4XJTA

Human cd38 complexed with inhibitor 2 [4-[(2,6-dimethylbenzyl)amino]-2-methylquinoline-8-carboxamide]
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
241
Chain Sequence
b'WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Discovery of 4-Amino-8-quinoline Carboxamides as Novel, Submicromolar Inhibitors of NAD-Hydrolyzing Enzyme CD38.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, transferase
total genus 79
structure length 241
sequence length 245
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4xjtA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xjtA02
1OZAA 3WGQA 1PU2A 5JYDA 2RAFA 1NNUA 3AY6A 1B7GO 4D3FA 1Y81A 2EKLA 4R68A 2IEBA 3IKVA 4J3FA 1PJSA 1M2WA 2W2KB 2OO5A 1KY5A 1XQ6A 3WMXA 1JWAB 4YAIA 5KIAA 3ZGYA 2HU2A 3ORFA 3MCVA 4R16A 1Y5RA 3S2GA 1C1DB 1CIVA 1O9BA 3U49A 5G0VA 3IP1A 3UKOA 2C59A 1LEHA 3D5QA 1PZFA 3H9EO 5COQA 5KVQA 1A27A 1U8FO 2OP1A 4BNGA 4BNXA 1UH5A 3IP3A 3O38A 5BSEA 2YHIA 3GMSA 2D0IA 3ZHBA 5A5EA 1EQUA 4JK3A 4NK4A 3E6AA 3ADPA 5BSFA 1N9GA 4YJGB 4ZQBA 3SC4A 3NT2A 5LC1A 3E1KA 4TRNA 3KLPX 4G65A 4J0EA 5JAZA 1HYGA 4YVFA 3OQ1A 4I5FA 3NGLA 3PXXA 2GDZA 1PQPA 5LDGA 4JBIA 3LK7A 3PQDA 3G49A 3OP4A 4D43A 1PJ4A 4Z3KA 1QYVA 2H6EA 1YWGO 2G82A 2QRJA 4J91A 4UAGA 2YFHA 1E5QA 4NFSA 5JC1A 4CL3A 3FHLA 1Q1NA 4JBHA 3AI2A 5CG2A 3PHGA 3S2FA 3E03A 3TSCA 1EE9A 1OBFO 1MV8A 3DAPA 3KYCB 4FGWA 1WNTA 4YAEA 2X1HA 4TKLA 3FR8A 1AE1A 1NASA 4PLTA 5TLSA 2YV1A 1GQ2A 3GVCA 1T2AA 3JQDA 1VM6A 2HRBA 2RIRA 2O4CA 2PH5A 2V6GA 4GLOA 4KQWA 3WNVA 3U09A 4OSOA 5ILOA 1LDBA 1R37A 3F47A 3QWFA 3CE6A 5T64A 3JYLA 1GAEO 1CETA 1X1TA 3NTRA 1LQTA 2JL1A 2JCXA 2Q49A 3TZ6A 1R4MA 2VRCD 3ZU3A 4GGPA 4IQGA 2VUSA 4AICA 2W98A 4J1SA 1LNQA 2J3JA 4CQLB 3I9LA 3KBOA 3W8FA 3RSHA 2O3RA 4IJVA 2W2KA 3WIDA 5KTKA 1GEGA 4PLPA 3F46A 1XA0A 3PDUA 1NYTA 3GGOA 1Y7TA 1U9JA 3D5TA 2NNLD 3JYQA 1ENOA 1ENPA 5GZ1A 1W6UA 1PX0A 5B1YA 1UR5A 4BKRA 1EFKA 1K2WA 1RYDA 1DBVO 3I9JA 1E3LA 4M89A 2VYVA 4U6SA 4OIMA 1JDJA 2QYSA 1U3TA 5TNXA 4WLUA 2BHLA 1PJQA 1SC6A 4XD2A 1EUDA 4ZVVA 4K26A 4U0KA 4UVHA 1MG0A 1Q0HA 4NQZA 1LC0A 3DBVO 3BMQB 4QO7A 3GGPA 5K0ZA 3Q0EA 4ND3A 1ARZA 3GRPA 1NHGA 4JXKA 4GAEA 4NIMA 4QECA 1LA2A 3D4NA 1YO6A 1E5LA 7MDHA 1D3AA 5ITVA 3DOJA 6LDHA 1MC4A 4PZCA 3OICA 3WSWA 2A4KA 3HUDA 3JD2A 5AXCA 4ROSA 5COBA 2Q2QA 1C0IA 4CLEA 2DUUA 3EGOA 3C24A 4OXNA 5G0SA 3BTVA 4OKNA 1DC5A 3JQAD 1LX6A 3PDJA 3HQ4O 1PJBA 4EBFA 2Y1GA 5FYDA 3ETDA 4OO3A 4RL6A 3SEFA 4D3SA 1QLHA 4FFPA 1YBVA 3L07A 1HL3A 4GVXA 1CDOA 4FSHA 5TSDA 4RVSA 1PWZA 1HETA 1M76A 2X7HA 4NBTA 3TRIA 1P1HA 2Y99A 3D4OA 1XDWA 1AGNA 3H2SA 4J4TA 4KQXA 2PH3A 3GFGA 4E5MA 4FIZA 1EDZA 3H2ZA 2X9NA 4NDNE 4IXWA 3FNEA 3WQQA 2R00A 1U5CA 4PIVA 4CQLA 4Y6SA 3TDKA 1N5DA 4YJHA 3RUHA 3WDSA 4Y6RA 4YAGA 1P9LA 1GTMA 3TQHA 3GF4A 4GL4A 1UZLA 2D4AA 1ZK0A 3KEOA 2G17A 3ZWVA 4BO5A 4BKUA 5KWEA 2X0NA 4ZHSA 3HE3A 4J7CA 3WGGA 2UAGA 4R3WA 1DHRA 4MKRA 4IPTA 4CM5A 4Y8VA 5HM8A 5A4DA 4J4HA 1XLTA 1EUZA 3QY9A 1RM0A 1ZMTA 1ZVMA 2R00C 1YJQA 3AOGA 4BNJA 4NFYA 4N5MA 3TJRA 4C7KA 5KCZA 1PL7A 5EL0A 3S55A 4AJLA 1X0VA 1Z75A 2O3UA 7ADHA 3I4FA 1H2HA 5IZCA 1OAAA 3GAFA 4P8RA 2HMWA 3LLVA 3QV1A 4ZGWA 2B36A 3BMQA 4XR9A 2JHFA 3H6KA 1Y9AA 5AVOA 1P44A 4W7IA 3GVXA 2JHGA 4TQGA 5I8ZA 3GOHA 1IHYA 5A3VA 5CEEA 3TPCA 1Q7GA 3CMCO 2VYNA 3CZRA 1HTBA 3GY0A 3JD1A 4Z0PA 2PNFA 3S2EA 4DUPA 1HZJA 2PGJA 1QR6A 1YONA 4CQMB 2PY6A 3MOIA 3VC7A 4ESOA 4UEKA 2DTDA 1H93A 1WP4A 1RPNA 4JIGA 1SPXA 2OORA 2P5YA 3EZLA 4W9NA 5DULA 3Q3CA 4UEJA 4CM4B 1N1EA 4JJIA 2GPTA 5IZCC 5I7SA 3TFOA 3ZCXA 4F6CA 4GBJA 4ILKA 4D79A 1GD1O 2JAPA 3PI7A 4GWKA 3DTTA 3JQ8B 3QSGA 4YAJA 1ZSYA 1A7KA 3E9MA 1SOWA 4CV1A 1LDNA 1ZK2A 3WQRA 4PLYA 5IAAA 4P4GA 5EN4A 1SO8A 4LN1A 2A35A 1Y6JA 2UV8A 4UUMA 1DFHA 2AQHA 2Q1SA 1RM3A 4FJ2A 4O63O 2W2LA 1EVIA 3KHUA 3P7MA 1U4SA 3R3JA 4MPDA 5BT9A 3VPSA 1XELA 4AL4A 4W9NC 5T6BA 1PL8A 3WTCA 1ZK3A 2D3TA 4FFOA 2PD3A 4MVJE 3RC9A 2J3HA 1PTJA 4O5OA 4BB5A 3F6YA 3TL2A 5ICSA 4N54A 3QLJA 4Y9DA 2R2GA 4UEOA 4ZQEA 3EAGA 4TZTA 2Y67A 5IFLA 1GQQA 2AQ8A 3WBBA 3NT5A 1UXKA 4UVDA 3GZ4A 5BSGA 4WKGA 5EINA 5TT1A 1MXHA 3DMTA 4RLSA 3FF4A 4BNIA 1PJ3A 3AUSA 4MVJF 4RDHA 4XZ3A 1IPEA 4DYDA 3GH3A 5KJCA 4W82A 3W1VA 4DYVA 1BVRA 1SAYA 1UAGA 4FPXA 4WCFB 2Z1MA 3OH8A 3W6UA 2FPIA 2HK8A 1SMKA 1HYHA 2OHXA 3A4VA 4E21A 5JW6A 4J7UA 5BNFA 4BGIA 2EP7A 3JQ7A 4WE3A 5CEFA 4GWGA 3TF5A 3KSZO 2ZB4A 4LGVA 2O4UX 2ZQYA 4QXMA 1ZXBA 3AY7A 3DMTC 3C8MA 2PFGA 5L51A 5DDIP 5I9MA 2NVUB 1CQJA 3DZKA 3ABIA 3VPXA 3PLNA 2HSDA 3HHPA 1Y1PA 3TN7A 2Y1DA 5AXAA 2VHZA 5C7LO 2HK7A 3Q1LA 1NVMB 2CNBA 2WD7B 4OMUA 3ZHXA 4CLHA 4HXYA 1YRLA 2YV3A 3DL2A 3GVHA 3ZW8A 3S8MA 3BHMA 2OOSA 3OMLA 4E4YA 1I3KA 4CQMA 2AMFA 2E49A 1ZJZA 4XYBA 4BMNA 4XQGA 5CPBA 1XR3A 1UP6A 4UULA 2OBNA 3DXFA 2HJSA 3JV7A 3HN2A 2B4TO 3ANMA 3PFWO 4HFJA 4I9HA 4LSMA 3OEYA 2YUTA 2ZYAA 3F5QA 5AXBA 5JO0A 4OH1A 3JQ8A 1GZ3A 1UJMA 1XKQA 3IUSA 2Y93A 1ENZA 1UP4A 3RUAA 1WAMA 3KTDA 1LJ8A 2DKNA 2NM0A 4UUNA 4BQPA 1ZEJA 4K6CA 4HFRA 2IZ1A 1IHXA 3VZSA 2Q46A 4U5QA 2VTDA 1T26A 2VUUA 3GQVA 1N1GA 1Y5MA 3DBLB 3VOSA 3AM3A 4IDGA 2NSDA 3HDQA 2WMDA 3ON5A 1ONOA 4XX0A 4CLOB 1ZEMA 3LC7O 1V0JA 3A9WA 3N58A 4EEZA 4FS3A 2BFAA 2ET6A 5BNIA 3LDHA 3GDFA 4IUYA 4QFDA 2P4HX 4PLGA 4E12A 2IZZA 1YH3A 3NDJA 3RI3A 4ALLA 4II3A 4NR0A 3E48A 2CDAA 3VTFA 1BGVA 3WG9A 5G4KB 1HLDA 5U4QA 3INTA 1LC3A 1GPDG 3IIEA 3GZNB 4OQYA 1A7AA 5HBRA 1YL5A 5F5NA 4B79A 4TMFA 3OJOA 1TT5B 1ZNQO 4GX5A 1HEUA 1LU9A 1BSVA 3G1TA 5BQFA 1D1SA 1XSEA 3ZWWA 3V2UA 1B3RA 1GV1A 3QVOA 1TLTA 1E1LA 1UZMA 3GDOA 3TZCA 4CMCA 2NU6A 2JJYA 4CV3A 5I9LA 3OECA 4L0QA 2EP5A 4MDHA 3JYNA 5TJ9A 1OC2A 4YRAA 4E13A 4BO3A 3OA0A 5JC8A 1Z7BA 3KYDA 3V2HA 4E5PA 1EEHA 1DC3A 4YRDA 4PFJA 1R0LA 2J3KA 1P74A 4GSLA 5CAEA 2BD0A 3E5MA 3CSDA 2WD7A 1EVJA 1G1AA 2I67A 3ONFA 5B12A 4M1QA 1V6AA 3FWZA 4RPLA 4DC0A 2Q1WA 4CM8A 2PZMA 3VDQA 4FJ1A 2A9FA 4JBGA 4MVJI 1QYWA 4MVJD 3G17A 1HDOA 2QW8A 2VZ8A 4BO9A 2DUWA 3WSVA 4PZDA 4FN4A 4CMIB 5ENDA 2GERA 2Q1UA 3HADA 1GUYA 4I5EA 5JAQA 2X5JO 3U4DA 1EVZA 4WOJA 1JVSA 3A06A 4AJ4A 4BNKA 1WPQA 1Z73A 2DBZA 2BI7A 1DRUA 5T5QA 3W4IA 2CY0A 3CINA 2NU9A 1B3BA 1MA0A 3UCEA 4CM6A 3ITDA 3PZRA 3OETA 3MTGA 5J23A 3OIGA 4GKVA 4H15A 4BVAA 1DEHA 1UP7A 3U9LA 1LRLA 2JD0A 1U1IA 1CF2O 1HSOA 1FJHA 1EZ4A 3I6QA 4XQEA 5B4VA 4PLVA 5EIOA 2CSUA 5ES3A 2VN8A 4CLOA 4FJ0A 1HKUA 3SJUA 3RCBA 1BVUA 1BXGA 2E37A 1NVTA 2AE1A 4LW8A 2ZIZA 1BDMA 2AA3A 3IQDB 4RPHA 3Q6IA 2X23A 2G5CA 1P1JA 3C7DB 4IQ8A 2P4QA 1D7OA 3RD5A 2VNAA 5G4KA 4KUEA 3UN1A 4PGFA 1E3IA 3JCZA 5L4SA 2NU8A 4MIYA 1DC6A 1R0KA 1SCUA 3AUTA 2I9PA 3GZNA 1WZEA 4N5LA 4B8WA 3ETGA 1I2CA 3V1TC 1UDCA 5JFOA 1B0AA 3HDHA 4LRSB 3WBFA 3PHIA 5DP2A 1WXDA 3D0OA 1JAXA 3NYWA 2NWQA 3O26A 4YJFB 1YQGA 2ZCUA 1V3VA 3O4RA 4HADA 1TEHA 2DBQA 3GMDA 5CDYA 5AXDA 1DXYA 1BW9A 4U0JA 4NG5A 1M6WA 4LMRA 3UUWA 3GGGA 1H6AA 2D5CA 4HNHA 5L9AA 1V9LA 1NPTO 5L95A 1I10A 2VUTA 4Y6PA 5B4TA 5JE8A 2O2SA 2XOXA 1HLPA 4JROA 1GEEA 5CHEA 2EV9A 3ROPA 1R66A 1HE4A 5C3MA 4O1MA 2O48X 1V3UA 4TSKA 1EQ2A 3NJ4A 3VPGA 1NFQA 4GSKA 4II2A 4Y67A 4DL9A 1C0KA 3H9QA 4RGBA 2VOEA 3UH1A 2AXQA 2Y05A 3NKLA 1B16A 2OZPA 3DBRA 3GK3A 1J0XO 1QKIA 2VYND 4MP6A 4RDIA 2J6IA 1NXQA 3DBHB 5FEUA 1E0DA 4BV8A 4GX2A 3OHSX 1WDKA 2W4QA 4R1SA 4DVJA 1JA9A 1GZ6A 4RQUA 1JN0A 3I3OA 4IGEA 1PZHA 3DHEA 4F45A 1ZK1A 2GASA 3KXDA 3QWIA 4IBOA 5JYEA 1DRVA 5A5FA 3QVSA 3ZV6A 2O23A 1HE5A 4I1IA 3BTUA 2C0CA 4N18A 4FC6A 4CV0A 4DQUA 1YE3A 4WECA 5DCUA 3WQSB 1GYQA 3PZBA 1H0KA 4JX8A 2BGKA 4R1UA 1QORA 3AU9A 3LQFA 2VT2A 2HO5A 4IQ0A 4DWVA 3IMFA 2DFVA 3SBOA 5DNAA 1XG5A 3DEYX 2RHCA 1K6IA 2ZYDA 5DOZA 5EPOA 2PKRA 1SNYA 2Q3EA 1ISHA 4IINA 2B4RO 3H9JA 1F06A 3L6OO 2CZCA 1OMOA 2GNAA 1JW9B 4MO2A 5LCXA 4DPMA 2AW5A 3NUGA 3GN1A 4G2NA 2GUGA 1C0PA 1ISJA 1YOVB 1U4OA 5T8KA 3DOOA 1GL3A 2C5EA 4FW8A 4NZ9A 4Y98A 3M2TA 2GO1A 2JFFA 2I65A 4CM9A 1WW8A 4FQ8A 1LDEA 3RJ5A 3GPIA 4B3HA 5CDUA 3BZUA 4YTEA 3TZQA 4BO2A 4MP8A 3BXXA 2ZTLA 1KOLA 3KZVA 5IXYA 4INAA 4TROA 3BTSA 4BNTA 3LT2A 4YCAA 1RJWA 4RV9A 1AXEA 3BMOA 4XIYA 4B3IA 3EK2A 2Q2VA 1CERA 4HY3A 1O6ZA 5DT9A 5T8KC 2FPPA 5L4LA 1QMGA 1V35A 4MIEA 2VHXA 4KDEA 1NPDA 1E1KA 3EUWA 4PG7A 1V3TA 3RC2A 3VPHA 3GEMA 4UUPA 1DLIA 2HCTA 1ISIA 1X7HA 1H6BA 2GGSA 1SEVA 4XEHA 5TIIA 3FTPA 3T7EA 4BKQA 3WWYA 3UVEA 1P45A 5F5LA 1HDCA 4PLFA 2O2YA 1L7EA 3DBHA 5KNLA 1UZNA 2BGMA 3KSDO 3PHLA 5BNTA 5HWSA 1NQOA 1FDWA 1K89A 3PIIA 2IXAA 5CFZA 3RU9A 2X0JA 4KUHA 1B8UA 4HKTA 4QTZA 1PJTA 1XWFA 3OA2A 3VH4A 3MOGA 1N7HA 2C29D 4FFNA 4RF4A 3AUUA 4XIJA 4CR8A 2ZKLA 1YQDA 3UFXA 4ZQHA 5U9CA 3NAQA 1AHHA 2FZWA 1QSGA 1E3SA 1KEWA 4PVCA 3K73O 1VSUA 3VTZA 2VWHA 3HFSA 2JD2A 1T2DA 3ZDFA 5ICMA 3HFGA 1HE3A 1YL7A 4MP3A 4CPDA 4E2ZA 1D8AA 3KETA 1C1DA 4RQTA 3HJAA 2V65A 4FDAA 3TOXA 2PR2A 1E7MA 2X22A 2I5PO 1B8PA 1NHWA 3VDRA 3IS3A 5CG1A 3SXPA 5CPFA 1SBYA 1ADGA 1X0XA 2VNSA 1UXIA 4IIVA 1E1NA 1LUAA 1HZZA 1DIRA 4YJGA 4Z6KA 5IDQA 1X13A 2Y0CA 1MX3A 1VL0A 1NFFA 1H9AA 2PGLA 3FNGA 2B35A 3PPIA 5JCXA 1DIBA 1YB5A 3ZWAA 1NAHA 2NTVA 3JYPA 3CPSA 1Y8QB 3ZH2A 5TJHA 2HDHA 5ADHA 3TNLA 4J2HA 4XYLA 5GY7A 5B37A 2AG8A 5I9NA 3ULKA 4E3ZA 4Q39A 4DREA 3K9QO 4EUFA 5HTOA 4QO8A 3JYOA 1R4NB 2ZQZA 1Z74A 4NFHA 3RFTA 2NADA 3U4IA 1KVSA 3B1KA 2YW9A 3R0IA 5TF4A 4D7AA 5G0UA 4FFRA 2X0IA 4FFLA 4IS2A 2OMEA 1DIAA 3I9OA 1J6UA 4MIOA 1E1MA 3HWRA 1FDTA 1ONPA 1LBEA 3O8QB 4I5GA 2ZB3A 4XRGA 3ZV4A 3DFZA 3DC2A 1DAPA 1LDYA 3D1LA 3KYCA 4DC1A 3CUKA 1FDVA 4R54A 3JQBA 1E92A 4HWKA 5T57A 4MKZA 2UUOA 3U62A 2I3GA 4GX1A 4ND1A 1ADFA 1P1KA 2AEFA 2CDCA 3N7UA 4OXKA 2YV2A 3LT1A 2PKQP 2XF8A 1LI4A 3P2YA 4J0FA 4PRLA 3INGA 2I6TA 1Z82A 4WLFA 2HAEA 4JQCA 1QYCA 3ZWCA 2P91A 2CFCA 1J5PA 4A0SA 2ZTVA 2NTJA 1KVQA 1LDMA 4DQXA 3G79A 4OHUA 5H83A 3JQGB 4Q3DA 3S1LA 1XEAA 3OJLA 3WOHA 1A4IA 1NPYA 3JQBC 3RUIA 4ALMA 1T1SA 4RPGA 1F14A 5HRUA 3R3SA 3GVIA 1MP0A 3F4BA 1KBZA 3DHYA 4HBGA 4XDZA 4EI2A 3PLRA 5DP1A 5TC4A 3ENNA 5DBIA 4DXHA 4XR4A 2EEZA 3I1JA 4J4BA 1XHLA 4H7PA 3O9ZA 3NJ8A 2I66A 3RQSA 1P33A 2H9IA 2FOIA 3NDRA 4WNCA 5DF1A 3OF2A 2QQ5A 5EMHA 2P9CA 3GG2A 3D3WB 3L4SO 4NBRA 4WOKA 4DIFA 2P9EA 5CDSA 1G0NA 4W4TA 3K2EA 3PHHA 5B4UA 4QT0A 3FCOA 3QA9A 1HE2A 3ASUA 3WJAA 2IYPA 2JFGA 5TQVA 5A03A 1EVYA 1VSVA 4PVDA 5ITWA 1MG5A 3AW9A 3D64A 3U4CA 3AFNA 3KEQA 4MINA 2DPHA 2NTNA 4MVJH 3W8DA 1TB4A 3DFUA 3DR3A 4PLCA 3ZNNA 2A94A 1A9YA 2IRWA 2DBVO 1F8GA 3OFSA 3ENKA 4CJXA 3W4JA 2X8LA 3V5NA 2LDBA 4YEDA 3E82A 5BR7A 1VKNA 2GF2A 4N5NA 1K5HA 3H5AA 3MJVA 4S1VA 2Q45A 3AUAA 4BO0A 4UREA 2Z5LA 4W7HA 4BS9A 2V6FA 3BMCB 5KJEA 2VT3A 4JN6B 2HRZA 1F17A 3B1FA 4NMHA 3KLMX 1ZZEA 1E6UA 4PCVA 3UOGA 3I5MA 3VZRA 5JCJA 4ND4A 1VJTA 4NBUA 4UVIA 4D46A 1GUZA 4NPCA 4I9NA 3RC1A 4BL5A 2CDBA 2EGHA 2E48A 1B8VA 4A5OA 2NLOA 2DT5A 4XGKA 5KKCA 3WB9A 2PA3A 1HF3A 4DRYA 5IDXA 1CQIA 4ZA2A 1DPGA 1NR1A 2CVZA 2I99A 1I2ZA 1PGNA 4GLLA 4LK3A 3TZHA 2FSSA 3B70A 1GR0A 2HMVA 3WFIA 4KTVE 1GCUA 3GEDA 3JQGA 1W0CA 4YB8A 4YT5A 4OOEA 4Q9NA 1W4ZA 3PYMA 1P1IA 1E7SA 4BNVA 2GN8A 2NVWA 3C3XA 2X9VA 3OJEA 1WMBA 3ZN2A 1I36A 3GHHA 1O89A 3I23A 3QVWA 2GZ1A 1W73A 2EW2A 1PJLA 3TL3A 3RUCA 3P19A 4CV2A 3JQ6A 2VOJA 2I76A 5L4NA 3UHAA 1E77A 2A92A 3GNSA 1T4BA 4Z9XA 4K28A 4CMKA 2YQ4A 3K96A 1O0SA 4TVOA 1C1XB 2DTEA 3SLGA 5I8WA 3D3WA 3MEQA 3MJCA 3T4XA 4KZPA 1GFSA 3C85A 1T4DA 3JQEA 3M2PA 4DIOA 2Q2WA 3E5RA 4FOSA 1BMDA 4RJTA 1YBAA 4KOAA 1Z45A 1YVEI 3VHRA 2VHYA 1ZXLA 4I9UA 4XA8A 3CEAA 4EJ0A 4XYGA 3KSUA 3ZU4A 1J4AA 1I8TA 1RKXA 2EGGA 4IXTA 1H5QA 5A9RA 3W8EA 4ZU3A 1MFPA 3U0BA 5IDWA 3D3EA 2D1YA 4GX0A 4J7XA 1RM4A 1CEQA 1ENYA 4CM9D 4P4LA 4YJDA 2DPGA 1NQTA 4GMFA 1F8FA 1GU7A 4J9VA 3WLFA 4E33A 4WNIA 3KVOA 2NU7A 3MWDB 3PJEA 2PK3A 5KJ1A 3LVFO 2FP4A 4OKIA 4OSPA 1MGOA 2J5RA 3K31A 4QUKA 3RROA 4FD3A 1QV6A 4Q3AA 3WS7A 4CM4A 1IE3A 4HX5A 2OGUA 3SC6A 4U6QA 2BF7A 3EY4A 1G6KA 3WFJA 1PZEA 3ZHYA 4WUVA 2X0RA 2ZB7A 3HZZA 4BB6A 2PZJA 4BNYA 4NNJA 3WNQA 4G81A 4AFNA 1Q0LA 4ALKA 4XWYA 3WXBA 1F12A 4FB5A 1DRWA 3JQAB 4RVDA 2EWMA 4WLEA 3V1UA 4EUHA 2PV7A 4O6VA 4EZBA 1T25A 2OBYA 4ALIA 2H1SA 1X14A 1IZ9A 5G4LA 3RAJA 1EUCA 2BMAA 3WGYA 3GEGA 3AU8A 5F3RA 3GR6A 4W6ZA 9LDTA 2I3AA 3K8ZA 5DZSA 2JCYA 3CIFA 1EK5A 4BMVA 1OFGA 1SB8A 2VRCA 1HDZA 3GUYA 4X54A 5F1PA 1N7GA 3WGZA 3LC2O 4KWIA 2POQX 2P68A 4Z0HO 1KERA 1FDSA 2DFDA 1H94A 1F0YA 4JP3A 4DQVA 2QHXA 4M49A 3F5SA 1XQ1A 4E5KA 3V2GA 3H3FA 3R6DA 5TT0A 4DPKA 1R15A 2GZ3A 2PD4A 2YDXA 3NRCA 4HV4A 3LF1A 1TXGA 4WCFA 5FI3A 3AI3A 4JCOA 3LZ6A 3GNQA 1T1RA 1RYEA 5MGBA 3FR7A 2QX7A 3UGKA 1B15A 4NH4A 4XQ9A 4RVHA 3EZYA 3AI1A 3MTJA 3WYBA 1GDHA 4EJMA 4NBVA 1R12A 1PIWA 2NVUA 4K1LA 1YL6A 3C1TA 2X9GA 1OI7A 4WK6A 1P0CA 5BSHA 2PTGA 3P2OA 3RUFA 2IEDA 1NWCA 1ZJYA 1K0UA 2WDZA 3DZHA 2FY8A 2WD8A 1HDGO 1DJQA 1VC2A 3KO8A 2VYVD 3I4CA 4NJOA 4NJMB 3MZ0A 4Z0TA 4WCFC 5JS6A 4E2WA 4EGFA 3H4VA 1BTOA 1IZ0A 2Q4BA 2VQ3A 3AJRA 4BNFA 4TVBA 1WWKA 4WCDA 2C2XA 2IDZA 2VZ9A 3A1NA 2ZJ0A 1PZGA 4R1NA 5ER9A 3IKTA 1FDUA 4F46A 1U3UA 1PGJA 1D1TA 3WWZA 2Y0EA 4LISA 4AJKA 4CMEA 4HFMA 5ENVA 4RPKA 1JKFA 1EFLA 4G5HA 4WLNA 1P31A 3EHEA 5DCWA 4M86A 3ZNPA 3W4KA 2SCUA 3LT0A 2DU8A 4J49A 4KTTE 2ZTUA 5JNLA 1I30A 1B26A 1PGPA 1RWBA 1NAIA 3DBLA 1UAYA 3IJRA 4J2OA 2X86A 4NU6A 1L7DA 3ZU2A 5JSFA 4CMEC 1HYEA 3CH6A 3QWAA 3C7AA 3MJEA 3K6JA 3H9UA 1DB3A 4E5NA 3SLKA 5H82A 3PIDA 4P38A 3INRA 3OBBA 1WLYA 1YQXA 2HMSA 4GVLA 4EW6A 4BV9A 1ISMA 1LLCA 1PS8A 1ULUA 3AFMA 2V6BA 4HUJA 3HNPA 4N7RA 1U7TA 4O59O 4BO6A 4EUEA 1LSUA 1HDRA 4YYZA 3AK4A 1E7YA 2GSDA 4GH5A 3ROQA 4WASA 2EW8A 3RFVA 4AJIA 5JAIA 1X1EA 4BO8A 4YPOA 3RUDA 4E5YA 3F1KA 5IN5A 3EW7A 5JPIA 1Y8RB 4R5HA 3S2IA 3KUXA 3NT4A 3SJ7A 1PSDA 1TT5A 5JDIA 1R0SA 3HDJA 4IDEA 1IYZA 2ZYGA 4QX6A 4Q3EA 1WDMA 2HQ1A 2CMDA 4A7PA 1Q0QA 1CRWG 1PS0A 2FR0A 2ZJ1A 4XGIA 2XXJA 4B4WA 3SVTA 4YACA 1C0LA 3H3JA 5ILGA 4YQYA 3B6ZA 3ZU5A 5IZ4A 1LDGA 5L7YA 3WIEA 1LSJA 1MUUA 4IDCA 4M8SA 1OC4A 1VI2A 1QP8A 1IL0A 1P1RA 2JFHA 5TGDA 5JMWA 1E7RA 1ADCA 1VPDA 4Q3BA 4XQCA 4AVYA 5F1OA 5JXWA 2H63A 4AJJA 3ZWNA 2X4GA 4MKXA 5JDIC 3QJ5A 2IODA 4L4SA 2GR9A 2NACA 2YHIB 4OYRA 3ST7A 1BDBA 2C7GA 2NVBA 2AEJA 1ISGA 1PGQA 4GPD1 1HXHA 5IJZA 4L8VA 4RF5A 4D0SA 1DLJA 2GN6A 3FPLA 4KP7A 5EJ2A 3IAHA 1U8XX 2Y0DA 4OQZA 4BNMA 4CMIA 2X6TA 4XYEA 3IOYA 4DIBA 5IG2A 1PQUA 1HRDA 4R51A 4TRMA 4BO4A 1ZMOA 3I6IA 3STHA 4A26A 4IMRA 5G0TA 1KEVA 5U1PA 4CODB 6ADHA 2WM3A 2YY7A 1YDWA 2CF5A 3B1JA 4LVCA 4E0BA 3FN4A 3PQEA 2FZEA 4RCVA 2D8AA 3GAZA 1GY8A 4R9SA 4XJTA 1ZSNA 1I3LA 1UDAA 2E82A 5FF9A 3PYXA 2Y1CA 1I2BA 1U7HA 2YDYA 4M54A 3PRJA 3GHYA 3G1UA 1HWYA 2OFPA 3QW2A 3WJ7A 1BXZA 4ALJA 4B7XA 4A03A 1N92A 2W2LD 4RORA 4CMHA 3GVPA 4BOYA 4JLWA 4B4UA 4Z9FA 4R69A 4JJGA 1AN9A 3PFFA 3AM5A 4PRKA 4DLLA 2UVDA 5DBGA 3OIFA 2AHRA 3RIHA 4IGFA 2O7QA 3VH1A 1ULSA 2EERA 1R4MB 4IDDA 4J16A 3TOZA 2J3IA 3E8XA 3FNFA 4D44A 4KUGA 5T67A 3X2FA 1G0OA 1ZIDA 4MVJG 1KYQA 4PG4A 4R5MA 1CJCA 4P4NA 4BNZA 1KEUA 3U4HA 1DOHA 1EDOA 1Q2XA 2ZTMA 3FWNA 3H7AA 4YJFA 5JMPA 4BQRA 5THQA 2JD1A 4IDBA 1XU9A 4O0LA 1I0ZA 4R9RA 3BYZA 2O3QA 2JKVA 3H65A 4XRRA 4IS3A 4CM3A 4BNNA 4LMPA 1LRJA 4J1QA 5DBFA 2F00A 1LSOA 2H5LA 2QG4A 4IZIA 5C7OO 3RKUA 3GT0A 3A28A 4B4VA 2C07A 4BUCA 2Y68A 5JAMA 2ILTA 3UAGA 4AJHA 3JD3A 3PJGA 2W90A 3RBZA 4WGGA 5CP8A 3K2BA 3KM0A 4K6FA 3UXYA 5GMOA 3HN7A 3F1LA 2R6JA 3HB5X 2Q50A 3FBTA 3QWHA 4AJEA 2LDXA 4EYEA 1DAOA 1O94A 4B7CA 3TWOA 1SOVA 1WDLA 3GA0A 4JGBA 5G2OA 3UW3A 1YJ8A 2DBRA 1JKJA 5JY1A 2O50A 3I9NA 5A9SB 3EC7A 3DTYA 2BFPA 4HFNA 3WGTA 4PG8A 3ZWOA 1M67A 5DCYA 3H8VA 1I3MA 2P2SA 4BGUA 2J8ZA 4R01A 1JKIA 2PGDA 3IJPA 2NQTA 3BIOA 3IL2A 5F1KA 1HT0A 1GYRA 3D7LA 4ZICA 1JLLA 1I24A 3KV3O 4AJNA 1UXHA 4KWHA 3OJ0A 4GKBA 4GQAA 1M6HA 4CQMD 2BGLA 4E2XA 3NX4A 4L4XA 3OEWA 4BHTA 2Z1NA 4XB1A 3F9IA 4IM7A 5CDTA 5AOVA 2G1UA 3F4LA 3ZI0A 2PZKA 1P77A 4AJPA 2BELA 1UXJA 2RCYA 2WYUA 1Q7CA 3K5PA 2DQ4A 2C2YA 5TX7A 4NHEA 4TRJA 1DC4A 4H3VA 2PWZA 1E6WA 4F3YA 2CD9A 5F21A 2VTEA 4C4OA 3VPFA 3GUCA 3LSYA 1QXSA 1NTOA 4RLHA 4CR6A 4XJSA 3GDGA 1VL8A 4ZQFA 1PJ2A 5EERA 2OP0A 3DZGA 3NTQA 4QFCA 5COAA 4YXFA 1PS9A 5KVVA 1SEPA 3HG7A 2VCYA 4E32A 4FGSA 4NBWA 1MB4A 2AEMA 2V6MA 4ID9A 4PLWA 5G0WA 2WEKA 1A72A 1KVUA 2O7SA 1L1FA 5L7TA 3ZZNA 4DA9A 1KETA 3LT4A 4RVGA 2XPCA 1M75A 1YOVA 1ZO8A 4YA6A 2EKQA 1X7GA 4ND2A 3QWBA 4YJHB 1WMAA 4Z9YA 4YQZA 1BRMA 2FHSA 3C1OA 4BO1A 3EMKA 1HDXA 2AQKA 2HKIA 3KOUA 1ZUD1 3Q11A 1QLJA 3ASVA 4CLXA 5KVSA 1KEPA 1SZJG 4D3DA 1UDBA 5I7EA 2YQ5A 4H16A 3DO5A 1VL6A 3EVTA 2YFQA 2NV6A 4RF3A 2EHDA 2VZ0A 3M1LA 3VH2A 5HA5A 5CEJA 3DZJA 2QZ9A 1XYGA 1KY4A 2AE2A 5KOIA 1A71A 5A9SA 1ORRA 1EE2A 2F1KA 3ANLA 3CZMA 1B14A 3DZFA 2FN7A 3OQ6A 4MVJA 3PWKA 3JTMA 1BXKA 1N8KA 1XCBA 3AWDA 1U2DA 2RHRA 3PP8A 4EITA 1C3VA 4JJFA 3WTBA 1GUFA 4J1NA 3GC6A 1YB4A 3U5TA 1GCOA 4BNLA 2P9GA 1KVRA 3DHNA 3VAZA 2C82A 1I33A 3OIDA 1A5ZA 3CKYA 4FBGA 4ZJUA 2G0TA 4BNWA 3E18A 3LF2A 4B8ZA 4A73A 1GQYA 3NGXA 3RVDA 3WGIA 1T2EA 3RWBA 1U28A 1I32A 1NBOA 3I52A 1LXCA 3Q9UA 4L75A 1DIGA 4DLBA 1PJCA 1NM5A 2YZ7A 4M55A 2V7PA 1H9BA 4OM8A 1XGKA 3I83A 4WPGA 3ZWMA 5LDHA 2X5OA 2J5QA 5A02A 4AJ1A 3MJSA 4S3MA 1PEDA 5KJ6A 1B2LA 4OL9A 1GADO 5A04A 3FSRA 5AQ1A 1E7WA 2WYWA 5ER6A 4BO7A 1NWHA 2WTBA 1VE9A 1LLDA 2QRKA 1KS9A 4OGWA 1NX6A 1PWXA 1A4UA 4IIUA 1H6CA 4A27A 4FR5A 3GNTA 2X5KO 4D45A 5IN4A 3GPDG 3QRWA 2TMGA 4RVFA 1TA4A 2UYYA 4ZD6A 2Y1OA 4RZIA 2DTXA 2CVQA 1C14A 3RFXA 1VRWA 4OAQA 4YAKA 3SX2A 3MWEB 3P5SA 2FR8A 4U8GA 4J90A 3PJDA 4YT2A 3FBGA 3IUPA 5KJFA 3ZWPA 4IDAA 5H81A 4KDFA 4E2YA 3W6ZA 3B20A 1AHIA 4WLVA 4CR7A 3RU7A 3G0OA 3K30A 4WJZA 1Y8QA 4XDYA 5HS6A 1P3DA 3O03A 3FPCA 4ND5A 4DGSA 3NTOA 3JQ7B 3R1IA 1FF9A 4J9UE 4WEOA 2QZZA 4BNHA 3MJ4A 3V8BA 5THKA 1R4NA 3ZV3A 3VZQA 2Y66A 3ICCA 2GD1O 2XAAA 1WVGA 3HSKA 4J6FA 4YR9A 4ZRMA 2HMTA 4R1TA 2WJPA 3QVTA 2VWGA 3T7CA 2OUIA 3N74A 1EK6A 3PGXA 4IMPA 1IY8A 3O8QA 2DAPA 3QHAA 1DDOA 4XKJA 3E9QA 5IDYA 3F3SA 5A1TA 3WLEA 2NUAA 2WWRA 2JAHA 2CF6A 2ZATA 3FI9A 5AYVA 2ZCVA 3PQFA 1I01A 3CMMA 4LVUA 4I8XA 4AJ2A 1O8CA 2Z95A 3PVZA 4EEXA 1T2FA 2RH8A 3V1YA 1NR7A 1LLUA 4CM1A 1DFGA 3NV9A 3RC7A 2IE0A 3BA1A 4MVJP 4CL8A 1T2CA 2D2IA 3JQCA 1IB6A 5GZ6A 3DMYA 3WICA 1KVTA 2B37A 3Q9NA 1DIHA 4WEQA 5A05A 3DZIA 4XCVA 1KC1A 5A3JA 2EJWA 1ZK4A 4CMBA 3H9GA 3UICA 1VJ1A 4BKPA 1DHTA 1PGOA 3CXRA 3PGJA 4KMSA 3KB6A 4IY1A 2B0JA 4QQRA 4BGEA 4F6LA 4Z3DA 1LSSA 3A14A 2QYTA 3BHJA 1JVBA 2B5WA 5JLAA 4CUZA 5JDCA 4R3NA 2EF1A 4NU5A 2Q4EA 1NVGA 3BMNB 3RASA 1VLLA 1H2BA 1YGYA 3WGOA 2G76A 4WLOA 3OJFA 4CLRB 1LTHR 4CLDA 4ZN6A 2BH9A 4HP8A 1LLQA 2Q99A 1R16A 2FPGA 3TZKA 3OM9A 1VJ0A 2E6UX 4B4OA 2RBEA 5IF3A 3VH3A 2AG5A 3ITKA 1AUPA 1UUFA 2TMDA 1AXGA 1E3WB 3RUEA 2O3TA 1JU9A 1DSSG 4LCJA 3ROMA 4DTIA 3NDIA 3VZPA 1E6EA 1JQBA 5JDCC 3WR5A 4U7WA 3HDYA 4YT8A 2C54A 3VVBA 3QQPA 3LLSA 3DZBA 2ZK7A 1TVEA 4Q3CA 1TT7A 5CDGA 3K92A 3DAFA 4R41A 4A10A 1QYDA 4IJUA 2QIOA 1IPFA 5L3ZA 3LU1A 4IDFA 4RPJA 2Q1TA 3RBVA 2HJRA 2GLXA 3BMCA 4RZHA 3ZHZA 3EVNA 1IUKA 1PR3A 4PLHA 3KYDB 1ZSVA 4JP2A 5FFFA 4LRTB 3RKRA 3JQFA 2FSVA 2BKAA 2GN4A 8LDHA 2GYYA 1QYXA 3JD4A 1JWBB 4QSMA 1S6YA 4URFA 5C37A 3E9NA 3WX0A 1Q7BA 4JNKA 1LQUA 3FNHA 1K3TA 4L76A 1S7CA 1E7QA 4CM8B 1XIVA 3L4BA 4BGVA 3PYLA 3AY3A 3RBXA 3ZWXA 2EKPA 3I9KA 4CMGA 2EG9A 4E30A 2B5VA 2Y1FA 4CUKA 4DBZA 9LDBA 2B83A 5KKAA 4D41A 1GZ4A 3GG9A 2HK9A 3JQFC 4FCCA 1HDYA 3PTZA 4L9RA 2C7VA 3PEFA 4MJLA 1A9ZA 5MDHA 3UF0A 1H6DA 1JAYA 3MJTA 4FFMA 3D4PA 2QRLA 3IDSA 1U5AA 3DB2A 1PR9A 3L4BC 1MLDA 5L40A 4PG6A 1ZFNA 4PZEA 1VKOA 1O95A 2WSBA 2PLAA 3AM4A 4OXYA 1EBFA 5JY6A 1E3JA 4OJNA 2GZ2A 4OOFA 1ZBQA 5JBIA 4AG3A 2VHWA 2B4QA 1RM5A 3BMNA 1BXGB 2DVMA 1C1XA 4L4RA 4EJ6A 1EBUA 3AOEA 4YWJA 4PLZA 2OL4A 1MC5A 1SB9A 4CLRA 3FTNA 4RVUA 4B3JA 3M1AA 2B69A 1R6DA 1U2GA 2XXBA 1T24A 4DBVO 1X7DA 1FMCA 2UUPA 1GYPA 1E3WA 4UVGA 3WGHA 2DLDA 2O3SA 4ALNA 4W99A 5EQFA 2GRAA 1JTVA 1ID1A 2O3JA 4IJWA 4I5DA 2EXXA 3FRJA 4IZHA 3GLQA 1DFIA 4DMMA 1GV0A 4AJOA 3AOEC 2J5KA 3CTMA 1Z6ZA 4LSWA 1ZH8A 4CMJA 1MFZA 4D42A 1ONNA 2IXBA 4J1TA 4QEDA 5KVCA 3ONDA 5JO9A 5GZ3A 2PD6A 1BW9B 1EMDA 4M87A 3JD0A 5L53A 5L45A 1PL6A 4BIIA 1IOLA 4C7JA 1W8DA 4CUJA 1DJNA 2RH4A 4J43A 2E4AA 1DO8A 3BAZA 3M6IA 1OOEA 4P22A 4A2CA 1QRRA 2W8ZA 8ADHA 4RF2A 3L9WA 5EQDA 3IC5A 1FXSA 2VWQA 2C20A 4LCEA 3JQAA 1U3VA 2AQIA 3WMWA 2BFMA 2DM6A 2UDPA 1GPJA 3DQPA 3DWFA 1WZIA 4UUOA 5EESA 2IZ0A 3DONA 1E3EA 3ROKA 2VHVA 4ONEA 3X2EA 5DN9A 2YYYA 3C7CB 4TRRA 2FMUA 3DBRB 1QG6A 1ZKMA 4D0RA 3ETEA 1U3WA 5TS3A 3JQ9A 1BWSA 5I7VA 3ADOA 4YBZA 3DOCA 3LC1O 2YJZA 4FC7A 5A9TA 5K6AA 2GCGA 1ZW1A 1P0FA 3C1AA 3T4EA 3UCFA 2D5AA 2HLPA 4HNGA 4RO0A 4TZKA 3PK0A 1PQWA 3ZWYA 2BLLA 1ADBA 5HS4A 1ISFA 1ZCJA 1N2SA 3JSAA 5C5IA 2P5UA 3KRTA 2JCVA 5TRTA 2FWMX 2HUNA 4E31A 2PKQO 4TWRA 3U3XA 5K9ZA 5IXSA 2WE7A 3JQ9C 4E6PA 3GFBA 1YDEA 1NFRA 5K6AC 4BMSA 1CWUA 4DMLA 1BG6A 3GRKA 4GGOA 2NQ8A 3RJ9A 1LRKA 4PG5A 4XGNA 4YDRA 2VRBA 5A06A 3ZWBA 1NP3A 1QV7A 3H5NA 2X58A 3EYWA 4CMAA 4B7UA 4TKMA 1YB1A 4DLAA 4PN3A 4FOOA 3KYBA 5I7FA 2BRUA 4YRBA 1YS4A 3NEPX 3HB4X 1MXFA 3WYEA 4XB2A 3QIVA 2ZB8A 3OQBA 3I9MA 2HMUA 2BI8A 2GN9A 4NJMA 4EDFA 3PWSA 5L7WA 3QE3A 3Q2KA 1Y9EA 1BHSA 3QP9A 5C7IO 5DOVA 3L77A 1N9GB 4UVEA 2FRDA 4I08A 4NI5A 4NK5A 1XU7A 1YKFA 2VWPA 4L74A 1K6JA 1KIFA 3GN2A 3H5RA 4GI2A 1J49A 2OXIA 2CVOA 3OSUA 1X15A 2C5AA 2D59A 3WYCA 2FR1A 4XYMA 4BKOA 1FK8A 1V8BA 3ANNA 3FD8A 3G3EA 3LYLA 4Q3NA 4CM7A 5FWNA 2WYVA 1IULA 3PWZA 3BMOB 2BFOA 3L9XA 3ZV5A 3BHIA 3EDMA 1I5RA 5FI5A 4L73A 1UXGA 3PJFA 4MOWA 1CYDA 1HSZA 1K6XA 2EIHA 4MVJM 3Q2IA 3VKUA 3L6EA 1M66A 5JCJD 1NQAO 1O5IA 3COSA 4R4JA 3VKVA 4DPLA 4YT4A 2YHUA 1KC3A 3ZNQA 2DC1A 3DDNA 4BNUA 1ML3A 3PHJA 1NQ5A 1Z7EA 2EJVA 3QVXA 1YXMA 4IJKA 3ZW9A 4ITUA 1YBMA 3TFQA 3VVCA 2PZLA 3L0DA 1P1FA 1TI7A 3L6DA 4GMGA 2CUKA 2Y1EA 3BTOA 4ZRNA 2IYOA 4ZQGA 3ONEA 1D4FA 1I3NA 3ZNOA 3ICPA 3DAGA 4K9DA 1Y8RA 2WE8A 3UCXA
chains in the Genus database with same CATH superfamily
4PZLA 2DQKA 3F3YA 3VM6A 4OQFA 3RRYA 3GLFE 5FNZA 5JYDA 1NNUA 4MNTA 1Z0ZA 2XKAA 1B7GO 3KJQA 3SE7A 4RIHA 5JJBA 3LTNC 4HZGA 1PQ4A 2IEBA 4J3FA 1Z16A 4DM7A 1T6ZA 3BWVA 5EJ6A 2J3DA 2OO5A 3LPDA 1XQ6A 2IV2X 5FIUA 2J9RA 3CA8A 1R0YA 1P4GA 2DFNA 2Y76A 3S2GA 1KJZA 3QLVA 4GR9A 2J59A 1L1QA 4GFDA 2VAWA 1LEHA 2W6JA 1PZFA 1OLUB 1KY3A 2AXPA 2JF0A 4YJ3B 2JFUA 2OP1A 4RVNA 5KYNA 5TGTA 4K05A 5L3QA 1UH5A 3KB2A 2A0XA 4M7PA 5K0SA 4AIIA 2YHIA 3GMSA 4DWJA 4EKGA 5A5EA 2IT1A 1V8FA 3MQFA 3OUTA 4FOLA 1N2CA 3OF5A 5CCEA 1GFZA 3RIGA 4AP6A 4L9AA 2WF6A 3UMBA 1WF6A 3FFTA 2P9FA 1CJMA 3O8RA 1CYEA 4DHEA 1K4KA 3KCNA 2IPAB 3AHEA 3CZCA 2K2QB 5L3VA 5SY6A 3NGLA 1LPNA 4RHCA 1D4OA 4E7PA 4JJ6A 5BQPA 2VPZA 1CK4A 1JIQA 1T36A 1Y1LA 2C5SA 2HXSA 1UCFA 2VH2A 3PCTA 5EIBC 1OVGA 3HWWA 4ZDKA 2SBTA 3Q88A 3G49A 4BNDB 1HRKA 2JBAA 3R9IA 4D43A 1T4GA 4I8DA 1QYVA 1U7OA 5AVQA 3O4JA 4KOEC 2QRJA 4DV2B 2IY9A 2WILA 3C3AA 4FX2A 4DMKA 1E5QA 1U0EA 1C2TA 3CZ5A 4PTYA 4NYMR 1GJRA 3QG5A 4Y0NA 3GOQA 3E3MA 5BOSA 1UFOA 1Z5WA 2W6ID 1TM7E 3RSSA 2B99A 3S2FA 4GOJA 4DY6A 3TSCA 1EE9A 4YCBA 3TIGA 2BHTA 2VK2A 4MQFA 4PYJA 2PS3A 3DAPA 1F20A 4FGWA 1JDTA 5C81A 1UPBA 3MT0A 4KYVA 5EGNA 2BGRA 2X1HA 3HUUA 4W5OA 4F5DA 4PLTA 1VKZA 5TLSA 2IP4A 1P61B 2YV1A 5CIYA 5ELXA 3IXLA 1XLUA 4LHXA 2Q5HA 1G98A 3GVCA 4NYJQ 1R5OA 1SFRA 1T2AA 1VM6A 2BTOA 2O4CA 1KNXA 2PH5A 3EOBI 1OX4A 2Z3ZA 2CE7A 4G1BA 4LXGA 3TG8A 1R37A 3EXHA 5DK4A 1NLFA 5T64A 1A8QA 3SSOA 1GAEO 2GESA 3LOUA 3LH5A 2IOFK 2Q49A 2JCXA 3NTRA 2OV4A 1R4MA 4FIDA 5FTMA 5LA6B 3ZU3A 1YJAA 3D1VA 3Q3VA 4LE1A 4H4EA 4G8JA 4MV1A 4AICA 2BUCA 4D4JA 4OCZA 1LNQA 4WXEA 3M5PA 3I9LA 2I2DA 3HNOA 1VIAA 5FL7D 1ECCA 5A6VA 2CVHA 2QYOA 2OOKA 3KBOA 1QMPA 2VUHB 4IJVA 2ZAGA 4OGGA 1RBZA 2W8BA 4G8CA 3STWA 1VSQA 4PU0A 2VHUA 3F46A 3VVLA 1YI0A 2O0MA 1TD1A 3KKNA 3PDUA 2PUGA 2WHEA 1XWWA 3HGMA 4LX8A 2O2XA 2YVLA 4POOA 2V6IA 1A9QA 1U9JA 4RSMA 3TRHA 4MV6A 3JYQA 4AAYA 1ENOA 1U3CA 4P98A 4UNQA 1P9WA 5GZ1A 1W6UA 1NN3A 1ZA1A 2NT4A 5M3BA 1EFKA 1YJBA 3ZCUA 3F6BX 3ER9A 1U1FA 2C8KA 3I9JA 2HSGA 1QJ4A 2R60A 1H5UA 3MK31 5B6JA 2YXDA 5IVHA 4LRUA 3L3BA 3GP5A 1GPAA 3A11A 4OIMA 4EG5A 1RPZA 3OTHA 2QYSA 3WDLA 1W581 1OHHD 2JDIA 3P45A 3HA5A 4FEGA 1L4MA 4E5DA 1PEKE 2BHLA 4XD2A 1SC6A 2WZQA 4GECA 5HTKA 4PS0A 3JY6A 4D81A 3FDXA 2IVZA 4ZAVA 3NBZC 1X80A 2IITA 1M8GA 1MG0A 1Q0HA 2ZUVA 3C3DA 4WD3A 2IXDA 3KT6A 1LV8A 2GEUA 1ZNXA 1BQEA 2ID9A 1G63A 3OFND 3OD1A 3Q0EA 3WLOA 5G40A 2RGDA 4BTEA 2R86A 1NHGA 3HFJA 4KVAA 3Q3GE 1Y4UA 3SQMA 1YO6A 1YCGA 1W88A 3O73A 1D3AA 4UNIA 3V33A 2AG1A 4HNAB 3OPVA 4KE6A 1MC4A 3ZDZB 4OF4A 4O4LA 3DQQA 3ED5A 2QMZA 3IDQA 3NFRA 4ROSA 4R40A 4GI3A 4EW1A 2VDUE 5COBA 3EVBA 2C9OA 3VO8A 3DKKA 2I7DA 2QUJA 3C24A 4HQ0A 1VHLA 2XVXA 3AJEA 2ZBDA 2QOEA 1QH1B 4FK8A 3BTVA 4JY7A 3EW9A 4RK6A 5BR4A 1IAVA 3JQAD 2QTLA 4IFTA 3PDJA 4ZANA 4Q9HA 5DCLA 4BZWA 1FS4A 1E2BA 4RL6A 1BKYA 2WF9A 4IIYA 2ZYVX 2I4OA 1S3FA 2VS1A 1QLHA 2OV3A 3G88A 4YUAA 4OHRA 3L07A 2IWRA 3VQTA 1BZYA 1FYWA 2YXBA 2CFSA 3RHTA 5CVTA 4GVXA 4MUAA 3U7FB 3EXIB 4JWTA 3ZE7A 4BX2A 2PUWA 4EMBA 1J9GA 4XGQA 5ALQA 3BCSA 3PNLA 1PWZA 4LXUA 5F12A 4UHHA 5FTNA 3C43A 4NBTA 5GM2A 1NQVA 3CG4A 3D4OA 1EX1A 3C2QA 3F3MA 1XDWA 4NMLA 1BGWA 3BGIA 3AGPA 3GFGA 5JNSA 1DKOA 2X9NA 1CE8B 4GMHA 3FPBA 4DLRA 3FNEA 5C80A 4ETNA 4KO3S 5KNDA 1DEXA 1KXJA 1U5CA 5KYWB 1KDPA 4KPYA 4YO8A 3HZRA 1RLIA 2ZSBA 4WOCA 2OSBA 4Y6RA 2REQA 3B13B 2ZOSA 5EXXA 5H68A 4YRQA 2D4AA 1SXPA 2G17A 4BKUA 3CFYA 4H77A 1V7QA 4A0HA 4JC4A 4EB3A 3WGGA 1CUEA 4CG0A 1DHRA 4MKRA 5SYNA 5AW2A 2IPOA 2Q5LA 4O5AA 4BVJA 5BVHB 5AR1A 1IG0A 1Z4OA 2AZXA 2HSWA 1XLTA 1EUZA 2YWRA 2ZB2A 1RM0A 3MTQA 4FT4A 3BL8A 1ZVMA 1NNI1 4OBBA 3WO1A 2FPUA 4L07A 4XX1A 3EXFA 4BNJA 4U00A 4YS6A 1DS6A 4N5MA 4U2CA 4QYXA 3QVKA 1IN4A 2PO7A 4LJ7A 1NTRA 1Z75A 2ZAOA 3TR6A 7ADHA 1GPNA 5KPDA 1CQJB 1H2HA 2XW6A 4R31A 1Q16A 3U9SA 4AWBA 3K05A 4AULA 3NZEA 2XA9A 4ZGWA 2B36A 3K09A 5ICGA 1NW5A 2JHFA 3H6KA 1Y9AA 2DY0A 5AVOA 4DA7A 5KSZA 3GVXA 2V3VA 1YS6A 5FTJA 3ZOZA 3ZJVA 3OZFA 1OV6A 1JDNA 3GEIA 4MEJA 3DNMA 1BD4A 2D4HA 3HRKA 3CMCO 2VK8A 4WZBB 3TPCA 3TRDA 1HTBA 1OXVA 3GY0A 4Z0PA 1Y1QA 3IB6A 2PNFA 1GGFA 2H4YA 3C3YA 1K68A 1HZJA 5SZJA 3TEMA 2PY6A 3IXMA 2DHDA 2DTDA 1H93A 1RPNA 1T3SA 1LW6E 2OORA 2P5YA 2PX6A 3SKVA 4XH9B 1NXWA 5EWLA 5IZCC 3CZPA 1ITZA 1JZSA 1P2VA 5EI5A 4F6CA 4GBJA 3CLRD 3F7TA 2O2DA 4YAJA 3QSGA 4Q93A 2XSZD 3U7QB 4KXLA 4CV1A 3TTSA 3VR4A 4YLYA 1EP9A 5I9IA 5IAAA 1GVNB 2QTGA 1GXSA 4G0XA 3TLXA 2AQHA 121PA 2RGBA 3NRJA 4Q3OA 3D8TA 4GQBA 3KHUA 1SA0A 1U4SA 1E1CB 3F7OA 3NASA 3R3JA 1VPTA 4MR7B 4AL4A 2GAIA 3RF6A 4TYQA 3E3AA 2ODEA 3PUXA 1QX4A 3QVVA 4BRUA 1HC7A 2J3HA 1GL9B 1PTJA 4BB5A 2M2IA 5FPHA 3ZDCA 1OBVA 4HMQA 3CIOA 2G9QA 3V46A 4YMTA 4Y9DA 4UEOA 3EAGA 4TZTA 3IQXA 2Y67A 2AQ8A 2HIGA 3LQKA 4MI1A 1SU7A 1XTBA 3GT3A 4WKGA 1RWKA 2QDKA 3A1FA 1ZCZA 3OTIA 3WLPA 3DMTA 1D0IA 3WLHA 3FF4A 1DTEA 4M60A 3PXEA 1PJ3A 4MVJF 1ZM9A 3C6KA 3D8HA 3BK2A 1J97A 1V48A 3LQ4A 4PNZA 3NHJA 4XZ3A 4NBNA 5ESXA 4YRGA 1LVGA 2B82A 1C7RA 4H1HA 5GGXA 4JI1B 3MWGA 5D5QA 4D9MA 1TJYA 4DYVA 4I50A 1BVRA 2P2YA 1FMFA 5ABPA 2ZE6A 2HEGA 5DI9A 3W6UA 5D87A 1F5NA 2ID8A 2YRXA 5BN4A 1BHQ1 2HXGA 2OZLA 1YU6A 2QJFA 1AF7A 4RKEA 1O77A 4DT1B 5C34B 621PA 2O4UX 2FW0A 1KU6A 1FRNA 3A2NA 1ZXBA 1MJ5A 2WVJA 2BGNA 2ZRAA 1D2EA 4Y2UA 1SIBE 3JTEA 4JOBA 1T9ZA 3CBGA 2ZAIA 4OI4A 5I9MA 1PJZA 3ABIA 1Z9BA 3DOIA 4JVOA 2IF0A 2W4MA 2KPOA 2IS1A 1KS2A 1Q5PA 1X77A 2P3QA 1R6AA 3K8QA 5AXAA 3PE4A 3VTAA 1MF7A 4IJ5A 4X92A 3RS8A 3WWPA 5AHXA 4WI1A 4NYIR 3TB4A 2ZGVA 4QOSA 4QELA 1TPYA 4I99A 1DC7A 1QIHA 2FPRA 1O94D 4QDUA 4C4TA 1XP8A 1EXVA 4DW8A 3SAJA 2COKA 3AIMA 4CLHA 1U11A 4HXYA 1YRLA 4I4TA 2YV3A 5AJYA 5LL6P 5EWMA 2XDWA 3BHMA 2OOSA 3PDIB 1IVYA 2H2GA 4BCDA 1H05A 1EU1A 1ZJZA 1ZC3A 4NS1A 2XXAA 5CPBA 3FNQA 1XR3A 3B3AA 4UULA 1P81A 2F2TA 5F9MA 3VR0A 1T5BA 4TTAA 4LI3X 2H2IA 3K9FC 1HR0B 3B6IA 1RZ3A 4H3HB 5LD2C 1RRGA 4I9HA 2AR0A 3N8IA 3G59A 2QLTA 3KLOA 1VE3A 4Y7DA 1N25A 4ME6A 1UJMA 3PSAA 2QNRA 3IEPA 2K6GA 4OH1A 2Q5CA 1PG2A 1UP4A 4XARA 1WAMA 3JASA 4DMRA 2NM0A 4BQPA 1ZEJA 4FYJA 4HFRA 2IZ1A 1QBKC 5AK4A 1J33A 1UBHS 4OJYA 4UPEA 3UJNA 4TTPA 4B6GA 5IT5A 2JLUA 1ZMBA 3BIWA 3OQJA 3GQVA 3PPYA 1NJ5A 1L3CA 1N1GA 1USVA 1Y5MA 2Q4OA 4QJ4A 4C6TB 2PJDA 3DBLB 4ZVRA 4B7ZA 3AM3A 4DXDA 4EH1A 5B7NA 1UPUA 1IONA 5DNWA 5FPQA 1YASA 5FWYB 5JS7A 3KQLA 3A3KA 2WVGA 3GRAA 3HB1A 4MWTA 1R0XA 3ON5A 4XX0A 3VPDA 4FHFA 1SUFA 1ONBA 3G7SA 1ZEMA 3O3MB 2IQ5A 1T15A 4K3UA 1C9KA 1V0JA 3A9WA 5A0TA 5AW5A 3TO5A 1OF1A 3MWJA 2ET6A 4RY0A 5BNIA 5IK2A 4BCBA 4IUYA 4QFDA 3E4CA 4UOZA 5B3KA 3KQUA 1KNQA 4PLGA 5DNDA 1C7FA 2VP0A 1YH3A 3VMFA 3HVIA 4ZGBA 4ALLA 5CR9A 3ZCRA 4DYHA 3MNFA 3IEUA 1YFJA 3CXUA 2QL7A 1BGVA 3FPJA 4FYMA 3COZA 5BQ3A 1RHKA 3L8HA 4MS1A 1IY1A 1NBHA 3UTCA 5LP1A 1GPDG 3NM5A 4TTJA 5DM1A 4S12A 2PQ0A 3INNA 2XB4A 4HYTA 4UCFA 5E1BA 4GX5A 4EPRA 1YZVA 5BQFA 4IIHA 1D2GA 1SOUA 2V98A 3EQ9A 4NF2A 4G4IA 1TLTA 1E1LA 1Z8FA 3IVXA 4NV0A 2NU6A 5A2GA 4A2QA 4BV3A 3OECA 5I9LA 2Z2XA 3REQB 2CMFA 1E0JA 2JJ8A 2CK3D 2R4UA 3JYNA 3V32A 5TJ9A 2OGTA 4EHLA 1QZ3A 3UUFA 4E13A 1MB0A 3PE6A 1W36C 1XEWX 3H1BA 3UJAA 5JC8A 1GLGA 2D7CA 4TUYB 3IP5A 4E5PA 2Y71A 3B9QA 3L0SA 1R0LA 1UBMS 3I8OA 1IN8A 4PFJA 1P74A 2I6UA 1TW3A 1JH9A 3VA7A 1X38A 1A82A 4JHLA 1EVJA 2Z6UA 3V1MA 4D4LA 3UXEA 1TOAA 1WB4A 3R9XA 2I7CA 1NVUQ 4QL3A 5A3RA 2MYTA 3VMMA 1RLJA 4JBGA 4KXWA 1ATIA 2V7BA 4MVJD 1U0BB 2QZ4A 1BJTA 1Y48E 1HDOA 3W6OA 4ZREA 2H65A 3EPLA 4QG7A 4GZ6A 3GWZA 3GLVA 1QFYA 3OX3A 2HQBA 4BO9A 2DUWA 3GCXA 4FN4A 2XUHA 4KWEA 3CKLA 2P6RA 4BVGA 3FUVA 1ZG3A 4OP3A 4XIIA 1CIJA 1F4VA 3H2JA 1XD9A 3FUCA 3IAM6 5HBGA 3K1JA 5E6RB 3U4DA 2XMRA 2ZI5A 4HVTA 1RHUA 3W3AA 2CNKA 4BNKA 1WPQA 4V24A 1XZJA 1Z8HA 2BI7A 1A9PA 2FAXA 2VEDA 3L93A 3TMAA 1IEVA 2NU9A 2I6FA 3H2GA 3SHQA 3GLGE 1MA0A 2DCUA 3M6MD 3GA7A 3K9CA 3QX3A 1QIIA 3N0VA 5BUSA 3B7WA 1C3XA 3OIGA 4H15A 4BVAA 3U9LA 3ZZMA 4QLBA 1K8QA 4RTPA 1CF2O 2XH8A 2C3MA 2ZT8A 1VI6A 3QV2A 4JR0A 4RQBA 2GKGA 3N8NA 4MRNA 4PLVA 5ES3A 4BLUA 1EM6A 4OHYA 4L2IB 2BMJA 1NYLA 2O2JA 3HKDB 3LNTA 4MS4B 1CT9A 3NOQA 3RCBA 1CUDA 2FEWB 4X7PA 2PVCA 1PT5A 2E37A 5BURA 1NVTA 4FI3C 2ZBRA 2VJPA 5HCNA 3OTOB 4RPHA 3Q6IA 4FXOA 4M1KA 1Y1SA 5ICMA 2WINI 1YZGA 5MFPA 1Z68A 1TAGA 2BP7B 3M3PA 3P94A 4IQ8A 4LZPA 5DFAA 2P4QA 5TPWB 4DVGA 2XBMA 3Q3HA 2WWFA 3ISVA 3PCXA 4HD8A 3UN1A 5KWSA 2AKAB 1GZSA 3FIUA 4BVLA 2IYXA 4DDVA 1A9XB 3JCZA 4RTQA 3NAZA 4N82A 2NU8A 1TCUA 4RV5A 3DSRA 3GZNA 2IYEA 1WZEA 4N5LA 3QFTA 5AVVA 1OWLA 2HU8A 2LTAA 3TAUA 2UYCA 2JKYA 3IULA 3CX6A 4MICA 4XVQA 1SRQA 2KLBA 2ATEA 2KB0A 1QHXA 1XRPA 1YQGA 1YQQA 2DR0A 2ZCUA 3IUNA 3B8HA 2V7XA 3WZ2A 1ULTA 4R9VA 2DBQA 2GHTA 4HZUA 5TQJA 3GARA 2GETA 3B3GA 5E4YA 2AFIA 4NG5A 1U90A 3F7NA 4LMRA 2G5PA 4M0DA 1Y80A 2J0VA 4RJKA 5KDDA 2CBGA 1AB5A 1XPJA 1SVKA 2D5CA 3IQZA 3NC1C 1V9LA 4HNHA 4YMSA 4JU9A 4P0PB 1I10A 3RC3A 1KRWA 2VUTA 3COVA 2C98A 5B4TA 1QNFA 4J0KA 2XOXA 1QS0B 1CUWA 1JYFA 1YJCA 2Q3MA 1RKUA 3EIUA 3TM5A 2WHPA 4R6WA 4RHTA 4DSZA 1R66A 4HTAA 3NQ41 5K7SA 2VDNB 1V39A 2YJ4A 1VA4A 2ZR0A 4TSKA 4D8WA 2VJCA 3DCNA 3NJ4A 2L2QA 1U3FA 3GXBA 4EJSA 2ACKA 2B0CA 3OPYA 3C97A 3ZKAA 3HVHA 4AG6A 4II2A 4Y9RA 3WIUA 4BECA 1AB6A 2JAXA 2AXQA 3C7KA 3L4EA 3PUVA 2F8TA 1DEKA 3DBRA 3NKLA 3TLEA 2RB5A 3O94A 3PHBE 5A4MS 1SZDA 3T9CA 2X8WA 1EYZA 4HRVA 4ZI7B 5M2QA 3MYRA 5KYKA 2VYND 3DDUA 2O9JA 4MP6A 4DABA 4W63A 3LXRA 4RVCA 1DBWA 4NCIA 5LLTA 4YR7A 2DPXA 1WDKA 1XUOA 3ESZA 1JZQA 4DVJA 3U3OA 5JJ5A 2IHYA 3AESB 3I37X 3I3OA 4IGEA 1W1IA 4F45A 1E1RD 2ZEJA 5M7EA 2CYCA 2W48A 1XMQB 3QWIA 4D96A 1DRVA 4D97A 1CLUA 4B3GA 3PV0A 3STVA 4I1PA 1Z5OA 1T3ZA 4OM7A 1HE5A 2P4UA 1YC2A 3BTUA 3T99A 1V8DA 4JAVC 1UFKA 3DMGA 4UTRA 1L4FA 4N18A 1QP7A 1THMA 1GUAA 1Z4PX 2NTYC 2J0QA 4II7A 3SN6A 1G3QA 3IO5A 2Q6VA 3Q4GA 2IUTA 2L0XA 4JX8A 1Z4JA 4R2KA 1ZCAA 2ZG6A 5IBPA 3OZEA 3EFOA 4N6OA 1QORA 5C0OE 4C0HA 1L8OA 2QW1A 2WHYA 3WRXC 5A0VA 2HO5A 2H8GA 4PZ9A 4X1OA 3RS7A 2CXQA 3EVCA 1XG5A 3QOFA 1V47A 1K6IA 5AW7A 5EPOA 1SNYA 4TV8A 3TBHA 2W6PA 3SDZA 3L7MA 4Q5IA 2EJBA 2AFHA 2AW5A 4I6JA 5F23A 2BGGA 4KITB 5FORA 4HH1A 2J45A 3ZK8A 1O03A 2QS9A 4MA0A 3KDSE 1L9KA 1GL3A 3QKSA 1B73A 2PCJA 4YC7A 1YIOA 3TNYA 2I65A 1WW8A 3L0CA 4L15A 3QPCA 4FQ8A 4M9SA 1RHRA 1E8NA 1KJ8A 5FA8A 1L0BA 3QFFA 4UNPA 1FTQA 5JRZA 1B00A 1UJ5A 4ZQIA 4EOGA 2G04A 4YTEA 2YIMA 4BO2A 4YP9A 1AUQA 3COJA 3NBFA 2WKQA 3LUBA 4MP8A 4X7BA 2OILA 2RG1A 4YV0A 1G5QA 1JXOA 2QPLA 3NWOA 3IYLW 1KOLA 3KZVA 1C80A 3BWEA 4Q4DA 3ROTA 5TF0A 1ZITA 1J70A 3GLHA 1V26A 3JZAA 1WHSB 1EA7A 5B1SA 1C50A 1PNRA 4XIYA 4R8RA 4CTOA 3RUPA 4BJHB 4D5EA 1BH6A 3R44A 5L4LA 1QMGA 3P0HA 3DDCA 4WKOA 3PDCA 4FB4A 1PNOA 2HBRA 1E1KA 4EHNA 4AKGA 5CX1A 1QWOA 4PG7A 3RC2A 1C3OA 2IK8A 2H5JA 3DOEA 1RBMA 5IP5A 1JAIA 1X7HA 4CRWB 3LX8A 2QJOA 1PFVA 1GG5A 1NYQA 1TVKA 3LYHA 2DKFA 4DARA 3WWYA 1N5LA 3UVEA 5KZMB 3WZLA 1TYAE 4N3NA 4R2WA 4PLFA 1GHTA 1KAOA 2J0UA 4EQZA 1C5KA 3E9ZA 1UZNA 1TJPB 2BGMA 3KSDO 3KJFA 3PHLA 4MGZR 4YWHA 5BNTA 1WXFA 5HKBA 1FDWA 3PIIA 4M53A 2JGJA 4MXDA 3ME5A 4JP1A 2IXEA 1XCMA 1OZGA 1EFUA 2Y4NA 3F96A 1Z0KA 3ITNA 4QTZA 4D99A 3LDUA 4QVIA 1LJUA 3MOGA 3QX7A 1XZBA 3A4NA 1VMDA 2AG6A 3HCEA 1LH0A 4FFNA 4QDOA 4Q05A 5AHOA 4L8WB 3RJTA 4CR8A 1P2FA 4M0MA 1P0PA 1ZJ4A 3QHQA 1YQDA 3MAAC 1W85B 1ST3A 3UC5A 5BUCA 4R0NA 4ZCLA 5U9CA 3DTNA 5HMLA 3EIOA 1F51E 2R1TB 3CRVA 1E3SA 4P4UA 2H59A 3K73O 3ZVRA 3GFRA 4MUXA 4ML3A 5C1OA 1HK7A 3BSYA 2YJ6A 5IKOA 2ZVQX 1OI4A 1V1JA 2FQ1A 4U9IS 2G5TA 3HFSA 2UZAA 3A2MA 3VFDA 1ZIYA 4LHYA 4CIBA 3WIVA 3KX2A 1O95D 2ZWMA 1S8FA 1FYDA 3OPMA 4RH3A 1JBQA 2V8BA 5DHFA 1UL1X 1YL7A 2O1SA 4MP3A 4IIFA 1WUIS 4CPDA 4E2ZA 3CRW1 1Z3IX 5I7RA 1YHNA 4RQTA 1CRZA 1IEWA 1JHUA 1YSCA 2Z5FA 3W77A 2B6NA 4DHWA 2RE8A 1XPRA 1OXBB 1IBCA 2PR2A 2H48A 3JU3A 1XTQA 2G70A 3IHTA 4HQ6A 1PI3A 3GRVA 4H2DA 2OFWA 4ZDWA 5E8RA 1B8PA 3EBPA 3OO1A 4ZARA 1RYYA 3JALB 2FSGA 3PQ3A 1R27A 2J7PA 1JILA 1A8PA 2P6PA 1L5ZA 1T8PA 3IBCA 1IBMB 2ZYWX 1UXIA 1YZYA 1R9JA 3UY4A 3ZHUA 3WSTA 2BEWB 4PO1A 2QR2A 4TL6A 4YJGA 2G9NA 2G8LA 821PA 1CJKC 3LQQA 1G3RA 4OG2A 1UT5A 2WNSA 4YUVA 4ZHQB 3T9FA 1RRKA 2PGLA 3G2LA 2GD2A 2EYQA 3PPIA 3ZWAA 3L7DA 1NAHA 4V3CA 2NTVA 5HE8A 3CPSA 1Y8QB 4HWGA 5I6DA 3QUBA 1XEXA 5AMXA 2BIFA 4XYLA 4ZMRA 1D07A 1KIAA 4YLGA 4WNAA 5B37A 3EC2A 3FW1A 3LJKA 2RGRA 1GGEA 4PXYA 3ULKA 4Q39A 1J22A 3LBHA 4YJKA 4DREA 1B42A 3GX1A 4EUFA 3ROZA 1OH8A 4YCSA 2IHZA 4WQMA 1R4NB 5C53B 4Y1RB 3CR3C 1NF9A 1XZHA 1SC1A 4ERNA 2NADA 2YW9A 3ELWA 1WPGA 2Q9UA 1HZZC 4AKIA 2PFKA 2X0IA 1YV9A 1DIAA 3I9OA 1J6UA 2ZBEA 1XQXA 1OA1A 1UIRA 2G6BA 2E4VA 4P81A 3HWRA 5HVNA 2C7QA 2DQZA 3RYFA 4I6GA 4KO1S 3S40A 1Z83A 1MQ8B 4IOLA 1DAPA 3KYCA 2AF4C 4L57A 4R54A 2NAPA 1NUPA 2JH8A 3B7PA 1HA3A 2YIDA 4HWKA 4PO8A 1MOQA 3VGJA 4J0IA 4CL0A 5KYTA 1NVBA 5CB4A 3D43A 4J3JA 4MV9A 3LHSA 2QN8A 3A2LA 1DEAA 1Q77A 3LQYA 3LIPA 1GPBA 4GX1A 4ND1A 4TT3A 4V39A 5JQGB 2HCFA 4FE4A 2RHHA 3ZYZA 4WKNA 2SKDA 1G55A 5HQ3A 2YV2A 3O1HB 4G0WA 1QE0A 2D2XA 3WGNA 2KX7A 1AA6A 5BT8A 4J0FA 5JJKA 3INGA 4C07A 5GAJA 3SWWA 3W8NA 3QMPA 1J5PA 3C74A 4A0SA 1JU4A 3E53A 1W52X 5CBPB 2F17A 2E1PA 1GA4A 2RG7A 3IQFA 3R3VA 5JAOA 1XEAA 1D6SA 1ESDA 3OJLA 1A4IA 3JQBC 4QDTA 1Q44A 3EDRA 4RPGA 4E1AA 3WL8A 5AJUA 4LV8B 1DKNA 2FZLA 2AUMA 2SECE 4HDKA 4B81A 1FFEA 5DP1A 1KZ4A 1X3SA 2F3TA 2IXFA 2W83A 3OC0A 2WWHA 3ZX4A 5L3SB 4LWQA 4C7MA 3HY6A 4DXHA 3IVGA 4XR4A 3L01A 4I1OA 1H2FA 2B78A 1ZD4A 3CW2A 2P8JA 3EEIA 4YCLA 4WOBA 2FOIA 4JUDX 3NTLA 2YH2A 4L3WA 2NZXA 4Q6WA 3TDMA 4X41A 2VP6A 5LQRA 3UG7A 1P80A 5CLLA 2R8PA 2WP8J 3UT5B 1N32B 1ND5A 3D3WB 5F1YA 1L4BA 4NBRA 4WOKA 1QHIA 3PE3A 4KHZA 2C7PA 3IP7A 4Q03A 3K2EA 3JWGA 3BQMB 3X2SA 2XD9A 2FI1A 2FKAA 1R6XA 1R4AA 1GUDA 3ASUA 4LY6A 4E14A 5A03A 5AIBA 4KGXA 1VSVA 3KAPA 4ON9A 3KEQA 4MINA 1B41A 3VO9A 1IEQA 4MVJH 4OAPA 2OM2A 1QVAA 1AMOA 3DR3A 1NW8A 4TMXA 1KTVA 4AM8A 3VPAA 3DGFC 3LPMA 3I2FA 1F8GA 5FUXA 2O8DA 2QMOA 1RLMA 5HW0A 2WABA 3W4JA 1A7UA 2X8LA 3X1XA 2WLTA 4YEDA 1NT4A 5BR7A 3ABSB 3VGPA 4N5NA 2PWBA 1Z6XA 4S1VA 4X90A 1GO2A 2XHZA 1PUXA 3AUAA 1KZ7B 1NZDA 1XN4A 1QIMA 3OQVA 3KQOA 4LY9A 4W7HA 2V6FA 4MCAA 3RG8A 5CXQA 1N6PA 1M34A 2E87A 2PJZA 3N87A 3TLYA 2PGOA 2WSLA 4OB8A 3ELBA 5KQMA 1U02A 5ITZA 4IDQA 3UOGA 4NJEA 4U2KA 3TI9A 5JCJA 4ND4A 4MJXA 1IVSA 1VJTA 2FMKA 3HNRA 4FSDA 3T7KA 1EP3B 2RH9B 3DVAB 3SFZA 1C1HA 2JFNA 4BLRA 2H0AA 2G4CA 2EGHA 2E48A 4FDUA 2QVCA 4ARSA 5GV8A 2WA1A 3ZE6A 2IS4A 3SMQA 4YLEA 3A1TA 5KKCA 4GP6A 3U19A 2GAFA 4O3MA 3WRYC 2WKRA 1RP7A 1V1RB 2I99A 5FHRA 2HNKA 1G20B 2XDAA 1N6RA 4KDRA 2RB4A 4LXTA 3DTVA 3KOMA 3M5CA 4UHFA 4YAWA 2YBEA 3EPHA 4X1YB 1GZUA 3FYDA 1GCUA 1TEVA 2WSMA 1JZTA 2IX9A 3I5AA 3OKFA 1IXKA 4GOND 3L1HA 3FAKA 3UZUA 3CNNA 1T5DX 5K05A 1W4ZA 1G19A 3ABZA 1E2NA 4UHEA 4BZPA 1E7SA 4FEYA 4FHCA 4DJ5X 3FDIA 4Z8XA 2AC2A 1FYVA 2GN8A 2NVWA 3LGXA 3OJEA 3Q7EA 3ZN2A 5ETJA 1I36A 5FT9A 1O89A 3ROXA 1OR8A 2P3OA 1PJLA 3EG9A 3RUCA 1JSCA 2ZLBA 1N33B 3L40A 2I22A 3P19A 1A77A 4CV2A 3ZWQA 5F3DA 1KA9H 5DX1A 5L4NA 3B2EA 3KZNA 3RSCA 3UHAA 1SD2A 1E77A 2A92A 1I2MA 4P7FA 1A96A 2YQ4A 2ETVA 3K96A 3U60B 4R6XA 4G0VA 4C0KA 5CM9C 1WD5A 1XXHE 4TVOA 1C1XB 2GPNA 4LK2A 4CIVA 2DTEA 3MEQA 3MJCA 3KL4A 2MSNA 1LNZA 2VDQB 4K6GA 4DIOA 4ZP1A 1USWA 4JJ7A 1O57A 2ODQA 5IKEA 3AIOA 1O5TA 3N2EA 4O4LF 2W0SA 4DDHA 5BXYA 1A5AB 1WXQA 3D6UA 1P4JA 3OJXA 1KFKB 4N48A 2K5UA 3T7IA 3P9NA 5TARA 3KEFA 4BVHA 4XYGA 1GARA 4U7DA 4ANFA 2W00A 3ILHA 1UKVY 4JP5A 3BXZA 1J4AA 1I8TA 4M37A 4B2PA 4IXTA 3CUSA 4UBIA 1H5QA 4HMOA 5BSUA 3MGKA 3W8EA 1HGXA 1LCIA 2VJMB 1MFPA 3K0BA 4HATA 3I04A 4MCJA 3D3EA 2LZ0A 3TFWA 4GX0A 1RM4A 1ZM4A 3DDSA 1ENYA 4CM9D 4ZT2A 4P4LA 2C4MA 4N1AA 3W5AA 5JFGA 4GMFA 2H7VA 4ESEA 4DR4B 1D4ZA 1G5RA 2IC5A 3MBKA 4J9VA 3WLFA 5BXQC 4WNIA 2BOVA 1Z0UA 2JJ1A 2BKEA 4OGKA 2QL9A 5CX4A 3I32A 2I2CA 3BREA 3W6PA 4MULA 2UU9B 3RROA 1QV6A 3PG5A 4DJAA 3LL4A 1IE3A 1T2VA 4ZOLF 5J1TB 5F9HA 2G6TA 4EYGA 3WFJA 1F8XA 3B9RA 3FZQA 4Z8YA 4WJLA 3RW9A 1XDGA 2HPAA 2ZRIA 4WKPA 4TXLA 2J9ZB 4NNJA 4AX4A 4D4HA 4GD3Q 4S1PA 4KR7A 5LP6B 1U8CB 4PN7A 3UMCA 4ECEA 4BXOA 4B0OA 1E3QA 4LRQA 5E9AA 3WXBA 2PZBA 2Z57A 4RVDA 4EUHA 4WLEA 4DNQA 5JHHB 2PV7A 5FWXB 3AHJA 2XE7A 3MA0A 2ECKA 1X14A 1IZ9A 1V7PC 2JK1A 2V0CA 3N2NA 4YP5A 1NRXA 2AN5A 4G9EA 5JROA 1W2HA 2VDWB 4HDOB 5C5EA 3S27A 1CSEE 3WGYA 1QCDA 4H31A 4TYWA 2GYWA 1DINA 3PF8A 4W6ZA 2HPZA 2I3BA 5E2BA 2WUGA 3AEZA 2JCYA 3OE7D 5EHGA 3CIFA 2Q8NA 1G8GA 3A6KA 4C4AA 5IJ9A 1OFGA 1P7ZA 5MN4A 2BHSA 5AP9A 1N6LA 4G1UC 2GFQA 4UQLA 3ECAA 4L8FA 4KWIA 2POQX 5IJXA 1D2NA 2LPMA 4QVKA 3FYUC 1H94A 2B98A 4KIGA 4MS3A 4RDXA 5DYTA 1B76A 3FLBA 2GHRA 5DXAA 1QTIA 1RDFA 4C87A 1C7EA 3D0QA 1H5NA 4BC1A 1XZEA 2RHWA 1PBNA 2ZSAA 3QW4B 2CBXA 2VSOA 5F4ZA 2Q3CA 1HOTA 3LFHA 3M8KA 3QTLA 5EMKA 5IH7A 3EUFA 1QIGA 4JP8A 2I3ZA 4JDUA 3NRCA 3UQZA 5BYAA 4QFBA 3MUEA 3TNFA 3QU4A 2OCAA 1FLVA 5FI3A 1J8MF 3G8BA 1SD5A 3LZ6A 1PK8A 1MQAA 4JCOA 2PZFA 1WR8A 2ZI4A 1AO3A 1WV1A 4I14A 3UGKA 4Q24A 1I4WA 5FUVA 3ADDA 3O8OA 4ZCQA 4KWTA 1E3DA 3VR2A 4RVHA 3EZYA 2NO1A 2ZAMA 3MTJA 2Q0HA 1GDHA 3WYBA 1U1EA 1UM9A 1AC5A 1M2JA 3E27A 3W2TA 1JEDA 3OU7A 1N57A 2NVUA 2LVBA 3PNMA 2CL5A 4K1LA 3NBYC 3CCCA 1P0CA 4YMIA 2VXOA 3SR0A 3FFBA 2PTGA 2HQRA 3P2OA 4EHDA 2H4XA 2O0LA 1ZJYA 3DZHA 3ST7A 2WJ6A 4NJMB 3I92A 3SJBA 3T3IA 3DE6X 4AUKA 4D92A 4C2AA 4HAWA 3NVMB 4WCFC 5HRAA 5KSYA 4RESA 1JWLA 4CKCB 5JS6A 3OT1B 2JDID 4I4LA 4WKCA 1KXZA 2QPOA 1OJLA 3WWEA 1A4RA 2OV2A 4BNFA 1P7VA 1WWKA 3RTBA 2I9KA 1KWKA 5JJIA 2C2XA 1WUKS 1MJFA 2ZJ0A 1PZGA 2VTBA 1EPUA 1DMSA 4K9KA 4F46A 1U3UA 1XVVA 3P9ZA 4K9SA 2QIPA 1RLOA 1D1TA 1ZNWA 4Y1EA 4CMEA 2VJDA 4CU5A 3FGZA 1FDIA 3HJHA 4AZTA 5DGDA 2X1MA 1OFVA 3WBKA 3EVGA 5B30A 2IF2A 4KI7A 2OK7A 2C9ZA 4LQLA 4ZYTA 3PICA 4G5HA 4UNNA 4D57A 4ZPXA 3GWGA 1S5PA 4G0NA 5JD4A 5EJIA 2DOKA 4TLMB 4KSYA 3UK0A 3E1SA 3L02A 2C9MA 1RWBA 1B26A 1QVWA 3WAKA 3OC6A 5HZGA 3MOSA 4WZAE 3GGJA 3VKHA 2D7JA 2HA6A 4NU6A 4I50F 5FL3A 1L7DA 3HRIA 1A88A 2PRKA 1YCDA 4KYIB 4DLTA 3KQVA 3QWAA 3C7AA 4BCCA 3ZDBA 2O06A 5LUBA 3SLKA 3TE7A 1CTQA 1C9NA 1QIEA 2YV4A 1XZQA 1GGJA 1JBEA 3NHUA 4EKIA 1ZUNB 1RW4A 1QIKA 2YWFA 4ZT6A 3S6JA 1JLMA 1ISMA 1PS8A 2O1EA 3HNPA 5EUCA 4Z51A 1K92A 4PIMA 3HVUA 4HXEB 1FW8A 1I4TD 2IKQA 3FPKA 3T7AA 4YYZA 1E7YA 1ES9A 1PP4A 2GSDA 2FN9A 2EW8A 2ZYTX 4WASA 1P1CA 4BO8A 3V4SA 4UU8A 4TMVA 4RVOA 5CUQA 1QKKA 2X8AA 3RTAA 3KPVA 4N01A 1SC9A 4AD8A 1U4NA 3S2IA 1EGHA 3SJ7A 3KOOA 1PSDA 1TT5A 2ZE5A 3BXGA 3GCGA 4H6PA 4I4TF 3R7WA 1J8VA 3HDJA 4LJKA 2ZYGA 1DUIA 2DH6A 4Q7MB 2HQ1A 1YOBA 2C0PA 2ZJ1A 3M1YA 1GUBA 3A9RA 2OXCA 1J0BA 1NA5A 5BRAA 2FK7A 4A2PA 1WO8A 2QTNA 1K7XB 1LGYA 1KZYC 1KJJA 3VO2A 1TTQB 3BILA 3FIJA 4BYMA 5IBRA 4JQSA 4G84A 4ZYVA 3TXXA 1ZY2A 2APJA 1P1RA 3TTUA 2CFTA 1L4EA 3DCJA 3NFYA 5FPPA 5FJJA 4C6SA 1E7RA 1VPDA 4Q3BA 5DN6A 4AVYA 1MMFB 5F1OA 5LOVA 4FHEA 4AJJA 1CHNA 1KH3A 5JDIC 4BQFA 4M99A 4P54A 2NACA 1VYHA 2YHIB 3ANYB 4RK5A 4M8KA 3JAWA 3VZBA 1KO7A 3G5AA 2AMLA 2ACVA 1N2CB 3R0QA 1ZJJA 1D1QA 1JECA 2R65A 1K7YA 1ND6A 3C6ZA 3K0FB 1ZL0A 1X1QA 2AEJA 3CCBA 4FILA 2KS6A 3GJZA 5IJZA 3BE4A 4L8VA 3S4YA 2PJRA 3N8HA 3FX2A 1BN6A 4B6PA 2W4IA 2JIDA 4CMIA 1J1IA 4AYWA 2HM7A 4XYEA 2F8SA 2QG6A 1PQUA 3BMXA 5ERXA 1TZ2A 1ZMOA 2ENWA 3I6IA 4BO4A 5A6SA 1CS0A 1DQNA 1KFBB 3BH0A 3D6HA 4IMRA 4CGYA 5G0TA 2I62A 1KEVA 1SQSA 3K4QA 3TMYA 1QTRA 3NDBB 4CETA 5F7JA 2WM3A 5IDVA 2OSVA 1UQTA 4PWYA 4WH0A 2XVAA 4KH0A 2RGGA 4E0BA 2C4WA 4PYIA 4PY2A 2A5LA 3GAZA 5EJ4A 1FFHA 1UDAA 1RXVA 1QRTA 1SKUA 1YQUA 2F3RA 1VP3A 3MGCA 3QTTA 4OQXA 4XUDA 2ZBGA 3T1OA 5BOSB 2HR1A 3FYHA 1UBOS