2O06A

Human spermidine synthase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
297
structure length
297
Chain Sequence
b'DGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase
publication title Structure and mechanism of spermidine synthases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 2o06A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2o06A02
3ELWA 2R3SA 5EHGA 2PX5A 1UWVA 3ERCA 3FUVA 2I7CA 4DMGA 2FRXA 3B3JA 3DTNA 4M7RA 3R0QA 4KDRA 1D2HA 5H02A 5ICFA 4YV1A 2VDUE 5BW4A 1TPYA 5DM0A 5ICEA 2IGTA 5KYGA 1NBHA 3FUWA 3UJ7A 4GUAA 4M36A 5GOZA 1H1DA 3KR9A 1F3LA 1VLMA 5HFJA 3T7TA 1WXWA 4IWNA 1HNNA 2IBTA 4EVIA 3LX6A 3EGEA 2ZULA 5EMLA 3G88A 2ESRA 4FT2A 2B9EA 3HEMA 4KIGA 3CGGA 2FK7A 2VP3A 2ZW9A 3HCDA 2C7PA 4LECA 1R6AA 1NW8A 3G7UA 1NE2A 3GRRA 3IV6A 2HMYB 3PB3A 2CKDA 5KS2A 3NWEA 3GRZA 5EG5A 1VL5A 3G5TA 2LD4A 1G60A 3P2EA 3KQYA 4DM3A 4CWAA 5K0JA 5LQNA 2ONZA 2ZWAA 1KR5A 4RVHA 5K03A 5CCXA 3HA7A 3P97A 2QRVA 1HMYA 3EGVA 4FZVA 3TOSA 5EZSA 3JWGA 1FBNA 4HRAA 4BLVA 4E31A 3P2KA 2AVNA 5CVUA 4PCAA 1AQIA 3BZBA 5DXAA 2BM8A 3UJ9A 5E2BA 4H0NA 2GA9A 2K4MA 3KQVA 2AOUB 3LBYA 4DF3A 1MJFA 4QQNA 3B3FA 3T7RA 1SUIA 3SXJA 3PFGA 2GAFA 4F84A 3EMBA 2YVLA 3M70A 4FGZA 3TR6A 2AOTA 2EJTA 2C7RA 1JG1A 4FP9A 5DM4A 3EVBA 2ZIEA 4P58A 5CVJA 3FPHA 5EZQA 3E05A 4ER6A 3KU1A 1NBIA 2GB4A 2GS9A 4X1OA 5FHRA 2I9KA 3FUXA 4HC4A 1P1BA 2YQZA 3CCFA 4RTJA 3DMGA 3HTXA 3ER8A 3S68A 3KPUA 3X0DA 4DQ0A 1XDZA 3OU7A 4RTKA 2H00A 2GPYA 2HWKA 3CJQA 4CTKA 2PKWA 4FS8A 2FPOA 3M4XA 3NJRA 4QTUB 2P7HA 4HTFA 4RYLA 3UA4A 1FJXA 3FPEA 3DXXA 2XVMA 4MTLA 4DZRA 1N7IA 5K0FA 2Y1WA 2PXXA 3TPZA 3TLJA 3KQSA 3VC2A 1SKMA 1KPHA 2G72A 9MHTA 3FZGA 3UJ6A 1DUSA 5E8JA 5CVVA 5GM2A 4RTPA 1XCJA 3BGVA 5D1NA 3DLCA 2IDKA 2H1RA 1G55A 3A27A 3LDGA 2BR4A 3GXOA 4OQEA 4UOEA 4GC9A 2EX4A 5C9ZA 1RI2A 5LQUA 3ER9A 1KHHA 1D2CA 4Y30A 2Q41A 4E33A 4AZVA 2YUIA 3RIEA 3O7WA 2C7QA 2NP7A 3R9XB 1F38A 3PT9A 5FWDA 1SQGA 5T67A 1TW2A 2IDJA 5DM2A 3L8DA 1AQJA 2IPXA 3P9KA 5LR6A 1L9KA 5BW5A 2PBFA 3EVFA 3LECA 4BY9E 5M5BA 1RJGA 3JWHA 3EVCA 5T6BA 5BP7A 4E30A 4LWOA 3CJRA 3RW9A 3WSTA 2UYHA 4HH4A 2IH2A 5LQRA 4DKJA 1JQDA 5ICGA 2PJDA 1RI4A 3ANXA 4CTJA 3DP7A 1XDUA 4FT4A 1FP1D 1XJ5A 3BWBA 1ZG3A 2QRVB 1ZQ9A 1N2XA 3HVIA 3PFHA 3LHDA 3MTEA 1YUBA 2AOXA 3BGIA 4GC5A 3M33A 4QDJA 5E1OA 3QV2A 5EEGA 4M38A 1EQAA 3GRVA 5K0EA 3D2LA 3OZTA 2FCAA 3UJBA 1BC5A 3HCEA 3C6KA 3UFBA 5F2NA 2PWPA 1Q0SA 1AV6A 3ELUA 1RJFA 5CUQA 2NXEA 2FHPA 1VP9A 1EIZA 2AOTB 3THRA 5GIPE 1YFLA 3HCAA 1SQFA 2O05A 5DTRA 2I62A 3A7EA 2BM9A 1NW7A 4YV0A 3GRUA 1P1CA 2AVDA 2XVAA 4R8SA 2PXCA 5E1DA 4E2ZA 2G71A 3DLIA 2P8JA 2ZBQA 4EKGA 3AXTA 2QY6A 5EC8A 2ZBRA 1O9HA 3LCUA 2OB2A 3PVCA 3BWCA 2YXEA 1RJEA 4FR0A 4XUCA 5DX8A 4QPPA 4PYMA 4YUYA 4CKBA 1I9GA 4HTFB 4A6DA 2JH8A 5K01A 3C6MA 4V0RA 2OPBA 3EPPA 3HVJA 3LCVB 4RX1A 2HR1A 7MHTA 3VC1A 4RTNA 3EVEA 5EPEA 2OBFA 1M6EX 3HNRA 1JSXA 5E8RA 4GOOD 2JG3A 1B42A 4GOND 5DTQA 3MAGA 3ELDA 2OYRA 2CWWA 2B78A 2N47A 5E9JA 3BWYA 2ZWVA 3B89A 3HA5A 4GQBA 3KQWA 5EVJA 5IKMA 5CD1A 2Z6AA 1L3IA 4ER7A 5EGSA 2BH2A 3OE5A 3NTVA 5GWXA 5CVEA 5FA5A 3V8VA 3NMUF 4HSGA 3MERA 3FPGA 3P9IA 2CMHA 3BWMA 3DMHA 4NECA 2AN4A 4P7JA 2O06A 3UA3A 2ZCJA 8MHTA 1ZGAA 4QTTB 3R6TA 3I58A 1ORHA 3G2MA 4P7KA 4GOLD 4RSRA 1QZZA 3DUWA 3FRHA 3G89A 2P3LA 4RVGA 5LQCA 2XBMA 2ZZNA 4M37A 2P35A 1VE3A 4OA5A 1VIDA 3SVZA 3TM5A 1PRYA 4DCGA 5K09A 1FPQA 1MHTA 1BKYA 1YZHA 2FYTA 2P3QA 2VDWA 5FUBA 1JSZA 4G56A 3G2PA 2AN5A 3RODA 4AZWA 5FCDA 1R00A 2VS1A 2HV9A 3DH0A 3NWBA 3OFJA 3UBTA 3Q87B 4XUDA 5HEKA 3FTDA 3OCJA 2ZFUA 4O29A 1EJ0A 3DXYA 5DT2A 3MB5A 1JR4A 5ICCA 4RTMA 4C03A 3OZSA 4EK9A 1R74A 3EVDA 4HGYA 4JXJA 5FTWA 1L3BA 1R8YA 3P8ZA 5LQJA 1Q0TA 4PYIA 1QANA 2C7OA 1JG4A 2O07A 2O0LA 2DPMA 2FK8A 5JUWA 4OX9Y 1ZKDA 3PX3A 4ER5A 3DOUA 4C04A 2YTZA 4YUZA 1EAMA 1X1CA 1QAQA 4PYKA 5FA8A 4C05A 3LPMA 4PONA 3SSNA 4C08A 3OU2A 1SUSA 3C0KA 3CVOA 3A4TA 1JQ3A 3BUSA 3B3GA 2P3OA 4YUVA 3KPYA 3TMAA 3UJCA 4RTQA 5HIMA 5BXYA 1NT2A 1RI1A 2P41A 4GF5A 5K8VA 5CCBA 2DULA 3KPWA 3HCBA 5HIIA 3TQSA 3P9CA 3ORHA 3REOA 2B2CA 3EEYA 3T7SA 2UYQA 3TKAA 2CL5A 4MHTA 4E70A 5EQJB 2QM3A 3NW9A 2G8NA 5E2AA 1JTFA 4WXHA 3I64A 5HILA 3SX0A 4R6XA 4RTSA 4AX8A 3GIWA 4BLUA 2NXCA 5DPMA 2YX1A 3GWZA 3SGLA 4AZTA 4KWCA 3AWIA 1P91A 1WS6A 4GBED 4K6MA 3M6UA 4X41A 2IFTA 4KVZA 3KKZA 4PGGA 5DSTA 2E5WA 3GO4A 2G1PA 4OBWA 4F85A 5GIOE 5FHQA 5GM1A 2ZZKA 1WG8A 5K0NA 3UJ8A 5DSXA 3KPJA 1X19A 2BR5A 2UYOA 4P7GA 2ONYA 4L7VA 4RVFA 5FULA 3G2OA 5DRTA 4PYOA 3DR5A 3KQQA 1DL5A 2NP6A 3FTFA 2ZBPA 3A7DA 2PXAA 2Z6UA 1WXXA 2NXJA 3CC8A 1BOOA 4ISCA 4IKPA 4PWYA 1SVUA 3KQOA 2EJUA 1N7JA 3ME5A 2AN3A 3O4FA 3KQPA 4Z2YA 2ZIGA 2ZLBA 1L1EA 3GDHA 2AOWA 3GCZA 1SG9A 5DXJA 2WA1A 2OO3A 3LBFA 3MGGA 1OR8A 2YXLA 4XCXA 5U4XA 2AOVA 1IY9A 1R18A 3KR1A 3IHTA 5DM1A 5C1IA 5HIKA 2ERCA 3G5LA 4E2YA 1NKVA 3SMQA 1JG3A 2BR3A 2YXDA 2WA2A 3BXOA 5GP1A 4YUWA 3DMFA 4DA4A 5FQNA 1T43A 2WK1A 5K0LA 3A25A 3PTAA 2IBSA 2EFJA 2VDVE 5EMKA 2AR0A 3BKWA 3G8BA 4PIMA 3M6VA 4QVGA 3TKYA 3PLAE 2IP2A 3EGIA 3C3PA 3OE4A 3ELYA 1P39A 1M6YA 4KIFA 3KQTA 4X63A 2HTEA 2JH9A 2BZGA 2YR0A 1RJDA 4E2XA 4CKEA 1KPGA 1I1NA 3GGDA 2P7IA 2PX2A 3P71T 4HGZA 1V39A 2PX8A 3UWPA 4WVLA 1X1AA 2ADMA 4OA8A 3GU3A 4E2WA 2AS0A 1FP2A 5E1MA 4PNEA 1I4WA 2IH5A 1NV8A 3CKKA 3O31A 3HP7A 3NVMB 4KRGA 1O9GA 2B3TA 2P1DA 5EHIA 4C06A 1DCTA 4BP1A 3JWJA 4RVDA 3U81A 3KR0A 1YB2A 1Z3CA 1G8AA 4PYNA 3B7PA 2ZSUA 4YMHA 1NW5A 1XTPA 5EIWA 1KP9A 4X61A 2NXNA 5F2KA 3SR4A 3I9FA 5CVDA 3NDJA 3I5UA 3FTCA 3MCZA 3P9NA 2ZZMA 3OPNA 3R3HA 1M0EA 3FTEA 1NW6A 2G70A 5F2OA 4YUXA 2NNWB 10MHA 3C3YA 1XVAA 5EMJA 4A6EA 3E23A 4IV8A 5DX1A 3GJYA 3AXSA 1JQEA 1IXKA 3VYWA 4C4AA 4ER0A 1VBFA 3GRYA 2H11A 3M6XA 1EJ6A 1L3CA 3FUUA 3H2BA 2F8LA 3AY0A 4GEKA 3UZUA 1PJZA 1WZNA 2OY0A 4PINA 1TW3A 3K6RA 1NW3A 2JHCA 4PYQA 3SSMA 2ZVJA 3G2QA 4PIPA 5CIYA 3LDUA 4PCLA 3Q7EA 2ZIFA 3FUTA 3V97A 4QDKA 5FQOA 4C07A 3PX2A 3R24A 2UYCA 1ZHFA 2R6ZA 3HA3A 4QVKA 5EMMA 3K0BA 3T0IA 5DLYA 3BT7A 4F86A 4BLWA 4FSDA 3LL7A 3UJDA 3KHKA 5JR3A 3A26A 4P7FA 4RTOA 1U2ZA 4ER3A 4E32A 1G38A 4RWZA 2AZTA 1KXZA 2Y1XA 3LKZA 2PSSA 4R6WA 5B1SA 2CMGA 3EVAA 2IH4A 1VP3A 2B25A 4MWZA 4RV9A 1XDSA 5DTMA 3NVKI 2OKCA 5E9WA 1VPTA 2PX4A 3TFWA 1QYRA 1R8XA 4X60A 2PV0A 3HVKA 3ID6C 4MQ4A 5C0OE 3I53A 4PGHA 4KW7A 2PY6A 1JG2A 3MQ2A 2QE6A 4AZSA 1KPIA 4KDCA 5K0GA 3NDIA 2A14A 4EQZA 4YMGA 2V7EA 5EKUA 5KVAA 3MHTA 2OXTA 2OZVA 3KPVA 1YZ3A 3OU6A 4ZTBA 5FWAA 5CM2Z 3SSOA 4RTLA 3IYLW 4GOMD 3QOWA 2GH1A 2VZ9A 4OBXA 5IH3A 4POOA 2UZ4A 3HCFA 3LSTA 1WY7A 4ATNA 4B17A 4OQDA 2ORED 4QQKA 3HVHA 3FYCA 4DCMA 5EEHA 1ZGJA 5HZMA 1YF3A 4XUEA 2V74B 3F4KA 3MCTA 5P8WA 2NYUA 4PYLA 1IM8A 1O54A 3TRKA 3FYDA 3E7PA 1X1DA 3E8SA 3G8AA 4HG2A 2HNKA 5DRYA 4AUKA 5HOQA 2PGXA 1ORIA 5FADA 1UIRA 3GNLA 5E9QA 4RTRA 3HM2A 2O57A 2XYRA 5KQSA 2ZTHA 1JTEA 5E1BA 5LSAA 1X1BA 3FRIA 3BKXA 4IV0A 3KR2A 1RI3A 2JHAA 2PWYA 3DULA 5EOVA 3EVZA 2QYOA 1INLA 2AOUA 3AJDA 1KYZA 3DXZA 1EG2A 1G6Q1 3OFKA 1D2GA 3BGDA 4LWPA 4MIKA 5EIFA 5DX0A 1KIAA 1RI5A 2IIPA 3JWIA 4CKCA 2JJQA 3FPJA 4BP3A 2P40A 5ERGB 3SM3A 5LQKA 2EG5A 3PS9A 3HCCA 1VQ1A 4QPNA 3THSA 1AF7A 2XYQA 1QAOA 2I6GA 4FSXA 1XXLA 4V0QA 5GINE 5LQAA 1QAMA 1XCLA 4LG1A 3QOXA 4CXMA 4U7PB 4EKIA 4R8RA 3P2IA 4PYJA 3MTIA 3UJAA 5K0CA 3CBGA 5T64A 5G02A 4EMSA 3LKDA 3LDFA 3IEIA 5EKXA 2PT9A 2JHPA 3EVGA 3OZRA 2PT6A 2OB1A 5D1HA 1G8SA 1NV9A 1UFKA 1BHJA 3M6WA 2XYVA 3TM4A 5K05A 3EEOA 1YFJA 2Z6QA 5MHTA 4R05A 4YV2A 4U7TB 3LGAA 2KW5A 3EMDA 1KYWA 5HIJA 3VSEA 1Y8CA 3LCCA 5DWQA 5K0BA 4Y2HA 2PLWA 3CJTA 2GLUA 3B5IA 5KQRA 2PVCA 3FPFA 3KQMA
chains in the Genus database with same CATH superfamily
1AB5A 1WW8A 2DPXA 3M3DA 1ID1A 2D2XA 3HCRA 3R7DA 3RIXA 3IERA 2KQUA 3NGLA 4FFLA 2QGNA 2XX3A 1YDMA 4G5OA 5JSZB 1V8FA 1KRWA 4YACA 3SSAA 2VBCA 4G41A 4YV1A 3H18A 2IOQA 1ZISA 4G8JA 4OMCA 2OGUA 1Z6AA 4O8ZA 2XKKA 3LF2A 5JO0A 4Z9YA 2ZJ0A 1U0JA 1LSUA 4LTNA 4M36A 4CFZA 4IJKA 1RR6A 4QASA 1XZEA 3ZZTA 3I3OA 5AXDA 2O23A 1E3QA 3O8OA 2R2AA 5ITZB 2ZS8A 2NMVA 2DUNA 5TF0A 3VOAA 4NCAA 2WWHA 3RYHA 2X0KA 3ZH9B 1QB7A 3A6PC 1TO1E 4UFNA 2C7PA 1HK7A 1ORVA 3WE7A 4CCYB 4E1BA 5KHLB 1KORA 3B6EA 1PR0A 3OPQA 2ZJZA 2LD4A 1R66A 2AG5A 1AHHA 2OD9A 3OQPA 5HKBA 3THWB 2M2IA 3OQIB 1ZGCA 2H5JA 1RWPA 3DOFA 1GFWA 3EGVA 1DAFA 4HRAA 2WFAA 4JBGA 3AEQB 4CMGA 5T6MA 3HYLA 3TDNA 2OO5A 5CG1A 5JZMA 4LN1A 2NTVA 4OOEA 3LBYA 2XDQB 2VPQA 2B35A 1TUGA 3RIYA 3OLZA 5EZYB 3ICCA 4B82A 4WE3A 4XOUA 4GFDA 1ZNQO 2PJZA 2X2EA 2O2CA 1UEJA 4QSHA 821PA 2JAXA 3FSJX 1V9LA 2PGOA 2WUDA 3DT6A 2YVLA 5IXSA 2C9BA 3LTEA 1L0BA 1L7AA 3MJHA 1FDTA 5JMWA 3VTKA 1D4AA 1O1YA 4EZBA 3BCUA 5J2UB 2WVHA 3P4XA 2Z5VA 1JDZA 3LPDA 4V39A 3ZIUA 3N5KA 1LU9A 1YNOA 2KLBA 1HRKA 3E05A 4RDCA 1VLLA 2BKUA 2CXUA 3HDTA 3F98A 1GTSA 2I9KA 1A71A 2NZXA 3CCFA 4RTJA 4J94A 2G07A 1XZ8A 3GZNB 4L8FA 1L7QA 1MEJA 1NBAA 5CX4A 3KSMA 5FUVA 3HTXA 1QB8A 2BI7A 2FLKA 3ZGNA 1OIWA 3DHNA 4ODIA 4MQMA 4KACA 5JY6A 1QC5B 4KMRA 2H8KA 5J40A 2AJCA 5HIAA 1DQPA 1ZH2A 3L0BA 4IOMA 4RFVA 1U3GA 4IDOA 1E3WB 2R8BA 1A9RA 4OFZA 3NHBA 3EEBA 3B6KA 4Z2AA 5JXGA 2CVHA 3NIDB 2W37A 4JIMA 2QN3A 3DDCA 3T0GA 4R2LA 4FQ5A 2R0QC 2JI7A 2FP3A 2PJUA 3BCHA 3DLCA 2QS9A 3T4XA 3MD9A 3QWAA 3WWEA 1MTZA 4ZT7A 1DU4A 2GERA 2J7PA 5E6RA 1VSBA 2KSQA 4PZ9A 4QUIA 2LNDA 4W7SA 2VBGA 2XADA 5B7QA 1DFIA 3KIPA 4UHEA 2VEDA 4B6SA 5IVKA 4XFJA 5C1OA 5GVSA 1QRUA 4AZVA 4J2TA 3D54D 1ZITA 3RIEA 5AMXA 2OD2A 1OV6A 4R7ZA 5ITSA 3OEHD 4N0EA 2C7QA 2C2XA 5FFMA 1QYCA 4M7OA 3DT8A 1Z0DA 3R9XB 3DWEX 1REQB 3GA0A 4HUTA 2H1CA 5JBIA 1JEEA 1BGWA 1Z68A 5C4IA 4QECA 3BA6A 3DDHA 3LECA 3AHIA 1ZGHA 3KJIA 4RSMA 4YR7A 3EVCA 1N5KA 1KVTA 2IVZA 3LQYA 3MQ4A 3NBMA 1C3EA 2E2WA 4E30A 4GRIA 2DTDA 4JWKA 3H87A 3TW6A 1NQOA 1YFKA 3W4JA 4L08A 4EDFA 4NH4A 4Q3BA 3EGDB 4G9EA 4KEAA 4EHHA 2EF0A 5BR4A 4QBKA 4OQQA 5I8WA 3HVIA 4EFDA 1RM0A 3TBKA 1CNFA 2REXB 3M6FA 2X58A 4QDXA 1JDBC 1KYQA 2VQ3A 1II8A 2P65A 2ZVQX 4GICA 3U4GA 5AKGA 5EJFA 4WRRA 3FOEC 3W9SA 4HDQB 2PYZA 3UMSA 3N9IA 1DQNA 5F73A 2PUVA 4CIDA 4AIIA 3TSCA 1XZIA 2WTUA 2GEFA 4I55F 1V3VA 3MCAA 1SUDA 5EXTA 3AUUA 5FTMA 4HDRB 5KDOA 3QF7A 6ABPA 2BM9A 2FRDA 3LUKA 2IDZA 1HF3A 4ZMBA 3ZCVA 3OBIA 2YCLA 1J00A 1GAEO 1O08A 1KZGB 5U9CA 2GBFA 1N7GA 1S0UA 3QLUC 5IUJC 4Q6BA 1EGAA 4YRCA 4FBLA 5D84A 2ZM5A 3BRQA 4TKLA 3AXTA 3BGOS 3IURA 3UWSA 1DZIA 3NOOA 1AGRA 1ISPA 3QNMA 1RJEA 2QMYA 5C5EA 4OOFA 4U39A 4AICA 1VYVA 1XT6A 3ADDA 3P0RA 3KJHA 1AUQA 4V0RA 3UB2A 4YP7A 4BLPA 1U0BB 2C3UA 1AGNA 3UHJA 4AKTA 2F55A 2GT1A 3HY4A 3VNUA 1I0IA 1LLCA 4XWAA 1HUQA 1PCXA 1CUDA 4D8YA 3DPUA 2BOVA 4N3BA 3DFKA 3VO8A 2WPDA 4CV1A 4ZMSA 3B89A 4ETNA 2H9YA 1LNQA 1Y80A 1C0EA 2ZRBA 3B48A 5BN3B 2Z6AA 2W2PA 5KPDA 3V4PB 2P2YA 4V03A 4J3NA 4B80A 2OESA 4FDTA 4S1TA 3I05A 2OGZA 3ETDA 2OORA 3O8QA 4IQGA 4Q9AA 1EXMA 3CKMA 4PPQA 3TZKA 4REOA 1MOSA 1CQXA 1D4FA 3ZS8A 3H5IA 4A73A 5KWIA 3FHCB 5BSUA 2XF2A 1KSFX 1A4RA 1U0OC 5LQCA 3BN3A 1OJLA 4ZHQF 3CRVA 4OA5A 3RH0A 1PZNA 3DYBA 1PRYA 4CN9A 2C8VA 3EXIA 5L8VA 3WDMA 3I30X 4TZKA 1U9YA 5CXXA 3NNDA 2J67A 3BE5A 3K30A 3F9IA 4LC0A 5ALFA 5JH7B 4JOQA 4Q0MA 4DHWA 1WETA 4YCMA 2HK8A 1F9EA 2GPAA 1U7TA 4ZI7A 7ABPA 5IJ9A 5HPYB 4YJHB 3HZHA 1G8FA 2UVDA 3EGXB 4IIXA 1Z0IA 3V2UA 1M2VB 3ANNA 3JZMA 5ARBA 1L1QA 2V7WA 3FYUB 3IO5A 3D7SA 1MLDA 3CR7A 4BNKA 4PYIA 4YT4A 3NI2A 4ZCMA 5CFMA 1SC4A 3M5DA 2P2SA 4OL9A 1W4AA 1XMJA 1XZPA 5HS6A 1RCTE 3CNHA 3DT9A 4BZQA 1SG0A 4I50B 3MT0A 4TSFA 1KS9A 1BD3A 1NJ2A 3Q3IA 4RD3A 1XMPA 3PG5A 2B7BA 3OI7A 1IUPA 5JI2E 1Q6YA 3T3EA 5HIMA 1P5JA 3VR5H 3ZFNA 1RI1A 5DF1A 2PRJA 3RVBA 3JQBA 5CJPA 2PUFA 1ZL0A 5EIOA 4TRMA 4LRQA 1CR2A 2O3JA 3ORHA 5CFZA 1SHUX 2ORVA 1G20B 3G5AA 3CH6A 3MD0A 5FUXA 3COSA 3H2HA 3TOZA 3ZWKA 1NUQA 3WBBA 1GJRA 1SR8A 4RQBA 2J3EA 3NKLA 3RBZA 4RTSA 4NU8X 4OQYA 1V96A 3D5QA 5JS2A 2VQEB 4WLVA 3BXXA 1P91A 4KLAA 1KJ9A 3W5JA 4MS4B 3ZWVA 3LW8A 3OY2A 4FX2A 2RH5A 3FMIA 4ZVQA 1OLUB 3KQUA 2IXBA 3SQLA 4DLKA 1OA0A 1PSDA 3B38A 3HYNA 2C31A 1U0SY 1PG5A 2Y1FA 1SZDA 3D4OA 3DR5A 4DR7B 2OBMA 2XRZA 1PTKA 3QPAA 1TUBA 5KVSA 3BPSA 4PWYA 4LV8B 5LP6F 1SUEA 4MUEA 1VMIA 2IHUA 4XM2A 4JKYA 4HDAA 5FA6A 4AJ2A 5IVIA 5BUZA 2C4VA 2IS2A 3ND9A 4O2BA 1RLMA 3WYEA 2X0NA 4KH1A 4D8WA 4JR2A 1KC1A 3FBWA 4J91A 3GCZA 2GMWA 3PFNA 5KI6A 4M0UA 3OZAA 4B75A 4NYIR 5JMOA 1NM5A 3ASVA 2GZAA 3HSKA 3OKAA 1JG7A 3NDRA 3LT5A 3ER6A 3KLPX 4MKFA 3SMQA 1Y81A 1J1IA 3CU5A 4DYHA 1ZOOA 1EVJA 1TKBA 1X0XA 3EXAA 1IC6A 4FYMA 4NCNA 4MVJE 2BFEB 1WB9A 3DTTA 2AYYA 3P5BA 4OKIA 4Y1RB 5I7EA 3GDWA 4B8YA 5J43A 1IBCA 1M76A 4L4ZA 3SOZA 3D1JA 4L22A 2J9YB 4HGZA 5FNVF 1V39A 4JI5B 1II9A 5FLYA 2IHZA 3JASA 4TROA 3GU3A 4HSEA 1X1SA 4OGGA 4AQDA 3GP8A 3HDQA 1KQPA 1QFMA 1G2OA 1A7UA 1CIJA 2B3TA 2WDPA 3I23A 4HF7A 5D3MA 3VKWA 5BN4A 2GCOA 1R64A 3DONA 3FKQA 3GVIA 1JYSA 3IUSA 2CYCA 3DHWC 3K4HA 1IG0A 1LB1B 1M1UA 3ESBA 4J4TA 1RWOA 4PRZA 3V8RA 3UHAA 3L1JA 4EUEA 4P53A 4X61A 1Y0BA 3WA6A 3I9FA 5CVDA 1I2AA 3E70C 1R6TA 3LVRE 2JD2A 2PD3A 3WLTA 1DBSA 2WLTA 2C61A 3KXDA 3R3HA 3SEFA 5C7IO 5E4FA 4UE6A 4AJEA 3C3YA 3R3SA 3WB2A 2FMKA 3MTBA 2W2LA 5JVDB 2DXIA 2Q4TA 1RD4A 3MLAA 4RD4A 4LJ9A 3M6XA 4OLHA 5H9VA 2N42A 1B23P 1EJ6A 1JPNA 3H2BA 1ZH8A 5JXJA 4K28A 2OPHA 2AKYA 4E5SA 2FE1A 3OE7A 4DWVA 4MUFA 2VPZA 5IMBA 1XCOA 2HIMA 2D8MA 1ESDA 1E64A 1FSSA 1MDBA 1C1XB 1QCCA 1YZGA 3WK4A 1CV2A 5CFPA 5LUBA 3PF8A 1DXYA 4EVRA 3F73A 5I7VA 1V4NA 1WMAA 3CZRA 1POWA 3F5MA 2JIZD 3JQ6A 3C6XA 2PPVA 3Q0TA 5IAAA 4TVBA 5CYPA 2WEKA 5HTKA 1I2DA 1D4ZA 1E18A 2J9ZB 5KSOA 1AC5A 1XKLA 1C0KA 2NZUG 4HFRA 5KTRA 1TJ5A 1WZIA 5ALJA 4C0SA 4F3NA 1FNDA 2IPLA 2BT4A 1NFQA 2ZP1A 3DE7X 4I1RA 4LPKA 4C3VA 4MDEA 1HFWA 2IS1A 1GQQA 2ZI4A 2QT1A 4BNTA 1CX9B 2WWIA 5I47A 3ID6C 3C15C 5EPOA 1I14A 3A10A 2GNPA 2POCA 4PGMA 5A9TA 3EY9A 1P18A 1WY5A 4LGCA 4N01A 4A0QA 3ZE6A 1JLHA 3L1IA 3V5NA 5KNLA 3ROZA 2NTJA 4J03A 5I48A 4DR1B 1SNYA 4MJLA 4CLXA 2BUCA 5ECGC 2CE7A 2XHZA 3IHKA 2IUUA 3I4CA 4MGHA 5FWAA 3U7QB 5ELXA 4AMUA 4GOMD 3TNYA 4NKRA 2G5GX 2CHUA 4IILA 1XN1A 2PKRA 3D3QA 5EE9A 4ZOEA 1TU4A 3F3KA 5DGIA 1OD6A 3PQ2A 2QMOA 4R40A 5I5GA 3WIVA 4FEGA 4E5YA 2XYGA 4EHFA 3G82C 5A06A 3AFMA 1RC1A 4WD3A 1XU7A 1UR5A 3R7LA 3Q3GE 1XPRA 2CZQA 2IP1A 3GNLA 3LXUX 5KTOA 3ITEA 1L5GB 1VM6A 4RTRA 3FSGA 1GSOA 4FU0A 4LY3A 3OJWA 2Y0DA 4EHLA 1LD3A 1XWFA 2GXSA 4XUGB 5JD5A 1OXSC 2RBEA 3FRIA 4RVCA 3O74A 2WFLB 2XOXA 2I6QA 3NBUA 4ZJYA 5ADVA 3G9ZA 2VHUA 3I01M 5BSKA 1SU6A 1O8CA 3KVRA 3P9XA 3TB6A 3WDKA 2QBYA 3IOCA 1T0HB 5BQOA 1KNQA 3Q5EA 5HRUA 4AXXA 1ZD8A 2FX5A 2ODPA 2JJ1A 1XRNA 3CURA 4KE8A 1R5OA 1GDDA 1OREA 1GZ3A 1SXJD 3CLRC 1IPEA 2I6GA 5FT9A 5LB4A 2I91A 3UTCA 3UT5B 1XXLA 3O3MB 1UAGA 2OD7A 4NYJQ 4OJMX 1UIMA 1HDOA 3R3VA 1C2YA 2WV7A 3PQFA 4IRMA 4UZEA 2A1TS 2Y1OA 4IOLA 4NR0A 2IU0A 2A33A 4PBSA 1DDOA 1CY0A 1QXSA 5K0TA 1EBBA 1WVGA 3IVAA 1VJ0A 1QLWA 3QBEA 4NV3A 3LNCA 5EKXA 1R0CA 3U9TA 3UKDA 5BV1A 1JH9A 2HSGA 4R41A 1V9SA 1FDUA 3U4QA 1PBNA 4HNGA 1F2TA 2EFCB 4IGIA 1YR3A 4W9RA 5EY5B 3RS4A 2QJFA 2W43A 3WJ2A 3BS4A 1C81A 4ZP1A 3E9DA 4DLXA 3FNEA 2OAEA 2ZS7A 2G63A 2GLUA 4EG7A 4ZAZA 2VH1A 3R0QA 4QPDA 3DEZA 1WIWA 2GI4A 5B3JC 3N0RA 1YGPA 1F4LA 2QD3A 2XCRB 2C20A 1EESA 1EXDA 1N1DA 3KOOA 2YFYA 3NHUA 4N3CA 3D59A 3Q2IA 4KLRA 4LJAA 4TV9A 4X95A 1TQ8A 3EOZA 1TPYA 3TJMA 4FI3C 4RKRA 5BY2A 4WA8A 2GKGA 1QUFA 3V7FA 3WKCA 1C3XA 2G1UA 5CM9C 4W8OA 3KKQA 3AUSA 2ZUTA 1OFTA 1IM2A 2OHHA 2ZYRA 2JL1A 3COVA 4OLJA 1MAAA 3GAZA 4PHHA 1ACJA 1K0UA 1XAJA 4WCFB 5LLTA 5DDIP 3KQKA 1KXJA 1Y6QA 2OGWA 3N05A 5TEVA 2OXEA 4BV8A 4F4FA 2J3QA 4WK4B 3V1LA 2BBTA 3GLUA 4KL8S 4MKGA 2PKQP 3QE3A 2CLEB 1LPAB 1G41A 5F1YA 4K6KA 3OKPA 4JYMA 4IDQA 3BAZA 3GFBA 1ZWLA 3R9KA 3A1VA 3E9MA 3P2EA 3HXMA 4J1TA 3SBXA 2EKPA 2Y99A 5K0JA 4N65A 1G9SA 2ZOSA 3WADA 1KEEA 4B6RA 1UDBA 3KG2A 3WHKA 5L3SB 1IOWA 5DNYB 1FRZA 4L76A 4BIIA 5K3FA 4DNXA 3FOBA 3I9NA 3LWZA 4S2UA 3VZRA 2OHVA 4CM9D 1OYYA 2Z1NA 1AQIA 3DE1X 1A82A 4BMDA 1X1EA 5E2BA 1AF4A 5LXTB 5C8VA 3HR7A 3CF2A 1D8TA 1E69A 4FMDB 5EJEA 5F33A 1PW7A 3RCBA 2XQGA 2IJGX 1EM8A 2OV3A 5CAEA 4EJMA 3BAFA 1B0AA 3KBBA 1C4OA 3DOJA 5I9SA 3KBOA 2Z4TA 2PVSA 1CZKA 3L43A 1N33B 4BATA 2C7RA 4GPD1 1MUUA 4OSOA 1CYEA 2VP9A 4MDYA 1SVSA 2B4QA 3IEMA 1MKYA 4MQUA 3FYSA 2PD6A 3FPHA 2FQXA 4MRMB 5JPIA 1M8JA 1YS4A 4UUPA 1C9NA 2A94A 4TMVA 4NBWA 1W8DA 2A7XA 4MR9A 4M89A 3ONEA 3PA6A 1PHPA 5DW3A 2C95A 2I5PO 3ZY2A 2GKOA 4CU5A 4F6CA 1KWGA 1RZRA 1W6RA 1V3TA 3D3NA 5TMPA 3WRWA 3ZV4A 3CVWA 1U9JA 4MCHA 2X9LA 4QAJA 2Y1KA 2V8OA 1OXBB 1DV1A 2WJHA 4EHKA 3IHLA 3VC3A 1E3JA 3AETA 5CU7A 2O5EA 4D4KA 1PS8A 3OLYA 5E7MA 4DZRA 4E4TA 4IZIA 2ISSD 1CJUC 1VB3A 2GESA 4MJXA 3I0ZA 4F9EA 1QE0A 3FVVA 1YJXA 4D4GA 7REQA 2ECQA 1E2LA 2QVCA 3U9LA 1LRJA 2ETVA 2YQ4A 1XP5A 3HJBA 4BECA 3GLQA 2AQ8A 2W8ZA 5TEWA 2OQRA 4KYTA 1EJBA 3WV4A 1W47A 3V7UA 1FU7A 2L82A 3LDGA 1GPMA 2QMQA 2QTHA 3LX4A 4MB0A 3E27A 1JWLA 1B6RA 3F1KA 2UUPA 1AS0A 1Q2XA 3EWSA 1WMSA 4QVIA 4MUBA 1YZQA 4RD2A 2GN2A 3O8OB 4JA0A 4XVHA 4RH0A 3VO2A 3ZHXA 4X66B 4RGBA 3G6WA 3K0SA 4DR4B 4Q9DA 2I3ZA 3ZV5A 3HJNA 2C1XA 4DAOA 4A2QA 5E6SA 2XNDA 1YR7A 3OTQA 4UNSA 3E7WA 2VUUA 3EXG2 4QYSA 5JSFA 1SKQA 4WLOA 2ZE7A 4TMYA 4CN8A 3QUSA 1CHDA 1E1QA 3KNZA 1ZK4A 1EDDA 2ZQYA 2OV8A 4BVAA 1LDBA 3O21A 4GQAA 1EH5A 1XO1A 4XB2A 3WYAA 1HE1C 1KKLA 5LQRA 3BYZA 1RI4A 3GEGA 4M1YA 2AFIA 3AHGA 4E21A 1EZ4A 2BGWA 1U0FA 2XRFA 3EA4A 1ETHA 4RCVA 3O2SB 5DCYA 4I9FA 4Q16A 4G1UC 3WIDA 3ZK9A 4LSMA 3S8EA 1SVOA 2QHXA 1JTVA 3PC6A 3QKWA 1BA2A 1DTEA 3E9YA 5DBFA 1DRWA 2IZ6A 1T9KA 5HE9A 4YREA 5ULLA 4AWAA 2VF4X 4MV1A 2ZU6A 3PV0A 5DHPA 1Q0SA 2QRMA 1RAFA 1YI0A 2WVJA 2Z5GA 4MV6A 1TNDA 1M5RA 2HJHA 4KN5A 1CUXA 4BMXA 4EYKA 1RWKA 4UD6A 2RBKA 3L6RA 4KWTA 5B4TA 2QRNA 2AYZA 1N8KA 1G7CA 4XGQA 2GJ8A 4K46A 2GFQA 1WDTA 1E3SA 2PWBA 3QYAA 3C98A 3Q3VA 4HWGA 4MKHA 4QHYA 4GHWA 1P6QA 3PXXA 5E1DA 3PQ4A 3U9SA 3ZN2A 3IE2A 4FMBB 5ES4B 1JEYA 2PAAA 5AP9A 2QORA 2OAGA 2FUKA 3HMKA 5A6SA 4ZAGA 3F3SA 1OAKA 5EC8A 4TVSA 4L6CA 4NENA 5GJWC 2G5PA 3GGJA 5I01A 1DG3A 4JVNA 5HQ3A 5LMUB 3PQ8A 4HLCA 5CT8A 1NLMA 2XWJI 1H94A 4UU7A 3LG2A 4AB1A 3M2PA 5JHHB 4X7PA 4I9GA 4GLOA 1EWQA 3IE0A 1U2GA 2PUCA 1Z39A 2QJRA 2QU7A 1Z5WA 3C1TA 3L8FA 1RHMA 1B42A 2GBLC 3HPRA 4G6ZA 1YBFA 2GN1A 2NV6A 2EW8A 1LDEA 2ZWVA 1QHEA 4UAJA 1GP2A 2PT5A 3V32A 4EPTA 4QARA 3WGQA 1ENPA 2E4WA 3ESQA 3VKUA 2X0RA 2VKQA 1M66A 5E6RB 3PRYA 3E7FA 1DQZA 5CVEA 1TT5A 3LPNA 4NX2A 2R8PA 1ZMRA 1ML4A 1P2DA 1S7CA 3BWMA 3I72A 2WOOA 1O4VA 3OVMA 4QE3A 4XTRA 3VU0A 2VHJA 3CR8A 3H9EO 1DHTA 3FB1A 4H7HA 4J7UA 1B73A 1NJ1A 3MFQA 3ZHVA 2QV7A 3AKCA 3O95A 2VP5A 4DY4A 5C35A 3AZPA 3G2MA 4PPNA 3RYIA 4BKOA 3RBAA 4RQAA 3CSUA 4BX0A 4XA8A 3RYFA 4DUPA 5A2QA 5JWOA 5IT4A 1T5HX 4UDOA 3TH5A 4YJGA 1MHTA 1DKUA 4FFNA 1R8SA 3IVCA 4TOIA 4ADSG 4KKVA 4AQYB 1YTUA 1XLTA 1PV1A 1Y4UA 3TN7A 2V98A 2MCFA 1CY8A 1ZCFA 2FW0A 3Q87B 3KE8A 1NVKA 2I78A 4DUGA 3LI2A 3OTIA 4R81A 2VA9A 5IK2A 3TB4A 4C20A 1IBKB 2H59A 4DNPA 1TAUA 4QEZA 2BL4A 2G6TA 4R5MA 4XIGS 4DDVA 3TUZC 3QKTA 1OLSA 5F9MA 2W83A 3M5WA 1BHQ1 3HLTA 1II8B 1IJFA 1Y1RA 2DHCA 3V8NA 3MGKA 1ZC4A 2YWJA 1ZUWA 4LXYA 4G2NA 1FDIA 5IN4A 2DAPA 1Q1BA 1A8UA 3TI7A 4ALNA 4C08A 2TMGA 3CWQA 1Y42X 3LQRA 4KNVA 1XF9A 1UXJA 3C3BA 4JROA 1MH1A 1HX7A 1RKXA 1OAOC 1XTBA 2VNIA 4BFXA 3GJ3A 4E6PA 2NNLD 3B2QA 2KB0A 1OASA 2JIPA 5E7JA 3KT8A 1USKA 4M8IA 1RWNA 2ZSKA 1QTQA 4QLBA 1JVBA 1RLUA 3JRNA 4RPKA 2MR6A 1VBNA 2VAVA 2CHVA 4E70A 1C0LA 2VUTA 1LH0A 1ZYUA 4JEHA 1T36B 4NNOA 1R4MB 4J1NA 2BGNA 2QL9A 3MTGA 3N6XA 3QENA 5DN6A 2NXCA 3EX7C 1XTIA 5TT1A 5DPMA 4DV5B 1EB9A 5I7RA 4DUYB 1VPWA 2G09A 4BBAA 4R2IA 5D86A 1KYTA 3W5DA 1PZFA 2G1PA 5TRTA 1K6IA 1YZNA 5K8LA 1TM4E 2PWZA 4ZODA 4ZDKA 3FHOA 3PEEA 1T8YA 1T2DA 1WZUA 3CX3A 2J0VA 5B53A 4MUYA 2NO9A 5FULA 1H2EA 3TIXB 4W5JA 1TAGA 4QZVA 5LOVF 1EDBA 2WC1A 2HB6A 3LXMA 3PUJA 4G3XA 4MPJA 4BQIA 4IX9A 4PICA 2CLOB 1MXFA 4UM8B 2QBYB 3I5MA 2BUAA 3L5KA 4JVSB 1SVUA 2QUHA 1UBOS 4RZ3A 3O8QB 4ZYYA 3FCAA 1MBZA 1RXCA 3HADA 2HH9A 3MUFA 4UM5A 3H9GA 1PT7A 4F38A 1V5IA 2ZLBA 1J2JA 3TFOA 5LWHA 4QQ8A 4IFBA 1ZWKA 5F21A 1I7LA 1V8OA 3QBDA 1I36A 4DEXA 2OG1A 5MF6A 1ZU4A 3NAMA 5BN5A 4BO5A 1RQRA 3EXIB 3M89A 2BC9A 2IXDA 3FNQA 4KE7A 4S1NA 4YCDA 5HQTA 5HNKA 2P1ZA 2WILA 1EK0A 2ROQA 3BRWA 3EHEA 3T38A 3FGOA 5LBTA 4DM4A 5I4IA 4U0KA 4BNZA 1AA6A 2PZKA 3WL5A 1A98A 3BKWA 2QX8A 4ZI7B 3F74A 4B4UA 3G7SA 5IJ9B 2B4KA 3QEMA 3ETCA 3T3NA 4IPTA 3QEAZ 1A4XA 2FH5B 2Q9UA 4L5JA 3AIIA 4WL0A 4MVYA 4L28A 4O2AF 5B55A 4BQQA 1M2FA 1V26A 1OYOA 2Q5OA 4C5BA 4E2WA 3VYVA 3WMXA 1O9GA 1BE6A 6Q21A 5KPJA 1U98A 3I2GA 3BORA 4E7OA 3P45A 3S7ZA 5JPDA 4WLUA 1TIKA 1Z3CA 3HWRA 4K5QA 4O4HF 1HL7A 4E5PA 4KIJA 1RLOA 4PX3A 4H1TA 4R4JA 1YJAA 1X7HA 1DCMA 4Y0NA 4MV9A 2UUOA 1WD7A 4ZMRA 1HKUA 1PR5A 4Z1MA 4PSKA 5C4GB 3RRBA 1QUEA 1A9OA 3FNRA 2NNWB 1G9XA 4L50A 4JYAB 1DRKA 1G5HA 4ZWNA 4EG4A 3GRYA 1GNRA 3I2KA 3IVXA 4OSEA 1EUCA 2GEDA 2F8LA 1GILA 3JYLA 4IGEA 4NCXA 2QTWB 4BVJA 1RYHA 2G7ZA 3EE6A 1SXHA 4OUDA 2OBLA 2ADFA 3R5FA 4O2RA 4TM8A 4FWTA 4K87A 1Q12A 1G63A 3BSSA 4LOLA 2UUAB 1D6NA 3LFUA 2XIJA 1PUIA 5CXSA 5DLYA 3TLEA 4V0KA 4XGRA 5H80A 3R4CA 4UZSA 4MRSA 5IZCA 4CEHA 4LDRA 1JHDA 3TTXA 1HOTA 4RTOA 4HVAA 4BTVA 1GA4A 2Q1UA 3W5AA 1BMTA 3GYBA 1PNVA 4AUEA 4Z99A 4TLMB 2VK1A 1Z22A 5KO2A 2FN9A 1TUBB 2WAXA 4LMPA 4X6YA 2W11A 1N8TA 3T3GA 1QGZA 4AJLA 5HHTA 4AI6A 2WIFA 2BKAA 1KYYA 4UKDA 4N0QA 3QU9A 2XE6A 4WASA 2MSNA 1WQ3A 1ZIPA 5CMLA 1J56A 1UJNA 4O2BB 2OM2A 1TCAA 2WF7A 1FFGA 1R8XA 1THZA 1G9TA 3FJYA 4RVNA 3BG5A 2MTBA 4KW7A 2DU8A 2XUIA 1NQTA 3CLSC 5E6UA 3GMDA 4QTXA 3W6PA 1A4IA 1QV7A 2NTNA 5A05A 5LBIA 1L5NA 2OFXA 5JJCA 1KQNA 4OJNA 1QX4A 2XT0A 3E84A 1W59A 4AP6A 1FFXA 4XEUA 2NLOA 1T8TA 3TRJA 4PZPA 1ECCA 5EQTA 2OVBA 1WEHA 2VZ9A 3M7IA 3X1ZA 4B8ZA 1RHUA 1KGSA 2YWCA 3KL4A 2ZT8A 3KHSA 4B17A 2ORED 1J8DA 4L4YA 1NG1A 4NMHA 4O1IA 5HZMA 3TTUA 4LCJA 4IDFA 4BC1A 3RT9A 4MLPA 4Y0VA 1RXIA 4ZT6A 1IM8A 2B83A 1NYRA 4AP5A 3A37A 4I14A 3E8SA 2Z3ZA 1CEEA 4LS3A 1AU9A 2PGXA 2I8AA 1JQBA 1MVOA 3BB1A 4TV8A 3OIWA 2YJ3A 1HLGA 3JASB 3ML1A 5LSAA 5FLXA 2EIXA 4LZLA 5FKJA 1TVFA 3T5BA 5HZKA 4N6NA 2YNMD 3FVQA 3SEAA 5KJFA 3D2CA 1XN4A 4HBZA 5D3MB 3ORQA 5I4BA 1V11A 2GCOB 3O9ZA 4X5OA 4UDNA 4HX9A 3AUXA 3BSYA 1U6IA 4DRXA 3GAMA 1WM1A 3CX4A 5CCDA 1J25A 1MX5A 1XMXA 2J3KA 2VJLA 3FPJA 1EDOA 1P44A 4JVMA 3GC6A 3T0FA 1R0XA 2MR5A 2EGUA 2F9MA 2YDYA 2QY9A 3F7TA 4P36A 3HCCA 5L7TA 1DWOA 1U2DC 3WDLA 3PEWA 2YHIA 4ZK2A 2AK3A 1GXSA 1W4BA 1Z37A 5DHQA 4CZ2A 1AK2A 4V0QA 2X0IA 2XQKA 3MEQA 1J42A 1VGQA 2ZVPX 5CLJA 4MXDA 1PDVA 4UTXA 3QOXA 4A6XA 3RRXA 4CIBA 4A8PA 2EYUA 3BFJA 3CA8A 3ENWA 3VR1A 1WQ4A 2VZLA 2Q0SA 1LA2A 2XUOA 4J16C 1X2BA 4A26A 4OQXA 1LI5A 1WPGA 1R8QA 2GWRA 5CB6A 3EEOA 1RCUA 1TM7E 3ZIDA 2ZRGA 1LNSA 4MV3A 1Y9EA 2LW7A 2PT7A 4EYQA 2CXXA 2J6CA 3KT6A 1Y8CA 3IAM6 4A5SA 4PX2A 4KMOA 5AJYA 1C9DB 3QEJA 4X0EA 2YXBA 1Z6PA 3Q5GA 3AKDA 1T9DA 3RROA 1C0PA 3PI7A 5JYCA 3HFJA 1GKLA 4MUJA 2FRXA 3B3JA 3DA8A 1WXDA 2QD1A 4F2GA 4DDWA 4KN6A 4YAIA 3I6ZA 2MSEB 4DMFA 4RLFA 2LIPA 3ZY4A 3HB1A 3PBKA 2IW3A 2XE8A 2FR0A 2BRUA 2HT6A 1D7AA 1ULTA 2VF2A 1UP7A 2Q0HA 5I7OA 3PPXA 3T7TA 1FXWA 2C4NA 3Q7QA 1WXWA 4OYHA 4XE5A 2ECFA 4OXQA 4DEVA 2RI0A 4KQMA 2IBTA 1ORTA 3EWIA 2HJVA 1SEVA 5THQA 2B9EA 5ENDA 3A2MA 2VP3A 3VMFA 1QVVA 4ALKA 5B12A 1B2LA 1Z2DA 1YL5A 4L73A 1PR3A 3WGZA 2Q2QA 3NWEA 4FMCB 4BCDA 5SYNA 3PZBA 1G17A 1GDTA 4XJXA 2BTOA 3HN7A 2Y4OA 2AMYA 5EE5B 5TY0A 4DMGA 1XE3A 4C5CA 2QTBA 2R85A 4ALMA 4EKEA 1GITA 4ARCA 3Q7SA 4Y6QA 4P84A 3II6X 2OZEA 3L7BA 4PSVA 2HU2A 1DJQA 1G8HA 4DDKA 1VIAA 3HB7A 4N8SA 4AY3A 2WG1A 1A8SA 3UJ9A 2YZNA 3KQVA 4HEHA 4P81A 1HG0A 2NT3A 1O58A 4Q7QA 4U6NA 2CNLA 1I6MA 1BGVA 1BJTA 2Z8YM 3B3FA 3DLAA 3OCXA 3VFDA 2ODWA 4UBLA 4EG5A 4MGIR 5BR8B 3K4QA 4TXLA 3UOAB 5EHXA 3OEYA 5I3ZA 5IWAB 1PAUA 5HF9A 2JI9A 3OMWA 4HLQB 3SYKA 2X3UA 3FIUA 1ZP6A 5DM4A 4OQMA 1UFQA 4KPGA 2QLBA 4I8XA 4Q03A 3FNGA 5H5JA 5B1HA 3OIYA 3H97A 5C51B 1YS2X 1ISGA 4Y9RA 5FL7D 4KHPB 4DE5A 2A3NA 2F8MA 1DO8A 1N77A 2WYWA 1UCFA 1OZHA 3AK4A 4B74A 5A62A 1AV7A 2ZKIA 4JIGA 5IKXA 1EXNA 3QSYA 2VYVA 3RVMA 5ILGA 4C4YA 1L7DA 1ZXBA 3CX7A 2NU8A 4Y2XA 3CJQA 2HWKA 1PG2A 1OPXA 1V43A 1JIVA 3ZBQA 4DSTA 1F2TB 1Z17A 4PZDA 4UCFA 4U3JA 4UULA 1MOPA 3DXXA 4UUOA 2RG7A 3WGJA 1N7IA 3QZUA 4NEQA 1XZBA 4M55A 3NTUA 4JODA 2C82A 4H7KA 4FDAA 4LJ4A 4Y1FA 4DNQA 2RJ3A 4CIAA 4HDCA 4Y2VA 2KBFA 2JAOA 4MA4A 3TLJA 2G72A 3IKJA 1JQLB 3N8KA 3WTBA 4EF6A 5KVQA 3UJ6A 5JMTA 1XTKA 1Y5IA 2WMOB 3KO8A 2YJ6A 3ZY3A 3CM0A 4PHFA 1FDOA 2IYPA 3AJEA 4TV9B 3M6IA 1YCFA 4LF6B 4GGPA 4BNLA 3P4YA 1T26A 1XAIA 2K5UA 3IIIA 1QE5A 4FR5A 2B4AA 1Y7TA 5K0SA 5A7GA 2BH2A 5HF8A 2EX4A 4JB3A 1TEHA 4L5YA 5CX1A 1E1CA 4Y30A 4CTMA 2OFOA 1AA9A 2VHWA 1F8GA 1BCSA 2XZPA 3FVRA 3NVDA 4HNAA 5PGMA 4EDHA 3M34A 4B3XA 1BEEA 1HDIA 3ABQB 2RH9B 5JQGF 4B0PA 4GXNA 3HY3A 3DLPX 2PHZA 2QTCA 4AJJA 3OM1A 2IPXA 5DLPA 4B3FX 4DIUA 1HDEA 1BXKA 5AOVA 1IB0A 3AVOA 2XUGA 2GK7A 2AXEA 1U8ZA 3RUHA 5BP7A 1BH6A 4LWOA 4PTZA 1F48A 3DYIA 4KR9A 3CWCA 1KEEB 4NSNA 3DAFA 4QGBA 3IFSA 5A6VA 4BNVA 1J23A 2WJZB 3OLCX 1SQ6A 5DGTA 4PZZA 3ODGA 4OO3A 5BSRA 4ZO8A 3STTA 2A4KA 1PEYA 4F3RA 1W1WA 3QLVA 4NPCA 2VP6A 4LA4A 4D8UA 3JAWA 2GYYA 2ZSHA 2QGZA 1ECJA 5CAEB 1EM8B 5CNIA 3A3YA 1RYMA 1T2VA 2Y0CA 1HGXA 3CNNA 3IX7A 3MTDA 4RPCA 3UFBA 4OH7A 4ZN6A 1VP9A 4R9UC 4EGQA 1AQYA 1FMLA 4EA9A 3DBRA 4Z8XA 3KSZO 3ED1A 3X2FA 3R20A 1RSZA 2F9LA 5IDQA 3C1AA 2W7TA 2BEKA 3PNQA 3WLOA 4F1WA 1KJ8A 3PWZA 4MR9B 5TX7A 4G36A 3RSZA 4H35A 2JLVA 2VYFA 4F3YA 4C88A 2Q2NA 1THGA 4HLUC 1H5NA 4BNUA 3IEUA 5C80A 2QZ4A 3GIDA 2GPSA 3RS5A 4Q6WA 2JIDA 3RVNA 2OCLA 3IB6A 4PYMA 4DNFA 4QYXA 3L79A 3AETB 4WZZA 6ADHA 1DZ3A 2A0UA 2WHQA 1E5DA 4HB0A 5KTNA 5HFAA 1E6KA 2V7QA 1T0JB 4I1VA 4JI2B 3FPSA 3MOIA 3TDMA 2BJWA 4IYJA 3TSAA 2V3VA 4OJTA 3ZCTA 3HB9A 3EQZA 3OUZA 4JJ4A 7REQB 2LCIA 4X45A 1ZINA 4QOSA 2R1ZA 2Q29A 3D3EA 5DM70 2RAPA 1F3OA 2YVAA 3AKYA 3QJYA 3OE5A 1AXGA 2QG9A 3EUEA 1CS4C 3MCVA 4NARA 3W5IA 3RHZA 1FFYA 2PSDA 1ABEA 1I3LA 1NN3A 4O8CA 1CCWA 5EE1A 3KEFA 1A96A 2IDMA 3FPGA 1G8GA 3WMWA 3LC2O 1WMDA 4LCEA 2V59A 3QWHA 2GXAA 1RTTA 5K3BA 2XJ4A 1N6OA 1GAQA 4PS0A 5GV8A 3LDAA 4RSRA 5E6SB 5B7NA 1MJGA 5EUCA 3BJMA 4UREA 2BKEA 1IN4A 2BBOA 2NACA 2VSNA 4B44A 3T4UA 4PNPA 1AT1A 2JAWA 4N8DA 3KE9A 3P9YA 4NL4H 3LVQE 3O90A 3D6NB 5BOSA 4BKQA 5KX5A 4W8GA 4AZWA 1NUSA 5C2JB 4R71A 5TPZD 5E2IA 4L5CA 1O03A 1RMQA 1G3RA 1L7MA 1SELA 4EUSA 1GTL1 4CODB 2ZVDA 3VNBA 1PW5A 2P9EA 3I6IA 1LBIA 4DG5A 4YYZA 1TADA 4FHZA 4NV0A 4B4OA 4BMNA 1CUZA 3V1MA 1HMPA 3SE7A 4D2IA 5C31A 5LU9A 1E58A 1DEHA 1E6EA 1FUKA 1G1AA 1ZIXA 3P8ZA 1AKWA 3QW2A 4P86A 4W1RA 5EFZA 3CE6A 4H7JA 4DZTA 1A9PA 1OAAA 5JUWA 4UOQA 3Q8XB 1OHHA 4KMMA 1JHZA 1JG6A 2IEYA 1O94D 3TRDA 1QDEA 2BF4A 1D1QA 1UAYA 3HJCA 4EO7A 1RMTA 1XEWY 1CJMA 5TGZA 4ZJZA 3DV0A 5C53B 2FGKA 3IAXA 2IWHA 3MHPA 3H75A 3DAGA 1RC0A 1QIFA 3MIZA 3HU3A 2DULA 4C89A 1NX9A 4EA8A 2Q6VA 5HIIA 4V3BA 5J47A 3ISTA 5JJ5A 3AHJA 1BDMA 1U8YA 1JEYB 4CBVA 1LPNA 3HC7A 3WLHA 3ZUPA 2PX6A 3NV9A 5A6SB 5BMOA 4GNRA 3OZBA 2CVPA 3PUHA 3H2SA 4NENB 3DC7A 2JLWA 1DWUA 2C4HA 3DB2A 5BSWA 4D0SA 2BE9A 5HQ3B 1N2HA 2CUTA 2CUKA 3USZA 4AX8A 1P4GA 3B53X 5FWNA 4JUFA 4YAEA 1DTWA 4GX5A 2Q62A 4KUEA 4WZBA 3ZHBA 2D0OB 2F6RA 1L7BA 4WBNA 3DM5A 4INJA 2X8LA 5JT1A 3OQNA 1IJEA 4Q9IA 3SZLA 1KKMA 3F3YA 2ZZKA 3VBEA 5AFSA 3MYYA 3ESXA 4RVFA 2H4XA 2ODAA 5IVDA 1C8KA 3VUEA 3Q8LA 2HBYA 1ZI9A 4E0BA 4K40A 3IEKA 1GZVA 3RI3A 3RVQA 1ZA2A 3FTFA 3F97A 8GPBA 3T3PB 1UANA 1BOOA 3N70A 1TT5B 2HIAA 3DS8A 3MWJA 3N8HA 4IKPA 5SYMA 2WJGA 1SHLA 3E9RA 2XKAA 4I0WB 5F51A 2W6JD 3G68A 3KOYA 3PPIA 1QQ7A 4KQWA 3WL7A 1OFGA 3UAXA 3H8JA 4FNMA 2AR7A 1D0IA 3B5JA 2ANCA 3OM0A 4Z2YA 1H69A 2GZRA 1ZW1A 1NU8A 1BMFD 2JVIA 4E22A 2WA1A 3RYIB 1RRMA 3X1DA 1KK3A 5ARCA 1P4RA 3ZS9A 1JXMA 1UK7A 1A7AA 3WGMA 2DHEA 1Y6ZA 3DZKA 1Z15A 3RYFB 4DZZA 4X44A 4YJ2F 4ZI3A 4YJGB 2ABWA 5GJBA 1QIEA 3U3OA 2F48A 4GKVA 1TLLA 1TA9A 1CZLA 2BR3A 1JECA 4GE0A 4QFMA 3TNJA 3IQGX 4P3YA 4QWMA 4YUWA 2JS7A 2XECA 3EQ6A 2EYQA 4MK4A 2VAXA 3C3WA 4JBXA 5K0LA 2RI6A 5DHSA 2JFGA 5LA6B 1N2IA 3B51X 4D79A 4US0R 2IP2A 3EGIA 1JHAA 2WE7A 4UNPA 3SJAA 2ZDHA 1I3MA 1MJGM 2JJMA 4F04A 3UM9A 2PQMA 1A2QA 1UPBA 1Z4IA 4E2XA 5A9SA 4YMUA 1OLSB 1ISHA 2KS6A 3ZU6A 5HM8A 2PWAA 5J4HA 3DOEA 3I2HA 3IMKA 4INPA 1UUFA 5ALKA 3V4LA 3EOAI 4E15A 1YR6A 3CKKA 1Q74A 1CUWA 4KRGA 4V38A 1DJPA 3PFKA 3MT9A 5EVCA 3ZBTA 1T5SA 1PQPA 5JNVA 3PQ6A 1C3VA 2WAYA 2WFMA 3ESDA 2IOFK 2X0EA 4DQDA 1Y7IA 1F4VA 3EFEA 4O63O 4E12A 2QZSA 1E7QA 4JWTA 5AOAA 1PLLA 4J1QA 1GGVA 4LI3X 5K4AA 5FF9A 3PZRA 4OM7A 4LWZA 1VB5A 4P92A 4AFNA 3A9RA 4EFNA 4H1WA 4S1VA 2WSSA 5GY7A 2JIOA 4RLQA 4O3FA 4ER0A 3H16A 1G3MA 3LK6A 1VBFA 1ST3A 2YYYA 1V5GA 2XXJA 4D99A 3ZXIA 3ENQA 4ME6A 4EIWA 2PANA 4J07A 5JS6A 1CT9A 1P81A 2AR9A 2O8NA 2RGYA 4OPMA 1P72A 3Q7EA 4XJSA 4FHDA 1VTKA 4FE3A 4XIFA 2D13A 1T2UA 4HYQA 5H3CA 1LEHA 4A1OA 2EJWA 2VCYA 2Q49A 4F86A 5EJ9A 2V3CC 1E1RD 4M9UA 5KOHB 4Q4AA 3BRSA 2EF1A 3UW3A 1MFPA 3H3FA 4XQ9A 1E20A 2RCYA 2CXOA 3NTXA 4G81A 1AMUA 1CJTC 4PLPA 1UKAA 1B74A 3VZBA 3SAJA 4URZR 1ODJA 5IFLA 4QNRA 2GCEA 4WDQA 5EESA 4B9EA 3GT0A 3Q7RA 4F0JA 5A04A 3IALA 3VHXB 5HBGA 5J5CA 1QIJA 4BFZA 1P75A 4KK3A 1KNXA 4Y98A 1QYRA 5FP0A 3TFWA 4DIBA 5K99A 4ZTZB 4D25A 2DVMA 3HLKA 3ZY5A 1JG2A 4TMFA 2PIDA 3OJEA 1OJ7A 2QE6A 1ZGBA 4RY2A 3VH2A 5KTSA 2WSLA 3DMDA 3U13A 3UAZA 1H2YA 2QTFA 3IILA 2VJMA 5D3QA 4WXRA 5AKIA 5BN5B 4LZWA 3IKTA 3MAAC 2BD0A 2AYXA 2W6OA 4AQ7A 2IITA 1TK3A 1TM1E 3MJEA 3OQBA 3GJQA 4QQKA 4DCMA 3FYCA 1GSIA 1F7VA 2HA7A 3OQMA 3ZDCA 1I01A 4LXHA 1P2FA 1E94E 3MCTA 3QEMB 2XT9A 2YW9A 1T4GA 2GWHA 1KAQA 2AMFA 2FWRA 1SBNE 4AJOA 1W52X 2VATA 3NCHA 1B3RA 2J0QA 2Y1GA 5JYDA 4US2R 3WWYA 2YFKA 5ECYA 2I6SA 2IUSA 1KY3A 1OU0A 3FMFA 3HXTA 3GUVA 4CRWB 2IS4A 3E9NA 1X1BA 2FFQA 1PWYE 1Q92A 4RSHA 2MYUA 2VTVA 1Z45A 2C00A 2PWYA 3IPCA 4TQAA 3DKIA 3PPVA 5E38A 3WYNA 2P30A 3DD5A 1GM5A 2PX0A 4F3TA 1O89A 4AKGA 3JVDA 4I5EA 2B7CA 3CLSD 1NDUA 2B8WA 3C74A 4RHFA 3TD6A 5MN5A 1GNLA 2AIRA 1WABA 3A31A 2C0QA 5JARA 2HWUA 4C0XA 3LUPA 3ZWBA 1FUYB 4EWLA 3R6WA 4FTWA 1EJ2A 1QAOA 3F96A 3N59A 3FMPB 1PS0A 2PZGA 3GLHA 5JJIA 3T1NA 5K6TA 2QUJA 1X7XA 4M9QA 5GINE 1GUAA 1QGUA 4ZREA 3NHLA 2VRCA 2J4CA 1JP7A 1DINA 4E5UA 5KKCA 1MZVA 1GV0A 3AM3A 4H3HB 5BSEA 2AKEA 4IDGA 2RK4A 4EMSA 3MJVA 1IPHA 3EIOA 2Z2IA 3N8GA 4HK4A 4NZNA 4DMMA 3FX2A 4OUDB 5BT8A 1M1YE 6AT1A 3GFFA 1A95A 7MDHA 1KJJA 2DFTA 2IYYA 2KLHA 3OOHA 3OF5A 3TLAA 5EMHA 2NV2B 1EGVB 2X0JA 3GLIA 3SICE 4JLSA 1JHYA 2EHJA 4KO1S 4P22A 2HHAA 2VNAA 5EXDA 4BQNA 2J4FA 4CEHB 5C8XA 2LCFA 1BDJA 1QIHA 3OTWA 2HLNA 1LC0A 3P19A 4NBTA 3OPXA 4YAWA 5F5XA 1XPJA 4WOKA 2CVFA 1FBTA 1P0FA 1IWPB 1WXFA 2J7PD 3N8DA 2HSJA 3QRWA 2I66A 4JITA 5G0TA 5CG2A 3L4BC 3CPJB 3OP4A 1UT8A 2F4VB 3NC4A 1MN6A 1BDIA 4BGVA 4Y6OA 4CL0A 2VRWA 3VTFA 2CZGA 2BW0A 4W9NA 1BCRA 1ANKA 4L5IA 1OWMA 5IUKC 3FUWA 5HR5A 3QHAA 5E6UB 3L7IA 2CVOA 4P1ZA 5DTEA 5HFJA 4G8BA 5HVNA 2ZJ4A 4ZHQA 3WLNA 4ISBA 3SKYA 2OEPA 3O9VA 5HKOA 3S2YA 4BASA 3N2IA 4OATA 1B3BA 2A9RA 2BFWA 4RVSA 4D43A 4I08A 2GEUA 1MZPA 2AFHE 1WSDA 1BX0A 3FWHA 4IP0A 4XQCA 4A03A 4CMEC 4MO2A 4C7BA 4URXR 1OQAA 2FDXA 5DTIA 3R8FA 2PL3A 2D1SA 3O84A 4CEIA 3PHBE 2XB4A 4RMJA 2NZYA 2PNJA 1N92A 3TFQA 2I8LA 1E5QA 3M0EA 5L4NA 1ZD4A 3GPBA 4D97A 4LE2A 1NWCA 1B0PA 3EZLA 3ES9A 4NEGA 1KR5A 4Z3OA 4L3WA 1U2GC 3QK7A 4UTZA 1ODSA 4KLZA 4TV8B 4TLBA 3W34A 5CBPB 1R88A 4UQOA 3K2BA 1A69A 3OO0A 5AUQA 3H19A 3IQDB 3CZ4A 1KA9H 3FF4A 4HPWA 1NZFA 1V11B 4L9RA 2NU7A 4JJEA 4M9ZA 4NOKA 3PK0A 1FFAA 3UANA 3RNLA 3ZGYA 4YMVA 3ROKA 4EG3A 4GRAA 4WOPA 4FOLA 5AVWA 2RGWA 5IASA 3G9XA 2VNSA 4KFSA 3QF4A 3RS8A 1YQEA 4V0SA 1YDWA 1M5TA 2YHIB 1VE9A 3TTVA 3MIIA 3T34A 1JJ7A 3CGWA 1YKGA 2GN0A 4MVJP 4TLLB 4URUR 1NPYA 3LV8A 1SM4A 4BYGA 1WU8A 2VH2A 4Y2SA 3IC5A 2Q5FA 2YQZA 2ZR8A 1I13A 3SJCA 1UK8A 3WZ2A 2RAUA 2ZJAA 3L2OB 3QU2A 5DNEA 1JRLA 2TECE 2IRWA 4HUQB 2BGLA 3QMWA 3OU7A 3TS1A 1XQ9A 1KAHA 2WU1A 4EABA 3SYTA 1FW6A 1KDOA 5BQXA 3M4XA 2P7HA 3U3ZA 1G18A 3OC0A 4UXJA 4BLRA 3IP8A 3MWKA 1F2VA 3KB2A 3NTOA 1VLHA 3CKYA 1EHIA 4JJ6A 2QJWA 4N0MA 1VMDA 2ZIUB 2AE1A 3QSGA 4LNHA 4KWHA 1P4SA 4G85A 4CQMA 3KQSA 4J0QA 2Z1MA 2ZIZA 4DC1A 9MHTA 3C5VA 1CQIA 4IQ0A 3VYSB 1K9SA 1Q84A 4D8VA 2FR8C 4EY8A 4GOJA 5LP6A 2ZXFA 4X1YA 4YI3A 4KP7A 1V1JA 1OWLA 4PQGA 2AT1A 4YPVA 1UF9A 4QEKA 2Y4NA 3BWDD 4BCCA 4GDFA 3ILXA 1XHFA 1CUEA 1YJCA 2VQFB 4QYTA 2JFFA 3RVOA 1H9BA 2K87A 4LSZA 3RAPR 4QBHA 4KTTE 1F38A 4CG0A 1UEXC 2HCTA 4UAGA 5FORA 3HCPA 7ADHA 4Q01A 3TYXA 1AVTA 3L8DA 3UIEA 3A1CA 5LR6A 1XDWA 3R76A 3NZEA 1C80A 2VOEA 3OQ6A 2BFCA 3SC3A 5AXAA 5JBNA 2PUEA 2JLUA 4GE3A 1E5LA 3VU3A 5AW4A 1GZHB 2E37A 1M6WA 2GA8A 2YV4A 2OQVA 5JEDA 2PMCA 2HO5A 4HZUA 5KNBD 4JP1A 1DRVA 1FP1D 3V4VB 1D1SA 5FNVA 4BEBA 2NZJA 3KYIB 2ZCUA 2CLIB 4LNUA 4C0WA 2EFDB 3PFHA 2B5WA 5I7WA 5HKLA 1H1TA 1NP3A 1VKJA 1Z9BA 2ZIXA 3MGBA 5C3UA 3NHJA 3QV2A 2V6MA 3U44A 1T1RA 5M29A 5G4KA 3F6BX 2B30A 1U6KA 4GU5A 3C6KA 4PXYA 2QMZA 4PLCA 2PWPA 3ZGOA 4A10A 1NPDA 5CUQA 1KOGA 2ZYGA 3GJ5A 4UEOA 4HADA 5BPFA 1I2ZA 4Z4QA 2XZDA 5F5NA 2YN0A 4JLNA 1ZIYA 1G2IA 3IO3A 3MLBA 2ZT5A 4TLDA 4MRVA 3RWBA 1DIHA 3FBTA 3OZVA 3WYCA 1C9KA 1FYDA 2GZSA 3A6HA 3PUKA 2JAPA 4H9JA 4PR3A 5K9ZA 1SC1A 3SFTA 1ZM2A 2PSEA 3RSHA 4Y6GB 3CLKA 2I6UA 3VR2A 1TT7A 2EERA 3C6ZA 4UARA 1RS0A 2OL4A 3DLIA 3GXBA 1Y9JA 3MS7A 4WNIA 4CCSA 3NXKA 3KUCA 1UJMA 2ONJA 4JB8A 4FDMA 5IHXA 1O95A 1CJSA 2YXEA 3AEUA 3GPIA 1NNUA 4G0NA 4WNYA 5AM5A 2NU8B 4ZU1X 4F1JA 2GO1A 4KR0A 4MHSA 4BNDA 1K6EA 1E6MA 4XWTA 4U3JB 2QM0A 3FSEA 5A4JA 2ZGVA 2G83A 2OPBA 3D7MA 3G2HA 1FYVA 3HVJA 4KOEC 1PR4A 3NASA 4IEIA 2OBXA 5E8RA 4GOOD 3TF5A 2WBLC 3IL2A 1OH6A 1A9QA 4KZKA 4LHZA 3C16C 1CQPA 1QG0A 3OPVA 4I6JA 3ZWAA 1WP9A 3RU2A 4RZQA 3UMYA 3O47A 1AG9A 4UBJA 3KQWA 1L3IA 3RSFA 4D41A 2E3JA 3UY4A 1XLWA 4B6OA 2C03A 3E9QA 1QOZA 4E03A 2JLAA 1LS1A 2OKGA 4OB8A 3V8VA 3AHHA 4PLVA 1MGPA 2Z30A 3P9IA 4NECA 5JCOA 1XUOA 4UU1A 1E1CB 2WTXA 4MX8A 4B1FA 1C0IA 1DUIA 1YRLA 2ZR0A 1HQDA 1BCSB 4HNAB 3U5TA 1XSEA 2YJTD 2FEOA 4EY7A 1TVMA 1V37A 4TL8A 4M21A 3V2IA 1QF9A 2ZUEA 1NVVR 4Q02A 1F8YA 1VIDA 2P5TB 2WKRA 3K1AA 3KDSE 4N3AA 2B37A 4K9DA 1NIPA 5FYQA 4B6GA 5FUBA 4Q4DA 4EAAA 2ILTA 2ZAGA 4CDNA 4EHAA 1JU9A 2QRJA 2J0UA 4FZ5A 1WVIA 1NUPA 2WABA 3IT3A 2PZLA 4G0OA 2DSNA 3QVKA 4GPTA 2F3QA 1JDVA 3K0CA 3MB5A 3R7BA 2BISA 4YDQA 2J5KA 3ZCRA 5IZCC 2J3JA 1E1LA 4IAOA 4YP9A 5AJZA 2H4HA 2X15A 4PSUA 4X3CA 3JSXA 4GH5A 1PJRA 4BKUA 3MRSA 4RJ2A 4YRAA 1E2QA 1EAMA 5TS3A 4HAOA 1W85A 4PYKA 1LI4A 1MHPA 1ADGA 1GQYA 5SY4A 5F7OA 4AP9A 2PRSA 3C0KA 2KI5A 2B3DA 2BFFA 2ONKA 3UGKA 1UDRA 2HWYA 3DBRB 3IP9A 2WYHA 4MOWA 2QRPA 5KU1A 3ZWNA 3ZCSA 1XVUA 4YAFA 4HB3A 1S8FA 3JRWA 2IE8A 3HCBA 1GVNB 4DPLA 2UUCB 3CUTA 4YRRA 3WC4A 3T7SA 3VKGA 2A78A 4F11A 4IOJA 2QM3A 3OAAA 4XARA 2W6IA 4J43A 1FTQA 3UK1A 2AEEA 3QIAA 4HNUA 1S4QA 3W1VA 1PUXA 1R6XA 1E4VA 2H18A 4Q15A 5JRJA 2WF6A 1S3GA 2RCNA 3I45A 4K05A 1RPNA 4M53A 3ZW9A 1JHUA 3B1VA 2C9OA 2OILA 1BA3A 5ALSA 4Y6RA 3W4KA 1L4BA 1M2EA 2I4TA 4KQ9A 1MP0A 3N1UA 4Q48A 3RRFA 3VAZA 3C4VA 1TYAE 3MCWA 2HU7A 1XEXA 3ZHQA 5FBLB 1HTTA 1O87A 2GK3A 3RGWS 1NVDA 1WG8A 4R0NA 1Y7PA 5FOQA 2OOSA 3V1TC 4L7VA 4LJLA 2FAXA 5DRTA 2XI4A 4YCNA 1ZD5A 2WNHA 3WLJA 4OUKX 3V8BA 2OC4A 2QWXA 5FV7A 2Z6UA 2R8ZA 1W93A 5CT4A 3IGFA 4WZBE 3WRXA 1N7JA 2P3SA 1MV5A 3VPSA 4MPRA 3GLGA 3ICQB 1Q22A 2ZB7A 1L1EA 4M8NE 1MA3A 2C07A 3CY6A 4MPDA 2MSWA 2VK2A 4W6ZA 3AFGA 3LC0A 3AR3A 1LBHA 2AOVA 4JBNA 5FAKA 3FOFC 3Q9LA 1SEPA 1UDAA 4X93A 1WZ2A 3Q3JB 4KPEC 1RBMA 3FFWA 2BFDA 3ZX5A 5BSHA 5BOSB 2XCSB 3HL0A 1DIRA 5KX5B 1W7AA 3HKBB 1Z8DA 4IIHA 5CHYA 4KQ6A 4HCJA 4RF5A 4O33A 2VDVE 2LDBA 2AR0A 3F8TA 4MKRA 3H2GA 1QP0A 3CYFA 1WCV1 1M6YA 4XQGA 2E5LB 2YS7A 4OQFA 3SHQA 1KPGA 2ZSBA 1UL1X 4RACA 1DG9A 4UM9D 3RFCA 2BP7A 3ILHA 2NZWA 3ADBA 3H86A 3I6YA 1NJ6A 4TMZA 3LXXA 4GT1A 2C84A 3BMXA 3QNWA 2A86A 4EELA 7AT1A 1EUZA 3PNPA 2FLWA 4BVGA 1QVZA 2DTXA 4Q66C 1KEKA 2XMCA 5GV7A 2C7VA 2GFHA 4GI5A 1ZCZA 2HJGA 3KAQA 1U2EA 1WDMA 2CDCA 4ZI2A 4ESEA 3DV0B 2BRUC 2QK4A 4I3HA 1JKFA 2Q1TA 2VJPA 3ZU2A 4JSRA 4TWIA 2ZITA 2X8BA 5JLJA 2ZZMA 2IUTA 3SHFA 3ASZA 3CBQA 3U4AA 1T1JA 3ZHYA 3NM5A 3FRJA 4ACAA 3O8DA 3GROA 2ICAA 3N3BC 1R0LA 4DV7B 3E23A 4LJYA 2R25B 1NMQA 1JQEA 2B69A 2GJ4A 2JNWA 4BXOA 5GVRA 2V7PA 5KQMA 1YNSA 3JD0A 3UZUA 3X1MA 1C1DA 4ZOLF 3ZI4A 3QBVA 3QPUA 3AVYA 1R6UA 2OFPA 1TJPB 3A3KA 5D6OA 3PNBA 2V7GA 3T5MA 4WZBB 4DAEA 4O4JF 1IK4A 5AESA 2QTRA 4C1NA 2XZTA 1ZHFA 3GDGA 1EFUA 2X5XA 3HA3A 4H0CA 4V1CA 4C3OB 4D96A 2QPOA 4DLPA 3B2NA 4CV0A 3UJDA 8ADHA 1S2OA 1GL6A 2EZTA 3O4IA 5BSFA 1VSUA 1Y5MA 4IFIA 3K72B 2D4AA 3GA7A 2JD1A 2F00A 3WLAA 1JXAA 2RONA 2YINC 1VHLA 3ZCPA 3MMPA 2IH4A 1ZXXA 1KZHA 1VP3A 4LBWA 5A9RA 2DY0A 3IDFA 4OQZA 5A3SA 5T41A 2AA3A 4GSYA 4A23A 2XGJA 16PKA 4FINA 1RABA 4F5EA 3H0CA 1NY5A 3R0ZA 2G36A 4HDSB 1T8SA 1YL6A 3QWFA 5B58C 1KYXA 5HCUA 2BJHA 4L9AA 3TQIA 2F3SA 1XCGB 2YYZA 3VMMA 5CA0B 2XUKA 1YDHA 2ARKA 2OXTA 3KPVA 3DNMA 4P7BA 5FBZA 5FFNA 3RJ9A 1C1HA 5ALZA 1UPFA 5FUYA 3OO1A 1SVKA 5JG7A 5IH3A 2D7DA 2NUAB 3C3KA 2NVWA 1E77A 1Y4ZA 2IUEA 4FYXA 4TTQA 5B57C 3L5OA 3RFFA 1N9KA 2RGXA 4MGZR 4OLBA 1H3FA 7GPBA 4GIBA 2QPLA 2VC2B 5G41A 2FP4A 1TI7A 2PGNA 3FYDA 1I3KA 4HV4A 2W98A 1IG3A 1V5EA 3R3JA 1H0KA 5FADA 3KSDO 3M4ZA 2O19A 2YUTA 3KWLA 3M8KA 4B81A 4D6YA 1TJNA 4QGSA 1BS2A 1PV2A 2Y92A 4U2BA 4RIFA 4TMKA 4YPFA 2FSVC 1X8KA 1RI3A 3QU7A 4DV2B 3NYIA 1KWKA 2EKDA 3SZGA 4EG6A 1KMNA 1UADA 3D7LA 5EIFA 5JE8A 5C8DA 4MHOA 1JIXA 1XCMA 3H9QA 4Q3EA 4QQFA 4U7HA 3RVLA 5LL6P 1HLPA 4G9BA 4GMXA 3KQHA 4R1LA 1DEXA 2J5QA 2WNSA 1Z35A 2HK7A 1DAHA 1Q14A 1SPXA 5IM5A 5HOEA 2XF8A 4DV4B 4YRBA 2UXDB 1C9MA 2N75A 4EMTA 2EU8A 3LQFA 1N0WA 1FNSA 3M6AA 1X8XA 4E5KA 4CXMA 2VP4A 4JJFA 3KZVA 3MILA 1NF2A 1V41E 4PYJA 2CNKA 3UJAA 4MI1A 1SBIA 3AOEC 3LKDA 3HP4A 4FS3A 3NORA 1ZOPA 4IJQA 2XCQA 2AQIA 1XQXA 1DOAA 2H0AA 3JYPA 1ESEA 2FQYA 1GT6A 2OB1A 4J0KA 4L1KA 3SJZA 4R16A 3VR6H 4UTNA 1VL2A 5DNVA 1KOLA 1YFJA 1CUAA 1OLXB 3B2EA 3M49A 4R05A 3SU8A 3T5GA 5F5LA 4ENQA 4Q4CA 4FDUA 5LQJA 1QORA 3GRAA 3EMDA 3VPCA 2NZ8A 3BWXA 2UKDA 4B84A 3KQNA 1BE0A 3CIFA 2R60A 4HDKA 3GH3A 3Q6MA 4WK0B 5DWQA 5JRZA 4ENRA 5JTTA 4HXYA 2XUPA 1WU7A 2XGOA 2LVBA 1ISRA 1E2BA 3R09A 3I1FA 5CGQB 4PZ0A 1EVKA 3DF9A 3GY0A 4PC3A 1JHQA 3ZDYB 4I3GA 5ICFA 4Y9DA 1XHEA 4HGNA 2C9MA 1D2HA 3B8EA 3BD7A 3HXLA 4P4UA 5FO1A 4BBZA 2IX9A 2WHRA 3DOIA 4N3GA 1D7OA 2V7BA 3RV3A 5ERXA 3VJKA 4C0KA 1I7DA 5FI0B 2FSUA 2IZZA 3ZWMA 2CFTA 4DQLA 1F3LA 1PJ8A 1Q2UA 1ENZA 1YMUA 4JJIA 1C9EA 3KKMA 3SPXA 4C2TA 1N57A 9LDBA 2VJMB 2H9AA 2QLNA 2IUYA 2XB6A 2VXYA 1PKXA 3IDSA 1AQLA 3EGEA 4G9GA 4R1PA 3E6AA 1U02A 3TINA 1L7EA 1ZL2A 5CLFA 4MVJI 5AVZA 4OFBA 1PQUA 2JAUA 2ZW9A 4G1CA 4M8LA 4B45A 4B2PA 4IVPA 5KTKA 1NW8A 2DUMA 4DIMA 4AS2A 1A50B 3VDRA 1HLDA 1CY7A 2ZCVA 1KR2A 4LBVA 2EDAA 3K94A 4J0GA 2O0HA 5EG5A 5CNJA 3N86A 4HFNA 4CVNA 1CUCA 1XK6A 3IQXA 3QUBA 3CW8X 4OQPA 1N34B 3RRJA 3I5AA 1CUJA 4WVFA 3NEAA 2VNKA 4NOJA 1E2FA 2E9SA 2P2GA 4ZAVA 3A3NA 3G0OA 5LMCA 1JVSA 1APBA 1UXIA 1OMOA 2PFGA 4LE1A 2PL1A 4L8YA 1P0PA 4P98A 5KYXB 2YFQA 4MLZA 5C7OO 1JX6A 2PFSA 1PVVA 4PAOA 5AJVB 5HFNA 3TQTA 4I55B 3IPYA 1WPQA 2VT7A 4G26A 5L7YA 4Z3KA 1V4BA 1KHTA 3WLRA 2GAFA 3ZOKA 1NJFA 1HFEL 3C6QA 4JBLA 1HQKA 3PUXA 3SZOA 2AOTA 1YULA 4AWBA 3EZXA 2HQSA 4FUQA 5T3UA 1KY2A 3GLHB 4JC0A 2VHCA 5CVJA 3RS2A 3ETGA 3OEHA 4R51A 1X7XB 4GPAA 3KU1A 4LEIA 4DBLE 4ER6A 1QGUB 4WNAA 2ISQA 4K03A 1A1VA 3I2IA 4OHZA 1Z7YA 4W5RA 1DO2A 2CLKB 3DSRA 4ZQGA 2MMGA 2P2LA 2GAAA 2A35A 3PQEA 3INYA 1I6WA 3AEKA 4RVUA 4BP8A 4IDHA 1CZHA 2GPYA 4K9PA 1BD4A 1WLYA 4BTEA 3V4SA 2GPJA 1ZGGA 4CTKA 4D80A 1W5EA 3H4TA 1T9GS 5H81A 3ITKA 4W5OA 2FB9A 3A14A 1HQYE 2O2SA 4DQUA 4XQ0A 1YOVA 3AZQA 4HATA 3HJAA 5J2TF 4AWXA 3CB2A 3K0FA 4ESVA 3W4IA 1E2DA 3CHYA 2IYEA 3IUQA 3FZGA 4E08A 1OYWA 4JNKA 4R98A 4DCPA 4HQLA 4M1ZA 4S3MA 4NFYA 4OKSA 3M6MD 2WE8A 1WR8A 2O14A 3GJTA 3ZXYA 1BCRB 1VIMA 1U6JA 2FN3A 3RRYA 1U04A 5JXHA 4OQEA 3ND5A 1DOHA 1IRIA 2QX6A 5ALGA 1EDZA 3AG5A 2BSQA 3A32A 1G291 2OA0A 4CKYA 4ZHQB 3ACCA 2IEBA 2YUIA 3VHRA 1NRJB 3B9QA 3UKOA 4NBLA 1OI7A 2O4CA 3VQTA 4CF4A 5UKDA 3TPCA 1JZQA 3U61B 1R0YA 3OZWA 4HDMA 4ZVVA 2N3ZA 2H2DA 3RSOA 3SS9X 1KIFA 4O1MA 4CMHA 4XCQA 1ACMA 2MSLA 3LO8A 4CEIB 2P79A 4HH4A 2QGFA 3ITNA 5GPBA 2JARA 1MMFB 3IP5A 2B82A 2PJDA 3KTOA 4GM0A 4O2AA 1ZNWA 4C21A 1XJ5A 5LYYA 3NM4A 4B5LA 5ALTA 1FQKA 1JWAB 2J5XA 4I5FA 4JGGA 4ZYLA 4Y2QA 2Z83A 3BGIA 3EIWA 4QDJA 1G21A 3G0BA 3M33A 4CUKA 4R8VA 2FNAA 1TFRA 1P2BA 4ZRMA 1AH2A 2VPXA 3KWJA 1ZN9A 2NU7B 3NP9A 1AXRA 1TU0A 4RH3A 4ZFNA 4ZZ0A 3HCEA 4M4SA 3F6CA 3J80A 2G9UA 3O1HB 5ELMA 2XDYA 3NWOA 4O4HA 4RZIA 4X84A 3OUTA 5ED4A 5BO5A 3HNOA 4RPHA 2QM8A 1NNEA 2LR0A 4BMYA 4K0KB 3QF4B 1RXVA 1KFCB 4YJ3F 3WMFA 1YAHA 4TSKA 3JYNA 2SCUA 1BTOA 3TOXA 3QU5A 1ZU5A 1IBRA 4AKIA 2BEVA 5EWJA 3RC9A 2NSLA 4PIVA 5EWLA 1Y1LA 4B71A 3VVMA 1URPA 2V9ZA 3L7OA 5AWFC 1E6UA 1NDHA 2TMDA 1R4ZA 3K70B 1GLGA 1GUFA 1Z88A 3PIIA 1UJ4A 3SQOA 1AUVA 4RVOA 3U0BA 4EMBA 2NPOA 2DR2A 1QO7A 5AKLA 2ZBRA 4B3SB 3EC7A 1D6SA 3H83A 1I7NA 2VBFA 4FR0A 4KGZA 4N5MA 4O0LA 4ZT4A 1TD9A 3GLVA 4ZCLA 2Y0BA 5D87A 3WMEA 4ANFA 4BDSA 2JI8A 2IBMA 1XMOB 1J9EA