4XJTA

Human cd38 complexed with inhibitor 2 [4-[(2,6-dimethylbenzyl)amino]-2-methylquinoline-8-carboxamide]
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
241
Chain Sequence
WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Discovery of 4-Amino-8-quinoline Carboxamides as Novel, Submicromolar Inhibitors of NAD-Hydrolyzing Enzyme CD38.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, transferase
total genus 79
structure length 241
sequence length 245
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4xjtA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xjtA02
2GN6A 1XYGA 1ZH8A 1EVJA 2BH9A 2PV7A 3DBHB 5I7SA 2WE8A 2D5AA 1QSGA 1WMAA 3VPSA 1DIHA 4BO9A 3EMKA 4H7PA 2BFOA 3E03A 1PIWA 1MXFA 1EE9A 1M75A 3KHUA 1N5DA 2X22A 3U9LA 2G0TA 2P91A 2W2LD 3AY6A 3EC7A 4IQ8A 3VC7A 2X1HA 1N7GA 5ADHA 4JBIA 4K1LA 4R3WA 1YDWA 2B69A 2WSBA 2FZEA 3I9OA 2DBRA 3HB5X 2GF2A 2Q4EA 1B26A 2HK7A 3F4LA 5ITVA 1F14A 2J8ZA 3C8MA 5JXWA 4WJZA 5A5FA 3WQQA 2GRAA 1UXIA 4UEKA 4KMSA 3GVPA 3HADA 5DN9A 3BMNA 4GMGA 2EKPA 3AM3A 4EZBA 3AY7A 3EK2A 3RAJA 2YV3A 1Q7BA 5B37A 1EK5A 3E9QA 5C37A 2FHSA 4NIMA 2ZATA 4FOOA 3FTNA 3JQAA 3U09A 2IZZA 5TC4A 3DXFA 4JXKA 1V0JA 5BNIA 3D0OA 2GZ1A 3TZCA 3VKUA 1PU2A 1H6CA 4HX5A 3NGLA 2R2GA 2ZQYA 4HBGA 3TZQA 1D1SA 5I7EA 1PGOA 3MJSA 1E3IA 3DBRA 3IKTA 2B37A 1QR6A 2NLOA 2NVBA 5EQDA 4TRJA 4D7AA 4Z9YA 5F1OA 1E3JA 2WMDA 4G65A 4NG5A 5L95A 2Y68A 2PFGA 1ZUD1 3KXDA 1MC4A 3A28A 5B1YA 2RH4A 5I7FA 2YQ5A 1V6AA 2VZ0A 5F3RA 4BMVA 2BI7A 4DTIA 4WCFA 1G1AA 3OICA 4E5MA 5CDUA 3WGQA 2C07A 4RVUA 5IXYA 3WQRA 4JCOA 1B15A 5HTOA 4ZQFA 4LMPA 5EIOA 1LLQA 4XR9A 3L9XA 3NDRA 2VT3A 3EZLA 3R1IA 4YT5A 3B20A 4MPDA 4CODB 5LCXA 3G0OA 4BMSA 1HSZA 1ZJZA 3ZWMA 3W4IA 5FFFA 3WWZA 3AUAA 3V1YA 3QVTA 4NDNE 1A71A 3H9GA 4QECA 1XQ1A 1QLJA 3UH1A 3TZ6A 1LSJA 4BQPA 1GEGA 4BNGA 4CPDA 4WK6A 1R0SA 1XU9A 2GN8A 2OUIA 1J49A 1LTHR 5TJHA 5IJZA 3G1TA 4J43A 3DMTA 4JP3A 5TGDA 5IDQA 2Y1EA 4ZGWA 3PHJA 2AEMA 4NJMA 4J2OA 1T26A 1CYDA 2IZ0A 3H4VA 3LSYA 3FF4A 4UUMA 3QP9A 3FWZA 5ES3A 1EMDA 5KIAA 4XWYA 4OOEA 2JHFA 1PQUA 1YWGO 1PJQA 1UP7A 3F5QA 3Q2KA 4NFHA 3KEOA 3F1KA 3UN1A 2X7HA 3ON5A 1KETA 5CHEA 3TDKA 1D1TA 5LDHA 1M66A 3JQAD 1XDWA 5B4VA 4QQRA 3AY3A 4WE3A 1A7AA 3AOGA 4BKPA 4ZA2A 2RIRA 1M6WA 4YVFA 3K30A 2BMAA 2Q3EA 4L4XA 4DBVO 4J1SA 4R69A 1F8GA 1O94A 5GZ6A 1DC6A 3EAGA 3I5MA 4DC0A 2DT5A 4RPKA 2POQX 4DMMA 4U5QA 2I65A 2I66A 1L7DA 3CXRA 4W9NA 3VPGA 1H6BA 2NV6A 4R4JA 2QYSA 2EKLA 1UR5A 3QVSA 3ZNQA 4J9UE 3SX2A 1N9GB 3NT4A 4GQAA 3PDUA 5TIIA 4JQCA 2Y93A 4BKUA 3TN7A 1X13A 2PZJA 5JDCC 4DPKA 3ZWXA 2Q49A 1R0KA 3GGGA 3W8EA 5BR7A 5CG2A 4CLOA 4LGVA 4YQZA 3F47A 1KBZA 3INTA 1BW9A 4MKXA 5TJ9A 3WFIA 4DQVA 1QORA 3D5QA 2PD4A 4AICA 4MVJG 3ITDA 3GZNA 4Z0HO 5JCJA 1R4MA 4XQGA 5JMPA 3UOGA 5ICMA 3R3JA 1JLLA 4QTZA 3I4CA 4CMKA 1SB8A 1V9LA 1RM4A 1C1XA 4E2ZA 2EW8A 4OJNA 3WB9A 1DRUA 3AU9A 4QFDA 1PWXA 8ADHA 1OI7A 1NASA 2Z95A 1YS4A 4B3JA 2PK3A 1Y5RA 3VHRA 1Q7GA 1LDMA 4HNHA 4II3A 3L07A 1OOEA 2HRBA 1ID1A 4RCVA 1AXGA 4GSLA 3H2SA 3JQGB 2WYVA 1I3LA 4XQ9A 2VWHA 1ADGA 2WD7B 4LCJA 4XQCA 1HZZA 3QIVA 1D7OA 1O95A 4YAIA 3IAHA 2D1YA 5BNFA 1P1IA 3PLRA 3OQ1A 4QO7A 4R3NA 3RUIA 3PXXA 3QV1A 5FF9A 3BHMA 3LVFO 3O38A 1HDRA 3P7MA 2Y1DA 4ALNA 4E0BA 2X0JA 1AXEA 4BNXA 1B14A 4AJNA 4I9UA 3ONFA 3RUAA 1P1KA 4JP2A 1QKIA 4J0EA 2XOXA 1B3RA 3D1LA 4WNIA 4J4HA 3VKVA 4IIVA 3KETA 3V2GA 4ALJA 3DONA 4F46A 1O8CA 1BXGB 4ITUA 2OFPA 3CH6A 3UKOA 4OM8A 1T2EA 2V6FA 5AOVA 4BNUA 3WG9A 2YHIA 1X1EA 4L8VA 4YWJA 2DBZA 2C82A 4YJFA 1HF3A 1GYQA 2NWQA 3M1AA 4FJ1A 1R66A 4BGVA 5JAIA 1K6XA 4YR9A 2HAEA 2FSVA 1M67A 1XQ6A 2CDCA 1Y1PA 4BS9A 4NFSA 1PX0A 2O4UX 5MDHA 3B70A 5JFOA 4RVSA 3F1LA 1PQPA 1WPQA 3Q1LA 1C0KA 4I08A 1HLDA 1JVSA 3LF1A 3RBXA 4HFRA 3QSGA 2B5VA 3WTCA 5L53A 1HEUA 1VKNA 2DBVO 1I32A 1NAIA 4FFOA 4YRDA 2GYYA 1NP3A 3BMQB 2X5OA 3D3EA 4Z0PA 4PFJA 3VZQA 1N1EA 3PK0A 4J7XA 4WLVA 1TEHA 1Q0QA 2I99A 3H6KA 2PGJA 3OJEA 1CRWG 1QV7A 1WZEA 5T64A 4IPTA 4Z9XA 3ROKA 3UF0A 3WGHA 3G3EA 5G2OA 1EK6A 2Z5LA 3KBOA 1W4ZA 1KY4A 3EGOA 3O8QA 1WAMA 1VJTA 2EF1A 2W2KA 4U7WA 4RZHA 4CLRB 3ZZNA 3NX4A 5KJFA 2X0NA 3IC5A 3LT1A 3DZGA 5T8KC 1XWFA 4CM6A 4R68A 2HLPA 2GZ3A 2VHWA 1S7CA 1BG6A 1QLHA 2Y1OA 3NAQA 3K6JA 2C2XA 1ZXLA 4TROA 1B16A 3GUYA 3C7CB 1X7HA 3GLQA 1GADO 3GC6A 5JAMA 1JQBA 1MFZA 1HSOA 1IZ0A 1R4NB 3DMTC 3WJ7A 5KWEA 1W73A 1N7HA 2P9EA 3IOYA 1MFPA 4DBZA 3S8MA 1QP8A 3IUSA 4BKOA 5CEJA 1W0CA 2DU8A 1QYCA 1MXHA 2AQIA 2HUNA 2NU6A 2SCUA 1G0OA 3IJRA 1UZLA 3ZNNA 2YZ7A 4R1SA 4TKMA 4BO8A 5L51A 3C7AA 5DBFA 3PQDA 4WLUA 3V2UA 3OSUA 1R15A 3HHPA 4YJGB 1UXGA 3P19A 3RWBA 4E3ZA 4OXKA 4PLFA 1PGJA 3DWFA 2AQ8A 1T24A 1C14A 4MVJM 1DLIA 4KQXA 3FBGA 5DDIP 3UCEA 3C24A 4LVUA 2HQ1A 4WASA 2OOSA 1HRDA 4RVGA 3RUFA 2O7QA 1TI7A 4INAA 5BSFA 4A5OA 4KDEA 4CQLB 3AOEA 1QMGA 1MG5A 3S2FA 3WX0A 4BNIA 2PD6A 4R1UA 2HMSA 1H0KA 3VTZA 1E3LA 3FNFA 2ZYDA 1C0PA 3CZMA 3BMCB 3GEGA 1GQYA 5JMWA 1DFGA 4WKGA 2DLDA 3JYQA 1GEEA 1ZZEA 2BFAA 2C59A 4TKLA 1Z73A 1B8PA 4G81A 2VQ3A 1DBVO 2IRWA 4WECA 3D5TA 4RF5A 2PKQO 4DIFA 2YDYA 1N8KA 2GPTA 4PLCA 4L75A 4OL9A 1GDHA 3ROQA 1TLTA 3GNSA 3VZPA 4YT4A 4B4OA 1RKXA 5H83A 3W8DA 2FY8A 4W7IA 2O2YA 3WNVA 1E3WA 2GZ2A 1I5RA 1NX6A 2D4AA 3U4IA 4KOAA 3I4FA 4CM8B 5AXCA 2NU7A 1P77A 3PZBA 4NK5A 1T2DA 4WLOA 1ZBQA 1Z7BA 4GX1A 5KTKA 5CEEA 2QRLA 1Y5MA 4XYLA 4F45A 4MVJI 3GAFA 2J5KA 4O0LA 1KVTA 1E0DA 5T5QA 2ZIZA 3LC1O 3DC2A 1PL8A 1UDAA 5ICSA 3DQPA 3PHGA 1AHHA 1Y8RB 2TMGA 4MO2A 4PG7A 1K2WA 1IYZA 4NMHA 2HMUA 4E30A 5F1KA 2GASA 4MIEA 4A26A 2R00C 5JPIA 4EJ0A 3ADPA 4JIGA 4GX0A 4NQZA 5DF1A 4CUKA 3QRWA 4BNHA 5HRUA 1HKUA 2AE1A 3E18A 1NQTA 1E1MA 5JE8A 1V8BA 2PZKA 5LDGA 1K6JA 1PGPA 3G79A 4I8XA 3JQ7B 2BFMA 1AN9A 3PGJA 5AXDA 2OGUA 4OH1A 1NNUA 3GNQA 4FW8A 3BTOA 1TVEA 4JLWA 1CJCA 1NFQA 2QZZA 4BO3A 1W6UA 1LXCA 2UV8A 1DAPA 5U1PA 2Q1TA 5HS6A 2CVQA 4K6FA 1OMOA 4Y67A 2Q2WA 3ANLA 3S55A 4CM3A 1X7GA 1BDBA 1U3UA 1DEHA 1NVMB 3OQBA 5COBA 1G0NA 1ISHA 1DHRA 5G0UA 3UVEA 3B1KA 3GT0A 1B3BA 3QWFA 3KSDO 4CMIB 1P1FA 3B6ZA 2LDBA 3FN4A 5L7WA 4CV2A 5KKAA 3TRIA 3RU9A 1WWKA 5A05A 1YGYA 4IZHA 2GSDA 3KM0A 2AQHA 2UAGA 1S6YA 3FNEA 3O4RA 4NBTA 3WSWA 4CM7A 5CG1A 2EP5A 3MJVA 1IHYA 4EGFA 2YUTA 4BO0A 2I9PA 1YO6A 4NH4A 3NKLA 4LMRA 1ZIDA 2O3TA 4RVDA 2DUUA 3LK7A 1ENPA 3PZRA 1H5QA 3RROA 4KWIA 3SLGA 3HDYA 3OIFA 4Q3AA 3DHEA 4Q3NA 5KVSA 1KS9A 3K8ZA 1PZHA 3DBVO 1LNQA 4Q3DA 4BNTA 2ZYAA 3VDQA 1K6IA 5DBGA 1Q0HA 1PEDA 4XKJA 4BNZA 5IDXA 1EBFA 4DLAA 4J16A 1CERA 3PJFA 3U0BA 3RU7A 3TFQA 5IAAA 3IUPA 1DIAA 2BGKA 3O26A 3PVZA 4UAGA 3V1UA 2RAFA 4D46A 4FN4A 4D44A 1UAYA 2JCXA 3RFVA 4IDCA 1NWHA 4RDIA 1E7YA 3DBHA 5THKA 1E7SA 1Y8QB 3ETGA 3FHLA 1VE9A 4Q3BA 3VH3A 4D3FA 1IY8A 3VPXA 4Y6RA 1P0FA 3OBBA 1ZK2A 4RPJA 3GFGA 4XR4A 4GI2A 4A7PA 3NJ8A 5JW6A 4K26A 2ZB4A 1UAGA 2B0JA 2P5YA 4EYEA 1ZSNA 1ZMOA 1YQDA 4MKZA 1LI4A 3A9WA 3ZV5A 5K0ZA 1BWSA 1GAEO 2O23A 3PWSA 3DEYX 5IZ4A 3PQFA 1SBYA 5KVCA 1HDZA 1QYXA 2I3AA 3GNTA 2F00A 3JCZA 1H94A 4PLZA 1Y81A 3HJAA 4YAJA 3BIOA 3P2YA 3DOJA 2DM6A 4BNWA 2CUKA 3DTTA 1PJCA 3OA2A 4TRRA 4M86A 3INRA 4WLFA 3KYBA 3KLMX 5HM8A 1UDBA 3RUEA 3HFGA 3L4BA 2FMUA 1B2LA 2CD9A 3LC2O 3CKYA 4IQ0A 4CV1A 1HDGO 1Z6ZA 1V35A 1A9ZA 4AVYA 3IQDB 3FR8A 4PG4A 5IN4A 2X8LA 1E1KA 4YXFA 3BZUA 3ABIA 2IEDA 2GO1A 3ZWNA 3GY0A 4FFNA 3DHYA 3WMXA 4PG8A 3U4DA 4OKNA 1HYGA 2EV9A 1LDBA 7ADHA 3WGYA 3OJOA 4RV9A 1JA9A 1I3NA 1DRVA 2VNAA 4CLHA 1EFKA 1GZ3A 2Y1FA 4MDHA 1H6DA 2Q2VA 3H8VA 3OIDA 5CP8A 4ZJUA 1LU9A 1T1SA 4ONEA 3E5MA 3MWEB 1GYPA 2DC1A 5HA5A 2FPGA 2GR9A 5CEFA 1GZ4A 4Y98A 2V6BA 4A03A 4UULA 4HFNA 2YYYA 1YVEI 2DVMA 4BNMA 1SC6A 1BXZA 3DZHA 1BXKA 1P1RA 3FTPA 3K5PA 3NTOA 5T57A 1EVYA 1R6DA 1NR7A 3MOIA 3SC4A 4FC7A 2WE7A 3BA1A 1JDJA 1OFGA 4C7JA 4KDFA 4NI5A 3WDSA 3L9WA 4ND1A 3AM4A 2BGMA 1YBVA 4AL4A 1XSEA 5IDYA 4F3YA 1HYEA 1NYTA 3DL2A 3ZV4A 3C85A 1KIFA 3H5AA 2IEBA 2B35A 3K73O 2PH5A 3S2GA 4PVCA 3DBLB 4RQTA 2PA3A 3OEYA 4GVLA 1N2SA 2ZB3A 1I30A 3BTSA 1I2BA 4IXTA 3JV7A 2DBQA 3OM9A 4JX8A 4KUHA 3H5NA 2ZJ0A 4GMFA 4MVJE 1DAOA 2X5KO 1DIRA 2R6JA 4M49A 5G4LA 4D0SA 1NPYA 2YV1A 1UP6A 4XGKA 1E3EA 3GRPA 2Y67A 3I9NA 4IGFA 4GX5A 4RL6A 4LSMA 4FDAA 4J6FA 4BKQA 4NNJA 1WNTA 4NBRA 1NVGA 3QWBA 3I9MA 3IKVA 3QWAA 1RYEA 2E82A 2WTBA 3L77A 4DIOA 4DPMA 3ENNA 3MEQA 4XYGA 1TXGA 1PJTA 4OGWA 1H9AA 4GVXA 1A4UA 1Y9AA 4RF3A 1SOVA 1MGOA 1VC2A 4B79A 2NTVA 1LDGA 4W7HA 2YY7A 3MWDB 3ONEA 4W6ZA 5B4TA 2WD8A 3NV9A 2AQKA 2E48A 3AWDA 2Y0DA 2Y1CA 1JN0A 2OO5A 5EQFA 3C1OA 3CPSA 4MKRA 1GV1A 3ANMA 3EUWA 1N9GA 4AJ4A 3K96A 1ZK3A 2HMWA 1P1JA 1R16A 1I24A 2HJRA 4GX2A 3B1JA 4J0FA 3U5TA 4IJUA 4DPLA 1SEPA 4YQYA 3PHIA 2PLAA 3GFBA 4X54A 1FMCA 5T8KA 4GH5A 1PS8A 2Y99A 2A94A 1JKFA 5IF3A 2OL4A 3ZI0A 5CDSA 2G17A 1X14A 5COQA 4PZDA 3I3OA 4OQYA 3NEPX 4HKTA 3PFWO 2O3RA 4KTTE 2C0CA 2OHXA 5GMOA 5ENVA 3LU1A 3RUDA 3GEMA 1C3VA 1LLUA 2GUGA 3ZNPA 1HE5A 4CR8A 4FBGA 1KERA 2ZTUA 3HUDA 4BNFA 1XELA 1AGNA 1E6WA 3OECA 3UFXA 5KJEA 4AJ2A 3ZCXA 2P9CA 1NTOA 1OC4A 1ADCA 2DAPA 1NQOA 2J3JA 3ZN2A 5BQFA 2FRDA 4KTVE 1U4SA 3JQGA 2CVOA 3MZ0A 3JQBA 2WD7A 1JAXA 1CQIA 4MJLA 3UICA 3JYNA 5G0WA 4A0SA 2C7VA 2DTDA 4XEHA 2ZTMA 4URFA 3E82A 5DCYA 2GNAA 1RYDA 2IZ1A 2Y1GA 3QVOA 2NUAA 5JO9A 3RVDA 3UGKA 5KJ1A 2NQTA 4Q3CA 3TFOA 4YCAA 4YJHB 4I5FA 5F21A 1SZJG 4EITA 2X0RA 3UUWA 3G49A 2JKVA 2PZLA 2UUOA 2ZB8A 3I9KA 1ZVMA 2JFGA 2RHRA 2X5JO 3HE3A 1PZEA 1HDCA 3MOGA 4XYEA 4GKBA 3E1KA 1TA4A 3PJGA 1SOWA 1EZ4A 1BXGA 1GU7A 2D8AA 5TS3A 1HXHA 4CMGA 3RKRA 4IDBA 4L73A 2NU9A 1ZSVA 2XF8A 4DUPA 4WEOA 1WMBA 3T4EA 4CUJA 5I8ZA 5A5EA 5FI5A 1VSUA 3EW7A 3VH1A 1E1LA 1GPJA 5DZSA 1VL0A 5EERA 1ISJA 2YHUA 2D3TA 4BOYA 4ZN6A 3ZWPA 4BO7A 3JD0A 3L4BC 3D4OA 4NBVA 3ZWOA 4IDAA 1HDXA 5DOZA 5EN4A 5DOVA 4CM1A 5TT1A 3H3JA 3CE6A 4EJ6A 1QRRA 3O03A 5JBIA 2QQ5A 3R0IA 1BGVA 1J4AA 3HDJA 1KEWA 3SEFA 1K0UA 4NHEA 3K2BA 3BMQA 3K92A 1P44A 2P4HX 2Y66A 2Q1UA 4TVBA 3OHSX 1P1HA 4FJ0A 1DHTA 3RC2A 2VZ9A 3OFSA 2JD2A 4UVDA 5I9MA 1JVBA 4R9SA 1GQ2A 1QYVA 1NBOA 1DFIA 4B8ZA 5K6AC 4PLVA 4ZVVA 4B4VA 1F17A 1EEHA 4PLWA 2OORA 4Z6KA 3GA0A 4LN1A 1WDMA 4OMUA 4NFYA 3VVBA 2OP1A 4HWKA 4BV9A 2BKAA 4CLRA 2R00A 1FDSA 1T4BA 4U6SA 1F8FA 1YJQA 3QVXA 3LYLA 2ILTA 3GG9A 4UREA 1N1GA 2VRCA 1YL6A 2CDBA 3L4SO 5AVOA 3IDSA 3TOXA 1ONNA 2YDXA 4ALIA 3F3SA 3MTJA 3ST7A 4FFRA 3P5SA 4PLGA 4RDHA 3S1LA 1ZEMA 5CDGA 2X6TA 4FIZA 1R4NA 4KP7A 4Y6PA 3H9JA 4PCVA 3Q11A 4MIYA 3PDJA 4PG6A 4QX6A 3GR6A 5DP2A 3W4KA 4MP8A 1LLCA 5AXBA 2JFHA 3QE3A 4ALKA 3WNQA 2HK9A 4CM5A 5KOIA 1ZW1A 4ND3A 5IZCA 4N5LA 2DTXA 3PEFA 3WR5A 2I5PO 1SMKA 4KQWA 4Q9NA 3DOOA 1FF9A 5C7IO 2X0IA 5FEUA 3GPIA 4AJKA 1LX6A 5L7TA 4MVJH 4ZQEA 4GLLA 2PGLA 5TSDA 3RUHA 3PPIA 1JKJA 3WJAA 2X23A 4YJGA 3NRCA 1L1FA 1DSSG 4NR0A 3CSDA 4BO1A 5JCJD 3IP3A 1GFSA 1E7RA 2JJYA 3UCFA 4R51A 3I1JA 5TT0A 1Y7TA 1JWBB 3WMWA 5THQA 4XRRA 4HUJA 1VL8A 2VHVA 4YRAA 2JFFA 8LDHA 2JCVA 3EHEA 1GPDG 3OJLA 4PRLA 3WBBA 1E5QA 4CQLA 1ZNQO 3PIIA 1B8VA 5CPBA 5TX7A 3G1UA 4BGUA 4XDYA 1SB9A 9LDBA 3RCBA 4RF2A 4DWVA 5CDTA 1C1XB 3JQFA 4R5HA 1BHSA 4ZQHA 3BMCA 3SBOA 1GL3A 1QYWA 1DPGA 2D0IA 3PYXA 5B12A 3HFSA 1I10A 1ZK0A 1Z7EA 5HS4A 1C0IA 1GD1O 2HK8A 5FWNA 4N18A 2QZ9A 4E2WA 5JC8A 1U3WA 1XLTA 1VI2A 1W8DA 4LK3A 4H15A 2IDZA 1MB4A 3NTRA 4TRNA 1IZ9A 3HN2A 5JAQA 3WTBA 3PHLA 4J7UA 3JD3A 3G17A 5EL0A 4D41A 2J5QA 3ZHYA 4FJ2A 4OAQA 1R0LA 3V2HA 1O9BA 2ZTLA 1AE1A 4OXYA 2VRCD 1B0AA 4UEOA 1A7KA 4MP3A 2D59A 3QVWA 3C3XA 1T2AA 1JKIA 1RPNA 2HMTA 3EY4A 4CM4B 1N92A 4C7KA 2GDZA 2HRZA 1U3VA 3A14A 4CM8A 5F5LA 3HB4X 2AMFA 3PFFA 1WP4A 4XX0A 3I83A 1BMDA 4CMHA 1O0SA 2DPHA 4XDZA 4Y6SA 4K6CA 3ROPA 1JW9B 4K28A 3CUKA 2FR1A 4DYDA 2EEZA 3ORFA 3JQBC 3KZVA 4DLBA 1IUKA 4U0KA 2AG5A 1YKFA 1Y8RA 1Y6JA 3NDIA 3MJEA 1EFLA 4N5MA 3U3XA 2VWQA 4M55A 2OP0A 4CL8A 2PTGA 3KSZO 4PZCA 5A03A 1YONA 3E48A 3EVNA 3RI3A 3N74A 4UVHA 3B1FA 4GBJA 1LDNA 3JQDA 1WDKA 3BTUA 2GN9A 1U3TA 2EXXA 3GGPA 1K89A 4D45A 2FP4A 2EIHA 3JQ7A 4UEJA 4Z3KA 3LQFA 3T7CA 1F12A 2VNSA 3VPHA 3WYCA 3D64A 4B3IA 4RLSA 2GD1O 3WIDA 1SCUA 3KEQA 4EI2A 3U4HA 1NR1A 1GR0A 1TB4A 3RC1A 3LC7O 3RUCA 1C1DB 3HDHA 4N5NA 5BSHA 5JC1A 4E21A 1KC1A 5IDWA 1XG5A 1I8TA 1Q0LA 3TZHA 1PL6A 4PIVA 3H2ZA 1CQJA 1DIBA 1P45A 2G5CA 4J91A 1YRLA 3RFXA 4CMIA 2IXBA 3H65A 4R9RA 1PQWA 3LT0A 1PZGA 2HU2A 3ETDA 4EUEA 1YDEA 2IYOA 3JQEA 1KVUA 1LQUA 3I52A 4U0JA 1NM5A 5C3MA 4NU5A 4FOSA 4IY1A 3RJ9A 4G2NA 3WBFA 3GH3A 2WDZA 4UVIA 5G0TA 2I6TA 1B7GO 5I7VA 4PLHA 3W6UA 4M1QA 1FK8A 1WLYA 1O6ZA 1YOVB 5DCUA 3RSHA 2WJPA 1LUAA 2Z1MA 1ZFNA 5DP1A 4B4UA 3RASA 3GRKA 3LZ6A 3HWRA 4YB8A 4CV0A 1CWUA 4UUPA 2JL1A 1E7MA 4F6CA 5TF4A 1ZO8A 1XEAA 3SJ7A 2QYTA 3GMDA 3DZFA 1EDZA 2CMDA 4BQRA 5BNTA 4RORA 2C7GA 1HE2A 3H5RA 2A9FA 2GGSA 5L45A 2X4GA 1SO8A 3H7AA 3WIEA 3ZHBA 3HG7A 2ZYGA 2LDXA 4PLPA 1KYQA 2Z1NA 4MVJA 3VPFA 1M2WA 1FDVA 4XA8A 1DIGA 1Y8QA 2FWMX 2ZB7A 2X9NA 4UVGA 4CLDA 4ALLA 3CINA 4PLYA 4R54A 3SVTA 1R37A 2IE0A 5L4SA 3O9ZA 2AEJA 4E2YA 4IDEA 1VM6A 1ADBA 1P9LA 1LLDA 3AM5A 3E9NA 4XD2A 1ISGA 3TJRA 3ZU5A 2FPIA 3KV3O 1HZJA 2A4KA 1DLJA 3IJPA 2BD0A 3OETA 5EPOA 2E4AA 1V3UA 1E77A 2WEKA 5ENDA 4D3SA 4DRYA 3KVOA 1PWZA 2B4QA 3AK4A 1Z75A 1YB5A 5H82A 3AUSA 4B7XA 2YJZA 4R5MA 4RPLA 4GGPA 3WWYA 4O5OA 4YACA 1ENOA 4CQMB 5IZCC 1HETA 1Z82A 3DMYA 5U4QA 2B4RO 1XHLA 3PIDA 2ET6A 1BTOA 1YBAA 3GN2A 3WYBA 1VSVA 3KB6A 3TOZA 3RD5A 3V8BA 1NPTO 2H6EA 1UXJA 2XPCA 4OKIA 1ZKMA 3SJUA 2OBYA 1C0LA 4AJHA 2FR8A 1GTMA 1YB4A 2PGDA 4ZQBA 4HADA 2UVDA 3DR3A 3SLKA 1DRWA 2VUUA 4LISA 1JU9A 4KWHA 1ZXBA 3QWHA 4XJSA 4JNKA 4QXMA 3UAGA 2EJWA 4PG5A 1IE3A 3GDOA 1XCBA 4CMAA 2RHCA 4Y9DA 2VRBA 1GCUA 3QY9A 3LT4A 4CR7A 3Q6IA 1XIVA 3IMFA 4PGFA 1HLPA 2ZKLA 4GKVA 2JCYA 3KTDA 3RKUA 2FZWA 1IULA 1MA0A 3JQ8B 3JQFC 3KYDB 1UJMA 3OEWA 4O59O 2CSUA 4BNLA 1MC5A 4BMNA 1PR9A 4MVJP 1E7WA 1YE3A 1U5CA 3DHNA 4YEDA 4EW6A 2B83A 2V6MA 2BELA 4XCVA 5G0VA 4D0RA 4EUFA 1DFHA 4GGOA 4YAKA 1E6UA 4MVJD 2C20A 4GPD1 2H63A 2W8ZA 4DYVA 1ML3A 5GY7A 2CNBA 1GY8A 1ZJYA 2J6IA 3GF4A 3ZWYA 2C29D 1VL6A 3DAGA 2WWRA 3N58A 4ZQGA 2NU8A 1VJ1A 4AFNA 1U1IA 1FDUA 4N7RA 4O1MA 2E49A 3WFJA 1LRKA 4OSPA 4B7CA 1HDYA 4I5EA 4RZIA 2YQ4A 3D4PA 3DBLA 5JAZA 3A06A 1Q1NA 1KOLA 1JTVA 3BMOB 4EDFA 3COSA 3FNHA 3VZSA 3FNGA 1I36A 3GAZA 3F6YA 2I67A 1QG6A 4CL3A 2O2SA 2P2SA 3STHA 1ISIA 1IL0A 1PS9A 4H16A 3GVIA 1GUZA 4TVOA 4HP8A 4EEXA 1NQAO 3D4NA 4PVDA 1LA2A 1HDOA 5ITWA 1J5PA 3ZW8A 5HWSA 2O50A 2TMDA 1KC3A 2IYPA 4UUOA 1PJBA 3FSRA 3JSAA 4YPOA 1PGQA 5L40A 1ONOA 1BVUA 3D3WB 4Z0TA 1PTJA 3GGOA 4FCCA 4AJEA 3VVCA 3PWKA 1Y9EA 2C2YA 3VAZA 1PJ2A 1I3KA 3JD1A 4AJPA 3GZ4A 3M6IA 1BSVA 4D42A 4LW8A 1GQQA 4BGEA 2Q46A 9LDTA 1HYHA 3S2IA 1UXHA 1UDCA 3CIFA 4IMPA 1X15A 3I6IA 3UHAA 5K6AA 2AE2A 4RQUA 3RFTA 1A27A 2HKIA 1SEVA 3AJRA 2Y0CA 3KYCB 3DO5A 5KVVA 2PR2A 4E13A 4MOWA 2Q1SA 2I3GA 1U28A 4Z9FA 3MJTA 4B7UA 2Y05A 5EINA 1FJHA 4IBOA 1NVTA 3FBTA 3HZZA 4IIUA 1H2HA 2E6UX 3OQ6A 5B4UA 4S3MA 2BRUA 2H5LA 2AW5A 3JQ6A 2GN4A 3E5RA 3I6QA 1LC3A 1KVQA 5DBIA 1EQUA 1WW8A 3ZH2A 3MJ4A 3WGTA 1SPXA 2VYNA 3EZYA 1X7DA 1QV6A 1NXQA 1KVRA 1YB1A 4RF4A 2EGGA 2VOEA 5G4KB 5AXAA 4OSOA 4JROA 4CMEC 2CVZA 1T1RA 2WYWA 4NK4A 1P31A 3AW9A 5TRTA 5JDIC 2NSDA 2ZTVA 6LDHA 1K3TA 3OJFA 3IS3A 4BNYA 5IFLA 5KCZA 3ZWBA 4CMCA 4HFMA 4LSWA 3JQ9C 4WPGA 4YJDA 4IS2A 4BL5A 3ZU2A 4J1QA 1HTBA 1ZMTA 1A9YA 3QHAA 2J3KA 5JCXA 3WQSB 3TQHA 4XRGA 1NHGA 1YL5A 2QG4A 3U4CA 4DQXA 1BDMA 3L6OO 4IDFA 1YH3A 3FI9A 4FC6A 2Q50A 4YJHA 3U62A 3GOHA 1PJ4A 3TF5A 2GERA 4J3FA 1RM5A 2OMEA 3GVHA 5KVQA 1ZSYA 2NM0A 2VWGA 4BHTA 4DIBA 4F6LA 2ZK7A 3GUCA 4L9RA 4W4TA 4W82A 3ZU3A 5L9AA 3JD4A 2VOJA 3X2EA 2JD1A 4FFPA 1T2FA 4MVJF 5DT9A 3ZHXA 2VHZA 4G5HA 1X1TA 4ZD6A 3AI2A 4OIMA 3GN1A 5DULA 1X0XA 2X9GA 1GYRA 4KZPA 5A9SB 2EERA 1DO8A 3RC7A 4AJIA 4J90A 1P33A 1PJSA 5EESA 1TT5B 4WUVA 4PRKA 2X9VA 3CEAA 4IQGA 4J49A 1YQGA 3AUUA 2O3UA 3DB2A 2NVUB 4J9VA 4J1NA 3ZWAA 1LQTA 4BB5A 4XYBA 2P68A 4NJOA 5L4LA 4J1TA 1I2CA 1RWBA 4CR6A 2EHDA 1MLDA 1PJ3A 4IINA 2VYND 3PLNA 1OC2A 1YL7A 4JJGA 1LBEA 1KEVA 4FGSA 1K5HA 3DZBA 4GWGA 3KO8A 1A4IA 1DC4A 2PH3A 4OQZA 4GL4A 3WICA 2G76A 2XXBA 4R1TA 2FPPA 3OP4A 1Z74A 2H9IA 4XIYA 5JY6A 3ZNOA 5G0SA 1KY5A 3NT5A 1JAYA 3W4JA 1PL7A 5I9NA 5IN5A 4IDDA 1YXMA 2W98A 4BNJA 2RBEA 4N54A 5JY1A 4RPHA 5ER9A 2P9GA 3WS7A 2HJSA 3BAZA 3OH8A 4QT0A 3RIHA 2C54A 2J3HA 3L0DA 3Q2IA 4XGIA 1OAAA 2B4TO 3BMNB 1WZIA 2VT2A 3TPCA 4EBFA 2NTJA 3FPCA 3W1VA 4R41A 1H2BA 3V5NA 4ID9A 4LCEA 3S2EA 5U9CA 4ESOA 1ZEJA 3H9UA 3JQAB 1A72A 3GG2A 4JJIA 1U4OA 3LLVA 2VWPA 4EEZA 4IDGA 4BKRA 5T67A 4RVHA 1MUUA 2P5UA 1F06A 2EGHA 3ULKA 4IXWA 4HV4A 3ENKA 3DBRB 3ADOA 2OXIA 2O3JA 4ZRMA 4PN3A 1GV0A 3VOSA 4ZRNA 1E3SA 3QA9A 2FOIA 3AUTA 3DTYA 2O3QA 1XGKA 1D3AA 1I3MA 5TNXA 3FR7A 3T4XA 2HSDA 4FSHA 4BNKA 2GCGA 1KEPA 3BHIA 4WCFB 3N7UA 3FPLA 3PRJA 3RBVA 4ILKA 4OOFA 4BB6A 3DZJA 1O5IA 3WLFA 1H93A 5AYVA 1VJ0A 4ALMA 4CJXA 3L6DA 1LDEA 3CTMA 3GEDA 5FYDA 4TZTA 3LLSA 3BXXA 3JYLA 2PY6A 2YV2A 3GDFA 4UUNA 4BO4A 1D8AA 3W6ZA 2BI8A 1D4FA 5JYEA 4ND5A 2X86A 3PI7A 1NFFA 3BYZA 5KNLA 2E37A 1U9JA 1QXSA 3UCXA 3PYMA 4KUEA 3V1TC 3OJ0A 4MINA 2A92A 1H6AA 4DC1A 3PQEA 4BGIA 3KLPX 1UZNA 5CFZA 4J2HA 2F1KA 2NVWA 4NJMB 1B8UA 4CLEA 3GMSA 5CDYA 1PGNA 5F5NA 3PJEA 1Q7CA 1PZFA 5BSGA 4YRBA 3Q3CA 3RJ5A 4XB2A 2EP7A 3A1NA 4JBHA 4AG3A 1LDYA 1UZMA 4ZHSA 5JNLA 4P4NA 4DQUA 3AFMA 2QIOA 1DJNA 4CMJA 1X0VA 4W99A 1HL3A 1RJWA 3IIEA 1XA0A 4A27A 4LRTB 5I9LA 5K9ZA 5IG2A 3W8FA 3ZGYA 4GSKA 3WSVA 1ADFA 1U2GA 1KEUA 1U8XX 4BUCA 4CM4A 3L6EA 3NUGA 4M89A 1QYDA 4RGBA 4MIOA 2C5AA 1ULSA 3OMLA 1RM3A 2JD0A 3EVTA 4L74A 5JLAA 4RJTA 3I9JA 2HMVA 4I5GA 1FDTA 4CM9A 3OA0A 3H3FA 3M2PA 5L4NA 3PTZA 3T7EA 4BNNA 3TL2A 4KUGA 1ZK1A 1O89A 4GLOA 4DA9A 2QW8A 3EYWA 4OHUA 1KVSA 3CMMA 1E5LA 3OIGA 4ND4A 7MDHA 2OBNA 1OBFO 1XR3A 2B5WA 4NZ9A 3WGOA 1U7TA 5C7OO 2VHYA 2G1UA 3QQPA 1DC5A 4QSMA 1ORRA 2CF5A 1TT7A 5COAA 3LF2A 3QWIA 4CLOB 3EDMA 2JHGA 1T4DA 4C4OA 1BW9B 1IB6A 3H9EO 1IPFA 4L0QA 3DZIA 4JGBA 3GZNB 3TL3A 3FCOA 1R4MB 2QHXA 3JYPA 5A4DA 1CEQA 2BGLA 3DDNA 3JQCA 3ZWCA 2VYVA 4YA6A 3OF2A 5LC1A 1DB3A 4DGSA 4L4RA 2BLLA 1C1DA 4IZIA 3KUXA 3NDJA 4E5KA 1UUFA 5CPFA 1E7QA 3E9MA 3WYEA 5IXSA 4WNCA 2IXAA 3U49A 3UXYA 1UP4A 3MJCA 2AA3A 3RC9A 4E31A 1GCOA 5T6BA 4IJKA 3BTVA 4A10A 1YQXA 2DFVA 4AJJA 3ZWVA 2ZJ1A 1EUCA 4A2CA 4WCFC 2Q2QA 3PGXA 4YT2A 4Q3EA 1DOHA 5TQVA 2Q45A 5ER6A 3AFNA 4M8SA 3DFUA 1GUYA 4FQ8A 2DKNA 2OZPA 3DOCA 1YOVA 1U7HA 4I9HA 3R3SA 1ENZA 5MGBA 2DTEA 2DFDA 3ASUA 2CDAA 2YFQA 3VH4A 5CAEA 3Q0EA 3ICCA 3HN7A 5EJ2A 2EJVA 2VZ8A 1HWYA 5AQ1A 4RO0A 3X2FA 4DLLA 3R6DA 3CMCO 5JSFA 5ILOA 4WGGA 3HQ4O 4CM9D 1MP0A 3RBZA 1ISMA 4E5PA 1J0XO 4DL9A 1EBUA 1U2DA 3ANNA 1I2ZA 2I76A 2IODA 2YHIB 4XZ3A 3RQSA 1VLLA 3I23A 2XAAA 1IOLA 1P3DA 3HSKA 3H9QA 4YJFB 3E8XA 1PJLA 3GQVA 2VTEA 1WDLA 2HCTA 4IJWA 1P0CA 4FS3A 4J4BA 3QLJA 1HT0A 3I9LA 2AXQA 3GPDG 1DJQA 3TWOA 3ZW9A 4II2A 1U8FO 5A3VA 4OXNA 3DFZA 3KRTA 4FFMA 3K9QO 3UW3A 4HNGA 4BNVA 2BFPA 3GDGA 1LRJA 3ZV3A 2P4QA 4Y8VA 3GHHA 4E5YA 4CLXA 4D43A 2O7SA 4B8WA 2CY0A 4YBZA 1VPDA 4OO3A 3AU8A 4TZKA 4H3VA 5C5IA 2VYVD 4J7CA 3VZRA 2PKQP 4NPCA 4O6VA 1ULUA 2DPGA 2ZQZA 4CQMA 4YDRA 4HXYA 4J4TA 5A9TA 4W9NC 1DXYA 1ZK4A 1ENYA 4YTEA 4WLEA 6ADHA 5F1PA 1EUZA 3O8QB 2O4CA 2X58A 1CETA 2W2KB 2J5RA 4FPXA 1LSSA 2PNFA 2NQ8A 4JJFA 4TSKA 4IMRA 4R16A 4P8RA 2G82A 2BHLA 4JBGA 1FXSA 2JAPA 3K2EA 4CMEA 3Q9UA 5I8WA 2YFHA 4JN6B 3WLEA 4Q39A 3ROMA 1EVZA 2H1SA 1T2CA 3HDQA 2QRJA 2Q4BA 1EVIA 4DMLA 5JDIA 2B36A 3VTFA 2WM3A 1SNYA 4IM7A 1BRMA 4PLTA 4L76A 2D5CA 2DUWA 3FWNA 4A73A 4LVCA 1M6HA 2CFCA 4IJVA 3DZKA 3JQ9A 5JO0A 4P4LA 4WCDA 2FR0A 4K9DA 3JQ8A 2AEFA 1R12A 3KYDA 4L4SA 5KJ6A 2PWZA 3ZHZA 1H9BA 4IUYA 5JS6A 5A9RA 1V3TA 5A02A 1BVRA 2EKQA 4DREA 4RVFA 4I5DA 2ZCUA 4M54A 2W90A 2YW9A 4AJLA 4XGNA 4WEQA 4RPGA 2QX7A 5GZ1A 1ONPA 1ARZA 3F9IA 1I33A 2UDPA 2BF7A 2RCYA 4WOKA 4TMFA 3WGGA 2D2IA 3PJDA 3KSUA 3ETEA 1YBMA 4CV3A 2J3IA 4YYZA 5DNAA 3BMOA 3GVCA 2EW2A 1A5ZA 3QW2A 2UUPA 3C1AA 3P2OA 1EE2A 4XB1A 2HO5A 1LEHA 1LSUA 2PZMA 3SC6A 5FI3A 2ZCVA 1Z45A 2V6GA 1NHWA 3NYWA 4IS3A 4CQMD 2Y0EA 2VHXA 4XQEA 2JAHA 3LT2A 4NBUA 3M1LA 1E6EA 1E1NA 2A35A 4Z3DA 1UH5A 4BVAA 1WXDA 1PR3A 4QEDA 1PSDA 5L7YA 4RLHA 3AI3A 3D3WA 4BIIA 5A3JA 3ZV6A 4ZICA 3NTQA 4TWRA 3ITKA 4BO2A 4I9NA 4MP6A 1ISFA 5KJCA 5KKCA 4DVJA 2DQ4A 4IGEA 4P38A 2VN8A 4B3HA 3TNLA 1NAHA 2VCYA 3F4BA 4ND2A 5BT9A 2AHRA 5A06A 1NQ5A 2NADA 4D3DA 4FFLA 3JTMA 4FB5A 2AG8A 2VUTA 2W4QA 4GAEA 1E3WB 4D79A 5L3ZA 4UVEA 3KYCA 2CF6A 1MX3A 4E4YA 3PP8A 4HY3A 2UYYA 1CIVA 3ZDFA 3Q9NA 3IP1A 3DAPA 3CZRA 3MTGA 4HFJA 2C5EA 4E5NA 2WYUA 1OZAA 4PZEA 1DDOA 1XKQA 3K31A 4E6PA 4ROSA 2NNLD 4R01A 2CZCA 1GUFA 1L7EA 3PHHA 1HE4A 3VH2A 2O48X 4I1IA 3F46A 4QO8A 3ASVA 4E33A 1HE3A 1VKOA 3INGA 3C1TA 3BHJA 4WLNA 4AJ1A 4E2XA 4QFCA 4YT8A 1I0ZA 3WGZA 4U8GA 3WOHA 1XU7A 1LRLA 2HDHA 1LC0A 4EJMA 1PS0A 1NPDA 1ZCJA 1M76A 5EMHA 5G4KA 5GZ3A 1EUDA 4YAGA 1MG0A 1V3VA 1WVGA 1JWAB 3DAFA 3FD8A 3TSCA 1GZ6A 1AUPA 3JD2A 3SXPA 5HBRA 1E92A 1I01A 3ZU4A 4EUHA 4E32A 4FD3A 4FR5A 4FGWA 3ICPA 3PYLA 1DC3A 2W2LA 1RM0A 3FRJA 5TLSA 1LSOA 4AJOA 1YJ8A 3M2TA 2O3SA 4TRMA 3NT2A 3IL2A 1EDOA 2EG9A 1EQ2A 4P22A 1FDWA 4B4WA 4BV8A 2GLXA 4O63O 2Q99A 1NWCA 2PKRA 4BO5A 5H81A 1SAYA 3C7DB 5ILGA 2XXJA 4WOJA 3E6AA 4OYRA 1F0YA 4XJTA 2V65A 1T25A 3GK3A 4NU6A 4U6QA 5JDCA 1LJ8A 4YAEA 5DCWA 4DXHA 5A04A 1UXKA 3NGXA 4R1NA 3KOUA 2VTDA 1IHXA 1AHIA 3AI1A 5JYDA 3WXBA 5BSEA 1CDOA 3HNPA 3F5SA 1P74A 4TQGA 2V7PA 3LDHA 1CF2O 4P4GA 4CMBA 2NTNA 4XIJA 3WGIA 1VRWA 4CUZA 4NBWA 4E12A 1G6KA 3A4VA 4BO6A 2PD3A 5J23A 5A9SA 5C7LO 3JYOA 4S1VA 2RH8A 4GWKA 4JK3A 3TZKA 1TT5A 3AOEC 5A1TA 3QJ5A 2QRKA 1MV8A 3GVXA 3GHYA 3ONDA 1Q2XA 3NJ4A 4M87A 4ZU3A 4QUKA 3VDRA 4XYMA 2FSSA 1NFRA 3MCVA 2EWMA 2NVUA 3D7LA 2Q1WA 4LRSB 1IPEA 1U5AA 2FN7A 3PWZA 3ZWWA 1J6UA 2NACA 2VUSA
chains in the Genus database with same CATH superfamily
1Z4JA 2NPOA 3TJMA 3M34A 4TLMB 1HV8A 5T4FA 3WDKA 5HF8A 3ZDXB 4EYGA 3DLBA 2R6GA 2YINC 5DGIA 2BH9A 1CUDA 1T8RA 3N39C 4RY8A 4ZDIA 1G21E 1U80A 4Q9DA 1WMAA 1CEYA 3CF4A 3EMKA 4P36A 1SXIA 1WZNA 2AB0A 4H7PA 1PIWA 4DEXA 4FNMA 4IWYA 1EE9A 4QXRA 3BJEA 1O97D 3ZGXA 1Q0TA 3AVUA 3ONVA 3AJEA 2G0TA 4E11A 2AHOA 1RYYA 3HZRA 5LP6F 2W2LD 5AI8A 3AY6A 3EC7A 5CVVA 4X1KB 4YFYA 4JBIA 5ADHA 2NXWA 3MT0A 4NESA 2MYTA 2JBWA 4O2AB 1FJGB 2JLVA 2FZEA 3X44A 1G18A 2I4LA 3MT9A 3FHJA 3NVDA 2PUGA 2O1EA 5LN1A 2J8ZA 1PG0A 2A5YB 2N1BA 3AR9A 5JXWA 2GVDC 2YL2A 4WJZA 5A5FA 4IP0A 3M4YA 4H08A 1DQYA 1XMVA 4CF7A 3BG5A 2XYGA 3E0XA 1GPLA 4KMSA 4BWGA 2W42A 4LOJA 4PIPA 3DVAA 3HJTA 3K15A 5KDLA 2HMYB 3EK2A 2YBDA 4ZALA 5AW5A 2K6GA 1Q7BA 4AZSA 1EK5A 2H7YA 4IIHA 1JEQB 4MHSA 4XSHA 2MT9A 2ODWA 3JQAA 5TC4A 1EVLA 2XDWA 1V0JA 2YIJA 2XECA 1OWMA 2IYEA 2G72A 3DT8A 4FHCA 4IKEA 3TIXB 4RW0A 4EUSA 3QNUA 3PE4A 1MO3A 1O57A 1KP3A 2QN9A 3JVVA 4FP9A 4UMEA 5CUQA 3VR6A 4HH0A 1NXPA 4HMOA 4M0KA 5DLPA 5CIQA 1B4DA 3I2HA 4RMNA 3WKEA 4CKBB 4YY3B 2ZQYA 3TZQA 2WM8A 4PSUA 3CF6R 2A5LA 1A9XA 4ER3A 1Z06A 3IKTA 4W5OA 1QR6A 1X3LA 4G63A 2NLOA 5DYNA 5FIUA 5EQDA 4Z9YA 4C3VA 4K40A 1E3JA 1EXNA 3BB1A 2WMDA 2DKFA 3DYBA 4G65A 2JIPA 2ZT8A 3UIEA 4C2BA 2Z6QA 5JSUA 2MOKA 4L8FA 2VAXA 4HLCA 1MC4A 3RTDA 5I7FA 2ZANA 1X8LA 2V4ZA 2BFBA 4QYWA 5F3RA 1WPXA 3FZNA 4EQ6B 3T8YA 1G1AA 3PNYA 3AKCA 1JSCA 2LNDA 4RVUA 3I1IA 4FHZA 4XPIB 5J4VA 1U02A 1F5SA 5FV7A 4ZQFA 3LVQE 4KR2A 3OU7A 5FWAA 5EIOA 1LLQA 2GCOB 3EZLA 5JQGA 3E7PA 3KDSE 4YXWA 4EY4A 5LCXA 4RNDB 4BMSA 3E9CA 1RAGA 1HSZA 1YA8A 1ESDA 1ZJZA 2XCOA 1TZCA 3IA7A 3W4IA 1EFAA 2P6RA 2VDWB 1KZHA 3FYUB 3S2ZA 1L4MA 4YASA 3HV0A 1Z7YA 2ZEJA 3BQNB 4NDNE 1H3NA 4LY9A 3U7GA 1XAGA 4QECA 2A1TS 1G8PA 2HA3A 3CY6A 3HKDB 4YI5A 2JFPA 3K1JA 3MERA 2C8JA 1YS9A 4ZODA 1RQPA 1VXOA 3E2IA 3HXTA 4AX8A 5EKUA 1IM8A 1J49A 1LTHR 1T3GA 3ESYA 3OFNA 3GLVA 3H6GA 4GD3Q 4YLYA 2AFHB 3A05A 5HKKA 1ODTC 4RLFA 1Q83A 3ONWA 1T26A 1EX6A 1T43A 1YZTA 2ZAOA 3F6SA 5EHIA 3ZXXA 3LSYA 2YKGA 1NVDA 2DWUA 1OWNA 4N5DA 1ECFA 3BBPA 2KHZA 3AZOA 1UBTS 1G6Q1 3PCRB 3RYHB 3USES 4JUDX 1YUBA 2O8BB 1H2YA 1G8MA 2DT8A 1KFKB 1V11B 1RKVA 2OHIA 3DEKA 4XWYA 1N6NA 4RTLA 2WU3A 4AKIA 3TQFA 2WB4A 1MEEA 1YWGO 1PJQA 3JZMA 3Q2KA 3KEFA 3UN1A 3FPBA 2WFAA 1TX4B 4DTCA 1WOMA 2XA2A 4IIXA 3JQAD 3KDAA 1XDWA 2Q0XA 5ALYA 1TYEB 2C92A 4ER0A 4EFLA 5HJ5A 1JT2A 3ZCUA 1XMXA 2MSCB 4PHHA 3LY7A 4BKPA 1RVDA 3VVLA 1DCKA 1M6WA 1GAQA 3F49S 3QX9A 1V48A 4M88A 3K30A 2G8LA 2BMAA 2VT6A 2Q3EA 2WF9A 1GKKA 4L72A 4QIHA 3V8MA 4YMLA 2HA2A 1F8GA 4NNPA 2LKCA 2UVPA 2WJVA 4GM1A 1DINA 3SBXA 1DC6A 2JLBA 3I5MA 4R40A 4DR7B 2NZ2A 5IJ0B 1OXKB 2XMZA 4DW8A 4QRHA 4U5QA 5FUMA 4F2DA 2I66A 2JAQA 1L7DA 3I45A 4IDOA 1NDUA 2FPXA 3OO1A 4NMMA 4R4JA 3KHSA 4MS3A 2QYSA 4BLUA 2CD7A 3L0BA 3T34A 3BIXA 1F0KA 4OK6A 4J9UE 2DSTA 2GM3A 2HF8A 5G3YA 2VH2A 1NW9B 1VDMA 3NT4A 3ZBPA 4QPNA 2V0CA 5T3YA 5TIIA 4UU8A 3HCFA 2CKDA 1AK9A 1EH5A 4C0SA 4A36A 4RS4A 1XFAA 1L7MA 1X13A 1MT3A 2HDNB 2PZJA 3A04A 3L8CA 3M82A 1FNCA 2V1XA 3ZWXA 3LW8A 1R0KA 3GGGA 3PNBA 3W8EA 4MUHA 3D0KA 4I3FA 1NLFA 4DG9A 4DJJA 3F47A 4YXWD 3RRBA 2HRRA 4UBIA 3INTA 2HZBA 1BW9A 4MKXA 5TJ9A 4BB9A 5DNDA 1QX3A 2PD4A 3K0HA 1RBZA 4BMDA 4BQFA 5KSYA 2QIPA 1IY2A 1V6CA 5EPEA 2WWGA 3CTPA 4DWWA 4Q9IA 1R4MA 1YI1A 2XA9A 4XQGA 3SZRA 1P5HA 1JDVA 1RQNA 3A1UA 3WBJA 3R3JA 5ICMA 2VH5R 1JLLA 4QTZA 2PBLA 3WL7A 4P3NA 1D5WA 1YULA 5F4BA 2PT5A 1OWLA 1V9LA 3BJRA 3LRTA 5H16A 2X0FA 1C1XA 3LBHA 2EW8A 3WB9A 4HPXB 1W93A 1JF8A 1PWXA 3EQ6A 4EK9A 3PUVA 2IXEA 2ZAYA 2Z95A 1W85A 4MYCA 3NQ41 3LSTA 2PK3A 5E2AA 3NAZA 3VHRA 1AQ6A 4FFVA 4XX1A 5HKKD 1Q7GA 3JR3A 1LDMA 4II3A 4U8HA 2HRBA 2QL6A 4I50A 4Q1EA 1AKTA 2L19A 3JQGB 4Q0MA 3PX2A 4R2KA 3GL9A 2VWHA 1E1CB 3SFTA 1HZZA 3QIVA 3RV3A 1CQIB 1D7OA 1O95A 4XJXA 4YAIA 3A0UA 1IK4A 2DFNA 1P1IA 3PLRA 4QO7A 1JH8A 2YXDA 4MV6A 4V38A 4H6VA 1TQ2A 3WWDA 2FETA 1HDRA 2ZIEA 3N05A 1Y63A 3KL4A 2HJWA 2FI1A 2VQSA 4IX9A 5BURA 5IX8A 2JLAA 3SGLA 2RC5A 1B14A 4AJNA 3RUAA 2LBPA 3M9LA 1P1KA 1IAQA 3D2LA 1EUQA 4B48A 3D1VA 2CVPA 4QTYA 2NAFA 1L7XA 2ZBEA 4DV0B 1Y1KE 3OOHA 4J4HA 4MUYA 3KETA 1KEZA 1WZ2A 3NHKA 1SU6A 2V7XA 1NNI1 5AQEA 4JQOA 5EUCA 5C52B 4FFBA 5TB5A 3SKYA 4F46A 1IOWA 1AB5A 3NASA 1UKAA 4FSDA 4OM8A 1AKQA 1T2EA 5AOVA 4AKTA 1RLMA 4XWAA 4RMHA 5DM0A 3D2BA 2H54A 2PN1A 4I1OA 1K5PA 3VO9A 2FJPA 3EGXB 1JDTA 2NWQA 4N9WA 2IHUA 3P9KA 4KAXA 3M1AA 4DZTA 1MO5A 4IMIB 3K0AB 2HAEA 3TNJA 3EIWA 4NKRA 1Y1PA 3WB1A 2A67A 4LSZA 3HN6A 4NFSA 4EW2A 4O1IA 3B70A 2PMDA 1JG1A 5JFOA 2WAXA 3F1LA 2ZJ6A 4MMZB 1ODLA 2E1PA 2V7EA 3MOSA 4RHXA 3PL1A 4LJ5A 2XGSA 4QGSA 1JVSA 2PJDA 4U4AA 2FP3A 4HSEA 4AUEA 1LVHA 2NZJA 1JLKA 3K9NA 4LUCA 3GFQA 3WTCA 4JJEA 3GQBB 3ZDEA 3WGVA 1OI4A 4KK3A 3QOFA 4MWBA 2L69A 1TAQA 2FMHA 4NCKA 1SD1A 2H4ZA 3SZUA 3HKBA 2E4ZA 1QH9A 3BMQB 5KNBH 1FUEA 4MV5A 1XEXA 4EQZA 1NDQA 3S0JA 4KLAA 3U60B 5LMUB 1VGVA 4HNSA 3HB7A 3PK0A 4MKGA 4WLVA 4AB1A 1Q0QA 5T64A 1ICEA 1WZEA 4QGGA 2H08A 1LPAB 2IK8A 1C30A 2NG1A 3CO0S 5DI9A 2P1RA 5G2OA 3LUBA 4TV8B 4Q4AA 3EGOA 4EB0A 1WAMA 1NRIA 2PSSA 4YV7A 3SZLA 2QVBA 3IERA 4QGAA 4WERA 3TW8B 1JYFA 5B36A 4U7WA 1O95D 3WRXA 4CFSA 3VSDA 1QFJA 5KJFA 3G02A 1K9SA 4DGQA 3IC5A 3RTAA 1X7ZB 1YSCA 3C8ZA 1IY0A 4GBMA 5KNCH 2GZSA 4E1BA 5BUQA 5GM2A 2R5NA 3BCUA 4GIBA 3L8EA 4ICIA 2R6FA 1MU0A 2W0SA 1ZNWA 2BFDA 4TKUB 5DV9A 3NORA 2VHWA 4B85A 1IDOA 4I4TB 2HM7A 1RCTE 3H2JA 1RBQA 1BG6A 4DWJA 4EB6B 1D6NA 5IYZF 2B1GA 2E5LB 2WJIA 1X1SA 3L8MA 3SXJA 1ZUIA 4CW7A 4ZVNA 3GUYA 2XD4A 1W96A 3PC4A 3RVKA 1X7HA 2BWJA 1RD4A 4I4IA 1QGYA 4Q00A 1OTHA 2NZVG 4GNRA 4LWPA 4GKAA 4F5DA 2CUNA 3PD0A 3SEZA 4GKJB 3HRKA 3Q88A 3M9XA 4JT8A 4DBZA 2CJXA 4U9UA 3EIHA 3S8MA 5FQOA 1UANA 5I3CA 2QP3A 4BKOA 5CEJA 4E70A 3H3XA 5CD9A 1MXHA 4F2GA 2QVLA 1UOEA 1UMCB 3DBIA 2P67A 4HTFA 3ESRA 4EHLA 4URXR 2JG3A 3C7AA 5C5CA 3PQDA 4M3NA 1TM5E 4KN5A 4L6IA 4WLUA 5TVGA 1Y6QA 3C6ZA 1JKJB 3HHPA 3OKFA 3QX8A 4G1VA 1QO7A 3JWIA 3P19A 2F3UA 2GO7A 1R3UA 5I4BA 3DWFA 2JZCA 4NARA 1RQGA 1VPTA 4A6XA 2CL6X 1L5GB 4D8XA 1WULS 3PF9A 1NXVA 1MIHA 2G07A 2HQ1A 2Q5EA 1GA1A 1GKLA 2EEPA 2Q6IA 2YMPA 5I7AA 3ZQ6A 2JAUA 5J40A 2CSXA 3RUFA 1H0HA 2J5XA 5CA0F 2Z3VA 4MGKR 3OE5A 2HDOA 4A5OA 4BBZA 4QPPA 2A7QA 4QNRA 3LPMA 3JAMA 1ZXXA 4DCOA 4RTRA 3UTDA 1ID8A 3HZOA 1ST3A 4KVFA 4RC9A 4R1UA 5KBYA 4DQ0A 2DX7A 2PCJA 1EFHA 1GPWB 3VTZA 1AZLA 2DY1A 3B1WA 5K8UA 4G5GA 3SZOA 3BD7A 3C16C 3RYCA 1OPRA 2QT1A 2FQXA 2C59A 1T4CA 4TKLA 3T7TA 5L3SB 3UMGA 2R96A 1M1YB 1Z2OX 2WHPA 2IRWA 2CN1A 4FU0A 3OCWA 3D5TA 4WECA 4M9CA 2ZZNA 1FQKA 2MDTA 4DIFA 3V4SA 4ZJYA 1KOJA 3IOEA 4LFCB 2RGRA 3PEWA 1PT7A 1TKAA 4ZHQB 3QMMA 4HGOA 1E64A 3MQ2A 4OL9A 1PLKA 2A57A 1DUSA 5LB4A 1Z17A 4P82A 3TNFA 3VUFA 1TW3A 2IHKA 2XRYA 4H18A 3LPLA 5C1IA 4MRAA 4M7WA 4KOAA 1WDWB 5SV2A 3RS5A 4TUYB 3I4FA 1GRQA 4CM8B 4YHHB 5CK5A 5FADA 3VR1A 4NK5A 4OFXA 1UOQA 4WLOA 5HP4A 1Z7BA 3KP1A 2ZPUA 3GGSA 1Q0UA 2JFYA 1CY7A 2OCDA 4GX1A 2QRLA 2WT4A 2ZUSA 1NBMA 2BM9A 3DO6A 4JI3B 5CEEA 1Y5MA 2LW7A 3U1TA 3UKJA 2J5KA 1E1DA 4GP6A 2NYVA 5T5QA 3P2JA 1B1AA 1Q1AA 3K09A 4LS3A 3JRNA 4PE5B 1PZXA 5IARA 3AVPA 2WUGA 4QPDA 4PWYA 3S81A 4OHWA 4NYMR 4GOND 4MO2A 4BTLA 4CKCA 1Q0RA 1QLWA 5FBZA 1JBEA 2Z8ZA 4X62B 4EX7A 1IYZA 3A3KA 3MC1A 4B33A 3QE4A 1M2OA 5F1KA 2GASA 5HBGA 5IJXA 4MMYB 4TT3A 5KQSA 2R00C 3CWZA 1MAAA 4DXAA 1RJDA 1XP8A 2X40A 3K8YA 4GX0A 5DF1A 1Y98A 4A23A 5AVQA 1AUVA 1DTWA 1IOZA 2JGNA 5HRUA 3AHFA 3DFIA 4URWR 2AE1A 4HWGA 3A2NA 4Q48A 2PT7A 2IYUA 4IIYA 3GLFB 3ETCA 1T5DX 3DZCA 2BMVA 3KPJA 3G79A 4RGVA 4WFKA 3HCPA 3PUZA 4RX1A 4DMRA 1SCIA 2P75A 2WHEA 3PGJA 1U9YA 1UINA 4RVNA 2OGUA 2XNSA 1DKOA 2WYOA 4FW8A 2GPWA 2VFAA 4U7GA 4RYDA 4ZAZA 3X1ZA 2EFGA 1LXCA 3RJTA 1XNJA 5AKGA 4EL0A 1H2EA 2FTKE 3U44A 2II6A 1RKUA 3G2KA 3ANLA 4DMKA 3OURA 4L5AA 4DJ5X 1DEHA 4LY0A 2PS9A 4L0DA 4LV8B 5F3DA 1T1EA 2ZXUA 2IS6A 3MUNA 1ZM4A 2XCUA 1CQJB 4IMJB 4Y9RA 3GB9A 1B3BA 4YP9A 2INGX 3L02A 5LUBA 3F96A 3VPDA 2H1HA 4RHUA 3B6ZA 3CZQA 1T1IA 3FN4A 4QOJA 3CR8A 1LBHA 2J3LA 4NZMA 2D1QA 3IQXA 3TAXA 4IZHA 1YA4A 2GSDA 2O0JA 3BIFA 3NEJA 4CRWB 5I9BA 1GKYA 1DVRA 4DLTA 3F67A 4EGFA 1U65A 2VTVA 4WJLA 3B3QA 2FCRA 1E89A 1NF9A 2EC5A 2I9PA 1BIFA 4NH4A 5KMGA 1MHTA 1HDEA 1A1SA 2O3TA 2Q5LA 2ZIXB 2ZPAA 1ENPA 3EG9B 2DFTA 4MULA 5FXMA 1PAUA 3V4PB 1U9ZA 3HDYA 1ZOPA 4WW0A 2Z3ZA 3OTWA 5KVSA 1TO2E 3C3DA 3QXGA 2QTBA 5JHGB 1RWXA 3EPPA 4RJLA 2Z57A 3EQ2A 1OX5A 1Y3FE 4U39A 4Q3DA 5FPHA 4HDSA 1YHYA 4AY3A 3ZI7A 1JB1A 1NBMD 1ZD8A 2HIAA 3LUHA 3QLEA 2Y9MB 1AQJA 3WK4A 2R5FA 2VJKA 4M1MA 2GILA 3KU4A 1ACMA 3MMSA 3OIUA 2X8WA 4Y9SA 3X0DA 2ECKA 1Z4NA 3BSWA 1SVOA 3IUPA 2GCIA 1DIAA 3E58A 2BGKA 3BM5A 3G6WA 3NBYC 3P0EA 4Y6LA 4UAGA 3CLTD 3CW9A 3KKPA 4U7HA 4FN4A 3VBEA 2YWCA 4KMOA 1G3IA 3TVYA 1JP7A 5TDHA 4B6QA 5LVAA 2LZ0A 4GE0A 1IHUA 2RHLA 1N2OA 3DBHA 2YY6A 4Q47A 2HHAA 2GHTA 5THKA 1XTBA 4O4LF 3PFIA 2JIRA 4FK8A 2G4CA 5C35A 1P4AA 4WBNB 2XVXA 3BGSA 3NXSA 2XCRB 2QPOA 4Y6RA 4KXYA 3E15A 2VEDA 3OQVA 1LZLA 4A7PA 1G5IA 1N25A 2OXFA 3WYNA 3RVNA 2R1VA 1FU7A 3PV0A 1UAGA 1XZHA 2FPIB 2YJTD 3CH5A 3MGCA 5B1EA 1A9OA 1ZSNA 3G68A 3E35A 2LVBA 1KAGA 2Z2YA 4MWSA 2R86A 3ICVA 4UXHA 3ABSB 3A9WA 3IVAA 3TOCA 3ZCRA 4AWXA 2BGJA 3O8CA 1JKMA 2FLWA 4G0ZA 1KRXA 3HVUA 4ZVSA 4BP1A 4TVSA 1RVV1 4J0HA 5FPQA 4QXOA 2OGTA 1HDZA 1QYXA 2BL4A 2GEVA 2VJQA 3GD7A 3JARB 5EIHA 2F00A 4PLZA 6AT1A 1KMHB 4HHEA 1YZ3A 2WT9A 4ZQCB 3VNAA 4KE9A 1QQ5A 1W1IA 3P2YA 4A0RA 1E4VA 5M04A 2HU8A 2CUKA 3F5MA 3M6MD 1MB0A 5HCNA 1I4OA 5TEVA 3VZBA 2FQQA 3OPYI 2X8AA 3OA2A 4TRRA 3INRA 2X9QA 4WLFA 4MYRA 3L7MA 2C5SA 4QQ8A 3RG2A 2QD2A 1V5GA 1MOZA 3L4BA 2CD9A 3DHVA 4MQEB 3HSYA 1H3EA 1HT2E 3EH1A 3IEPA 4FX2A 1Z6ZA 4N0MA 5I4IA 3FR8A 3R0VA 2VP0A 1KR5A 4PG4A 3NXKA 3RTEA 4ZGGA 5B7PA 3KK0A 1CSEE 3ABIA 3GP5A 5DK4A 4RTSA 3K5WA 4ND8B 3ZWNA 2R8XA 1E2KA 1U2ZA 4GHWA 4KOEC 3U4DA 4AECA 1FRNA 4WFQA 7ADHA 2I6UA 3N2KB 1P2TA 3Q98A 5FRDA 1I3NA 3MTDA 2ZRJA 3DE7X 3H7IA 1EFKA 2Y1LA 1N2JA 1OPXA 2D00A 4I6EA 1FTNA 2DPMA 5AOCA 4ZGBA 1NRJB 5K01A 3R3ZA 5A2GA 2QTFA 5JZOA 5CEFA 5HA5A 2GR9A 4HQ0A 2CNNA 3BXZA 4H60A 2FPWA 2IDMA 3IV9A 4Y98A 1SULA 1X7WB 4HFNA 4UULA 5EJFA 4ZC1A 3JPWA 1SC6A 4XVRA 1WXXA 1HDIA 4Y9UA 2DGDA 2O2IA 3RFUA 1J2JA 1BXZA 4YRFA 4X45A 3U5ZB 3FTPA 5T57A 1EVYA 3LC0A 5AI4A 2PX4A 1Y7PA 3ESCA 3R7WB 1NJFA 1SWWA 1OFGA 2Z43A 3WHKA 1M6VB 4C7BA 1J07A 1U8UA 5CXUA 4NI5A 2ATXA 4P83A 2UYHA 2GA8A 2BW0A 1NM5C 1SBTA 3VR4A 4AL4A 3IP7A 3KJIA 4QYXA 3DMRA 5IDYA 4F3YA 1OIVA 5IAOA 1H2ZA 1ZA1A 3NNDA 4QATA 4N1AA 2NU8B 5LMNB 3V7UA 4O4HF 4WFIA 5MN5A 3N8DA 3H5AA 3UPUA 5E7QA 1YZUA 2B35A 4S2UA 4FB4A 2YW2A 4ON9A 3DBLB 3IKMB 1I4DD 3OEYA 3ZLBA 3UJ9A 4GVLA 4EJSA 3MPOA 1UFQA 3BTSA 3I6ZA 5IHPA 4YCDA 3RVLA 4WSOA 1Z5UA 4KUHA 2BFEB 5KX5F 2UUAB 2OCXA 4GMFA 4Z54A 4PM4A 1DEOA 1D4OA 2G09A 2X5KO 4L57A 1NN1A 4Q1BA 1R74A 2E18A 2FA9A 2RKOA 4W63A 1FTYA 1V8DA 4ZT7A 2EJBA 5G4LA 1VBFA 1WKBA 4ARZA 4D0SA 4QODA 1QKKA 1IHDA 2W6CX 3GRPA 3W7VA 3FNBA 3GLIB 4GX5A 5DGHA 4LSMA 3N2GB 3I3SR 3JX9A 1NVGA 3QWBA 5K3AA 5JSYA 1KK3A 2E9SA 4I1RA 1TXGA 5BN4B 3IULA 1DWOA 4TLLB 4J0JA 4V2UA 1A4UA 4ZXPA 3E3MA 4RS3A 1Y9AA 4HUQB 2M32A 2JGAA 2AG0A 1K1EA 2ZJFA 3TZLA 4XARA 4F06A 4Z4HA 4B79A 2NTVA 2C2OA 4RULA 2EBFX 2YY7A 4RZ2A 3MWDB 2AD1A 8MHTA 1V96A 4G4GA 4KYVA 1I7DA 2XIQA 2XZPA 5E0OA 5B4TA 2YJGA 4OF4A 2AQKA 1BQ4A 1XZIA 2I4RA 2WW8A 2A14A 3WFZA 2C94A 5BY2A 5J2TF 1JN0A 1QV9A 2FB9A 4KYIB 5A4FS 1A77A 2GAOA 5AM3A 4ZAWA 1OA0A 3F7OA 3EUWA 2AI3A 2NZ8A 4XUGB 4N7BA 3CBQA 1R16A 2AMJA 4UHKA 2HJVA 5DLEA 3EGDB 5FHRA 2OOKA 4IJUA 4MQFA 3OTHA 5D5QA 3SICE 4TYNA 3KXKA 3PHIA 1XB2A 2IEGA 3OESA 3M6VA 3UANA 2IKQA 1I7NA 4L8YA 1CULC 2GKOA 2PMCA 1Z37A 3F2VA 3P45A 5JS7A 2V8BA 2A9KA 4HLQB 4MNTA 3WP1B 1I6WA 4KACA 2E55A 2DJ5A 2G17A 2F3QA 1ISRA 4OQYA 1IXYA 1LCIA 3NEPX 3PF8A 1QH8A 3PFWO 2O3RA 1DBWA 1GG5A 1HY3A 3VR4D 2EBHX 4I1PA 2C0CA 1HM5A 1Q92A 1YAHA 5ENVA 2QM8A 3A31A 1TYDE 3KYIB 2DUMA 4Q4JA 5C8XA 3L8ZA 2GUGA 4F4UA 2G08A 4LZAA 1T5BA 1N0IA 3ZQUA 1U8YA 3HA5A 2R4QA 1WO8A 2JEYA 1KERA 2ZTUA 1UT5A 2IF0A 1Q22A 4CIAA 3ASZA 1V71A 3H75A 4NJEA 3H16A 1ADCA 5J5AA 2DAPA 4U63A 4BBJA 2FRDA 5CT5A 2H1RA 1NE7A 1RIIA 2YVQA 3H1PA 3QTLA 3X43A 1N2CA 5CM9C 3N8NA 3R8CA 4ANFA 1JAXA 1E2QA 3M81A 1QZ3A 3QU2A 1CPYA 1S2OA 5D6NA 4JVLA 1MRZA 3DT6A 3HXLA 4DMHA 4OHFA 4A0SA 5DSZA 2C7VA 3STUA 1JS1X 1U0RA 5KHAA 4I81A 3RVDA 5KJ1A 2NUAA 5JO9A 2P2NA 1WMDA 3OMXA 3ROZA 3ISVA 2B3DA 2OV1A 1R5NA 4LHXA 4YJHB 1Y4AE 3OFJA 4I5FA 5F21A 1BGWA 3DT9A 4PNHA 4N8EA 5FHQA 4EGCB 3CVXA 4JNCA 1PK7A 2PKEA 1PZNA 2OHJA 2KBFA 2JKVA 3G49A 3VR2D 1UOPA 1ZICA 2JFGA 1W0JA 2HWWA 5D87A 2BHTA 1PZEA 2HBZA 2OR3A 3LBAA 4HGNA 4C9BA 3A6DA 1PT9A 1EZ4A 2QVCA 5G1PA 1M0SA 4Y0VA 1CB7A 1KJZA 1BXGA 2ZSIA 1VCNA 3FGNA 3HP7A 3QEKA 1BCRA 2XY4A 4B31A 1GU7A 5TS3A 3CUUA 4NMLA 5KC9A 2CNKA 5E3JA 2NU9A 2AR0A 1GFIA 2XF8A 5K0FA 2HMAA 3ZLJA 1SOAA 1WHTB 3NC0C 4CUJA 3VNVA 4HGRA 3CX4A 5DO9A 1L3IA 5CA1B 1ZY2A 1H65A 4WGFA 3R6TA 1VSUA 4A1FA 1UIMA 4NXMB 3L0CA 2XYPA 3IPXA 5DNWA 1ISJA 2PWBA 1EWYA 1M6NA 2YHUA 3A9CA 3DVSX 1UBGA 4IHKA 2R62A 4MEJA 4ZN6A 5F23A 4BO7A 3DV0A 5CCBA 1Z2DA 3FJYA 5FBWB 4IDAA 3LP8A 2H0RA 1X74A 4OQNA 5EJGA 2H2DA 3L49A 4EKYA 3FFAA 4EJFA 1P0MA 2IU3A 4M53A 4EJ6A 2C4VA 1IXZA 3QTTA 3RJZA 2D2FA 5KPDA 5IVKA 1USIA 3TFWA 3QLVC 1EDBA 3R0IA 4MUEA 5KSZA 3T99A 1WM1A 4X6YA 1VG0B 1KL7A 3K92A 4I55A 2P4HX 1Z6GA 1T4GA 2Y66A 4TVBA 5HQ3A 3OHSX 4TWAA 3AEUA 4R2WA 5FTNA 2VZ9A 3U1BA 2MYUA 2JD2A 4JD5A 5I9MA 1RHRA 3DKKA 5JNUA 1GQ2A 1DFIA 1OLUB 2OO3A 5HFNA 1DKNA 3FGZA 4J0DA 4ZOLA 1C3OB 4PLWA 2BUBA 5C7YA 2ON6A 1GFZA 2QK4A 3GA0A 5IDVA 1U0LA 2J9FB 2H1LA 1L0BA 4Y1EA 1GL9B 1XXHA 3HYLA 2R00A 3MS7A 1BO6A 5DHFA 1F8FA 2XKBA 4YO8A 3C4JA 3LYLA 1VRCA 3CRNA 2HGZA 1IBMB 1BFKA 4D9FA 4ENUA 1CC1S 2HXYA 4TS3A 4OXXA 5A7FA 2BRUC 2R7AA 4QDXA 3ZE2B 1RKBA 3J7AC 4UREA 4H3KB 4RSHA 4W1RA 5FPSA 5SYMA 4IDQA 2CDBA 2RGBA 1FFAA 5HIAA 1RP7A 1OY1A 3HNRA 2HHJA 1ONNA 2Z5VA 1W0JD 1YRAA 2HLDD 2ZUTA 3LM8A 1KO4A 3TKYA 3QKRB 4FFRA 3P5SA 3GCZA 5UKDA 1NOJA 4BCBA 5E9AA 4C6TA 2EX1A 2RGYA 1K7XB 4OTZA 3VSAA 2JIOA 2VBGA 3G8AA 5LNK6 4FMBB 4RY9A 2GDJA 2JGFA 4PCVA 1M5RA 1V47A 4MIYA 2OQ2A 4PG6A 2AV6A 3SDBA 1JSRA 3GRAA 5LMZA 4BFWA 1Q14A 1GGFA 2ESRA 2VTKA 3PNQA 4TLAA 1E60A 4ALKA 3WNQA 4I9FA 1NXTA 2VP3A 3QBEA 2ZAGA 4ND3A 2RMKA 3WJ2A 1G9XA 1E32A 2DTXA 2I5PO 5AHKA 4KQWA 3WR5A 4EPTA 4W5NA 2WKRA 2X0IA 1MO2A 5EWMB 4B84A 1BMFA 5HFAA 1MABA 2QTHA 1LX6A 3HR4A 3PC3A 3AR3A 2N42A 3MGGA 3CLSC 4HDKB 4MVJH 3F73A 3RUHA 1XTPA 3AYXB 2X23A 1UZAA 4MVYA 4YJGA 9ABPA 2MTBA 4K2AA 1JHQA 4NR0A 4LTDA 4LECA 3U0VA 3EVBA 5JCJD 3EFHA 5NULA 3QY0A 2AZDA 2JA2A 1GFSA 1K7CA 2JJYA 2QR3A 3FMFA 4FLFA 1D6MA 2PFSA 2B99A 3CISA 1I7SB 5AKXA 4JZYA 5K4HA 1PJRA 1VG1A 1Q16A 4G86A 4O2LA 4WZAE 2ZSFA 4KE8A 4LC9A 3WMWA 4HUJA 3B85A 2VHVA 1NW4A 3ZS9A 2DQYA 4O4JF 8LDHA 1S2LA 2JCVA 2KMLA 1JG6A 1QWSA 4NULA 2C4WA 1TZJA 1N6OA 2G9UA 3CQ9A 1ZRMA 4CQLA 4RL4A 3SCZA 1QBKC 2R6R1 1ZNQO 1HH4A 1GPUA 1B8VA 5CPBA 2OBFA 4Y2HA 4MUXA 3G9TA 3K5HA 5JVDA 3RF7A 4IHJA 1FRZA 2IUTA 4EG0A 1C1XB 5FEMA 5A62A 3A9TA 5E4JA 1BHSA 1QS0B 2MSNA 2VF8A 1QYWA 3T0GA 1A9PA 3IPCA 4OYYA 1FRVA 4ZO9A 5G02A 3QYPA 3W2EA 3UJHA 3N8KA 2J41A 4FNAA 1Z7EA 5BN3A 2PGNA 4BQSA 1V6SA 4NZZA 2C8KA 2CLMB 1U2PA 3F6EX 1NMQA 4H1WA 3FTEA 2GTIA 2QZ9A 5EKTA 4AP9A 1DAFA 3EEQA 4L5IA 1TW2A 4MTLA 5MN4A 3SWWA 4TRNA 2GJAA 3HKEB 4YRJA 3BWYA 4BX0A 5JR3A 2VSXA 2J5QA 3GLGA 2EOAA 2GARA 5AJVB 5F78A 4EI8A 3V2HA 2ZTLA 3G7NA 3VZCA 1PK8A 4L1KA 2GLTA 2HTEA 4J1TC 3QLUC 2ZDHA 1L4FA 3W1WA 1A7KA 1FFDA 1TQ8A 5I9SA 3C3XA 3I0ZA 2C2MA 3TINA 1XTUA 2BMFA 2I29A 2UXBB 1K4MA 3A1CA 1N92A 4QBKA 4C7KA 1A9XB 3LHDA 4CM4B 2HRZA 5ITZB 2BH2A 3UG7A 2B8NA 1KYIA 1WVIA 4RVOA 5F5LA 4HQ6A 4UCWA 3PFFA 3D6NB 4RSGA 2HZ7A 1BMDA 4S24A 4ENPA 1RMTA 4DQDA 4LF5B 3SLRA 4XDZA 3A4IA 3II6X 4JUAA 3VO8A 1JHUA 2VHTA 4J0IA 3EE6A 3TLAA 1NIJA 2H4YA 3ORFA 5L6LB 1FNBA 2HHHB 2VL7A 1C8LA 2V9ZA 2O5VA 2OC9A 3ID6C 2NSJA 2YWGA 1L4YA 1YKFA 4U0KA 2IE8A 1Y8RA 3NDIA 4ZMBA 1BMFD 4W9RA 3MJEA 1EFLA 1QZZA 3WA7A 4QDUA 3SS9X 4C78A 3HB1A 4WA8A 3RFCA 1TZKA 1CS4C 3EXFB 3OZDA 5KWJA 1X2EA 5A03A 4DMCA 2JGEA 1SJ9A 2QUBA 3NBAA 1MC8A 4TWJA 1F1BA 1C3LA 1L8AA 1J0CA 3RI3A 1SIBE 4HXGA 2X2PA 5JWRA 1LDNA 3JQDA 4MYUA 3L8GA 2OB2A 1T0PA 1T9HA 1K89A 1UADA 3L7NA 4D45A 2JFZA 4RD2A 3B7WA 1VMEA 2ENWA 2JHPA 1VCHA 3JQ7A 3KIPA 4UDOA 4OXRA 5AP9A 5GWXA 1F12A 4LOKA 1SXJA 2GK6A 2VNSA 1GDTA 1RI4A 3JASB 4BIMA 4B3IA 5C4MA 5KNDA 4EYKA 4B3BA 1W25A 3CEMA 3OM0A 1NR1A 3RC1A 4Q6BA 4BBAA 5LQCA 2PSDA 3HDHA 5BSHA 2YWRA 5JC1A 4E21A 1RE1A 5JH7A 1SXGA 5BVGA 3CO5A 5IDWA 4FYWA 4IJMA 4CT4B 1AMUA 2Q6LA 5BOSA 2O2JA 2V7TA 1PL6A 2W2MA 2Z83A 3H2ZA 4MRMB 4QYTA 1DIBA 2G5CA 5AHOA 2DUNA 1YRLA 3DC7A 5HFJA 2IXBA 3H65A 4FGZA 2EX0A 1OROA 1CUIA 1PQWA 2B2NA 3FPKA 4H1HA 4I0WB 3R5KA 4JR0A 1D09A 3DO8A 3T9AA 1LQUA 4AMBA 2P3OA 3I52A 1NM5A 1UBHS 3Q9SA 3WK8A 5L3VA 4G9GA 3WDLA 1NUHA 3ABQB 5JBNA 3P0HA 3FZGA 2YVUA 4IY1A 3RJ9A 5BSUA 1OUMA 2XIJA 2PZ8A 2W8BA 1B7GO 3P94A 1OXSC 1TIKA 2CXHA 2REQA 1O6ZA 1UAAA 2OENG 2N46A 1YOVB 2WJPA 1U9CA 2Z1MA 2PUCA 4MUIA 3SF8A 4B4UA 2FGKA 2QU8A 1QDLB 4EKGA 3L01A 1KZYC 4O3MA 5DEIA 3HLKA 3AUJB 4MROA 2PZEA 5CAEB 4IJ6A 4GPAA 4UU0A 1CQXA 3OT5A 4MWEA 3H4IA 3IRVA 1TJ5A 4F60A 1E7MA 4F6CA 2WKSA 2GK4A 3EWSA 3KKQA 2WSSA 3CYFA 3KS9A 1C8BA 1THZA 4ZEOA 1RQ7A 3SJ7A 2RKWA 3DZFA 1Q12A 4F56A 1EPUA 3ITEA 5BYKA 4H2DA 2VF5X 3LX6A 4RORA 1K7SN 5EA2A 3UMSA 1ZC4A 3H5RA 3G2NA 4DNPA 3U3JA 2X4GA 4KO4S 3H7AA 5L45A 1J97A 3HYTA 5A6SA 2FX5A 4KG7A 5MF6A 1BS2A 1HMYA 3E9RA 2ZYGA 1EE1A 3UUEA 4PLPA 1UQRA 4YR7A 4MW1A 4EFMA 2Z1NA 1U2QA 3QE0A 4LJ4A 1AN0A 4NEGA 1L5LA 1DIGA 1Y8QA 4GI5A 4GW3A 2X9NA 4UVGA 4CLDA 4WXRA 4EX6A 3S1SA 3CINA 4ADSG 3N70A 2BT4A 1YDMA 3PPWA 5C46F 3QNMA 5H4GA 5L4SA 3R9WA 1Q19A 3ZC3A 1JFSA 1E94E 1VM6A 3U1VA 3MRVA 4YS6A 2QQGA 1LLDA 4Z7QB 3IA2A 2ZVJA 4V0LA 1ISGA 4EECA 1IUOA 2FWRA 1G20E 2MIIA 2IZ6A 1HZJA 1KBQA 3KAPA 1TZBA 3IJPA 3OETA 3IBFA 1XHFA 1SXJD 3EXIA 4DUGA 5IBRA 1Y1QA 1E77A 1M8GA 4ZZ1A 3IP8A 1CW2B 1G38A 1HQKA 2O6LA 4BVBA 1LNZA 1W94A 4GSYA 4B7XA 4LF4B 2PWYA 1XCOA 2RJNA 3L1UA 3WWYA 1MD9A 2GBGA 4RHCA 2OFFA 3HRHA 3GJZA 1ENOA 2HSWA 4I99A 4PYNA 4YACA 1HETA 5F35A 5DGDA 3UXMA 4BY9E 1QQ7A 1HEIA 2ZIVB 1XHLA 1YFZA 2QZ4A 2XQKA 2ET6A 3LE8A 5CXQA 3GN2A 5ERYA 1VSVA 5CFRA 3U6BA 1YACA 8GPBA 1UM9B 3NHWA 4FYHA 2C04A 1JAZA 3K71B 1Q15A 4S2EA 3EXG2 1JSLA 3LQKA 1FSSA 3H5WA 4LA4A 3F71A 4OYLA 3LO5A 2JIMA 1TKBA 4M7PA 4PYRA 3GRUA 2C4MA 4L9AA 1GXSB 4UBLA 4YAFA 4Q9JA 2J9GA 1KH2A 3MMZA 2AJDA 3SLKA 2XB9A 2WP8J 16PKA 4H7KA 2R25B 3KVYA 4RZUA 1DRWA 1SD2A 4LISA 1KI9A 1UJNA 4RACA 4KWHA 5F33A 3RIEA 5A5GA 4BXOA 1EZ1A 1Z0JA 2XHZA 4J29A 4QXMA 4EP1A 3R4CA 1ECJA 4KEAA 1VLHA 2W83A 4J94A 1DV2A 1XCBA 4HSGA 4Y9DA 3ZGNA 2VRBA 1GCUA 4BJ6A 3QY9A 3LT4A 3V3KA 4YROA 2NNWB 2C97A 3RYFA 5IXJA 3Q6IA 1DXQA 4ZAYA 4Q16A 2CBZA 3DDZX 2CMGA 1YE8A 1DARA 4YN3A 2JCYA 4HBZA 2QRVA 3WOVA 4DA0A 4EMUA 5I3ZA 2VCEA 3MWEA 4IDPA 1UJMA 2R4UA 2CSUA 1G21B 3FETA 3OOJA 3JWHA 4A0FA 4HOYA 1N4DA 1BNCA 1YE3A 2DOKA 2VJAA 3NB0A 3ZI4A 5DNUA 3E70C 1WW3A 1T8WA 1A98A 2B83A 3M4JA 4A6DA 6PFKA 2BELA 1SKMA 5EMMA 3AVVA 1N5OX 3GUVA 1QCYA 1WLSA 1GIAA 2P0YA 5BV8A 2P8SA 1XLTC 4QXAA 2VKQA 1E6UA 2XF2A 2XZOA 2H3EA 3U2QA 2BEVA 4IQ4A 4MWCA 3VV3A 3C3EA 4GPD1 1LJUA 1ML3A 5EXTA 2CNBA 3ZK9A 4DYVA 3KV1A 4ENQA 5KHLB 2XITA 3GF4A 3P26A 1U0JA 2AGVA 3THXA 3O93A 2QRPA 3SI7A 1U1IA 1FDUA 1M2HA 4NRDA 3FVVA 4OSPA 2DFKB 2COEA 5JBQA 4I5EA 1NF3A 2YQ4A 2AN5A 4RZIA 4UD2A 3TIGA 3WNCA 2PRSA 5JAZA 2O8VA