4XJTA

Human cd38 complexed with inhibitor 2 [4-[(2,6-dimethylbenzyl)amino]-2-methylquinoline-8-carboxamide]
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
241
Chain Sequence
b'WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Discovery of 4-Amino-8-quinoline Carboxamides as Novel, Submicromolar Inhibitors of NAD-Hydrolyzing Enzyme CD38.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, transferase
total genus 79
structure length 241
sequence length 245
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4xjtA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xjtA02
3OA0A 1ZZEA 5JY6A 5CP8A 5JC8A 5T8KC 4RGBA 4TWRA 2FPIA 4K9DA 2A4KA 3GR6A 4UEKA 3RFXA 4BMVA 3OICA 4MP3A 4EUHA 1R16A 2JJYA 4J4HA 3ZCXA 5DCYA 4HFRA 3HUDA 2D4AA 4XQCA 2DFDA 3RBXA 4A5OA 5I7EA 3QWFA 4M1QA 3SC6A 4YEDA 1OBFO 1PGQA 2PWZA 3CEAA 3DL2A 4URFA 3TDKA 4BV8A 3MCVA 4L75A 4JBHA 5MGBA 3CTMA 4RVGA 2VWQA 3UW3A 2OBYA 1MA0A 5TIIA 4IQ0A 1UXJA 4YJFA 1GPJA 2YHIB 1YBMA 2CSUA 1EVZA 2CMDA 2VT2A 1NAHA 4H3VA 5AYVA 2HMVA 5CAEA 1PS9A 1WDMA 2WE8A 3DAGA 4UVDA 2QYSA 3MEQA 4Y6RA 1VLLA 4D79A 2PH3A 3G1TA 1VRWA 1F12A 2Q1WA 3PJEA 4BO6A 3PHHA 2JCXA 1JAXA 3KLMX 1MXFA 5IF3A 3JQEA 1PL8A 2PK3A 2GERA 4DLLA 3VC7A 2V6BA 3ZI0A 3D3WB 1BMDA 2Q4BA 5CDYA 2A35A 3Q0EA 5LDGA 2VYVD 5TLSA 4ZRMA 4MVJF 1KBZA 4YT5A 1UXKA 4RQUA 3UOGA 4WCFA 3DZFA 2AEFA 5JFOA 1QXSA 5A03A 2EERA 3CIFA 1C3VA 4U0JA 4B3JA 2UV8A 5CPBA 3K92A 5G4LA 2PH5A 4IDCA 2NU7A 1NVGA 4D0RA 1EBUA 5BSFA 3LF1A 5IFLA 3L4BC 3HDYA 3AI1A 3I52A 1PQUA 4PG6A 1I2CA 4BKUA 1Y6JA 2O23A 3H65A 4D41A 3VZPA 3OP4A 4RDHA 1RM0A 4JIGA 4BL5A 1PIWA 1LRJA 5JLAA 1IE3A 2JKVA 2O4CA 3AM3A 3DMTA 4E2WA 3ROMA 5ILOA 1DJNA 1P1RA 3ZWCA 4CLDA 4DLBA 1I3MA 3DBHB 3WTBA 1S7CA 3WQQA 4PLYA 4QECA 3TPCA 1SZJG 1M76A 4NMHA 3HFSA 1Q1NA 3LLSA 4JK3A 1DLJA 1W0CA 1HSZA 4IDDA 4CMCA 1GEGA 1OC2A 1IB6A 2ZATA 4QFCA 1CF2O 1PWZA 1V3UA 4LGVA 3FNFA 3VDRA 3W6UA 4N5LA 1T4BA 1LNQA 3D4PA 3E1KA 4GLLA 4WGGA 5TX7A 1Z74A 2PD3A 3ITDA 3K8ZA 1Z75A 5KKAA 1Z7EA 3L9XA 1WVGA 1E3LA 1QR6A 1XQ6A 4XYBA 1SOWA 4PN3A 1QP8A 4XRGA 3FWZA 3PJGA 2I6TA 1U2GA 1KVRA 1VM6A 5ILGA 5JBIA 3RUHA 3ANMA 4HUJA 4Q39A 5I9LA 3I83A 4MOWA 3ZV4A 3F46A 4FB5A 2IEBA 4PZCA 2GCGA 2O3QA 2IXAA 4MIYA 1UJMA 1E1MA 2A92A 4M87A 2P9CA 1TB4A 1UAYA 1I10A 3C7DB 5L7WA 3NTOA 2X58A 3DBRB 1XU7A 1ZXLA 3HADA 4MP8A 3VPXA 3I9OA 2H63A 1MFPA 1XG5A 4BO7A 3INTA 2F00A 3ZHBA 1ID1A 5IXYA 4IJUA 3BAZA 3SJ7A 5IZ4A 2CDCA 3TQHA 4OKIA 4E2XA 4ZJUA 4ONEA 2VTEA 5AXCA 3LZ6A 5JDCA 2Q99A 3WGOA 1LTHR 4IMRA 5TNXA 4J90A 1A7AA 3WB9A 5KJ1A 3L77A 1JWAB 1M6WA 4CM8B 1HL3A 5EINA 2HKIA 3DAFA 3L6DA 3K2BA 3QA9A 5ENDA 8LDHA 2NU6A 4MVJP 4JGBA 1P45A 3IUPA 3E03A 2YY7A 3VZQA 4ND5A 3UH1A 3NKLA 2YFQA 4I5FA 5COQA 5ER9A 3I6IA 1EFKA 1ZK4A 5A4DA 2CZCA 1DOHA 3NGXA 1YB4A 5AXBA 3I5MA 3ZZNA 3DMYA 4R5HA 1YQGA 2B4RO 3KV3O 5JE8A 2GN9A 4INAA 4QQRA 3RROA 4WOJA 1C1DB 2B4QA 1FDVA 4OGWA 2PFGA 4D46A 4UUMA 2I76A 4CL3A 2FZEA 4MP6A 4BNFA 1YH3A 3TWOA 5U1PA 4OSPA 3M1LA 2I99A 3MJVA 4CM9D 1ZMTA 3GOHA 4J9UE 3IP3A 3EUWA 4CLRB 1R4MB 4GX2A 1OI7A 4TVOA 3KLPX 4PRLA 5B37A 5KIAA 1PGJA 5ES3A 1V9LA 2DAPA 4QX6A 1EVJA 1LRKA 2VN8A 4UUOA 2C7VA 5DDIP 3WBFA 4IBOA 4CMEA 1UR5A 2O3TA 1YL5A 3AFMA 2WYVA 4JX8A 1VPDA 1A7KA 3F1KA 3JQAA 4RV9A 3VDQA 1K89A 1KY4A 4II2A 4AFNA 4CM1A 4D43A 1C1DA 3HDJA 4MKRA 4NBWA 3LK7A 5FFFA 1QSGA 3EC7A 3HB4X 4IPTA 4TROA 2YV2A 2NVUB 2YV1A 3UF0A 3DZHA 4E31A 4ZQEA 2VT3A 2NVWA 3CZMA 1N8KA 1PJ3A 1Y8QA 3GG2A 4I5DA 1HF3A 2Y67A 1MP0A 1W6UA 5KJFA 2CDBA 1YJ8A 2DU8A 3I9KA 4ILKA 1D1TA 3KYCB 5EN4A 1XR3A 2J3KA 2XOXA 1H94A 2I9PA 3C8MA 4NU5A 3K2EA 2Y66A 3KSZO 4XQGA 1Y9EA 4RJTA 1HEUA 2PKRA 4PZEA 2P9GA 4F3YA 3BYZA 3RUFA 4G5HA 1ULSA 1B3RA 3WYEA 4J7UA 3K96A 1DC6A 3WGHA 4PLCA 1HE4A 5HBRA 1JTVA 2B35A 4J9VA 4NQZA 4W9NC 3DFZA 5GZ6A 1A9ZA 1R15A 2B37A 4CR7A 4DQVA 3MWEB 2NU9A 3NDIA 3NV9A 4D7AA 2ZCVA 3ZU2A 5JPIA 2AEJA 2V6FA 5DP1A 2NM0A 1PGOA 5GMOA 1JLLA 4BGIA 3GAFA 2C07A 1ZIDA 3N58A 9LDBA 4JLWA 2HSDA 5C7OO 4QUKA 3I23A 4RO0A 1MC4A 1IUKA 4CUKA 3H4VA 3NUGA 1Q7BA 4FN4A 3WGQA 4WNIA 4TZKA 2OOSA 4LMPA 2GZ1A 2FN7A 3NTQA 4H16A 2HK8A 3FTPA 1WMBA 4O6VA 2WTBA 5G0SA 3GHYA 4E0BA 1GFSA 3LQFA 1R4NA 3ZN2A 1LDYA 2X23A 1U3UA 4WLFA 4Y6PA 1E1NA 1C14A 1UXHA 4E21A 4IMPA 4NPCA 3SJUA 2I3GA 1Z73A 3JYPA 5DF1A 5A3JA 3RI3A 3ZNOA 2NACA 3OJ0A 3ZU4A 1AUPA 1Q0HA 3U9LA 3K73O 2VYVA 6LDHA 3F47A 4FDAA 1KOLA 1NFRA 5FEUA 3DOOA 4NHEA 1B7GO 2NSDA 4NIMA 4CQLB 3IL2A 3C1TA 4R69A 5A1TA 1T26A 1SO8A 4HFJA 3PGXA 4YJGB 2C5EA 3OQBA 1GQ2A 3VVBA 1FDTA 1J49A 1QLJA 3IDSA 4PLWA 5A05A 5G4KB 4IDAA 2GO1A 2WSBA 3BTSA 2X8LA 3MJSA 3QVSA 5JW6A 4DL9A 1H2HA 4ID9A 1GZ4A 1T2EA 3JQ7A 3H3JA 2RHRA 1E7RA 1XELA 1YXMA 3RUDA 4DQUA 3D5QA 1P33A 3UN1A 1JKIA 3UUWA 3EGOA 3WFIA 3GNTA 3P2YA 1GADO 5GZ3A 3GUCA 1ENOA 2CVZA 4TVBA 1DIBA 5JDIC 1E5LA 2X9NA 3FF4A 4YPOA 1NTOA 5CDTA 1IY8A 3U4CA 3IJRA 2OL4A 2GZ3A 4BGUA 2G17A 5JSFA 1NQ5A 4EUFA 4GQAA 5JAQA 4BNYA 3TJRA 2NTJA 1DDOA 2PNFA 2B0JA 1QYVA 3LT0A 4NBTA 3RC7A 4ZA2A 3VH3A 4RF4A 4MVJD 2Q1TA 3HN7A 4E2YA 4WOKA 4J7XA 3I4FA 2AQKA 4HX5A 4YRAA 1I24A 2P91A 5KVVA 2O4UX 1ISFA 1BXZA 1EUDA 1YO6A 3S1LA 1ORRA 4MDHA 1KETA 1E5QA 2ZQYA 3DB2A 4Z0TA 1I32A 2VYND 5DBIA 4UAGA 3GN2A 1NQOA 1WDLA 1JDJA 4L4XA 5I7SA 3PWZA 2GDZA 2GD1O 1HZJA 5JY1A 2YFHA 4EITA 4FD3A 4OIMA 1B26A 1PR3A 2GR9A 3VPSA 3WGYA 1E7WA 1ZMOA 4FFRA 4IJWA 3ZWMA 4R1NA 2FSVA 2Y1FA 5COBA 4WLNA 1SC6A 3ZV5A 3IMFA 2IZZA 5I9NA 4PRKA 4YDRA 1PZHA 3OQ6A 2VHYA 2DTEA 3CH6A 3CMCO 4XCVA 4BGVA 4E13A 1GYPA 3PGJA 3UICA 1ISGA 4UVEA 3WMXA 3V5NA 3RASA 2IYOA 2C2YA 4LSMA 2OUIA 1H9AA 2G76A 1AN9A 2AEMA 2FRDA 4L8VA 4BO2A 2RBEA 3RKRA 2AG8A 1KY5A 2Q4EA 1CQIA 5JC1A 4WK6A 3UVEA 5A5EA 2E37A 2TMDA 4F6LA 5GY7A 4FJ1A 3IUSA 4K28A 5T64A 3BHJA 1JA9A 1UUFA 5AVOA 1EK5A 1XKQA 3WQSB 4YQYA 3OA2A 1NPDA 4IDGA 2Q49A 2PZJA 1GZ6A 3L0DA 1DHTA 4Y67A 4MPDA 1X1TA 5DCWA 4CM7A 1I2ZA 3NEPX 4XYGA 4DXHA 1JKJA 1XLTA 2Y0DA 4Y98A 3JQBC 4N5MA 3C7CB 4BOYA 4M55A 3QSGA 4OM8A 3HNPA 1EEHA 4CLOB 3FRJA 3HQ4O 1DRUA 2ZCUA 3FN4A 3RIHA 1I3KA 3H2SA 4A73A 1FK8A 2AXQA 2X86A 4FFNA 1E6UA 2Z95A 4M89A 4ZQGA 2VWPA 3JQFC 4HADA 4CR8A 3DONA 2ZTMA 3HJAA 1U8FO 3AY7A 3GDGA 1GQQA 4IDFA 5EQDA 1UH5A 3E8XA 3ENNA 1QYCA 3RUAA 4QO8A 2NV6A 2EG9A 1NX6A 3DOJA 3LDHA 2HMTA 2SCUA 4EZBA 2QHXA 1N7HA 2J3HA 1W73A 4KP7A 1B16A 4KTTE 1J5PA 1JVSA 4BGEA 2HMUA 4CLOA 1LBEA 4I9HA 1E1LA 1DIHA 4J91A 4PVCA 1HDOA 3P7MA 4CR6A 2EF1A 2YQ5A 3BHMA 2PZMA 1KIFA 5L7TA 3MZ0A 1E7SA 3QVWA 4DPLA 1MV8A 3H9QA 2J6IA 3LU1A 4X54A 4M54A 1CQJA 1UXIA 2DVMA 2PD6A 1ZK3A 2CF6A 4J1TA 5L45A 1RWBA 1I3LA 3ZWAA 2Q2QA 2HUNA 1NVTA 1U7TA 2BLLA 3BZUA 3HDHA 4IDEA 4KZPA 1NPTO 1O95A 3AU8A 3PYLA 5IN4A 2Y1CA 2Q50A 4GGPA 2FWMX 1L1FA 4YA6A 4BB5A 2PD4A 4BKRA 1DRWA 3WQRA 5FWNA 4QSMA 4RL6A 3G79A 4O1MA 1B15A 4B7CA 3QE3A 1B3BA 5U4QA 4BO8A 1CIVA 1H93A 1J6UA 5ENVA 5A3VA 4BO5A 2VNAA 1LSOA 3NTRA 2E48A 1A72A 3CSDA 1RM5A 3NT4A 2CY0A 3PPIA 4K1LA 2FHSA 4PGFA 4CL8A 5IXSA 2B83A 1ISHA 3OSUA 3KM0A 2FSSA 2I3AA 2VHWA 4GL4A 2VUTA 1JW9B 3TOXA 4EJMA 3OJOA 2EP7A 2HMSA 3UAGA 4NFSA 1DC3A 4NJOA 4RVUA 2VQ3A 5KKCA 3VZSA 4BMSA 3VH1A 2PV7A 4ZICA 1JVBA 2BFAA 4G81A 3DO5A 4L74A 4Z9XA 4R4JA 1YOVB 3AY6A 4HNHA 4LN1A 3ZNNA 3ONFA 3WIDA 5JXWA 3VAZA 4CMGA 4DLAA 3TZCA 2YHUA 4C7KA 1XCBA 1BW9A 3CE6A 3EZYA 1DPGA 3VPGA 4DYDA 4J2OA 4ZD6A 3GC6A 3ZWPA 1BSVA 3KYBA 3OEYA 4DREA 2QYTA 2ZIZA 4RZHA 1M67A 1ZK2A 1PL7A 4YJFB 5F21A 4KQWA 4Z3DA 5TJ9A 4DA9A 2R00A 3WDSA 4U5QA 3OHSX 4BQRA 4QFDA 3WSWA 4PG8A 2NLOA 4YACA 4AJLA 2YYYA 4WECA 1DB3A 1HE3A 4J16A 4JXKA 2BGKA 5TS3A 1YOVA 1QLHA 2V6MA 2QZZA 2ZK7A 3AOEA 4R9RA 2DTDA 4O63O 3EVTA 5J23A 5L53A 1YS4A 3JQ6A 1N92A 4JROA 3FNGA 3GPIA 1MXHA 1NR1A 1U1IA 5TF4A 3KETA 4DMMA 3CINA 3B70A 2ZB4A 1Y9AA 2OP1A 1ZJZA 2R2GA 4H7PA 4J1QA 4S3MA 4I9NA 2OP0A 3CXRA 5JMPA 3I1JA 4WCFB 2OORA 1YL6A 3DZJA 4OKNA 1E6WA 4ITUA 3V1TC 8ADHA 2DTXA 4R3WA 1QYXA 3W8DA 1ADGA 3R3SA 4DRYA 1DAPA 3OEWA 3JQ8A 4J49A 1YBAA 2O7SA 4CODB 5LCXA 3GT0A 3P2OA 5A5FA 2C5AA 3DZIA 1HYHA 4DGSA 4FBGA 4GGOA 4BNHA 1C0LA 2C2XA 2EP5A 2P5YA 3ZWXA 3OH8A 4RPJA 1CDOA 5ICMA 2CVQA 3G17A 1U9JA 4BVAA 3Q6IA 4NNJA 1PSDA 4GI2A 5A9TA 4QTZA 3GEDA 4P4NA 4MVJA 2YW9A 5DULA 3ZV6A 4MVJH 4XQ9A 3R0IA 1SMKA 4XB2A 2J5RA 4OYRA 1PJCA 3E82A 1K2WA 1X1EA 5DCUA 1A27A 4LW8A 3JD0A 5IAAA 4K6CA 4Y9DA 3GNQA 5AQ1A 2PY6A 1J0XO 5IZCA 1H6CA 4P4LA 2ZB8A 1WLYA 1N1GA 7MDHA 3PWSA 1O0SA 3ST7A 1FDWA 1PJTA 5IDWA 4PLGA 4ZGWA 4OXKA 4AJPA 4PLTA 3ONEA 1X0VA 3OJLA 1CJCA 2GASA 3BMCA 4XB1A 4NI5A 4R51A 3RJ5A 4QO7A 3VVCA 3A1NA 4OH1A 3MJCA 1EDZA 2DUUA 4W7HA 4WNCA 1LSSA 1YQXA 1D1SA 4W7IA 3EHEA 4D45A 4GMGA 3EZLA 4Z3KA 2BGLA 3GGOA 1X0XA 4BS9A 1EQ2A 1HKUA 1PJLA 2HMWA 2FPGA 5A06A 3ZU5A 1YB1A 5ITVA 1KERA 2JAPA 3PHGA 3TRIA 2XF8A 3ZWWA 1HDCA 3DFUA 3RFVA 1C1XA 3KBOA 1ZO8A 5KNLA 4GSKA 1MG0A 3UGKA 3Q2KA 4RPHA 4JP3A 3RU7A 2ZTUA 5L7YA 2X5JO 2FR0A 2P4HX 4CMIA 4GKBA 3JTMA 3E9NA 1LQUA 3QW2A 2C7GA 3NRCA 4UVIA 1H6AA 1LDBA 5EPOA 2E82A 1WNTA 4RF3A 1RM4A 5BNIA 3ZV3A 1SB8A 5CDUA 2W98A 4NU6A 3ETDA 1E7QA 3NDRA 1Q0LA 4LSWA 3DZKA 4TRNA 1FDSA 4N5NA 3HHPA 5CDSA 2B69A 3ZWVA 4BNUA 1R0LA 4CV1A 3WNVA 1ENYA 1DBVO 3ZWOA 4B8ZA 1PR9A 4I5GA 4I5EA 1AHHA 2OHXA 5EMHA 4DIFA 5G0WA 2GSDA 4U6SA 3T7CA 3IKVA 4AJOA 2AA3A 3QWIA 3U4IA 3HFGA 1JWBB 4CLXA 5AXAA 3IC5A 2O2YA 1RYEA 4EEZA 2VZ0A 4NBVA 5K6AA 1XHLA 1DO8A 3O9ZA 2NWQA 2ZJ0A 4BO9A 1Z82A 2VUUA 1EBFA 3E48A 4YCAA 4HFMA 3CMMA 4IDBA 3VHRA 3LT1A 4WE3A 2C59A 5CPFA 4XJTA 3RSHA 3ZWBA 4BNKA 5HS4A 3O8QA 4A10A 3D64A 3SLKA 3PQEA 1QV6A 3L6EA 3Q2IA 2NQ8A 3PWKA 4HP8A 2X9GA 4JJIA 4YWJA 3BTOA 3KSDO 2RH4A 3FR8A 2B5VA 3G1UA 4CPDA 3D4OA 4BNIA 2W2KA 1B0AA 4QEDA 3JQAB 1K5HA 3H6KA 1Y5RA 3NX4A 3U3XA 4CUZA 4YJHB 4BO3A 1B8PA 2YDYA 1F14A 2IRWA 3DTTA 3BMQA 1UP6A 4GWGA 1T4DA 3WX0A 5A9SA 4BUCA 2ET6A 3GHHA 2HCTA 4Q3BA 3EVNA 4Z9YA 1B14A 1RYDA 1T2AA 1BGVA 1FDUA 1Y8QB 2EKQA 1LSUA 1HETA 4PG4A 3RUCA 1GPDG 4ND4A 1T1SA 4KOAA 2BFPA 4WUVA 1SCUA 2AE2A 2AMFA 5DN9A 1PS0A 5JS6A 4P8RA 1LLDA 3CPSA 2WMDA 3JYOA 2AW5A 3PEFA 3WNQA 2O3RA 1LLQA 1SBYA 4KDEA 1I0ZA 1EDOA 4IGFA 4R01A 4R16A 2GGSA 3KEOA 4CM4A 4ZRNA 1DIGA 4CV3A 4BO4A 4YJHA 2DFVA 3AK4A 5FF9A 1VE9A 4DVJA 4E6PA 1OC4A 1AXEA 1G0OA 4ZU3A 1U3VA 2DPHA 3AM5A 1A5ZA 4CQMD 3FSRA 4FGWA 1Y8RA 3GVXA 2VZ8A 3KOUA 1XYGA 5F1PA 4F46A 1A4IA 2VZ9A 3A14A 1IPEA 5DNAA 3CKYA 4XQEA 3QV1A 1E0DA 1K6JA 1L7DA 4PVDA 3RD5A 1U4OA 3TZHA 3F6YA 2GPTA 4DPKA 1LLUA 3TFOA 3PI7A 3K31A 3VTZA 1HYGA 5EJ2A 1D3AA 2O48X 1IOLA 2QRKA 2D1YA 3ASUA 4A2CA 3E9QA 4ALKA 1NNUA 2EGGA 2JFFA 3W6ZA 3H5AA 4Z0HO 1UXGA 4XGNA 3NDJA 4IXWA 4OQZA 4FGSA 1I01A 4MIOA 1A71A 5LC1A 1XA0A 3ZW8A 1CEQA 2EXXA 1ARZA 4R54A 3GLQA 1LQTA 2BFMA 4EEXA 1AE1A 1BRMA 4XDZA 2ILTA 1X14A 1I36A 1R4NB 2C54A 1OMOA 3F4LA 5CEFA 3M2PA 3RJ9A 3EYWA 1GTMA 1OOEA 3GRPA 4ALIA 3UXYA 1UDBA 3QHAA 5T57A 2POQX 1R6DA 4KWIA 1P1IA 2ZYGA 3FBGA 4D3FA 3TL3A 3WS7A 4TQGA 1ZJYA 1WDKA 1HZZA 3KXDA 1ZEMA 2NNLD 1O6ZA 4P4GA 3PP8A 5CEEA 4XGIA 3ROKA 1T2FA 1VJ1A 2ZTLA 1RKXA 3O03A 1M66A 5DT9A 3FTNA 4GKVA 4XYLA 1GZ3A 4B4OA 4GAEA 4WCFC 1VKNA 1HWYA 4FJ0A 3INRA 1DJQA 2WJPA 2W2LD 1JN0A 2D0IA 1LLCA 1ONPA 3QLJA 4K26A 4BO0A 3AUTA 1NFQA 4EJ0A 4XYMA 2HK7A 3JQ7B 4A7PA 4NBUA 5L3ZA 3A28A 3WIEA 1BVUA 2W90A 4PG7A 1BG6A 2OGUA 5HM8A 1D4FA 4UREA 2Z1MA 4TKLA 2VHXA 4IGEA 4CMHA 1XDWA 2WD7A 4AJKA 1QV7A 4KWHA 5A9RA 1H0KA 1H2BA 1Y5MA 2BD0A 2HAEA 3M2TA 3I9JA 4DIBA 2WE7A 4YT4A 1GUYA 3KUXA 4BNJA 1SB9A 4JBIA 5I7VA 1UZLA 1VL8A 2QZ9A 4XR9A 3WJ7A 1T2CA 4RF2A 1XIVA 3JQ9A 2XXJA 1ZK1A 4FQ8A 3WFJA 4RVDA 3DMTC 4CV2A 2CFCA 2TMGA 3RQSA 4PLFA 3GNSA 1GR0A 1PJSA 1GD1O 3JQDA 1IZ9A 2BI7A 1DC5A 2A9FA 4AICA 1O5IA 3LSYA 3S2FA 4OAQA 1NQTA 1YBVA 3QIVA 3I9LA 2JCVA 2UDPA 3ZDFA 2EWMA 2X6TA 4LCEA 4J43A 5G0TA 1U2DA 1EE9A 4IZHA 5B4VA 2PR2A 2NTVA 3BMNA 4IZIA 4ZVVA 4B7XA 4LK3A 2NU8A 2G5CA 3W1VA 4R1TA 1ISIA 2B4TO 5G2OA 2H1SA 1H9BA 3IAHA 1PWXA 2BF7A 3K5PA 3JD3A 4KTVE 1OFGA 3KEQA 4YJDA 1WZIA 3BXXA 4CLEA 3NAQA 4J2HA 3W8FA 1XSEA 1QKIA 2F1KA 4O5OA 1PJ4A 4XR4A 1F06A 4FFLA 2HU2A 4A26A 3L4SO 4U8GA 3WGGA 3K30A 3L9WA 2E6UX 3TZ6A 4GX1A 1U5CA 3OBBA 1HDXA 4NJMA 2X0JA 3HWRA 4FFMA 3WSVA 4IS3A 4YVFA 2IDZA 4YRBA 1VJTA 4W6ZA 3VPFA 4D42A 1NWCA 1QG6A 3KZVA 1K6IA 3C24A 3QVTA 4WJZA 2Q1SA 3FWNA 3PK0A 1LDNA 4CMAA 1D7OA 4YAJA 4E5PA 3AFNA 1E6EA 5CFZA 3CUKA 2D8AA 4J4BA 5JCJD 1E3EA 5JO0A 3GFGA 1F0YA 4JQCA 2QIOA 2VOEA 4YAKA 3GN1A 2CF5A 1E77A 4OXNA 1NR7A 3UCFA 1SNYA 3ZHZA 3ADOA 3LT4A 5BNFA 5JDCC 2X9VA 3DR3A 3EK2A 1K6XA 4RF5A 4RZIA 1SEPA 2AHRA 2Y0EA 4G2NA 1TI7A 4ND3A 1QRRA 3GFBA 3ZW9A 3GVCA 1B2LA 4FW8A 1LA2A 1LX6A 1G6KA 2YJZA 1ENZA 1E7YA 1X7GA 3KYDB 4DC0A 1IHXA 3ZHYA 3ZNPA 4D0SA 4DUPA 4BNXA 2FPPA 4ALMA 5KCZA 3OM9A 1KVSA 2GLXA 3HZZA 4GVXA 1NWHA 2QRJA 5GZ1A 2ZB7A 4I9UA 3U5TA 4TZTA 3ULKA 2JFHA 4EI2A 3FI9A 1W4ZA 3W8EA 1PGNA 2DUWA 4N54A 5THQA 4Q3EA 4PLHA 1NASA 3GGGA 3WWZA 4ALNA 4ESOA 3NT2A 3OQ1A 4HKTA 1M75A 2P2SA 1N5DA 3L4BA 2XAAA 5I7FA 3AOGA 1Z7BA 2J5QA 1JAYA 4DMLA 1BXKA 2Y05A 1P3DA 4YB8A 3IKTA 1KEVA 1X7HA 3OJEA 1NP3A 3TZKA 5L40A 3KYDA 3F3SA 5LDHA 5ICSA 3MWDB 3LLVA 3PJFA 3DC2A 2BMAA 3NT5A 3V8BA 4TRRA 3DQPA 3KB6A 2DBQA 3SC4A 5L95A 4MO2A 3U62A 1NAIA 4E12A 3WYBA 3AM4A 4CMEC 5H81A 4GMFA 4FR5A 5BR7A 1HTBA 1LU9A 2RCYA 5B4TA 1C0IA 2V6GA 2PZLA 2X5KO 3OMLA 4GX0A 3ZU3A 1EMDA 4HV4A 2QRLA 2LDBA 4TRJA 4KMSA 5KVCA 4DWVA 5EIOA 1XWFA 3S55A 4BNGA 3NYWA 4CM9A 3UCEA 1V3TA 4OSOA 1E3WA 1RM3A 3FNEA 4H15A 1UZNA 4XIJA 2JFGA 3X2FA 5ER6A 3VTFA 1B8UA 4TRMA 5TC4A 3W4KA 1ZW1A 1PZEA 1YKFA 1Y81A 5I9MA 4WEQA 4J0EA 3PFFA 1U7HA 4R1UA 1CERA 1YL7A 1ZSYA 1N2SA 1GDHA 2I67A 1YRLA 2HJRA 4OMUA 2PZKA 1AXGA 3C7AA 4Q3DA 2WYWA 4CQMA 3JD1A 4RVFA 5TRTA 2QW8A 3GEGA 3H9EO 3ZNQA 4UUPA 3OFSA 2PTGA 3IJPA 1P0FA 1IZ0A 1Q7GA 1S6YA 1MFZA 2H6EA 1WWKA 4MJLA 3GMDA 3AUAA 3U4DA 1BDBA 3ROQA 4FS3A 1HDZA 1GV0A 2D2IA 4GSLA 4D44A 4YAEA 3EW7A 1BW9B 5L4LA 3HSKA 1FF9A 3FPCA 3K6JA 4R1SA 1V6AA 4JJGA 2IEDA 4QXMA 4AJEA 3H9UA 3ORFA 1MGOA 2UYYA 3D1LA 1P1KA 3JQGA 5F1KA 2HO5A 1PGPA 1N1EA 3D7LA 3MOIA 3KSUA 3S2GA 3LF2A 1OAAA 4BQPA 3GGPA 4JBGA 3ITKA 2Z1NA 1WMAA 4WCDA 1KEPA 5DP2A 5KWEA 5JCXA 4KUGA 3DHYA 1GV1A 5A02A 4CUJA 1X13A 3ETGA 3PZBA 4RDIA 1DFGA 2W8ZA 4FC6A 2Y0CA 1KYQA 1B8VA 1VL6A 1U3WA 4GPD1 4FOSA 1NFFA 4PFJA 1XQ1A 4NFYA 1PQWA 3I9MA 5B12A 5JAIA 1KC3A 5IDXA 3WGZA 4E30A 1GEEA 1ENPA 1V0JA 4K6FA 5L4NA 5KVSA 1I2BA 4OJNA 3GMSA 1DXYA 3U0BA 1ZK0A 2D5CA 2W2LA 4RLHA 2DQ4A 4L73A 4XJSA 1YONA 3N74A 3JQ8B 1TA4A 1HLDA 1P1FA 3QP9A 3L07A 1GUZA 1TXGA 3RBZA 2Y1OA 4PG5A 3WICA 2V65A 4NK5A 2EV9A 5FYDA 1HDYA 1ZFNA 1LRLA 3T4XA 1AGNA 4YBZA 4GX5A 2WDZA 3MJEA 1WXDA 1A4UA 4I8XA 4DC1A 2EJWA 1TLTA 1HYEA 4J3FA 1LC3A 2HRZA 4E5NA 4DBVO 1PZGA 4Q3CA 2H5LA 4A0SA 2GN4A 3QQPA 3WYCA 5KJCA 1V3VA 4ZN6A 1TT5A 1UDCA 3OECA 3RAJA 4RPLA 3D0OA 5EL0A 2BFOA 2BELA 1YJQA 3DBLA 2WWRA 3ANLA 3I6QA 3L6OO 4GH5A 4WPGA 3RUIA 2J3JA 3TFQA 2A94A 1JKFA 4JP2A 3CZRA 2Y93A 4J4TA 3COSA 3D3EA 4DYVA 1PEDA 1NHGA 4GBJA 4EJ6A 2O3JA 3GZNA 4IJVA 4W9NA 2Z5LA 4XIYA 4J7CA 3WXBA 1HE5A 4UEOA 3RC1A 5IN5A 2I66A 4DTIA 4BNNA 1AHIA 1N7GA 3PHJA 2O3SA 3ABIA 4MIEA 3BMCB 4B4VA 1ZUD1 3SX2A 4KUEA 3V1YA 4B7UA 1ONOA 4FC7A 4BV9A 4OQYA 4GLOA 4W82A 4MINA 4RPGA 4TMFA 3KRTA 3QWBA 4PIVA 1PL6A 4IXTA 4J1NA 4F6CA 5T67A 2FMUA 2G0TA 2P5UA 2VRCD 4IS2A 2PGJA 4FFPA 3PTZA 2EIHA 1GY8A 4UVHA 4LVCA 1NYTA 2VYNA 1X7DA 2XXBA 5JAZA 4NG5A 3PXXA 4ALJA 1C1XB 2EKPA 3U49A 3UCXA 4F45A 5JCJA 4YXFA 2IZ0A 1T1RA 3RC2A 3GAZA 5K0ZA 5JYEA 4BO1A 2YHIA 1ZCJA 3ANNA 4A27A 5C7LO 3LC2O 4CMBA 2IYPA 5TSDA 1KEUA 4D3DA 1DSSG 3NJ8A 4CMIB 4AJ2A 5DOVA 3PLRA 4AJ4A 2GNAA 1E92A 1LC0A 2ZJ1A 1UDAA 2NVBA 1PQPA 4RLSA 1ADBA 4B8WA 5TGDA 5JNLA 5F1OA 2OO5A 1ZSVA 4W4TA 4NDNE 1N9GB 4JNKA 3TOZA 4R68A 1LI4A 2D59A 4XZ3A 2CNBA 1ISJA 1HXHA 1X15A 3D3WA 3RCBA 1U4SA 3WLEA 3H5NA 1XEAA 2BH9A 2WM3A 1XGKA 4XDYA 1R66A 2EJVA 1SOVA 4RVSA 2JHGA 2ZTVA 1LSJA 3OIDA 3QJ5A 1SPXA 1K3TA 3Q11A 1WZEA 1MX3A 3AUUA 1P1JA 3PIIA 4QT0A 2ZYAA 4YRDA 4XYEA 5B4UA 1NQAO 3GEMA 4L0QA 3LC7O 4FIZA 1O8CA 4NBRA 3AI3A 4G65A 4UULA 5DBGA 4MVJM 5K9ZA 2D5AA 2OZPA 3DWFA 2HK9A 1GL3A 3GH3A 1E3IA 5AXDA 5JDIA 3D5TA 3GDOA 1DC4A 1N9GA 2OBNA 4R3NA 2E4AA 3HDQA 3O8QB 4KUHA 5BT9A 3GY0A 1IHYA 1Y1PA 2EW8A 3INGA 3V2GA 5IDYA 1YDEA 5C7IO 1M6HA 5KJEA 3F5SA 1ZKMA 4WLUA 4FPXA 3VH2A 2VWHA 1DHRA 2GUGA 3U4HA 4CMJA 1H6DA 1Z6ZA 4ZHSA 2UAGA 5U9CA 4YT8A 2W2KB 2C0CA 1W8DA 1DFIA 3IS3A 3DBHA 3R3JA 3PYXA 5TT0A 1PJBA 4IQGA 3BMQB 3AJRA 2ZYDA 2JHFA 3BTVA 4BKPA 5A9SB 1M2WA 3RFTA 3A9WA 3DXFA 4Y8VA 5EERA 5H82A 3RVDA 1LDEA 4B3HA 1JQBA 3HG7A 3VZRA 2Q2WA 3BTUA 1GYRA 5CG2A 4PCVA 3NGLA 1EQUA 1Y7TA 3OF2A 2HJSA 5F5LA 2VRBA 1WW8A 4AG3A 2CDAA 4E3ZA 1BVRA 1DAOA 3JYLA 4IIVA 5F5NA 3QVXA 1ZEJA 2VTDA 3AU9A 4CM4B 2H9IA 3H2ZA 2YV3A 2J5KA 3DTYA 3AI2A 2AE1A 2IE0A 3EAGA 3F1LA 2ZQZA 5IDQA 4N18A 4XGKA 2P9EA 2X0RA 1D8AA 4I1IA 5G0VA 1ADFA 1U28A 1Q7CA 2G82A 4R5MA 1Y8RB 2NQTA 3X2EA 3BHIA 2CD9A 3TNLA 1OZAA 1K0UA 4B3IA 2VUSA 4BHTA 1NHWA 3E6AA 1LDMA 3DBRA 4WLVA 1VI2A 3NJ4A 1P77A 4IJKA 4XX0A 4MVJE 2BRUA 3SBOA 3ZHXA 3OIFA 3GVPA 4NZ9A 3V2HA 2E49A 2Q45A 2Y1GA 4EUEA 3SEFA 1C0KA 2P4QA 4Z6KA 1J4AA 4D3SA 5BSEA 4DBZA 3P5SA 4BIIA 1NVMB 1R0SA 1ONNA 3QWAA 2IZ1A 1NXQA 1YVEI 1Q0QA 3E9MA 2V7PA 4CM8A 3JQBA 1EK6A 1GCUA 2NUAA 4GWKA 3ONDA 1E1KA 1JU9A 1A9YA 1DFHA 2PA3A 3JD2A 3WOHA 1F8FA 1YB5A 2PKQO 4J0FA 2Y99A 1IYZA 2CUKA 3TSCA 5I8WA 2EKLA 1QYWA 2R00C 1E7MA 4E5YA 5AOVA 3RUEA 1P9LA 3JQFA 3DZBA 2FZWA 3UKOA 2WYUA 2VHVA 5A04A 2P68A 1P74A 1KC1A 4AVYA 1NBOA 1Q2XA 2FOIA 3AOEC 4OOFA 4EDFA 4LRSB 3ROPA 3Q9UA 3WJAA 2RHCA 1LUAA 3WGIA 3RBVA 4ND2A 3STHA 1KVUA 4ROSA 3E5MA 3OIGA 5L4SA 1ZBQA 1YDWA 2OMEA 3E5RA 4XA8A 3FD8A 1EE2A 4WEOA 5EESA 5G0UA 1CETA 2FY8A 2EGHA 2NTNA 1ISMA 2RIRA 4B4WA 1R4MA 1R12A 1T24A 4E32A 4CLRA 5EQFA 1HRDA 4CV0A 1DEHA 3DEYX 4M86A 3BMOB 4L4RA 3EDMA 3G49A 3GG9A 3PZRA 3C1OA 1I33A 3R6DA 4NH4A 5BNTA 4ZQFA 4YQZA 4HY3A 1P44A 4L9RA 5BSGA 5BSHA 2X0NA 1G1AA 2BKAA 3ZH2A 3EY4A 1P31A 3E18A 2WD7B 3FNHA 3SLGA 2IODA 5IG2A 1EVIA 4JN6B 3F5QA 3O4RA 2JCYA 2NVUA 3H9GA 2FP4A 4IINA 4PZDA 4OOEA 4FSHA 1CRWG 3MJ4A 4WASA 4P22A 4RPKA 1P1HA 1EUCA 4UVGA 1HSOA 5C5IA 2QG4A 3ASVA 3JYNA 4M49A 1HE2A 3KYCA 3OETA 3UHAA 3PDJA 3GQVA 2VCYA 3DBVO 1TT7A 4YTEA 4GVLA 3OJFA 4KDFA 4BNMA 3BMOA 1C0PA 1XU9A 1VJ0A 1PJQA 1PZFA 4BNTA 3ON5A 3PHLA 3TF5A 5IZCC 1GCOA 3U09A 3T7EA 5HTOA 3WR5A 3BMNB 3QVOA 3BA1A 2YDXA 3B1JA 3PDUA 3P19A 4U0KA 1YE3A 2Y68A 4XKJA 3PHIA 2EEZA 1HLPA 4AJHA 3V2UA 1G0NA 2I65A 1KVTA 5MDHA 1R37A 1DLIA 3PQDA 4AJIA 1F8GA 1QORA 3G3EA 2PGDA 4NK4A 2YZ7A 1HDRA 4Q9NA 1O9BA 2HRBA 3JCZA 2ZB3A 4HXYA 4NJMB 1EUZA 2CVOA 4OO3A 5THKA 2VRCA 4UEJA 3T4EA 6ADHA 1SAYA 4E4YA 2C20A 3WMWA 1FJHA 1IPFA 2FR1A 2DBVO 2OXIA 1R0KA 4U7WA 4MKXA 2X1HA 3QY9A 4TSKA 3FCOA 3H7AA 5TJHA 4AJJA 1ULUA 4CM3A 4BKOA 4LCJA 3RWBA 1WAMA 4HNGA 4WKGA 4PLVA 4BNWA 5HWSA 1VSUA 3I3OA 4XRRA 3B1KA 3Q1LA 4Q3NA 2RAFA 5T8KA 4BNVA 1ML3A 3UFXA 5KOIA 4DIOA 3WWYA 4E5KA 1DRVA 2DLDA 4AJNA 1DIRA 2VNSA 1ADCA 2GF2A 4M8SA 1RJWA 4RCVA 4B79A 3ADPA 1L7EA 1H6BA 7ADHA 4TKMA 2BGMA 3HB5X 3PLNA 3QRWA 4XD2A 4FCCA 3PQFA 1EVYA 5I8ZA 1I5RA 3DHNA 4EGFA 5JO9A 2HDHA 1BDMA 2Q2VA 3IP1A 4WLEA 4IY1A 3A4VA 1NM5A 3PIDA 2JL1A 3RU9A 4E5MA 3ZWNA 2Q46A 3B1FA 4CQLA 2IXBA 3GK3A 3C3XA 3H9JA 4U6QA 3HE3A 2DT5A 4YJGA 4L4SA 5HRUA 2X7HA 2J8ZA 3VKUA 1LJ8A 5G4KA 3QWHA 4ND1A 3D4NA 4WLOA 1PX0A 3Q9NA 5JYDA 2VHZA 2EHDA 2C82A 4IUYA 4R9SA 2PLAA 2NADA 3W4JA 1V8BA 1T25A 2QQ5A 4EW6A 5DZSA 5K6AC 4NR0A 2BI8A 1GYQA 3GVHA 3WLFA 4FJ2A 3JSAA 3N7UA 3PRJA 3FHLA 2PKQP 3MTGA 3DZGA 4KQXA 1I8TA 4II3A 4N7RA 3PVZA 3C1AA 3MOGA 5TQVA 3WTCA 4C4OA 3AW9A 1QMGA 4LRTB 1YWGO 2GZ2A 2YUTA 2RH8A 3IOYA 2D3TA 1UAGA 2JD1A 1P0CA 3O38A 4ZQHA 5JMWA 5F3RA 4J1SA 3ICPA 3GZ4A 1MG5A 1PS8A 1VKOA 2W4QA 3B20A 2DBZA 1BXGB 3ICCA 3PYMA 1TEHA 1QYDA 1V35A 4HWKA 3GUYA 1TVEA 1IL0A 2EW2A 2UUPA 1IULA 1HDGO 1PJ2A 1RPNA 3SXPA 4B4UA 2UUOA 4NFHA 2G1UA 3F4BA 3IIEA 1E3WB 3IQDB 2LDXA 3KTDA 4YAGA 5H83A 1WPQA 4BB6A 1LEHA 1EZ4A 3FR7A 5TT1A 1ZH8A 5ADHA 1UZMA 3AY3A 1CYDA 1ZNQO 3LVFO 4MVJG 5KTKA 3F9IA 5C3MA 2AQHA 1VSVA 4PLPA 1BHSA 1O94A 1UP4A 2HQ1A 2O50A 3B6ZA 4CLHA 5ITWA 1BXGA 5JAMA 4LVUA 1E3JA 2AQIA 2DM6A 3PJDA 4MVJI 5DOZA 3S2EA 4RQTA 4CQMB 2Y1DA 2Y1EA 3TN7A 3M6IA 1U8XX 2UVDA 2BHLA 5HS6A 2X22A 4IIUA 4S1VA 3GPDG 2QX7A 4BKQA 4HBGA 1I30A 5BQFA 4P38A 5KVQA 3JQCA 4YT2A 4BNLA 1E3SA 4Y6SA 3ETEA 1PTJA 5COAA 4AL4A 3FBTA 4YYZA 3AWDA 4ALLA 1BTOA 3H3FA 4Z0PA 5C37A 4CJXA 3O26A 3GVIA 3AUSA 1I3NA 4OL9A 5CDGA 3PFWO 4FOOA 2DKNA 2PGLA 1GQYA 1MLDA 1O89A 3K9QO 4LMRA 3ZGYA 1Z45A 4EBFA 1ZXBA 1GU7A 3ZWYA 3JD4A 1KS9A 2VOJA 2AQ8A 4O0LA 5DBFA 1VL0A 2DPGA 3JQGB 4HFNA 5IJZA 4FFOA 3GRKA 3JYQA 1BWSA 1HT0A 3DHEA 2O7QA 4CM5A 2I5PO 3JV7A 5L51A 1MB4A 2J3IA 3C85A 4YAIA 3SVTA 2R6JA 3VOSA 3WBBA 2AG5A 9LDTA 3VPHA 3ENKA 4E33A 3G0OA 2O2SA 2GYYA 1ZVMA 3I4CA 4BMNA 3RC9A 2DBRA 2WEKA 3EMKA 4XEHA 4OXYA 5CG1A 4OHUA 2DC1A 2GN6A 4I08A 4Q3AA 1F17A 1U3TA 3W4IA 2ZKLA 1PU2A 3MTJA 1T2DA 2B36A 3HN2A 3S2IA 5T5QA 1LDGA 4AJ1A 4E2ZA 3GA0A 4MKZA 3TZQA 4W99A 3LYLA 4IM7A 1GAEO 4XWYA 4ZQBA 3TL2A 1GUFA 3LC1O 4L76A 4R41A 3DDNA 2FR8A 4RVHA 2XPCA 1SEVA 3Q3CA 3JQAD 1KVQA 2Q3EA 1ZSNA 3WGTA 1LXCA 4O59O 4C7JA 1KEWA 1NPYA 1UP7A 4UUNA 2HLPA 3LT2A 2JD0A 3VH4A 3KO8A 1EFLA 3DOCA 4IQ8A 3MJTA 1FMCA 3GF4A 4J6FA 3KHUA 3A06A 2B5WA 1CWUA 2VWGA 4YR9A 5CEJA 4BNZA 3GDFA 3JQ9C 4A03A 2JAHA 5FI3A 1TT5B 3WG9A 1VC2A 5CHEA 4DPMA 4JJFA 1YQDA 3DBLB 1WP4A 5KJ6A 2JD2A 3S8MA 1U5AA 2Q1UA 2X4GA 3I9NA 4LISA 3KVOA 1FXSA 2X5OA 3DAPA 1MC5A 3H5RA 2GRAA 3VKVA 3V1UA 2OFPA 4EYEA 3GZNB 3H8VA 5HA5A 3FPLA 2GN8A 4PLZA 3BIOA 1MUUA 2X0IA 4CM6A 3R1IA 2YQ4A 4Z9FA 5B1YA 1DIAA 2C29D 3M1AA 5FI5A 2O3UA 1H5QA 4RORA 5L9AA 2WD8A 1YGYA 4JCOA 4CMKA 5T6BA 3RKUA 4DQXA
chains in the Genus database with same CATH superfamily
3OA0A 4EOGA 3NVDA 5JC8A 3AUJB 3RVRA 3EARA 2Z2ZA 4RGBA 4MNTA 4TWRA 1U1FA 1BE0A 3OO0A 5J4HA 2D5BA 4YMUA 4ZVNA 3QTTA 3QXSA 1YMVA 2JJYA 4DANA 4P3XA 1XNJA 5IC5A 2IXDA 5DCYA 4OFBA 5CMLA 5F3WB 2O2CA 4G56A 1W87A 2YS6A 3SLRA 4RY2A 2FN8A 1E2HA 3IFSA 3QWFA 1IUNA 2DG2A 2VPQA 4H1UA 2G88A 3EIXA 1TCAA 3SR0A 3NV7A 1CZLA 1L6IA 4URFA 3T0GA 4YRSA 2Q41A 3MCVA 4DA4A 2FQXA 5MGBA 4YMGA 1D2HA 1FYFA 3CTMA 3VJMA 1MAHA 1O6FA 3FVRA 4PGMA 5D6NA 5TIIA 1RRCA 2C3YA 3ABOB 2IYNA 1DTWA 2YHIB 2CSUA 4LYEA 4Q66C 4ROTA 4YJFA 1EVZA 3BF7A 4MWEA 3RTGA 1IY1A 1NTRA 1PNQA 2ZRIA 4H3VA 1CUJA 3OFND 2CXNA 2C8KA 5JS8A 2DEUA 2WE8A 4N5DA 2Z98A 4KXQA 4UVDA 3QU2A 2QYSA 4J0DA 3Q7QA 4Y6RA 3WLHA 4CW7A 2Q3LA 1QV9A 1ZAYA 4C5BA 3G1TA 1VRWA 3TQOA 1UQRA 3TJZA 3IQZA 4P93A 4HQRA 2X3YA 4PR0A 2JCXA 4U2BA 1RHKA 2O2JA 3MMXA 4LCBA 2B6HA 2Y71A 5A1JA 2I2WA 4WQMA 1ES9A 1ZD2P 1ZHFA 2GERA 3B3GA 3EZ2A 3NBFA 1YK0A 3OZIA 4XJVA 5TARA 1VYHA 2EWWA 3D3WB 1PT8A 1VG8A 2B7BA 3CT6A 3UM9A 4MVJF 3TW6A 1KBZA 3AZPA 5DBHX 3PG5A 3DZFA 5JFOA 3RC3A 4KH1A 3EEOA 4F3CA 1M8GA 4KXMA 2IYFA 4DR1B 3CIFA 1C3VA 4LNUB 2C1ZA 3PPWA 5BWOA 1ZUNB 3G59A 1DXQA 4UBIA 4GC5A 1QFJA 2ONKA 5AW9A 4CXMA 3C3PA 3SQMA 2B1IA 2NU7A 1NVGA 1SKYE 4LZJA 1Q84A 3HDYA 3AI1A 4PG6A 5HDQA 2VF5X 1OV6A 1RLMA 1USUA 2GFIA 2PUWA 3CWQA 1Y6JA 2PL1A 3TH5A 1QGYA 1E0SA 2C88A 2ORYA 3H65A 4YJ2F 1QFMA 1EFPA 1Z5OA 1BE1A 3LOQA 4NDZA 3VZPA 2BI4A 4WXRA 4BTLA 2IDKA 4WINA 1AV6A 1C2YA 1O97C 1RM0A 1KU6A 2HA2A 2RB4A 2RGYA 1W2WB 2ZSKA 3CLTD 5CT4A 3RRXA 1RRMA 1VCOA 1A9TA 3Q40A 2FN4A 3JWIA 3PDWA 5JLAA 4E2WA 3DMTA 3AM3A 4R7ZA 5AW1A 4UHHA 4Q7QA 4GPAA 3EQ2A 2AZ4A 1CJVC 1ESNA 2X1VA 4F4FA 3O6VA 2B9EA 2WIJA 4B17A 1LPBB 2A9RA 4ZVMA 2WTNA 3L8ZA 7ABPA 4YUYA 3NXKA 4KK3A 3TPCA 1R9JA 1MEJA 2J9ZB 3WL7A 2OD9A 3L8CA 1SVSA 2P9FA 1XK7A 3LLSA 3CCFA 1ADJA 4GPTA 4JK3A 1W0CA 2ASEA 3D5EA 3UWKA 3WIBA 1TTTA 1HSZA 3BSYA 2QD3A 3IQGX 2FG5A 5JALA 2RKOA 1E4EB 1C3OA 4QIHA 3EQ7A 3E22B 1CF2O 1PWZA 4LGVA 3WZ2A 4B5KA 6ABPA 1LNQA 3D4PA 2JFPA 4RKRA 3W9SA 2JASA 3K1YA 3K8ZA 1Z75A 1QFSA 4RKWA 1JDPA 2FAXA 2PL5A 3U44B 1JSXA 3AF4A 1E3LA 3H2BA 3O7MA 3OHMA 1QR6A 5DNEA 3ZKAA 2QJRA 4D4MA 4EG1A 2FDCA 4MLZA 3R3ZA 4Q7EA 4CKBB 3ZYCA 1E32A 4G5RA 3D2BA 4TLAA 3EJWA 4URYR 3MYYA 1KVRA 5ILGA 3L0OA 1J56A 5I9LA 2QUAA 4ZEMA 1RP1A 3KQVA 2JIQA 3ZV4A 1DKNA 3F46A 4BBJA 5LP6A 2IEBA 1JR3E 3KOYA 1JHXA 1QHNA 1BROA 2O3QA 2GCGA 3B9RA 1UJMA 4LV5B 3ZS8A 4Y2GA 1BOOA 4RFSB 3ICWA 5AW0A 1Q1AA 1GFIA 4ZMBA 1M8JA 1K7CA 2A9QA 2X58A 4RZUA 2HLNA 1SG6A 1XU7A 3F6SA 3LBAA 4I4TB 3HADA 4K5QA 1OA0A 4Q00A 3U7EB 3VPXA 5KSOA 3I9OA 3DEFA 3RG8A 1O3YA 5H16A 2H63A 2XNDA 1C4KA 1QE3A 3AP1A 4YBRA 2FE4A 1WXEA 3CX4A 4QPDA 5IXYA 3FFBA 4IJUA 4BDSA 3VX3A 3G2LA 2CDCA 4IZ6A 4OXIA 1EX9A 4GXTA 4Z1MD 3TQHA 1IRXA 1MB0A 1QVWA 2RI0A 3A4LA 3DTVA 4E2XA 1YUNA 1XOIA 3NHRA 4DSTA 3L0BA 5AXCA 1W9HA 3WGOA 3TTTA 3WV4A 1ESCA 1KO5A 1SQ0A 4FHZA 4J90A 4MYHA 3OCYA 4X8LA 1M6WA 1RJGA 3JPYA 3KHTA 3W5VA 2H29A 4CM8B 1H3FA 2WPDA 1HL3A 4A0GA 4M0EA 3L6DA 5FUMA 4RXMA 1WXFA 1FMLA 3HP4A 5AI8A 2C7QA 5ENDA 1UBFA 3KKKA 3M0EA 2ZUEA 1P8JA 4IOJA 2FETA 2YY7A 4J3JA 3UH1A 1E59A 4XVUA 2Q07A 1O96B 2XA2A 1ZCFA 3K0AB 4H59A 5ER9A 4AZVA 1J21A 1UADA 1OWLA 3HEMA 2ZM6B 1KZ1A 2PGOA 4W8OA 3DB1A 4OFZA 4EA6A 3DF9A 1DOHA 4RELA 4EHDA 4H1HA 4XEUA 3UHPA 2PUHA 3PF9A 5B7PA 5HMLA 6CHYA 3QQ5A 1QH1B 1AM4D 2P4SA 1KQ3A 4HMOA 5LYJA 3WSVA 4ATNA 5BSKA 1F4LA 1R0YA 2X8JA 2XKJE 2XE8A 3UOAB 4OGWA 4OFXA 1QX4A 5LN1A 2I76A 2FZEA 3QIAA 3DPIA 1HFKA 4OSPA 1GPBA 3M1LA 2I2DA 2ZIGA 1YVRA 2QTVA 4KI7A 3GOHA 1YVDA 5GV8A 2P40A 1QGED 2QPOA 4GX2A 5FWXB 1CFZA 2AOXA 1MO3A 3L1VA 3QKSB 2Y4NA 4KQ1A 1PGJA 5KIAA 1LRKA 4UUOA 4UPVA 4HSEA 3HYCA 1WBJB 1L5KA 1R18A 3ESXA 4HN9A 1E4OA 2RHTA 4DBLE 2EU8A 3GNLA 1H23A 4H1VA 3THYA 2WU1A 3JQAA 2P1DA 3EDYA 3O8OB 4RV9A 1G3RA 2N46A 2RHHA 3VDQA 4URVR 2PRYA 1UT8A 5C4MA 2OXFA 5A4KA 4D43A 1C1DA 5GAJA 1IU9A 2O2HA 3EY9A 3HCOA 5FFFA 3C6ZA 1QSGA 2ZJ6A 4TTRA 5FA5A 4B73A 1FZTA 1GN9A 3DZHA 5DU2A 2GJAA 1N2BA 1YAHA 1TYDE 4CKWB 1Z5ZA 2ZP1A 2MSLA 1PJ3A 3SX0A 1Y8QA 4U63A 4K9KA 1MP0A 1NJFA 3ILVA 4K46A 1ZGAA 3AWIA 4AO7A 2DU8A 1M2VB 3VU1A 2IPAB 2Q6LA 2J3KA 1KMIY 2I9PA 5LOVA 5F23A 2Y66A 3TOSA 1WZNA 3NG1A 3EUAA 3ZE9A 4BFTA 4PZEA 2NP7A 3V1NA 3NWJA 3QI2A 4LRQA 5EXEA 3SMQA 1AMNA 1C9MA 4DR2B 3AVXA 1IM8A 1S8OA 4LS3A 4MR9A 1ULSA 3H5VA 1B3RA 4QNRA 3EMVA 4B4DA 1XTTA 4EARA 1D5WA 1UWVA 3K96A 1DC6A 4HLUC 3WGHA 2GWHA 1AK1A 2JJQA 3ZLBA 4YC7A 3UMSA 4CNQA 1R6UA 5ITZB 1P2GA 1HE4A 2ZRLA 2IOHA 2ZIUB 4IDNA 5CGQB 1M2OB 3DFZA 3E1SA 5JSYA 2V9PA 2E2WA 3RFUA 4CF7A 3KD2A 1QIKA 4URHA 4WVFA 1KP3A 1GKKA 2B37A 4M2LA 3GMTA 1BE8A 5EIBD 1II8B 4NYIQ 2NU9A 3V42A 2W2OA 2HQSA 3NV9A 1NN5A 4JLVA 4L72A 1LQ2A 1UWLA 2ZCVA 3KFLA 3VR6D 3BE6A 1R6BX 4U2DA 5FULA 3ZU2A 2PUBA 2HK6A 2DPMA 1VDMA 1ECPA 2AEJA 2H7VA 2W00A 2V6FA 4LFCB 1IN8A 1SU4A 2NM0A 5GMOA 1JLLA 3GAFA 2OCDA 1ZIDA 2V59A 5DX1A 1JIKA 4EHIA 4F1KA 5IBCA 5JH7A 3GRAA 1CEXA 4JLWA 2BSQA 5EPEA 2O8NA 2XBLA 1OLUB 2JFNA 3FB1A 2YW2A 3I23A 2OBBA 3DDUA 4GLBA 4QXPA 4QU9A 2PA0A 5FUQA 1Q7BA 1ATZA 4ETNA 3RT7A 1SD1A 3BB3A 4OKSA 1F2TB 2G07A 3CRZA 3A2LA 4HAYA 3T5MA 3I01M 2FN7A 1XZPA 2HI0A 2WAOA 3EOZA 3K5HA 4RIGA 3OZDA 2HK8A 3FTPA 5HJ7A 3RS8A 3IR5A 2HCBA 4KN8A 3A10A 1FTSA 1NVEA 3GHYA 2XUAA 3HC7A 3OFNA 3C97A 5G0SA 5HK8A 4XVHA 1GFSA 4PW0A 1PNVA 3KTAB 1J2TA 1KH2A 2AN1A 5EFOA 1N2CE 1BN7A 3K4QA 4QBIA 3V4PB 5M7EA 5JBNA 1FTYA 1OT3A 2AIRA 1W4CA 3HWX1 3QKIA 2QGNA 4E21A 3BEOA 1K86A 2YYAA 4QGBA 3ZQUA 1Z73A 1XZAA 2N9UA 1LPAB 3IP7A 3OUZA 3QJGA 1P5JA 3IAS1 3EVDA 2XOKD 3D6TB 4Q4JB 3HFRA 3L06A 4JBWA 3WLNA 3GGCA 1IAQA 1ISSA 2BUAA 3GEHA 1DT5A 3GH1A 2P1RA 3FYCA 5HF8A 1GRRA 3UK0A 10MHA 2TSYB 4HO1X 2EKDA 4OATA 2EDAA 5TQ0A 4BLWA 2QORA 3DOOA 2XCLA 3V97A 4GZMA 5CA0B 2HNAA 4DCGA 3HUFA 4WK0B 1IBCA 2C5EA 5BT8A 3OQBA 3DT9A 1GQ2A 3VVBA 4F6RB 1J49A 1I2AA 3UMYA 4YAWA 1IG0A 4QC2A 3K1ZA 4FW9A 2AI2A 1QRTA 1D6NA 1EZ1A 4PZPA 2A67A 2P3LA 4DL9A 1GVHA 3C2QA 4ZYYA 3L6CA 4LHSA 2XVMA 3RUDA 4KSYA 3SWWA 3BILA 1ZM4A 5J2TB 1W5SA 2ROQA 3SXJA 2QB5A 2BTOA 4ZZ2A 3ELYA 1SBCA 2ZI7A 2NZVG 2ZPTX 4ZCQA 2B21A 2BMWA 1K3UB 2R1VA 3GUCA 1VJDA 2CVZA 4LXUA 5GZ3A 5JECA 4JYZA 2ATEA 3FF4A 2X9NA 1XKLA 4NH0A 5EI5A 1IAVA 1T9HA 4TUYA 3REOA 3TQQA 5ETJA 3SHOA 2VNKA 4ZVOA 2J9GA 2MSWA 1PO7A 4MA0A 2GZ3A 1PR6A 3OE7D 1XL0A 2XWJI 3LQ4A 4Y9SA 4AP6A 5CDFE 1NQ5A 1WY5A 1L5MA 2XNCA 3AEQB 5AVZA 1N0UA 1KFEB 1QYVA 4JP8A 1UMCA 2E6KA 5P8WA 3CUEF 1WQ1R 3ZDYB 3MWJA 3AKYA 3MNFA 1JIVA 3DUFA 1KI3A 1UJCA 1CUFA 2P6OA 1VXRA 3I9V1 5GIOE 3K70B 4UZSA 4WOKA 4J7XA 3A6DA 1Q7TA 2A14A 2AQKA 3VR4H 2ZBPA 2P91A 5KVVA 2O4UX 3L8DA 1E61A 1YOBA 1BXZA 1EUDA 1GL6A 1YO6A 5CJPA 2HWXA 3CHYA 1ORRA 3K9HA 2VUIB 1KETA 2JAUA 1I7NA 3KEGA 4MDHA 4NY1A 5B64A 3MS4A 4RTJA 5EE3A 1XTZA 1D9ZA 3QBTA 2FZGA 3OE5A 1EM8B 1T34A 2PRZA 3GN2A 2H1CA 4HRAA 4KBYA 1WDLA 5I7SA 5IM4A 4ZIRB 4GLJA 2OCGA 1AKUA 1S7GA 2A7XA 3A05A 2RARA 4YAOA 2GD1O 3ZZMA 1C8KA 2VTBA 1KWGA 1YS6A 1F51E 3BX1A 2VK2A 2ZVDA 3OFKA 4FD3A 4OIMA 4BJ6A 2GR9A 4JSYA 2BP7B 1E7WA 1ZMOA 2P75A 3ESZA 5DMHA 1G98A 4LOLA 2GN1A 4E4RA 3ZIDA 4Y7CA 5L3SA 4IJWA 4R1NA 5K3SA 2Y2VA 1II0A 1FEZA 1GGFA 1T5DX 3WE7A 5COBA 3TQRA 4DDUA 1NULA 3K05A 4WKNA 4FLFA 2VHYA 2DTEA 3CMCO 3GBPA 1DOZA 4NNOA 1GYPA 1ODLA 4H9GA 4ARVA 2W2QA 4BQOA 5IKPA 1D6SA 3O8BA 1WLSA 2IYOA 3KQSA 4KYUA 1U81A 4YCCA 1WHSB 2WJVA 1V48A 1NVUQ 1BD3A 4Q93A 2IEAA 1L1RA 1Y7PA 1AN9A 5ILQA 1YJAA 3N70A 3DP7A 1AKMA 2Q4EA 2R87A 4J07A 1L4LA 1AKNA 4OQEA 5TVGA 1CQIA 5JC1A 1Q7EA 2FFRA 4Z1MA 5EYPA 3UVEA 2TMDA 4JYBA 4HG2A 1UBHS 2QL5A 1E9FA 1IY0A 5JQGF 2H5JA 1XDSA 2VLIA 4HWGA 5AESA 4YONB 2ZT5A 5F12A 4ZYVA 1XKQA 2VSQA 5TS2A 2IY7A 5D8DA 3AQ4A 4D5GA 1PHPA 3ROTA 4Y2UA 1E9AA 1Z0FA 3B82A 4CFZA 1X1TA 1P9WA 3ETJA 3OT5A 1I2ZA 4RAOA 5DKFA 4DXHA 3CB2A 3UZUA 3HKBA 4ISBA 4UHBA 4A9AA 4IDHA 4N5MA 4MV8A 1LV7A 4AN1A 4CTMA 3VR2D 1KI7A 1M0SA 5FV7A 1HR0B 1ETHA 5ED0A 4W9RA 1DRUA 3FN4A 1INLA 4JOBA 2JG3A 2PX3A 4CN9A 3QFFA 1E6UA 3T9EA 3W6NA 4O8ZA 4ZQGA 2VWPA 3JQFC 5KAPA 2PKEA 3ESCA 3TVDA 4CR8A 2HM7A 3BGWA 4GZ5A 4CI9A 4DCVA 3LGSA 1V1MA 3EN0A 1JG2A 2AR9A 3M3HA 3OT1B 1PZXA 4M53A 4FFSA 4WKOA 3TBKA 3VSBA 5EQDA 3FNBA 3OKFA 3E8XA 3ELUA 1WB6A 4KQKA 4UUQA 2OFFA 4DKXA 1H8ED 3AEKB 1QC5A 1EP2B 1NX6A 4I50A 1A77A 1V96A 3LC0A 3ER9A 1HG1A 1NLUA 2SCUA 1HKHA 3DVQX 3EFEA 3EGXA 1N7HA 3GJZA 1W73A 2QM7A 3HGQA 4RJJA 3WP0A 3MWDA 4KTTE 2RK4A 2PXXA 1JVSA 1KJYA 1KQOA 2I71A 4BGEA 1IHDA 4UOEA 3EXFA 1QHHB 4CLOA 1SKBA 5LLTA 5K3FA 1Y82A 4LHVA 1HO3A 5LXTA 1A9OA 4BVLA 1HT3A 4I4LA 1I5EA 3LL4A 3O8DA 4ZC8A 4OIFA 2PKCA 3AV3A 2HF9A 3V8MA 2EF1A 1RAEA 1RR6A 2YQ5A 2YY5A 4V0SA 4Y3UA 5EKXA 5KDLA 2GSWA 4TKZA 1Q0RA 3T9CA 2V7WA 4D96A 3NBZC 3REQA 4ZFNA 3H9QA 2VSYA 5ENZA 2P9JA 1CQJA 2DVMA 1XZKA 2CLMB 3BFXA 3QJYA 3QFHA 1KJ8A 1XTIA 3ND6A 2WIBA 3ZE7A 1L4GA 3MSXA 4JI2B 2GD2A 2HUNA 1Q5PA 1NVTA 2BLLA 3OUTA 1C8LA 4RDCA 2ZRBA 2VJNA 4NCNA 3AU8A 5IN4A 2Y1CA 2Q50A 2FWMX 5FPPA 4LAFA 2WW8A 1OGJA 1V1RB 3DAYA 4Y2JA 2JPDA 1GTSA 2WKPA 4ZRDA 2WWTA 5F4BA 1EWQA 2V7GA 5U4QA 3AJ8A 5L3SB 1UODA 1H93A 3KT6A 1J6UA 2YX1A 1XMJA 3IKLA 1THGA 3FMFA 3RRMA 4BEJA 4BO5A 1GSIA 3O1JC 5AVSA 1QQTA 5E1DA 2Q5OA 3D2LA 4Z49A 1Z17A 3AJEA 1ZWKA 4C87A 4CL8A 5I3ZA 2I0FA 2VPIA 4LMBA 1TEVA 1E5TA 2V98A 1Z39A 4G26A 1KI6A 4S0XA 4EB0A 3P4YA 3V48A 1JW9B 3LUCA 4GOKA 4N6OA 3TOXA 3V34A 4LYYA 4BMPB 4EO9A 4ENVA 5JI2E 1S96A 3H6HA 2FZ4A 4M9RA 2EBWA 1P17A 1ZI6A 2HMSA 5H80A 3UAGA 2PVCA 3ORQA 2HNKA 3LS2A 4TSRA 2CKMA 2I6GA 3I6ZA 3ECSA 1TJNA 3AEZA 5L6LB 3EFBA 4NBKA 2PV7A 3SC3A 5EIEA 4MV1A 4AF8A 1P19A 1ZL0A 3P2JA 4ZICA 4L74A 1J5XA 1YOVB 3AY6A 3A9TA 1TADA 3ZNNA 4LRWA 4L78A 4YREA 3R8FA 3PWTA 3VAZA 4DLAA 4EBBA 2AXPA 4QGHA 3V8NA 2NVOA 5BXQC 2EVWX 3WLTA 4QYIA 2P4EA 5JD5A 1AS0A 4H6PA 4KPFC 2GNPA 4DNFA 1KO4A 3CF2A 3RR2A 3S7TA 1O4WA 3TVTA 4DREA 4MKFA 3U60B 2QYTA 1ZJJA 1GWNA 1M67A 3D4BA 3DAHA 3T7RA 1KFJB 2IQIA 5AK5A 5BWLA 3W2GA 5CDHA 5KTNA 5REQB 2PX4A 5LXTF 5EZQA 5HJ2A 2Z56A 5DWVA 1JHPA 1FPQA 3I2KA 4NZMA 4OB8A 4RYDA 5ALIA 4BQRA 4I36A 3MUFA 3WSWA 1L5YA 4KMOA 1T5HX 4PG8A 2NLOA 4AJLA 3DPUA 4QOFA 1XFAA 1V8OA 3TLZA 4WECA 4JOCA 4W1SA 4DV4B 2IYTA 2XOKA 2ZK7A 4RMIA 4V03A 3GPCA 2YJ3A 1SVNA 2PLFA 5IXJA 4Z2AA 3HGMA 1YS4A 2R4TA 1E9DA 1N92A 1MOSA 2IHZA 4DIEA 1K4MA 3JVIA 3K32A 4Q4AB 1XO1A 4AF6A 1H4QA 3KETA 2HGZA 4BEWA 3RF7A 2CJWB 2ZB4A 1Y9AA 4J29A 1ZJZA 4F72A 1JUDA 3ZC3A 2BFEB 4S3MA 2BFWA 4KR3A 3I1JA 1JEQB 1NM5C 3HH8A 4WCFB 4WBNF 4R71A 2EFGA 1E6MA 3WXMA 3ADKA 2OCLA 4DV7B 4ITUA 1FS6A 1CHNA 1UJ5A 2DTXA 2YVKA 4DV0B 1Q2UA 2EL9A 3KAQA 3U16A 4UBNA 3MRVA 1WSDA 3JQ8A 4UAUA 5E3JA 5L6MB 3BOSA 1OLSB 3LGXA 3JASA 1I0IA 3TKLA 2NXCA 2FWIA 2PRSA 2GBCA 1JQAA 1V11A 2RAVA 3UG6A 2QQ0A 2JEYA 2C9OA 4IJMA 4ERXA 3LY8A 4DB2A 5GJCA 3RSLA 1DC7A 2N3ZA 2NAPA 2Q8QA 4LKOA 3E9RA 1C0LA 1QTIA 1OXKB 3N28A 3ZWXA 4JVMA 4RPJA 4RSHA 2WTEA 1ZVQA 1V8DA 1SCDA 1YE5A 3OE7A 2F90A 1P6XA 1T3HA 3CLRD 4YJ2B 3FYUC 4JT9A 1XNHA 1G66A 1P1CA 3I05A 2ZUWA 5A9TA 4QTZA 5BW8A 1ZHHA 1YE8A 3I6BA 3KDSE 4JJKA 4XQ9A 2O07A 4ENQA 3PUZA 4JJ6A 5D3QA 4TPKA 5CXXA 1PJCA 3R7AA 1J1UA 4YMWA 2HBRA 2QXUA 4XUGB 4Y1FA 1CUBA 1X1EA 1UFRA 3JYHA 2IHYA 3JD0A 5CBPA 3GNQA 2PY6A 3BK1A 1H6CA 3CZPA 4R6WA 5DNCA 2KSQA 4P4LA 4ES6A 1QF7A 4MR8A 3T3DA 4XLTA 3L7CA 4D02A 1BS9A 4BL5A 2TECE 4I7EA 7AT1A 1FDWA 1QGUA 1PJTA 3QMMA 1M0TA 4HDRA 2NPFA 1U6KA 4OGGA 2VK4A 4AJPA 1C0EA 4PLTA 4ABTA 1FFHA 1CJCA 3VV3A 3DV2A 3IP6A 1W52X 3A2KA 4DEXA 3UT5A 1L5HA 1VGQA 3QHPA 3UHOA 4TWAA 1N2OA 4OBBA 1SG0A 3WRVA 4X8HA 2JLXA 1EDZA 2DUUA 1J2JA 3E0XA 4B81A 5CLJA 4IEIA 4BEBA 2J0UB 1VI6A 4I19A 2PXCA 4H35A 4W7IA 2B7CA 1DGQA 4LXIA 1A2KC 5AKZA 1KF0A 3EZLA 4KVAA 4AKIA 4QTUB 2XUIA 3CN9A 4MRAA 4G9GA 4GM4A 4H60A 1R50A 4UBLA 1PJLA 4AMUA 1NN3A 2J87A 4D4LA 3H04A 1E1YA 4HQOA 3SNHA 2QUZA 5CIYA 2V7QD 3J81A 2JAPA 1P8AA 4JUCA 3SZGA 1PHRA 4F9FA 3RHFA 2XF8A 2ZRQA 3C4QA 1C1XA 1F1BA 3T5TA 1ZO8A 1XTQA 2JF0A 3C5EA 2I80A 1CU1A 1UMBB 3RIGA 3HZHA 3Q2KA 4JP3A 2PFKA 4PAWA 4WI1A 1CR6A 5IABA 2JIRA 2I7TA 2X7XA 5DTRA 3W8NA 5DYNA 4CMIA 1X7YB 4QTTB 1U99A 3E1GA 3QW2A 1PW5A 3OLXA 2V7EA 2QYHA 2ZBVA 1GSOA 1RXUA 5DB4A 1LDBA 3AZOA 4FFVA 3TCKA 4JXJA 4P7BA 1UFVA 5EMMA 5BNIA 4D0NA 2XBUA 3QVJA 5JHGB 4RIEA 4NU6A 4O2BF 1E7QA 1Q0LA 1O5OA 4LSWA 4D4JA 2REBA 1YR1A 4FYJA 5ALWA 3L5KA 4KVFA 3VR2A 5JHHB 3LDUA 4WOPA 1KZ9A 3ZWVA 1AHNA 2B69A 2RGDA 1N6OA 1TCUA 1R0LA 3LVQE 4GDMA 4H3SA 4DG5A 2W6ID 3HEBA 2O6LA 3EXHB 5A4AA 2GZMA 3EF0A 1CBUA 3QBVA 4MXDA 4RK4A 4LXXA 3RC8A 1EIZA 3P4XA 4L5YA 1XRMA 3IKVA 3QE0A 1SHTX 5FPHA 2AA3A 2VSNA 2Z2XA 2G4LA 3OAAD 4AYXA 2O8EB 1KU0A 1ZYUA 1XT6A 2GPSA 3HFGA 2WUVA 3AJ9A 1F2DA 4NYMR 5DE3A 1MT0A 3OKCA 3TR5A 3IC5A 4FK8A 1V5FA 2O2YA 3P5BA 4IDOA 4Q9JA 5FNZA 3ED5A 1YR3A 3NTXA 4N6NA 1H8EA 3V7UA 5K6AA 1UBEA 1EGMB 3A1CA 4OY3A 1VHLA 2VZLA 3QG1A 2X4LA 4HFMA 1JG1A 3CMMA 4MHOA 4WSOA 1BWQA 4YMVA 2C59A 1SUCA 3W5JA 3W5HA 3X1ZA 4R0MA 1UOOA 2WQ6A 1Z12A 2WZDA 4XJTA 1TU4A 4GMKA 4I5IA 3ZWBA 3O8QA 4R98A 4DQ0A 5KNBD 1Z88A 1QV6A 1F7UA 3O4IA 2NQ8A 2OXEA 1TYZA 2JI6A 2I34A 2OVBA 1IC6A 1VZ3A 1JJBA 3GIDA 5FUWA 1OH8A 1WTAA 1J25A 1T5BA 2B5VA 2YMLA 3L7IA 3S2ZA 4ZO9A 4RHTA 5T4FA 4QFMA 3UPTA 1ODJA 2IUFA 2W2KA 3IXQA 1B0AA 5J47A 2UKDA 4K05A 4H6XA 1KO1A 1QS0B 3CN7A 3A3PA 3GRUA 4MW4A 2FR8C 1B8PA 4JBLA 4YJHB 4MTCA 4C22A 1EWRA 4X8OA 2PUDA 2ID4A 2ZRKA 3HKDB 5AJTA 1IEXA 1UP6A 1E64A 2WG2A 3F71A 3L0ZA 4LZZA 1VA5A 2GETA 1JFRA 4HUQB 3WX0A 1FFSA 3GHHA 1EGHA 1SURA 4G5GA 2C9ZA 3CUYA 4Q3BA 3EVNA 4Z9YA 1D8TA 4MW9A 1B14A 1RYDA 1T2AA 2DHQA 3I2GA 3JY6A 3L0PA 3R0QA 2R6AA 2YFYA 4G1EB 1Z62A 4HXFB 3HCNA 4B2LA 2D3WA 1IBMB 4KDRA 1HETA 4NCAA 4QPZA 4PG4A 1MHTA 2IUYA 4Q1CA 2XDQB 1BWPA 1RTTA 2JC3A 3ROXA 3SFZA 1E1QD 1IK4A 1K63A 2BFPA 4PCAA 2QN8A 4QJ5A 1FJXA 1J9ZA 4MWOA 4RCYA 4UTZA 5DN9A 4X00A 4WDQA 1Q15A 1HMPA 5JS6A 5AVYA 1MJ5A 1LLDA 2ZJ4A 1FYWA 3G8BA 3JYOA 3WNQA 1W581 2W2MA 3QKRA 4QVGA 1EINA 1EDOA 1I0ZA 1NMSA 2DE0X 4R16A 2GGSA 3KEOA 5LZ7A 3T5DA 3UC9A 3EZ9A 4O4IA 4MQ6A 4ZRNA 1DAIA 3NHJA 4ZAGA 2RGNA 2DFVA 3PQ6A 4S1TA 4OPMA 1DBRA 5DI9A 1OC4A 1PLKA 1AXEA 4XM1A 1G0OA 4DVJA 3E84A 1VHDA 3DE0X 5FA6A 3CISA 4LHEA 3EAFA 3M9WA 1SQFA 4FGWA 1WULS 2ZT6A 2NO0A 3ZD8A 2ZIFA 4TL6A 2ERXA 2JGFA 3G2KA 4UM7A 4C07A 2VZ9A 2EQ5A 3KQPA 1CY7A 4EYGA 2FK7A 1RLUA 4H3KB 4M6WA 1GP2A 2G40A 4MQ5A 3EIUA 3OFVA 4JX9A 3DCNA 1L7DA 2XJ9A 4XQEA 3U3DA 4ZHQA 3NEAA 2UUAB 3ZKWA 2GCEA 3TZHA 3F6YA 1NP6A 2ONJA 4J8PA 2Q5IA 4H17A 4DPKA 2I29A 4PO3X 5JNRA 3PI7A 4Z99A 1NC3A 3D3JA 4QEKA 5EJ2A 1NF3A 2O48X 1IOLA 2QRKA 3RSSA 4CTKA 2VDUE 5JT1A 4A2CA 3B1YA 3E9QA 4F97A 2CE2X 1VHTA 3DLTA 1NNUA 2JFFA 3IE0A 4ADSG 2GM3A 1FVFA 3H5AA 4Z0HO 4FHEA 5BV8A 2C7OA 3TZBA 1DKQA 2J07A 5KYXA 4TVSA 2H0QA 1Y1LA 1ZRSA 3IESA 4NENA 3C15C 4HQLA 4BVKA 4ZT7A 1O2DA 1XA0A 5LC1A 4FWBA 2EXXA 4U7TB 3A2MA 4DYHA 4L0DA 1LQTA 2BCGY 3NWOA 4YFYA 1AE1A 1FFDA 4EEXA 4XDZA 5IJWA 3U40A 2O2XA 4FFBB 1NKTA 5H5JA 2R5WA 1TGYA 1K5GA 1JPVA 1C3JA 3THWB 2CLFB 3LT5A 4BPRA 1N3IA 3HXLA 4FHGA 4LRYA 4A2PA 1DQYA 2OHVA 2R79A 3ZD6A 3QE4A 1H65A 3IJEB 5AJVB 4UE6A 4E7OA 4Q19A 1R6DA 3TX6A 2WKQA 4KWIA 1P1IA 3IPAA 3P4UA 5I9BA 3WS7A 4RA9A 5HPYB 1NNEA 4J0HA 3BJEA 4J6EA 1KZYC 4V0QA 3KXDA 4LJAA 1ZEMA 2P5TB 1E9BA 5T6MA 1Q95A 1Z83A 5EEHA 3RRNA 2LTAA 4Q47A 3ROKA 2QP4A 4PIMA 3BJZA 3H13A 1RKXA 1DBQA 1XMOB 4GKVA 1DQNA 5FFMA 1W0JD 1KBQA 2BPOA 3O3CA 5I9IA 2B8WA 2XCIA 3QUBA 1VCMA 1HWYA 4H2DA 3INRA 1DJQA 4WZZA 3SZOA 3ZHOA 1KP9A 1LLCA 1ONPA 1U1GA 2D0IA 3QLJA 4K26A 2HCFA 2J31A 3AUTA 3OU7A 3L41A 3PFIA 4QUGA 2JEOA 1OH5A 1WSWA 1KOGA 2KPOA 3KKZA 3P9RA 2W90A 2IOQA 4AD8A 3I30X 4HGQA 4WA8A 3AGPA 3KQWA 4KACA 3TIXB 1QIGA 5HM8A 4CEIA 2Q1YA 3BIXA 4XUCA 2Z1MA 2NU8B 3A9VA 4TKLA 4BASA 4AJKA 4CMHA 1XDWA 3QUSA 3AFIA 5JZOA 1QV7A 5A9RA 4BE4A 1MQAA 3A1FA 4HDQB 1TLLA 2ETXA 2YR0A 1Y5MA 3M2TA 4ZAXA 1G8FA 3ITNA 3I9JA 1FYVA 2WE7A 1GUYA 1I9GA 4MWBA 2VA9A 4JBIA 1UZLA 5I7VA 3IILA 1V7ZA 2MDTA 4FILA 1XIVA 2VPTA 3JQ9A 2FMIA 2QTBA 2XF2A 2VQDA 3DMTC 1JG4A 4ZYXA 2TMGA 2WMNB 4UM5A 7REQA 1S3IA 1IXRC 3VTKA 4D9CA 3N8GA 2JGEA 5B7GA 3S2FA 1NQTA 4QGAA 2VF7A 1NUQA 2X6TA 3OEED 1UPTA 3FGZA 5PGMA 2NPOA 2I78A 1TVCA 1EE9A 1R1DA 5CVJA 5B4VA 4IZIA 5C4IA 1C1HA 4Y6GB 3AESA 4LK3A 3SBEA 4B7XA 1T0HB 3W1VA 4KRGA 3EW9A 4F2GA 5M29A 1ISIA 2H1SA 2CYBA 4B1FA 2PMFA 2VDMB 4D9EA 2FPRA 2QPLA 1H9BA 1FRFS 3BGIA 1FQKA 1KJWA 1YR8A 2XUJA 3D1VA 3LV8A 5G41A 4KTVE 4EA8A 5GJBA 2PLWA 4CLEA 4J2HA 1U2QA 4WIAA 4CQJA 1F9AA 1QKIA 1XSEA 4EH1A 3TAXA 4G89A 3PFNA 3HBFA 3BD7A 2XCRB 3A7EA 4K8OA 5KKNB 3SC2B 3WGGA 3TZ6A 4R6XA 5IJAA 3W0LB 4D92A 1Q14A 1SXQA 1Y37A 5JAOA 2Q0HA 3V55A 3MTBA 3DDWA 3LX6A 1ZAKA 4RACA 4FFMA 3KUKA 3MWLA 1N5KA 2E4YA 2V7QA 1AG9A 4WZBA 1BCSA 2V96A 5LP6C 2YZNA 4D42A 1M2NA 1QG6A 2CT8A 1L4YA 1VDZA 3K0CA 1FTNA 3QE2A 4YMHA 1PFGA 2ZW9A 3VNSA 1D7OA 3R5XA 4ER3A 5ALVA 2RK3A 3AFNA 3AUFA 3M6XA 3UWOA 1M34A 2NOAA 1JYSA 2BEVB 2X8BA 1TYAE 3HGTA 4KIJA 4I9FA 4MGIR 5HIMA 5JCJD 3EVEA 5A06A 1ORVA 1G5HA 4JQCA 3QF4B 3K0HA 5HILA 4ABYA 4EQ6A 4JNCA 4DCPA 3PNSA 1PNOA 5AJZA 1PSZA 1J90A 1GCAA 2J85A 2A5FA 2BZSA 3VOAA 1KDOA 1WU7A 1NR7A 1RQRA 1SNYA 2PSJA 1N8TA 4C6TB 3T7DA 1XRRA 3TEFA 5LB4A 3OOYA 5EGSA 3UJCA 3JATA 4AC9A 1RQGA 1SEPA 2AHRA 3LVBA 4RZIA 1AO0A 1EP3B 4ND3A 3GP3A 1QRRA 5LA6B 4E94A 1FRNA 1DCKA 1W85B 3JR7A 3G5MA 3KOOA 4Y0AA 1ENZA 1JKJB 4ZOAA 1Y3AA 1GAJA 1RYNA 1Q1QA 5FLEX 3EXEB 1N3YA 3DL0A 2BCJQ 1E1CA 4BNXA 1NVVQ 3NB0A 2UYOA 2W6IA 5KCZA 1EIWA 4XPIA 3MLBA 2HFKA 4I9UA 1Q44A 3GFPA 1EP1B 2P8JA 1LWOA 2WHPB 1ZR2A 4KR0A 1QUFA 5HKOA 2GBPA 3WIVA 1FSFA 3OAAA 3E3NA 1PGNA 1TA0A 3QXCA 3W8EA 1XD8A 3MB8A 3NTVA 5BRNA 3GGGA 1RAIA 4YN3A 2ZUTA 4C0QC 3OQ1A 4PTZA 1M75A 2W0SA 2XAAA 3SXUB 4EGCB 1RJ9B 4Z7QB 2BBSA 2WZCA 2J5QA 2LIPA 2Z0MA 3EEYA 4HHEA 1PWYE 4DMLA 3G2IA 1P3DA 4YB8A 3IKTA 1KEVA 4GHWA 4QOHA 5FAXA 4N48A 2NX2A 2XMGA 1QVRA 5KNBA 3ZR4B 1NP3A 4XTRA 3KT8A 3KYDA 1AT1A 2WJ6A 1NOIA 5L40A 1SC4A 1U8CB 4MUAA 1ZMBA 1GKIA 1AC5A 4MRRA 3AHCA 1VSQA 3LY9A 3VI4B 3FVVA 3PFKA 5DK4A 3FWHA 4BRWA 3AVPA 3PVCA 4NZNA 3SC4A 4AIRA 1UXOA 4CG0A 1FDIA 1NAIA 1PFUA 3EXIB 2QIPA 5EXXA 3WYBA 4E12A 4F9GA 1T8UA 4XD7D 5H81A 1HE8B 1MX1A 3PUKA 4RLFA 5TV2A 5BR7A 3H0KA 4DIMA 4BLOA 5BP7A 1A2BA 3D8HA 3UGQA 4N8EA 4M1SA 2OLJA 2HBYA 4ZP1A 3OMLA 4OGLA 4YLGA 1EMDA 1P7YA 2F3UA 2PXAA 5LZ9A 4M9QA 5IKOA 1YJBA 5D2CA 4DM3A 1G6Q1 3S55A 3I04M 4DWVA 5IRCD 4ZO4A 2C4UA 3OD5A 1T5SA 5CT9A 4R9UC 4CM9A 1DVRA 3N8NA 1V3TA 2AVNA 2IPNA 3FNEA 1LVUA 4NE9A 1QYRA 5HUQA 1V8ZA 5SYNA 3VTFA 3LBNA 4TRMA 1ZW1A 5IT4A 4YRGA 2XMBA 3LX4A 5I9MA 2C8LA 4WEQA 3PRYA 2VDKB 2IVZA 3O4HA 1NMXA 2QN2A 5DHAA 5BV0A 4R1UA 4PHGA 3BE5A 1YL7A 1X2BA 2R1ZA 3G1WA 3K0BA 1W47A 1TYBE 4I6EA 2XYRA 4RDXA 3K09A 3LVRE 1CJKC 1Z2EA 3CX8A 4U7JA 1SXJB 1QPBA 2PZKA 3ILHA 3PDHA 3NXSA 2OCYC 1YZLA 3MJDA 3FPEA 6REQA 1L8AA 3E7DA 1TJYA 1FVHA 3RT1A 4KAJA 2OA0A 4GKKB 2AS0A 3IAAA 2J9FA 4HWTA 1KAQA 1P0FA 4HMPA 1FSSA 4CF3A 4W5TA 1CVIA 1Q7GA 1R64A 4NCHA 1E9CA 1WWKA 2P77A 2HA0A 2AEEA 1JH9A 1AK9A 3RAEC 1ST2A 1RRPA 4OHPA 3HU1A 4L5CA 3CLKA 5DH9A 2O0JA 3TJMA 3QTBA 2FFQA 2R6ZA 3CRNA 4EF6A 2CEAA 1I4OA 5EG5A 1JU4A 2B8EA 1EAYA 3TIVA 4PN7A 5JXIA 4YMIA 4DV6B 1EXNA 3PQ3A 1LX7A 1V47A 2F1JA 4NZOA 5FUVA 1U94A 4GOMD 4M8LA 4CKEB 3HSKA 4G1VA 1RADA 5ALMA 3UXEA 5L4LA 2PHZA 1FF9A 3FPCA 3K6JA 5A3RA 4ZPXA 1T2VA 2D00A 3PUWA 1D6JA 1EGVB 1SUBA 3D8TA 5DYIA 1QG0A 2LCQA 2BKXA 3Q6NA 4PR3A 4N9WA 3NOQA 5DHTA 4BFWA 3MOIA 1E2JA 1OWNA 4INPA 2RC5A 5C5CA 1OAAA 3M3PA 3ZOKA 3GGPA 3UH0A 1CE8A 4WJLA 1XAGA 4B5LA 1WMAA 3FDJA 4QDOA 3FVTA 5JCXA