC 1KYTA 1RPZA 3K9FC 4NCBA 3GIWA 5CYFA 4LE1A 1QYWA 3SYMA 2Z04A 2Z0MA 5AXDA 3R7WA 2EKDA 4EG5A 4RTMA 1NXSA 3G9TA 1SHZA 3CUSA 4FWBA 4HL6A 4IIGA 3K96A 4G5GA 1JUDA 4QBTA 1FP1D 1QV9A 4UBMA 2WJ3A 4AKTA 4B0PA 5T7BA 4KXUA 3UJHA 2DFVA 3CVYA 1Q95A 3FD8A 2V96A 4OQNA 2ZBPA 3EZGA 5GMOA 1ODFA 3G7SA 3OZIA 5HJ2A 3ZWMA 4F1JA 2X6QA 5HTKA 4YJ2A 4Y2SA 1IY1A 1EU1A 1TA0A 3ZJ4A 5LD2C 5HP4A 2GD1O 2B3TA 5CA1B 5LIRA 1REQA 3E1SA 2AN4A 4WLFA 2HREA 4HGPA 1FLAA 3N53A 1DELA 3QVJA 1VG0B 4GE3A 3D7LA 3N0RA 2TMGA 3CBGA 5F7ZA 3QJYA 2NO4A 1UP6A 3D7KA 1E6LA 5KDLA 5TQ2A 3EYWA 4REMA 3SLRA 1J1UA 2IHYA 4FFMA 4YAKA 2GRAA 2XMGA 3HACA 4OQPA 1NYLA 1BCSB 4P93A 3GUYA 3TSYA 4HDNB 2NU8B 2QZJA 5CJPA 2LWIA 4FIDA 2PU5A 4R2JA 3QX8A 3OIVA 1CZOA 5C32A 3S81A 4LBWA 4JI4B 2ONCA 4ND2A 3AFOA 1ZRMA 3KUXA 4CEJA 3ONFA 4XIFA 4CMJA 3NP7A 4L3OA 1QPZA 5IF3A 1YRHA 4ESOA 1YH3A 2HDHA 3WLKX 4F3RA 3M5PA 4OYLA 5KVQA 2JK1A 4FFNA 2KSQA 4R6WA 1Z4KA 2OFXA 2OHOA 1LD3A 1QM5A 4J0FA 3STTA 3DTYA 3HYLA 3C3BA 3IRUA 4PO1A 4Q4AB 4RDCA 1WZEA 3DDHA 3QLUA 3ESAA 4H27A 2X13A 5JRJA 3CR7A 2KLBA 1ZSNA 1XDUA 5EWJB 1JLHA 2VC2B 4BV2A 1WEHA 4DT1B 5I9NA 3O90A 5DIFA 1Z15A 3KQKA 2O7VA 1GFIA 1JWBB 1LLCA 2B20A 5TGZA 1JIXA 1F06A 1IWBB 1G6OA 1AXEA 1B73A 4GVPA 4MYTA 4OHKA 4CE6A 5ECGC 1RVV1 4HD8A 1FNMA 3M1LA 3OTGA 1KHTA 1SCBA 1SOAA 2Q1WA 3HN6A 4HF7A 4EQ6B 3K8OE 1YB2A 2HH9A 1M2KA 2J6CA 2I99A 4D8UA 2EIXA 1MOZA 4FSDA 3T4UA 1X7DA 1KMHB 2FN7A 4R69A 2ZYHA 1KP2A 1SVWA 1PQWA 4QAQA 1AA9A 2AH5A 4L8YA 2ID9A 1U8FO 1YB4A 3VDNB 1L9KA 1Z5ZA 3OSUA 1SC1A 1E89A 2WKRA 2WWXA 3PE4A 4E11A 1AN9A 2JHCA 1UBTS 2G36A 2XDWA 4RYLA 2PSHA 3PDUA 2PFKA 3TZKA 2XLBA 4EY4A 1C8BA 2J45A 5JDCA 2CXNA 4D9EA 1JTEA 3ABRB 4LDRA 3SF8A 4GECA 3H9JA 2P91A 4LN1A 5IM5A 3AVWA 1U8CB 2EZ4A 1LBEA 1R9NA 1DWOA 3LG2A 2PSJA 2OD7A 1ZW6A 5EXXA 4Z53A 5H59A 5H3LA 2G1KA 5A4IS 3EVZA 1QYXA 4H08A 1S2GA 2P75A 1OXMA 1JKJA 2XNSA 1N0IA 1R2QA 4CNQA 1GYQA 1BS9A 4YRZA 4MV9A 4WACA 3RJZA 3R3JA 4RMGA 2G1AA 2Z6VA 1BHJA 3G6WA 1M34A 1TD1A 1XD9A 4I14A 2IDJA 3Q0EA 4RD3A 3O31A 4UTZA 2ZYRA 3I83A 3GUHA 3HJGA 4M49A 3H6GA 2FSFA 3E9QA 4KL8S 3CRVA 4LJKA 1A8SA 5J4KA 4F9GA 3GJZA 3D1VA 3QENA 3WSWA 5BN5A 2VRBA 2A5YB 4R83A 5FBRB 5CURA 2Q2QA 5AKYA 3EQ8A 3LUDA 3HKEA 2PYZA 3WQRA 3A1NA 1V47A 2UVPA 1M8GA 1CW2B 3EIWA 3GNTA 4B45A 4Q3NA 1K63A 1Q6YA 2FQWA 3H3JA 1M2FA 4CETA 3BE6A 3FPHA 3FUVA 3N70A 3N58A 4J9VA 1GNQA 2DT5A 3EXAA 4A92A 1ILEA 3NBUA 1FXWA 3L1HA 3NP9A 4YC7A 3I64A 1PUXA 2YUIA 3HBFA 3CURA 4LHVA 2P40A 2Q9CA 3ZHTA 1TX4B 2HMVA 1V7ZA 2HRRA 3O7WA 4FNGA 4H2DA 3WLRA 2VDWB 3CNHA 5TT0A 2PGIA 4NYJR 3BTSA 5I48A 3PF8A 4B44A 3GG2A 1GNPA 1OMOA 2AHRA 2WTEA 1N2GA 2WTXA 3Q9NA 2HXYA 3U37A 4XASA 2R6CA 4RKQA 1RYZA 4D9FA 3ZGOA 1XALA 1ZK2A 4DAOA 3FRJA 2F4NA 3L7DA 1LPNA 3VR2D 2A33A 3RRMA 3URMA 4IFTA 1SHJA 1JIQA 4MUFA 3BCRA 3NBZC 1GQQA 2QTAA 4CM3A 4EYKA 3NMUF 3OTHA 4DABA 2ZETA 1AVTA 2CNWA 3TJMA 1RBMA 3VO2A 3VR3A 1KJNA 3AZQA 3EFHA 2BFWA 1SU6A 3VI3B 4KAFA 1S2DA 3I09A 2NXWA 5BSVA 1Q7TA 1MPTA 3AHCA 4CR8A 2HDOA 4GPBA 1I0IA 1K5DA 1E2MA 4MRAA 4XAQA 1GPNA 2IELA 4ZCMA 1WZ2A 2XCUA 2V5AA 2RGBA 4YJFA 5T67A 3DE0X 2CJYA 3VSDA 4LF4B 3WA6A 1PLJA 3JQ8A 4FGKA 4M4SA 3UPUA 4OKIA 1NVVR 3OFKA 4ZQHA 1THGA 2ZUCA 1M1NA 1E9EA 3UAGA 4Y2HA 1J5EB 3PUHA 4P2BA 1YBVA 3AONB 3GOHA 3I4FA 4TM8A 1YCFA 5AOBA 2P6NA 2PD6A 1LNSA 2HK7A 2V9CA 5DGXA 1GDHA 1QHFA 4L1KA 5DBIA 4E2ZA 2F64A 4P0PB 2I1QA 1WDMA 1CZRA 4LNUB 3SZRA 1HYQA 1SXQA 4TV8F 3UJAA 1CDEA 4LRXA 3KFVA 4YAFA 2CFIA 3TLMA 4XLLA 3M1IA 5IAAA 2O06A 3C1UA 5DCUA 3SM3A 4DUGA 3TZQA 4BMSA 2JGJA 2O8VA 1BROA 2PZMA 4XX0A 3VH1A 3M70A 1I6WA 1XNHA 4F56A 4P2GA 1GV1A 3QITA 1F9EA 2VSXA 5DNAA 4J0JA 2YZNA 2C82A 5C8DA 1G63A 4L2IB 1DHRA 5HF8A 2H54A 1IUOA 5JQWA 4LXGA 4M3NA 2GN4A 4NG5A 5IEJA 3H5TA 3HCCA 1DDIA 1P2DA 2Q5HA 3U3RA 5CVDA 3I9NA 3G2NA 4GYKA 5KQMA 1ECFA 1C0PA 2Q4RA 5EKUA 3O1JC 4PIPA 4ZT2A 1GUYA 3GMTA 3GA7A 2N1MA 3VISA 2YWBA 4D99A 1N0VC 2ROQA 2GPYA 4HAWA 1R0ZA 3TLAA 3NM6B 1PR0A 4TWIA 4ZVPA 1VL2A 2BFEA 4LYEA 4GUAA 4B3JA 4AY2A 2NYVA 2J8ZA 2ZRCA 2X0FA 1JT2A 2X41A 3A70A 1MRNA 4OXXA 3SX2A 1W44A 1HMYA 3K94A 4ATNA 1PNVA 4PQRA 2W2OA 2BJWA 1VOTA 1MUUA 4GYYA 4DSZA 1OR8A 3ZWVA 2ZIZA 4IIJB 2WG1A 2WM2A 4W63A 2JFBA 5L9AA 3EZ2A 1ZCFA 1HMPA 2Q3CA 3ZLTA 3AM1A 3QRWA 2FDRA 5BNFA 4LJRA 2ZE8A 1CK4A 2E3JA 2FWAA 2HGZA 3NHJA 4JQZA 4OUDA 4Q9IA 2Q6LA 3R75A 4MRNA 3UC9A 1X94A 2WTAA 3G8BA 1OH8A 3FZYA 2HN9A 2WJYA 1AB6A 1BE0A 3GHYA 3PRKE 3ZWNA 2ONKA 4HNGA 3RK0A 4XOIA 6ADHA 3EQ7A 1FS5A 2IE0A 1IIBA 1M5TA 3M6MD 4GZLA 4C7BA 2G6TA 5HGXA 4QGBA 2SCUB 4NFSA 2O07A 3UA3A 4A0FA 2F8SA 5C7OO 2XADA 5ALVA 1FSGA 2LCIA 1QFJA 3Q7RA 1YBMA 3W6PA 1GZHB 5HF6A 2VDPB 2BHSA 4IQ0A 4Q3BA 5H9VA 3I62A 1QGZA 3A4VA 2JLWA 2R87A 1NZJA 1XCLA 1OYWA 2I65A 3BXEA 5J1TB 4FNMA 4IDOA 4AROA 4OQQA 2VA8A 3I5UA 2ZWIA 4M60A 4MGYR 2WRZA 2BTOA 3CZAA 1WSWA 4MQMA 1NOJA 3OT4A 2R6JA 4D7AA 2VLIA 3RVKA 2PWYA 3U4DA 1OOEA 4RPKA 1UMDB 1C7IA 1USVA 4URUR 2IGBA 1S2IA 4FNOA 5DXAA 3FMPB 1U7TA 3NV9A 4QOIA 4GC9A 4I55B 3QXJA 2R97A 1WWKA 2AI3A 2FSHA 1NJSA 2GAIA 1QRAA 2V6BA 2WFAA 3B2QA 3DKPA 3L2OB 2XQJA 4IJQA 5AM5A 3ZWKA 4QPDA 2ZI9A 4DYHA 4LYJA 1OX4B 3TZEA 4HX2A 3ZZNA 5FTKA 2EJVA 3RAEC 1FXUA 4UM9D 1PRYA 3KPYA 4Z7JA 3WGIA 1GZVA 1CRWG 1UANA 1YE5A 3R3XA 4Z3KA 1W7AA 1CD5A 1G3RA 2Q3JA 4G1MB 3IP5A 4TTTS 1QB8A 4ZDKA 1AQYA 1GAJA 3BXOA 3I34X 3KALA 4HDKB 3SQMA 5HRUA 5ICGA 1F12A 1PU2A 1RP7A 1ZMBA 2P62A 1CUEA 4HDAA 3ASUA 1GGEA 3HHPA 2JIMA 5C1OA 5JFTA 4C3UA 3B3GA 5DN6D 2HEGA 1U8UA 3OQOA 1NF8A 3OP1A 4G0PA 3STWA 1F8GA 1VBKA 3MWFA 2VJCA 1TO1E 2F43B 3W3AA 4MWCA 2W58A 5D1HA 4DA7A 4HTAA 3KT6A 1SUEA 3I1YA 4B87A 1JLLB 1DJOA 1KDRA 3AIKA 3GJ0A 4O5AA 3AV0B 3T52A 3EQ9A 1LBHA 1TC2A 1Q3TA 2EJCA 2GO1A 2NN3C 5K5EA 1X1AA 3G2IA 2WLSA 3L93A 3RODA 1RQXA 3E7FA 1RLOA 3D4LA 4XIIA 4O2LA 2YCLA 1UPBA 4R2KA 2VDKB 4IGFA 1SU4A 3PD1A 3AVPA 4FSHA 4MI6A 3KU4A 3U1BA 2CB9A 1RYDA 2V6FA 4UJ3A 1E2IA 1E7MA 4RV5A 5EWMB 5BOVA 4B4KA 2PBFA 5KYYA 2IOHA 4IY1A 1GD1O 2AJDA 4QO8A 3QEAZ 1R9GA 4MKHA 2P7IA 2H7YA 5D1NA 2VXCA 8ABPA 3BXZA 3SAJA 1QQ7A 4TV8B 1FVHA 4RZ2A 3OQNA 2Q4EA 3MJEA 5KYGA 3CLKA 1U6IA 2E2WA 3VYWA 2V59A 1UXIA 3D4IA 4LJAA 1MOPA 4R41A 2VP9A 1KERA 1RBYA 1FRNA 1A2BA 4PQGA 4D3FA 2C2OA 2ERCA 4QTTB 2Q07A 1MGOA 1Y8CA 3AV3A 2X23A 1J8DA 3PVSA 2L2QA 4IFEA 5L3VA 1X15A 3ACDA 1N5JA 2XCRB 3VOAA 5EJ5A 4A0GA 5ALDA 1EUZA 4RGYA 1QMPA 3FW1A 1JIVA 4J1SA 4RHCA 1XMQB 1GM5A 3NATA 2X6RA 4BNTA 2NPIA 2EFHB 5AJUA 5EIBD 2ZSEA 4M9XA 2OCIA 2FPMA 2VKTA 1E6UA 1L7XA 2NPFA 3K9NA 4QQ8A 4TTPA 2BWJA 2FPKA 4TM7A 1XCBA 1YCHA 2PBRA 3P0FA 4TVBA 3S7TA 3SEQA 3C87A 2QPLA 1G0NA 4XEHA 2JAHA 3BN3A 1RWKA 5E7MA 1U3CA 1WOYA 2PKWA 3ZU5A 4NQRA 1WQ1R 1GCOA 4G9BA 2YVLA 3VHRA 4NEHB 1JEDA 1KO5A 4MAMA 2VPQA 3PNYA 2QX8A 3D4NA 4H3SA 5CFOA 2BHLA 2XVXA 4MKGA 1AX9A 3OPYB 3PTAA 1V4NA 2AFHB 2NSHA 3B9PA 3I9MA 4IYRA 1E7YA 1YASA 3OQHA 3IOEA 2V3CC 1Z0UA 3UXYA 1WJGA 3I0MA 4UOQA 4IW3B 1GLGA 5CA1A 1U5BB 1XLTC 1R0KA 1Z5VA 1AGYA 4DYVA 2CEAA 1U0GA 1UBNA 2FG6C 1MQSA 2QL9A 4DBVO 2CF6A 3BMOB 2CHFA 5B6PA 2BSQA 1KJ9A 1RQ2A 1M1UA 3AL2A 1BXGB 1N7HA 3AUXA 5E7JA 1A7JA 2IXGA 3B89A 2JJ2A 2WJVA 3A6HA 3HN7A 3UEOA 3ZHRA 4BBPA 4OXKA 4LY6A 2B9EA 4XUGB 3ESZA 1E7SA 4TYWA 1PTKA 1KI8A 2ZRHA 4XIGS 1N5KA 1W0KD 1H3FA 1BCSA 1SC3A 4UEQA 4FFWA 1WSBA 3WHPA 4HDNA 2D5IA 3NHAA 4HWRA 5J5VA 2NU8A 1VDZA 5KJEA 3UH0A 4LVNA 5HOEA 4OSOA 1D8TA 3ENWA 3K6SB 5J1SB 1E6CA 3RTAA 4DQDA 4TT8A 3LVFO 2HFKA 2QTZA 3ZY2A 4DM7A 5BWNA 3CIOA 1B4DA 1T4DA 4E21A 3OU2A 1PZGA 1THMA 4WXPA 2R8BA 1K8XB 3OPMA 4EI9A 1AQUA 4M9UA 4K0KB 2H65A 1PN3A 3T3IA 3GARA 2X3UA 3A27A 3D2BA 3F9IA 1HY3A 4Q4AA 5EIFA 2H8GA 1DCMA 2QN9A 2WMOB 2WUWE 1P1KA 4TUYF 5BYBA 4B4VA 5EWJA 2JD2A 2V4ZA 2MMCA 4KYVA 4O6VA 3ZD8A 4DT1A 4KHPB 3D1JA 3VC7A 5HIJA 1J2YA 3NKVA 4KNYA 2B0CA 3IIMA 3GLVA 1T6XA 3PZBA 4N65A 3ZK7A 5TX7A 4F5EA 1T36B 2FWBA 3IR6A 5KOHB 1P33A 3K53A 1WXWA 2MYUA 3IFSA 1K8ZB 3KJQA 4URZR 3P2KA 2QE6A 1FF9A 1Q3HA 3STUA 4AJEA 1JBKA 5AVSA 1SBZA 2EOAA 4MWDA 4P35A 4PZEA 4KB5A 4HQFA 4ZRMA 3R8XA 4EQ6A 2UUAB 4O2BB 3BSSA 4Z9BA 3V32A 4J43A 4LI0A 4PC7A 4RCVA 3CRRA 4DLYA 1DIGA 1APBA 3AWIA 2CYAA 1RWQA 2QGFA 4J7XA 4XE5A 2CDCA 1KMMA 3LLMA 4N5MA 4X5OA 1TUEA 6CHYA 3DDUA 3B36A 3AF4A 3N2KB 3CB2A 1LF5A 1QIJA 3KKNA 4OSPA 3A9CA 1SZCA 1R18A 4ZYZA 2UDPA 2Y6UA 2XTAA 3OJFA 3GCDA 4ADSG 2WICA 3OIGA 2B9VA 4X95A 1L1EA 2RC6A 5KSYA 2B30A 5ALWA 1V48A 5ER9A 1OT3A 2NVWA 3GRFA 5JAUA 1QIGA 2ICAA 3PQ5A 4XSHA 2CHVA 1M6YA 3Q85A 4D57A 1T2VA 2JHAA 2ODEA 3GLHA 1R10A 2I2AA 2ZJZA 3BWEA 5KU7A 1YCGA 4Y98A 3D5TA 4YRPA 3R0XA 2BMFA 1HKHA 2QHXA 2XVAA 1XZLA 2C3YA 1JKIA 1S96A 3IAFA 3KHTA 3OZSA 2WHYA 1QZUA 1W85B 4RXMA 3CO5A 2V6JA 4EFKA 1MPXA 1T9DA 4ESEA 4PVCA 2GFHA 5LQDA 3T1TA 3PC8A 4HDRB 5EVJA 3V7NA 2Y3IA 1JYFA 4K6OA 1IBLB 1QLWA 2A6PA 2UXCB 1NP7A 1N2IA 1Z56C 4BP8A 4GX5A 5DM70 4Z6KA 1YVRA 3EC7A 3EEQA 4JBWA 3SQNA 5G1PA 1DQZA 2X4GA 1WBJB 2Q9BA 4IIBA 1COWA 3WLTA 2HXGA 1J9GA 3EEIA 4GSYA 2AFHE 2P9TA 1Z75A 2FQYA 3GEPA 4JELA 2OMEA 2Y9MB 1K88A 1Y6QA 3HUUA 4PC1A 4CFYA 5AW9A 5HBRA 1E4OA 5LZ4A 2Z9CA 2ORIA 5FLKA 1KGDA 1N8KA 1OWNA 2J9FB 4DMUB 3KZXA 3NHWA 1IWOA 1DKLA 1YKGA 1K0FA 2C96A 3B52X 3JD4A 4IDBA 5H82A 3IP8A 1K3UB 2YBEA 2IYLD 1HFWA 3AJ9A 3BBLA 1MC5A 4RJJA 4FYKA 4FHCA 2GPBA 4OQMA 2XOKA 2ST1A 1DBQA 2QD1A 3MINB 4LGCA 4QJIA 2Q6VA 2B8JA 3UV7A 1Y0BA 4LWZA 4PHFA 4U1RA 2J5RA 1FDOA 2JCYA 1V8ZA 3RDPA 5CDTA 4LKRA 4JLPA 4AUNA 2B3DA 1NRXA 3H2JA 4RHEA 2O19A 1G42A 4U2KA 1JZSA 1EQUA 5FO0A 3M9WA 4ILEA 5G2OA 1JEEA 3AHIA 5KB3A 3E70C 3SIRA 4BLSA 2JJ1D 3N6RA 2R5WA 4HQNA 2YFQA 3AUTA 1J97A 3MCZA 3NVMB 4FT4A 3DE6X 3T12A 3GLFB 3TJZA 1XV5A 1N4DA 2YV1A 2YBDA 3A4IA 3PCRB 3ICPA 1UL1X 1G41A 2AXQA 2Q5JA 2BSXA 3PYXA 1Z0KA 1M1ZA 1RZ3A 2RAPA 3F1LA 4OBEA 4QO7A 5DX0A 4U63A 5ALHA 2UUOA 4OMCA 2C5GA 1TZJA 3T3DA 5HM6A 3IKTA 5JG7A 4Q21A 2PGLA 4UARA 1AUQA 5BWCA 3GEBA 4NBNA 5K2MA 3KZCA 1OFGA 1N0WA 4D4JA 1AQJA 3UJDA 3AX6A 5AI5A 1N5RA 3UJ3X 2X2OA 3HJRA 3VJKA 3CUEF 1A69A 1CRPA 2YVAA 1TA4A 1SHLA 5EJ2A 4TGLA 1BQ4A 2X22A 4MVJF 5B2ZA 4EEKA 1T8YA 1MEOA 3L4SO 4C0JA 2PT9A 1VI2A 3GRVA 2LBPA 1HDGO 2W98A 1DZ3A 3CF4A 4E5KA 4YRDA 3H2GA 2VCYA 4LNUA 3QP9A 2A92A 4C6SA 3RGGA 4D0SA 2O0LA 2YKGA 4L5JA 1F2VA 3U0BA 2GPSA 4IIDA 5CM9C 4ALIA 1XBTA 2FZCA 1IK4A 2NZ8A 4LG1A 3ZS8A 4FZ5A 3I53A 1U2ZA 2C42A 2HWXA 2QTNA 2RHJA 5DLYA 4YRSA 1JDSA 1P2VA 2BKVA 2EBHX 3DT6A 3DUFB 2EDAA 5D6NA 5HXAA 3IUNA 4B6GA 4L5YA 3TSZA 1YD7A 4QHTA 1QGED 2Q29A 4DA4A 4L2IA 1MJGM 2VZ9A 1D2EA 1V0JA 1PAUA 2OBLA 2QLMA 1C0IA 1YC5A 3NDIA 4I5FA 4OMDA 5FOQA 4P8RA 1K4MA 1FRQA 1NDUA 2DH5A 3JW8A 4LWOA 3N2LA 2M32A 4GBJA 1NU6A 2CD9A 3NOVA 3AERA 1AMOA 2H48A 4RW0A 3L8ZA 1I13A 1NW9B 4JEUA 1CQIB 3W2HA 4MUXA 3RUDA 3WLHA 2VYNA 5ALYA 4L78A 5CNIA 3KB1A 2CKMA 1ZM9A 3Q8WA 2X8WA 4FX5A 3HL4A 4QUJA 4UVEA 4X6XA 3TGLA 4M76B 4R9SA 4AU1A 3ONVA 4CFZA 4KR2A 3C43A 1SXJB 4IZOA 4PCVA 3UMSA 4KFCA 4MGEA 2OKGA 1LJUA 1MA3A 1XL1A 1YZTA 3IUBA 4JBLA 5D8DA 1FRVA 1NHWA 1Z68A 1JXAA 1IPFA 2A0KA 4WKOA 5JZBA 4P3XA 2I87A 4IIJA 4L76A 4QUAA 4QODA 3P97A 1P1BA 2NMVA 3OE1A 2FV8A 3G1WA 4K6KA 5T4BA 4Z3OA 3SCZA 2FW8A 4HMPA 5IC6A 4L28A 4JVOA 1ID8A 2ZAMA 1TPZA 3LZDA 5FTWA 3K4HA 5FT9A 5IC4A 3KO8A 4K28A 4D98A 5CGQB 3KVYA 5LBUA 1WVGA 4MV3A 2XZOA 3FOAA 5CFQA 1OJLA 1RXWA 2GXQA 1YB6A 3DT9A 4NCHA 2AF4C 4DRZA 3FHTA 2EL7A 4QX6A 1SRQA 2HV9A 4BP9A 2OD9A 2C0PA 4J91A 3AVVA 3HBJA 4F3TA 2SCUA 5BV7A 4AWBA 2ES4A 2OO3A 1K4YA 3R44A 4INJA 1E1KA 4FBLA 1EE1A 5CLLA 1X1QA 4JVLA 2D0PB 2D5CA 4KODA 1XPRA 2BUBA 1T8SA 3P4UA 2AB0A 1BMTA 2BMAA 2G80A 3E7DA 4DNPA 4PYKA 2Z8ZA 1U0EA 5AJTA 5JSUA 1XCPA 2X14A 5F9MA 3UFXB 4BTLA 4TT3A 1JKXA 2G8NA 4WLUA 2JFPA 1KVSA 4JBHA 4MQUA 4ZGGA 3GLFE 1U65A 4MV6A 1YU6A 3E2MA 3NTXA 2NO7A 2WMDA 1NW5A 3C45A 5EGNA 4AD8A 4I55A 4E2XA 3ZBTA 2CL0X 3FJYA 2HJRA 1WF6A 1PK8A 1TDJA 3IDSA 4UHDA 3OURA 3EOAI 3SYKA 3L7BA 4BFZA 5J47A 5LZ2A 1K7CA 2GPJA 1AQIA 1OX4A 2FVXA 2Q3LA 1QPBA 4O2AF 2WT4A 1BHQ1 3PVZA 1GO2A 4CYMA 3N9IA 2JIOA 1VB3A 2GUWA 3ZWDA 2EATA 2XKBA 3NBQA 1VRVA 3KOXA 1PJBA 4AJOA 1TC1A 2KX7A 3JD3A 4P81A 4I1OA 4HDKA 4FYJA 3THOA 3HJHA 1F8XA 1U3WA 3QHPA 2BBSA 2CNLA 3O03A 3QOFA 1XIVA 4IKOA 4W99A 3T0FA 5HR5A 2GHIA 5CAEA 3PNBA 4R8SA 5FLYA 4PXSA 1HM5A 2RH5A 1VXOA 1Z29A 2PT5A 1HSOA 1V8PA 1OPRA 2YFKA 4EGAA 1WY5A 4F12A 5KNDH 1ZR2A 3Q12A 4AT1A 5CT8A 2P11A 2BW0A 5D3KA 3Q8KA 1H85A 1C9MA 4IDEA 3WDKA 3RLIA 1N8TA 3WFIA 4L9SA 2BGUA 4PYIA 2Z6AA 1OWOA 4YP7A 3BILA 2JGRA 1UZLA 1Z47A 2FSSA 2ZRNA 3FCXA 5EJ4A 1CUZA 1QQTA 2IY9A 1YRLA 2ZR9A 2WSSD 3G9QA 5CLGA 3SX0A 3UK6A 1E2UA 2GN0A 2PX4A 3WO1A 4EGJA 5MFPA 1K5PA 3U4MA 3AJEA 1FFSA 2B92A 4KV9A 3WQHA 2WTUA 2DXIA 3OICA 4DLLA 3NEPX 3MBKA 3U4AA 2FSPA 4U6SA 4RTJA 3JVIA 5EWMA 3ANYB 2XYVA 2J0VA 2WOJA 4OMFG 1NN3A 1R6UA 4HRYA 4EW1A 1E1MA 4ZTBA 3STHA 2DM6A 5AESA 1XU9A 3IUEA 4TV8A 1W46A 4CIYA 1G1MA 3G1TA 3PFHA 4X91A 1K9VF 4J1TC 5CEFA 2GM9A 1B0AA 1FU7A 1W5AA 4KQWA 4NU5A 4CTKA 1SXJE 1RWMA 1Z28A 3S6JA 1Y5LA 3VH3A 1E96A 1GVNB 1MHTA 2JAQA 3JVUA 1ZD9A 1YDFA 3LQKA 3FI0A 1EP3B 3HCOA 4IEIA 3UA4A 1GTVA 1Z62A 4ZC1A 1U1IA 5MGBA 1ZESA 1TUGA 5EJ9A 1KJIA 4CU2A 1US8B 1V95A 3A36A 3GRPA 3RBVA 1R4MB 1JHDA 4QUKA 3E3OA 4GXNA 2FSIA 2TMYA 1QK3A 4HTFB 5DPMA 2H29A 5CDFE 3CF6R 3K05A 2PAAA 1ICEA 3OZGA 1PJRA 2AKYA 1M73E 3L4EA 3N2GB 2I4IA 3O38A 3LL4A 4PX9A 3ZC3A 5I4KA 3D2LA 3CF0A 5JT1A 3DR3A 1J2JA 2HIMA 1X7ZB 4JLSA 4PG7A 2QTWB 1H0HA 4OY3A 5IASA 2O7SA 2HB6A 3LBAA 5SZKB 1WCYA 2C07A 4A91A 4CIBA 1TLTA 1E0JA 2F90A 4BY9E 5K1ZA 3OPYA 2DYKA 3QUCA 2OV6A 5CNJA 4EFLA 3E23A 3OIYA 4JT8A 1P2TA 9LDBA 5KVCA 2I6GA 4WKBA 3JPYA 2M1ZA 2NTJA 3HDQA 1LPPA 4BBAA 1RZRD 1XP5A 3A7EA 4MHTA 5FQOA 1A5BB 4V39A 3RVOA 4KAJA 1L8AA 1T2AA 1U5BA 1NYQA 5AXAA 3RRZA 2LZ0A 3DFMA 4WV3A 2IW1A 5AQEA 1PVOA 4WK6A 3BMOA 1YBAA 1ZNWA 3KQWA 5IK2D 4QQKA 2SNIE 1ID1A 5C81A 1N8SA 5HUHA 3OE4A 4NRDA 4EHFA 1F20A 3I6IA 3SBDA 1BXGA 1EGHA 3JV7A 4AYWA 1NLZA 1Z3CA 1MO4A 2WAXA 5IHXA 5KYWB 4G01B 4QT0A 4DV2B 1QHYA 3HQ4O 3ML1A 2ZBGA 4PLHA 2R7AA 3GJRA 2VJYA 4G1VA 2IT1A 2CK3A 2ZB3A 3C24A 3HZOA 2AFIB 2V1UA 1XEXB 1PWEA 1OWPA 3B51X 3JD2A 2O5RA 5DM0A 2C58A 1NWHA 2ATXA 4B17A 4OOFA 1XZBA 3JQFA 3QA3E 4PLYA 2RHMA 3MWKA 3W5VA 2G8LA 1X8XA 3K6SA 4M7PA 3THWB 2D54A 4GI5A 3DAFA 1QK4A 1XKTA 1BC5A 1KOFA 3KYJB 5BV8A 1SB9A 4J90A 3LUJA 4IMIB 1M75A 3QTLA 3V4RA 2YHUA 4KXNA 1I7NA 4XLTA 2WSBA 5JROA 2QSYA 4KREA 1X14A 2H1RA 3AHEA 4L9RA 1OZ0A 3UHFA 3OTQA 3HP1A 1QO9A 3T0GA 2GXSA 3SI7A 4D3DA 3GRAA 3IMFA 4KVGA 4MMYB 1EDEA 4UAUA 4DXAA 2I6SA 3PHCA 3ZXUB 4O2AB 1QH0A 1EINA 1ONSA 2XIJA 3G0DA 1T4BA 2P4QA 5KOHA 4PYJA 4Q82A 1M6WA 1T36A 3NXSA 1VJ5A 4QJ4A 1NM5A 4CIXA 1YI8A 2AJTA 2JIZD 3R9WA 2BKEA 4AC9A 2XB8A 1R66A 4NF2A 3C74A 5EMNA 3ZXXA 3GP8A 3O8QB 4FMDF 2BH2A 4AYXA 2C5SA 4A6XA 4ID9A 1VKJA 3WNCA 1JQLB 2AKAB 2ZSIA 1F4VA 5JEDA 1J7JA 2WNHA 1YNSA 2H9AA 2FAXA 1QAOA 3G17A 4YEDA 1BX0A 4IXDA 4LF9B 4FFRA 1MF7A 1DFGA 1A9XB 5GJCA 3G2MA 3ST7A 1EFHA 5TPZA 4B4UA 2J0SA 3N2KA 4QPZA 5HUQA 2Z3VA 5TMDA 1JDBB 1T2UA 2FZ5A 4ETIA 4HQ6A 5CDUA 5T64A 1F7UA 4J7CA 3QUAA 1SRRA 2IIQA 2OC9A 4PLGA 2HWWA 1TM2A 1MIOB 3VOTA 1Z4IA 3HVKA 3NHLA 4JXJA 4FYMA 4EO4A 2AMYA 1I1QB 1QOPB 2XUPA 1G9TA 4D02A 1Z0ZA 4P33A 5FV4A 1FY2A 2XUAA 1HG0A 2HBRA 4LIPD 1C14A 1UXOA 5H81A 3HXOA 5IXJA 4J1TA 1ZI8A 4JI5B 3UTCA 2H18A 3NTOA 1QNFA 2AQHA 3RIGA 1ZH8A 2DRIA 2OQIA 2J08A 4UQOA 3SSAA 3S2EA 4GOLD 2Y0EA 4KFRA 2GETA 5CB0A 5HCUA 2QQ0A 3EVEA 3QSYA 2DQKA 4P36A 1M6NA 5IMSA 1B26A 5LMZA 1V5IA 2G5CA 2NT3A 3MVEA 3TLJA 4HDRA 2WTBA 4WESB 2Y1DA 4LHXA 1V5WA 1PEYA 4D41A 5EQJB 3CU5A 1GT91 4ARUA 1IZ9A 1VPTA 3FMIA 4DR1B 1QFZA 1EUQA 1FTNA 3CLVA 1SZDA 3CGWA 2NAFA 2YJNA 3WK9A 2FG7C 4ARVA 3IJ5A 1QU2A 4QKQA 4JBYA 1OXTA 2XUFA 4UZEA 2YQ5A 4C4ZA 3DJFA 1GCAA 3WB1A 5FCDA 4W5TA 5D84A 1I2AA 2J9FA 3H9EO 2FKAA 4YPFA 1I01A 2XXJA 3BD6A 2Q7OE 3W9UA 3ZQKA 3HXKA 5LM3A 5G02A 5GY7A 3ZDAA 3HVJA 4UD2A 2EW2A 4JIMA 4RACA 2QM3A 3FGPA 2CL7X 3PPVA 5EZYF 4J94A 3HM9A 4G56A 4D8WA 4HEA1 4E32A 2OB1A 1IM2A 2AYXA 4ZVOA 4UKDA 5HKKD 1JV2B 3MINA 1I3KA 4YJDA 3ZY4A 4ESVA 3GDWA 3IOMA 3OHSX 4TMTA 2V7WA 2AFIE 4ALNA 5EXPA 1R4ZA 3Q8MA 3I28A 1ST3A 2VA9A 1DC6A 1BU5A 1DFHA 2A5GA 4J7AA 4JGGA 4BVLA 4QZVA 4UAGA 1UPXA 4O02B 3NGMA 4HYTA 5G0UA 4EVQA 3EZFA 2YS6A 3AKDA 1NDQA 4NYIQ 3T06B 1PBTA 3OMWA 1TMOA 3ZZ1A 3GLFA 1BX3A 3EDMA 4GXRA 1N2EA 1Q2XA 2DKFA 5IRCD 1GTG1 4DV1B 3ZD9A 1NW4A 2H51A 4DNOA 1Z6XA 4QTZA 4L5CA 4P08A 1V3UA 2ZYGA 4R7GA 4CM9D 3F46A 4EKYA 2P9BA 4PHHA 2NO5A 2B83A 4Y6LA 1DTWB 5HJ5A 2C94A 4G5QA 5HBGA 4U9IS 4WXRA 2V4MA 4JZKA 3O8CA 1CQPA 1Y9EA 4RZHA 1GNTA 2G9QA 4NPCA 1J0EA 2VNIA 1UBFA 4TLEA 3LHFA 3TYXA 2OK7A 2VUHB 4BEVA 4YR7A 5ITSA 5GADl 2F8TA 2D6FA 2JLVA 2JLBA 5E95A 1E3QA 4R1NA 2IZZA 2B5VA 3CG4A 4C88A 1IRXA 2IIBA 3QEMB 4EA8A 2ATCA 1QIEA 3UZUA 3HL0A 2C4NA 4ZTUB 1UBMS 2D7JA 4LZAA 4RZIA 3SHTA 3LDUA 5JW6A 1ICIA 3AG6A 5IKEA 4KLCA 5I4BA 1RVDA 1T0UA 1BRTA 1TD9A 3CEJA 2DR2A 4O0MA 4EHKA 2BR3A 4N0QA 4ZQBA 1N9ZA 5JJ5A 1GILA 2HHJA 1I4OA 4OQXA 2PMCA 1Z2CA 1AF7A 3ORHA 1IPHA 3D8TA 1X77A 3DUFA 3LKVA 1EXVA 3M5CA 5KNBA 1KE1A 3NYQA 3B1YA 1VL6A 1GFWA 1QO7A 3BJMA 4OHBA 1RI2A 1WMFA 3M5WA 1L8LA 2RBEA 3Q5EA 1RAHA 4TXJA 1P0CA 3HSKA 4LTMA 4BFVA 1G7RA 3LPMA 2F8MA 4OAOA 2EBUA 5KJFA 3W5UA 1CUIA 5CHYA 5KJCA 2WT9A 4L9AA 1RXUA 2ZS8A 5FOXA 2GKGA 1UUFA 1CQIA 1XTBA 2GRJA 5FPTA 2HEIA 1NMYA 2DQ4A 4GEKA 1HLFA 2TMDA 1PK9A 3KL4A 4LXXA 4HPJB 3LSYA 1D1PA 2XA1A 1CJSA 1JA9A 1P1RA 3CX7A 4JGIA 4QU5A 4EHDA 5B4VA 3TIGA 3NNNA 2GZ2A 4Q18A 2O4CA 4BHTA 4MULA 5HFJA 1MX9A 1SXJA 1TU0A 3P9QA 4B3IA 3CXRA 4U7DA 2D1TA 2VH5R 5JC1A 3AVUA 5DV9A 3M6LA 3NZEA 4KLNA 1YL7A 4N49A 4Q6BA 2YHBA 2P7HA 5BXQC 1UF9A 3AI7A 5JRZA 4PR0A 2VF7A 3D2CA 4GXTA 1JLRA 2J4DA 1GZ4A 5FPQA 3O4JA 1O6FA 4M0UA 4ENRA 1GPLA 3IIJA 4PC2A 3OU7A 4PZLA 2C3PA 3NV7A 5KO2A 3IPXA 4R3NA 1EGVB 2I2BA 3HABA 4MI9A 4GL2A 4XM2A 3QBDA 2CLIB 3L5OA 2DC1A 2C03A 3F97A 3OCUA 1VFNA 5K0NA 2Q6IA 1VCOA 5CDFA 1Q77A 1CUBA 2QMHA 3V55A 1GEGA 4QBKA 4KYIB 3ZU3A 5HZKA 3CX6A 5TRTA 5GTDA 3SSMA 3Q72A 4HYEA 1NT4A 3MT7A 1KOJA 2HRCA 2PEZA 3AF5A 4UVHA 3OECA 1A8HA 3P71T 2PGOA 3NT4A 1KFKB 1W5FA 1E8DA 1E4VA 2R86A 1GUDA 1CY6A 1EWTA 2B7BA 2JGAA 3TZHA 1QTNA 3VZRA 2R8YA 1E1DA 4ZA2A 1SQFA 3RAFC 3T1HB 4C4SA 3RVSA 1X8KA 3NTUA 3FF1A 3IYLW 3DBOB 3QVOA 4FHEA 4NMMA 1EWYA 4JLAA 2WJIA 4AMGA 5BR8B 3QIAA 3K30A 3BICA 5AVRA 2JBWA 3U9TA 2IYSA 5JJLA 4G4GA 5FULA 1NW6A 4OHYA 3D8UA 1G64A 1ZC3A 1UK8A 3UFXA 1YMQA 2PRZA 4UDXX 2QW0X 1BYIA 5D51S 1XEFA 4YXWD 1XAGA 3EGDB 3KLPX 4X41A 2QAGC 3QV2A 1OGIA 1IOLA 4ND4A 4N7MA 1QQ5A 3GGDA 4K2HA 2LDXA 3U4HA 1S1MA 1RCTE 3JQEA 4ZT5A 2YHAA 4URWR 3K0CC 1EE9A 1FPMA 1VJDA 3QGMA 3C3EA 4NBTA 4IG9A 5P21A 2B1JA 2Z3WA 2C2MA 2TYSB 1MDBA 3L07A 4YCCA 1PJ2A 1JSLA 3DONA 2CFCA 1MNAA 3BXHA 2I76A 3IAXA 1OF1A 3FN4A 4QOHA 1QHEA 3DWFA 4E4TA 4DV4B 4D8XA 3O26A 2JAUA 1MQ9A 3ZE1B 2HLDD 3MMZA 4JU9A 1GCGA 3E48A 4X7MA 3VSBA 3BTVA 5TF4A 1T5TA 1GU7A 1NF2A 2ZYWX 3IERA 1ZJ6A 3BREA 1K4KA 1P19A 3ZGLA 1GUAA 1S2OA 4KYTA 2YOFA 4BFUA 3IKVA 5TMEA 5JXIA 5IYZF 1EI9A 2ZI6A 4KJXA 3NWPA 5HF9A 3CH5A 1XZHA 3ACBA 4ZEXA 4B6PA 1W36D 3GI1A 3H4TA 1KIMA 2UVQA 4FWTA 2NV2B 1E3SA 1BE1A 4DCCA 1FVXA 3RRNA 1JDBC 2ANCA 2CLFB 1KJWA 4LX8A 1RWOA 3F49S 4DJTA 2OHFA 1XNJA 1N2BA 3E0XA 1N2JA 1QRTA 3NUZA 3DO5A 2A4MA 4MHSA 3DZBA 4TLCA 1SVOA 2ZTVA 4D8YA 2X5XA 1MVLA 4K6CA 1OAKA 4HB3A 1YT5A 4EHHA 5JPIA 4YDQA 2VNAA 3T5CA 2X0IA 5EHXA 5CVJA 4RIFA 1YDMA 4LFCB 2V7UA 4QFDA 1XROA 2GCNA 3NT2A 5EA2A 1XGKA 3P19A 2WINI 2A9QA 2HK6A 2NTEA 4Z2YA 2HGSA 4ZOLB 4RHYA 3X44A 1YI1A 1JN0A 3IE2A 4BZWA 3H5NA 2QRPA 2W6OA 3GUVA 4UTXA 1EXMA 1KBZA 1NPYA 1K6XA 1ZLXA 2A1UA 2EX4A 2VPIA 4G24A 3LX6A 1EQAA 1DUIA 4QLAA 3IQHX 3L0ZA 2LE0A 2VOJA 5AHKA 3UWSA 5IM4A 1R9JA 1NGSA 3ZLJA 1US8A 1UIMA 1YS7A 2Z58A 4Q3DA 4YJ3B 3DM5A 1SBHA 3AJAA 1QYRA 1R4MA 3C7CB 3GZJA 3MOIA 1F6BA 1PLLA 4FW8A 3O21A 1ZD4A 5HE8A 1NF3A 1FCJA 1UXKA 3WGQA 1CR2A 4HTFA 4KIGA 1NX6A 3SY8A 3ND8A 4OAPA 3OZ7A 3A2KA 3W6ZA 1WNFA 2WDPA 4XVQA 3LC0A 5EJ8A 2VDRB 4I5GA 1URPA 4Y30A 4KQHA 1X7ZA 5ILQA 1UBSB 4IHJF 5CB4F 1ORDA 5KJ1A 3O4RA 2OGZA 1PL0A 4O4JB 3LUPA 1YR3A 2OO5A 2WHPB 3P1JA 3JWEA 1NVTA 3PR1A 3SS8A 2BMWA 1A9OA 1DFIA 2OL4A 4GP7A 1KVUA 1YA6A 3O4IA 2YFYA 1QXSA 3MAGA 5KVVA 1Z5OA 4LZNA 4F6CA 4MW7A 3VZSA 3GU3A 1IZ8A 3A6ZA 4LMAA 3Q9UA 2G6BA 3LY9A 4HWKA 4L3VA 2CHQA 1Z2PX 3U3DA 3M6UA 5LQRA 4Y1FA 3TEFA 3VVBA 5BWBA 2JC3A 2H1LA 1JXMA 2YZGA 3RRFA 4IVNA 2VDJA 4DTIA 1JWAB 4BJ3A 4LF5B 1LPAB 4ZKDA 4ZT6A 4NV3A 2Y1LA 1A3CA 4IOLA 1QKKA 2DBZA 3VPBA 4C0KA 3AETB 3DV0B 4U5XA 5CCDA 4ZJYA 3H6KA 1Q20A 5ADVA 3IDQA 2ZCUA 4EK9A 2Q8QA 5AVWA 4QBIA 5DK4A 4MYRA 2ZIXA 1M33A 3DLTA 2AFIA 3JU3A 1XEXA 2H3EA 3G8CA 3VU8A 5J4YA 3V8BA 4ZANA 5TC4A 1HG1A 1E2LA 3KKPA 3H5WA 2QAGA 4P7GA 2CVPA 3PQEA 1R0CA 3THWA 3PQ7A 121PA 1U28A 3IV7A 4KGDA 1F2UB 2AXPA 3BL8A 4FMBB 4M0EA 5F51A 4OB6A 1AHNA 1R12A 2XBUA 4ALJA 5EUBA 3K0CA 1G21B 5TEWA 5B5SA 2CMFA 2YVUA 3BXFA 1EA5A 2F1KA 2OXRA 4D26A 1J6UA 3FPJA 4UASA 3L7MA 1VI5A 2ZULA 2UYYA 3BD9A 5CUQA 3EUWA 1PG5A 2I7TA 3WMXA 4OKNA 2ZWVA 2DR0A 2H2AA 4RLQA 4KZKA 3H0EA 5D7BA 4OOEA 2G09A 2KLHA 3IBTA 3OWHA 4BZPA 1EGAA 2GBPA 3NS7A 4XFKA 4NBVA 4O2AA 2HA7A 4ENWA 3F98A 4V2IA 2WTMA 3S1LA 2PRJA 1EEXB 4HX9A 4LKOA 3ZI7A 4DMHA 3EIQA 3DQPA 2DAPA 4S1TA 4EPXA 2P6RA 5L53A 2H1HA 5FPHA 3LQ2A 2WU0A 4NK4A 1X9HA 2VQDA 5DTEA 1J90A 1MB3A 2E82A 4ALKA 5CDGA 3JZIA 4W5QA 4NYJQ 2I2XB 4GLFA 3N0XA 4CDNA 4CI0B 3T3MB 1ESCA 1S8OA 2A0UA 4YDHB 5IBPA 3WL4A 1LF0A 4F5WA 3E18A 1XEWY 4YQFA 5KTOA 4CGZA 3C3CA 5AOVA 1MKYA 3DFKA 1YFLA 2WF8A 1VP9A 2P6UA 2W8ZA 1VL5A 2P4HX 3GEGA 4A5OA 4I8IA 1MIOA 3WGOA 4M0PA 4PQEA 3RREA 4QULA 2H92A 4TKMA 4N40A 1KKUA 2C5LA 2EZ9A 2P6OA 4YCLA 3OUUA 3Q9LA 1ISMA 1BTOA 1PL7A 1YR2A 3IUQA 4PNPA 4RWZA 5FTJA 3UMVA 2FSUA 4H3KB 1WLYA 3C4JA 4YFVA 4AZVA 4C3OB 5DB4A 3KS9A 1VE9A 2FFBA 3UJCA 3E6AA 5DYTA 1E9RA 1DAMA 1ZLYA 3L7YA 2GN6A 4G5XA 1Z73A 2FPGB 5ICEA 2J4FA 5CRIA 3AEUB 3CNBA 2NO9A 1P5FA 3AM3A 4ARIA 3LX8A 4BKOA 2B4AA 1FXSA 5AXCA 3S0JA 4QRIA 3U3JA 1I10A 4FCVA 4M8KA 3V1MA 1GZ3A 4WESA 4AN0A 1T0IA 1I9GA 1OB5A 2UZAA 3NHFA 3ZIUA 2ARKA 3KKOA 1CNEA 4D0RA 4X8HA 5LR6A 2ACWA 2BISA 2VJKA 2BEJA 1JG2A 1CS0B 1DTSA 2PPVA 1CP3A 4NIMA 4RO0A 4B9AA 2VQFB 4UHKA 2Z2IA 3CYFA 2L17A 3PSHA 4N7JA 3TPFA 3U0VA 1L4LA 3ISVA 5IJWA 5IBRA 2PKQP 1T4GA 1VG8A 2K7ZA 3RSQA 5K0FA 4DLKA 3P9ZA 5IP5A 2BKLA 3T1NA 4W6QA 3CEMA 3RS5A 3DCYA 2AZMA 1L5QA 3FCYA 2HSDA 4YRKA 1E59A 1SB8A 1EUDA 4I9NA 1XRJA 2FZWA 2LP4Y 2XQVA 4BO6A 1NF9A 4BJ5A 3W3AH 1JYEA 2IPAB 3EX7C 3V8NA 1K3TA 3HGTA 1P0IA 1ONBA 1DG1G 2HMAA 2CFSA 1YE8A 2J6IA 4PGHA 4PN7A 3EHEA 2V0GA 2HHLA 3TUJC 4RIGA 3HVIA 4BNNA 5CB4B 2J5KA 1GA6A 3LCJA 2Z6UA 1DWQA 2PGAA 3A1UA 3AFNA 1AG9A 3T3HA 4OG2A 2FUEA 2NTVA 4C76A 5JYDA 3DL4A 4BMDA 1P1JA 4EZIA 3FJ1A 1HNXB 3GLUA 3FFAA 4FUQA 2W2NA 3JRNA 4INAA 3OQBA 4BV8A 4UFNA 3BGOS 3WGKA 3BMNB 1P1IA 3K2EA 2KJQA 2PSSA 4B09A 4DIBA 5GV8A 1T3GA 3E0QA 2HU8A 1W52X 2VSFA 3DKVA 3D1LA 2EXXA 3EODA 2IGTA 3TR6A 1WZIA 2FUG1 1J24A 2VTEA 3BHJA 3ETGA 3PRJA 1L4NA 4XDYA 3DXXA 5FNVF 3C6MA 3W7VA 1G21E 1KAOA 4U3JB 1CUVA 3NAZA 3EGWA 3RW9A 1TK2A 3R5XA 1YBFA 4QJ5A 1OFIA 3PFWO 3KUDA 4LA4A 3ETNA 4QSMA 5HIIA 4HZUB 4XZ3A 3WTBA 5EJ6A 1XJWA 3ASYA 3EBLA 2XWQA 3MWGA 3PPIA 5CT4A 5AW0A 1RM4A 1DTWA 2PWZA 2QROA 4HDSB 5F12A 4V0OA 2ZWOA 4RIEA 2QUZA 1X70A 3UCEA 2LDBA 1K66A 4E70A 2CB0A 5LXTF 3ZDBA 3SR0A 4C6RA 1Q1BA 2VQSA 2HW8A 3D4PA 4P0QB 3GNLA 3KUKA 3QEMA 2KE5A 3ILXA 4AJLA 2C7VA 2ZJ2A 3UB4A 1Y3CE 1Y3DE 2GZSA 2WVGA 1N8NA 2NXNA 5LZ9A 1IN1A 5BUZA 1XA3A 1XCMA 2W2MA 3KFXA 1J8FA 1NPDA 2IEIA 2D2EA 3E82A 4K1XA 4RTLA 3R77A 3H5RA 2GS9A 4J2TA 2C1EA 1Y34E 3DVAB 3BJRA 3EE6A 4XRRA 4Q4DA 5DVZA 3RVLA 3D7RA 3U13A 3PEYA 1HDRA 1LH0A 3BF8A 3C6XA 1CR1A 4BNYA 3D6AA 3PPYA 5E6RB 5J63A 2Z95A 1IL0A 5H16A 3AHDA 3LA6A 3UWDA 1ZJ5A 2G0NA 4XM0A 5HE9A 4EARA 2CLOB 4F85A 1Q5PA 2XTJA 3X1DA 3BSYA 3OLWA 2JKYA 3VVLA 1L4MA 3N7AA 1Y1LA 5BURA 4BGIA 4OBWA 4PSKA 1DX6A 2MWMA 2O05A 3H1FA 1SIUA 2Q1SA 3ROFA 2WWTA 2HU5A 3UHAA 2NOAA 4YUVA 2VBFA 4NZPA 3RJ9A 3JR3A 1V7CA 3CRMA 2NACA 1G6KA 5FBLB 2E87A 5BSUA 1LZKA 5H80A 3GX1A 1DEOA 3VI4B 2XMPA 2OHGA 1NP6A 4W5JA 4Q9LA 2AC2A 3WGUA 4EVRA 4KN9S 4OHWA 4PFQA 5CLHA 4TYPA 1WP9A 3BRCA 2VDQB 3M4NA 1JFSA 1XPUA 4RUKA 4AJIA 4EI8A 3E9YA 4PO9A 4EB3A 4EFDA 4CQMD 2PH7A 3QTBA 7MDHA 4DBLC 3K8YA 4HPXB 4GL4A 5LSAA 3E9MA 3WS7A 5ALEA 5A4AA 1VECA 3F7OA 4GS5A 4IIEA 3D81A 4MDYA 1CEEA 3CISA 3HO1A 1BA3A 1JIJA 1M2OA 1SC4A 2DCUA 3MGAA 4TS1A 621PA 1NMQA 3LQ1A 4W1RA 2P35A 3ZX5A 3KSRA 5F3WB 4L74A 1JHVA 2H1SA 4OHCA 4I4NA 1U7XA 4OK6A 3WWOA 3EASA 3EQ2A 3G59A 4LJLA 5JD6A 1X7XB 3RS9A 5KNDD 5C5IA 1Z0SA 5M34A 1JH8A 5FOWA 5I9IA 4JODA 3R9XA 4GFDA 1JWLA 1SCKA 2B4QA 1J0CA 1JAHA 1GU0A 3GJQA 5HQJA 4DCPA 1ES9A 2IYQA 3DD5A 1NLYA 4G5FA 4GT1A 1HFJA 3KM0A 5KWIA 4DUZB 1ZL0A 4DNFA 2QUHA 4QD3A 2RI6A 4ZKEA 1Q19A 5ARBA 1ZITA 4HS9A 4WOPA 1DRVA 4AURA 3BFXA 1BQ3A 4JLBA 3PR2B 4J0IA 2ZUFA 1RYBA 1U11A 4P3YA 3ZN2A 3CLUD 2BBTA 4XD2A 1XDBA 1RRKA 2AMLA 2YINC 4J6FA 1CDDA 3U6BA 3FDJA 1XTJA 4ER6A 2PRSA 3P9RA 3UANA 1M7BA 3EH1A 3OF5A 4EGFA 1D07A 1UFRA 3NBYC 1ZRHA 1QTIA 2H1CA 2LIVA 2PZBA 2VF2A 2OZKA 3IXQA 1TFRA 3DKRA 2GOYA 1UEJA 3EGDA 3LF1A 3OZCA 2Q3FA 3EEBA 3P2YA 1H6DA 1CUDA 4X94A 1DXQA 1GUBA 1NQOA 2D1FA 2D1SA 1PSWA 3GO4A 4I66A 1T5DX 4JOCA 3TUIC 1XU4A 2LKDA 5EZYA 3H1EA 1I4TD 1RD4A 3I0NA 3JVDA 3K0AA 3B7GA 1AF4A 1LPOA 2OBYA 2AOUB 3IUYA 2V58A 4YN3A 4NDZA 3R6TA 4KKVA 1LX6A 1UBEA 2O0JA 2NYRA 3PWSA 3BH6A 1R0BA 5L3SB 3CINA 1JRLA 1GKUB 4JD5A 2PXAA 3PV0A 2DPLA 3QG5A 3SKVA 3WGVA 2ZYUX 2Z5VA 4GMDA 2R0QC 4P82A 2RGRA 4IGEA 4IRMA 4QOJA 3LUGA 4FE4A 4YP1A 1RRVA 4ZO8A 3VNQA 4D9CA 4ZMSA 3PEWA 2P2LA 3ZGZA 1L7MA 1L7RA 4PPYA 5FNVB 1FFHA 3L04A 4MJ3A 1QCDA 4I5DA 5EE1A 5KPJA 3OCXA 5D85A 2F3QA 2ODQA 3E81A 5G4LA 2AV6A 4LJ9A 3L6EA 2IZ0A 2Q62A 4CMKA 2PYDA 1Z6TA 4N54A 3I58A 3PLNA 2ZB4A 4GQIA 3LY5A 4A23A 5JNTA 4MO2A 4MUYA 1CPYA 1MVOA 2OD2A 3SX4A 4BWFB 4DR6B 2VXYA 2CLHB 1ZQ9A 3GH3A 4LPSA 2MSCB 5F77A 1DQNA 3Q3GE 1R4NB 4IRXA 4QAJA 2RAUA 3EY4A 2EHJA 5KTSA 3NHPA 1KDYA 3PCXA 3V4LA 3VMFA 4TLDA 4A03A 5JYCA 4YRFA 4Z4CA 4DDMA 1XT6A 2ZJ8A 8GPBA 1JE1A 2JFYA 1NJ6A 1WMDA 2TECE 5JZSA 2TRSB 2IXDA 1N34B 3BYZA 1JA1A 3L8EA 4NULA 3O8NA 2WVAA 2DLNA 3HV2A 2OHXA 3PXXA 4LXQA 4YMUA 1HT2E 3O8LA 2IZ6A 4JLOA 4UNNA 1BZYA 2BI7A 5KX5F 3CR8A 3EPHA 2GAJA 3I2HA 2D7CA 4ZOLA 4D3XA 4IRUB 4J29A 3DOIA 1UJ4A 2AS0A 4EHLA 3DG9A 3LNCA 3GRZA 3A6KA 3F5FA 4KX5A 2XCIA 3TWOA 4FOPA 1TM3E 5JSQA 2Q49A 5MGNA 1KSHA 3TLKA 1U31A 4D1YA 4K6GA 7GPBA 4RTQA 3T15A 5CITA 1DBSA 2Q1UA 1BYUA 3ICQB 1PBNA 3CZ4A 3U39A 4LYHA 1FFCA 3A1TA 2APJA 1D2CA 1OC4A 4L4UA 2HCFA 3GZNA 4YYEA 4BFCA 2MU1A 2Q5EA 3HU1A 4E13A 3FPCA 4NMXB 4OI1A 2P2NA 3ZV7A 2D1RA 3G68A 3ANNA 3QLVC 1KFEB 4IDNA 3AYZB 2CJXA 1D2AA 3TVTA 1AHPA 3I9FA 2WHPA 1KWKA 2WWHA 3LFTA 3P0IA 4ZOCA 3AK4A 3O75A 4URHA 1LQUA 2YZ2A 4E3ZA 1K9SA 4NNPA 5AKLA 4Y0NA 1IXRC 1DRKA 3QK7A 4M1OA 5IDVA 2DKOA 3KD3A 5BN3B 1XTTA 4NDNE 4XXHA 4EH1A 3WAGA 1QQ6A 1WTCA 2ZPUA 1II0A 3PFFA 4W9MC 4UUMA 3I72A 2HJWA 4Q1FA 4ZHSA 1GRVA 5GQSA 1TTTA 2HIGA 2VDNB 5EZSA 3RVDA 1UXGA 4ETNA 4WBNF 2IS4A 2Q4DA 2NVBA 1KORA 3C1OA 2CMDA 2PUGA 4P7KA 3MZ0A 2H1IA 4C0XA 3AETA 3DV0A 1ZA1A 2G28A 2F3PA 5GIPE 4ZAZA 3OM9A 4XQ9A 1PR6A 1HNWB 1YS2X 2EQBA 1KO1A 3F3SA 3FAKA 2G1JA 1P9RA 3JQ9C 1G19A 5A4FS 2F62A 2Y1GA 3R0JA 3RUIA 4B3TB 2DKNA 2B5OA 3U9SA 1IMJA 1Q1EA 2XAAA 3T9BA 4WFQA 2XDYA 4DREA 4EB6B 1ORTA 4FBGA 3NFYA 4U7TB 4JLKA 1Y4UA 3FYHA 1BMDA 1F2UA 5ESXA 2C8LA 3SIXA 3VR1A 2Q46A 3WNQA 3L77A 4FDLA 2RGDA 3B12A 1KH2A 1G21A 3DMTC 3H9QA 4WXEA 1AUXA 2JDIA 5L4NA 1R16A 5BSRA 2AN9A 1QWSA 4M9QA 4X84A 5GVSA 4BIIA 1VE5A 3HP7A 2QYSA 3E27A 4ITUA 3ONNA 3QBEA 2QB5A 1LQTA 3G2JA 4NESA 4QDOA 4XCVA 1UKEA 3RS2A 3AESB 3QBJA 4DCNA 1UEIA 4G9GA 4BO8A 1Z6AA 1E8NA 3ON5A 4Y6QA 2ZKIA 3PI6A 1DPFA 1RI4A 4JR1A 2VHEA 3DE4X 3FROA 5F4ZA 4RETA 5H3HA 1QC5B 2FP3A 4BAGA 4IPTA 4BNFA 3EDCA 3PI7A 1I30A 1LDBA 1NXPA 5H83A 3MJDA 4D56A 1I6LA 1S3IA 5I51A 4D8VA 3E4DA 2I4NA 3GBVA 2A94A 1UQUA 3HA3A 3JWHA 3RNOA 3L01A 2QD2A 2RKWA 3C3JA 1NSTA 5BUQA 3UJPA 5HIAA 1MO2A 2YIVX 5BSKA 1NFFA 3FVWA 3SGLA 5I7HA 1Z6GA 2VXOA 4FP9A 4BPBA 4HQ0A 2QQGA 1SGWA 3OOJA 3MCWA 4PHTA 2XMRA 4R68A 2GERA 4GMXA 4UBOA 3UT5B 2W2LD 4MUIA 3F6YA 2GILA 5E1MA 3OZAA 3WQSB 1D6SA 4C0WA 3KHKA 5DFAA 4LJYA 4BRZA 3FWZA 4ZDIA 3UF0A 5IXSA 2NZJA 3EMBA 4BFLA 3F5QA 5JY6A 2NZ2A 1Y8QB 1ULZA 1AY0A 1ESEA 1GU1A 1VL8A 4TWJA 3PK0A 1X2EA 3RSOA 1E58A 1PJ8A 4OHRA 3PFIA 5A4JA 2O2CA 3KXKA 1H2ZA 1VMIA 1RC0A 2ANBA 3N8KA 1N6LA 3G0OA 4XGKA 1DBVO 3IEKA 4BVFA 1RKQA 2J0EA 5GJVC 1UJNA 1JG6A 2A4KA 2FPGA 4IWXA 4I3HA 3HGMA 3ZXYA 3AEUA 1R74A 3NIWA 4B71A 3KJXA 3DPIA 2ZIEA 2AG0A 4RK6A 4EG8A 5IULC 4UMVA 4WW0A 4A1FA 1RHRA 3A9WA 2AFRA 2ISCA 4HH0A 1ETUA 1YDEA 4JN6B 4JWKA 1ZWLA 5EHGA 1WY7A 1VPDA 4KOEC 3RF7A 3QWBA 2HJ9A 1IUPA 1CS0A 3O1IC 3KAPA 4RY8A 2RB5A 4HUQB 4TMVA 2ZSKA 1NR7A 5AM4A 3RBXA 1TQ8A 2QQ5A 4ZEVA 1RIFA 3QKTA 1PJSA 1K8YB 1UPAA 3EFEA 3NGXA 3GJSA 4WD3A 2JLYA 2P3SA 1VZ2A 2HPHA 3O93A 1Y3AA 3W5DA 1AT1A 3JX9A 1X1DA 3UY4A 5JU6A 4RD1A 3HWWA 3ROQA 3QLVA 4DCSA 1EXNA 3KJNA 1SULA 1UZUA 4PIVA 5JS7A 2CLEB 2OXFA 2SKCA 3QWAA 1WMSA 2WY2D 2HPAA 4AJ2A 2XGJA 2ZTSA 4FDMA 3AR9A 1EAMA 1FDWA 2XGSA 2Z4RA 1E2FA 1YK1A 3EDQA 1NRWA 1PUIA 1P7VA 3MTBA 5AUNB 1JPUA 4Q3CA 4IHJA 5CB4A 1O4WA 3NUQA 1EGMB 4D6PA 5K3BA 2IHVA 1J2RA 3Q5DA 1VHWA 3FGNA 2E85A 2FNAA 1QP0A 4PO3X 4IVPA 5JFGA 2BFPA 3TSWA 4R9NA 4MS3B 2ZVPX 3PUWA 3W78A 2VP4A 3BMNA 1WOMA 3CZ5A 3DE1X 4YWHA 2YV3A 5DNWA 3WLQA 4Y1EA 4H7IA 1ZBQA 1Y4ZA 2E4UA 2PSDA 4FR5A 1R88A 1GAXA 1AK2A 3B1FA 3KU1A 1V4BA 2GEKA 3R8FA 1LLDA 3COJA 3JASB 4U3JA 4PNHA 3TD9A 1RFLA 2I66A 1RTKA 4NABA 1QKJA 3W4KA 2X5JO 4HZUA 3WGNA 3PHJA 4Y7DA 2R2AA 1T0PA 4R1OA 2PPLA 3RUPA 3ZJ5A 2VDMB 3W1VA 4HDSA 5ERXA 4BGUA 1O7JA 2R8RA 3LW8A 1U2QA 3I9OA 4FC6A 3OOWA 5FR2A 4CV2A 4EPYA 1I1NA 1M0WA 4U2GA 2ZS9A 3RS8A 1R0XA 3ADDA 1UBGA 4LAFA 2OHIA 1PL8A 3N39C 4XQGA 3GPBA 3MB5A 5KJ6A 1E2EA 1Q1ZA 3MS7A 5JH7B 2IP1A 1J1ZA 3O4GA 3LT1A 1U80A 1ORWA 4YX9A 3DVRX 3TF5A 3P0EA 4S3MA 5HM8A 3LQFA 2CXXA 1T34A 4L75A 3OZDA 3WLLA 2C04A 4CHGA 1L5MA 5DLEA 3X43A 2E5LB 2EBWA 3RV4A 1E3MA 3AKZA 1X92A 3IHKA 4H6WA 4N0MA 4QBGB 1CR4A 4M7WA 1B1CA 3DWGA 5E6RA 1QLJA 5KYUB 2VT3A 2ZRJA 4UBJA 2WSLA 5MN5A 1U8YA 3QA9A 1T6NA 4XWKA 4G4SO 3COSA 3WLPA 2YXEA 4RENA 2FP4B 3KTAB 1FX0B 4IHAA 4QYIB 4REQA 1L4UA 2A1TR 5DE3A 5EPEA 1ZR4A 1W87A 1FC0A 3TCNA 3FNQA 4B6RA 1H4QA 1TJ5A 2X8LA 3CA8A 2A1IA 4BEBA 1CUYA 1GARA 3HMQA 4KK4A 1T1IA 4KAXA 3D6JA 2V98A 1YOBA 3UGQA 3OFVA 4XEUA 4DJAA 1DADA 4ZOBA 1RPAA 1LXCA 4JP3A 1VSUA 2PGNA 3TLXA 4F46A 1Z7YA 3VUFA 1KDVA 2VHZA 4B46A 4M86A 4DM3A 3PPXA 3M2TA 1E7WA 4MW6A 1P6UA 3EJ6A 4XPIB 5E1BA 4G0YA 1ULUA 1CHDA 2WF9A 2ATIA 3HBNA 3ILSA 4N18A 1SKBA 4R81A 2J5XA 4YLEA 5DXJA 4CG3A 3QYFA 1ADFA 1NVWQ 3H0KA 2OFPA 4MTCA 5F21A 3K70C 1JPJA 4FGLA 4ZI7B 4IV5A 1XAHA 4WL0A 4FM9A 3RFCA 2ODWA 3KPUA 4KR9A 2DTEA 2W6QA 3HB0A 4Z4HA 3HCDA 1DC7A 3UKJA 3LYHA 3WP0A 4QUEA 2Y71A 5EOVA 1X7XA 4F84A 4Q01A 4MYHA 5G4KB 4B0OA 4E5YA 5C51B 1R8XA 4FI3F 1V8DA 2W6PA 4CEIA 2GKSA 2HRZA 4MA5A 3FYTA 1CUJA 1OZHA 4I99A 4MAAA 3ITKA 4YRAA 3CEPB 1TM1E 1Z06A 3IGFA 3CLHA 1RM3A 5C3UA 4HWTA 4XH9B 1TGYA 1AZTA 2WHRA 1NUPA 2X58A 4X65B 1PFWA 4GM0A 3CWQA 2GJ9A 3AEYA 1Z5WA 3INRA 1S1CA 5D00A 2CJWB 3BXXA 2Y8EA 4EYOA 1RWPA 4OXIA 2E7ZA 1V1JA 5IBCA 2ALJA 1ZIOA 2R6R1 2PD4A 1S3GA 4RS3A 4QM7A 1J8MF 1P72A 2PM8A 3DO6A 2YV2A 3DQQA 4TLMB 3NNDA 4O2BA 2WAOA 4IFBA 1WLSA 1WUHS 5CIQA 3JZDA 4F92B 3GPIA 4FR2A 4AZ3B 2XB6A 2CE7A 1BDHA 2HNBA 4XIYA 5LP6B 1PSZA 2R6ZA 4MPDA 3UJBA 1HDZA 1Y6RA 1C9YA 2CBXA 3M0EA 3MRTA 4Y9DA 5AIAA 4GI2A 1GPYA 2AOUA 2XUJA 4BVGA 4YT8A 1FJ2A 1LLUA 2A2ZA 2IVZA 2OBXA 2V3VA 3LV8A 1C29B 4XTCS 1SBQA 3G0IA 5AHXA 1MR3F 4PRYA 3RRBA 5M2QA 2YC2C 4WK2B 2XZPA 5L3SA 3O4VA 1XK7A 1NMXA 3AUYA 5EUQB 3JZMA 3ORFA 4G41A 1F6DA 1ZD3A 3LDFA 2EP8A 1SA0B 2GCPA 2C7QA 4A0SA 3BEDA 1P5ZB 2QRJA 3IAM1 1ESMA 3WGTA 4LJSA 3ZKAA 1ZMRA 3VR4H 1O03A 4X97A 4YI3A 3Q87B 3Q4GA 2CUTA 2CNWD 2EFJA 2A7XA 3F4KA 4LCBA 5FNVA 4BUZA 3L7LA 1NKSA 2W4IA 3OOSA 3VR3D 4BTVA 1PX0A 4F6RB 2ZK7A 1A97A 1P29A 3QLTA 4IDAA 4F11A 5AVUA 4DA6A 4JLUA 1Y7LA 5JZMA 1XJ0A 5D86A 3DYBA 3DB1A 4RM3A 4W5OA 2W2QA 3AQ4A 4O1MA 3VKUA 4I4TB 2X0NA 2JAWA 3G8DA 4IGKA 2GZHA 2ZYDA 1LBQA 3D3EA 1Z37A 3F3KA 1GRRA 1DCKA 5EN4A 1R4NA 1MC1A 3P94A 1IK6A 1LV7A 2WIBA 2VSQA 2WT8A 3OD5A 1Q6ZA 5EP3A 1Z0IA 1SWVA 3VPDA 1F51E 2BRUC 1GZSA 4HY3A 5CK4A 1J07A 1OI4A 1JEOA 1Z08A 2PMFA 2VUUA 3MCTA 3IEUA 1U6JA 3LK7A 5DKFA 1TJYA 5AW3A 3B6ZA 1ECCA 1Z18A 5K0BA 1E6WA 1ULTA 2QVLA 2D4HA 1UZAA 3ULKA 5KDOA 3PQCA 2QT9A 4DUGD 3D4BA 1RMTA 1SXGA 1ULSA 5DI9A 1CJKC 2Z43A 3RSLA 2NWQA 3A9TA 3L05A 5FA6A 5GM1A 5MDHA 1NBOA 5AK3A 1Q91A 5DNEA 2ZT6A 4JA2A 5K09A 1ZD5A 3NHZA 5EWLB 3EWAA 2O14A 5TQ0B 1S8NA 1FLNA 1N9KA 4JT9A 1RTTA 1KEKA 3RSFA 1A4IA 5CU7A 2BUCA 1ZH2A 1RCUA 5TV2A 4KCGA 4CJXA 4G1CA 3CSSA 4TMZA 3ZZTA 5EP2A 4ACAA 1MORA 1WKVA 1S4MA 5COQA 1UM8A 3SIPA 4E4RA 3WB0A 2DFDA 1MB4A 1MRSA 2NT4A 1QIHA 3JYLA 4IXMA 4AN1A 3AR3A 2CXPA 4TXHA 2R65A 4EELA 4G5SA 2P6PA 3UYKA 2O6LA 3EMVA 4HNSA 5CVVA 1SHTX 2WI8A 3QXXA 1RXVA 4JAVC 5EINA 1JZTA 4XX1A 4CF7A 1UQRA 1JDUA 2JS7A 4IDFA 1JQ5A 5CVEA 4J0DA 5BVHB 1QIFA 3CBQA 1HXHA 3R5HA 4IDGA 1N2SA 1DUVG 4G1UC 5HVNA 3QYAA 1YZYA 4LSGA 3Q2OA 4EL0A 1W8IA 2QZZA 1E18A 3NFRA 1XPOA 3VNVA 1GY8A 2F2TA 1STOA 2XNJA 1QWOA 3E8SA 1WCWA 4KX3A 4QQFA 3ROPA 5C8YF 3R3HA 5KMGB 5KSPA 2JA2A 4HATA 3WXMA 2NQTA 1C7JA 1PV2A 4L4ZA 2KS6A 2HZ7A 1UXJA 4ZXFA 1UAGA 1XDDA 3WY9A 5EY5B 3G2QA 5IVIA 4I4CA 1Z13A 2BELA 4Q1BA 4K8RB 4HADA 4AX8A 2DERA 3HPQA 1O89A 4UVIA 5JZOA 3PNKA 2QEQA 3I4LA 1JX6A 1E3LA 1O0SA 3MERA 1XKXA 1EFCA 2ZS7A 4JC5A 4BU0A 3I4CA 5MFZA 3JQBC 5K3FB 1F0KA 1ZGCA 4X44A 4BCBA 2RHTA 2WWFA 3GFOA 1SUIA 2ZSBA 4BKUA 3N86A 2ZEJA 1M83A 2B99A 2CDBA 4P4TA 2Q7DA 1CQWA 4QVGA 5KNBH 2MSDB 2FJ0A 2C5BA 3L0YA 3G5TA 2XE4A 3H11B 1VSVA 1DV2A 1RQLA 2QZ9A 3AEQB 2YRWA 3L7CA 4FOTA 3QELB 4OV6B 5LZ5A 2RH4A 1ZGAA 2BVNA 2AOVA 3M8KA 3S2YA 1E6MA 1VJ1A 5FDFA 2P9HA 1BGXT 1A7UA 3P2MA 2DPXA 4EB6A 5KOIA 1PQUA 2P8JA 3DWIA 4LGVA 3OI7A 3TTSA 1FNSA 1GG9A 2INGX 5AKKA 1S01A 1T9GS 1U3TA 2O2IA 3VPGA 1KK0A 3IO5A 3K3PA 2PJDA 3RIEA 1HEYA 3QE3A 4UM7A 3ZIAA 1W35A 1O5TA 1ZGGA 2QRNA 4M22A 2GB4A 3GGJA 3ZUGA 5JBNA 3TG2A 3CPJB 1NU8A 1R8YA 3NEYA 1C9EA 2PCLA 5D3QA 1JHYA 3WAJA 2CVZA 2YY5A 3L84A 4HN9A 4RK0A 1VSQA 5CA0F 2QN6A 4F96A 3DP9A 4ZDWA 2ODBA 3UPDA 1HTWA 3EXG1 1KS9A 2XEDA 1TM4E 4CL8A 3QF4A 2I4OA 1QCYA 4FTWA 3TX6A 5A9RA 3TQOA 1H93A 4MUAA 4A3SA 4ENQA 4PTLA 4RLSA 1LC3A 1ZK0A 3K5WA 3QFHA 1YZUA 1FJHA 4RH0A 3DVSX 4L6AA 2HBYA 2CXHA 2ONJA 1SUCA 1PGOA 4AF8A 4L5BA 2YYYA 5ALGA 3W3AD 3ZYCA 1T3HA 2EW1A 3E3AA 4MRMB 4TMFA 1YFJA 2QN1A 2ADFA 1Y3FE 3B13B 4N7BA 4WE3A 1USUA 2R00C 2VTBB 1U9IC 3IVXA 1M0EA 5JCJA 4KYUA 3ZEIA 5IPFA 3TQCA 2RCNA 2D1QA 4RQAA 3ZDYB 3MUNA 2M6RA 3LY8A 3ONWA 3UT5A 3VNUA 4DQ0A 5K4AA 1KA9H 2Z1DA 3CVOA 2A5DA 4NBUA 3U7JA 3CLSC 4YV0A 4I46A 1CJVC 1R3DA 4WY2A 2BRUA 5LBTA 2QVZX 4A16A 3I45A 1RIIA 2R85A 1W4RA 3B48A 4D44A 3FETA 3CE9A 3MTIA 4MR8B 5ALQA 1NUUA 3L06A 3VR5A 2OK8A 4WK4B 1NVDA 3UB2A 5FYDA 4EF5A 3BM5A 1GYPA 4JYPA 13PKA 2GA8A 1JQBA 1XFDA 5U4XA 1T4CB 4DLAA 3IESA 1L4BA 1YNOA 3OPVA 1PFQA 1V7PC 2C97A 3GFPA 4OHXA 5CNMA 1V9CA 3NQ41 5EC8A 5CVTA 1YA4A 1ZOSA 4PR3A 3MQ4A 3MJVA 4LFAB 4QOGA 1IQRA 1ZM4A 2DWPA 1KZ9A 2H07A 2ISSD 3A2MA 4R1MA 3GGSA 4JEHA 2EP5A 3ISTA 5A4MS 4YRBA 2OFWA 1W1IA 5I8PA 3TZBA 1M2VB 4YAWA 5I7WA 2QL7A 3F8TA 1RLUA 4HUQA 1SQ0A 2JRLA 1M5UA 4L85A 1YIAA 2WQ6A 4C7OA 1FJXA 1L5VA