4XJTA

Human cd38 complexed with inhibitor 2 [4-[(2,6-dimethylbenzyl)amino]-2-methylquinoline-8-carboxamide]
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
241
Chain Sequence
WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transferase
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Discovery of 4-Amino-8-quinoline Carboxamides as Novel, Submicromolar Inhibitors of NAD-Hydrolyzing Enzyme CD38.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 241
sequence length 245
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4xjtA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xjtA02
1KVUA 3ANLA 3C1TA 1RM0A 3VPSA 1X15A 1YB1A 1K2WA 1JW9B 1GADO 4H15A 2W8ZA 4Y6PA 3RSHA 2FP4A 2Y0EA 3I9MA 2P4QA 3IKTA 1QP8A 3ROPA 3OBBA 1U3UA 4E12A 4RL6A 3GR6A 3BHJA 4WNCA 3DEYX 1PEDA 1W8DA 3FNFA 1NR1A 1AXEA 3EY4A 1XA0A 2YW9A 1YXMA 4KWHA 2GRAA 2X5KO 4D43A 2GR9A 1PZEA 1EVZA 3JQ7B 3H65A 4HBGA 2DBRA 2CMDA 1NVTA 3AU8A 4HP8A 2VZ9A 4QTZA 1GAEO 3BMCB 5ADHA 4INAA 4J7XA 2D59A 3GUYA 1UP6A 3AI1A 3AUTA 3VKUA 1HE5A 4PVCA 1P1HA 4XX0A 3NYWA 4NBRA 3RBXA 4EJ0A 1B15A 1MA0A 1FXSA 2CZCA 3I6QA 4DA9A 1O8CA 4XDZA 3KZVA 4ZU3A 3RFTA 3RUAA 3GVCA 1T1SA 3HN7A 3QVSA 1GV1A 3CTMA 4Z3KA 3DOJA 2YY7A 5DF1A 2JD0A 4JIGA 2P9EA 4O1MA 1E6EA 1CJCA 1NHWA 1T2AA 4KUGA 3RCBA 1XSEA 3GRPA 3BHMA 4HADA 3ROMA 1SZJG 1HRDA 3E03A 4UVGA 2OP0A 5ICSA 3TL3A 1V0JA 4JROA 1DJNA 5A5EA 5I7EA 5L95A 3HN2A 4CQMD 1YS4A 3NT2A 1JU9A 4ZQBA 4GSLA 1DSSG 2I3GA 4PLVA 4J7CA 4D42A 3DFUA 2BH9A 2BFOA 2NVUA 4CODB 1HE2A 4RV9A 5F1OA 3LC1O 4FJ2A 3U0BA 3B70A 1G0NA 3B1JA 4L8VA 3C8MA 4AJPA 4KQXA 3JD4A 1H2BA 4QQRA 3NJ8A 3P19A 4II2A 2D0IA 2BLLA 1LU9A 2JJYA 1PJBA 2PR2A 3KYDA 4WLUA 5G4KB 3WGYA 3SVTA 1HF3A 4D3FA 2BELA 4WCFA 3IDSA 3SJ7A 5A06A 4D3SA 5DP1A 4Q3NA 2BFAA 4HXYA 2HU2A 2JHFA 5TF4A 2FSVA 1MXFA 5LDHA 5HBRA 4ZA2A 4DREA 4Q3CA 2ZQZA 3GDGA 4NJMA 4JBIA 5MGBA 1H2HA 1PX0A 4O5OA 3UAGA 1XU9A 4DUPA 5FFFA 2PKQO 4YJFA 1Q7BA 5A02A 4P4LA 5TT1A 5EQFA 4FOOA 1I36A 1YB4A 3JQ6A 2PGLA 6ADHA 4RF4A 3JSAA 3B20A 3CUKA 3R0IA 5TX7A 4AJJA 1U7TA 1Y8RB 2Q3EA 2Y93A 4QSMA 3W6UA 3RASA 4GQAA 4CM7A 4U5QA 1A7KA 2E4AA 2DKNA 2V6BA 4NK5A 2O3SA 2ZB4A 3HUDA 5C3MA 4LVCA 4FFMA 2OP1A 5EERA 3U4CA 2GZ1A 3FPCA 2VTDA 3O26A 4TRRA 4J1SA 2YQ4A 3I52A 3DONA 1R0SA 3CE6A 3I6IA 1OFGA 4BHTA 1DC6A 4L73A 3PXXA 5U9CA 4TMFA 2VUUA 2XPCA 3OF2A 5JAIA 2C20A 4AJOA 3KO8A 3AFNA 4ZRMA 2GN4A 1KIFA 2AMFA 3ZNNA 3EHEA 1VSVA 1RYEA 3IS3A 4B4OA 2CF6A 4RLHA 4CUKA 3LC7O 3QVXA 1O89A 4NR0A 3W1VA 4M87A 5LDGA 3ZI0A 2O3JA 3D7LA 1N7GA 2YFQA 4ZD6A 1NQ5A 3F5QA 3I23A 4ZICA 5CEEA 3M1LA 3JQGB 5DBIA 3W4IA 3QRWA 4F3YA 5DOZA 3ZW8A 3U09A 4DC0A 3D3WB 3UN1A 5BNFA 4FR5A 4GAEA 5EN4A 3W8FA 2AQHA 2HKIA 4D0SA 4WOKA 1LDGA 1U2DA 2OL4A 1P0CA 3CZMA 1D7OA 1K0UA 3NTOA 3ZV4A 1PGNA 1ZW1A 2G76A 2OUIA 4E2YA 1FK8A 1P1IA 2GYYA 1W73A 2J3JA 4ALMA 3TFOA 3ON5A 3EVTA 1E6WA 4WECA 1C1DB 1DEHA 1QXSA 5A03A 4BNZA 3AUAA 4GLLA 3VDRA 1NWHA 3WTCA 4CMJA 3FF4A 3GH3A 2QYSA 3LC2O 5CDSA 1U5CA 2A94A 2ZB8A 3DC2A 4JGBA 2UUPA 4ZRNA 1DC5A 4XQCA 8ADHA 1DC4A 2VWGA 3TZHA 2J3IA 3ZV6A 4CM6A 3OIDA 5KJEA 5JY6A 3MEQA 4J91A 1MXHA 3GNTA 3WLFA 5HS6A 4FC6A 3WXBA 4MP3A 3GEMA 1VL8A 4U6SA 4W82A 1SPXA 3IUPA 3JQCA 1IB6A 4TRJA 2YJZA 4JJIA 4ALNA 3I9LA 1ARZA 3AUSA 1LDMA 4K9DA 5EPOA 3TZ6A 3L4SO 3VKVA 2RIRA 3KYCA 1HYGA 4WK6A 3DBRA 4FS3A 2C54A 4YEDA 3WIEA 3O03A 2FSSA 4Z0PA 1BW9B 1IZ0A 2FOIA 4DTIA 4OYRA 4GMGA 2ILTA 4Y9DA 4BQPA 1E7SA 3F1LA 1E1LA 3AY6A 1DIGA 2EGHA 3IMFA 4ROSA 5JAQA 1R16A 4XGNA 4BMSA 4Z0HO 3K96A 1ZSVA 2QHXA 3EAGA 1E3IA 3BHIA 3KVOA 4IY1A 4E5PA 4JBHA 5AXCA 3K30A 2WEKA 3GHYA 3GGOA 3BTOA 1UXJA 3QVWA 1T24A 4MP8A 4E5YA 3G17A 3IJRA 4KUEA 2W2KA 3ZWBA 5KVVA 1E3EA 3RBVA 4YCAA 4WASA 2OBYA 2VHVA 4BNFA 4AJEA 1L1FA 1C1XA 1ZMTA 3IQDB 4R5HA 3DWFA 5IN5A 2I65A 4A5OA 3E6AA 4B4VA 1EDOA 3G49A 1GCOA 5TLSA 1DRUA 1I10A 1X1TA 3JYOA 1Z74A 1DAOA 1C0LA 1I3LA 2NNLD 4OO3A 1GQYA 4Z6KA 1N92A 1TEHA 4CM5A 4IDDA 2GCGA 5AYVA 4J43A 3SBOA 1VKNA 3L0DA 4RLSA 3VOSA 3O9ZA 4EBFA 3OP4A 3H3JA 3DZKA 3ONDA 4AJHA 2PD4A 3T4EA 3SX2A 2Y1GA 4F45A 4G2NA 1C14A 1PJLA 3F3SA 4EUFA 1BDMA 2HDHA 2NWQA 3X2FA 4PLFA 3I1JA 1YBAA 4IMRA 3UGKA 1BHSA 5GMOA 1P77A 4IDGA 3TDKA 1ML3A 3LSYA 4M54A 3ZV3A 4W7HA 4A73A 5IJZA 1E6UA 1R0KA 2WE8A 3VH4A 4CM8A 1LSOA 4DBZA 4JBGA 1ID1A 1KEWA 3ZWAA 1RWBA 3V5NA 4UUMA 1S7CA 2WE7A 3STHA 3FD8A 3H2ZA 1M6HA 3K9QO 4YJHA 2XXJA 4DWVA 3VVCA 4CMIA 5L51A 1I3KA 5ITVA 3BYZA 3RI3A 3L4BA 3UCFA 3GC6A 1B8VA 1TB4A 1Y5MA 1ZBQA 4NBWA 2PGDA 1QG6A 3F4BA 3LVFO 2PTGA 4C4OA 2QRJA 4MIOA 1CQJA 2BHLA 3ZU3A 3LT0A 2P91A 1J0XO 1V35A 3IP1A 3RKUA 4BB6A 4KDFA 2O23A 4AJNA 3NRCA 5KNLA 4RQUA 1GR0A 1XYGA 1I24A 3C24A 3PPIA 5EL0A 2PZLA 1PSDA 3BMNB 1P44A 4CQLA 2GUGA 2HRZA 4MKRA 4BGIA 4D3DA 1DIBA 4YBZA 2B4RO 2PLAA 5DCWA 5F5LA 3KYBA 4TRMA 5KVSA 4I5FA 2RH4A 1T2DA 4GVLA 3SLKA 4B4WA 3UUWA 5JPIA 4TZTA 4BNVA 4N18A 3BMOB 4XKJA 3PHGA 4I08A 3PI7A 1J49A 1R37A 5I9LA 1VSUA 1ULSA 4LRSB 4ZQGA 1YVEI 4EGFA 2IEDA 2C2XA 2UAGA 3WMXA 2OORA 4MVJM 1PU2A 2HMWA 4XD2A 3ZWXA 1QR6A 4IBOA 2X5JO 5I7VA 3JD3A 1NQTA 1C3VA 4C7JA 2E6UX 3LT4A 4ONEA 2POQX 4U0KA 5IZ4A 4J3FA 3Q2KA 3RC2A 2FR1A 2NVWA 4RPLA 1VI2A 4HX5A 1AUPA 3AUUA 4HUJA 2C5AA 3UOGA 4M1QA 1IULA 4CMBA 2AQIA 3HWRA 2VHYA 1P1KA 2VYVA 1LRKA 1PL6A 4YT5A 1OBFO 1HETA 4XGIA 4GWGA 3F46A 2IEBA 1O0SA 5I8ZA 5KVCA 1G1AA 4YTEA 4YT4A 3QP9A 1K5HA 3PWSA 1F17A 5HTOA 1SNYA 1MC5A 2FR0A 4AL4A 1IPFA 3D4PA 1VM6A 2E37A 3MOIA 4N5LA 3EYWA 3WR5A 2EKPA 2B69A 3L9XA 3RUDA 1EVJA 3GDFA 3RUEA 3ZU4A 1A7AA 5JAMA 5KWEA 5A3VA 2ZTUA 2EWMA 3JQ8B 4F6CA 3E9NA 3Q11A 3C85A 3NGLA 1A4UA 4O0LA 1YE3A 4NFSA 3WMWA 1EDZA 3SC6A 3NV9A 1M75A 1LC0A 2HK8A 3FHLA 1YBMA 5IDXA 3WNQA 3NEPX 4YRDA 1ADBA 4YT8A 4BO2A 3NTRA 3OJOA 5G0TA 3T4XA 4CM9A 1YQGA 3ZHZA 5B4VA 2RHRA 4IS3A 3ZWCA 5CDGA 4R16A 4Y98A 3S2EA 1WWKA 4LMRA 1J6UA 4FSHA 2JCXA 5IDYA 3PHLA 1TT7A 1E7RA 3VHRA 4YAIA 1T25A 3C1OA 4A26A 5L4SA 4NIMA 1RYDA 3HFSA 4CLRB 1UAYA 3ZU2A 3A28A 4RF5A 1I5RA 3ZNPA 4CLOA 3RIHA 4NDNE 3RJ9A 3WGHA 3DZIA 3UCEA 2VYND 1HLDA 5ES3A 1PQWA 4R54A 4UUNA 4MKZA 4Z3DA 2CDBA 2YHUA 2CD9A 4HFRA 3SEFA 1WDLA 3CXRA 2OHXA 4R41A 1VL0A 2TMDA 3C3XA 4XQEA 3MJ4A 4WEOA 1R4MB 4CM1A 3QWFA 4GX1A 2O3QA 4CM4A 4AVYA 1A9ZA 4PIVA 2CY0A 5JYDA 2V7PA 4ND3A 3RJ5A 5TT0A 1ZNQO 3NJ4A 3GOHA 4FCCA 4DLLA 4BO6A 1A9YA 3ETEA 3PK0A 5BNTA 1MLDA 2H5LA 4FW8A 4UVHA 1DOHA 3MCVA 3U62A 1NVMB 2X58A 1NPYA 1EZ4A 3K8ZA 5L40A 3IP3A 4OMUA 3CZRA 2BRUA 3DHEA 3O4RA 5EIOA 3LYLA 1JWBB 4KWIA 3X2EA 3WWYA 3SLGA 2R6JA 1B0AA 3KSDO 1DHTA 1H94A 1O6ZA 1BXZA 1QV7A 1XHLA 4L75A 1LC3A 4R1SA 2IODA 5G0VA 1GYQA 2DPHA 1UJMA 4WPGA 4TQGA 2B35A 4CQMB 4BO0A 2GDZA 3GFBA 4XJSA 5CP8A 4D79A 9LDBA 1YO6A 4RVFA 1K89A 4CR7A 4N54A 4BNGA 1B8UA 4EEZA 4IDEA 1ZSYA 2VT2A 4CV1A 5KKCA 2HUNA 5CDYA 1WP4A 2YV3A 2NU7A 4WGGA 9LDTA 2NLOA 1Q7CA 2QX7A 1TLTA 4IXTA 3N58A 2E48A 4NU6A 1YOVB 5TNXA 3OSUA 5EINA 4W9NA 4N5MA 3PWZA 3S2FA 3ULKA 3VZQA 2JCVA 2CVQA 2ZYGA 2WDZA 2DFVA 2VQ3A 4PGFA 3Q6IA 5DULA 2D4AA 3T7EA 1GUZA 3WYEA 1ZZEA 3PJFA 3ZV5A 5C7IO 2DQ4A 1GEGA 1ONOA 3JQDA 1H6BA 1MG0A 1F14A 1CIVA 1UXHA 3CSDA 3QHAA 1NASA 4OSPA 3MTGA 1PGJA 2GPTA 2X4GA 1PGQA 4TROA 1BG6A 4Y8VA 5DBFA 4PLYA 2OO5A 3MWDB 3OFSA 1EBUA 4U8GA 1T4DA 3U4HA 3RC9A 3V1UA 4DRYA 3PQFA 4FC7A 5LC1A 1UDAA 3L07A 1TI7A 3HNPA 2P5YA 2VOJA 3WYBA 4EUEA 4KMSA 1X13A 3PDUA 5A05A 2PA3A 1XU7A 3PZBA 1BRMA 3KLMX 4IXWA 1E3WB 3F47A 2PGJA 5BNIA 3AWDA 4YRAA 5AXAA 1FMCA 4GBJA 4FGWA 1MC4A 1IOLA 3D4NA 4E0BA 4DMLA 4DXHA 1AHHA 2B37A 2J3HA 1H9AA 3WGQA 3ZNOA 4ALIA 5K6AA 7MDHA 2C2YA 3PTZA 4BNJA 4RPGA 5IZCA 5CFZA 1ORRA 1QORA 3L9WA 3OETA 4KUHA 1HWYA 2LDBA 1GV0A 3GQVA 4XRGA 5A9SB 4YJGB 1Q7GA 3CKYA 2EP7A 2WWRA 3H5AA 3GNSA 4PZEA 1A5ZA 1LSJA 4DMMA 1ZK4A 1DLJA 4GMFA 4B7CA 4E32A 3WIDA 3PJEA 3GVPA 3HDYA 4WCDA 4D41A 3U3XA 4DYDA 3R6DA 1Z6ZA 4RQTA 4D7AA 3DZJA 4KQWA 4B3JA 3Q0EA 2BI7A 3DB2A 4PLHA 3RC7A 3S1LA 4E4YA 1ISFA 3BMQB 1TT5A 1ZJZA 4R9RA 1FF9A 3GF4A 3GMSA 3JYLA 1PJ3A 2YDYA 3GZNB 5COQA 1EEHA 2DVMA 5BSHA 1LSSA 1VL6A 4BOYA 3BTVA 3WQQA 4E2XA 1ISHA 4W7IA 5A9TA 3ZGYA 1FJHA 1C0PA 3Q1LA 3TJRA 3L4BC 5CEFA 2BGMA 1R4NA 3EZYA 4XCVA 4WLEA 1WDKA 4ITUA 1M6WA 4QFCA 1DIHA 1I8TA 1YL5A 3ZWOA 1NBOA 2P5UA 1N9GB 1XEAA 1N1EA 2ZB3A 3QLJA 2VYVD 1FDWA 4OM8A 5IF3A 1YDEA 5HS4A 4IJUA 2X1HA 5FWNA 3JQAB 2VRBA 3G79A 4P38A 3GAFA 2VUSA 4YACA 4OQZA 3EVNA 4RDHA 4YAGA 3ENKA 4UVIA 4WE3A 1D8AA 1PS0A 5H82A 3ROKA 2YUTA 2EW8A 4BV8A 3ZDFA 1DIAA 1NFFA 2BMAA 3AM5A 3G3EA 3WJAA 4DQUA 1P0FA 1P9LA 2O48X 4OOFA 1PGOA 1Q1NA 1QKIA 1Y7TA 4RZHA 4DGSA 2PY6A 1AN9A 4PLCA 1Y8QB 4ID9A 1G0OA 4MVJA 1EQ2A 3A1NA 1T2EA 5L4LA 4GLOA 4E30A 4RVUA 4XJTA 2V6GA 5JS6A 5CEJA 4WKGA 4TKMA 1JKFA 4BKQA 2ZATA 1DFIA 3GVIA 1SOWA 4DVJA 1YKFA 5KVQA 4LGVA 2VN8A 2B83A 2YFHA 1KOLA 1HSZA 1B3BA 1UR5A 2VRCD 3JD0A 1KVSA 4CM3A 3AJRA 2JHGA 1CF2O 3K2BA 3PLNA 4IMPA 3W6ZA 3LLSA 4AJIA 4BNWA 1I32A 4B3IA 3K6JA 4A2CA 4BNUA 1TXGA 2Y1CA 2EP5A 1N8KA 5L3ZA 1RJWA 1T2CA 3WFJA 2X0IA 1M76A 1EUDA 1KYQA 2D1YA 4MVJF 1PTJA 4URFA 1YBVA 3GN2A 3HE3A 3D0OA 1PQPA 3CINA 1QV6A 2VHZA 1CRWG 4DLAA 2I6TA 1K6JA 1LQTA 2PZMA 4CLDA 2W2LD 3NX4A 3ORFA 2WYUA 2ZJ1A 1E1NA 3V1YA 1M66A 2NACA 3OJEA 1HDOA 4RF3A 4OXNA 3DR3A 1LQUA 3JQ9C 1PZHA 4NPCA 2CFCA 3HDHA 3RVDA 4MVJH 5IXYA 3JV7A 3Q9UA 1N7HA 4P4NA 5CG1A 2HQ1A 2RH8A 1OC2A 1GY8A 2P9GA 3DBHA 4KP7A 3S2IA 4Z9FA 1E1MA 3RUHA 4BO4A 5CG2A 3VH3A 3JYQA 3UICA 4AJ1A 3QWBA 2VTEA 4DIOA 1HYHA 4J2HA 2O4CA 1E7WA 1LLQA 1NX6A 1T2FA 5B4UA 3OEYA 4G5HA 2F1KA 4LSMA 4XB2A 3RFXA 4E33A 1BXGA 2QYTA 5GZ6A 5IAAA 3OH8A 2OFPA 4IGFA 4J6FA 3PFFA 3NUGA 4K26A 3DBLA 3EZLA 1VLLA 2R00C 4P4GA 1DRWA 1SO8A 2DPGA 2JKVA 3AOGA 1B2LA 2O3UA 2V65A 3GPDG 3ICCA 1YL7A 3HG7A 4H7PA 4GSKA 4OQYA 3PYXA 2PZKA 3DZHA 2PV7A 1NYTA 5AXBA 4MPDA 2NTVA 3GEDA 4OL9A 5KIAA 4LISA 3NAQA 4FFNA 2B36A 3OIGA 3UH1A 1YDWA 3DZBA 4JJGA 2NVUB 4WLFA 2NTNA 3WGGA 4BGVA 2WD7A 4EITA 3HDJA 2AE1A 2JFGA 4WUVA 3KYDB 3JQAD 2B5WA 2FWMX 4MVJE 3OA2A 3DMYA 4UVDA 2YV1A 3ANMA 4WCFB 4TVBA 4A7PA 3ITKA 2ZTVA 5JC1A 1PZGA 1XDWA 2J5KA 1ZXLA 5G0WA 2FR8A 3V2UA 3KLPX 4O59O 3FN4A 2HK7A 4L4SA 1H9BA 4UEOA 1ENOA 5JE8A 2VWPA 1HL3A 3IKVA 1ZKMA 4NJMB 3KBOA 4E2WA 3H5NA 5L7YA 4PG4A 1RM3A 4YJFB 1T26A 1YL6A 5F21A 4R69A 3QY9A 4R1UA 4UEJA 3H6KA 4J49A 2RAFA 1NAHA 5JFOA 1U1IA 3OQ1A 1GZ4A 1RKXA 5A04A 1U3TA 3VPHA 4BB5A 1H0KA 1CQIA 3COSA 2X9GA 2JFHA 1K6XA 3PEFA 3I9OA 1M2WA 2G17A 1UP4A 3MTJA 2FHSA 4UEKA 2HK9A 3K5PA 2X9VA 3OQBA 1HE4A 4G81A 2P2SA 1X7DA 4XB1A 1JDJA 3UHAA 1GZ6A 2I99A 2OBNA 5CHEA 4YQZA 3NDRA 5JCJA 5ER9A 4Z9XA 2Q45A 5I9NA 3KOUA 4YVFA 4CV3A 2J5QA 4MVJG 3QQPA 3IJPA 3KRTA 1HDCA 4RPKA 1F12A 2FPPA 3DAGA 4BNXA 2ET6A 2X5OA 3RAJA 3G0OA 3MJSA 3QVOA 3VH1A 2Y67A 1XLTA 4W9NC 3H7AA 2GD1O 1U5AA 3AI3A 3KEOA 3FBTA 1Y5RA 5JSFA 3D1LA 4CUJA 4OXKA 4I9HA 4NH4A 4OXYA 1ZCJA 2NV6A 1QSGA 1U4SA 2VHXA 5TIIA 1NTOA 1TA4A 1AXGA 4M8SA 1OOEA 3ADOA 4MVJI 3M2TA 4OIMA 2HO5A 1JAXA 1NAIA 2P9CA 4L9RA 3LQFA 1ZFNA 5BSGA 3JQFA 3HJAA 1A27A 1DHRA 2UV8A 1JVSA 3LZ6A 2JAPA 4IGEA 1ZMOA 4AICA 1U8FO 4M89A 1ISJA 7ADHA 2EIHA 1JN0A 1LDYA 1PS9A 4KDEA 3P2YA 3VTZA 4E3ZA 4I9UA 1JAYA 4J9UE 2ZJ0A 2DBVO 1GUFA 4NBVA 1ENPA 2YHIA 4DBVO 3TL2A 3VDQA 1QRRA 5BR7A 1Y81A 5LCXA 4Y6RA 1XKQA 2EF1A 3QWAA 3ZWYA 1B7GO 5GY7A 1C0KA 5JDCA 3ONFA 3IL2A 3CMCO 3FWNA 5AVOA 1XWFA 1PZFA 3DTTA 2I5PO 3PLRA 1QYVA 3L6OO 2GASA 4FPXA 5JC8A 5K6AC 4B4UA 1W6UA 3A06A 3ZWMA 5IZCC 3SJUA 1DJQA 1EBFA 3WNVA 3DAFA 3ZWWA 3U5TA 1ZO8A 3JTMA 3MZ0A 3K73O 1VJ1A 3P2OA 5THKA 2XF8A 1ZUD1 3DL2A 4FGSA 2X7HA 1XR3A 5T6BA 1YQDA 2O2SA 4R01A 3QJ5A 1OAAA 1U9JA 1J4AA 3OJLA 4J4TA 2GGSA 5AQ1A 3PFWO 1I01A 3JD2A 4P8RA 4JQCA 4J0FA 3GNQA 5BSEA 3C7AA 4ND5A 3KYCB 3VPXA 1HYEA 4DPKA 1UDBA 5DZSA 3DBRB 4JN6B 3TSCA 4YAJA 4LCJA 5CDTA 4II3A 1MX3A 4FFRA 1QMGA 3PIIA 3HFGA 4I5GA 3ZN2A 4BO3A 4Z9YA 3D5QA 3INGA 3VC7A 5BT9A 3ZHBA 3HQ4O 1NQAO 4XIJA 2IXAA 1UXKA 1EVIA 1HDRA 4WLOA 3WDSA 4Q3DA 4ZGWA 1EFLA 1K3TA 1PR3A 3CMMA 4BO7A 1QYXA 1GL3A 1O9BA 2GO1A 4E6PA 1SMKA 3ZU5A 4E5MA 1GFSA 1XQ6A 1U28A 3MOGA 1JQBA 2Z95A 1IUKA 4FJ0A 1ENYA 4XZ3A 1EUCA 2HLPA 3FNEA 1E77A 3V1TC 2O7SA 1RM4A 1C1XB 1NQOA 1UZLA 4BNKA 1P3DA 3RWBA 2OMEA 1Z7EA 1Q0QA 1R0LA 3WB9A 4OSOA 3TWOA 5IN4A 2BFPA 3LDHA 3WSVA 4L76A 3SXPA 1Y9AA 4CMCA 4B8WA 4IUYA 1I30A 3ZH2A 3TQHA 1E92A 2CDCA 3OEWA 2JD1A 4G65A 1PJ2A 2DLDA 4CMEA 2EGGA 2YYYA 4NFHA 1C0IA 1X0VA 3GFGA 3ZWVA 2C7GA 1HZZA 1HE3A 5B1YA 1PGPA 2P68A 1IHYA 2X0NA 1IY8A 2FPIA 2B5VA 3L6EA 4QFDA 1S6YA 1V3UA 5F5NA 3OECA 4NBUA 1H6CA 2JCYA 1DDOA 5KJ6A 1P1RA 4XQ9A 1PS8A 3RUFA 1BTOA 1B16A 1JA9A 3INRA 1YONA 3JQ9A 4DLBA 3EMKA 3H5RA 3V2GA 4IZIA 1OZAA 1SC6A 3AI2A 4IDAA 4ZQEA 3ZCXA 4PG8A 3IUSA 4GGPA 4RCVA 4R1NA 4CM8B 5TC4A 1EE9A 4O6VA 3H9QA 2PD6A 4HNGA 4FQ8A 4U6QA 3F9IA 4NG5A 2GLXA 2DT5A 1D1SA 3H4VA 2Q2WA 1WAMA 4YJHB 4RVHA 2AEMA 2NSDA 2Y1FA 1EVYA 4CMIB 1EQUA 2AQ8A 1LDBA 3KXDA 1H6DA 4FOSA 4PG7A 2Q1TA 3NGXA 3QA9A 2RBEA 2VHWA 3AM3A 3RUCA 3CH6A 5KOIA 2I76A 1O5IA 4BO1A 6LDHA 4PRLA 4JLWA 4IINA 2R00A 2Z5LA 1V3VA 4LSWA 2VWHA 1YB5A 1WMAA 5BQFA 3RFVA 2Q2QA 3DMTC 1YJQA 5JDIA 4GVXA 4FFOA 4J16A 1HLPA 5G0SA 4CPDA 1PWZA 4HNHA 4JCOA 5C7OO 4CQLB 3MJTA 1KETA 3H8VA 2XOXA 4GX2A 3O38A 2X8LA 4L0QA 1K6IA 3PP8A 1AGNA 3AM4A 3KETA 2YV2A 1I33A 4EI2A 4P22A 4BMNA 1WLYA 3GG9A 5T64A 3ZHYA 4IDCA 2VZ8A 3H2SA 1KEUA 4O63O 5DDIP 2QZ9A 2EW2A 2GN8A 4IPTA 2OXIA 5TRTA 4RVDA 4WOJA 3S55A 4HV4A 4BV9A 4BNHA 4BKUA 2Q2VA 4XA8A 3AY3A 3WWZA 3SC4A 3RC1A 1I0ZA 2DBQA 1ZH8A 4PVDA 1SB9A 2DU8A 3VTFA 4ALLA 1ISMA 1SBYA 4R3NA 4YB8A 3FR7A 4PLPA 3PIDA 5JCJD 4KOAA 2AQKA 2FRDA 4ND4A 1KY5A 3O8QB 3OMLA 5AXDA 2I67A 1KEPA 1WZEA 3HB4X 1WNTA 3TZQA 1U2GA 1T4BA 1W4ZA 2H6EA 2O4UX 1QYWA 4AJ2A 4J90A 2SCUA 2G82A 4EJMA 1CEQA 2VUTA 4N7RA 1OMOA 1R15A 2V6FA 4IJVA 2QQ5A 5F3RA 1Z7BA 1GDHA 3LK7A 1ENZA 3JQ7A 3F4LA 4M55A 2CF5A 2NU6A 3DAPA 3Q2IA 1O95A 1WW8A 4I9NA 2FZWA 3BMCA 4NU5A 1ISGA 1EE2A 1GEEA 2PH5A 2Z1NA 3G1UA 4EYEA 1FDSA 3AW9A 3C7CB 2CDAA 1AE1A 4Y6SA 3ZZNA 1ADFA 4UUOA 4XGKA 1P1FA 1SEPA 5C7LO 1UZMA 3BMQA 2O7QA 5L7TA 3E5MA 1EFKA 2I66A 5HA5A 3E8XA 1E5QA 1F8FA 3VZSA 3W4KA 2EV9A 4ESOA 3TNLA 3KHUA 1P45A 2OZPA 3D4OA 2FN7A 3DBVO 5T8KA 1LLDA 1NR7A 4LRTB 3W8EA 4E13A 4BNYA 5DNAA 2IYOA 4A27A 3PHIA 5TJ9A 3P5SA 1M67A 5C37A 5ILGA 1BWSA 4OOEA 1MUUA 4A10A 3GDOA 4DYVA 2GZ3A 4W6ZA 1EK6A 3QWHA 3PQEA 5CPBA 3PJGA 2C7VA 3FI9A 5AOVA 5JLAA 3FRJA 1HT0A 1ZVMA 1NP3A 5JO0A 3BTSA 4XYLA 1V6AA 1HDYA 3WFIA 1A4IA 1X1EA 1Z45A 4R9SA 2P4HX 3TN7A 2Q1UA 2UYYA 1D4FA 3PVZA 2D8AA 3QIVA 1QLJA 2Y05A 3OJFA 1ZJYA 4J7UA 3LF2A 4XIYA 1LUAA 4OAQA 2Y66A 3I9KA 1XQ1A 2Y99A 4BS9A 1VE9A 5J23A 2X9NA 3ETGA 2AXQA 4A03A 3FNHA 2B4QA 3EDMA 1E0DA 3GAZA 4CLOB 1DRVA 2JFFA 1IZ9A 3DZGA 5EMHA 1HDGO 3NT5A 1DFHA 1Y6JA 3HDQA 2VWQA 1LI4A 1PJ4A 1ISIA 5G4KA 4DPMA 1GQQA 4PFJA 1PQUA 3I9JA 4PLGA 5K9ZA 3JQFC 3KUXA 1YWGO 5H81A 3E9MA 3WQSB 3ROQA 1ADCA 1Z73A 1V3TA 2J6IA 4CM4B 5KJFA 2DUWA 1OC4A 3MJVA 2VCYA 1XELA 2OOSA 1F0YA 2Q1WA 3CEAA 4HWKA 4YAEA 3BTUA 4ZVVA 3BAZA 4X54A 4AFNA 4CLXA 3HADA 2WTBA 3PGXA 1PJTA 1XG5A 5JDCC 4E2ZA 4Q3BA 5F1KA 4F46A 2AA3A 1CWUA 1TVEA 5I7FA 1Y8RA 5U4QA 4XR4A 3LT1A 3H9EO 1UP7A 4IIUA 4YAKA 2C29D 3KEQA 4R5MA 3WYCA 1O94A 2DFDA 3EUWA 4RO0A 3FTPA 5COAA 1DC3A 5CAEA 2Q1SA 2WYWA 4XDYA 3AU9A 4FBGA 3DO5A 3PDJA 3R3SA 4QECA 2CVZA 3DXFA 2WYVA 2XXBA 4MO2A 5GZ3A 5T67A 2D5CA 3AK4A 3PZRA 4L4RA 2C0CA 4R51A 4J1NA 2FMUA 3WBBA 4MP6A 4Q39A 1NXQA 1R66A 3UVEA 5K0ZA 1B14A 4PLTA 1UAGA 1NHGA 3F5SA 1Y1PA 3U9LA 3JQGA 3K2EA 1SB8A 2WD8A 2ZKLA 1JWAB 2EXXA 3D3WA 3F1KA 4QXMA 5ITWA 3H9GA 4KTVE 1I3MA 5TQVA 2Q46A 3EK2A 5G0UA 1LTHR 4FJ1A 3WGZA 4B7XA 4LCEA 2PH3A 4CV0A 4BL5A 4IQ0A 3KB6A 1T1RA 2GN9A 4RVGA 2J3KA 1DAPA 4RORA 3E82A 3JYNA 3GK3A 3IAHA 1X7HA 2DC1A 3NDJA 3PGJA 4UREA 2VZ0A 4WEQA 4GX5A 2QW8A 1Q2XA 2Y1DA 1C1DA 2QIOA 4LW8A 1E5LA 3UW3A 3KTDA 4OKNA 1WMBA 1ZEJA 4CLEA 4BNLA 4QX6A 2AE2A 3U4DA 4CM9D 3N7UA 4WNIA 5TGDA 4CMEC 3GGPA 4PLZA 4ND2A 3ZWNA 2DBZA 4I1IA 4NHEA 2IRWA 5T5QA 4YQYA 1GD1O 4GWKA 4IIVA 4JXKA 4WLVA 4CL3A 3KSZO 4BNMA 1NM5A 2IDZA 2DTEA 2WJPA 4J4BA 3HHPA 4PN3A 5HWSA 2AG5A 1PWXA 1VRWA 4R68A 5FYDA 3JCZA 5DT9A 1ZEMA 1HDZA 4CR8A 4OHUA 3KSUA 3ABIA 4FFLA 5JBIA 3PRJA 4MDHA 2HMVA 4L74A 3WLEA 4CMKA 3GZ4A 1F8GA 2NU8A 2DTDA 4IQGA 4DQVA 3DMTA 3C7DB 5JMPA 4EZBA 4NMHA 2ZTMA 4ZN6A 3I4CA 4FFPA 4CL8A 1TT5B 3DOCA 1BW9A 4RVSA 3D5TA 2X0RA 2IZZA 4DIBA 5TJHA 2E82A 3ZWPA 2C5EA 5ER6A 2IXBA 3BXXA 1DBVO 2HJRA 1R4NB 4YYZA 2X0JA 2IE0A 3AFMA 2QRLA 3LF1A 4QEDA 3KM0A 3WBFA 1LDNA 5JO9A 2FY8A 4XYBA 1AHIA 1P31A 3T7CA 1DFGA 3GMDA 2ZQYA 2HJSA 5JDIC 4PG6A 3NDIA 3TF5A 1U8XX 4U0JA 2Y1EA 2PD3A 3Q9NA 5IFLA 1SAYA 1VKOA 4OJNA 2EJWA 5TS3A 2GNAA 1Q0HA 2EG9A 1HKUA 5JCXA 4GL4A 2BGLA 2ZK7A 3UCXA 2D2IA 3GVXA 1KS9A 1LLUA 1XIVA 2NU9A 3FWZA 8LDHA 5A4DA 1CDOA 1GQ2A 1U3WA 1ZK3A 2NQ8A 4PG5A 3FPLA 1Z82A 1N2SA 3HSKA 1ZK0A 4QUKA 3GPIA 3DHNA 2ZTLA 1E3JA 4YDRA 1GU7A 2GN6A 1V8BA 1H93A 4JNKA 3HZZA 4JX8A 2D5AA 2W4QA 3JQBC 1LEHA 1D3AA 3VH2A 4D0RA 1QLHA 1Z75A 2YZ7A 2AW5A 5ICMA 5FF9A 1YJ8A 2D3TA 4MINA 4W99A 5U1PA 3MWEB 4BNIA 4ZHSA 1A71A 3WGIA 3ZHXA 3H3FA 1FDVA 4J1TA 1PJQA 4TZKA 4LMPA 3GGGA 3H9UA 1KEVA 3IC5A 4HFJA 2NTJA 3QSGA 1HEUA 5L7WA 5I9MA 1ADGA 4GKBA 3BIOA 4GH5A 1CERA 1U3VA 3ST7A 1HSOA 3ASUA 3RBZA 1FDUA 1NFQA 3ONEA 4M86A 2A9FA 4J9VA 2YQ5A 2EEZA 1ONNA 2W98A 4XQGA 4JP2A 3VZRA 3E18A 3UF0A 1LX6A 3AOEA 3DHYA 1E7QA 2NVBA 3GY0A 1X7GA 5DBGA 3ASVA 3TFQA 3H9JA 2PK3A 3ICPA 4HY3A 1SOVA 3GRKA 2A35A 3FCOA 4RF2A 4IDFA 4AJKA 5IG2A 2UVDA 3RQSA 3LLVA 2VYNA 3OICA 3DBHB 3L77A 1GTMA 5JW6A 3BMNA 2X86A 4CJXA 2PZJA 3M1AA 2Y68A 2Q50A 1Q0LA 5CDUA 1ZK2A 5T8KC 1UXIA 2CVOA 1WXDA 4QO8A 4E21A 2ZCVA 5JXWA 5HRUA 4K6CA 2NQTA 1MP0A 1EUZA 2GSDA 2O2YA 3W4JA 4EJ6A 5A5FA 3AY7A 1BVRA 1ZK1A 4H16A 4XRRA 4TKLA 5DCUA 4PZDA 1BXGB 3BMOA 4UAGA 4E5KA 5L45A 4FB5A 4WJZA 1UZNA 3DBLB 3ZW9A 3GHHA 1DXYA 3A9WA 4R1TA 1IPEA 3S2GA 4CUZA 1WPQA 4MVJP 3LU1A 4K28A 2X23A 1R12A 2QG4A 3ITDA 3RU9A 4HKTA 3FBGA 3I9NA 2GERA 4RPHA 5CPFA 1VPDA 2NM0A 4DC1A 4YRBA 4BUCA 2R2GA 1WDMA 3PWKA 2ZCUA 1MFPA 1IYZA 1RPNA 4LVUA 3ZNQA 3TOXA 4RPJA 3TZKA 1KBZA 4F6LA 1E1KA 2WD7B 4CR6A 1OI7A 4M49A 2DM6A 3ANNA 3WG9A 3K31A 2FPGA 1HXHA 5GZ1A 1KC1A 4JP3A 5I7SA 4YT2A 1QYDA 2F00A 5EESA 2X6TA 2IZ1A 2LDXA 3PHJA 4I5DA 2CSUA 1KVRA 2VNSA 1G6KA 4YPOA 3C1AA 2I9PA 4XEHA 1B26A 5KKAA 1ZSNA 1RM5A 2Q49A 4ALJA 4BQRA 1YH3A 4RZIA 1YGYA 3WGOA 3VPGA 1ONPA 2WM3A 4XYMA 4MVJD 3W8DA 4DL9A 3ETDA 4NBTA 1EK5A 3FNGA 4RGBA 4C7KA 4GGOA 2EERA 5DP2A 4GKVA 3JD1A 4BO5A 3OA0A 1P1JA 1U4OA 1B8PA 5L53A 2C82A 1DB3A 3JQ8A 5T57A 4NNJA 4HFNA 5KCZA 1JTVA 2Q4BA 4QT0A 1I2BA 3B6ZA 4NI5A 1NFRA 4OH1A 1GPJA 5JY1A 1PIWA 2O50A 4GPD1 1UXGA 1BGVA 4D45A 3L6DA 2V6MA 1DIRA 2E49A 3GUCA 1BXKA 2GZ2A 2RHCA 3QE3A 2WSBA 4N5NA 2FZEA 3CIFA 3G1TA 5JMWA 4BKRA 4R4JA 3DZFA 4BO9A 5MDHA 4JJFA 1E7MA 2G0TA 2I3AA 5JAZA 4B7UA 5DOVA 2HCTA 1E7YA 2W2KB 5A9RA 2O3TA 4MJLA 4UULA 5B4TA 4CMGA 1J5PA 3EC7A 1NVGA 4YWJA 1CETA 4CLRA 4KTTE 1A72A 5ENDA 5DN9A 3WGTA 1LJ8A 4EW6A 4TSKA 2Y0DA 5FEUA 4Q3EA 4CLHA 1D1TA 4LK3A 2C07A 2WMDA 5COBA 2B4TO 4ND1A 4IS2A 1LSUA 3NTQA 2EJVA 3JQEA 2AEJA 3P7MA 4OKIA 5BSFA 2UUOA 4J1QA 2HSDA 2AEFA 2EKQA 4RDIA 4DPLA 5IDWA 1GYPA 1R4MA 5HM8A 1BSVA 2QZZA 3PYMA 2G1UA 4MIYA 2H9IA 3PHHA 4K1LA 3TOZA 2BGKA 2JL1A 5KJ1A 4Y67A 2DUUA 1HDXA 2VT3A 4TRNA 1WVGA 2H1SA 4W4TA 1DPGA 2AHRA 3OM9A 2YHIB 1LNQA 1WZIA 3O8QA 1N5DA 3M2PA 1W0CA 1NNUA 3E48A 1E3SA 1EMDA 2J8ZA 2HAEA 4B3HA 4EEXA 1PL7A 4ZQHA 2YDXA 3VAZA 4QO7A 4D44A 1HZJA 4R3WA 3JYPA 4PRKA 4TVOA 4WCFC 4ILKA 3V2HA 1PL8A 3IOYA 3GG2A 1U7HA 4WLNA 3U49A 3WSWA 3TPCA 2HMUA 5JNLA 3I3OA 3IIEA 4CQMA 2PKRA 2B0JA 2Y0CA 4BIIA 4BVAA 3TRIA 3DTYA 1MB4A 5KJCA 2W90A 2TMGA 2ZYAA 4S1VA 5IDQA 3FSRA 1ZXBA 4NQZA 4BKOA 4U7WA 4HFMA 4K6FA 2Z1MA 1P33A 3CPSA 1H6AA 1GUYA 3A14A 4FD3A 2BF7A 1JKJA 1PJCA 1VJ0A 3I4FA 4ALKA 5I8WA 5ILOA 2H63A 1YOVA 2PKQP 3WOHA 3N74A 2Y1OA 1V9LA 1KC3A 1LDEA 2HRBA 2NUAA 5TSDA 4BGUA 5FI5A 1ZIDA 2ZB7A 4GX0A 3D64A 3B1FA 4BNTA 4OGWA 2ZYDA 5G2OA 4MIEA 3INTA 3R1IA 1E3LA 1HTBA 3E9QA 4BNNA 2IYPA 4JK3A 4IDBA 2VRCA 3FR8A 4CMHA 1I3NA 3F6YA 1IL0A 2HMSA 2BFMA 4J0EA 5THQA 1IE3A 2VOEA 2UDPA 3K92A 3VPFA 3VZPA 3OQ6A 2DAPA 4EDFA 1N1GA 1PR9A 3BZUA 5A1TA 1FDTA 1GCUA 1NWCA 4D46A 3D3EA 1Y9EA 3UFXA 4NZ9A 3KV3O 3JQBA 3NKLA 4XR9A 4YJDA 2C59A 1E3WA 3GA0A 1KERA 4YXFA 2CNBA 1SEVA 4TWRA 4B8ZA 2W2LA 3DQPA 3MJCA 5EQDA 3GN1A 3VVBA 4S3MA 3WTBA 1I2ZA 1PJSA 1F06A 1VC2A 4DQXA 4IJKA 3DDNA 3QWIA 4LN1A 1MFZA 3ENNA 2BI8A 2EKLA 2O3RA 4J2OA 3RKRA 1H5QA 2EHDA 4IQ8A 1MG5A 4AJ4A 3GEGA 3MJEA 1BDBA 2XAAA 5A9SA 4YJGA 3M6IA 3OIFA 4I8XA 2BKAA 4MKXA 1I2CA 1IHXA 3TZCA 5L4NA 1BMDA 3EGOA 3WX0A 5H83A 3S8MA 2A92A 3E1KA 2A4KA 4IZHA 4CMAA 4DIFA 1LXCA 5DCYA 3OHSX 4Q3AA 1NPTO 5B12A 1UDCA 3PJDA 5C5IA 2RCYA 4NJOA 4ZQFA 1LA2A 2GF2A 4BGEA 4CV2A 4L4XA 3I83A 2NADA 2AG8A 1YRLA 2Q4EA 1KY4A 1X0XA 2IZ0A 4FN4A 5ENVA 4BO8A 2CUKA 3R3JA 4NK4A 3GZNA 3WS7A 4E5NA 5B37A 2OGUA 2ZIZA 1DO8A 1QYCA 1MGOA 1NPDA 2X22A 5F1PA 4ZJUA 3U4IA 1MV8A 1B3RA 1CYDA 3QW2A 3PYLA 1KVTA 3AOEC 4AJLA 4YA6A 3PQDA 4YR9A 5G4LA 2HMTA 5L9AA 2QRKA 1LLCA 4IJWA 4MOWA 1UH5A 4Q9NA 4GI2A 2BD0A 1SCUA 4IM7A 3QV1A 3DOOA 1JLLA 1VJTA 1XCBA 1N9GA 1YQXA 3RD5A 2Q99A 3RUIA 1ULUA 3A4VA 1LBEA 3GT0A 1KVQA 5EJ2A 1GPDG 1LRLA 1JVBA 4UVEA 3JQAA 3LT2A 2VNAA 4BKPA 2G5CA 1JKIA 3V8BA 1L7DA 1XGKA 1GYRA 4Z0TA 1X14A 1LRJA 5A3JA 4XYEA 3NT4A 4I5EA 5FI3A 4UUPA 3WICA 4PZCA 3ADPA 3B1KA 3OJ0A 4FIZA 4H3VA 4B79A 4BMVA 3BA1A 3GLQA 4RJTA 2PNFA 3UKOA 3FTNA 1L7EA 4J4HA 3EW7A 1DLIA 1Y8QA 1UUFA 1P74A 2JD2A 3Q3CA 4XYGA 3WQRA 2JAHA 3I5MA 5JYEA 1R6DA 3GVHA 4NFYA 4FDAA 5IXSA 4EUHA 5KTKA 4AG3A 4PLWA 3QVTA 3E5RA 1GZ3A 3RROA 3WJ7A 4PCVA 4A0SA 2PFGA 2DTXA 1BVUA 3RU7A 4KZPA 2J5RA 3HB5X 4XWYA 3UXYA 4E31A 3DFZA 2PWZA
chains in the Genus database with same CATH superfamily
4G0WA 1KVUA 4OGKA 3EGXA 3NBAA 1NRJB 2ZPUA 4WJKB 1XRLA 2QLJA 4LGMA 2XB9A 3IVAA 1X1QA 2FLKA 1L5SA 2YC2C 3EIWA 3LKDA 5H5JA 3JZMA 3TL6A 4YJ3A 1CBUA 3IBYA 4IQFA 2P4QA 4LV8B 4C4SA 3MMPA 5CMLA 1JPVA 4ZCLA 5TQ2A 2E4WA 3BHJA 3E2PA 1GGHA 2E2WA 4PYLA 1SQ0A 5IBRA 5FOQA 1K5DA 3LDGA 2YW9A 5DJ5A 4GR4A 1YXMA 1XD8A 2X5KO 3O0TA 1NYLA 2GR9A 2XKKA 3ZCSA 2VJOA 1PZEA 3IKLA 1EVZA 3L7YA 1XC7A 3H65A 4LDQA 1KKMA 2A5DA 3V7WA 4EELA 1GNSA 3SS8A 4WJLA 1FSFA 1NVTA 2Z30A 1ZIPA 2Z5FA 5E6SA 1TJNA 2H3EA 3UWSA 4UHCA 3BMCB 1QH1B 4UU1A 3UG7A 4EPXA 5B1IA 1UP6A 1G9SA 1GTVA 4G9BA 4RABA 4DCCA 2CLOB 5ALQA 2WT9A 3BXOA 4IDQA 2R96A 4WFIA 3NIFB 3O73A 4O2LA 4CL2A 1JJIA 1O8CA 3BWBA 3VXKA 3NIWA 2IL1A 4UNSA 1FUYB 3S7TA 3QVSA 1GV1A 3CTMA 5H9VA 3DOJA 3KBBA 3BWYA 2YWGA 4HXGA 4O1MA 1J7KA 2QTAA 5T6MA 2LV8A 2QTCA 3JARA 3DPSA 1GG8A 1K7EB 1LS1A 2C0QA 2D62A 1QK5A 2Q3HA 1K5GA 1XSEA 3BHNA 1SQ5A 1N5LA 3IP9A 2H1WA 1FFHA 2AZMA 2WU3A 2AFIB 4S05A 3DV0A 3RJZA 5TGTA 2Z1DA 1HRDA 1P9OA 3F71A 2PJZA 2R6R1 4HB4A 2ZIUB 1XPRA 5CLIA 3RS5A 1U0BB 3PD7A 4DC9A 4GR9A 4TPKA 2Q9CA 1FNDA 1L5WA 1T5SA 1V4NA 2HJ9A 4JROA 5D6NA 3NVKI 1NG1A 5I7EA 3GJ5A 3HN2A 2NO9A 5DTRA 1VSQA 3NT2A 3DFKA 3PUHA 1V1MB 3D8RA 3RSGA 2AG6A 4ZQBA 1DSSG 2ICAA 4PX5A 3ZD7A 3ICQB 1SK8A 1SWVA 1YB7A 1RYNA 2Q0HA 4GNKA 5J58A 3FOBA 4EKIA 3N76A 2NVUA 4OHVA 3HJCA 3GJXC 5F1OA 3LC1O 4KJXA 4OQDA 4DCPA 3F97A 2VF7A 5K2OA 4H2DA 3S99A 1DUIA 3HN6A 5IC6A 3DOFA 3BWMA 1YZNA 3P19A 4HZIA 4LX0A 4QJIA 1LFDB 4WLUA 2D0PB 2KQUA 4XVHA 2J6BA 3TUZC 1SZDA 1AS3A 1T8WA 1MENA 4QOJA 5A06A 2F62A 3HCEA 2HCJB 1TO6A 4X7PA 1G8FA 1JR4A 1W19A 2BFAA 2FOLA 5FIUA 1PEAA 5KINB 3I34X 4AMYA 5LD2B 5JI2E 4RS4A 1U6JA 1THTA 3TW0A 1MXFA 4TMWA 5JNVA 5HBRA 2JI6A 1XWIA 3AKCA 4Q3CA 1JHUA 1YNOA 1GL9B 3GDGA 5FOTA 2ECKA 3QXSA 3W6PA 5DBOA 2YOGA 1XU9A 3VDXA 3G0IA 4BTEA 1Z39A 1UODA 2WWTA 3AZPA 2XVMA 5FFFA 5KQLA 3T9FA 1Q7BA 3GLGA 5TT1A 5EQFA 4FOOA 3E35A 3MUNA 5K8TA 3ILVA 2PGLA 4IFIA 3T5BA 3I61A 3CUKA 4LTDA 2OY0A 4AJJA 2Y93A 4M22A 3FMOB 4AXBA 1ECJA 2PRKA 2PT6A 3WGNA 1IWOA 1E2EA 1A7KA 2E4AA 3MELA 4GBGA 2ANCA 2V6BA 4J0DA 4L02A 5CUQA 1MNQA 1IK6A 2JEOA 3B82A 1B0ZA 2BM0A 2V59A 4ZVSA 5A3SA 4A0GA 1YU9A 4EI7A 2MMGA 1KDOA 3QPAA 4RK5A 1KWGA 1W5AA 1PK8A 3FSGA 4L6IA 1QU3A 3D8HA 3HP7A 4MV5A 2RBGA 3OX2A 3CE6A 1LQ2A 1J1IA 1OFGA 1L4NA 2XUOA 2YXDA 4IRUB 4OQXA 3SQLA 1CR0A 1CR2A 1F38A 2AOTA 2I6QA 1Z5WA 4HDRB 1AO3A 4OHZA 3KO8A 2OAQ1 3UWMA 4AJOA 5KYNA 1YAHA 3MWJA 4U8HA 1XCPA 4RY0A 4DYHA 4RKEA 4YRTA 1XLVA 1RYEA 2FV8A 3IS3A 5DGCA 2D5IA 2VR1A 1OX6A 1QLWA 3ZVRA 3QKUA 2I4OA 4RLHA 3Q8KA 5FQNA 1YUBA 1E63A 1F1BA 3LC7O 1RYBA 3LP5A 3QVXA 4G1CA 1T9CA 1RADA 2ZXUA 3SAJA 4CW7A 3ZI0A 1IXZA 2O3JA 3D7LA 1N7GA 2YFQA 4MVCA 4MWDA 5AW3A 3U31A 2EL9A 1CVLA 1SUIA 3M1LA 3JQGB 5CEEA 4IRXA 3QRWA 5DOZA 4TSRA 1XB2A 1R3UA 3RVPA 2Y6VA 5E9QA 1N5OX 3D3WB 5C81A 3IV7A 4WAUA 5AQEA 4XFJA 1QOZA 2G6BA 4Y2YA 5ELMA 1XNQB 4FR5A 3WKAA 1EP3B 5EN4A 1I2MA 4OX9B 1NKSA 1Z0DA 2AXPA 4I55A 2RGXA 5L3QB 1LDGA 1CV2A 3STYA 2D2XA 1MJGM 1IXRC 1K0UA 1TM7E 2WIKA 3NTOA 2OUIA 2XE6A 3I5AA 3QPWA 4E2YA 5JALA 2AK3A 4G85A 1OBOA 2J3JA 1JIIA 1W73A 2TECE 4PBSA 1THZA 4D2IA 2P0AA 3EVTA 5EGNA 2H4ZA 1C1DB 4QTUB 4BNZA 4EG7A 4ISCA 3O3OB 1YZLA 1M6VB 2AYXA 1GPMA 5C1IA 2YZGA 3GBSA 4QGGA 5EJAA 3C48A 4CMJA 1RYFA 4DLSA 5EE5B 2BFFA 2C9CA 3LC2O 4BWGA 1KY3A 3CJTA 4IEIA 1B76A 2JIZD 2ZB8A 3DC2A 3DE0X 3KQPA 2I2BA 1WV1A 2QD5A 4KE6A 1SKUA 4XQCA 5AK3A 1DC4A 2VWGA 4LHZA 4U7TB 1AQYA 1M5RA 5JJ5A 4BP8A 1E0JA 1Z38A 5KJEA 1X92A 1TJ4A 3FLAA 2CNNA 1RE0A 4OQEA 1E69A 1VYTA 1CS0B 3WB1A 1DEKA 4J91A 3ASZA 3GNTA 4YFYA 3S7ZA 3G5TA 3M1IA 4OK5A 4X20A 1J9GA 1IJEA 3BX1A 4A0HA 4LE2A 1F6DA 3GEMA 1VL8A 4ZT4A 3V33A 3N8NA 1SPXA 3JQCA 1IB6A 3RGWS 1FFBA 4ZFNA 2YJZA 3IBTA 4IZ6A 3KUKA 3QX3A 4OXRA 2HIMA 4ALNA 5JAHA 1XCJA 2AX3A 2RB4A 1M1YB 5BYJA 3CKMA 3GLIB 3DKVA 5KTPA 1LDMA 4FDVA 2WAXA 2GYUA 4KQEA 3TZ6A 2IBTA 3L4SO 2BRUC 4UFNA 3QF7A 3M9WA 4G3XA 3BRCA 1QTRA 1OWOA 1IBCA 1TYAE 2XWJI 2FSSA 5I4CA 2GXSA 1WA5A 3NWOA 5DHPA 4BMYA 5IM4A 3VNVA 4AMVA 1DKRA 2R8OA 4BFLA 3NORA 5JNSA 4GMGA 2IS2A 1ZCFA 4K9PA 4BQPA 2WKQA 5DTJA 3AY6A 4CF4A 5HX7A 4ROSA 1AK1A 4H1WA 3NAGA 3Q10A 4I19A 1DXHA 4XDGA 1OWLA 2SKEA 1DL5A 4LWQA 1ECBA 5I9SA 3NC0C 4FTWA 3BHIA 1DKOA 2XNCA 1NUTA 3R5XA 4X3OA 4R1PA 3N8IA 3WWOA 1E2DA 3K30A 4KG7A 4YCJA 1Q16A 3AM1A 3BTOA 1UXJA 1GQRA 3QVWA 3AERB 4IDHA 4LXUA 4OYYA 1OB5A 2OBXA 5HKKD 3BIJA 3IJRA 4LJ4A 3C70A 3FCSB 5A4MS 3PC8A 5KVVA 4WASA 3SQWA 1OH8A 2AHOA 2HSGA 1XN1A 3FB1A 1ZMTA 2YUIA 2WLTA 5AKHA 1PR0A 4YO7A 4LDPA 1RIFA 1WNFA 1GCOA 4GXRA 3R6WA 1NXWA 4URVR 4I50F 1HMYA 5F51A 1XDSA 3JYOA 1UKAA 1P4GA 1YKSA 2VXBA 1Z74A 1X7XA 2C2HA 1C0LA 1I3LA 2NNLD 3GLVA 4R1MA 3W0LB 1TEHA 1L6IA 3P0JA 4LYHA 1VCIA 2R47A 3JWGA 4M9QA 4CM5A 1RXWA 2EG5A 4QYXA 2AR9A 4RLSA 4MA4A 1CRZA 4G0MA 4AJHA 1T3GA 3IQXA 1YR3A 1MEEA 2AF4C 3FDXA 4RHCA 4F45A 1ZYUA 3KFXA 3DT8A 4OMCA 4AKSA 1VGRA 3LUDA 4DLXA 1DAGA 2R2AA 1C14A 4H0CA 4Q1AA 5A62A 1SURA 1URPA 1E5XA 2OZEA 2HDHA 2I4RA 4K03A 4RHUA 2NWQA 2R8XA 2FDXA 3SU8A 3I1JA 4BEVA 4FFWA 4B2LA 2PUTA 3LUHA 3MTQA 4RC9A 4UBOA 5GMOA 5AWFC 2W2VA 2PFKA 2HU7A 4MITA 4X64B 5H7XA 4AMUA 3K09A 2IU3A 3CEHA 1C3EA 1Q1QA 3V7YA 4J6EA 5CJ2A 3UB2A 4WNAA 3VH4A 4CM8A 1ULHA 1E9DA 2JIPA 1OXKB 2YY6A 1CT9A 3IQEA 3PKZA 4M0CA 5B1HA 3WIOA 4YALA 5PNTA 3U4AA 1WE2A 4Z49A 5HKAA 3PPVA 4B46A 2CLLB 4KREA 1DCKA 3STHA 5A0FA 2B92A 3FD8A 2WIBA 3WK9A 2J09A 3E4CA 1LJLA 1KQ3A 1U99A 3TGWA 3VVCA 5L51A 4BLWA 5JXGA 3RIYA 3BYZA 2CV2A 2PT5A 3K0FA 3WOHA 3R9IA 1TB4A 1Y5MA 1B4DA 1ZBQA 4E7OA 4NDAA 4OFWA 2IGTA 2J0VA 4OY3A 1K7CA 3AW8A 1BEUB 4I66A 1JEOA 3LCUA 3OM0A 1SFRA 4DBLE 3LT0A 3FLBA 3OE7A 3EQ2A 5LOVA 2WSMA 4RD3A 4XE5A 5CA0A 3TJZA 2O23A 4AJNA 1TZCA 3NRCA 3RPEA 5KNLA 1GR0A 5EZQA 2YQZA 4WX2B 4FEGA 3H8JA 2W2QA 4OQQA 5GJCA 1P44A 4MUGA 1PHPA 3DA8A 3Q1KA 1U2TA 1Y42X 4UNIA 4MA0A 5IYZB 1UBOS 4BGIA 3MPUA 3Q15C 4UZFA 4D3DA 4YBZA 2B4RO 2OBBA 2PLAA 5AW6A 5JSZA 4WN9B 3KYBA 4EI9A 4YDQA 2VL7A 1T2DA 3A2MA 1JDSA 2AG0A 2J3EA 1K9VF 1GPUA 2PUHA 4MQEB 5AKIA 3WLSA 4O3MA 2BKXA 4ZXFA 1OTXA 2XBUA 5HZMA 4B4DA 1XMVA 4MIKA 1HORA 2XCRB 1R37A 3W5IA 3RK1A 1K8YB 3C5EA 5EIBC 1UBGA 1GQSA 4LRSB 4KDCA 4OBWA 3PD1A 4EGFA 2IEDA 3M81A 4XVUA 3RS4A 1OBCA 2OORA 2WVHA 3TTYA 3NTUA 3ADKA 1XQXA 1PU2A 2A7XA 3EC1A 2ETVA 3ZWXA 3HVKA 3NH9A 5AW0A 3B2NA 2HREA 2CCGA 3JD3A 4JR2A 5L3SB 1CUDA 5SY9A 4MS4A 4NOMA 3HU5A 1V95A 5JY6A 5JWHA 2FK7A 5EJGA 1CIJA 2POQX 4ONEA 4P3NA 4OSEA 4U0KA 3AHCA 1KRXA 4J3FA 3AFOA 3Q2KA 4AM8A 1LV8A 2ZIWB 3Q4GA 4OXIA 3RC2A 2A6PA 2NVWA 1VI2A 1DCFA 1ZI8A 4REQB 1Z5UA 1SXJA 1PFUA 4MI9A 1MT0A 3LL7A 4UEQA 2CDRA 4P84A 5CJJA 2C5AA 5D3ZA 3FOWA 1A4RA 2F9LA 3NZEA 2JH9A 5AHKA 3OKAA 4QGBA 4UM5A 2ACEA 1VMDA 1Z4NA 2CVPA 3D0QA 4IOKA 4C5AA 1QGAA 2QWXA 2VHYA 5I45A 1U8UA 2N42A 2JGIA 3DXZA 1JXQA 2WPDA 3TR0A 4YT5A 1A8IA 3U4QA 4UJ5A 4YPFA 4N0MA 3MTBA 1HETA 1TIBA 3IOCA 2B2CA 4NAHA 5LXTB 1O0SA 1JEEA 1VGVA 4LJRA 1BVHA 4ETIA 2R8YA 4YTEA 5IJ9A 4BMZA 1KYYA 2Z8ZA 5KHLB 2XTMA 2FSVC 2HNKA 4N3AA 2WKSA 2AVDA 3ERCA 1K9SA 1MC5A 1R18A 2GEJA 5JSHA 4BJHB 2E5WA 4N12A 2G9RA 3D4PA 4RJKA 2FKAA 5AM3A 2OC9A 3V8QA 3MOIA 3CRVA 1QK4A 3GGDA 2IZOA 3IUJA 4OHFA 3RUDA 1Y4AE 4ENVA 3WRVA 2ZIXA 3N9IA 3KJQA 1A97A 4AKTA 3B13B 4ENWA 1PTJC 1ZM4A 5KWEA 4GZ3A 2ZTUA 3LKVA 3QVMA 4ARIA 1NXXA 4U3JB 4BVLA 3TQTA 3ZWKA 3PDCA 3I30X 3QYPA 4F4CA 1UJNA 5B55A 3C85A 4N65A 3LPAA 3NGLA 2QYOA 3DT6A 1DUVG 3H2GA 1H5NA 1TZJA 1YE3A 4FW9A 3VSBA 1WKBA 3WMWA 1AY0A 2B1RA 1K08A 2HQBA 2HK8A 1YJBA 4JOCA 4DJFC 2RC6A 1YBMA 4GS5A 4DDUA 2TMYA 3AETB 2NXEA 5CITA 1U3DA 3BD9A 4O4LA 2QLLA 3OJOA 2FMHA 4LJSA 3PSHA 5DTMA 3WICA 1BS2A 3ODGA 4C03A 3KKQA 2ZBEA 1II8A 3AGQA 1YQGA 4LF5B 4G25A 2RHRA 3L7LA 5TPZD 2AYYA 3U39A 4Y98A 3W5UA 3R5FA 3S2EA 4IX9A 3EVBA 1J6UA 2V54A 2XQGA 3DZDA 3STXA 4FSHA 2JCXA 3ECAA 2ATXA 4UQOA 1H2RS 1F0PA 2FK8A 3PHLA 1QONA 5I9BA 2P2DA 4YAIA 1T25A 3C1OA 4KN9S 3R3XA 5L4SA 4RTOA 1WHSB 2G77B 3HCPA 4NIMA 3VSEA 1F2TA 4CLRB 4CI0B 2EWWA 1VPTA 1ZPDA 4OV6B 5KKNB 5KTSA 3UBMA 3S4YA 1W5BA 2YMLA 4RF5A 5A7FA 5BO5A 5CXQA 4GE3A 3R3ZA 1G2OA 2GPSA 3NUZA 2Q0XA 3SCZA 4MLDA 2HEIA 4HEA1 1HLDA 5BXYA 1MJGA 5ITZA 4Y9UA 1JG3A 5K3EA 1J7JA 4P5DA 4N82A 3ONWA 1WUTA 2CCJA 2H0QA 4MGYR 1WDLA 2P1RA 2ZAYA 5LYYA 4HZUB 2H7CA 3X0DA 1RHJA 4R41A 2PBLA 3WOVA 2TMDA 4XQEA 1XKTA 2WWGA 1R4MB 4GX1A 4CKZA 4KO2S 3TQCA 3QXJA 3M9XA 3PQ4A 1Y3AA 2CY0A 1TK3A 1O57A 2V7PA 4ND3A 3SX0A 3BCUA 3NJ4A 2IUEA 1OX4B 2GH1A 3TW4A 1W52X 3CT6A 3LH5A 3PK0A 5JU6A 4MEJA 5BNTA 1AHPA 3Q8LA 4UVHA 2CXUA 5EIWA 3OM8A 2QZSA 2B2NA 3HVHA 1XVIA 1JU4A 3IPRA 4L57A 4DG8A 3O5AA 3F7MA 1UBJS 1R10A 1J8YF 1JIUA 2IE8A 4BNKA 5K4HA 1CZHA 4TS1A 3AXTA 2Y27A 1DDIA 3VVMA 3LYLA 1BXRA 1Z6YA 3BWCA 3R7AA 3WWYA 3PXUA 2R6JA 1B0AA 3C3DA 1E2KA 2FPRA 3KPJA 5FPSA 2IDMA 5LB4A 4ZKDA 2DJ5A 1H94A 1O6ZA 4M0UA 4BFWA 5EZYF 4M1SA 3TCNA 3MUFA 1TKRA 3OFJA 2RHWA 3I12A 1N1DA 2DPHA 3GZTB 2B20A 4HNVA 2B35A 4CQMB 1FTSA 2WWYA 2GDZA 3A1CA 4ZOLF 3BFKA 3Q8XB 1WKCA 4R0NA 3RVNA 3E1SA 5AKZA 4CCWA 3LBAA 4OXXA 4CR7A 4YRSA 4O4JA 5SYMA 4BNGA 5HJ7A 5A7GA 2IX9A 1USGA 4EEZA 5KYUB 4QXRA 1Y1KE 1ZSYA 1CC1S 2R6HA 2QU7A 1A8HA 2YV3A 2AMJA 1G8GA 1L7XA 1W1IA 1YZGA 2AC2A 2R60A 3TSOA 9LDTA 5JVDA 2CMHA 2BOVA 3T7AA 2GKGA 221PA 2ZGVA 3G6WA 5TNXA 3TTSA 2CLFB 2ZJ2A 1QCDA 3OSUA 5JQGB 3H4MA 2QGFA 3SLRA 1E94E 3ULKA 1XJ0A 3BWDD 3WO1A 4MI3A 3FLEA 1AUXA 1D2RA 5M04A 2WDZA 1BMFD 2VQ3A 2P27A 3OTWA 4PGFA 2F9MA 3LDFA 4TV9B 4D4JA 3LLCA 2B8WA 3ELWA 2YX1A 1DAIA 1ZZEA 4I6EA 4JENA 3ZV5A 1NMXA 5K5EA 3JQDA 1H6BA 2D4HA 5HZKA 4Z4HA 5IXJA 2JK1A 3PQ2A 4IAOA 1NASA 1EG2A 4DAEA 5F35A 1IWPB 5HCUA 4P7BA 5J2TB 2LVBA 4TROA 1BG6A 4BBPA 2P7HA 4X85A 5F7JA 3ILHA 1TW3A 3MWDB 4U8GA 1E1RD 4ENRA 3U4HA 1Z0ZA 3HJFA 4NS4A 4AYXA 3PQFA 1BQ3A 4FC7A 2V9ZA 4HB0A 3ZH9B 2MYTA 5K99A 2Q9UA 1C2TA 5LLDA 1QRUA 1TI7A 3HNPA 1AZWA 2P5YA 2VOJA 5EUMA 4WKBA 3WYBA 4U7FA 4C3VA 4ZTUB 2UVQA 4J0IA 3G5AA 3FNBA 3K0EA 5ADVA 3KTFA 4C7MA 3PZBA 1B6RA 4MMXB 4MGKR 1E3WB 1UWVA 2HV8A 3OD1A 3LGXA 2DQZA 2ZSDA 4DQKA 5AJTA 5BNIA 3PGKA 3IHWA 2OXRA 2GM3A 1YB2A 3MBIA 3EODA 3MSCA 1TA0A 1OAOA 3IEIA 5AXAA 4YK7A 3SHWA 3ZCRA 4B47A 3GP5A 3Q3HA 4PSKA 2WHXA 4I6JA 3UK0A 2R6GA 4DMLA 5ECYA 5GOTA 1H9AA 1JYFA 3AZQA 4PX9A 3L4JA 1XKLA 5AVYA 1NDHA 4PR0A 7MDHA 4CNQA 1RMYA 1TADA 2YJ6A 3E3OA 4L4YA 5IZCA 1ORRA 1QORA 3OETA 4HATA 1HWYA 3PGMA 1GV0A 2FPSA 2PJRA 4J7AA 4H3SA 3VKWA 2AIRA 2EP7A 1HG0A 4DJAA 4TM7A 2I33A 2K2WA 1A5ZA 4B7CA 4I99A 4E32A 4Z99A 3GVPA 3GJTA 4GUAA 1S01A 2I55A 1AC5A 4CQNA 1YMUA 2JLXA 3AR3A 2HA5A 4WZ6A 5TDHA 4BFTA 3RVQA 2FN8A 4J76A 3PPYA 3DZJA 2XYQA 3NYIA 3SDZA 4HGZA 4B3JA 3DB2A 3WK7A 1VE5A 2BMFA 2F8MA 1BA3A 4R9RA 3GF4A 3B1XA 4N6NA 4Z4CA 1X7WA 2G5GX 2VKQA 3GFVA 4QEKA 4BX3A 1EEHA 2QNRA 1E0AA 4NYMQ 1H8EA 4JBLA 4IIDA 1V4BA 3MBKA 4ZCIA 1T3ZA 5T7BA 4U00A 5A9TA 4FHGA 2DCUA 1FJHA 5LQRA 4Q7KA 5JS8A 5CEFA 3FOEC 2VJYA 2CVHA 3T3DA 4TUYF 2P2CA 1E2IA 5TY0A 2MSDB 4HLDA 4JSRA 4G0XA 2M6LA 2HA7A 5ALEA 2ZAMA 2JFBA 2JW5A 1JE1A 3RTDA 4C5BA 1SCUB 5AI4A 1SQ6A 2CHEA 4FE7A 1N9GB 1XEAA 2JCGA 3NIDB 1PT5A 1EVEA 1QF7A 3L4EA 3QOWA 1E9RA 1CY8A 4IJUA 2X1HA 2PYDA 4G01B 1VKRA 2Y4OA 4QBFA 3G79A 2PX5A 4GZ6A 3GAFA 5HF8A 3TTXA 2VUSA 1Z37A 5K03A 4YAGA 1Q0RA 3ENKA 3BQMB 1D8AA 1L7QA 3PDHA 5AO9A 1LBSA 2P9QA 1T2NA 2YUTA 2CUZA 3BCHA 4G5QA 4Q4LA 3NU1A 4YRNA 2QR5A 4RK7A 2I4IA 5CT4A 3ZHUA 3OOEA 1EFTA 2VJLA 2RGNA 2JFOA 4DQUA 2O48X 2QVXX 2W6MA 2GBCA 1PGOA 2EX1A 3IQGX 3QZUA 1RC0A 1IUOA 1ATIA 3H1BA 4LXHA 3UG6A 2GZDA 5IH3A 2QE6A 3RT9A 1T2EA 3LWZA 4DRXA 2EFYA 4RVUA 2A1TS 2GZHA 1JHYA 2G08A 4FEAA 1L7VC 7REQA 2OV1A 4QFBA 4BKQA 1W5TA 3N3AC 1T8YA 3FYCA 1SOWA 2BHNA 1BQ4A 2WF8A 4UZSA 4F71A 5B53A 1NKVA 1XI2A 5HYVA 3N2YA 1KOLA 3MCWA 5CB8A 1HSZA 1MT3A 4CM3A 4IRMA 3AJRA 3K2BA 2NW6A 4IMPA 4JELA 4M7WA 2JFXA 2HMYB 4WY2A 4MMZB 3VR3A 1ADJA 1BU5A 1VBFA 4Z4EA 1I32A 5CJPA 1UBLS 1X6VA 1QWOA 1UFVA 1TXGA 1QGZA 3IALA 5D01A 5IWAB 2RIPA 1O9HA 1SIWA 2XMZA 2FHPA 3CN9A 3QEJA 4X1YA 1T2CA 3RG8A 2PUVA 4HRVA 3SQMA 3NB0A 4JVSB 4X44A 1KYQA 1NW4A 2D1YA 4MVJF 4URFA 3OFNA 4HAOA 4XLZA 2FUG6 5HGXA 3SD7A 5IVPA 4CG0A 1GN9A 4MYUA 2GEUA 1ULBA 5DHFA 4EZIA 1DT5A 4PFKA 3EGDB 1N9KA 1CRWG 3M82A 2W2LD 3D0RA 1WP9A 5CK5A 3ZE9A 2ZJ1A 3HU3A 3SBXA 3OE1A 5D1NA 3RSSA 1M66A 1WLSA 1HDOA 3BXHA 4HHEA 3C3YA 2XMCA 2R8ZA 3SJAA 1JFFB 3ZCPA 1T4CA 3JQ9C 1PZHA 1Q95A 1DXQA 4ER5A 3HDHA 4HAVA 4HI0E 4P7JA 1N7HA 1IB0A 1GOTA 3ZQKA 2GM9A 2NAPA 2HQ1A 3V7UA 3VR5A 2Q0SA 3G5UA 5HCIA 3WLTA 1GO2A 2ZUEA 3A1WA 3UFBA 4Z9FA 4BKMA 4BO4A 4HDSA 4CT0A 5CG2A 1F51E 2WIAA 1JI3A 2HT6A 3IP6A 1RI1A 3UHOA 3JYQA 3UICA 2XYPA 3QWBA 4DIOA 1V43A 1W0JA 3EXIA 3M6LA 3EXEB 3LM8A 3ZLUA 1EM8A 2GZRA 3NHMA 5ICFA 1TCCA 2O4CA 1F7UA 2I54A 5LP6F 5B4UA 3V6MA 4IYJA 2R4UA 3DVAB 3HVJA 4FM9A 1FA9A 5BN4B 1Y5NA 3T0GA 4DZZA 3MB5A 1E98A 4MWEA 1BXGA 4E33A 3S28A 4RNCA 4J6FA 5FNVF 3QNWA 2V7VA 2Q5EA 3NUGA 1IHUA 1P9WA 1EWTA 1TC1A 1VLLA 2WHYA 2QI9F 3CNLA 1CUSA 1DRWA 1M0SA 1QHHA 3CEPB 3DMGA 3KVNA 4P4GA 4QJBA 4F8YA 3EOZA 3L49A 2PPVA 3PEVA 4FYHA 1IBSA 4OA5A 2O3UA 1YS6A 3HG7A 1RRPA 1C1YA 3L0BA 3PYXA 2PZKA 2UUAB 3R5HA 1NU8A 1UXOA 2W2MA 2HMAA 1I7QB 2VTBA 3KDPA 1RZRA 1NI4A 3TCXB 3OC6A 3OPVA 2NTVA 3GEDA 1X8LA 1E6LA 3NAQA 3PKJA 3OIGA 1YDMA 3IVXA 4JJGA 3W6OA 1QQTA 4K05A 3PNBA 5BOVA 4U5XA 4LYGA 4D3ZA 2E85A 1OXSC 3WGGA 1K4YA 2WD7A 4RM2A 4QUHA 2RGCA 3OY7A 1S2NA 1JB1A 3VR4H 1FYWA 4Y2RA 4L8FA 3KZCA 4HPWA 4HAWA 4RK1A 2C7RA 2FWMX 3FSEA 5FUBA 2I1WA 4K86A 3CVWA 3UBTA 3AVXA 2YV1A 3TVYA 3K1YA 4LG1A 4Q4DA 3IX7A 4TVBA 1XAJA 3ITKA 2LGJA 1PZGA 3WP0A 2JASA 1XTPA 2IPXA 3R7BA 3BSFA 3KR1A 3I5YA 1D6MA 1II9A 4W5NA 5HCNA 4KGZA 1H9BA 2YFKA 2F2TA 4LYEA 5JE8A 1HL3A 5FNZA 2XV1A 1H65A 1U4NA 4NJMB 4P3XA 4C30A 3THXB 4R8KA 4HUTA 4L9WA 3IXLA 1JHPA 3C39A 5BVHB 1LTQA 1YL6A 2Q4DA 3NW9A 4MCAA 4PZZA 2ZR9A 2H4YA 4R69A 2J1LA 4UEJA 5IJ0A 5K01A 2RAFA 1G9TA 3WJ2A 5IF9A 1YFJA 3U5ZB 1HO3A 1U1IA 2DSNA 2PRIA 3OQ1A 4QJ5A 1BWRA 4ZREA 3HRHA 1CJVC 1X38A 3N0WA 5LIPA 1H0KA 1NX9A 2CXSA 5T4FA 4EY4A 1M6YA 4F04A 1GGFA 4JBYA 4YMLA 2ZIGA 2OD2A 3DR5A 3PEFA 1GAXA 4MS1A 2G17A 1W76A 3OZXA 4IVRA 3C3PA 2XTNA 1JQ5A 1L3IA 2FHSA 2HF7A 4OLHA 3K5PA 2ERXA 2JLZA 5IT4A 3QMMA 1J70A 2NO0A 3A6ZA 4R9UC 4D92A 4EFNA 1YZKA 4XB1A 4F92B 2VK8A 5JSUA 1MAUA 2I99A 2W6QA 3B2QA 4RCYA 2CL7X 2SKCA 3VNRA 4UPEA 4WZBB 5ER9A 3QPVA 2C4HA 5I9NA 2CWWA 4XSHA 5MN5A 3G9ZA 1UOQA 1XFAA 3PHCA 3NBZC 1K8QA 4PE5B 3VR0A 5I3CA 1J00A 4NBNA 3SIXA 2OM6A 3MWLA 3T99A 3G0OA 4M38A 2OHOA 3VRHA 4PW0A 4JAVC 3RQIA 4BNXA 1N78A 3QVOA 5ALSA 5D1HA 2H4HA 1S5PA 2Y67A 1XLTA 1MZPA 2GD1O 2TSYB 3MLBA 5IBCA 4L9AA 1C9NA 2LXNA 5FOVA 2GBFA 3CFYA 1NGSA 1Y5RA 4KRGA 4KN6A 4RW0A 4YREA 2PR7A 3D1LA 1DEAA 3WO0A 3CVJA 5FOXA 4HVAA 4OXKA 3ILYA 2JATA 2O8EB 3T0FA 4L27A 2OE2A 4W9MC 3BRSA 1XE3A 1MJ5A 1QSGA 1U4SA 3H75A 1NTOA 3T8YA 4LF4B 2QTBA 1Z16A 1S4MA 1IN1A 2FAXA 4OIMA 3EVGA 2BGJA 1SUDA 1ORIA 2Z3VA 2NSHA 2IPOA 2FEXA 2OO5C 2FUNB 4RMGA 3I1FA 4KMMA 1UBEA 2XA2A 3GCXA 3GWZA 5A0VA 4IGEA 4J0JA 1ZMOA 3HXOA 1U8FO 4IVNA 4YMTA 2Q7OE 2AJDA 1XRJA 4N3NA 2OEPA 2EIHA 2JFZA 2CWDA 4PS0A 4GMHA 1JN0A 2EZUA 2XUGA 3P2YA 5C4IA 1JEQB 2C9OA 2ONCA 3AX6A 2VAPA 3CWZA 4G1FA 2MYPA 4I9UA 5JD4A 1PWHA 4ZANA 2I91A 2FPLA 4DBVO 4YUZA 3B3AA 3K8YA 2O8CB 4F4DA 5BR7A 4BFCA 5EIBD 2ZZKA 4OJTA 5BR8B 1XKQA 1Z5PA 2EF1A 3IT1A 3QWAA 1PJAA 3IBCA 3JVVA 3C3AA 3MFYA 5GY7A 3DDCA 1JHRA 1KMCA 1K98A 1VFPA 2DE0X 2UZAA 3CMCO 4DSZA 1XK7A 1VMEA 2B8EA 1V6SA 5KNBH 2I5PO 3PLRA 1QYVA 1I7PA 2B2XA 2GASA 1VKJA 4FPXA 4BQIA 3H9BA 3GJ4A 4N3CA 3DHVA 1PLLA 1W6UA 3PQCA 2GJKA 3HJTA 2NV0A 2WF7A 4LZLA 3KJEA 3ZWMA 1XVLA 4FT2A 4ER0A 2JLVA 4ED9A 2GPAA 4P3YA 1Y4SA 3ZWWA 1YRWA 2QEQA 3MZ0A 4WRRA 3NNDA 5AOCA 5GONF 3P2OA 5THKA 2AI2A 1ZN8A 3TRFA 4N41A 3C8HA 4ND6A 3LXXA 3AR9A 2X7HA 5T6BA 4URWR 4YIHA 5CGQB 1OWNA 2XTJA 3JAWB 5GGYA 5GADl 4JIMA 4RXUA 4LJ6A 3WWDA 3EH1A 3OJLA 4J4TA 2QSJA 3UGQA 4R84A 1UK9A 2GGSA 3CTPA 3L8MA 5AQ1A 5KWSA 3KP1A 2VJMB 2YN2A 3JD2A 4JQCA 2XZOA 3PEYA 4FOPA 1WX1A 2G70A 5EJ4A 3VPXA 1A7JA 1HYEA 1UDBA 4KIWA 4DPKA 5CFNA 3DLBA 4IGAA 5D87A 4LCJA 4FVTA 4YROA 1GFIA 2ZJOA 5JNTA 2IU4A 3ETLA 2DWOA 4AS3A 3KEMA 3DP9A 5CH3A 1WCV1 1M2OB 4FFRA 3HRIA 3MPOA 4I50B 1S8OA 3F6RA 1M2VB 4UM8B 2VBFA 4BN0A 1AKVA 3VC7A 4ZPJA 2AN9A 3ZHBA 3C45A 4EK9A 3UK7A 3EQ7A 3OZVA 3V4VB 1XJ5A 2MR5A 3I45A 3VO8A 1M8KA 2QRQA 1E64A 2ILVA 1KMNA 1K3TA 1PR3A 3EN0A 3Q9LA 4JITA 4RGYA 4MLPA 1JDTA 1QRSA 4YMHA 3SHVA 5HUHA 4HLNA 2UZ0A 1XZHA 3ZU5A 4L85A 4PZYA 1NULA 1J33A 1U28A 2LBPA 2PZ8A 3FTQA 3RYFB 1JQBA 5CA0F 3P2JA 2O0MA 1LD3A 3UNXA 4AN4A 1PDWA 2YIJA 1RM4A 3Q0TA 1L5YA 4XXHA 1UZLA 1D09A 2B4KA 4W5RA 1Z62A 1Z4LA 3F7TA 1Z7EA 1MH1A 1R0LA 3C43A 3WB9A 5KTMA 1KJ9A 4FYIA 3VC1A 2GM4A 3IT3A 1XZCA 1TU3A 1XNGA 2WHEA 3DVQX 1Y9AA 1YK1A 2H4WA 2J41A 2RAUA 3KZXA 3UA3A 4B8WA 3ZIUA 5KB3A 3TQHA 1E92A 2CEKA 2WSLA 4BU1A 2KWIA 4MKGA 4UHDA 2BP7A 1QH9A 1RDFA 2VEDA 3C97A 3AVYA 3PUIA 3C7TA 4RFSB 2P90A 4CN9A 2P68A 1D4OA 2H7VA 1HC7A 1EGAA 2UKDA 2QTVB 2FPIA 3MSXA 1YRHA 2B5VA 2W6JA 5DRYA 2WQ7A 1AJEA 4YRJA 5HK9A 3L43A 3OECA 3FDIA 1AS0A 5MN6A 4OHCA 5DK4A 3ZBTA 1H6CA 3CB4A 3FUVA 3G8DA 3A10A 1DCTA 1C8KA 3Q98A 4XQ9A 2O19A 2B9VA 3RUFA 1SN7A 3PNVA 2HRQA 4G8BA 4OFBA 3INRA 1YONA 3DTVA 3C5CA 3ISVA 3KKLA 3KU4A 4FR2A 4FUTA 4MUIA 3KR9A 4W1RA 4EHJA 3HYLA 1OZAA 2B6HA 2G9ZA 3AI2A 1PEYA 3MILA 2EU8A 3AV3A 2BEUB 3ZCXA 3ZXUB 4CF6A 4R1NA 2O2JA 1KQFA 5KU7A 4O6VA 4X1KA 3YASA 2FZGA 5FOUA 1CLEA 1MO3A 7YASA 4F5DA 4HRAA 4JB3A 3OZIA 5REQB 3H4VA 1N2CA 4UBMA 1P19A 4GZ5A 2ZUSA 5EE3A 4CMIB 1EQUA 1LDBA 3KXDA 1SXIA 4OHKA 4DT1A 4EMTA 3GAAA 4DCNA 3H0CA 1ID8A 4M3NA 1CKEA 1AQUA 1IN8A 4KN8A 2VHWA 4JHLA 2VJKA 2Q2NA 3VU1A 5TQ0B 5ARBA 2RAPA 3T1YB 1SKQA 4PRLA 6LDHA 2R00A 4V3BA 2Z5LA 1YDFA 2AJCA 2RK4A 5BQFA 3OWHA 4JJ6A 3RFVA 4BX9A 1YJQA 3FMFA 4V38A 4TXHA 4GVXA 4AJ9A 2MSKA 4J16A 1U7XA 4PX2A 2MCFA 3TOVA 1PWZA 4HNHA 5H68A 1TF2A 4CQLB 1IONA 3GLHA 3LVQE 1GSHA 1KETA 2C58A 4BZWA 1QP4A 1OI2A 3IUQA 3O38A 3HGMA 4WKNA 3IA2A 1L4YA 3KETA 3VR6H 4B3SB 2YV2A 2I0FA 1ZKDA 2IF2A 5BYAA 3TAUA 2GOYA 4P22A 1AF4A 3GG9A 3D4LA 1C4KA 1MAVA 3MS4A 3UK2A 1NVVQ 1SKAA 5F33A 1KEUA 2O8DA 1SH7A 1XVAA 4JUCA 4QPNA 2VATA 4IOLA 4HLUC 3RADC 2BJVA 4CCYB 3CW2A 2MOKA 3C8DA 3CGWA 2VP5A 2H9YA 4R8MA 2X8WA 2RGYA 3MN1A 3MUOA 3IDAA 5LZ8A 2Q2VA 2W83A 3BREA 2H5IA 2QXYA 1K2VN 3MD9A 4G1UC 4PVDA 1SB9A 3V2IA 2VAVA 3JASA 4J2TA 1ISMA 1JZSA 1SBYA 2IEZA 2HSWA 3FR7A 4ALLA 3NNSA 4PLPA 4D8WA 1RHMA 4C88A 3TKLA 4HX2A 4DG5A 4R6WA 1XTTA 4FZRA 2O0LA 1T1GA 2YTZA 2RONA 1DBQA 1RMQA 1XEXB 4FZVA 3WRXC 2Z08A 3FPKA 4DNXA 2QTNA 2I67A 1ILWA 1RXVA 3VAAA 5C31A 5IEJA 1WZEA 1HOTA 1RTTA 2I62A 2AD5A 5KNDD 2HB6A 2NYUA 1W4ZA 4TYYA 1QYWA 2EX0A 2SCUA 4P7FA 2WUDA 2VYFA 1NONA 3WLPA 4B6OA 2N1BA 5JANA 2QQ5A 2JANA 2MINA 3KCNA 5CDFA 1UPUA 1O77A 3KT0A 3Q7IA 3VOAA 5M2QA 1WBBA 5DM70 3JQ7A 1Q77A 2WVJA 2CSXA 4C7BA 1UJCA 4M55A 6YASA 1Q44A 2CF5A 2NU6A 3I04M 4XTCS 2FPWA 4AKEA 3PDIB 4S1OA 4FI3F 4EHBA 2WHQA 2XZLA 2FZWA 2AL7A 1CE8A 1TM4E 2I2FA 3LTEA 3G1UA 1HFKA 3OC0A 4NF2A 1AKTA 3HK2A 1AE1A 1S1MA 2HLDD 1L5HB 4PXYA 2NYRA 3ZZNA 3S8EA 4HL6A 3A32A 4K6HA 3CX3A 3HYSA 4IFEA 1UIRA 1UZMA 3H16A 5C7LO 4QULA 2QJTA 3BMQA 1GQFA 1EFKA 3E5MA 3HBFA 5F64A 3E8XA 4B44A 1QUFA 5AKGA 3QFFA 3KHUA 4MYCA 2ANBA 3KAPA 2FN7A 2FLWA 3DBVO 4CE6A 4LRTB 3W8EA 3EXG1 5TGZA 1LZKA 4A27A 3SE7A 5JAUA 1ZGAA 1EIZA 2BI4A 4J0KA 3GRVA 1M67A 2XHZA 3CJRA 4ZVOA 1BWSA 3EXFB 1J0AA 5JCOA 3FCEA 1J56A 2OCDA 2J9FB 1C50A 3GDOA 1G21E 3DFMA 3JR7A 4N7JA 2GZ3A 1M8PA