2O06A

Human spermidine synthase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
297
structure length
297
Chain Sequence
DGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of spermidine synthases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Spermidine synthase
total genus 97
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 2o06A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2o06A02
2PXXA 3B89A 5LSAA 3ANXA 3HP7A 4R8RA 1DL5A 2FYTA 4C05A 4GC9A 1UIRA 1D2GA 5T64A 1NW5A 4C08A 3M33A 5CCXA 2PWYA 5DX1A 1TW3A 2NXEA 4X41A 3B3FA 2CMGA 4RWZA 4QDKA 2GLUA 4QVGA 4FP9A 2OYRA 2R6ZA 1IM8A 2ZULA 1JTEA 2PX2A 5HIIA 2OXTA 2N47A 3EEOA 3MB5A 2AS0A 3OZRA 3GCZA 3JWGA 3UFBA 2AOTA 5ICFA 2P3QA 4RVGA 4RYLA 4CKCA 4X63A 5K8VA 2AVNA 3FPHA 5DTQA 1I9GA 5DXJA 1WXXA 3HNRA 4RTPA 3I64A 1G38A 1KHHA 4FT4A 1UWVA 1X1CA 2XYQA 3EGEA 3LPMA 3NDJA 4PYLA 2VDUE 4C03A 5CVJA 1L3IA 3GRZA 4QTUB 3THRA 2JHPA 4B17A 2JH8A 4KIGA 1YZHA 3TM5A 1FPQA 4V0QA 3BKXA 5HIJA 2XBMA 4M7RA 3QV2A 5DT2A 3LGAA 1ZG3A 3TMAA 2CMHA 1AQJA 3LSTA 3FUTA 3X0DA 3ERCA 2XYVA 3KQTA 2JHAA 4YMHA 2PKWA 2ZFUA 1NW3A 1VQ1A 5DPMA 1YF3A 4PCAA 3M6VA 5E1MA 3CJTA 2ZIFA 4A6EA 3PTAA 3CGGA 3IYLW 3MQ2A 4AZVA 5K0CA 3GXOA 3HCDA 1L1EA 3Q7EA 3UJCA 1NE2A 2AOVA 5ICGA 3DMHA 1XDZA 2H00A 2PX5A 4ER6A 4H0NA 3TRKA 1X1DA 4EQZA 3MAGA 3EGIA 3OU2A 4R8SA 4FGZA 3NTVA 4RTRA 4RTLA 2Z6AA 3RW9A 3KQSA 5DM1A 4C4AA 4PWYA 3HVJA 5DWQA 4BLVA 4A6DA 3LDFA 2YUIA 4HH4A 2FPOA 5KVAA 2NP6A 1VBFA 2JJQA 3CC8A 3K0BA 1QANA 5FWAA 1JQDA 1SG9A 5CIYA 3KHKA 4OX9Y 2ONZA 3GGDA 4AZWA 4HG2A 1YB2A 1DCTA 4WVLA 3B3GA 3OCJA 4OBWA 3TOSA 3DUWA 5GIOE 1G6Q1 2OZVA 3DMGA 5C0OE 3LKZA 2AVDA 2VDVE 4U7TB 1HNNA 4PGGA 2H1RA 5DRYA 3FRHA 3FTDA 5FQOA 4ER7A 4ER0A 3V8VA 2BM9A 5K0BA 5K0FA 2XVMA 3BGIA 2HV9A 4POOA 2G72A 5IKMA 1R74A 1F3LA 5K01A 1VPTA 3E23A 3KQOA 4V0RA 4WXHA 2EG5A 2ZIGA 5LQUA 3FPGA 4QQNA 2YXLA 1NBHA 3R6TA 5K0NA 2NYUA 3KPWA 3CBGA 4LG1A 1XCLA 4FSDA 2B9EA 4OQDA 5KQRA 3DXYA 4RVFA 2IDKA 5FUBA 1PRYA 2CL5A 3GU3A 3MERA 3M6XA 3PFGA 5F2OA 4NECA 3BZBA 1JSZA 5BW4A 5EIFA 5K03A 1QAQA 1O54A 1BHJA 3B7PA 1RJDA 1VIDA 3HCAA 5E2AA 2C7OA 1QAOA 1ZHFA 3EEYA 3FTFA 3KQPA 3E8SA 3JWIA 3TKAA 3UJ8A 2VP3A 4IWNA 4PYQA 3UJ9A 2CWWA 3EVDA 1NKVA 1YFJA 2ZZNA 1MJFA 1R8XA 4YUWA 3HVIA 4GBED 5BW5A 3BT7A 2IDJA 4DZRA 2ZZMA 2UYOA 2UZ4A 2UYCA 3G8AA 2G71A 1XDUA 2GS9A 4OA8A 3G89A 3V97A 1KPIA 1JQ3A 3C6KA 2AZTA 5DM2A 3OE5A 2H11A 5EIWA 4GOMD 2ZWVA 5HEKA 5EMMA 1RI4A 2BM8A 2CKDA 1NV8A 3C3YA 1ZGAA 2DULA 1L3CA 4M38A 10MHA 3BWBA 2IGTA 1NT2A 3HCBA 4BP1A 4E2YA 3NMUF 3ELUA 3LX6A 2HTEA 4DKJA 3P9CA 2AOTB 5E8JA 4XCXA 5E9QA 3T7TA 2AN3A 2OPBA 5D1NA 3UJAA 3P71T 1O9GA 4ER5A 1G60A 1NV9A 5BP7A 5CVDA 2HR1A 1AV6A 1G55A 3E7PA 4RTJA 1EIZA 1SVUA 3BGVA 3G5LA 4KDRA 4GUAA 1RI2A 2BR4A 2YQZA 4P58A 3UBTA 5T67A 2PLWA 1QZZA 4XUCA 3PT9A 3TKYA 3KR9A 7MHTA 2PSSA 3TLJA 1KPHA 4MTLA 5FA8A 3GWZA 1VP3A 2P7HA 3HCCA 3G2MA 4PONA 4RVDA 5EEGA 3OPNA 1VLMA 4XUDA 2B25A 5K09A 4YV1A 4E2XA 3KR2A 2BR3A 4F84A 3P2EA 2LD4A 5LQKA 3O4FA 3KKZA 2EJUA 4KDCA 3HVHA 3KQWA 5CVEA 1JTFA 2XYRA 4YMGA 1SUIA 1P1CA 4QTTB 5FHQA 4ZTBA 4M36A 4AZSA 2ZW9A 5CUQA 1RI1A 1V39A 2GB4A 2BH2A 1KXZA 3IV6A 4QPPA 5K0GA 3I5UA 2XVAA 5GIPE 1KIAA 3KQMA 3KPVA 4HGZA 3KQVA 1I1NA 2YTZA 2G8NA 3UJ7A 2ERCA 4PYNA 3MCTA 3GNLA 1YUBA 3SMQA 2Y1WA 1MHTA 4DCMA 3BWCA 2I62A 3KPYA 3GO4A 5CCBA 2PT9A 4P7FA 1WY7A 3DULA 3ORHA 1G8AA 2PXCA 3PFHA 4PYMA 1FP2A 1ZKDA 4RVHA 4LWPA 3T7SA 5LQNA 4RTKA 3DH0A 3B3JA 4X1OA 1X19A 4R6XA 1U2ZA 3EPPA 4MWZA 3GIWA 4HSGA 3FUXA 4GOLD 3G2OA 5GOZA 1UFKA 3BXOA 4OQEA 2O0LA 3AY0A 3GRYA 3LHDA 4RTMA 3THSA 5E9JA 3ER9A 2OO3A 3FTEA 2ZZKA 3FYCA 2GA9A 2VZ9A 5DM0A 2HNKA 1XXLA 4C07A 4L7VA 5FCDA 4BLWA 2PJDA 3TM4A 1INLA 1KYWA 2P35A 4R05A 1BKYA 2I6GA 1ORIA 3DXXA 5DSTA 5JUWA 4U7PB 3A27A 4C06A 5LQAA 3CVOA 1SQFA 3AJDA 2ZLBA 4DA4A 5H02A 2IH5A 2OBFA 3ID6C 1VP9A 1FBNA 3O7WA 2OKCA 4GEKA 5MHTA 2OY0A 4YV0A 3KPJA 1WZNA 4HGYA 5DLYA 2YX1A 3A4TA 1XJ5A 2AN4A 3GJYA 3GRUA 4FR0A 5E9WA 4AUKA 3HVKA 2P41A 3DLIA 4K6MA 3LBFA 3FUWA 5EC8A 3I58A 5EHIA 2JH9A 3FTCA 1JSXA 3G7UA 3P9IA 1ZGJA 1R6AA 2JHCA 3IHTA 4PIPA 2VS1A 4Z2YA 2QRVB 2NXJA 1L9KA 3BUSA 2C7PA 2R3SA 4CXMA 1ZQ9A 2O07A 5HIMA 2NNWB 2FRXA 5E8RA 4C04A 2KW5A 5FHRA 4X60A 4QDJA 2V74B 4EVIA 3FPFA 5GP1A 4GOOD 4IV0A 1Y8CA 4Y30A 2WA1A 3R24A 4RV9A 5GINE 4E30A 3ME5A 1JG3A 2P7IA 4CTKA 1G8SA 4KVZA 3A7EA 2BR5A 1WXWA 5LQRA 3MHTA 3G88A 3REOA 4XUEA 4YUVA 4PYKA 3M6UA 3NW9A 2O57A 2YXDA 3F4KA 3LDUA 3R0QA 5EMKA 5E1BA 1KPGA 2YXEA 3UA3A 3HA3A 5FWDA 2FHPA 5KS2A 4LECA 2IH2A 2Y1XA 2IPXA 4QVKA 3D2LA 1I4WA 2JG3A 1NBIA 3I9FA 5EVJA 1XTPA 3S68A 1XDSA 1XVAA 1D2HA 2ZVJA 3K6RA 3MTIA 5DRTA 4BP3A 1QAMA 1RJGA 4RTOA 1M6EX 3Q87B 4RTSA 1DUSA 4YUZA 1JQEA 5EZSA 3VSEA 2ZWAA 4PYJA 3HTXA 3DXZA 4RX1A 2EJTA 2IP2A 5LQCA 3DLCA 3G2QA 5BXYA 3BWMA 3G2PA 4IV8A 5M5BA 3OZTA 5DTRA 3SX0A 5E2BA 4E31A 2QRVA 3OFJA 4OBXA 1Q0TA 2ZIEA 3P2IA 4GC5A 2P8JA 2ZCJA 3PS9A 1KYZA 4FZVA 4YV2A 4FS8A 4CTJA 4E32A 2C7QA 2IBSA 1RJFA 5DTMA 5HILA 5KYGA 4MHTA 4RSRA 2BZGA 1EJ0A 3M70A 2ONYA 3UA4A 4E2WA 2GAFA 3FUVA 3SM3A 3HEMA 1NW7A 5HZMA 3T0IA 2FK7A 5K0JA 3LDGA 2EX4A 3PB3A 3FYDA 3ELYA 4IKPA 5DX8A 3TQSA 3LCVB 3LCUA 1JR4A 3EVEA 3OZSA 3FPEA 4JXJA 3TPZA 5HIKA 3HA5A 2ESRA 5DX0A 5FA5A 3VYWA 3LECA 5HOQA 3O31A 5DM4A 3MGGA 2PX8A 3G8BA 4KRGA 2FK8A 2IBTA 2F8LA 3FRIA 1IY9A 1SUSA 2HMYB 3UWPA 2AOXA 4E70A 5CD1A 1EG2A 4KW7A 1WG8A 3ELDA 2ZBRA 3SR4A 5CVVA 3CJQA 3NWEA 1RI3A 5C9ZA 5KQSA 1KR5A 1AF7A 1R00A 2IIPA 1O9HA 3DP7A 5EQJB 1JG2A 4LWOA 3P9NA 4E2ZA 1TPYA 3MCZA 3NDIA 4GQBA 1FJXA 2AOUA 2YVLA 5ICEA 3KR0A 4QPNA 3AWIA 3OE4A 2PGXA 1VL5A 2P40A 3NVMB 5FQNA 3KPUA 4CWAA 3DTNA 2GPYA 3HCEA 4M37A 4QQKA 1YFLA 3FUUA 1EJ6A 2PT6A 3ELWA 1D2CA 3EVZA 3KR1A 3C3PA 3HA7A 1M6YA 3HCFA 1T43A 1Q0SA 5IH3A 2ORED 2Q41A 5GM1A 3SXJA 5EHGA 5GWXA 1TW2A 8MHTA 4FSXA 2WA2A 3SGLA 3R3HA 1R8YA 2P3OA 4CKBA 3UJ6A 4PINA 3WSTA 4RTNA 2AN5A 2ADMA 3P9KA 5EG5A 5F2KA 2PY6A 2V7EA 3VC2A 5K0LA 1RJEA 2G1PA 1QYRA 5EEHA 3OU6A 4PIMA 2I7CA 2B3TA 2PVCA 2UYQA 4MIKA 2NXNA 5EMLA 1YZ3A 2Z6QA 3EVFA 5F2NA 1P91A 2B78A 1NW8A 3BKWA 3U81A 1NW6A 4PNEA 5EPEA 4BY9E 1FP1D 1H1DA 3DMFA 3DOUA 3PVCA 4ISCA 5GM2A 3NWBA 2WK1A 1ORHA 3P97A 4PGHA 1EQAA 2AOWA 2PV0A 3FZGA 3UZUA 1JG4A 1L3BA 1OR8A 3A7DA 5G02A 1AQIA 1N7IA 1VE3A 3EVAA 4DM3A 3IEIA 5HFJA 4BLUA 5K05A 3RODA 4YUXA 3KQYA 3MTEA 4P7KA 1B42A 2PWPA 1X1AA 5JR3A 3EGVA 3M4XA 2ZBQA 5FULA 3KQQA 1M0EA 3SSNA 3BGDA 2OB1A 3SSMA 3PX2A 4RTQA 5EKUA 3CJRA 3UJBA 5FTWA 4EK9A 5EOVA 2NXCA 3QOXA 4Y2HA 2QE6A 5B1SA 4ER3A 1P1BA 2PXAA 2AR0A 1SKMA 3DR5A 2Z6UA 4X61A 4PYIA 3NJRA 3GRVA 2DPMA 3P2KA 4G56A 4CKEA 1N7JA 5K0EA 3PX3A 2ZSUA 5ERGB 3AXTA 2YR0A 1RI5A 3EMBA 2FCAA 3EVBA 4GOND 4FT2A 3C6MA 3SSOA 2P3LA 5CVUA 3A25A 4MQ4A 5FADA 1WS6A 2P1DA 4F86A 3JWHA 5U4XA 3LL7A 2I9KA 2E5WA 3EMDA 5DSXA 5EMJA 3VC1A 4E33A 2UYHA 5DXAA 3CCFA 2IFTA 2HWKA 4HC4A 4O29A 2PBFA 5EKXA 3A26A 5ICCA 4P7GA 4F85A 2VDWA 1N2XA 1EAMA 3EVCA 4OA5A 2EFJA 3L8DA 5P8WA 2GH1A 1P39A 2C7RA 2ZBPA 2NP7A 3HM2A 4HTFB 4AX8A 4EMSA 5LR6A 4PCLA 4HRAA 4DF3A 3TFWA 3H2BA 3QOWA 2ZTHA 1IXKA 3ER8A 3UJDA 1BC5A 3T7RA 2O06A 2AOUB 5EZQA 5EGSA 3BWYA 2K4MA 3RIEA 2B2CA 2O05A 2A14A 3C0KA 3LBYA 4HTFA 4KIFA 4KWCA 5C1IA 9MHTA 3E05A 1HMYA 2PX4A 5T6BA 4UOEA 3AXSA 3GDHA 1SQGA 3GRRA 3CKKA 3M6WA 4DCGA 3KU1A 1PJZA 1R18A 2OB2A 3G5TA 5LQJA 3EVGA 1KP9A 4ATNA 5E1DA 3OFKA 5D1HA 3OU7A 3P8ZA 3TR6A 2G70A 1JG1A 4EKIA 3R9XB 3FPJA 5CM2Z 1Z3CA 2QYOA 3SVZA 2IH4A 3NVKI 4YUYA 2QY6A 4AZTA 4GF5A 5E1OA 4EKGA 1F38A 3I53A 4PYOA 1BOOA 4R6WA 4DMGA 4P7JA 1XCJA 3JWJA 3B5IA 3LKDA 3LCCA 2QM3A 3PLAE 4DQ0A 1X1BA
chains in the Genus database with same CATH superfamily
1E3JA 3DKRA 1TT7A 2EBUA 4HLUC 3RHTA 3BK2A 3HGQA 3SXUA 1Z74A 3ZGOA 1XYVA 1GCAA 4BZPA 3ECCA 5IWCA 3K31A 2H5EA 1RHMA 4F4JA 2FWMX 2ZI6A 5LBUA 4GZ6A 2XKJE 5F52A 2R1ZA 2G06A 1ATZA 1QIEA 2ODWA 2WHPA 1WNTA 2XLBA 2Q4TA 3FYHA 4KFSA 4Q3NA 1QKJA 1TEVA 4YRCA 2IZ7A 4AZ3B 2FPWA 2I3BA 1IJFA 1GUZA 3IEUA 4KAXA 4ND6A 4N39A 4QAJA 1BXZA 1KTVA 1L5GB 4EMBA 3O8CA 4OI0A 1Y6RA 2I54A 3IMCA 1JZQA 4IX9A 3WL6A 3BE6A 4ZO6A 4CCYA 4MW1A 3OZUA 4X63A 1PBTA 4DAOA 2PH7A 4TVKA 1I9GA 3AUTA 1V41E 5EXXA 2Z1DA 3AF4A 5TEWA 1BVRA 2DBVO 3KUXA 4M99A 1KJ8A 3QE4A 1K7EB 2Z8YA 4KRXA 3T3MB 4A26A 3NXKA 3JVVA 2GBPA 4MDEA 4B3GA 3RGGA 2JRCA 2AMVA 4ED9A 2G6TA 1O5OA 2JH8A 4JXZA 4W5QA 1T1SA 4V0QA 3BKXA 4X84A 4MW4A 2J3JA 2BONA 4N3NA 3TJMA 1FS4A 1S9HA 3LUCA 4JJ6A 2W2KB 4HN4B 2CMHA 1YGPA 3PHLA 4D9MA 2RHWA 4WMLA 2ECQA 3RM3A 3RU2A 2PMCA 1ID1A 1Y89A 2A78A 4ZARA 3GNTA 3M6VA 4F6RA 1A76A 1JR3E 2JD2A 1JEQB 4JGIA 3ZCXA 4C4SA 1K97A 2WILA 4PLZA 4BQEA 1E96A 3HCDA 3BK1A 1R0SA 4ER6A 1X1DA 4LE1A 5E6RA 1PTKA 4TUYF 2WD8A 3ZNPA 4I4IA 4OIFA 4Y6RA 2O2JA 2O4UX 1QQAA 1RDFA 4P4NA 1KBQA 1E4YA 4GSYA 4UBLA 5E7IA 1TVKA 4FD3A 1EDDA 1ZUNB 4KWEA 4AMZA 2C78A 4A91A 3HXOA 1KDVA 2NP6A 4PLWA 3QXJA 2ZB2A 4YB8A 1RM5A 2QUAA 1W88B 2L0XA 5FWAA 2ID7A 2DTXA 3TO5A 4DT1B 1E89A 2J3HA 1GT6A 1VYTA 3ESCA 4MRMA 3U60B 4WESA 1E2JA 4BB6A 3TOSA 1T5LA 1G6Q1 1Y1LA 3DVAB 4HMPA 4BRWA 1F2TA 5IKEA 3GGOA 4N3BA 4ECEA 2VDVE 3B2EA 4UTXA 4R1LA 5E6SA 3PNKA 3ZVMA 1EM8A 1R0KA 2PNJA 1UPXA 1KI4A 3FOCA 4D9JA 3F7MA 3H6HA 3Q7PA 1MEJA 2WYHA 1EINA 2N1MA 5HJ2A 4F9EA 5KUTA 3U5TA 1MHPA 2YXPX 2HYDA 3P2MA 3Q88A 3QXXA 4CCYB 3PFWO 3UWMA 4POOA 3V33A 1R1DA 5IJ0A 3KJNA 1NMEA 3BMOA 3G85A 4QARA 3T1OA 3WIBA 5CAEB 1YMQA 3PJRA 4FOTA 4J2TA 1WSBA 2GD1O 2GM3A 3A36A 3PG5A 2JIZA 3R6TA 4P22A 4DY4A 5KNDA 3RTAA 2V6BA 2QMOA 3KQUA 3EPLA 4DG5A 2Q4OA 3TGWA 3MGKA 1MC8A 3L7LA 2NZVG 5LBIA 4WZBE 1VIDA 1I36A 3QVOA 1MBZA 4FCTA 4IPTA 4Q39A 5DN6A 4MVJP 1GAQA 3UMGA 2BKLA 3AVYA 1FVHA 4YJHB 3D02A 3KQNA 3THYA 3PXGA 1VKRA 1NFFA 1PDOA 3KP1A 3OUTA 4B3TB 3EXIB 1CB7A 4PE5B 2I99A 1T3ZA 1YFJA 5AVVA 3IAS6 1R8XA 3SS7X 2AQKA 3HVIA 4C3VA 2UZ4A 2LGJA 5C5IA 5AVTA 2ZP1A 2MR6A 1WMEA 4CIDA 5EXDA 2VHCA 2QTFA 3ZD6A 5DNEA 1K7SN 1G9XA 3NHYA 4I1PA 2ZPAA 5KNDH 4GYKA 2QK4A 4PXSA 4ZHQB 4LYDA 4OQZA 3ETNA 5EZ5A 1YR7A 3FZYA 4FFMA 7ABPA 1SUPA 2IE0A 2AD1A 2ZIWB 3EGCA 5AJXA 5J2TF 3QW4B 4HTAA 3HCBA 3F49S 4I81A 1T0PA 1JPVA 4Q24A 4O0MA 4B71A 4KLCA 3IQGX 3BJIC 2CNWA 4ZMBA 1OGIA 4MA0A 3AINA 5DISB 4OM8A 1ZCAA 3RJZA 1G59A 4GICA 1EUQA 1EYZA 2GEUA 1ACLA 3QBJA 1WCIB 3BWEA 1MJGA 2EWVA 2ZT8A 1A5ZA 4RTJA 3HYTA 4DYHA 1P1HA 5JVDF 1LWOA 4GBGA 1FS6A 1GPYA 2EKPA 3DBIA 4F11A 1RI2A 4C0WA 5KWIA 2RGGA 1A7KA 2PLWA 4I1YA 1KOGA 3M4ZA 4NCHA 1VGRA 4YRRA 1PQ4A 2AIRA 2XQFA 4DRYA 2BGMA 3AR8A 1RWMA 1L5YA 2P7HA 4MNTA 4V1CI 4UMVA 4BZZA 3WLHA 1EQUA 4R2KA 2B35A 2NMVA 1LZLA 2MMCA 3LHFA 1R66A 5LQKA 3O4FA 1DWPA 2EJUA 2JIOA 1UMCB 1XQWA 2WTAA 3IELA 5CVEA 2Y6VA 4ZVMA 4DLYA 4TMTA 1T3SA 1ZIDA 4MGIR 2IW1A 2NU7B 2YXNA 4H3SA 2Y92A 3BE4A 1OLUB 4B6SA 1LW7A 1GGVA 2E3JA 3TQHA 3UK6A 5D2CA 3VPDA 3VU9B 2ZBUA 2ADOA 2IL1A 1U0SY 4D8VA 2BH2A 3DW3X 4D8XA 3KQMA 4F56A 5HDBB 4HGZA 2PSEA 1HUQA 1Z4PX 4G24A 1ZH0A 5HKKD 2D6FA 2YIDA 4JELA 3DDUA 4PYNA 4B80A 2V5AA 3ZIAD 7GPBA 5JD5A 1MHTA 2MINB 2VHTA 2RGNC 3IB3A 4IG4A 1Z37A 1XQXA 4XQGA 4FCCA 4PRYA 3GAFA 2E49A 1HFEL 4KKVA 1QIKA 3PQCA 4HXFB 4JNKA 4G9GA 3N7UA 4X1OA 4UUQA 1J24A 3RFVA 1O94C 3VC7A 3ZEIA 1M8JA 1O03A 1AS0A 3A6KA 2O8BA 2BE9A 2W00A 1PGOA 5LMNB 3AY0A 3VUFA 2IZ1A 2VHUA 2QEQA 2VLBA 3IIEA 3KM0A 1WETA 1XEWX 1FXWF 5HWSA 4U5XA 1C1HA 1K8ZB 3E82A 4TOIA 3U4CA 4KHZA 3ZWWA 1X80B 1BH2A 4HXYA 3P0IA 3N3BC 3PIRA 4DDHA 1P1KA 2WKPA 1CY4A 3ZWXA 5LQAA 2B99A 1TUIA 1LEHA 1VG9B 1X3SA 1RPTA 3VV2A 1K7FB 2I80A 4P81A 3J81k 4BX8A 1Y1PA 4YV0A 3VVMA 4OL0A 4MRAA 1GKIA 4KO1S 3AG5A 4BE9A 1XJ5A 1N1EA 2AN4A 3HL4A 1JA1A 5ALMA 3WWYA 5JSZA 2PRZA 3ILYA 3M82A 3S4YA 2OFFA 1GPNA 1C0IA 4HMQA 2CJWB 1KU6A 3LBFA 4E6EA 1MB3A 3WICA 4FDAA 4IXWA 4XWTA 3EA4A 5F3WB 1YZFA 3P9IA 4AM8A 3AT1A 4PIPA 2G7ZA 2A58A 4ZJUA 1L4GA 2QRVB 2JCSA 3BXPA 4HNVA 5FI1B 5CFRA 5JEDA 2XB8A 3W6NA 1SCAA 2PUTA 2Q1YA 3DTVD 1SR8A 4GEGA 4OJTA 4DDMA 5CD9A 1G19A 1V8OA 4LDJA 3I73A 4MV4A 4IO0A 3WL3A 3QUCA 2EZTA 1RR6A 3L0OA 4PCUA 1IATA 3LYUA 5FUMA 4IOJA 1BVUA 5BSRA 3U7QA 1Q17A 2B8WA 4FWIB 3KVVA 4X3CA 1VECA 1V16A 2RSLA 3B36A 5TY0A 4F06A 1TAGA 3JSAA 2GVNA 5HIAA 4E11A 3QPVA 2G63A 4EYEA 2GDJA 2BN4A 1F8XA 3ZJ5A 5LP6B 4ZOLF 3GJ4A 3MHTA 1GUBA 2Z3VA 1Y6QA 1CBUA 4CM1A 1MH1A 1F0NA 2FSFA 5AM3A 1ZP6A 5JS7A 3GJZA 1K8QA 3C14C 1LQUA 4BXOB 4ZYXA 3W2HA 1W76A 2E87A 2YV1A 3EIQA 5CK4A 5B37A 1ABEA 3UICA 1COZA 3FJYA 3L8CA 1YQWA 3VPBA 4YCMA 2VWPA 3WLRA 1Q3TA 2R5WA 4LXUA 4LVCA 2YJZA 5I4BA 3CLRD 1E60A 4UCWA 4B6GA 2HFJA 1IOZA 4HWTA 1QH1B 4P3YA 1NJ2A 3BE5A 3OIVA 4LSMA 1JQEA 4RIFA 3SXUB 4RTSA 2ZWAA 4H16A 4IF6A 3V48A 1BH6A 1NJ5A 2JGMA 4N3GA 1UDWA 1QGOA 5ITZB 4FMPA 4PFSA 3V1UA 1HI9A 1WIWA 3GJ7A 2PVSA 1R50A 4Z3OA 3WTCA 1QO0D 5PNTA 3IEKA 4N0QA 3PCTA 3C8UA 2PTHA 2QSYA 4WDQA 3UB3A 4OBXA 3H4VA 4LYJA 4E31A 4JFRA 1QIJA 3BMCA 1KYYA 1XKQA 4U7FA 4ARSA 4KUEA 4DARA 1P19A 3CZCA 3CW8X 3PS9A 1E3QA 1JPUA 2XB9A 4PCVA 2CDRA 3M2PA 4MQEA 1PP4A 1TCCA 4EPVA 3CUTA 1H8HA 1MO4A 4AWBA 2ONYA 3MLAA 3H97A 2RK4A 1IMJA 1E1QD 1KR2A 1KYQA 4QGBA 4Y2TA 5IW8A 3ZDEA 4ZEMA 5KO2A 1O0BA 4L28A 3CR3C 4OEHA 4RSHA 1I2BA 1Y8AA 1UC9A 4DQDA 5CFOA 3HB9A 3G82C 3S81A 3OX1A 3WGMA 5DX0A 2ZGVA 5DN9A 2OBLA 2ZUSA 1FTWA 2UKDA 1Y1QA 2FK8A 4MR7B 4KXNA 4ZAFA 3SHVA 1UZNA 1IY9A 3IJEB 1XELA 5JISA 2EQAA 5T4BA 3ELDA 2AG6A 2GBIA 1D7AA 1V37A 2HLDD 2ZBRA 3K6JA 5CVVA 2PUCA 3FOAA 1IYZA 1E7MA 1VSUA 3PDWA 3TOCA 1R00A 2JI8A 1O9HA 3F2IA 2AG8A 3NB0A 2RHLA 3P9NA 4LBVA 3HUEA 4HH0A 1NUPA 2X9LA 5P21A 3RWOA 2XITA 4GQBA 3O2NA 4EY5A 1C2TA 4HH3C 2BBWA 4HNHA 3RRJA 1EFRA 1ZH6A 2RDMA 1E7WA 1PYGA 4LOLA 3O4IA 2HF2A 2IHZA 3X1MA 4EO4A 1DXHA 1L5QA 1K5DA 5AP9A 1JQLB 4QQKA 1BW9B 4UW9A 1XFAA 4ZVQA 5ADUS 1XRRA 5AJTA 2GCOB 4R8MA 5DK4A 1DOHA 1GLGA 2IP4A 3N74A 1V11B 3K4QA 1FTQA 3B5JA 2NO9A 3HU2A 1BN7A 4AKHA 3K8OE 1B0ZA 1WCYA 3I39X 2VQ6A 1NJFA 4R5HA 4D0RA 1EXDA 4JI8B 4TSFD 5GMOA 3BWXA 4I50F 4LIPD 1JIVA 1S2IA 2H31A 2YZKA 1U3DA 5E4YA 3SF8B 3OM9A 1ZL0A 2ATEA 2ODNA 5JDIC 3DL2A 3I42A 1P0MA 3C7KA 4WJZA 5EG5A 4E09A 3KX2A 3LQQA 3VC2A 3ZHUA 2V7EA 1XN4A 4PHHA 3E03A 3H8VA 3LX4A 4IXTA 5AJHA 5LYJF 2C59A 2QZSA 4GLOA 1XV5A 4OHWA 1DELA 1IIBA 3R0IA 2J7KA 2HC9A 3KJIA 5CJ2A 1T9ZA 2B78A 3SNKA 2DHDA 5KINB 1PJ3A 5FNZA 1M1YA 3OQOA 1XPOA 3BHMA 3C3XA 4ZC1A 1B8NA 1YI8A 2X7JA 4PXAA 4EKYA 2FUCA 4HQ6A 1BJKA 1GGKA 3C6QA 3NWBA 1MQ8B 4Q19A 2WJGA 1ABFA 1N7IA 4AZ0B 4BNZA 3I09A 4W5OA 4BLTA 4QXMA 3IEIA 5AK5A 1NMQA 1G63A 1TRHA 5B58C 2XB4A 4CFZA 3T06B 2J33A 3R7FA 1Y9EA 3VH1A 2BCJQ 1XU4A 4UFPA 3T95A 3ND7A 4MVJF 4KO4S 4WTOA 3BGDA 3BCSA 2HHJA 5FBVB 2WWWA 4BB0A 3Q40A 3I2HA 3TB6A 4AJ2A 2GCPA 5FTWA 1Y8RA 4JL6A 1IEXA 1N5DA 4OJMX 2QVYX 4ER3A 3WV4A 1K27A 2H4JA 3C8ZA 3W9SA 4JVMA 1DGQA 1H8EA 4FZJA 4FHZA 1E69A 4WEOA 2PE5A 1TFUA 2K2WA 4JB2A 4DGSA 2I91A 1F6DA 1J8FA 3F73A 1RI5A 3STYA 4OP2A 2AQHA 3CPHA 4GGOA 1NI5A 1KDYA 3QBTA 1JIIA 2AUMA 1E3WB 2GX6A 4Q4HA 4F3TA 1TCAA 4I50B 4OX9B 1E1MA 3HP4A 2UUBB 1QQ6A 3LL7A 3SJ7A 6Q21A 4JA2A 4O1HA 4Z0NA 1TYAE 3PGXA 2H65A 4OJQA 4HPJB 2O2CA 3ICWA 5M34A 1ZGCA 2QSUA 1T8WA 3TOZA 2WSIA 3S29A 3D0QA 4K9OA 1QH8B 4AX8A 2BM0A 2UYYA 3FNGA 3WYDA 4Z3KA 9GPBA 3O2QB 4IGKA 1QRSA 4YAIA 1O8CA 3T3OA 3IBYA 3PRJA 4RD4A 4WEQA 3RFFA 1BC5A 3WC4A 3PQ5A 4R51A 4B2PA 2FP4A 3EYAA 1B8VA 3IPCA 2BI4A 4J3FA 4HTFA 3C0KA 2BEWB 2O2GA 5J2UB 1Q1GA 1WWKA 3FUCA 4KQCA 4RV5A 1JR6A 2ZQYA 3DE5X 1JHMA 3PD0A 1V7CA 2BFCB 2OB2A 3MJTA 1CPYA 3MTGA 4FCWA 4Q3KA 4QYIA 4XQEA 3SXPA 4GM0A 2G76A 2XMQA 5TMBA 1B4DA 4MI9A 4GI2A 2XGMA 3RNOA 4O25A 3AJAA 2CXPA 2C5BA 1EFPB 3B6KA 2RK3A 4IF4A 4M6WB 3QSYA 4HGQA 2CLCX 4LY9A 3O0DA 2BELA 4I8XA 5BN4A 1WBBA 1P5JA 1V5WA 1BOOA 3P0RA 1ZJ6A 3W34A 4DTCA 1Q2UA 3ABRB 3D4OA 4P7JA 2UXBB 3AETB 3IULA 4Z2YA 1GUDA 4YGXB 5TQ0B 2PH5A 3OOYA 3EBLA 4B7XA 3RAEC 4R8RA 1CIJA 2X8WA 3UK7A 1ZK0A 3RRMA 4MV7A 2DB3A 1NXXA 3T54A 3FCUB 1LBEA 4HQOA 3QFSA 1NOJA 1RC8A 4WOPA 3HMKA 2N75A 4RD1A 4RWZA 2WLSA 1NXVA 3U9LA 4BE4A 4ZAWA 1NP3A 5FAKA 4NZOA 3T1TA 1X1QA 5K3DA 1K5PA 1JHZA 3B12A 2ZE5A 5HIIA 1QHHA 8AT1A 1V1JA 3CLTD 4F72A 2FVYA 1KC3A 5F35A 3T8YA 1N6PA 2ZI5A 5A6VA 5AHOA 1U4SA 2BDUA 2ZRFA 3ZWCA 4B3RB 4W7IA 1A82A 2HV8A 2PMDA 2UUPA 2WIKA 3U0BA 4BX3A 3K0CA 5KQPA 3II6X 1EVLA 2WR8A 3RFTA 3FCXA 3U6BA 3NDJA 5KC9A 2ORIA 3R7SA 3Q7RA 2PBLA 4UBNA 3THRA 3P94A 4W5WA 4ZQHA 4YJGB 1Z5ZA 3BQMB 4JJEA 1ORDA 1JFRA 3D3WA 2FSSA 4FU0A 2B4YA 3TLMA 2X0JA 2XDQB 2ZRCA 1JEYB 4F1WA 2I71A 2MYNA 2QVBA 3COZA 1PK9A 4A6EA 3H8WA 1C3VA 2G5PA 5FBWB 2DFLA 3WYAA 3VBEA 1N6NA 1T1IA 1GU1A 1L1EA 3H9QA 1NE2A 3L6BA 3TDMA 1Y98A 4E4RA 1DKQA 1JXOA 1S1CA 3INYA 4CMAA 2XH8A 1CR4A 5BNZA 4U3JA 2AC4A 3QKIA 4J4BA 3TRKA 4EQZA 4LHVA 2P5SA 4FFWA 1EHCA 2F64A 3G2LA 3G9UA 1KSFX 2NU8A 1QF6A 1U3UA 1NOIA 4ZQIA 4Y98A 1HYGA 5IUKC 1FU4A 1H69A 3SK0A 4ENTA 3E9QA 1YZQA 4LX0A 2FPOA 2WYUA 2Z8ZA 3MOIA 4KWTA 4RVOA 5JNRA 1ZM9A 1BE6A 1X9HA 3QFHA 3ASZA 3DKVA 4W5HA 5JXIA 4R2MA 4KFRA 4ZZ0A 1QYIA 1IEVA 1AMNA 2KBEA 1CEXA 5JJCA 1M2KA 4ZYTA 3EB9A 1PFQA 3OCJA 1C8LA 3L7CA 4HZGA 3MJFA 4J16C 4S1VA 1HE5A 1OMOA 1QR2A 3OOJA 2WWRA 4A0FA 5AW3A 4EB6B 3PBKA 3GLIE 1DJNA 1W36D 4FFBB 1DC6A 2A9VA 2WUFA 3G0DA 3GELA 2FSHA 5A03A 1SC4A 2Q28A 1BGVA 1G7RA 2X8JB 4G1MB 4FYJA 3B8EA 2QPAA 3KYDB 3E48A 4QLAA 3TZKA 4EUEA 4TVSA 1CS0B 3WRXC 5KYWB 1J2JA 3CNEA 2X8AA 3E9YA 3H4TA 3I6ZA 3IUEA 3QTLA 4KLAA 4LSGA 3V7WA 4ZKEA 5C8XA 2EG5A 2QI9F 3DE4X 1XG5A 2F00A 3TRJA 1RWBA 4F45A 1Q0RA 3MWYW 4M54A 1W0JA 2AFHE 2P9BA 5FJIA 1E1QA 2RI6A 4N6NA 3KTAA 3Q9UA 3G5UA 3QI2A 4NECA 1AN9A 3E4DA 3OQMA 4JI4B 5ULLA 3T7IA 4EFNA 3E1KA 3RIHA 3EEYA 4C2BA 1KMHA 3KQPA 1QDEA 4TGLA 4G6ZA 3UJ9A 3QWAA 3V7NA 1YB4A 1IY8A 3DLAA 4F5ZA 1CDZA 4EHHA 4MK4A 4U7JA 2CXHA 1PNVA 1I2DA 1ZGHA 4KC0A 1DMRA 3RQIA 2JIZD 4I1VA 3UUEA 3ZBPA 2X3YA 3VZRA 2WWIA 4F7DA 3F2VA 2AN1A 1YMUA 2YFYA 3VHRA 2DOKA 2J32A 3B85A 2NWQA 1JLRA 2EL9A 4FYMA 3JD2A 4JEMA 4N65A 1FIUA 2G5TA 2FG5A 2D3TA 1OZHA 2D1RA 4PF1A 2R8ZA 5JNSA 2XOEA 4HVTA 4M38A 3ZQUA 2QENA 4WFQA 5IH7A 1HM5A 3JYNA 2QMUA 3OQPA 1Z2OX 5SICE 1KGSA 2HTEA 4KPUA 4LXYA 4FOLA 3AQIA 4Y1EA 4FIDA 1RU3A 2Q5IA 2MHCA 3LCRA 3VVBA 4X0EA 4PG4A 1PDWA 5FOQA 2WM9B 4TM7A 4QYSA 1WUHS 3P71T 1T0HB 1DKLA 1JW9B 1G60A 1XZAA 2HR1A 5C5EA 4F3NA 3PIDA 1XZGA 4AULA 1EK0A 1EIZA 3WG9A 4LRWA 1A8PA 1OZGA 5K0ZA 4GW3A 4TRMA 1AC5A 3H5IA 3FKQA 4WY5A 1T3TA 4AG6A 2CFRA 4OUKX 3JQ9A 5B4UA 3ZHQA 2GPSA 3WB0A 1WXHA 2B82A 2IRWA 3KR9A 4XRGA 1N5RA 3OY2A 5CVTA 1E2BA 3WO1A 2BGKA 1RHUA 3AKEA 4MV8A 2OT3B 2F2TA 3HCCA 5HCUA 1I7SB 3SQXA 3OLQA 2Z4RA 4JI6B 5K09A 4DNPA 2XZDA 4RZSA 2JGDA 5AW4A 3LV8A 5CLGA 3EQZA 2A5LA 4M1TA 4GXTA 1FLNA 1SIUA 2OGZA 2R85A 3RREA 3KVOA 4DV1B 3MMPA 1FJ2A 2NU9A 1FW8A 4ROSA 5JCJA 1SUIA 5KEIA 1NG9A 3BFPA 5KQGA 1B2RA 5FHQA 3O90A 3PFCA 4N8EA 2A6PA 2ZSEA 1DRUA 1E59A 3L7BA 3E35A 4YT5A 1GY8A 2ZT5A 4QULA 1H23A 1L4KA 1G16A 1U3VA 2PMFA 4P3KA 3I23A 3TG8A 2HDHA 1YL7A 2LKDA 4U1RA 5K2MA 1AK1A 1PG0A 4FZRA 1JH8A 2IYFA 2SNIE 4Z0PA 3CVUA 4CJXA 3TECE 4DCMA 2QOEA 4NU5A 4RA9A 1GEGA 1EHIA 2CC2A 2Q0SA 4M2LA 4ML3A 2C4HA 1U4NA 5F1KA 1X19A 5ARBA 3N8HA 4QEZA 5IHPA 2FPXA 4UPEA 3GIWA 2IYYA 5I4IA 2QYHA 1TX4B 1YSCA 1XD2B 4HDQB 2CFTA 4KGXA 1UK6A 4PV7A 2Q7OE 5DM0A 2JI4A 3LBIA 4EABA 3DBLA 4G1FA 4QHYA 5EI5A 2P9QA 2OWDA 5KJEA 2H0QA 5ALUA 2I6GA 4CU2A 5T41A 1T4CB 4FOOA 2QT9A 4FKBA 3E0QA 1EGMB 1XQ6A 3IQIX 3L1VA 4XUGB 3FGPA 4KFCA 2ZLBA 4PQYA 3GA5A 3DAHA 3O75A 5HKKA 2DTEA 5JBNA 4AUEA 2OKCA 4TMZA 2C2KA 4KR0A 4LYFA 4ND3A 5L7TA 2JKZA 2PQ0A 1ENOA 3RVLA 5IBPA 4IIJB 5KVCA 4B3DA 2JFGA 3FFAA 2HMAA 4S12A 3RB8A 4CG0A 4O3MA 3RVJA 3HVKA 3K9CA 5L3ZA 1XWWA 1T9HA 4EZEA 3ZTTA 4K6MA 2FOLA 4YH1A 3MD0A 1RJ9B 3U0VA 3WLQA 5C80A 4D1YA 3T41A 3OICA 3LW7A 1GRRA 1WUIS 2P9ZA 1UFQA 4BN4A 4BL5A 3BFXA 4Q93A 1G3QA 1TJ3A 2YV2A 1RPAA 3DZGA 1DAHA 2XZOA 4HQFA 3UKOA 4UUNA 4LX8A 4PM4A 3LLVA 1JV2B 2YOFA 3QJGA 3SX2A 3F9IA 1EGVB 1KZ4A 2EFEB 4UD6A 3KT8A 4CKCB 3S1LA 4HL6A 1QU2A 4YJDA 1UJBA 4KLNA 1UM8A 4U9UA 3I05A 5D7NA 3N8GA 2P7IA 3U4QA 4PQRA 2DVMA 4Q05A 4QQRA 2E6UX 2AI3A 2Q6KA 3A7EA 4XEHA 4YLGA 2ZB4A 1STOA 3JR7A 4BBZA 4FYKA 5EMKA 3WGQA 3M6UA 2J09A 4G9EA 4DPLA 2FPMA 2FEMA 3IQEA 4D9HA 1GOTA 1VRVA 1VIVA 1DT3A 2EERA 2Q4DA 2XR1A 3KYCB 4H3HB 3VU1A 3AM3A 3N39C 5ERYA 5J40A 4LECA 4MLZA 8MHTA 8ATCA 3RYTC 1XT6A 3HCOA 3W4JA 1SC3A 4G0QA 3K6RA 3WXBA 4BWVA 1Z7BA 2OO5C 4EG3A 1ZUD1 2D2IA 1DUSA 1Q14A 5EZSA 1ITZA 4HUQA 3CRQA 3O6VA 1M73E 2X8LA 1E58A 1TVKB 3H9UA 3HTXA 2XF8A 2EJTA 3UXEA 4DW8A 3ZU6A 1AIPA 2QR5A 3IBTA 4IJQA 3JYHA 2H3EA 4FLMA 4KO3S 4YRDA 3T9AA 3HR4A 5M5BA 1RZRD 1WBJB 3OX3A 3MJ4A 3O94A 4KNWA 1LS6A 3M9LA 3NNSA 4JT2A 4NMWA 4R8LA 3SYRA 1CQZA 2H5JA 2IC5A 3DT6A 3N8DA 4RCYA 1U5BA 5LXTB 3SWWA 1CF4A 2HZ7A 1EFUA 3HDQA 2VF5X 2OCLA 3CLVA 2ZJ2A 1SCJA 4FS8A 5AXBA 3QFTA 1QP4A 3U62A 5JROA 1P6XA 5KNBH 4M7OA 4YT2A 3C6ZA 3VNSA 5IF3A 1GPDG 5CGZA 4BRZA 1FVFA 1QDUA 1NI3A 1Z5WA 1ZOIA 1WXGA 5GGXA 3P0JA 4JL5A 2QMEA 3LWNA 3QE0A 6NULA 2ORWA 4DB4A 3ND6A 5JDCA 4OKSA 3ZFUA 1U0FA 4LBYA 3PX7A 1J20A 2EZ8A 2FUNB 1R7RA 1ZI6A 3ENQA 4QYXA 3W7VA 2XRYA 3RVDA 3WZLA 4AJEA 2QMYA 2C5HA 2BSAA 4Q4JB 4LISA 1W5EA 3MGGA 2PX8A 1WZEA 4LY0A 3DCNA 4MP8A 1N57A 5C1OA 3ZOKA 4QO7A 1P4HA 1CRWG 2DUWA 4ESVA 1MC5A 1L1RA 1RZUA 1SKYE 3HJCA 1FFYA 2XXAB 4AZ3A 2JVJA 1U8CB 5A1TA 1WMFA 2ZIVB 2IHKA 2Q3BA 1UMCA 1GZ6A 2QG6A 3DOJA 2AKYA 1Q0UA 4W1RA 4BVAA 3TRHA 2BEJA 4YECA 3DTNA 2FFJA 4BO4A 1Z7YA 2GXSA 4DILA 1K63A 3E9EA 3FVTA 1ZQ1A 2WW8A 1V1MB 3GJ3A 5BSKA 2PT6A 1FFWA 1SQ5A 1EUCA 2B6HA 1YS9A 2GBLA 3D64A 4GVXA 5FO1A 2WZCA 3IEXA 4IMIB 3HA7A 2RHOA 5LZ5A 4C0KA 5AVWA 1UWKA 1N1GA 2HLPA 4OQXA 4MITA 2CY0A 2OHOA 2V3CC 1DKMA 1U3FA 2O7RA 4L15A 1LBTA 1J7JA 3I2YX 2NSLA 3GCWA 5AW8A 2J9GA 3UANA 2FW0A 3U9SA 1WPGA 3V3TA 4C4YA 2ZJ7A 4B35A 4LZNA 2OFWA 4H6XA 3A58B 4MUAA 1M8GA 3I5AA 1KAEA 3O8LA 4I36A 1X42A 4AUNA 1HG0A 3WL5A 4WV3A 2FW6A 4TTAA 4RKEA 4YP5A 4EYGA 2NXNA 3GLTA 4LKOA 1BYUA 4WN3A 2R60A 2WAMA 1RLJA 2JIBA 4IIVA 4DVGA 5DHQA 3OQIA 4NEHB 2OMKA 3GG2A 4CG1A 3S2IA 3LWBA 1NMZA 1ORHA 4G4SP 1JIUA 3CVWA 3W7AA 2QNIA 4JU8A 1AQIA 3K4HA 3L4BA 1RBQA 1Z08A 4AO7A 1D2EA 1KJNA 1W1WA 2F1JA 3TRFA 2IYLD 4G2TA 4XB6B 4BMCA 4FYIA 1NXQA 5AKIA 2DF8A 2V8OA 4KJXA 4R1PA 4TQ9A 1XGKA 5M04A 2I9PA 3HUUA 4TMFA 4AWXA 2I87A 1DBRA 4O4LF 3EXHC 3PX2A 1NN0A 1SIWA 3BIXA 3ETJA 3GZNB 4N9QA 4R7GA 4EK9A 3CXRA 5EOVA 4M49A 4ARVA 1G5QA 5G0SA 4BZQA 3JAMA 1XCGB 5HG0A 2R7NA 3GBPA 1UEJA 4FXOA 4UARA 4GWLA 4EX6A 1VG0B 3JQFA 2GZ2A 3WK5A 1Q6YA 2EW8A 3BFVA 4BBJA 3O3NB 4KUHA 4UZFA 5LOVA 3AM1A 3KAKA 1FFXA 3B13B 2FPIA 3CN7A 4W9RA 4RPCA 4EP1A 3H9JA 4C0SA 3ND8A 4IMJB 1P4SA 4NDAA 3PJFA 4RH0A 1J06A 1YACA 2P3LA 4OHOA 1T2DA 2H1SA 3NPMA 2A4MA 5CVUA 3RT7A 4UQLA 4YREA 3RUAA 3EMDA 2AFRA 4WFKA 1Y81A 3I12A 1QQ5A 2OECA 3H3JA 1TD9A 4HAOA 5JNUA 1KP3A 1LBSA 1P75A 5ALYA 2FPLA 1MENA 2YJ5A 1N2XA 2WKRA 2MDTA 4G0ZA 1KI9A 1MJNA 4PTYA 5KTRA 4I8DA 4JLBA 2CSUA 4NR0A 5KYKA 1QLWA 1PS0A 5DV9A 1V2GA 1H3EA 1F7VA 1GILA 2BUBA 4LRSB 3WISA 3BXFA 3H2BA 4UM5A 2GZ3A 4ZGGA 3WKAA 4OK6A 2ZIAA 5JWHA 5H16A 1W5FA 2AOUB 2D13A 1QO7A 2RG1A 4B6QA 1K6EA 3U7RA 4A2CA 2E37A 2QYSA 3TMYA 1KK0A 1H66A 3IOEA 4CQMA 1GZ7A 1G5IA 4FFDA 4YWHA 1D4ZA 2DUNA 1EVZA 4NYMQ 2GWRA 1HFKA 3GRRA 4S04A 2DFNA 1CUEA 3KU1A 3GP8A 1TIKA 1UM9B 4AYTA 1H1LA 5AVXA 3GLIA 2VYFA 3I37X 3PXXA 4K9SA 3B38A 1WOYA 5CA1A 4MRRA 2Y68A 2DECA 4YRBA 1UKBA 3W04A 4RKFA 1J1UA 4FW9A 3LHSA 1LGYA 4JQCA 5FIUA 3U26A 2MCFA 2C3OA 3VPFA 3WHIA 4NF2A 1F38A 1J0BA 4EKGA 1A27A 2W83A 2BBTA 4PYOA 1Q19A 3U7FB 3E15A 4HDOB 4ZV7A 2O9JA 3PDIA 2QAGC 2FPGA 2YIJA 1SHLA 3KXDA 3I9NA 2JJ2A 1UBJS 4L95C 3PC2A 2OBMA 4DIMA 5A4AA 4DYVA 3IFSA 3TQOA 2EKLA 1TM2A 1SO8A 4CQLA 2D4AA 1CLUA 2O8FB 1T0JB 2CXUA 3MAJA 4IP0A 1PNTA 1H6AA 1T8UA 4PZEA 5A4JA 2BIFA 2CMGA 2BSQA 4BU0A 4HVCA 4FP9A 1F0PA 1UM9A 3NOOA 2D7CA 2G80A 3BSWA 3WFJA 2VDNB 4X6XA 2IS6A 2Q0QA 2WM2A 5ADHA 4INPA 3IQZA 4G0XA 3TL6A 2P9JA 4IHQA 2WHQA 4KBYA 4G26A 4CKCA 4D82A 1PI3A 3FPHA 3ROKA 3COJA 2AMYA 1T5OA 4JQOA 1DB3A 2IP1A 1X1CA 1OJ7A 5JLJA 3FMVA 4C87A 1OTHA 1Y37A 2BGTA 4I0WB 1NNLA 1Q1AA 1T91A 4ZP1A 2LP4Y 5K4AA 3TM5A 2FDRA 3KZMA 4REMA 5DDIP 3GLHE 3RQSA 4URFA 2PLAA 1O87A 3V42A 1AQJA 2RD2A 3FUTA 3X0DA 1Y5RA 1JTVA 4ZI7A 4B5KA 4Q1VA 3QLEA 4LNUA 4B3MB 1PQWA 3U81A 2G1JA 4RM3A 3Q7QA 3W6OA 3PTAA 3EX7C 5AVYA 1PL7A 2HRZA 3EZNA 3ITEA 1ZD2P 1NYTA 2AOVA 3CX6A 1YZKA 4KH1A 5EVCA 3EMKA 5GV8A 1MTOA 3WGYA 2C3UA 4GRDA 4NNPA 4IVRA 1FTSA 3W3ZB 1JA9A 4EYSA 1Y4ZA 4K0KB 4Z4FA 1Z7WA 4TS1A 1JSLA 2Z83A 4L8LA 4V3CA 4BNLA 1SUEA 3OPMA 3CC8A 2P6NA 2BFAA 2PRJA 3O3OB 1GVHA 2GRUA 2P2YA 1Z36A 1WHTB 3A6DA 3EF1A 4IM7A 2ZUFA 5I9TA 3L1KA 3L05A 5IYZA 1I5RA 2GYUA 2SHKA 2Y1EA 4AQYB 3TI7A 4I55A 4L4RA 2J3EA 2QY9A 4AECA 2E5FA 3M7IA 4M0UA 1U28C 1DIOB 3UV3A 4CF5A 1D6JA 2GNAA 2UZIR 2XDWA 5LA6B 4D3ZA 2DLDA 5BN1A 2A1TS 1TM5E 3D43A 3MQFA 3EXFA 3K71B 2SECE 3SR3A 4DCOA 5FPSA 3A9UA 2GO7A 1JFFA 1PGPA 1BXKA 4TZKA 2W6ID 2YHUA 3A6PC 4WZ6A 3W2EA 3LT0A 4EJSC 2AE2A 3PUJA 1SG6A 3AUJB 3VBCA 4ZODA 4P92A 3M9WA 1Y3FE 4GBMA 1XUOA 3BGIA 1YL5A 3TL3A 3A06A 3ZC3A 3MINA 3PYLA 4EFLA 4V0RA 4R5MA 3TR5A 2ZIGA 2PR2A 4Q02A 5TT1A 3GVHA 4ZANA 5LQUA 1NLMA 1KI7A 1E6EA 4H31A 1TRKA 2PLRA 1PRYA 3M89A 4IIJA 5IAGA 3ZWPA 2Y1OA 1LPNA 2C4UA 3GLVA 3O83A 4P4TA 4X6UA 3P19A 4WD3A 5AO9A 4BKRA 2C7OA 1Y8QB 3G9XA 2Q8QA 5IM4F 1QAOA 2WHXA 5SZJA 2LRHA 1F6WA 2OGTA 1X70A 4MKRA 5ILQA 4QGFA 3N6RA 3L82B 2VP3A 5DBOA 2O2ZA 4PYQA 5DHAA 3TW8B 2IOYA 1EFCA 2POCA 1M1NA 3BRCA 1MNQA 4RU1A 3IVXA 4D4KA 1WABA 1Y7IA 4NE2A 1EUCB 3FTQA 4RETA 1QCCA 2WIJA 4E1BA 2ODPA 1Y5MA 1I24A 3QVLA 3V97A 5C8DA 3P0FA 3A6GA 2QTBA 3OE5A 2PEYA 4IJKA 4OSOA 5EIWA 5EMHA 2R2AA 1ZMBA 1FMCA 5A4IS 3C3DA 4R3NA 3H7AA 3ZFNA 1OI2A 3TZEA 5E3JA 4EJFA 1JWBB 1NNI1 4YCBA 2R84A 2YNMA 3BD9A 3NM4A 1YK1A 2FA9A 3TEJA 3FMOB 4XTRA 3FYSA 2QN2A 2X13A 3NIBA 3INRA 5E8JA 3WL7A 3MTJA 4OMUA 3WA7A 3T7TA 1M6VB 2AN3A 5BV7A 2O4CA 1Z5VA 3UJAA 5JE8A 2ZYHA 4ER5A 3BTVA 4QOIA 2VRNA 3OD1A 1FX0A 1C4WA 3E7PA 4TTRA 5ETJA 4RNDB 4ASUD 1AN0A 1NLZA 3U7HB 2VHZA 1RLUA 1E0SA 1TK3A 4N9WA 2ZUEA 1NVUQ 2YQZA 3E3LA 4XOIA 2C97A 3KKQA 1A4XA 3M5PA 3PT9A 4XUCA 2IUUA 3JPWA 4OLFA 1CQIB 2W70A 3UV7A 4BVEA 5KHLB 3QEOA 4P98A 4HB0A 2FPUA 3SQDA 4CEIA 4UU0A 4PC3A 1LJUA 1PR5A 3VU8A 2H85A 2HSJA 4DIOA 8ABPA 5BR7A 2JBAB 1OBCA 5B3LA 3DOHA 4ZN6A 2XCLA 1A8HA 4YMGA 3J7AC 1IDOA 1TF5A 2AFIE 1B1AA 1C1XB 1SOVA 4CKEB 2AF4C 4PN3A 1FB5A 2GTPA 3E7DA 4HPWA 3AUSA 2QNRA 5F77A 1E9DA 1HSOA 3R2JA 3HU5A 1XRJA 5IMSA 1NL3A 1WDWB 5AW6A 4RFSA 3T3DA 2IUYA 3NNDA 4FNGA 1YOBA 3U4GA 1GTRA 4KFUA 2W93A 3UW1A 2O5EA 4R1OA 1E98A 3DULA 4BFWA 2PLFA 1PJQA 3SEAA 2IKQA 5LQNA 2NVUA 4F4FA 2B61A 5LB4A 1P60A 5C2JB 3U09A 3L7OA 4FYXA 3VKHA 1GQYA 4FN4A 5K0TA 4YHHB 2LCFA 4P82A 4XH9B 1SVKA 3WHKA 4NHOA 2IX3A 1N3BA 1XXLA 4IDAA 2PJDA 3TM4A 1ZCBA 4PAWA 2VBIA 2O5CA 1ZA2A 1BX1A 2J67A 1UOPA 2ZM6B 3DVQX 1I13A 1LI7A 3NKLA 4Z6KA 4H08A 1JKXA 1YE8A 2GLXA 2IPAB 4QLBA 5ED4A 2EDCA 4UUMA 5AKZA 4FR2A 2R97A 1N6KA 1V5EA 3AVVA 4QUJA 4AF8A 3CH4B 1DKOA 3JS5A 1DJOA 1E0KA 3V2GA 3S5UA 2FPPA 1A72A 2GMWA 2OCBA 4MWTA 2QX8A 5DBIA 4YXFA 3WL8A 3NASA 3GFVA 1JSXA 4JVOA 3IDAA 2B7CA 2BEKA 3S6JA 1LDBA 3OBIA 4NATA 1CWUA 3D1LA 1MAHA 1RLTA 3WKEA 2O52A 3KKKA 1LS1A 3MRVA 1TPZA 5E8RA 4LPKA 2OVFA 4BJ5A 4TV9B 3TBHA 4AU1A 4E5SA 4X7MA 2OXRA 3GVIA 3WJ1A 4GOOD 1TECE 2WA1A 5FT9A 1VM6A 3JRWA 3A2LA 4F2PA 1JG3A 2SKEA 1ND5A 3E9RA 2AEMA 4MLPA 4YVFA 3W3AA 3RUPA 1JQKA 2WAXA 1B14A 1U3TA 5LQRA 1QYCA 1YZUA 1IN6A 2ZB8A 4D0LB 2CFOA 1MQAA 4EUHA 4ZU1X 1OYVA 3FA2A 1IJEA 3FDXA 3F4KA 1U9IA 3ANNA 4HAIA 4E08A 1WLSA 2XA9A 1R0RE 2R62A 2PCJA 2GK4A 4TXHA 2QBYA 2FHPA 4UTOA 5KS2A 1GGHA 3Q15C 2QDXA 3VPAA 3F6RA 4E88A 1OH5A 4LF5B 1PJBA 3S5JA 3Q11A 3BEDA 3N0RA 1DUIA 4PU0A 5JG7A 3ZVRA 1C50A 4YRNA 1D5CA 4FM9A 1EX9A 4RX1A 1N2HA 3ZGYA 1ADBA 2CE7A 1LSOA 1H2ZA 1NVVQ 3GRPA 4MHSA 3UHJA 4CDNA 3GN2A 5BXYA 3T12A 4C7BA 3OZTA 5EJ9A 1KAGA 1RS0A 1W581 4N47A 1SWWA 4DJEC 4EHAA 2F9FA 3D81A 3G0IA 1JI3A 4JI7B 1JMVA 1U8FO 2GN8A 3O38A 5AH0A 5TPZD 4XSHA 3THXA 1KYZA 1SUBA 5D85A 1FP4B 2JJ1D 1GQFA 4I5DA 4YLYA 2IS2A 1YDEA 2QN8A 3K1AB 1EJ0A 1NOKA 1R8JA 4E2WA 4LE2A 4KO2S 1URPA 1OILA 2B1GA 2UVQA 4QRHA 1UXHA 2XD4A 4UPVA 1BDHA 3CQ9A 1P0CA 3KOUA 3EXHA 1DC5A 1T6YA 3HH8A 3ZK7A 1BXGB 2BGRA 4KXXA 1C9DB 1L7NA 1AXGA 4D02A 4MB6A 4OY3A 1F12A 5TJ9A 2FDCA 4MJXA 1S9DA 3FGOA 3ITNA 3O31A 1NU6A 2O6LA 3P9ZA 4KRGA 4YRPA 3QX3A 3GC6A 2FETA 3UMVA 2HF7A 4RD2A 5IKOA 2I3GA 5COBA 3D6TB 2Q2OA 2Y0CA 3IV9A 5FNVF 3UMRA 1KO8A 2AH5A 3I34X 3QPAA 4KU4A 3EQ7A 4MRPA 4XD7A 5AOBA 4X1YB 4RJLA 3ZVLA 3RAFC 2WKSA 4Q7KA 1DQYA 1KEWA 3PWSA 4CQLB 1NLFA 2PGXA 3BC1A 1VL5A 3EQ8A 1RCUA 4HGRA 2F1KA 1RYMA 5CT9A 2XMGA 4EQ6A 2LXNA 3EOZA 3GUUA 1HPLA 4H17A 3OUZA 2BFCA 2XV1A 5K3CA 1A9XB 1NY6A 2JA1A 1ECJA 1UOQA 3LLUA 3FM9A 4BHTA 2A94A 4AP6A 5LUAA 2BZSA 4FC7A 3LNCA 1AXEA 3H9CA 1HA3A 4YGYA 2CNBA 1QH0A 2ZRAA 1H0KA 1OI7A 2FPSA 3CLRC 4JUCA 3WGVA 3F7NA 1NDHA 5K6TA 1ACMA 1FCJA 3DKIA 3S1SA 2EKBA 3MMSA 1KZ6A 2NVWA 3FCYA 2JHFA 4MJ7A 4MUJA 3RH0A 3F67A 3KTAB 3TAXA 1CS4C 5JTTA 5AVQA 1YRHA 2PFGA 4BMOB 5JFGA 2D5AA 3JWPA 1VHWA 4H0FA 1DIHA 5AESA 5KU1A 4OM7A 4UFNA 2BFPA 4AC9A 4BO0A 3CIOA 3EVFA 3HNOA 2CXOA 2BKVA 4C43A 3FHLA 1XR3A 1BRTA 3VKVA 2DQ4A 1G8JA 2BI8A 1FYWA 2ST1A 4HRXA 4PLPA 5JY1A 5B1YA 1WVGA 1R3DA 3P26A 3PK0A 1ISSA 5IT0A 3IE0A 1CDDA 3N2YA 1YU9A 2CD9A 2IYRA 3AHHA 5K3AA 2FQQA 2FEKA 3E3AA 3Q3GE 2O0JA 4BLUA 1U6KA 4HH1A 4ZI5A 3MF4A 1P2TA 1UXKA 5FOSA 2KPOA 4B2YA 5AKHA 2ECFA 3GLKA 3K09C 5AJVB 4WDRA 5LDDC 4YQEA 1WEKA 3U4MA 3RIYA 4A5SA 2DFKB 1Y7PA 5EIHA 3E2MA 1KFJB 2WT4A 4YBZA 1RWWA 4N82A 3AFGA 4MQMA 3ITDA 2W71A 2Q9BA 2YWJA 1PJLA 3TNFA 1YVEI 1DCKA 1CZHA 2QQ5A 2BW0A 2R48A 3D6FA 5HA5A 3ZZTA 5BUQA 4JJ8A 3MS4A 4TYNA 1PYOA 3C6MA 4RABA 4PC7A 4UE6A 5AJWA 5B53A 4EA7A 2OORC 4JHXA 3Q5EA 2HA5A 3M4YA 4FPXA 4M9RA 4F6CA 3AP2A 4NZZA 1HDEA 4YJFA 2GM5A 4RHUA 4PLYA 4J2OA 4ZCMA 2E2WA 2W6PA 2R1UA 3AV3A 1J99A 3CCFA 3B8HA 4P3PA 5DXAA 4F2WA 3HZOA 1A4UA 3LHIA 4RACA 4TLBA 3TH5A 4OHFA 4F7WA 4G86A 4XEUA 3HLYA 4N49A 2VUHB 2D0DA 3KTFA 1W5BA 3AR4A 2ZYRA 4KIWA 4XKJA 5BWOA 2YWFA 1OX4B 1SRRA 2FWIA 4F4UA 4LZLA 1W47A 1NRWA 4C0LA 5J4LA 3CZ9A 1V35A 5F21A 1IXKA 1IBRA 5IDQA 3GJXC 3HG7A 4BWFB 2BFFA 2QPTA 4HS9A 5DGTA 4BNDA 2BTOA 5F1YA 3ZJTA 5A1JA 5EGSA 1GQ2A 1AKVA 2Z1NA 3ESZA 2K4MA 3EPJA 2QLFA 3OIGA 1C1DB 1L7PA 1JPJA 3R3XA 2GEDA 3VSDA 1OIXA 3T3EA 1I30A 1NAHA 4COOA 4UOEA 4UAVA 4NE9A 1EBFA 1GPWB 5AIAA 5HKLA 1KP9A 3AI7A 4RMIA 2YVQA 3AR7A 3A31A 2Y76A 4J3NA 5DTJA 3GF4A 3EDYA 1C7EA 1ZONA 3FG9A 1JT9A 4Q4DA 3JRNA 3WFZA 1Z3CA 5DMXA 5ENVA 3SVZA 4BATA 1NW9B 3H75A 5JBQA 2J9YB 3MIIA 1NDQA 3R6DA 2B5VA 2QVXX 3SHTA 2AJDA 5FOTA 3CE6A 3PXAA 4CM4B 5JH7B 5LDHA 3U61B 4B3JA 4HFRA 3P4UA 1NNEA 5A9SB 3WGGA 3ANXA 4PLHA 2DHQA 4G8DA 3V7FA 1HURA 1YGYA 3QK7A 3IJ5A 3R0XA 3WHPA 2JFFA 4BEVA 1EFPA 5CHEA 4GC9A 4WOCA 4B3FX 1M8FA 1TVEA 1ZLXA 3PWZA 5CXSA 3V4PB 4RA6A 2GA8A 2PA3A 1NWCA 4JX8A 3AG6A 2TS1A 4LY3A 3ET5A 3LCMA 3RTDA 4B7AA 1BJTA 2HU8A 2J85A 2EOAA 4LMBA 2R6ZA 1J42A 3FYUA 5CXUA 4LZWA 2RH8A 1UUFA 2Q0XA 1TAQA 4IFBA 4XVCA 2WHRA 3BMOB 4PLGA 3SU8A 1NNUA 3REGA 3DFKA 1CUHA 1J0AA 1ZK4A 5CFLA 4FVTA 4S1TA 2QTWB 1I4OA 2AEJA 2RAFA 4UXIA 5AMXA 2ZROA 5LXTF 1DG1G 1YV9A 3QVXA 2DUJA 3D59A 3WK7A 3LQ1A 6GPBA 1P3JA 1RWNA 2R5NA 2Z2JA 3IURA 4L5JA 1L8QA 3BE8A 5JEEA 5E6SB 4PWZA 3KFXA 3NBMA 4KIGA 4RK0A 3UKDA 1EIWA 2ZSIA 4AJNA 5AKGA 4BWGA 4C5AA 2XBMA 4PO1A 1ZIYA 4OL9A 3RYFB 2XXJA 1NTRA 3KJZA 5IZCC 2OV6A 5F9HA 4EW1A 1FRVA 1PLLA 2FRVA 2HX1A 3TDNA 4F0JA 2PKWA 4CYMA 1RPZA 4XM1A 1ADFA 4QOHA 4KPYA 2ZIFA 1UDBA 2EDAA 3CM0A 4PFQA 4WJKB 5JCJD 1G8PA 1QDLB 3GXOA 3KKMA 3GMTA 3PNLA 1YDWA 1X2BA 2FR1A 2QNBA 4B2IA 3PDHA 2Z98A 3E6AA 4WZBB 1PR9A 3ZPXA 4A0QA 4DPKA 4UU8A 3MW8A 4RTLA 3JW8A 1ZGGA 3RW9A 4TWAA 4CT5A 3QV1A 5E6RB 1AK9A 3MHPA 4QRIA 4UOZA 3K6SA 4NE7A 4KI0A 3K5WA 2Z3WA 4KN5A 3IOBA 1Z6GA 3VRHA 3O8QA 2JJQA 3N2NA 5D3QA 2VQFB 1T5DX 1SG9A 4K81B 5CIYA 2COKA 2XCTB 1GRNA 2O2YA 4BO1A 4NCBA 2QUKA 2FX5A 3RS4A 3I2GA 2ILTA 4MLCA 2DSNA 1HLFA 3NT4A 3PGJA 2GSDA 1Q0LA 1W48A 1T29A 2PANA 3B9BA 4RLFA 5EAIA 4RELA 1T8RA 2JAXA 1WM1A 3NANA 1YKSA 3KWJA 5JDIA 1DAFA 2DJIA 1SXJC 2AGVA 4A8JC 5DRYA 4IUDS 4DMRA 1E3DA 1GZ5A 5FQOA 3LY5A 2J08A 2I7XA 4K3VA 5I7FA 3K5IA 1NRJB 4KQ2A 1U63A 4WZAB 4G81A 3G2KA 4DVJA 3G9TA 2FX3A 1JYEA 4LWQA 4CM9A 2HV9A 2ZU0C 1UQRA 1R74A 3UC9A 3R6LA 3ZLJA 4MEBA 3FYUC 3K0CC 4NOKA 3SLRA 5A5GA 2CJWA 2HIMA 4R4JA 3JZAA 5C7OO 2YXLA 2Z09A 3L6UA 4RZIA 1IHUA 1VL2A 1PQUA 2PRYA 4OXXA 3BEOA 3DXYA 3K8QA 4MI6A 1R6BX 4YONB 3JASA 4KSYA 3GU3A 4MX8A 2J45A 3ZH9B 1KMMA 2GNOA 2BBOA 2ZIZA 3NDBB 3RU7A 3PD7A 1QAQA 1SBCA 2GZMA 3P27A 4OQNA 5E2AA 3S28A 3WNDA 5LXTA 521PA 3DXFA 5IYZF 1BDMA 3GNSA 2V03A 3FTFA 3QPUA 2WB4A 2IHNA 4K6FA 1GYRA 1XWIA 3QENA 1MJFA 2FR8C 5D7BA 5LD2C 3MUNA 1VTKA 2HA0A 1NF9A 1BEEA 1UXIA 1W1UA 1QOZA 3F71A 3WYCA 5LMUB 3K70B 3DZJA 4H7PA 1GM5A 2OQ2A 3CLHA 2HBYA 2Q3EA 4YMTA 4MCIA 2EF1A 2P6RA 3H0EA 4TTQA 2WJYA 13PKA 2HK9A 3FCAA 4MGHA 4E0BA 1T10A 1O0CA 1B8PA 2R751 3RV3A 2FPIB 2X4GA 1S02A 4HMOA 2ZSBA 1BROA 3LC1O 1M66A 2I29A 1CRZA 4MO9A 1EGHA 1L3CA 3EZFA 4DEYA 1AKNA 1JN0A 2NQ8A 3I5YA 1LBHA 4HLQB 4BFLA 5JVDA 2EXXA 2CFSA 3S2GA 3WKDA 1JDBC 1XD2A 4KQWA 1QPGA 2QUHA 4LFAB 1S2DA 3PYXA 4TLCA 4GMGA 5DW3A 4XCXA 5E9QA 1PWYE 1TU4A 1TT5A 2QHXA 4KV7A 2G83A 3VR5D 1NVGA 2ZBGA 3G0OA 2PBRA 2PWBA 4H7JA 4EZIA 5CG1A 2ZIUB 1ICIA 1PQPA 3GLHB 4UJ3A 4Y2QA 5HCNA 3WGNA 4EEKA 2HBRA 1AHNA 3R9KA 1NQ5A 1JP7A 3DDCA 4V3BA 5EZ6B 3SDBA 4KDRA 2IF2A 3QFFA 3WBBA 2OHJA 3UBTA 4MTCA 1Y1SA 4QNNA 3EXIA 3AUUA 1IN5A 3U1TA 4YCNA 4H59A 1UOEA 5KOJA 1RT9A 1C7JA 5IX8A 1RRMA 3D6UA 4D96A 5J1SB 1AZTA 5F64A 2H6EA 2P3SA 1PDVA 2H9YA 2WT9A 5FOVA 5CFPA 4NYMR 3R5JA 2V1UA 2CDCA 4NYIR 3TZCA 1C4OA 2CXSA 5D3KA 4RSGA 3KQWA 2J9ZB 4YY3B 2C84A 5EP4A 4CM9D 2W2LD 4PGAA 4U2CA 3K9QO 2NAPA 4W6QA 4F21A 1P2SA 2PJZA 5CUQA 5ILGA 1VHLA 3ZV7A 4XZ3A 1ISFA 2VUUA 2WU0A 3PUHA 1QONA 1ZJ4A 4PGFA 4C88A 2X0FA 4DMUB 5IJ0B 2G36A 3UV6A 4B84A 3FVWA 3HXQA 2W2LA 4DV4B 3DBLB 4G3XA 1Y4DE 3KLBA 2ZYVX 3V9AA 2HCJB 3FZEA 1FDSA 4M9SA 4QU5A 4ZOAA 1U02A 1FNSA 1WY7A 2GPNA 3ORHA 2W0SA 1F8GA 3E81A 3UMMA 3FNFA 2Q9AA 5A7GA 3ZK9A 3HR8A 3IUPA 4CKXA 4JQYA 1GV0A 1GPMA 1THTA 1UFKA 2UVDA 3PRKE 4G37A 4GOLD 4JLWA 4MIOA 4MRMB 4OQEA 4PHTA 4CLRA 1EEXB 1OQAA 4DT1A 2C82A 5JASA 3C16C 1YI0A 4I5GA 1S8AA 3AOGA 2V65A 5KYVA 3EF0A 4RL6A 3EDQA 4PG7A 4HI0E 2RGDA 2AC2A 3OOSA 4PAMA 4E51A 3OLWA 1J2EA 5CDHA 5JAHA 3ZU3A 3E3NA 5FUWA 1JQJC 2B3DA 2A5DA 1TM3E 4LJKA 2XE7A 4LEIA 3L8MA 3ID6C 4CKYA 5AQ1A 4NBVA 1CZKA 3NJ8A 3S8MA 1AGXA 4BFTA 5KDLA 2VWHA 4RD6A 4BEWA 4MS3B 4FGLA 2QW8A 3AVTA 3LA8A 3A4TA 5AVRA 4AUKA 2RGRA 4Q82A 1K9SA 2CUNA 3I72A 1YULA 4MVJD 2K7FA 3OKCA 4ZVLA 4HNTA 1DX4A 5CEFA 4D25A 2X6QA 1V0JA 2JH9A 2I1VB 4ZALA 1YRQA 1QB7A 2C07A 1HOTA 3MNFA 5JNLA 3QU4A 3OY7A 4WZAA 1FSPA 5AIBA 1ZBQA 2ZRHA 2H2GA 4IZOA 4NCIA 3RBAA 1YZTA 4KB5A 2GF2A 1Y8ZA 3ZE7A 1GKYA 1GGNA 1WXDA 4O5OA 1EZ4A 2FZVA 5GGYA 1F51E 1MV5A 2J31A 1G2PA 1QF7A 3DMTC 1X80A 3MM4A 4YXWA 4G25A 3JX9A 1MB9A 1BAPA 2GJAA 2JJYA 3H1AA 3T38A 4CG2A 2PWZA 3DMRA 4YRKA 2ZBEA 1WPQA 3M4NA 4KR6A 3GV0A 1VJGA 3BN3A 1I7NA 3DB1A 3QX8A 3KHSA 2BFNA 1G3IA 3B6IA 3DBHA 2PA0A 4OP3A 5DCYA 1YS2X 4C3UA 3IR5A 3UHAA 3I5MA 2NV2B 4YIHA 1TYZA 5AYVA 1Y3BE 3WKBA 2HIAA 3KUKA 5A4MS 1KPGA 5FFFA 2YVKA 2QTGA 3FCCA 3BJMA 5IJZA 1C30A 1I4WA 4UM9D 2FZKA 2RHMA 3OJLA 3B52X 4X8HA 3ADOA 1VFNA 3Q87B 4ZYWA 4ZYUA 3BK7A 4QU0A 1XEXA 1WB4A 5BVHA 1W52X 2Z56A 4YK7A 4C3OB 5BMVF 4BGDA 3K1ZA 4WCDA 1X92A 2CLIB 3ZXIA 3ZZ1A 3B53X 5JMTA 1QG6A 3E5HA 3N0VA 4G07A 1EVEA 4U3JB 1CJBA 5LOVB 5D87A 2YY7A 1Z26A 5C46F 1IOLA 2NUAB 1L5RA 3DT9A 4A6PA 3ESXA 2VZEA 1ZXXA 1E8NA 3NORA 4OMCA 5DTMA 3DOFA 5HILA 1K88A 4DMFA 1IWOA 2Y1KA 4JR2A 2EZ4A 2DE0X 1QVAA 4M4SA 4NDNE 5C5CA 1FW6A 2H2AA 3HEMA 2Z4TA 1HZZA 1RYEA 3LDGA 3UFXA 3VH2A 4PZAA 5ALJA 1K75A 4NCAA 2ZJ4A 3QU5A 4AWAA 3AM4A 2C0PA 2XVYA 1KSHA 3MWEB 4PSUA 3T3HA 3VYWA 4R2WA 5CITA 1AT1A 1KFEB 3M1IA 5GJWC 1MTZA 5DYIA 3C7AA 2F8LA 1H4VB 2AZDA 2Z5LA 3FRIA 2KYRA 2ZUBA 3D4NA 3QVGB 5CT6A 4KW7A 1ZVJA 4KOAA 1QTIA 2EEPA 3OEYA 2GARA 1AF7A 2RGNA 5I48A 4NU6A 1QP8A 1RWXA 1ZD5A 2VDJA 4LZZA 4M9UA 5FOXA 6REQA 2FSVC 1D1TA 2GHQA 2GBLC 2Q5FA 2QJWA 4Q9LA 2PX3A 1BA3A 4B82A 1M10A 1J0CA 1RQXA 1X1SA 1KJJA 2P40A 4XIJA 3KPUA 3T5MA 1F8YA 1PR0A 2REXB 4H77A 4KWHA 4XCQA 3KC2A 4IKOA 5CYFA 3FKSD 3H1EA 3ELWA 3ZNOA 2YASA 3W2IA 1CY6A 1VKHA 4EW2A 1RAAA 2GOYA 2H0RA 3PA6A 2WUWE 1VIAA 1G5TA 2AX3A 1BEUB 1NXOA 1ZCZA 3MAAC 4JODA 4XR4A 5AW7A 5JAOA 3C3WA 3Q41A 4PIVA 4FGUA 5CU7A 4KN9S 4ZYZA 2P3OA 4EBFA 1LSSA 4QE3A 2PKCA 1KDOA 5IANA 1JXMA 3VR1A 5C5DA 3ZS8A 1PG2A 1QRDA 1P5FA 4D6XA 5J63A 5TS3A 4YJGA 1HLDA 5JLAA 2WYOA 4Y6LA 1V25A 4QYIB 4YJ3F 3QQPA 5H82A 2Q99A 2ZTLA 3SHQA 3OAAD 4RC9A 5B12A 2QLBA 3IMFA 4A03A 3MPOA 5DIFA 3AHDA 4TV8F 4F6LA 3DOUA 1SEPA 5D84A 5KOHB 2P91A 3E9MA 2DH5A 3A3OA 1M7GA 1PT8A 2JGJA 1JQBA 1OR8A 4LQLA 3NQ41 5EJ4A 2I1WA 3HB0A 5CW1A 1ADYA 2G5CA 2ZSJA 4GI7A 4URUR 4BNUA 4ZDJA 5LZ9A 2KWIA 1H65A 4FZ3A 2IEZA 2QTRA 5KQSA 2BFWA 1UAGA 3ESAA 4Y6OA 2PWPA 4F5YA 1N78A 4JP8A 5FULA 3RS8A 4YPVA 2L82A 1RMYA 2NUTB 5A3JA 4RTQA 3COPA 3SBEA 4KODA 3HRHA 1DCMA 1GR1A 1TZJA 1SZPA 1QO0A 4JJ4A 1AUXA 2RK6A 3RFUA 1NATA 3OZDA 1O89A 4J0IA 1J70A 1PV2A 2VI5A 4FC6A 1OE0A 2O8VA 5HS6A 3GRVA 2PM8A 2I6TA 5FRDA 3TXAA 3WY9A 4IJUA 4JWKA 3PX3A 1RQ2A 2AF3C 3HYNA 2QPOA 3NWOA 3R3SA 4GOND 4HN2A 1F2UA 3IQWA 3EGDB 4HDRA 2R6R1 4G4IA 4LOHA 3UEOA 3IAAA 3AJ8A 4C0AC 5DNUA 1R0BA 5HR5A 1UK7A 1YRYE 4HGNA 4I1UA 3D7LA 1QC5B 4LDNA 5D3MA 3UW3A 1K98A 2ZBFA 3ZDZB 5ICCA 4UOQA 1V9LA 5AQEA 3RTBA 3O8OA 1N2ZA 4RDIA 5C7IO 1RWOA 1GDHA 4CL0A 5LYJB 2YBEA 3U4AA 5CB8A 1TZKA 1QTNA 4HEA6 1SXIA 1THZA 4FFSA 4HTFB 3RRYA 4BVHA 3QIVA 1UBRS 1N7HA 3QHPA 4PCLA 3SNHA 5LR6A 4M1WA 5DXFA 1IZZA 2JJ1A 2DY1A 4AO6A 3T1YB 1JVSA 1PR4A 3ER8A 5JADA 1XNRB 2YC4C 1TAHA 3A4MA 3D6NB 3OCZA 3GMDA 4GYJA 2IA5A 1OBVA 4FFNA 3KEQA 3TS1A 3UUGA 2O7SA 4MCAA 5AK0A 3FNHA 3BWYA 1G1MA 4KWCA 3LBYA 1LD3A 1XC7A 2XKBA 4HP8A 1T0UA 3AEKA 4DCNA 3O5AA 3ZD8A 5KVAA 2BGNA 3SOPA 4JLKA 3PKIA 2LVBA 4UMFA 3IRVA 4MVJH 2LDXA 5FR2A 5JPDA 4PR0A 2RHHA 3U9TA 4V2IA 4EPYA 4DSZA 2Q5LA 1OAAA 5EIXA 1S96A 3CLKA 4IFIA 3OMWA 1DO2A 3DWFA 3H2GA 2FGKA 3RFXA 1CJCA 1ZK2A 1AKMA 1JG1A 1Q7CA 5LMZA 4C4OA 1R8SA 4H35A 4D3YA 3VI3B 1WCV1 2NSDA 5AKKA 5CDFA 3LP8A 2QAGA 3C8DA 2D06A 4GKJB 1UP4A 2UUCB 4QJ5A 3ZOZA 1LB1B 4ZVPA 1MB0A 4RIIA 1I2MA 3K70C 1OVGA 4DMGA 2YQ4A 2QTCA 4RANA 4WERA 2B4KA 4WXRA 1MAAA 4CEIB 1GSIA 3P9PA 2O8NA 3UHPA 1ML4A 2H2FA 3GA0A 4M1YA 1CUBA 2VT2A 5CX1A 3DE7X 4WE3A 1V9CA 1OFUX 2HJRA 2FUG6 3VZCA 1AO3A 1ZOLA 3C8MA 4C2TA 5BWLA 3Q3IA 1JL3A 3NHBA 4KGZA 1PNQA 1LPMA 3EDRA 4QBTA 4BLPA 5BOSA 2GLUA 1W93A 2WD7A 2N9UA 4H18A 1QZUA 4QVGA 4PN7A 1IM8A 1ULBA 5AVJA 4CBVA 5J4VA 2PX2A 1VMIA 1XTZA 1Z16A 1X94A 2V45A 3E9CA 1PF7E 2YVUA 4LOJA 5KSWB 4UM7A 5SYNA 2P67A 1GPJA 1X6VA 3Q98A 4ZREA 5ICFA 1P9RA 1QK5A 2F3PA 3LWDA 1QCZA 4ZI2A 3ZHSA 2HWXA 4OYYA 3OMLA 1ZD3A 4ONEA 1ULZA 4YAJA 5I9LA 1A95A 2XUFA 2CMFA 1IY1A 3NOVA 3IT0A 3ADPA 5CVJA 1BMFA 3RYCB 5BMVA 5G41A 5T8KC 2WJPA 2R65A 1YVDA 3NEAA 1DU4A 4G4GA 4FFRA 3V7UA 3OZGA 3U3XA 1WZUA 2MSKA 3G0CA 4GPZA 3N2ZB 2QP4A 4MYHA 3LSTA 5CDGA 2VKQA 1PK7A 2H1OA 1IB6A 2ZFUA 1VQ1A 5DPMA 3LGSA 5AOAA 2Q3FA 1TC1A 4X9XA 5E1MA 4YPFA 3S1AA 3W8FA 3CGGA 4W8HA 4ZVNA 4RXMA 4R9RA 4K9MA 1RFLA 2XOKA 1FJGB 3EA5A 3EE6A 4DMKA 1XKXA 2AYYA 4DKXA 2PX5A 4G8BA 1E3TA 5BNIA 2A88A 1W4RA 5BSFA 2GBCA 4MJ3A 2QROA 4XARA 1EGAA 1O6ZA 4JI5B 1V3VA 2J3QA 5DWQA 2W6JD 4BLVA 2XA1A 4RZ2A 3ZI7A 1WXQA 5BVGB 1ZRHA 1GLVA 3PHHA 3VYUB 5IUNC 1QANA 1ZXLA 3WYGA 5FUXA 3ZWOA 4OX9Y 2JVKA 2QRLA 1YONA 4HRYA 1V95A 3BD7A 3H17A 2W2QA 4FJ2A 4X5OA 3ISJA 4S1OA 5ECYA 5BQ3A 3P7MA 3JVDA 3O95A 3U44A 4DLTA 2R9VA 4ZT5A 4A1OA 4M6WA 3ZLVA 4AKGA 4P3OA 1DOAA 1JU3A 2G9QA 2PSJA 1EX7A 4PGGA 5CH8A 3ZYCA 2MSDB 1XO1A 1JDPA 1NVEA 1U8ZA 3FTDA 3Q7IA 4I2NA 1D4AA 2G67A 1PKXA 1WP4A 3ROMA 4ZMSA 5HPYB 2VA9A 1FUKA 1W8IA 1FRQA 3L0BA 5A9TA 5FKJA 5DHTA 3TSCA 1VZ2A 3U13A 1U0HC 1ONOA 3DD5A 1VPTA 1QJCA 3MTBA 4RXUA 3GFRA 5EQDA 5H4HA 1VJ1A 4Q1FA 3CEMA 2IBSA 4JXKA 3AJRA 4LG1A 1KJWA 2O54A 1XOIA 3CG0A 5C7LO 3VR5H 2VR1A 4S1WA 1JMKC 2OHXA 4TKLA 1ISRA 1QK3A 1UCFA 1AO0A 1LDMA 5DI9A 1EWTA 3ZE6A 1OXUA 1PYDA 2YMQA 3R0JA 2KLHA 3KALA 1W46A 1R6VA 2X19A 3D6JA 1NN5A 4BEBA 2HBZA 1KI6A 3ZV4A 2X22A 3UK0A 4D79A 2JA2A 2PZLA 5BPHA 1NKVA 4LC0A 4FX5A 421PA 1J8QA 1G8GA 3B1XA 3FLAA 1KS2A 4HZUB 2AI2A 4C2UA 2V6FA 3G6KA 2ZZMA 1IHDA 1II0A 2UYCA 2QZZA 4RMHA 1IVSA 1YJQA 5F4BA 1JAIA 2ZANA 4C1BA 2ZVDA 2AZTA 2CLHB 4BNWA 1C7QA 2CVFA 1GU0A 3SBXA 1P0FA 1J7KA 1GTVA 3TLEA 1A8UA 1W4BA 4MS4A 5ALFA 1B7GO 1NXPA 3HFJA 1MG0A 1ZBDA 4JEIA 2ZWMA 4KK3A 2VBCA 4EG1A 2MYTA 3CB2A 4CKZA 3C3CA 4HQNA 1NUAA 3INTA 2COUA 2QVCA 1K06A 1USIA 1XK6A 4BP1A 5L7YA 4B7UA 3LUDA 1CQIA 4HWGA 2YRWA 1H0SA 2GGSA 3KZCA 3O8OB 3RROA 2AHRA 3LIIA 1CG6A 3DQZA 4AD8A 2C7BA 2OPBA 1BMDA 5DGIA 1VE6A 5EPOA 4QTYA 2G17A 1FE8A 2HWYA 2R8XA 2IUTA 2JFQA 3H9GA 2WY2D 1F2UB 3R8CA 4AJHA 5IVPA 3VZPA 2WTNA 5JYEA 3IVAA 2I2XB 3T6KA 4WECA 2JJ8A 4Q7JB 1CY1A 2A0WA 3TN7A 2JBAA